5B1BE

Bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 5b1bE00
3ASNE 2EIJE 5B1AE 1OCOE 1OCCE 1OCRE 5B3SE 3ABLE 3AG4E 3ABKE 3ASOE 1V54E 2EIME 1V55E 5B1BE 3AG2E 3X2QE 2EIKE 2DYSE 2EILE 2OCCE 3WG7E 3AG3E 2EINE 1OCZE 2ZXWE 2DYRE 5IY5E 3AG1E 2Y69E 3ABME
chains in the Genus database with same CATH superfamily
5CERB 4GTRA 3FDHA 1LD8A 5AYWD 5G05J 2IQCA 2KATA 3CVPA 4HRMB 2KXPC 2XS1A 4LERA 1UW4B 4DX2A 4U8YD 1HF8A 2KZTA 3MV3B 3R7RA 5HKPA 2OEWA 1DVPA 5CBNA 4HLLA 4APFA 3CKCA 5JHBA 5AQBA 4KYOB 4Q94A 5G04J 4LRZA 4UI9K 3T8KA 1N4PA 2WXGA 2P9LG 2CHWA 1KT1A 2LXMA 3UXGA 4ZFHA 3S7DA 1N0QA 3GZ2A 1OWPA 3APFA 2IOLA 4YDYA 4CEMA 3CHRA 2GW1A 3SFZA 3TWUA 2LNIA 3CVQA 3D9OA 5M72A 3ABLE 4G24A 3HXCA 1MX6A 1YCSB 3TG4A 2OVBA 3Q15A 5KJNA 1QNFA 1N11A 5IY5E 2FULA 1MX2A 2LAHA 3ZU7B 3DPYA 3QNKA 4F53A 3NQPA 2XGSA 4BERA 5KWDA 1PC2A 3UIOC 3QWPA 1X81A 3B7SA 2WXFA 4ANWA 3TWVA 3QC1A 2FEZA 1Z6TA 3UM0A 3I4GA 1O1TA 4GCOA 3PZ1A 1D8EA 3URZA 4APOA 1TNBA 3P1UA 5CHEE 3SFYA 3ISMC 1WM5A 3V2XA 3ZRHA 1NP7A 5BXUA 3E30A 1S0PA 5T4YA 2VSXE 2VJ8A 4MKTA 2QFCA 2WMNA 3OAWA 3FUEA 3ASFA 4B8CB 3RIBA 4FADA 2Q7FA 2GRMA 2P58C 3RO3A 2YNQA 4I17A 3W9FA 4XZ4A 1GW6A 2DYSE 3B7TA 2OOEA 1MHQA 4XKBA 5CBOA 4ABNA 3E4BA 3LJ3A 2PQRA 4KXKB 1BU9A 4J8FA 2GGFA 3SBTB 4M3OA 4N5CA 2WXLA 4DI3A 5E75A 3EHQA 5CCLA 3I5PA 4RQIA 4UI9J 3TL5A 1E8YA 2VGXA 4K5BA 2L9BA 3FULA 3FUIA 1U3CA 3LDZA 4CZ2D 3EIJA 1N4QA 3QAQA 4ILGA 3HIZA 3CSTA 4L9PA 3IKOB 3R7QA 4AJWA 4NIKA 3S7JA 4BESA 3OXFA 2YINA 2XCBA 3K9IA 2DVWA 4GMLA 3AU5A 1LD7A 2Y4UA 1UN9A 3UM1A 5KBAA 3UTMA 5AJDA 2EIJE 3QWWA 5JMND 3JQ1A 3CVYA 5JJ7A 3UUXA 4IYPA 3BG0B 2AXZA 4XE0A 2OV8A 4LCTA 3TWTA 4U95D 1IXVA 2IOSA 4GTPA 2IFUA 3L17A 1WDYA 4BSZB 2VTBA 1HX8A 2FF4A 3BEEA 1H19A 1HE8A 2H6GA 3V2OA 3HDXA 4GZCA 2LSVA 3G2WA 3UT4A 4GYYA 1KPSB 3D9HA 4EHMA 5JA4D 4CYMD 5CCMA 1N95A 1UJJA 1E8XA 2V8SE 3ESLA 3E34A 4L23A 3Q9UC 2VGEA 4GZ3A 1TJFA 3L16A 2I2OA 3CK8A 1MQSA 3DXMG 1D8DA 2BF0X 1RZ4A 4UWGA 1MX4A 3TXMA 3FEYA 3ZXSA 3RAUA 4A1GA 3E33A 3J5PA 3Q47B 1TEZA 3CVWA 3ZHEA 5LFAA 3PE3A 3FUKA 3UKRG 3P2BA 5AJLA 4DK5A 4C0EA 3BG1B 2E0IA 3PDNA 2RD0A 1SA4A 2CG3A 3MJWA 3Q49B 1UN8A 4PUCA 1U2VG 4WWPA 4HBDA 5KNGA 1SA5A 2WXKA 2DZNA 3C98A 5DIZA 5KJKA 3CVNA 2LAIA 1QBQA 1Y6IA 3FTWA 2WQ7A 2LUHA 1H6KA 5B3SE 2WXHA 5A6CA 3AG4E 3SQVA 2EQXA 5LP0A 3AAAC 2XPIA 3ZNGA 2R5SA 3HXEA 5CMYA 3SBSA 3CVXA 4CGVA 3KEAA 4BFRA 4QFVA 3SZ7A 5EN5D 4XEIG 2WB2A 3KAEA 3PZ4A 5CECB 4I6EA 4ILIA 1OCZE 3O48A 3T5XA 5DBKA 4DPRA 2PL2A 1TJCA 2P9NG 3PEVB 3JXJA 1Q2ZA 2PM7A 3Q4AB 5ENNA 3EHRA 3FFLA 1N4RA 2KC7A 5B1BE 4H7XA 2V4HC 2WVIA 3PH0C 5EILA 1JPLA 5LCWC 4B89A 4WNGA 3TGOA 2BUGA 5ENRD 3CKBA 4NQ0A 2V0PA 3ABME 4HOQA 2HYZA 4K5CA 3B7BA 1TNUA 2P9KG 3RRUA 3MKRA 3N71A 5CEAA 2C0MA 4GA1A 3VTYA 2VSYA 1UOHA 3JYSA 3KEZA 5ENTD 3ZXPA 2KBXA 2ILRA 3IHYA 3PNTB 4G26A 3ZW3A 2J9QA 3ZGQA 2OCCE 3GYZA 4F7AA 4XX5A 4FHKA 4BX9A 4URKA 2J08A 4UWHA 3I3NA 3EDTB 4RSYA 3PNLB 1FT2A 4LNUD 5ENQD 5FIOA 5T3RA 1LF8A 4NACA 2DIWA 3R9AB 3QB2A 3SY2A 2DYRE 4JW1A 3UM3A 3CHQA 5G55A 2DWZA 5FZQA 2J07A 4CDRA 2VQ2A 5FZSA 4EECA 1DCQA 2GRPB 1AP7A 3V79K 2FO7A 4CRWA 2KCKA 1MZCA 3DSSA 1K1AA 3HVEB 4A1SA 4EBAA 3Q73A 2BEDA 4CDNA 4DRXE 4GTQA 4F1SA 1NA0A 4MRUA 2DCPA 4K0RA 5FT9A 1S64A 1TR4A 3V31A 3ZYQA 5ANRA 1N0RA 1ZBPA 5HQ8A 4A55A 5BUZA 3DSXA 3MCXA 4JHKA 5HRYA 3CK7A 3ZYKA 3PS6A 5FQ7A 3Q79A 3MA5A 4JEHA 4AXHA 1G3NB 4HORA 1JWGA 3ULQA 3CR3A 2BKKB 2UY1B 5EIDA 1O1RA 4AVXA 2QC9A 2RFMA 1JCSA 2LSUA 1NZNA 3SD5A 5CMWA 3TXNA 4AP2A 5KJMA 1V55E 3IHVA 2CG2A 1ZB1A 3RRMB 5ARGA 3ULYA 4A63B 3CHMA 4JVSA 4TXPA 5EX0A 4HOTA 3F6QA 3SF4A 4J0UA 4GA0A 2ETAA 3NZSA 4ME2A 3C72A 4EBAG 2C0LA 2WXJA 1LTXA 3LEWA 4F3VA 3LY8A 3JXIA 3AG2E 2L0TB 4I2ZA 1FVFA 2ZXWE 3APCA 2F8XK 3LY7A 4DX6D 4DX7D 3ASDA 4GYWA 1SW6A 5ARFA 2LXLA 2BKGA 4K03A 4YNDA 1H6PA 1EDUA 3D3MA 1QYMA 1EPUA 4EZKA 3PEUB 4U04A 4G23A 4DJAA 3GZSA 4U7EB 4Y6CA 3NOCD 3S7FA 3L08A 4QQIA 4JZYA 3TWWA 1RW2A 3MKQB 3DSUA 3ASOE 4I2WA 4XI0A 3EHNA 3ONKA 1O1SA 3IBEA 3ZN3A 3MV2B 2ETCA 4FLBA 2OVFA 1SZAA 2R2LA 2X6HA 4RVBA 3RJVA 3L13A 4GMRA 1OCOE 3ZUVB 3LKUA 1FPPA 4JEUA 1BD8A 2JABA 2QYJA 3FH8A 4I6JA 2DZOA 5EYPF 1QQEA 2NYJA 4GTVA 4FP7A 3TWRA 1TNOA 3CHPA 3DBSA 2F37A 5ENSD 1FVHA 2L6JA 4E85A 4J8EA 3ML9A 2XRYA 4HQDA 3X2QE 3D9KA 3ONLA 4YDWA 4FA6A 5EKQD 1P5QA 1L5JA 4L2LA 4PS7A 3U3WA 4IRUA 3E37A 3FP3A 3SFXA 2IJGX 3C5RA 4UQZA 3FUNA 3C3RA 4N3AA 4WWOA 1HFAA 2Y1LE 3RK6A 4XKCA 5JHAA 4O60A 2JEKA 4J6IA 1SVXA 2PNNA 2X6IA 5BV1A 3ASGA 3HXBA 4JA7A 4JPSA 2L6BA 4NURA 1OY3D 2IU1A 2DBAA 2R17C 4I9CA 3RRNB 4BETA 3ZVVA 3IV0A 1U3DA 2KZTB 2AXVA 3FTZA 3DSVA 4ATZD 5LCWJ 3CQGB 2WXMA 3GZ1A 3L54A 4G8LA 4GTTA 3FH7A 3G2TA 3VTXA 1K1BA 1FT1A 3ML8A 3NBNB 1JUQA 2XEHA 3NF1A 4G11A 2E2EA 4AOFA 4AY6A 4I1AA 3IXEA 4X8QA 2A5UA 4ILHB 2KCLA 4C48B 3QKYA 3HG0D 1SQMA 5BXOA 3PUJA 4HOSA 4E6HA 3WG7E 3UIPC 2R02A 4ZHBA 3FU3A 2YHEA 4HOUA 3UPVA 4CT0A 4Y6WA 3D9NA 3T5VA 4GA2A 3PREA 5EDSA 3FEXA 2FO1E 2IY0C 4U0ZA 2LO6A 3JQ0A 4EZJA 2V5QC 3FHEA 1FCHA 1WAO1 3LY9A 3S7BA 3DEOA 4RG6A 4HRLA 5A23A 3D9LA 4FLHA 3NZUA 2AW6A 2GRQB 1OCCE 3SI5A 5ENOD 1E7UA 4TV3A 1OWLA 1TN7A 3CK9A 4AM9A 3FU5A 3G2UA 4TXQA 3EIQC 4I9EA 2KCVA 5AIJA 3LJNA 1ELRA 3PUKA 4U96D 5KCMA 3AS4A 1X5BA 2FI7A 3DWLG 2NXPA 5EIBE 4DI4A 4HS2A 3FTSA 4GCNA 4OYSA 5BPPA 1H2UA 2XRZA 1BI8B 4O1OA 3EU5A 1JCRA 4JB8P 4ATGA 5CRUA 2HO1A 3FTUA 1IHBA 1PY1A 3O4ZA 2ZU6B 3DXKG 1BI7B 4WAFA 3NAWA 4EPZA 4IULA 3DEPA 2HE0A 4XIFA 5HI7A 2XQ0A 3MEKA 3QARA 5ANLA 3KS2A 3FTVA 3AS5A 4IN3B 1XNFA 1S70B 1N4SA 3Q78A 4OVVA 5LX8A 4N39A 2A5EA 3E32A 3HXFA 5ENPD 3ULEG 2B6CA 2ZISA 4HI9A 1IQRA 4D10C 4GTSA 2CFUA 3UI2A 4HFGA 3SNXA 2IO3C 3ZIMA 2ZGGA 3OTNA 3T9KA 3U4TA 3SGHA 3C3OA 3QOUA 3LVRE 2VGXB 4KVMA 2WQHA 2WXPA 2XZTG 5CRVA 4L7TA 3RKVA 3PZ2A 4N5QA 3TAXA 4G8KA 2P9IG 2PM6A 2RG8A 5E76A 2VGYA 1KT0A 3AS8A 4KT6B 3OXGA 4HNAD 4FHJA 3PE4A 3RU0A 2WQ6A 3FUFA 2Y69E 3LCAA 1E96B 1UJKA 4GB9A 4U8VD 5B1AE 3W9GA 1DNPA 3ABKE 4R7LA 5D0QD 5FZRA 4GAAA 4JD2G 1Y8MA 3QWVA 1AWCB 4WNFA 4WWNA 3UX4A 4U8HA 2X6FA 3B7RL 3RSEG 5FQ4A 1JCQA 1WG0A 3PZDA 4YVQC 1K3ZD 2XEVA 4JL0A 4LUNU 3L6AA 2VTBB 3KD7A 1OWOA 1HXIA 3R9MA 2QYUA 4BSXA 4BT9A 4CGWA 3TG5A 4J8YA 1Z3YA 2A4ZA 4NRHB 3KSLA 4FC8A 4LNBA 4WNDA 3LYAA 5FWQA 4UWFA 1NFIE 3HXDA 5JJTA 2CFZA 3SO8A 5LOZA 4L2YA 3UINC 2MHKA 3Q7AA 4O6FA 4KZCA 4WUYA 1K8KG 4L1BA 2XHEA 3FH5A 1KZOA 4I1OB 4F1PA 3J5QB 1MJ0A 3NOGD 2GRLA 4GZ6A 4GMJA 3ZHEB 3FUMA 3U9WA 3D9JA 4MS6A 1TNYA 3MGBA 2HM8A 4HB5A 4YDEA 1INZA 4B93B 4GPKA 1YMPA 5FTPA 3LPZA 1IKND 3TWQA 4AIFA 1V54E 2XGMA 2FBNA 3D9PA 3GW4A 4YDOA 4JHJA 4UQYA 5C1DA 2I6HA 3RO2A 5FQ8A 4B94A 1A17A 1TNZA 1D9SA 3CGHA 4ANXA 3CHOA 3L22A 3T8MA 3CSFA 4I1MA 1H2VC 1YYHA 3FY4A 1NI1A 4N2SA 4F6RD 2P2CP 1UG3A 3L9TA 3UQ3A 3PRZA 4KVOA 1TN6A 1ELWA 3AG1E 4C9BB 2F0YA 2R03A 4FU3A 5KNHD 3PVLA 2WXOA 4FJZA 1XGWA 1N9AA 1ZU2A 3APDA 4KBQA 4A3TA 1YA0A 2WXNA 2KM4A 1E8ZA 2AXUA 5D0OD 3CVVA 5FQ6A 3FU0A 4TXRA 3BU8A 3AU4A 4CT4A 4KMOA 4G1TA 2XCCA 4HXIA 2RKKA 1IQUA 4GU5A 4K5AB 3Q9NC 3MYVA 4GPMA 4U07A 4UUCA 3DSWA 2EIME 3WXXA 2X6JA 1BLXB 3B13A 3B95A 3ZEFA 2X6KA 4Z68A 3FWVA 3C3QA 2WXIA 5BV0A 1EF1C 2IF4A 2J4BA 4DX1A 3G2SA 2L0IA 1B89A 1A5EA 3KSQA 4CCAA 3ASNE 3CVLA 4AEZC 2Y4TA 2YQ8A 1OCRE 3FUDA 3MZLB 4A3VA 2J09A 3I4RB 2GRRB 4I43A 3FTXA 4JHRA 4ACKA 2R59A 4XI9A 1ELKA 3VLFA 1VDYA 5AN8A 3L82A 3DSTA 2M63A 1MYOA 2IEJA 5EYLA 2EILE 3HYMB 4MLPA 4LEUA 5G05C 2IO2C 4ANUA 3ENEA 5AENA 3QDNA 1HH8A 5J08A 4PS3A 2Y0BG 4FJYA 1OUVA 5BW8C 4G2VA 3LXUX 5AQAA 4HRNA 3JCKC 2AWIA 1H2TC 4OAVB 2NC9A 5AAOA 3CVUA 2QZAA 2XPZA 5G04C 4JXTA 2PQNA 4DLQA 2XENA 4BT8A 3EJNA 4P29A 2P9UG 2VSOE 4BEPA 2H6FA 3ZKJA 5CEDB 2IONA 4HI8A 4G25A 4PH4B 5H7PA 5BT1A 1E90A 4UWKA 5ITZF 3FTYA 3ZYLA 1OWMA 3OXLA 1N54A 2EIKE 1BPOA 2NSZA 3UMVA 4BX8A 1NL4A 2OEVA 3QK0A 3EU9A 1DCEA 4V3IA 4GTMA 4Q69A 2AJAA 4LSZE 2UWJG 4UQXA 3JUIA 3UT8A 4BTAA 2I1JA 4N3BA 1HZ4A 4TUUA 2R05A 3ESKA 2Y3AA 5FJYA 3CHSA 4UWLA 1IYGA 5AARA 4DX5D 2ETBA 4N2QA 5D2MC 2GRNB 5J90A 3BQOA 3U66A 2I9CA 4OVUA 4J8SA 3AJIA 2C2LA 3S2AA 2WM9A 3HVEA 4M7CA 2GROB 4DUIA 1W3BA 4ANVA 3ZFWA 2X38A 3QJZA 3Q5MA 4BY6A 4RG9A 2XPYA 4HVBA 2WMOA 3TJPA 3Q75A 3TWSA 3Q7FA 4J8DA 3BUAA 1OXJA 3UT7A 3ZYMA 4RLYA 1HG5A 4MBGA 4PDXA 3DPDA 4I6GA 4ACLA 2XEEA 3VLDA 5T8IA 4GYOA 3B7UX 3FUHA 3SHFA 4LNGA 2UY1A 4BTBA 1N94A 5D66A 2XGOA 1Z3XA 5JJ6A 1TN8A 1SZ9A 4UI9C 3MX3A 2P9SG 5FINA 3IEGA 4LG6A 1OT8A 4U0SA 2J4DA 2X3MA 2VSNA 3AG3E 2EINE 2WXRA 2YHCA 1TYQG 2H6IA 4U63A 2CHXA 3G2VA 1QZ2A 3LVQE 4DLOA 3UKUG 3PZ3A 4GTOA 2F8YA 4PS8A 3EHMA 4JC8A 4KZ0A 2CHZA 3DRAA 2PZIA 2JLBA 4CDMA 4BWRA 4GZDA 4AY5A 2I1KA 4C0MA 5EX3A 2MRIA 3ASHA 2H6HA 3UM2A 3FUJA 3CQCB 2V4LA 5HS0A 3ZPJA 4TRQA 1HU3A 2RFAA 4J7WA 4B0ZA 4AV7A 1PAQA 2AVPA 4H7YA 2B0OE 2QY7A 3NB2A 1KLXA 3MKQA 2HR2A 2WXQA 3HHMA 2VYIA 1H0AA 4Q96A 2ONDA 1KZPA 4W9RA 3D9IA 4YVOA 1OWNA 3D9MA 3JUEA 3FU6A 2V5FA 4HLEA 1NA3A 5BNWA 5C2YA 3U64A 5G2NA 2MOWA 5A7DB 4EQFA 1O5MA 2J49A 4GZ5A 2WPVA 3VLEA 4WNEA 1H6OA 4O1PA 5AQ9A 4OAUC 1HO8A 3CV0A 3EUVA 3HRAA 1DC2A 3CLJA 2MYOA 2J8SD 2BTDA 1N52A 3CEQA 4N3CA 4EZLA 1Z5SC 1HG2A 3LS8A 1S63A 5AQ7A 1E7VA 2ZGDA 4JA9A 2XS8A 1EYHA 3TWXA 5KJLA 2P9PG 2ZIRA 1JWFA 3CIAA 4B8AA 4TUMA 4U0UA 1IHGA 4FULA 2XZDG 1WY6A 1E8WA 1HS6A 3V30A
chains in the Genus database with same CATH topology
3ASNE 2EIJE 5B1AE 1OCOE 1OCCE 1OCRE 5B3SE 3ABLE 3AG4E 3ABKE 3ASOE 1V54E 2EIME 1V55E 5B1BE 3AG2E 3X2QE 2EIKE 2DYSE 2EILE 2OCCE 3WG7E 3AG3E 2EINE 1OCZE 2ZXWE 2DYRE 5IY5E 3AG1E 2Y69E 3ABME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASN E;  2EIJ E;  5B1A E;  1OCO E;  1OCC E;  1OCR E;  5B3S E;  3ABL E;  3AG4 E;  3ABK E;  3ASO E;  1V54 E;  2EIM E;  1V55 E;  5B1B E;  3AG2 E;  3X2Q E;  2EIK E;  2DYS E;  2EIL E;  2OCC E;  3WG7 E;  3AG3 E;  2EIN E;  1OCZ E;  2ZXW E;  2DYR E;  5IY5 E;  3AG1 E;  2Y69 E;  3ABM E; 
#chains in the Genus database with same CATH topology
 5CER B;  4GTR A;  3FDH A;  1LD8 A;  5AYW D;  5G05 J;  2IQC A;  2KAT A;  3CVP A;  4HRM B;  2KXP C;  2XS1 A;  4LER A;  1UW4 B;  4DX2 A;  4U8Y D;  1HF8 A;  2KZT A;  3MV3 B;  3R7R A;  5HKP A;  2OEW A;  1DVP A;  5CBN A;  4HLL A;  4APF A;  3CKC A;  5JHB A;  5AQB A;  4KYO B;  4Q94 A;  5G04 J;  4LRZ A;  4UI9 K;  3T8K A;  1N4P A;  2WXG A;  2P9L G;  2CHW A;  1KT1 A;  2LXM A;  3UXG A;  4ZFH A;  3S7D A;  1N0Q A;  3GZ2 A;  1OWP A;  3APF A;  2IOL A;  4YDY A;  4CEM A;  3CHR A;  2GW1 A;  3SFZ A;  3TWU A;  2LNI A;  3CVQ A;  3D9O A;  5M72 A;  3ABL E;  4G24 A;  3HXC A;  1MX6 A;  1YCS B;  3TG4 A;  2OVB A;  3Q15 A;  5KJN A;  1QNF A;  1N11 A;  5IY5 E;  2FUL A;  1MX2 A;  2LAH A;  3ZU7 B;  3DPY A;  3QNK A;  4F53 A;  3NQP A;  2XGS A;  4BER A;  5KWD A;  1PC2 A;  3UIO C;  3QWP A;  1X81 A;  3B7S A;  2WXF A;  4ANW A;  3TWV A;  3QC1 A;  2FEZ A;  1Z6T A;  3UM0 A;  3I4G A;  1O1T A;  4GCO A;  3PZ1 A;  1D8E A;  3URZ A;  4APO A;  1TNB A;  3P1U A;  5CHE E;  3SFY A;  3ISM C;  1WM5 A;  3V2X A;  3ZRH A;  1NP7 A;  5BXU A;  3E30 A;  1S0P A;  5T4Y A;  2VSX E;  2VJ8 A;  4MKT A;  2QFC A;  2WMN A;  3OAW A;  3FUE A;  3ASF A;  4B8C B;  3RIB A;  4FAD A;  2Q7F A;  2GRM A;  2P58 C;  3RO3 A;  2YNQ A;  4I17 A;  3W9F A;  4XZ4 A;  1GW6 A;  2DYS E;  3B7T A;  2OOE A;  1MHQ A;  4XKB A;  5CBO A;  4ABN A;  3E4B A;  3LJ3 A;  2PQR A;  4KXK B;  1BU9 A;  4J8F A;  2GGF A;  3SBT B;  4M3O A;  4N5C A;  2WXL A;  4DI3 A;  5E75 A;  3EHQ A;  5CCL A;  3I5P A;  4RQI A;  4UI9 J;  3TL5 A;  1E8Y A;  2VGX A;  4K5B A;  2L9B A;  3FUL A;  3FUI A;  1U3C A;  3LDZ A;  4CZ2 D;  3EIJ A;  1N4Q A;  3QAQ A;  4ILG A;  3HIZ A;  3CST A;  4L9P A;  3IKO B;  3R7Q A;  4AJW A;  4NIK A;  3S7J A;  4BES A;  3OXF A;  2YIN A;  2XCB A;  3K9I A;  2DVW A;  4GML A;  3AU5 A;  1LD7 A;  2Y4U A;  1UN9 A;  3UM1 A;  5KBA A;  3UTM A;  5AJD A;  2EIJ E;  3QWW A;  5JMN D;  3JQ1 A;  3CVY A;  5JJ7 A;  3UUX A;  4IYP A;  3BG0 B;  2AXZ A;  4XE0 A;  2OV8 A;  4LCT A;  3TWT A;  4U95 D;  1IXV A;  2IOS A;  4GTP A;  2IFU A;  3L17 A;  1WDY A;  4BSZ B;  2VTB A;  1HX8 A;  2FF4 A;  3BEE A;  1H19 A;  1HE8 A;  2H6G A;  3V2O A;  3HDX A;  4GZC A;  2LSV A;  3G2W A;  3UT4 A;  4GYY A;  1KPS B;  3D9H A;  4EHM A;  5JA4 D;  4CYM D;  5CCM A;  1N95 A;  1UJJ A;  1E8X A;  2V8S E;  3ESL A;  3E34 A;  4L23 A;  3Q9U C;  2VGE A;  4GZ3 A;  1TJF A;  3L16 A;  2I2O A;  3CK8 A;  1MQS A;  3DXM G;  1D8D A;  2BF0 X;  1RZ4 A;  4UWG A;  1MX4 A;  3TXM A;  3FEY A;  3ZXS A;  3RAU A;  4A1G A;  3E33 A;  3J5P A;  3Q47 B;  1TEZ A;  3CVW A;  3ZHE A;  5LFA A;  3PE3 A;  3FUK A;  3UKR G;  3P2B A;  5AJL A;  4DK5 A;  4C0E A;  3BG1 B;  2E0I A;  3PDN A;  2RD0 A;  1SA4 A;  2CG3 A;  3MJW A;  3Q49 B;  1UN8 A;  4PUC A;  1U2V G;  4WWP A;  4HBD A;  5KNG A;  1SA5 A;  2WXK A;  2DZN A;  3C98 A;  5DIZ A;  5KJK A;  3CVN A;  2LAI A;  1QBQ A;  1Y6I A;  3FTW A;  2WQ7 A;  2LUH A;  1H6K A;  5B3S E;  2WXH A;  5A6C A;  3AG4 E;  3SQV A;  2EQX A;  5LP0 A;  3AAA C;  2XPI A;  3ZNG A;  2R5S A;  3HXE A;  5CMY A;  3SBS A;  3CVX A;  4CGV A;  3KEA A;  4BFR A;  4QFV A;  3SZ7 A;  5EN5 D;  4XEI G;  2WB2 A;  3KAE A;  3PZ4 A;  5CEC B;  4I6E A;  4ILI A;  1OCZ E;  3O48 A;  3T5X A;  5DBK A;  4DPR A;  2PL2 A;  1TJC A;  2P9N G;  3PEV B;  3JXJ A;  1Q2Z A;  2PM7 A;  3Q4A B;  5ENN A;  3EHR A;  3FFL A;  1N4R A;  2KC7 A;  5B1B E;  4H7X A;  2V4H C;  2WVI A;  3PH0 C;  5EIL A;  1JPL A;  5LCW C;  4B89 A;  4WNG A;  3TGO A;  2BUG A;  5ENR D;  3CKB A;  4NQ0 A;  2V0P A;  3ABM E;  4HOQ A;  2HYZ A;  4K5C A;  3B7B A;  1TNU A;  2P9K G;  3RRU A;  3MKR A;  3N71 A;  5CEA A;  2C0M A;  4GA1 A;  3VTY A;  2VSY A;  1UOH A;  3JYS A;  3KEZ A;  5ENT D;  3ZXP A;  2KBX A;  2ILR A;  3IHY A;  3PNT B;  4G26 A;  3ZW3 A;  2J9Q A;  3ZGQ A;  2OCC E;  3GYZ A;  4F7A A;  4XX5 A;  4FHK A;  4BX9 A;  4URK A;  2J08 A;  4UWH A;  3I3N A;  3EDT B;  4RSY A;  3PNL B;  1FT2 A;  4LNU D;  5ENQ D;  5FIO A;  5T3R A;  1LF8 A;  4NAC A;  2DIW A;  3R9A B;  3QB2 A;  3SY2 A;  2DYR E;  4JW1 A;  3UM3 A;  3CHQ A;  5G55 A;  2DWZ A;  5FZQ A;  2J07 A;  4CDR A;  2VQ2 A;  5FZS A;  4EEC A;  1DCQ A;  2GRP B;  1AP7 A;  3V79 K;  2FO7 A;  4CRW A;  2KCK A;  1MZC A;  3DSS A;  1K1A A;  3HVE B;  4A1S A;  4EBA A;  3Q73 A;  2BED A;  4CDN A;  4DRX E;  4GTQ A;  4F1S A;  1NA0 A;  4MRU A;  2DCP A;  4K0R A;  5FT9 A;  1S64 A;  1TR4 A;  3V31 A;  3ZYQ A;  5ANR A;  1N0R A;  1ZBP A;  5HQ8 A;  4A55 A;  5BUZ A;  3DSX A;  3MCX A;  4JHK A;  5HRY A;  3CK7 A;  3ZYK A;  3PS6 A;  5FQ7 A;  3Q79 A;  3MA5 A;  4JEH A;  4AXH A;  1G3N B;  4HOR A;  1JWG A;  3ULQ A;  3CR3 A;  2BKK B;  2UY1 B;  5EID A;  1O1R A;  4AVX A;  2QC9 A;  2RFM A;  1JCS A;  2LSU A;  1NZN A;  3SD5 A;  5CMW A;  3TXN A;  4AP2 A;  5KJM A;  1V55 E;  3IHV A;  2CG2 A;  1ZB1 A;  3RRM B;  5ARG A;  3ULY A;  4A63 B;  3CHM A;  4JVS A;  4TXP A;  5EX0 A;  4HOT A;  3F6Q A;  3SF4 A;  4J0U A;  4GA0 A;  2ETA A;  3NZS A;  4ME2 A;  3C72 A;  4EBA G;  2C0L A;  2WXJ A;  1LTX A;  3LEW A;  4F3V A;  3LY8 A;  3JXI A;  3AG2 E;  2L0T B;  4I2Z A;  1FVF A;  2ZXW E;  3APC A;  2F8X K;  3LY7 A;  4DX6 D;  4DX7 D;  3ASD A;  4GYW A;  1SW6 A;  5ARF A;  2LXL A;  2BKG A;  4K03 A;  4YND A;  1H6P A;  1EDU A;  3D3M A;  1QYM A;  1EPU A;  4EZK A;  3PEU B;  4U04 A;  4G23 A;  4DJA A;  3GZS A;  4U7E B;  4Y6C A;  3NOC D;  3S7F A;  3L08 A;  4QQI A;  4JZY A;  3TWW A;  1RW2 A;  3MKQ B;  3DSU A;  3ASO E;  4I2W A;  4XI0 A;  3EHN A;  3ONK A;  1O1S A;  3IBE A;  3ZN3 A;  3MV2 B;  2ETC A;  4FLB A;  2OVF A;  1SZA A;  2R2L A;  2X6H A;  4RVB A;  3RJV A;  3L13 A;  4GMR A;  1OCO E;  3ZUV B;  3LKU A;  1FPP A;  4JEU A;  1BD8 A;  2JAB A;  2QYJ A;  3FH8 A;  4I6J A;  2DZO A;  5EYP F;  1QQE A;  2NYJ A;  4GTV A;  4FP7 A;  3TWR A;  1TNO A;  3CHP A;  3DBS A;  2F37 A;  5ENS D;  1FVH A;  2L6J A;  4E85 A;  4J8E A;  3ML9 A;  2XRY A;  4HQD A;  3X2Q E;  3D9K A;  3ONL A;  4YDW A;  4FA6 A;  5EKQ D;  1P5Q A;  1L5J A;  4L2L A;  4PS7 A;  3U3W A;  4IRU A;  3E37 A;  3FP3 A;  3SFX A;  2IJG X;  3C5R A;  4UQZ A;  3FUN A;  3C3R A;  4N3A A;  4WWO A;  1HFA A;  2Y1L E;  3RK6 A;  4XKC A;  5JHA A;  4O60 A;  2JEK A;  4J6I A;  1SVX A;  2PNN A;  2X6I A;  5BV1 A;  3ASG A;  3HXB A;  4JA7 A;  4JPS A;  2L6B A;  4NUR A;  1OY3 D;  2IU1 A;  2DBA A;  2R17 C;  4I9C A;  3RRN B;  4BET A;  3ZVV A;  3IV0 A;  1U3D A;  2KZT B;  2AXV A;  3FTZ A;  3DSV A;  4ATZ D;  5LCW J;  3CQG B;  2WXM A;  3GZ1 A;  3L54 A;  4G8L A;  4GTT A;  3FH7 A;  3G2T A;  3VTX A;  1K1B A;  1FT1 A;  3ML8 A;  3NBN B;  1JUQ A;  2XEH A;  3NF1 A;  4G11 A;  2E2E A;  4AOF A;  4AY6 A;  4I1A A;  3IXE A;  4X8Q A;  2A5U A;  4ILH B;  2KCL A;  4C48 B;  3QKY A;  3HG0 D;  1SQM A;  5BXO A;  3PUJ A;  4HOS A;  4E6H A;  3WG7 E;  3UIP C;  2R02 A;  4ZHB A;  3FU3 A;  2YHE A;  4HOU A;  3UPV A;  4CT0 A;  4Y6W A;  3D9N A;  3T5V A;  4GA2 A;  3PRE A;  5EDS A;  3FEX A;  2FO1 E;  2IY0 C;  4U0Z A;  2LO6 A;  3JQ0 A;  4EZJ A;  2V5Q C;  3FHE A;  1FCH A;  1WAO 1;  3LY9 A;  3S7B A;  3DEO A;  4RG6 A;  4HRL A;  5A23 A;  3D9L A;  4FLH A;  3NZU A;  2AW6 A;  2GRQ B;  1OCC E;  3SI5 A;  5ENO D;  1E7U A;  4TV3 A;  1OWL A;  1TN7 A;  3CK9 A;  4AM9 A;  3FU5 A;  3G2U A;  4TXQ A;  3EIQ C;  4I9E A;  2KCV A;  5AIJ A;  3LJN A;  1ELR A;  3PUK A;  4U96 D;  5KCM A;  3AS4 A;  1X5B A;  2FI7 A;  3DWL G;  2NXP A;  5EIB E;  4DI4 A;  4HS2 A;  3FTS A;  4GCN A;  4OYS A;  5BPP A;  1H2U A;  2XRZ A;  1BI8 B;  4O1O A;  3EU5 A;  1JCR A;  4JB8 P;  4ATG A;  5CRU A;  2HO1 A;  3FTU A;  1IHB A;  1PY1 A;  3O4Z A;  2ZU6 B;  3DXK G;  1BI7 B;  4WAF A;  3NAW A;  4EPZ A;  4IUL A;  3DEP A;  2HE0 A;  4XIF A;  5HI7 A;  2XQ0 A;  3MEK A;  3QAR A;  5ANL A;  3KS2 A;  3FTV A;  3AS5 A;  4IN3 B;  1XNF A;  1S70 B;  1N4S A;  3Q78 A;  4OVV A;  5LX8 A;  4N39 A;  2A5E A;  3E32 A;  3HXF A;  5ENP D;  3ULE G;  2B6C A;  2ZIS A;  4HI9 A;  1IQR A;  4D10 C;  4GTS A;  2CFU A;  3UI2 A;  4HFG A;  3SNX A;  2IO3 C;  3ZIM A;  2ZGG A;  3OTN A;  3T9K A;  3U4T A;  3SGH A;  3C3O A;  3QOU A;  3LVR E;  2VGX B;  4KVM A;  2WQH A;  2WXP A;  2XZT G;  5CRV A;  4L7T A;  3RKV A;  3PZ2 A;  4N5Q A;  3TAX A;  4G8K A;  2P9I G;  2PM6 A;  2RG8 A;  5E76 A;  2VGY A;  1KT0 A;  3AS8 A;  4KT6 B;  3OXG A;  4HNA D;  4FHJ A;  3PE4 A;  3RU0 A;  2WQ6 A;  3FUF A;  2Y69 E;  3LCA A;  1E96 B;  1UJK A;  4GB9 A;  4U8V D;  5B1A E;  3W9G A;  1DNP A;  3ABK E;  4R7L A;  5D0Q D;  5FZR A;  4GAA A;  4JD2 G;  1Y8M A;  3QWV A;  1AWC B;  4WNF A;  4WWN A;  3UX4 A;  4U8H A;  2X6F A;  3B7R L;  3RSE G;  5FQ4 A;  1JCQ A;  1WG0 A;  3PZD A;  4YVQ C;  1K3Z D;  2XEV A;  4JL0 A;  4LUN U;  3L6A A;  2VTB B;  3KD7 A;  1OWO A;  1HXI A;  3R9M A;  2QYU A;  4BSX A;  4BT9 A;  4CGW A;  3TG5 A;  4J8Y A;  1Z3Y A;  2A4Z A;  4NRH B;  3KSL A;  4FC8 A;  4LNB A;  4WND A;  3LYA A;  5FWQ A;  4UWF A;  1NFI E;  3HXD A;  5JJT A;  2CFZ A;  3SO8 A;  5LOZ A;  4L2Y A;  3UIN C;  2MHK A;  3Q7A A;  4O6F A;  4KZC A;  4WUY A;  1K8K G;  4L1B A;  2XHE A;  3FH5 A;  1KZO A;  4I1O B;  4F1P A;  3J5Q B;  1MJ0 A;  3NOG D;  2GRL A;  4GZ6 A;  4GMJ A;  3ZHE B;  3FUM A;  3U9W A;  3D9J A;  4MS6 A;  1TNY A;  3MGB A;  2HM8 A;  4HB5 A;  4YDE A;  1INZ A;  4B93 B;  4GPK A;  1YMP A;  5FTP A;  3LPZ A;  1IKN D;  3TWQ A;  4AIF A;  1V54 E;  2XGM A;  2FBN A;  3D9P A;  3GW4 A;  4YDO A;  4JHJ A;  4UQY A;  5C1D A;  2I6H A;  3RO2 A;  5FQ8 A;  4B94 A;  1A17 A;  1TNZ A;  1D9S A;  3CGH A;  4ANX A;  3CHO A;  3L22 A;  3T8M A;  3CSF A;  4I1M A;  1H2V C;  1YYH A;  3FY4 A;  1NI1 A;  4N2S A;  4F6R D;  2P2C P;  1UG3 A;  3L9T A;  3UQ3 A;  3PRZ A;  4KVO A;  1TN6 A;  1ELW A;  3AG1 E;  4C9B B;  2F0Y A;  2R03 A;  4FU3 A;  5KNH D;  3PVL A;  2WXO A;  4FJZ A;  1XGW A;  1N9A A;  1ZU2 A;  3APD A;  4KBQ A;  4A3T A;  1YA0 A;  2WXN A;  2KM4 A;  1E8Z A;  2AXU A;  5D0O D;  3CVV A;  5FQ6 A;  3FU0 A;  4TXR A;  3BU8 A;  3AU4 A;  4CT4 A;  4KMO A;  4G1T A;  2XCC A;  4HXI A;  2RKK A;  1IQU A;  4GU5 A;  4K5A B;  3Q9N C;  3MYV A;  4GPM A;  4U07 A;  4UUC A;  3DSW A;  2EIM E;  3WXX A;  2X6J A;  1BLX B;  3B13 A;  3B95 A;  3ZEF A;  2X6K A;  4Z68 A;  3FWV A;  3C3Q A;  2WXI A;  5BV0 A;  1EF1 C;  2IF4 A;  2J4B A;  4DX1 A;  3G2S A;  2L0I A;  1B89 A;  1A5E A;  3KSQ A;  4CCA A;  3ASN E;  3CVL A;  4AEZ C;  2Y4T A;  2YQ8 A;  1OCR E;  3FUD A;  3MZL B;  4A3V A;  2J09 A;  3I4R B;  2GRR B;  4I43 A;  3FTX A;  4JHR A;  4ACK A;  2R59 A;  4XI9 A;  1ELK A;  3VLF A;  1VDY A;  5AN8 A;  3L82 A;  3DST A;  2M63 A;  1MYO A;  2IEJ A;  5EYL A;  2EIL E;  3HYM B;  4MLP A;  4LEU A;  5G05 C;  2IO2 C;  4ANU A;  3ENE A;  5AEN A;  3QDN A;  1HH8 A;  5J08 A;  4PS3 A;  2Y0B G;  4FJY A;  1OUV A;  5BW8 C;  4G2V A;  3LXU X;  5AQA A;  4HRN A;  3JCK C;  2AWI A;  1H2T C;  4OAV B;  2NC9 A;  5AAO A;  3CVU A;  2QZA A;  2XPZ A;  5G04 C;  4JXT A;  2PQN A;  4DLQ A;  2XEN A;  4BT8 A;  3EJN A;  4P29 A;  2P9U G;  2VSO E;  4BEP A;  2H6F A;  3ZKJ A;  5CED B;  2ION A;  4HI8 A;  4G25 A;  4PH4 B;  5H7P A;  5BT1 A;  1E90 A;  4UWK A;  5ITZ F;  3FTY A;  3ZYL A;  1OWM A;  3OXL A;  1N54 A;  2EIK E;  1BPO A;  2NSZ A;  3UMV A;  4BX8 A;  1NL4 A;  2OEV A;  3QK0 A;  3EU9 A;  1DCE A;  4V3I A;  4GTM A;  4Q69 A;  2AJA A;  4LSZ E;  2UWJ G;  4UQX A;  3JUI A;  3UT8 A;  4BTA A;  2I1J A;  4N3B A;  1HZ4 A;  4TUU A;  2R05 A;  3ESK A;  2Y3A A;  5FJY A;  3CHS A;  4UWL A;  1IYG A;  5AAR A;  4DX5 D;  2ETB A;  4N2Q A;  5D2M C;  2GRN B;  5J90 A;  3BQO A;  3U66 A;  2I9C A;  4OVU A;  4J8S A;  3AJI A;  2C2L A;  3S2A A;  2WM9 A;  3HVE A;  4M7C A;  2GRO B;  4DUI A;  1W3B A;  4ANV A;  3ZFW A;  2X38 A;  3QJZ A;  3Q5M A;  4BY6 A;  4RG9 A;  2XPY A;  4HVB A;  2WMO A;  3TJP A;  3Q75 A;  3TWS A;  3Q7F A;  4J8D A;  3BUA A;  1OXJ A;  3UT7 A;  3ZYM A;  4RLY A;  1HG5 A;  4MBG A;  4PDX A;  3DPD A;  4I6G A;  4ACL A;  2XEE A;  3VLD A;  5T8I A;  4GYO A;  3B7U X;  3FUH A;  3SHF A;  4LNG A;  2UY1 A;  4BTB A;  1N94 A;  5D66 A;  2XGO A;  1Z3X A;  5JJ6 A;  1TN8 A;  1SZ9 A;  4UI9 C;  3MX3 A;  2P9S G;  5FIN A;  3IEG A;  4LG6 A;  1OT8 A;  4U0S A;  2J4D A;  2X3M A;  2VSN A;  3AG3 E;  2EIN E;  2WXR A;  2YHC A;  1TYQ G;  2H6I A;  4U63 A;  2CHX A;  3G2V A;  1QZ2 A;  3LVQ E;  4DLO A;  3UKU G;  3PZ3 A;  4GTO A;  2F8Y A;  4PS8 A;  3EHM A;  4JC8 A;  4KZ0 A;  2CHZ A;  3DRA A;  2PZI A;  2JLB A;  4CDM A;  4BWR A;  4GZD A;  4AY5 A;  2I1K A;  4C0M A;  5EX3 A;  2MRI A;  3ASH A;  2H6H A;  3UM2 A;  3FUJ A;  3CQC B;  2V4L A;  5HS0 A;  3ZPJ A;  4TRQ A;  1HU3 A;  2RFA A;  4J7W A;  4B0Z A;  4AV7 A;  1PAQ A;  2AVP A;  4H7Y A;  2B0O E;  2QY7 A;  3NB2 A;  1KLX A;  3MKQ A;  2HR2 A;  2WXQ A;  3HHM A;  2VYI A;  1H0A A;  4Q96 A;  2OND A;  1KZP A;  4W9R A;  3D9I A;  4YVO A;  1OWN A;  3D9M A;  3JUE A;  3FU6 A;  2V5F A;  4HLE A;  1NA3 A;  5BNW A;  5C2Y A;  3U64 A;  5G2N A;  2MOW A;  5A7D B;  4EQF A;  1O5M A;  2J49 A;  4GZ5 A;  2WPV A;  3VLE A;  4WNE A;  1H6O A;  4O1P A;  5AQ9 A;  4OAU C;  1HO8 A;  3CV0 A;  3EUV A;  3HRA A;  1DC2 A;  3CLJ A;  2MYO A;  2J8S D;  2BTD A;  1N52 A;  3CEQ A;  4N3C A;  4EZL A;  1Z5S C;  1HG2 A;  3LS8 A;  1S63 A;  5AQ7 A;  1E7V A;  2ZGD A;  4JA9 A;  2XS8 A;  1EYH A;  3TWX A;  5KJL A;  2P9P G;  2ZIR A;  1JWF A;  3CIA A;  4B8A A;  4TUM A;  4U0U A;  1IHG A;  4FUL A;  2XZD G;  1WY6 A;  1E8W A;  1HS6 A;  3V30 A; 
#chains in the Genus database with same CATH homology
 3ASN E;  2EIJ E;  5B1A E;  1OCO E;  1OCC E;  1OCR E;  5B3S E;  3ABL E;  3AG4 E;  3ABK E;  3ASO E;  1V54 E;  2EIM E;  1V55 E;  5B1B E;  3AG2 E;  3X2Q E;  2EIK E;  2DYS E;  2EIL E;  2OCC E;  3WG7 E;  3AG3 E;  2EIN E;  1OCZ E;  2ZXW E;  2DYR E;  5IY5 E;  3AG1 E;  2Y69 E;  3ABM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...