5B1BE

Bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 5b1bE00
2EIKE 3AG3E 5B1AE 3ABME 1OCRE 3AG1E 2EIJE 3WG7E 5IY5E 2DYSE 3AG4E 2EINE 2OCCE 1OCOE 2EIME 2EILE 2ZXWE 3X2QE 3ASNE 1OCCE 1OCZE 3ABKE 5B3SE 2DYRE 1V54E 2Y69E 1V55E 3AG2E 5B1BE 3ABLE 3ASOE
chains in the Genus database with same CATH superfamily
4APFA 3Q78A 5CECB 5EYLA 1E8XA 4ACKA 1N4RA 3MGBA 2I9CA 3R9AB 2DWZA 2V5FA 3FP3A 2P9IG 1OWNA 1YCSB 5G04J 4HVBA 4W9RA 1SVXA 3N71A 2KZTB 2WXKA 4UQXA 1N0QA 3CHPA 1JCRA 2DYSE 5ARGA 5D66A 1FCHA 2KC7A 1O1TA 3E4BA 4C9BB 4U63A 1Y8MA 3ZUVB 2GRPB 5EN5D 3LEWA 1K8KG 5FQ7A 3OAWA 3QARA 3BG0B 3FUKA 1TN7A 3QK0A 3PREA 3FUEA 2NXPA 1OWMA 3FTWA 4ACLA 2EIME 3UT4A 2PM7A 4HQDA 4BEPA 4GU5A 2X6JA 3SBSA 3LPZA 3HHMA 4MS6A 2ZU6B 4BSZB 2V8SE 3DSWA 3TWVA 3G2WA 4HOUA 4N3BA 3E37A 4ME2A 3Q9NC 2AVPA 3DEOA 5HKPA 3ZKJA 1TNZA 4AP2A 2HM8A 2J49A 2OEWA 3OXLA 3KAEA 4I6EA 4XE0A 3V31A 5KBAA 4CEMA 3HXFA 3S2AA 1BU9A 4HLLA 5EIDA 3FTVA 4N3CA 3FEXA 4OAVB 3SHFA 4C0MA 2B0OE 4WNFA 2WQHA 4G23A 4HI8A 1ELKA 4GTOA 1IQRA 2ILRA 4J6IA 2X6IA 4ILIA 4IULA 3CVWA 4GTTA 2XEVA 2VSNA 3CHMA 3FH8A 2WXGA 3IKOB 1TNOA 4XKBA 3B7SA 1E90A 4ATGA 3MV3B 2H6FA 3CHQA 4WWNA 1HZ4A 4N2SA 2UWJG 3EU5A 5EYPF 4EBAG 4XZ4A 2GGFA 4A3TA 1U3CA 4GZCA 1MX6A 2YQ8A 5CEAA 2WB2A 4APOA 5ITZF 4GYOA 3AS8A 4FLHA 2IONA 3KSQA 2ZXWE 3SF4A 1X5BA 5AENA 4EZLA 2IEJA 3V2XA 1S63A 3IHVA 4HNAD 3ZVVA 1N95A 2LAHA 3L82A 3QOUA 2CHZA 3UT7A 2J4DA 1UN8A 4FC8A 3F6QA 1D8DA 3ZYKA 5ENQD 2WVIA 5B1BE 5BPPA 4J8SA 2P9UG 4OVUA 4WWOA 4K5CA 2RG8A 4AXHA 4L2LA 3RO3A 2XENA 1E7VA 5AQBA 2PZIA 3JXJA 4AJWA 4GYYA 2VGYA 4N5QA 3SBTB 3RRNB 2B6CA 3QJZA 1MX4A 4HOQA 3D9NA 1EYHA 3FUHA 4F6RD 2KM4A 4KMOA 1MX2A 3LY9A 2FO1E 4B93B 1VDYA 2A5UA 4I9EA 2WQ6A 5ENRD 4U8HA 4HRNA 4HOTA 5BV1A 1OWLA 4EHMA 3TWXA 4IRUA 5AJLA 3JYSA 3FUFA 5FZRA 4TRQA 1FVHA 2CFZA 2ZIRA 3ASFA 1GW6A 5FQ4A 1XNFA 1SA4A 1V55E 4DI4A 2F37A 3MCXA 4PS8A 5JHBA 3KSLA 3AG3E 1AWCB 3L9TA 4CZ2D 2LSUA 2QZAA 2I1KA 4RVBA 4FHKA 3U9WA 4EECA 4HRLA 4YDWA 3Q75A 3VLDA 2FO7A 3HG0D 4GYWA 2ETCA 4J8EA 4UWHA 1KT0A 3ASGA 1NL4A 3Q5MA 2DIWA 3UIPC 4ANWA 2OV8A 1QNFA 2IO2C 1OY3D 3E34A 4OAUC 5CCLA 2GRQB 1IXVA 1HU3A 3PE4A 1MZCA 3ZYMA 2X38A 1NFIE 4UWLA 4FADA 4WWPA 3FFLA 2DBAA 4MRUA 3CLJA 4G11A 1QZ2A 4FA6A 5AYWD 2IJGX 4U7EB 4UWKA 4Y6CA 1BI7B 1O1RA 3EHRA 4HI9A 3ML8A 2F0YA 3FUJA 5FTPA 4H7YA 4XKCA 5D0QD 4F53A 1WDYA 3TWTA 3AG4E 1ELRA 1QQEA 4HXIA 1E7UA 3ZNGA 4K5BA 4N39A 1P5QA 4MBGA 5CEDB 2MHKA 4G25A 3BQOA 1O5MA 3R9MA 3QB2A 1N52A 2OVBA 2XZDG 2XHEA 2XCBA 1E96B 4GTPA 3T8MA 1G3NB 1JPLA 2VGEA 2WXPA 4G26A 2J09A 1SA5A 1NA0A 2GRRB 2BEDA 2BKKB 3HRAA 3HYMB 3ZIMA 3IXEA 4IN3B 4O1OA 2CFUA 5BXUA 3ULYA 3AS5A 2GROB 2IO3C 3LXUX 5ARFA 3K9IA 1HF8A 4LUNU 2HE0A 3NQPA 3QWVA 2EINE 3CIAA 4XEIG 4FP7A 2F8XK 3UXGA 5FINA 1HO8A 5LP0A 4A3VA 3UM1A 2FULA 3CR3A 3QWPA 4I9CA 3PDNA 3TG5A 4A1GA 1H6KA 2WMNA 3U3WA 1NI1A 2Y1LE 4LNGA 5DBKA 1OT8A 2WXIA 1E8WA 3D9IA 3GZ1A 5HQ8A 3Q7FA 3D9LA 4G24A 1SW6A 2IU1A 3FTXA 4JEHA 1QYMA 3BG1B 4NIKA 2IQCA 4X8QA 3UM2A 3DPYA 3GZSA 3LCAA 1E8YA 3S7JA 3UI2A 3VTXA 3X2QE 4K03A 3O4ZA 1OXJA 3Q79A 3LVRE 1EPUA 3EHMA 3TWRA 1SQMA 5EKQD 2J9QA 2L6BA 4G2VA 4GMJA 1HH8A 3J5QB 3ABLE 2ZISA 3CVNA 1LTXA 2PM6A 1HXIA 2P9SG 3URZA 4K5AB 1ZBPA 1FPPA 1FT1A 1MYOA 1WAO1 3PRZA 2J4BA 3EIQC 4GB9A 5EX3A 1KPSB 2VYIA 2IOSA 3ULQA 4O6FA 2XS1A 4GZDA 3RRMB 3D9OA 4U07A 3FULA 3PUJA 1D8EA 5T4YA 2Y3AA 3FWVA 4Q69A 5ENOD 4B8CB 4JA7A 5JJTA 1SZAA 4UWFA 4J0UA 2DYRE 4F1PA 4BX8A 3DRAA 3FDHA 4PUCA 3DPDA 4M7CA 4XI0A 2ONDA 3DXMG 4M3OA 2H6IA 2WM9A 3CSFA 2MOWA 5T3RA 3NBNB 5DIZA 1N4SA 3TG4A 2FF4A 1OUVA 3FHEA 3L54A 4J8YA 3LYAA 4L23A 3I5PA 1H6PA 4EZJA 5E76A 4KBQA 5FQ8A 1A17A 3FUDA 1SZ9A 3ZW3A 3ZHEA 4B89A 3OXFA 3VLEA 2XGOA 2X6HA 5LFAA 3Q47B 5H7PA 4DRXE 2DVWA 2CHWA 2L6JA 4JXTA 5CERB 3FTZA 4I1MA 4PS7A 3ASOE 2DCPA 5AJDA 3TXNA 4AVXA 2EIKE 3NZUA 4G1TA 3G2SA 3AJIA 3AG1E 5HI7A 4F7AA 3I3NA 4LG6A 4HBDA 4C48B 4DJAA 3JQ0A 3DSSA 2VTBB 3RIBA 3KEZA 4J7WA 4EQFA 2P9NG 4MKTA 4O60A 2VTBA 1TN8A 4IYPA 1L5JA 3I4GA 4L2YA 2NYJA 3CVUA 5JJ6A 2ZGDA 4JHKA 1MJ0A 3QC1A 1RW2A 4QQIA 4HORA 2Y69E 3QNKA 2IY0C 3SFZA 4OYSA 1HS6A 2J08A 4KVOA 5J08A 1JCSA 5ENNA 2HO1A 3TL5A 3PZ1A 5CCMA 1NA3A 3MKRA 1Z6TA 3MZLB 2XEEA 4TXRA 3G2VA 1INZA 4DX6D 4DX1A 2CG2A 5KNHD 3SFXA 3VTYA 4NQ0A 4A55A 1K1AA 1H2TC 3L17A 4BX9A 2XGMA 2C0LA 1JUQA 4AIFA 3DWLG 3ONKA 3FU5A 2AXZA 1EDUA 3HDXA 2PQNA 1B89A 4JW1A 3MV2B 2XRZA 3TAXA 1JWFA 3HXEA 3WG7E 1TJFA 2OCCE 1Z3YA 5EDSA 2X6FA 2Y0BG 3AS4A 3KS2A 2L9BA 4CRWA 1HG2A 3SI5A 2WXNA 1KLXA 4KZ0A 4CDMA 3EIJA 3UM0A 1YA0A 4GPKA 3ZYLA 3UIOC 4JVSA 4B94A 1H19A 1BPOA 4RLYA 1DCQA 5CRUA 3S7BA 3L16A 1IYGA 2NC9A 1UN9A 3U66A 3W9GA 3CVLA 4AOFA 3KEAA 5AQ7A 3CVYA 1K1BA 2L0IA 2PQRA 3U64A 4Q94A 4PS3A 1JCQA 4JL0A 3OXGA 3RO2A 2YHCA 3J5PA 3TWSA 4R7LA 1K3ZD 4DX7D 1XGWA 5KWDA 1DCEA 3TWUA 5CHEE 2P58C 5CRVA 1UJJA 2VSXE 5AAOA 3RK6A 4CT4A 2ETAA 5ENPD 3CVVA 1OWOA 4FHJA 3B13A 3FH7A 4GTSA 4JZYA 2LUHA 5BXOA 2AW6A 2CG3A 4HRMB 1H0AA 1U3DA 3C98A 3EDTB 5A23A 4CDNA 3D9MA 1TN6A 4UI9C 3V79K 3APDA 4JHJA 4AM9A 2HYZA 4AV7A 4HS2A 4GZ6A 4BSXA 2KCKA 3DSUA 4YNDA 1DC2A 1MQSA 4LEUA 3Q15A 1TNYA 1ZB1A 5FZQA 3MYVA 1DVPA 2OVFA 3ZXPA 3T8KA 2EILE 5CBOA 3IEGA 5E75A 1OCCE 5FQ6A 4GTQA 2QYJA 4WNGA 2LXLA 3Q9UC 4FU3A 4F1SA 2XPZA 3FTUA 4ATZD 1ZU2A 2XCCA 2Y4UA 1KZOA 4QFVA 2A4ZA 3GW4A 3DSXA 3SGHA 1OCRE 1KZPA 3CVXA 4JC8A 3UPVA 3UINC 3MJWA 3C3QA 3I4RB 2RD0A 3FEYA 3EHNA 2Y4TA 4WAFA 3E32A 1JWGA 2ZGGA 4NRHB 5BW8C 3CKCA 2P9PG 4BFRA 3HIZA 4CGVA 2X6KA 3CQGB 1WG0A 5BT1A 5BNWA 3ZFWA 4BERA 3PZ3A 3IHYA 3S7DA 4I1AA 3UKUG 2I2OA 3PEVB 2QYUA 5D2MC 3FTSA 2VSYA 2VQ2A 3SFYA 3TXMA 3PNTB 3R7QA 4KZCA 2WXFA 5EIBE 3NZSA 4E6HA 2NSZA 2E0IA 3CK9A 3MA5A 4G8LA 4GTVA 1PC2A 3AU5A 1PAQA 4A63B 4U8YD 2GRMA 3JUIA 3PNLB 3UT8A 1UW4B 2RFAA 3MEKA 4CCAA 3HVEA 4N3AA 4JB8P 4DI3A 3RKVA 4I2WA 4A1SA 3SZ7A 4ANVA 3C72A 3PUKA 1TNBA 4DPRA 3UMVA 1LD8A 3PZDA 3BU8A 3UUXA 4I43A 4N5CA 3DSTA 2R02A 3DEPA 4GMLA 4LNBA 3HXDA 1WY6A 4TXPA 5KJKA 4DX5D 2F8YA 4P29A 1AP7A 1N4QA 4ANUA 4ILGA 3PH0C 2AJAA 2R59A 3B7UX 3FU6A 3ESKA 4WUYA 4XI9A 2VJ8A 4AY5A 3PVLA 2WXLA 5IY5E 1HG5A 2V4LA 4B8AA 2IFUA 4LSZE 5LX8A 4GA1A 4TUUA 4YDYA 3ZU7B 3PS6A 3FUMA 4GPMA 4GZ3A 3Q4AB 1N11A 3NOGD 4PDXA 3O48A 5A6CA 1Z5SC 1QBQA 1W3BA 2JABA 3AG2E 4Q96A 3Q49B 1YYHA 4JPSA 4Y6WA 2KZTA 3D9HA 3ZEFA 1N9AA 4CYMD 2R2LA 4E85A 1HX8A 1BI8B 3CEQA 4OVVA 3MX3A 2R03A 3CKBA 2YINA 3CVQA 4DK5A 3LY7A 2GRNB 4FJZA 3D9PA 4DX2A 3IBEA 4JEUA 3HVEB 4RSYA 2QC9A 3UQ3A 1A5EA 5CMWA 3UTMA 2FBNA 5FT9A 2XPIA 3FU0A 3RU0A 3T5XA 1FT2A 2YNQA 4BY6A 3Q7AA 2LXMA 4CGWA 2VGXB 4HFGA 3RSEG 3LY8A 2XPYA 1X81A 4BTBA 2IF4A 3CQCB 2UY1B 3UKRG 1TEZA 2L0TB 1OWPA 2XS8A 3LDZA 4BTAA 4BETA 3SQVA 4NURA 2WXJA 3D9JA 2LAIA 5AN8A 4J8DA 3EU9A 3P2BA 3DBSA 1S70B 3NOCD 3SD5A 1Y6IA 3ABKE 5HS0A 3NF1A 4PH4B 1HFAA 3SNXA 2Q7FA 4GCOA 4KXKB 3CHSA 3EHQA 3Q73A 2J07A 4TUMA 4GZ5A 2C2LA 3W9FA 1LD7A 3D9KA 2RFMA 3MKQA 3V30A 2BKGA 5CMYA 2AXVA 3UM3A 5J90A 4B0ZA 3PZ4A 3HXBA 1FVFA 4NACA 1S64A 4L9PA 3WXXA 4HB5A 1IHGA 5KJMA 3B7RL 5G04C 5CBNA 3FTYA 5BV0A 4L1BA 2OEVA 2X3MA 2WXQA 3RJVA 4L7TA 1TYQG 1IHBA 4RG9A 2VSOE 3L13A 3PE3A 4U8VD 4UUCA 4I17A 2LSVA 4GCNA 4F3VA 3ZRHA 5JA4D 3ZN3A 2LNIA 3JXIA 5KJLA 2WPVA 3ULEG 2RKKA 5KJNA 3FUIA 3ASDA 1MHQA 5LOZA 4J8FA 4URKA 2AXUA 4XX5A 2JLBA 4XIFA 3OTNA 3QKYA 4KT6B 3T9KA 3ENEA 1H2UA 4UQZA 4TXQA 2LO6A 5ANRA 4U95D 3RAUA 1H6OA 4FLBA 4U0SA 2WXHA 1S0PA 1Q2ZA 1OCOE 4LERA 3E33A 4K0RA 4EPZA 2H6HA 4LRZA 3ASNE 2I6HA 3FY4A 3B7TA 1TNUA 4GAAA 3V2OA 3LKUA 2DZOA 4ZFHA 4EBAA 3EUVA 2E2EA 2QFCA 4GMRA 2MRIA 5M72A 3ABME 2KCVA 1KT1A 2EQXA 5ENSD 1UG3A 2HR2A 4DLOA 2P2CP 4KYOB 4H7XA 5G2NA 5BUZA 4I6JA 3CHRA 5G05J 5JMND 5AQ9A 3TGOA 1RZ4A 1UJKA 1E8ZA 3FU3A 5ENTD 4UQYA 3JQ1A 4V3IA 3R7RA 2XRYA 2R17C 2OOEA 2GRLA 4ZHBA 1BLXB 3ZPJA 4I1OB 3T5VA 4ANXA 3APCA 1TR4A 2AWIA 4HLEA 4O1PA 4EZKA 3CVPA 5C2YA 2JEKA 3C5RA 3P1UA 1IQUA 3RRUA 2H6GA 2WXMA 3C3RA 3ML9A 4UI9J 3AAAC 1IKND 2WXOA 3B7BA 1V54E 2M63A 5A7DB 1ELWA 3C3OA 4U0ZA 4JHRA 1YMPA 3B95A 1WM5A 4FULA 4ILHB 5JJ7A 2WXRA 2P9KG 4KVMA 4WNDA 4HOSA 4YVOA 1N4PA 3CGHA 4GA0A 3PEUB 4BWRA 3NAWA 5FZSA 2PL2A 4JD2G 4RQIA 2V0PA 1N54A 3ISMC 4DLQA 2XQ0A 1U2VG 4TV3A 5B3SE 5AQAA 4U04A 2FEZA 3HXCA 3L08A 3G2TA 3ZXSA 4ABNA 3VLFA 2V5QC 4AY6A 2PNNA 3ONLA 4JA9A 2A5EA 5G05C 3KD7A 4YVQC 3GYZA 3CK7A 1OCZE 3LJ3A 2KCLA 3UX4A 4RG6A 3NB2A 3MKQB 3CSTA 4BT9A 1PY1A 2GW1A 2EIJE 4U96D 1DNPA 2FI7A 5T8IA 3ESLA 3PZ2A 3BUAA 2R5SA 5C1DA 1NP7A 2QY7A 2KBXA 3DXKG 2V4HC 3TWQA 3ZHEB 2DZNA 1TJCA 2KXPC 2I1JA 3G2UA 5EILA 2P9LG 3QWWA 1UOHA 2ETBA 5KNGA 1H2VC 5KCMA 3JUEA 1LF8A 2R05A 5HRYA 4YDOA 3JCKC 2UY1A 3EJNA 1N0RA 3GZ2A 4I2ZA 4BT8A 2BTDA 4C0EA 5B1AE 2YHEA 2XEHA 4CT0A 3LJNA 3ZGQA 1NZNA 2XGSA 4CDRA 2WMOA 4MLPA 2VGXA 3LS8A 3S7FA 1BD8A 5D0OD 3TJPA 4DUIA 3LVQE 3AU4A 1EF1C 5EX0A 2KATA 4D10C 3IV0A 3QDNA 4WNEA 3QAQA 1Z3XA 2MYOA 2XZTG 2BUGA 4GTMA 3APFA 2J8SD 2CHXA 3L22A 4UWGA 5ANLA 5FIOA 5AIJA 5AARA 3ASHA 4N2QA 1N94A 4I6GA 3SY2A 4LCTA 3U4TA 3DSVA 3CHOA 5FWQA 3CK8A 5LCWJ 4YDEA 4UI9K 3D3MA 5JHAA 5LCWC 4G8KA 3BEEA 2IOLA 3FH5A 4FJYA 1D9SA 1O1SA 3CV0A 4GTRA 4Z68A 3ZYQA 2BF0X 3E30A 4GA2A 3FUNA 4AEZC 2WQ7A 4LNUD 4U0UA 5G55A 5FJYA 3SO8A 4BESA 1HE8A 2C0MA 3L6AA 3TWWA
chains in the Genus database with same CATH topology
2EIKE 3AG3E 5B1AE 3ABME 1OCRE 3AG1E 2EIJE 3WG7E 5IY5E 2DYSE 3AG4E 2EINE 2OCCE 1OCOE 2EIME 2EILE 2ZXWE 3X2QE 3ASNE 1OCCE 1OCZE 3ABKE 5B3SE 2DYRE 1V54E 2Y69E 1V55E 3AG2E 5B1BE 3ABLE 3ASOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIK E;  3AG3 E;  5B1A E;  3ABM E;  1OCR E;  3AG1 E;  2EIJ E;  3WG7 E;  5IY5 E;  2DYS E;  3AG4 E;  2EIN E;  2OCC E;  1OCO E;  2EIM E;  2EIL E;  2ZXW E;  3X2Q E;  3ASN E;  1OCC E;  1OCZ E;  3ABK E;  5B3S E;  2DYR E;  1V54 E;  2Y69 E;  1V55 E;  3AG2 E;  5B1B E;  3ABL E;  3ASO E; 
#chains in the Genus database with same CATH topology
 4APF A;  3Q78 A;  5CEC B;  5EYL A;  1E8X A;  4ACK A;  1N4R A;  3MGB A;  2I9C A;  3R9A B;  2DWZ A;  2V5F A;  3FP3 A;  2P9I G;  1OWN A;  1YCS B;  5G04 J;  4HVB A;  4W9R A;  1SVX A;  3N71 A;  2KZT B;  2WXK A;  4UQX A;  1N0Q A;  3CHP A;  1JCR A;  2DYS E;  5ARG A;  5D66 A;  1FCH A;  2KC7 A;  1O1T A;  3E4B A;  4C9B B;  4U63 A;  1Y8M A;  3ZUV B;  2GRP B;  5EN5 D;  3LEW A;  1K8K G;  5FQ7 A;  3OAW A;  3QAR A;  3BG0 B;  3FUK A;  1TN7 A;  3QK0 A;  3PRE A;  3FUE A;  2NXP A;  1OWM A;  3FTW A;  4ACL A;  2EIM E;  3UT4 A;  2PM7 A;  4HQD A;  4BEP A;  4GU5 A;  2X6J A;  3SBS A;  3LPZ A;  3HHM A;  4MS6 A;  2ZU6 B;  4BSZ B;  2V8S E;  3DSW A;  3TWV A;  3G2W A;  4HOU A;  4N3B A;  3E37 A;  4ME2 A;  3Q9N C;  2AVP A;  3DEO A;  5HKP A;  3ZKJ A;  1TNZ A;  4AP2 A;  2HM8 A;  2J49 A;  2OEW A;  3OXL A;  3KAE A;  4I6E A;  4XE0 A;  3V31 A;  5KBA A;  4CEM A;  3HXF A;  3S2A A;  1BU9 A;  4HLL A;  5EID A;  3FTV A;  4N3C A;  3FEX A;  4OAV B;  3SHF A;  4C0M A;  2B0O E;  4WNF A;  2WQH A;  4G23 A;  4HI8 A;  1ELK A;  4GTO A;  1IQR A;  2ILR A;  4J6I A;  2X6I A;  4ILI A;  4IUL A;  3CVW A;  4GTT A;  2XEV A;  2VSN A;  3CHM A;  3FH8 A;  2WXG A;  3IKO B;  1TNO A;  4XKB A;  3B7S A;  1E90 A;  4ATG A;  3MV3 B;  2H6F A;  3CHQ A;  4WWN A;  1HZ4 A;  4N2S A;  2UWJ G;  3EU5 A;  5EYP F;  4EBA G;  4XZ4 A;  2GGF A;  4A3T A;  1U3C A;  4GZC A;  1MX6 A;  2YQ8 A;  5CEA A;  2WB2 A;  4APO A;  5ITZ F;  4GYO A;  3AS8 A;  4FLH A;  2ION A;  3KSQ A;  2ZXW E;  3SF4 A;  1X5B A;  5AEN A;  4EZL A;  2IEJ A;  3V2X A;  1S63 A;  3IHV A;  4HNA D;  3ZVV A;  1N95 A;  2LAH A;  3L82 A;  3QOU A;  2CHZ A;  3UT7 A;  2J4D A;  1UN8 A;  4FC8 A;  3F6Q A;  1D8D A;  3ZYK A;  5ENQ D;  2WVI A;  5B1B E;  5BPP A;  4J8S A;  2P9U G;  4OVU A;  4WWO A;  4K5C A;  2RG8 A;  4AXH A;  4L2L A;  3RO3 A;  2XEN A;  1E7V A;  5AQB A;  2PZI A;  3JXJ A;  4AJW A;  4GYY A;  2VGY A;  4N5Q A;  3SBT B;  3RRN B;  2B6C A;  3QJZ A;  1MX4 A;  4HOQ A;  3D9N A;  1EYH A;  3FUH A;  4F6R D;  2KM4 A;  4KMO A;  1MX2 A;  3LY9 A;  2FO1 E;  4B93 B;  1VDY A;  2A5U A;  4I9E A;  2WQ6 A;  5ENR D;  4U8H A;  4HRN A;  4HOT A;  5BV1 A;  1OWL A;  4EHM A;  3TWX A;  4IRU A;  5AJL A;  3JYS A;  3FUF A;  5FZR A;  4TRQ A;  1FVH A;  2CFZ A;  2ZIR A;  3ASF A;  1GW6 A;  5FQ4 A;  1XNF A;  1SA4 A;  1V55 E;  4DI4 A;  2F37 A;  3MCX A;  4PS8 A;  5JHB A;  3KSL A;  3AG3 E;  1AWC B;  3L9T A;  4CZ2 D;  2LSU A;  2QZA A;  2I1K A;  4RVB A;  4FHK A;  3U9W A;  4EEC A;  4HRL A;  4YDW A;  3Q75 A;  3VLD A;  2FO7 A;  3HG0 D;  4GYW A;  2ETC A;  4J8E A;  4UWH A;  1KT0 A;  3ASG A;  1NL4 A;  3Q5M A;  2DIW A;  3UIP C;  4ANW A;  2OV8 A;  1QNF A;  2IO2 C;  1OY3 D;  3E34 A;  4OAU C;  5CCL A;  2GRQ B;  1IXV A;  1HU3 A;  3PE4 A;  1MZC A;  3ZYM A;  2X38 A;  1NFI E;  4UWL A;  4FAD A;  4WWP A;  3FFL A;  2DBA A;  4MRU A;  3CLJ A;  4G11 A;  1QZ2 A;  4FA6 A;  5AYW D;  2IJG X;  4U7E B;  4UWK A;  4Y6C A;  1BI7 B;  1O1R A;  3EHR A;  4HI9 A;  3ML8 A;  2F0Y A;  3FUJ A;  5FTP A;  4H7Y A;  4XKC A;  5D0Q D;  4F53 A;  1WDY A;  3TWT A;  3AG4 E;  1ELR A;  1QQE A;  4HXI A;  1E7U A;  3ZNG A;  4K5B A;  4N39 A;  1P5Q A;  4MBG A;  5CED B;  2MHK A;  4G25 A;  3BQO A;  1O5M A;  3R9M A;  3QB2 A;  1N52 A;  2OVB A;  2XZD G;  2XHE A;  2XCB A;  1E96 B;  4GTP A;  3T8M A;  1G3N B;  1JPL A;  2VGE A;  2WXP A;  4G26 A;  2J09 A;  1SA5 A;  1NA0 A;  2GRR B;  2BED A;  2BKK B;  3HRA A;  3HYM B;  3ZIM A;  3IXE A;  4IN3 B;  4O1O A;  2CFU A;  5BXU A;  3ULY A;  3AS5 A;  2GRO B;  2IO3 C;  3LXU X;  5ARF A;  3K9I A;  1HF8 A;  4LUN U;  2HE0 A;  3NQP A;  3QWV A;  2EIN E;  3CIA A;  4XEI G;  4FP7 A;  2F8X K;  3UXG A;  5FIN A;  1HO8 A;  5LP0 A;  4A3V A;  3UM1 A;  2FUL A;  3CR3 A;  3QWP A;  4I9C A;  3PDN A;  3TG5 A;  4A1G A;  1H6K A;  2WMN A;  3U3W A;  1NI1 A;  2Y1L E;  4LNG A;  5DBK A;  1OT8 A;  2WXI A;  1E8W A;  3D9I A;  3GZ1 A;  5HQ8 A;  3Q7F A;  3D9L A;  4G24 A;  1SW6 A;  2IU1 A;  3FTX A;  4JEH A;  1QYM A;  3BG1 B;  4NIK A;  2IQC A;  4X8Q A;  3UM2 A;  3DPY A;  3GZS A;  3LCA A;  1E8Y A;  3S7J A;  3UI2 A;  3VTX A;  3X2Q E;  4K03 A;  3O4Z A;  1OXJ A;  3Q79 A;  3LVR E;  1EPU A;  3EHM A;  3TWR A;  1SQM A;  5EKQ D;  2J9Q A;  2L6B A;  4G2V A;  4GMJ A;  1HH8 A;  3J5Q B;  3ABL E;  2ZIS A;  3CVN A;  1LTX A;  2PM6 A;  1HXI A;  2P9S G;  3URZ A;  4K5A B;  1ZBP A;  1FPP A;  1FT1 A;  1MYO A;  1WAO 1;  3PRZ A;  2J4B A;  3EIQ C;  4GB9 A;  5EX3 A;  1KPS B;  2VYI A;  2IOS A;  3ULQ A;  4O6F A;  2XS1 A;  4GZD A;  3RRM B;  3D9O A;  4U07 A;  3FUL A;  3PUJ A;  1D8E A;  5T4Y A;  2Y3A A;  3FWV A;  4Q69 A;  5ENO D;  4B8C B;  4JA7 A;  5JJT A;  1SZA A;  4UWF A;  4J0U A;  2DYR E;  4F1P A;  4BX8 A;  3DRA A;  3FDH A;  4PUC A;  3DPD A;  4M7C A;  4XI0 A;  2OND A;  3DXM G;  4M3O A;  2H6I A;  2WM9 A;  3CSF A;  2MOW A;  5T3R A;  3NBN B;  5DIZ A;  1N4S A;  3TG4 A;  2FF4 A;  1OUV A;  3FHE A;  3L54 A;  4J8Y A;  3LYA A;  4L23 A;  3I5P A;  1H6P A;  4EZJ A;  5E76 A;  4KBQ A;  5FQ8 A;  1A17 A;  3FUD A;  1SZ9 A;  3ZW3 A;  3ZHE A;  4B89 A;  3OXF A;  3VLE A;  2XGO A;  2X6H A;  5LFA A;  3Q47 B;  5H7P A;  4DRX E;  2DVW A;  2CHW A;  2L6J A;  4JXT A;  5CER B;  3FTZ A;  4I1M A;  4PS7 A;  3ASO E;  2DCP A;  5AJD A;  3TXN A;  4AVX A;  2EIK E;  3NZU A;  4G1T A;  3G2S A;  3AJI A;  3AG1 E;  5HI7 A;  4F7A A;  3I3N A;  4LG6 A;  4HBD A;  4C48 B;  4DJA A;  3JQ0 A;  3DSS A;  2VTB B;  3RIB A;  3KEZ A;  4J7W A;  4EQF A;  2P9N G;  4MKT A;  4O60 A;  2VTB A;  1TN8 A;  4IYP A;  1L5J A;  3I4G A;  4L2Y A;  2NYJ A;  3CVU A;  5JJ6 A;  2ZGD A;  4JHK A;  1MJ0 A;  3QC1 A;  1RW2 A;  4QQI A;  4HOR A;  2Y69 E;  3QNK A;  2IY0 C;  3SFZ A;  4OYS A;  1HS6 A;  2J08 A;  4KVO A;  5J08 A;  1JCS A;  5ENN A;  2HO1 A;  3TL5 A;  3PZ1 A;  5CCM A;  1NA3 A;  3MKR A;  1Z6T A;  3MZL B;  2XEE A;  4TXR A;  3G2V A;  1INZ A;  4DX6 D;  4DX1 A;  2CG2 A;  5KNH D;  3SFX A;  3VTY A;  4NQ0 A;  4A55 A;  1K1A A;  1H2T C;  3L17 A;  4BX9 A;  2XGM A;  2C0L A;  1JUQ A;  4AIF A;  3DWL G;  3ONK A;  3FU5 A;  2AXZ A;  1EDU A;  3HDX A;  2PQN A;  1B89 A;  4JW1 A;  3MV2 B;  2XRZ A;  3TAX A;  1JWF A;  3HXE A;  3WG7 E;  1TJF A;  2OCC E;  1Z3Y A;  5EDS A;  2X6F A;  2Y0B G;  3AS4 A;  3KS2 A;  2L9B A;  4CRW A;  1HG2 A;  3SI5 A;  2WXN A;  1KLX A;  4KZ0 A;  4CDM A;  3EIJ A;  3UM0 A;  1YA0 A;  4GPK A;  3ZYL A;  3UIO C;  4JVS A;  4B94 A;  1H19 A;  1BPO A;  4RLY A;  1DCQ A;  5CRU A;  3S7B A;  3L16 A;  1IYG A;  2NC9 A;  1UN9 A;  3U66 A;  3W9G A;  3CVL A;  4AOF A;  3KEA A;  5AQ7 A;  3CVY A;  1K1B A;  2L0I A;  2PQR A;  3U64 A;  4Q94 A;  4PS3 A;  1JCQ A;  4JL0 A;  3OXG A;  3RO2 A;  2YHC A;  3J5P A;  3TWS A;  4R7L A;  1K3Z D;  4DX7 D;  1XGW A;  5KWD A;  1DCE A;  3TWU A;  5CHE E;  2P58 C;  5CRV A;  1UJJ A;  2VSX E;  5AAO A;  3RK6 A;  4CT4 A;  2ETA A;  5ENP D;  3CVV A;  1OWO A;  4FHJ A;  3B13 A;  3FH7 A;  4GTS A;  4JZY A;  2LUH A;  5BXO A;  2AW6 A;  2CG3 A;  4HRM B;  1H0A A;  1U3D A;  3C98 A;  3EDT B;  5A23 A;  4CDN A;  3D9M A;  1TN6 A;  4UI9 C;  3V79 K;  3APD A;  4JHJ A;  4AM9 A;  2HYZ A;  4AV7 A;  4HS2 A;  4GZ6 A;  4BSX A;  2KCK A;  3DSU A;  4YND A;  1DC2 A;  1MQS A;  4LEU A;  3Q15 A;  1TNY A;  1ZB1 A;  5FZQ A;  3MYV A;  1DVP A;  2OVF A;  3ZXP A;  3T8K A;  2EIL E;  5CBO A;  3IEG A;  5E75 A;  1OCC E;  5FQ6 A;  4GTQ A;  2QYJ A;  4WNG A;  2LXL A;  3Q9U C;  4FU3 A;  4F1S A;  2XPZ A;  3FTU A;  4ATZ D;  1ZU2 A;  2XCC A;  2Y4U A;  1KZO A;  4QFV A;  2A4Z A;  3GW4 A;  3DSX A;  3SGH A;  1OCR E;  1KZP A;  3CVX A;  4JC8 A;  3UPV A;  3UIN C;  3MJW A;  3C3Q A;  3I4R B;  2RD0 A;  3FEY A;  3EHN A;  2Y4T A;  4WAF A;  3E32 A;  1JWG A;  2ZGG A;  4NRH B;  5BW8 C;  3CKC A;  2P9P G;  4BFR A;  3HIZ A;  4CGV A;  2X6K A;  3CQG B;  1WG0 A;  5BT1 A;  5BNW A;  3ZFW A;  4BER A;  3PZ3 A;  3IHY A;  3S7D A;  4I1A A;  3UKU G;  2I2O A;  3PEV B;  2QYU A;  5D2M C;  3FTS A;  2VSY A;  2VQ2 A;  3SFY A;  3TXM A;  3PNT B;  3R7Q A;  4KZC A;  2WXF A;  5EIB E;  3NZS A;  4E6H A;  2NSZ A;  2E0I A;  3CK9 A;  3MA5 A;  4G8L A;  4GTV A;  1PC2 A;  3AU5 A;  1PAQ A;  4A63 B;  4U8Y D;  2GRM A;  3JUI A;  3PNL B;  3UT8 A;  1UW4 B;  2RFA A;  3MEK A;  4CCA A;  3HVE A;  4N3A A;  4JB8 P;  4DI3 A;  3RKV A;  4I2W A;  4A1S A;  3SZ7 A;  4ANV A;  3C72 A;  3PUK A;  1TNB A;  4DPR A;  3UMV A;  1LD8 A;  3PZD A;  3BU8 A;  3UUX A;  4I43 A;  4N5C A;  3DST A;  2R02 A;  3DEP A;  4GML A;  4LNB A;  3HXD A;  1WY6 A;  4TXP A;  5KJK A;  4DX5 D;  2F8Y A;  4P29 A;  1AP7 A;  1N4Q A;  4ANU A;  4ILG A;  3PH0 C;  2AJA A;  2R59 A;  3B7U X;  3FU6 A;  3ESK A;  4WUY A;  4XI9 A;  2VJ8 A;  4AY5 A;  3PVL A;  2WXL A;  5IY5 E;  1HG5 A;  2V4L A;  4B8A A;  2IFU A;  4LSZ E;  5LX8 A;  4GA1 A;  4TUU A;  4YDY A;  3ZU7 B;  3PS6 A;  3FUM A;  4GPM A;  4GZ3 A;  3Q4A B;  1N11 A;  3NOG D;  4PDX A;  3O48 A;  5A6C A;  1Z5S C;  1QBQ A;  1W3B A;  2JAB A;  3AG2 E;  4Q96 A;  3Q49 B;  1YYH A;  4JPS A;  4Y6W A;  2KZT A;  3D9H A;  3ZEF A;  1N9A A;  4CYM D;  2R2L A;  4E85 A;  1HX8 A;  1BI8 B;  3CEQ A;  4OVV A;  3MX3 A;  2R03 A;  3CKB A;  2YIN A;  3CVQ A;  4DK5 A;  3LY7 A;  2GRN B;  4FJZ A;  3D9P A;  4DX2 A;  3IBE A;  4JEU A;  3HVE B;  4RSY A;  2QC9 A;  3UQ3 A;  1A5E A;  5CMW A;  3UTM A;  2FBN A;  5FT9 A;  2XPI A;  3FU0 A;  3RU0 A;  3T5X A;  1FT2 A;  2YNQ A;  4BY6 A;  3Q7A A;  2LXM A;  4CGW A;  2VGX B;  4HFG A;  3RSE G;  3LY8 A;  2XPY A;  1X81 A;  4BTB A;  2IF4 A;  3CQC B;  2UY1 B;  3UKR G;  1TEZ A;  2L0T B;  1OWP A;  2XS8 A;  3LDZ A;  4BTA A;  4BET A;  3SQV A;  4NUR A;  2WXJ A;  3D9J A;  2LAI A;  5AN8 A;  4J8D A;  3EU9 A;  3P2B A;  3DBS A;  1S70 B;  3NOC D;  3SD5 A;  1Y6I A;  3ABK E;  5HS0 A;  3NF1 A;  4PH4 B;  1HFA A;  3SNX A;  2Q7F A;  4GCO A;  4KXK B;  3CHS A;  3EHQ A;  3Q73 A;  2J07 A;  4TUM A;  4GZ5 A;  2C2L A;  3W9F A;  1LD7 A;  3D9K A;  2RFM A;  3MKQ A;  3V30 A;  2BKG A;  5CMY A;  2AXV A;  3UM3 A;  5J90 A;  4B0Z A;  3PZ4 A;  3HXB A;  1FVF A;  4NAC A;  1S64 A;  4L9P A;  3WXX A;  4HB5 A;  1IHG A;  5KJM A;  3B7R L;  5G04 C;  5CBN A;  3FTY A;  5BV0 A;  4L1B A;  2OEV A;  2X3M A;  2WXQ A;  3RJV A;  4L7T A;  1TYQ G;  1IHB A;  4RG9 A;  2VSO E;  3L13 A;  3PE3 A;  4U8V D;  4UUC A;  4I17 A;  2LSV A;  4GCN A;  4F3V A;  3ZRH A;  5JA4 D;  3ZN3 A;  2LNI A;  3JXI A;  5KJL A;  2WPV A;  3ULE G;  2RKK A;  5KJN A;  3FUI A;  3ASD A;  1MHQ A;  5LOZ A;  4J8F A;  4URK A;  2AXU A;  4XX5 A;  2JLB A;  4XIF A;  3OTN A;  3QKY A;  4KT6 B;  3T9K A;  3ENE A;  1H2U A;  4UQZ A;  4TXQ A;  2LO6 A;  5ANR A;  4U95 D;  3RAU A;  1H6O A;  4FLB A;  4U0S A;  2WXH A;  1S0P A;  1Q2Z A;  1OCO E;  4LER A;  3E33 A;  4K0R A;  4EPZ A;  2H6H A;  4LRZ A;  3ASN E;  2I6H A;  3FY4 A;  3B7T A;  1TNU A;  4GAA A;  3V2O A;  3LKU A;  2DZO A;  4ZFH A;  4EBA A;  3EUV A;  2E2E A;  2QFC A;  4GMR A;  2MRI A;  5M72 A;  3ABM E;  2KCV A;  1KT1 A;  2EQX A;  5ENS D;  1UG3 A;  2HR2 A;  4DLO A;  2P2C P;  4KYO B;  4H7X A;  5G2N A;  5BUZ A;  4I6J A;  3CHR A;  5G05 J;  5JMN D;  5AQ9 A;  3TGO A;  1RZ4 A;  1UJK A;  1E8Z A;  3FU3 A;  5ENT D;  4UQY A;  3JQ1 A;  4V3I A;  3R7R A;  2XRY A;  2R17 C;  2OOE A;  2GRL A;  4ZHB A;  1BLX B;  3ZPJ A;  4I1O B;  3T5V A;  4ANX A;  3APC A;  1TR4 A;  2AWI A;  4HLE A;  4O1P A;  4EZK A;  3CVP A;  5C2Y A;  2JEK A;  3C5R A;  3P1U A;  1IQU A;  3RRU A;  2H6G A;  2WXM A;  3C3R A;  3ML9 A;  4UI9 J;  3AAA C;  1IKN D;  2WXO A;  3B7B A;  1V54 E;  2M63 A;  5A7D B;  1ELW A;  3C3O A;  4U0Z A;  4JHR A;  1YMP A;  3B95 A;  1WM5 A;  4FUL A;  4ILH B;  5JJ7 A;  2WXR A;  2P9K G;  4KVM A;  4WND A;  4HOS A;  4YVO A;  1N4P A;  3CGH A;  4GA0 A;  3PEU B;  4BWR A;  3NAW A;  5FZS A;  2PL2 A;  4JD2 G;  4RQI A;  2V0P A;  1N54 A;  3ISM C;  4DLQ A;  2XQ0 A;  1U2V G;  4TV3 A;  5B3S E;  5AQA A;  4U04 A;  2FEZ A;  3HXC A;  3L08 A;  3G2T A;  3ZXS A;  4ABN A;  3VLF A;  2V5Q C;  4AY6 A;  2PNN A;  3ONL A;  4JA9 A;  2A5E A;  5G05 C;  3KD7 A;  4YVQ C;  3GYZ A;  3CK7 A;  1OCZ E;  3LJ3 A;  2KCL A;  3UX4 A;  4RG6 A;  3NB2 A;  3MKQ B;  3CST A;  4BT9 A;  1PY1 A;  2GW1 A;  2EIJ E;  4U96 D;  1DNP A;  2FI7 A;  5T8I A;  3ESL A;  3PZ2 A;  3BUA A;  2R5S A;  5C1D A;  1NP7 A;  2QY7 A;  2KBX A;  3DXK G;  2V4H C;  3TWQ A;  3ZHE B;  2DZN A;  1TJC A;  2KXP C;  2I1J A;  3G2U A;  5EIL A;  2P9L G;  3QWW A;  1UOH A;  2ETB A;  5KNG A;  1H2V C;  5KCM A;  3JUE A;  1LF8 A;  2R05 A;  5HRY A;  4YDO A;  3JCK C;  2UY1 A;  3EJN A;  1N0R A;  3GZ2 A;  4I2Z A;  4BT8 A;  2BTD A;  4C0E A;  5B1A E;  2YHE A;  2XEH A;  4CT0 A;  3LJN A;  3ZGQ A;  1NZN A;  2XGS A;  4CDR A;  2WMO A;  4MLP A;  2VGX A;  3LS8 A;  3S7F A;  1BD8 A;  5D0O D;  3TJP A;  4DUI A;  3LVQ E;  3AU4 A;  1EF1 C;  5EX0 A;  2KAT A;  4D10 C;  3IV0 A;  3QDN A;  4WNE A;  3QAQ A;  1Z3X A;  2MYO A;  2XZT G;  2BUG A;  4GTM A;  3APF A;  2J8S D;  2CHX A;  3L22 A;  4UWG A;  5ANL A;  5FIO A;  5AIJ A;  5AAR A;  3ASH A;  4N2Q A;  1N94 A;  4I6G A;  3SY2 A;  4LCT A;  3U4T A;  3DSV A;  3CHO A;  5FWQ A;  3CK8 A;  5LCW J;  4YDE A;  4UI9 K;  3D3M A;  5JHA A;  5LCW C;  4G8K A;  3BEE A;  2IOL A;  3FH5 A;  4FJY A;  1D9S A;  1O1S A;  3CV0 A;  4GTR A;  4Z68 A;  3ZYQ A;  2BF0 X;  3E30 A;  4GA2 A;  3FUN A;  4AEZ C;  2WQ7 A;  4LNU D;  4U0U A;  5G55 A;  5FJY A;  3SO8 A;  4BES A;  1HE8 A;  2C0M A;  3L6A A;  3TWW A; 
#chains in the Genus database with same CATH homology
 2EIK E;  3AG3 E;  5B1A E;  3ABM E;  1OCR E;  3AG1 E;  2EIJ E;  3WG7 E;  5IY5 E;  2DYS E;  3AG4 E;  2EIN E;  2OCC E;  1OCO E;  2EIM E;  2EIL E;  2ZXW E;  3X2Q E;  3ASN E;  1OCC E;  1OCZ E;  3ABK E;  5B3S E;  2DYR E;  1V54 E;  2Y69 E;  1V55 E;  3AG2 E;  5B1B E;  3ABL E;  3ASO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...