3K9IA

Crystal structure of putative protein binding protein (np_241345.1) from bacillus halodurans at 2.71 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
110
structure length
110
Chain Sequence
AQAVPYYEKAIASGLQGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords BH0479 protein
publication title Crystal structure of Putative protein binding protein (NP_241345.1) from Bacillus halodurans at 2.71 A resolution
rcsb
source organism Bacillus halodurans
total genus 39
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3k9iA01
4GA1A 4F3VA 2XEVA 4GYYA 4J0UA 5KJLA 1XNFA 2AVPA 3CK8A 4BTBA 3KD7A 1HXIA 5LCWC 1OUVA 2L6JA 1B89A 2XGMA 3S7BA 4AY6A 2C0MA 3CVQA 2IF4A 1NZNA 2MHKA 4UQYA 4UQZA 4NRHB 3MV3B 5BT1A 1WM5A 3RO3A 3QOUA 5EX3A 2GW1A 2KATA 4RG9A 4GYOA 5AYWD 4JA9A 3CV0A 1HZ4A 1IYGA 1IHGA 5DIZA 4N3BA 4ABNA 1HH8A 2PQRA 3ZGQA 1WAO1 4O6FA 3JYSA 4J8DA 1A17A 4YNDA 3AS5A 1FCHA 1ZBPA 5KJNA 5JJ7A 4GZ3A 4CGWA 2WPVA 5KJKA 4GYWA 2IFUA 3Q47B 5FJYA 4UQXA 5G04J 4HOUA 4KXKB 3ASFA 4JL0A 3NF1A 4UI9J 3CEQA 2C2LA 3R9AB 4GZ5A 3TG4A 3MEKA 5DBKA 1KLXA 3LKUA 3U3WA 3Q4AB 4HOTA 1NA0A 5KJMA 5D0QD 2Y4UA 3MA5A 3VTYA 3OXGA 1E96B 3LY7A 4GCOA 5HQ8A 3N71A 3TGOA 1ZU2A 2LNIA 5ARFA 2LSVA 4U07A 4AIFA 2UY1B 1NA3A 3GZ1A 3ASHA 3QWVA 2FO7A 4YVQC 4N2QA 5EX0A 2XGSA 4WNFA 2VSYA 4WUYA 4N39A 5CCLA 3UUXA 2HYZA 5JJTA 4B94A 3EDTB 3GYZA 4BT9A 4AY5A 5G05J 3S7DA 3QWWA 3MKRA 1P5QA 4HORA 4U0UA 1TJCA 3MV2B 4N5CA 4XIFA 3Q15A 4JA7A 3CVLA 4NQ0A 4U0SA 4N3CA 2XCCA 2PZIA 3HYMB 3IEGA 2LSUA 5EKQD 5BNWA 1YA0A 3ASGA 2XCBA 4KYOB 4A1SA 4WNGA 2R5SA 2OOEA 1QQEA 4XI9A 5FTPA 3CVNA 3S7JA 2VGYA 4H7XA 4HOQA 2WQHA 5ARGA 5C1DA 5D0OD 2VSNA 2HO1A 1Y8MA 4Y6CA 3CKBA 2BUGA 2P58C 4U04A 2FI7A 2QFCA 2FF4A 3FP3A 4CGVA 4G24A 3KAEA 4UI9K 4XI0A 5FT9A 3Q49B 4CDRA 3AS8A 3RJVA 3PE3A 2J9QA 1ELRA 3QWPA 2PL2A 4LEUA 2XPIA 3Q5MA 2KC7A 4I9CA 3LPZA 4HOSA 3AS4A 2UY1A 4I2ZA 5HI7A 2UWJG 3CK9A 4N2SA 2PQNA 3KS2A 2Q7FA 2Y4TA 2ONDA 2C0LA 2KCLA 4I17A 3E4BA 5G04C 4J8EA 3TAXA 1KT1A 1PC2A 3CVPA 4BWRA 2HR2A 3K9IA 3OXLA 4AM9A 4UI9C 4H7YA 4G26A 4G2VA 4W9RA 2I6HA 2VGXB 3CKCA 5CHEE 3LY9A 2KCVA 3PDNA 2YHCA 3GZ2A 3ZN3A 3RKVA 5CCMA 2V5FA 3ESKA 4I1AA 2DBAA 3RO2A 4KBQA 5A7DB 1W3BA 3WXXA 2VQ2A 4RG6A 3RU0A 3VTXA 4APOA 3ZHEA 5FZQA 3CK7A 4WNEA 1ELWA 4G23A 2FBNA 3QDNA 3UPVA 3LYAA 4IN3B 3QKYA 3LCAA 4I2WA 4BTAA 2YQ8A 3SF4A 5M72A 3TG5A 2XGOA 4YVOA 3ZHEB 4JHRA 4Y6WA 3GW4A 4GA2A 3ZPJA 1KT0A 3ULQA 4J8FA 4GCNA 5BW8C 3URZA 4ME2A 4GZ6A 5FZRA 3FWVA 2E2EA 2FEZA 5LCWJ 3LY8A 4G25A 2KCKA 5G05C 3UQ3A 3RIBA 5JJ6A 4G1TA 4U0ZA 3ZFWA 3PE4A 3ASDA 2JLBA 4I9EA 3U4TA 3O48A 4GA0A 3S7FA 3OXFA 4EQFA 3BEEA 4BT8A 2VYIA 5FZSA 1QZ2A 4GPKA 4WNDA 2NC9A 5A6CA 4N3AA 2VGXA 3FFLA 3SZ7A
chains in the Genus database with same CATH superfamily
4F3VA 3HVEA 3CHQA 3QC1A 2P9SG 4OYSA 3CHMA 4DUIA 3JXJA 5KJLA 2AVPA 4PDXA 4BTBA 2AXUA 1OWPA 3LJNA 5ENOD 1K1AA 1BD8A 5EDSA 5LCWC 5LX8A 1OUVA 2XGMA 3T5VA 3PEVB 1D8EA 5EIBE 3NAWA 3TWXA 4FJYA 2I1JA 1SA4A 1NZNA 5FQ7A 4DX7D 3WG7E 3FDHA 4O60A 3AG3E 4JC8A 4LERA 3TXMA 5FIOA 2LAIA 5EX3A 2ETBA 4LRZA 3TWQA 4U95D 3VLFA 5AYWD 2XENA 2WXPA 1HZ4A 3ZYLA 1IYGA 1HH8A 4AVXA 3D9IA 3JYSA 4EECA 1Q2ZA 1UJJA 3UM2A 3D9JA 2OEVA 2Y0BG 3UKRG 3C3RA 5AQ7A 2LXMA 4CEMA 5CBNA 5KJKA 1N4PA 3Q47B 3FUFA 5KBAA 2XZTG 3ZVVA 5D66A 1SQMA 2A4ZA 3ASFA 3UKUG 3FU0A 3AU4A 3FTZA 2P9LG 4UI9J 3FUIA 4BY6A 5J08A 1GW6A 3HIZA 2B6CA 3D9HA 3MEKA 3ZKJA 5ENQD 2JEKA 3U3WA 1FT1A 4HQDA 1N95A 1U3CA 4AOFA 1NA0A 3UIPC 2WMNA 1H0AA 4NURA 2Y4UA 3MA5A 4I6EA 2M63A 5ENNA 3VTYA 1FPPA 3LY7A 4AJWA 5HQ8A 5ENSD 3RRUA 2XS8A 3JCKC 2LNIA 3EU9A 5EYLA 1SZAA 2CHWA 1EF1C 4HI8A 2DYRE 1X5BA 4DJAA 2CG3A 4AIFA 3V30A 4ATGA 4YVQC 3U66A 4L23A 4WUYA 4N39A 2B0OE 3B13A 1E8WA 4ZFHA 2HYZA 1TEZA 4XEIG 5G05J 3QWWA 3MKRA 3D9KA 4GTTA 4GTPA 4A63B 1XGWA 4GZDA 3L08A 5ENRD 4U63A 3Q73A 2NYJA 3T5XA 4JA7A 3CVLA 4NQ0A 3MJWA 4U0SA 4C0MA 4CT4A 4ILGA 3ABME 3FH7A 2PZIA 4RQIA 5BNWA 4F53A 5AENA 3ASGA 2F8YA 4A1SA 1TN8A 3BQOA 4XI9A 4RVBA 2HM8A 3CVNA 3S7JA 2VGYA 3MGBA 4HOQA 2WQHA 4C9BB 1Z6TA 4Y6CA 4DPRA 2BUGA 2P58C 2P9UG 3TL5A 2QFCA 3JQ0A 3DXMG 4U8VD 3KAEA 4F1SA 1FT2A 2IEJA 5FT9A 2XRYA 4CDRA 2DIWA 3AS8A 3PE3A 3QWPA 4XKBA 4JD2G 4U8YD 3L82A 3UI2A 3JQ1A 2EIJE 3D9MA 4I9CA 1TN7A 2XS1A 4OAUC 4HOSA 3AS4A 3PS6A 3PZ4A 4I2ZA 2OVFA 3CGHA 3CK9A 2X6HA 2QC9A 2Y4TA 2ZISA 4I17A 4J8EA 2WVIA 1PC2A 3DSSA 4BWRA 3KSLA 3K9IA 3OXLA 1NP7A 4HB5A 4PS3A 4W9RA 4GB9A 2I6HA 1N94A 4TRQA 1TNYA 1S63A 3CKCA 4EZLA 3GZ2A 4ZHBA 3ZN3A 3RKVA 1H2VC 3Q7AA 4BX8A 3ESKA 4JW1A 1PAQA 3E30A 4UWFA 1JWFA 3MKQB 3EHRA 4D10C 5A7DB 2R02A 3BG0B 2DZNA 2VQ2A 4A3TA 3CVVA 1MJ0A 3RU0A 5BPPA 4XE0A 3L6AA 2ZXWE 4APOA 3I3NA 3ZHEA 1LD8A 2BF0X 2R2LA 3QDNA 1OWOA 4LNGA 4BTAA 2XGOA 3GW4A 1OWNA 4GA2A 2EIKE 3DSWA 4QQIA 5BW8C 3FTYA 1OT8A 2P9PG 3URZA 2AXVA 4ME2A 4GZ6A 4DX2A 4GZCA 3TWUA 2E2EA 3TWVA 2J4BA 3LY8A 2A5EA 1OWLA 4U0ZA 3NBNB 4JEUA 2JLBA 4I9EA 3O48A 4GA0A 5B1AE 3OXFA 4JXTA 2YINA 3FUDA 4XZ4A 5FZSA 5FQ4A 2NC9A 1ZB1A 3ABLE 1VDYA 2GROB 3PH0C 1IQUA 1E90A 2XEVA 4HBDA 2GRQB 4K5CA 3DSXA 3DWLG 2XPZA 3CK8A 2L9BA 3KD7A 2J8SD 3UX4A 4G8LA 4A55A 1UN8A 2L6JA 1B89A 3ASOE 3SI5A 2H6GA 4I1MA 3FTUA 2JABA 1TN6A 4DX1A 2KXPC 2HE0A 1EYHA 1Z3YA 3MV3B 5BT1A 2CFUA 3RO3A 5JA4D 3DBSA 4U7EB 3QOUA 2J09A 2XRZA 5G2NA 2GRMA 2NSZA 5CMYA 4O1PA 4HFGA 4ACKA 4UUCA 3CV0A 5DIZA 3D9LA 4N3BA 1INZA 2XQ0A 2R17C 4FP7A 4GMRA 1OY3D 4L2YA 1WAO1 2IU1A 4O6FA 4J8DA 4YNDA 4KZ0A 2E0IA 5KJNA 5JJ7A 3Q78A 3HXCA 1YMPA 2QY7A 3CQGB 2CFZA 4GYWA 2IFUA 4M7CA 5FJYA 3B7RL 5G04J 3CVYA 1TJFA 1YCSB 4KXKB 3CVXA 3ZEFA 4JL0A 4NIKA 3ZXSA 4DK5A 2IOLA 3BG1B 1Y6IA 1JUQA 3UMVA 2C2LA 2WXGA 3FU5A 1UJKA 4E6HA 2F37A 1H6PA 5BV1A 3ZXPA 4LUNU 2XEHA 1AWCB 3FUMA 3UT8A 3QJZA 5KJMA 1WDYA 2WXQA 4B89A 5B3SE 4JEHA 5AARA 4CCAA 4GCOA 4CZ2D 3Q7FA 2BKKB 3HDXA 2YNQA 3N71A 4Q69A 3APFA 4YDEA 3FTXA 1LTXA 1SZ9A 3FEYA 1LD7A 2LSVA 3MZLB 4G11A 5AQAA 5IY5E 5FWQA 1WG0A 1E8ZA 4A3VA 3AG2E 3PZDA 5EX0A 3V79K 3U9WA 2XGSA 2FULA 4LNBA 1N0RA 1X81A 3PEUB 3W9GA 1HS6A 3G2VA 4J8YA 3EDTB 4AY5A 4F1PA 3S7DA 1HF8A 2PM6A 3RSEG 1O1TA 4HORA 4OVVA 4AP2A 1K3ZD 3B7BA 1TNUA 1LF8A 1O1RA 1V55E 2VTBA 4DRXE 1OCCE 4K03A 4J6IA 4N3CA 1HG5A 2XCCA 3RAUA 1DVPA 3CLJA 1YA0A 2WXLA 2XPYA 2XCBA 4CDNA 1N4SA 5KNHD 4BX9A 3UINC 4FA6A 5FTPA 4QFVA 4H7XA 5D0OD 2HO1A 4FHJA 3ESLA 4U04A 3DPYA 2RFMA 4UWGA 4B93B 2ILRA 4CGVA 4G24A 1HO8A 3SY2A 1EDUA 3CHRA 1BU9A 3Q9NC 3UT4A 3ZYMA 4LEUA 3FUJA 3ULEG 3FULA 1UG3A 3Q9UC 3LPZA 2J07A 2UY1A 5KCMA 2ZU6B 2OCCE 2UWJG 2BTDA 2KZTB 4CT0A 5CEAA 1KT1A 2H6FA 4DLOA 1UN9A 3CSTA 2XZDG 2I2OA 4UI9C 3DSVA 3MKQA 5AJLA 2VJ8A 3ZUVB 1HX8A 4G26A 4G2VA 4L2LA 3QARA 4Q94A 4JPSA 3AAAC 5CHEE 3UM0A 3P2BA 3PDNA 3DEPA 5CCMA 2BEDA 4BESA 1QNFA 2ETAA 5CERB 4G8KA 3WXXA 1IHBA 3LDZA 3T8KA 4JB8P 4FADA 4YDWA 3ZIMA 3F6QA 2FO1E 2WXFA 3VTXA 3C3QA 4L7TA 2MYOA 4BEPA 5LP0A 1N4RA 2V4LA 4ANXA 4C48B 3UPVA 3LCAA 4I2WA 3UT7A 4HI9A 1IKND 3LJ3A 2WXRA 4IULA 3SF4A 4Z68A 3PRZA 5T3RA 3O4ZA 1S0PA 4AXHA 2OEWA 1E7VA 5HRYA 4ILIA 2CG2A 2NXPA 4KT6B 4BFRA 3FWVA 2PM7A 5EIDA 4G25A 2KCKA 4ANWA 3T9KA 5G05C 3FTSA 2X38A 4HNAD 5JJ6A 3R9MA 3ZFWA 1JCQA 1Z3XA 5HKPA 4EHMA 4BETA 3BEEA 4BT8A 3Q79A 2VYIA 3NZSA 4FU3A 1OCZE 3IV0A 4N3AA 2VGXA 2L0TB 4ANVA 2VSOE 3FU6A 1H2TC 4TXQA 1XNFA 3DEOA 3HXDA 3PNLB 3FU3A 3CSFA 3JUEA 5EYPF 5ANRA 4AEZC 4F7AA 3L22A 3S7BA 4AY6A 2RD0A 3PVLA 3CVQA 3AJIA 4GTVA 2X6KA 4DX5D 2MHKA 4UQYA 1L5JA 5ITZF 4UQZA 2BKGA 3SFXA 4HS2A 1HE8A 3SBSA 2WXNA 3CHPA 1WM5A 2V4HC 4N5QA 4NACA 1HU3A 2ZIRA 2GW1A 3FUKA 2KATA 4RG9A 3LVRE 3JUIA 1O1SA 1IHGA 2WXHA 4ABNA 4E85A 4DI4A 2ETCA 4EZJA 5A23A 4B0ZA 2PQRA 3ZGQA 4ANUA 3DRAA 3ENEA 2Y1LE 3RK6A 4YDOA 4C0EA 1FCHA 3JXIA 2Y69E 4GZ3A 3LEWA 5KWDA 1JCRA 2IQCA 3UTMA 1U2VG 3TWTA 2P9IG 3NF1A 4HRNA 1UW4B 3APCA 1YYHA 4GZ5A 5B1BE 3TG4A 3FY4A 3DSTA 2AW6A 5DBKA 1KLXA 3LKUA 1EPUA 3E37A 2P2CP 1Z5SC 3Q4AB 1HG2A 3E32A 4PS8A 4HOTA 5AIJA 1MYOA 1HFAA 1JCSA 3FUEA 3PZ2A 3APDA 1QYMA 3OAWA 2EINE 3SQVA 4U8HA 3ONLA 2V8SE 4WWOA 3TGOA 3MYVA 4MKTA 3D9NA 4DLQA 3C72A 3L16A 4CRWA 4GTOA 4K5AB 5HS0A 4V3IA 5FINA 1S70B 1OXJA 3NZUA 5D2MC 2QZAA 4U07A 4HLEA 4LCTA 1E8XA 4HVBA 3BU8A 1NA3A 3C5RA 3C98A 4L1BA 3GZ1A 3G2SA 4EBAA 4F6RD 3ASHA 3IBEA 2FO7A 4B8AA 2WMOA 2VSYA 1S64A 5CCLA 4YDYA 3UUXA 1O5MA 2R59A 3GYZA 2IY0C 4BT9A 2V5QC 2CHZA 3D9OA 1P5QA 2V0PA 4HLLA 3MV2B 5ENPD 4N5CA 2RG8A 4XIFA 5G55A 3J5QB 2LXLA 3L54A 3EIQC 5LOZA 3SO8A 4HRLA 3HYMB 3EU5A 1D9SA 4KYOB 3B7SA 1MX4A 3FH5A 4WNGA 2J4DA 2R5SA 3UIOC 3TXNA 5T4YA 3ABKE 4GTMA 4GTRA 4FHKA 5ARGA 2VSNA 1Y8MA 3NOGD 4PUCA 3CKBA 3D9PA 4J8SA 1RZ4A 4JVSA 2GRNB 3EHMA 5AAOA 2L0IA 4GTQA 3G2WA 2GRLA 3CVWA 4B8CB 2FF4A 2IONA 4MS6A 1NFIE 3IKOB 2AJAA 4PS7A 3Q49B 4M3OA 3RJVA 1ELRA 3TWWA 4KZCA 2PL2A 3PUKA 2XPIA 5EN5D 4FLBA 2AXZA 3AG4E 4R7LA 3ML8A 4CYMD 4RLYA 5ANLA 3ASNE 4ACLA 2IO3C 4JHJA 2VGEA 3ZW3A 2PQNA 3LS8A 2C0LA 2EQXA 5G04C 2X6IA 3NB2A 5BXOA 3NQPA 2X3MA 2A5UA 3FH8A 2HR2A 4AM9A 3B7TA 4H7YA 3B7UX 5AQ9A 5JHBA 2WB2A 2WXMA 4FULA 3LY9A 3BUAA 2RFAA 2V5FA 4Q96A 2DBAA 2WQ6A 3FTVA 4WAFA 3RO2A 4KBQA 1W3BA 5AQBA 2OV8A 3T8MA 1N54A 3TJPA 2PNNA 4BERA 3KEZA 3V2OA 2H6HA 3CK7A 4WNEA 1OWMA 3FUHA 2AWIA 4G23A 2FBNA 4IN3B 1UOHA 3QKYA 1TNBA 3PUJA 2KBXA 5M72A 3TG5A 3EHQA 4JHRA 4A1GA 3ZPJA 1KT0A 3CHOA 1H19A 4J8FA 3SGHA 4GCNA 3J5PA 4KVOA 3CVUA 1TNZA 5FZRA 1QBQA 5KNGA 4UWKA 4EPZA 2FEZA 3FUNA 3SD5A 1N11A 4KMOA 2IO2C 1NL4A 3UQ3A 3RIBA 1BPOA 4I6JA 3ISMC 5AJDA 4XKCA 3U64A 3ASDA 3U4TA 4GAAA 4DX6D 2ZGDA 3UM1A 3S7FA 2WXIA 3B95A 2I1KA 1KPSB 4TV3A 3E34A 4GPKA 4HRMB 4WNDA 4K0RA 3ZYKA 1JPLA 2IJGX 1N0QA 5BV0A 3I5PA 4GA1A 1K8KG 1TNOA 2LUHA 4ATZD 3VLDA 4GYYA 4J0UA 2QYJA 4FLHA 1HXIA 2DYSE 2GRRB 5CRUA 1FVFA 3HVEB 2YHEA 4I1OB 3CHSA 2C0MA 2IF4A 3EHNA 3QAQA 2F0YA 4IRUA 4GTSA 3GZSA 4NRHB 3RRMB 1K1BA 1DNPA 3CQCB 1N52A 4GYOA 4JA9A 2DWZA 2I9CA 3IHYA 2VSXE 1FVHA 1U3DA 1H6KA 4OVUA 1BI8B 1A17A 4APFA 3AS5A 1ZBPA 1H6OA 1OCRE 1DC2A 3SFZA 4CGWA 4WWPA 3EIJA 2VTBB 2WPVA 2DVWA 4UQXA 1RW2A 3D3MA 4HOUA 3CIAA 2XEEA 3ZRHA 2GRPB 3DXKG 4X8QA 4LG6A 2MOWA 3QNKA 3CEQA 2WXOA 4TXRA 3SBTB 3R9AB 3V31A 3W9FA 2KM4A 4WWNA 2MRIA 4L9PA 2Y3AA 3V2XA 1E8YA 1WY6A 4BSZB 5H7PA 5D0QD 2R05A 1MHQA 3SHFA 2LO6A 4P29A 3OXGA 1E96B 5AN8A 4MLPA 3PZ3A 4K5BA 4MBGA 3MX3A 3HXFA 1IQRA 4I43A 5J90A 3HG0D 3DSUA 1A5EA 3ONKA 3C3OA 1ZU2A 4AV7A 4RSYA 5CBOA 5ARFA 4XX5A 4BSXA 3PZ1A 1H2UA 1KZOA 2P9KG 2UY1B 4HXIA 2L6BA 1MX6A 4EZKA 4MRUA 3QWVA 4N2QA 4WNFA 1G3NB 3G2TA 4GU5A 1BI7B 4FJZA 5JJTA 4B94A 1SA5A 1D8DA 5FQ6A 2DZOA 4TUUA 1MQSA 2WQ7A 4U0UA 3FHEA 1TR4A 1TJCA 4GPMA 4EBAG 2QYUA 3Q15A 3HXBA 1AP7A 5CECB 4GMJA 2H6IA 4U96D 3IEGA 2GGFA 2LSUA 2P9NG 5EKQD 1N9AA 3UM3A 3KSQA 4JHKA 5CEDB 3PNTB 2LAHA 2OOEA 3QB2A 1QQEA 2CHXA 1PY1A 4J7WA 4TUMA 4URKA 3HXEA 1NI1A 5JMND 5C1DA 2X6JA 4PH4B 3L17A 5EILA 3SFYA 5LFAA 5E76A 3L9TA 2FI7A 3IXEA 3L13A 3LVQE 4TXPA 3FP3A 4IYPA 1ELKA 4LSZE 3DPDA 1KZPA 4UI9K 4XI0A 3X2QE 3IHVA 2J9QA 4UWHA 3SNXA 2DCPA 1DCQA 3Q5MA 3HHMA 2KC7A 3ZNGA 5HI7A 4UWLA 4N2SA 5BUZA 2WM9A 3KS2A 2Q7FA 3P1UA 2ONDA 2KCLA 3E4BA 4DI3A 3TAXA 3MCXA 2J49A 3CVPA 1MZCA 3NOCD 1TYQG 1N4QA 1IXVA 3QK0A 4ILHB 1JWGA 2R03A 4LNUD 2J08A 4I6GA 2VGXB 3G2UA 3R7QA 3R7RA 2KCVA 2YHCA 3VLEA 4I1AA 3Q75A 3FTWA 2ZGGA 3FEXA 5ENTD 3UXGA 4RG6A 5CRVA 1E7UA 5T8IA 3TWSA 4O1OA 5FZQA 1ELWA 2IOSA 3AG1E 1DCEA 3RRNB 3LXUX 3LYAA 3OTNA 1SW6A 4KVMA 5BXUA 3ZU7B 4GMLA 3PREA 2YQ8A 2WXJA 4YVOA 3ZHEB 3TWRA 4Y6WA 5E75A 4FC8A 3EUVA 2XHEA 3ML9A 3ULQA 4JZYA 4OAVB 3I4GA 2OVBA 3KEAA 3E33A 2EIME 3EJNA 1BLXB 5FQ8A 5LCWJ 3ULYA 5C2YA 2WXKA 2F8XK 4G1TA 3CR3A 2EILE 3PE4A 3HRAA 2KZTA 3ZYQA 1MX2A 2X6FA 4EQFA 4CDMA 1SVXA 5JHAA 3S2AA 1QZ2A 1OCOE 3I4RB 3AU5A 5A6CA 5CMWA 1V54E 2RKKA 3FFLA 3SZ7A
chains in the Genus database with same CATH topology
3I5PA 3PH0C 1IQUA 4GA1A 4F3VA 1E90A 2L0TB 3HVEA 3CHQA 3QC1A 2XEVA 3VLDA 4ANVA 4GYYA 4OYSA 4J0UA 3CHMA 2VSOE 3FU6A 1H2TC 5KJLA 1XNFA 2XPZA 2AVPA 4FLHA 3CK8A 4PDXA 3PNLB 2L9BA 2AXUA 4BTBA 3KD7A 3FU3A 1OWPA 1HXIA 3CSFA 3UX4A 5ANRA 4A55A 5EDSA 4AEZC 5LCWC 5LX8A 1OUVA 1UN8A 2L6JA 1B89A 1FVFA 2XGMA 3HVEB 4F7AA 3L22A 3SI5A 3T5VA 2YHEA 3S7BA 4I1OB 4AY6A 3PEVB 2RD0A 4I1MA 3FTUA 3CHSA 4FJYA 2C0MA 2I1JA 3PVLA 3CVQA 2IF4A 3EHNA 3QAQA 1NZNA 2X6KA 2MHKA 4IRUA 4UQYA 5FQ7A 1L5JA 4UQZA 3FDHA 1EYHA 3GZSA 4NRHB 1Z3YA 1HE8A 4HS2A 4JC8A 3RRMB 3SBSA 2WXNA 3MV3B 5BT1A 3CHPA 1WM5A 2CFUA 4LERA 3RO3A 3TXMA 1DNPA 3DBSA 4NACA 3QOUA 1HU3A 2J09A 2LAIA 2XRZA 3CQCB 5G2NA 5EX3A 2GW1A 3FUKA 1N52A 4LRZA 2KATA 4RG9A 2GRMA 2NSZA 3LVRE 4GYOA 3JUIA 5CMYA 4HFGA 3VLFA 4ACKA 5AYWD 4JA9A 2WXPA 3CV0A 1HZ4A 3ZYLA 1IYGA 1IHGA 2I9CA 3D9LA 4N3BA 3IHYA 2WXHA 5DIZA 2XQ0A 4ABNA 4DI4A 2R17C 4E85A 1INZA 4FP7A 2VSXE 1FVHA 1HH8A 1U3DA 4EZJA 5A23A 4AVXA 1H6KA 4B0ZA 2PQRA 3ZGQA 4L2YA 4ANUA 1WAO1 2IU1A 3D9IA 4O6FA 4OVUA 3JYSA 4J8DA 1A17A 3ENEA 3RK6A 4YNDA 4KZ0A 4APFA 2E0IA 4EECA 3AS5A 1UJJA 4C0EA 1FCHA 3D9JA 1ZBPA 5KJNA 5JJ7A 4GZ3A 3SFZA 4CGWA 4WWPA 3LEWA 3EIJA 2VTBB 2QY7A 2IQCA 3CQGB 2WPVA 4CEMA 5KJKA 2CFZA 4GYWA 2IFUA 3Q47B 3FUFA 5FJYA 3B7RL 4UQXA 5G04J 3CVYA 1TJFA 3D3MA 4HOUA 4KXKB 3ZVVA 3CIAA 3CVXA 1SQMA 3ZRHA 3ZEFA 2A4ZA 3ASFA 4JL0A 3ZXSA 3FU0A 3NF1A 3AU4A 2IOLA 4DK5A 3BG1B 3FTZA 1Y6IA 2MOWA 3QNKA 1UW4B 4UI9J 3CEQA 2WXOA 3APCA 3FUIA 1JUQA 3UMVA 4BY6A 2C2LA 3SBTB 3R9AB 2WXGA 4GZ5A 5J08A 1GW6A 3FU5A 3TG4A 3FY4A 3HIZA 2KM4A 1UJKA 4E6HA 2AW6A 3MEKA 2MRIA 4WWNA 1KLXA 3LKUA 5DBKA 2JEKA 1EPUA 3U3WA 5BV1A 2Y3AA 1U3CA 4LUNU 3Q4AB 1E8YA 1WY6A 3FUMA 1HG2A 4PS8A 4AOFA 4HOTA 3UT8A 3QJZA 1NA0A 5AIJA 5KJMA 5D0QD 2WMNA 1H0AA 1MHQA 2WXQA 2Y4UA 4NURA 3SHFA 2LO6A 1HFAA 3MA5A 4B89A 4I6EA 2M63A 3FUEA 4JEHA 3APDA 4P29A 5ENNA 3VTYA 3OXGA 1E96B 4CCAA 3LY7A 4GCOA 3OAWA 4MLPA 4AJWA 4U8HA 3MX3A 3ONLA 1IQRA 3HDXA 5HQ8A 4I43A 5J90A 2V8SE 2YNQA 3N71A 3RRUA 4WWOA 3TGOA 3MYVA 4MKTA 3D9NA 3ONKA 3JCKC 1ZU2A 3APFA 4DLQA 4Q69A 4AV7A 4RSYA 3FTXA 2LNIA 3L16A 4CRWA 1SZAA 2CHWA 5ARFA 4XX5A 1EF1C 4V3IA 1SZ9A 3FEYA 4BSXA 2LSVA 3MZLB 3NZUA 1H2UA 1X5BA 4G11A 4U07A 4HLEA 4LCTA 1E8XA 4DJAA 4HVBA 2CG3A 4AIFA 5FWQA 2UY1B 4HXIA 1E8ZA 1NA3A 3C98A 4A3VA 4L1BA 3GZ1A 3G2SA 4EBAA 3ASHA 3IBEA 4ATGA 4EZKA 4MRUA 3QWVA 2FO7A 4YVQC 4N2QA 3U66A 3PZDA 5EX0A 4B8AA 3U9WA 2XGSA 4WNFA 2FULA 2WMOA 4L23A 3G2TA 4GU5A 2VSYA 3PEUB 4WUYA 4N39A 5CCLA 3UUXA 3B13A 1E8WA 2HYZA 1TEZA 4FJZA 1HS6A 5JJTA 3G2VA 4B94A 2R59A 3EDTB 3GYZA 4BT9A 4AY5A 2CHZA 3D9OA 5G05J 3S7DA 3QWWA 1HF8A 3MKRA 5FQ6A 3D9KA 4TUUA 1MQSA 2PM6A 1P5QA 2WQ7A 4HORA 4U0UA 2V0PA 3FHEA 4OVVA 4AP2A 1TJCA 1XGWA 3MV2B 4GZDA 3L08A 2RG8A 4N5CA 4XIFA 5G55A 4EBAG 4U63A 3L54A 3T5XA 3Q15A 4JA7A 1LF8A 2VTBA 3CVLA 3EIQC 4K03A 4J6IA 5LOZA 4GMJA 4NQ0A 3MJWA 4U0SA 4C0MA 4CT4A 4N3CA 1HG5A 2XCCA 4ILGA 3FH7A 2PZIA 3HYMB 3IEGA 2GGFA 2LSUA 1DVPA 5EKQD 3CLJA 5BNWA 1YA0A 4JHKA 2WXLA 4F53A 5AENA 3ASGA 2XPYA 2XCBA 4KYOB 3B7SA 4A1SA 3FH5A 3PNTB 2LAHA 4CDNA 4WNGA 2J4DA 2R5SA 2OOEA 3TXNA 3QB2A 1QQEA 2CHXA 5T4YA 1PY1A 4BX9A 4XI9A 4RVBA 4FA6A 4URKA 5FTPA 2HM8A 3CVNA 3S7JA 2VGYA 4QFVA 4H7XA 3MGBA 4HOQA 2WQHA 4FHKA 4C9BB 5ARGA 1Z6TA 5C1DA 5D0OD 2VSNA 2HO1A 1Y8MA 2X6JA 4PUCA 4Y6CA 4FHJA 4PH4B 3L17A 3CKBA 3D9PA 4DPRA 5LFAA 2BUGA 3ESLA 4J8SA 5E76A 2P58C 4U04A 4JVSA 2FI7A 3EHMA 3TL5A 2L0IA 3L13A 3LVQE 3G2WA 2GRLA 3CVWA 2QFCA 3JQ0A 4B8CB 4UWGA 2FF4A 2IONA 2ILRA 3FP3A 4IYPA 1ELKA 4CGVA 4G24A 1HO8A 4MS6A 3IKOB 3DPDA 3KAEA 4F1SA 4UI9K 4XI0A 1EDUA 4PS7A 3IHVA 5FT9A 2XRYA 3Q49B 4CDRA 3CHRA 4M3OA 2DIWA 3AS8A 3RJVA 3UT4A 3ZYMA 3PE3A 2J9QA 1ELRA 3QWPA 4UWHA 3SNXA 4KZCA 2PL2A 3PUKA 2DCPA 3FUJA 4LEUA 4XKBA 2XPIA 3Q5MA 3FULA 4FLBA 2AXZA 3HHMA 2KC7A 3JQ1A 4R7LA 1UG3A 3D9MA 3ML8A 4I9CA 3LPZA 5ANLA 2J07A 4ACLA 4HOSA 3AS4A 3PS6A 2UY1A 5KCMA 2ZU6B 4JHJA 4I2ZA 5HI7A 4UWLA 2OVFA 2UWJG 2BTDA 3CGHA 3CK9A 4N2SA 2KZTB 3ZW3A 2PQNA 5BUZA 3LS8A 2WM9A 2X6HA 3KS2A 4CT0A 2Q7FA 2Y4TA 3P1UA 2ONDA 2C0LA 2KCLA 4I17A 3E4BA 2EQXA 5G04C 2X6IA 4J8EA 4DI3A 3NQPA 2X3MA 3MCXA 1KT1A 2J49A 3TAXA 2A5UA 2WVIA 1PC2A 4DLOA 3CVPA 4BWRA 3FH8A 1UN9A 2HR2A 3K9IA 3OXLA 3CSTA 4AM9A 1NP7A 3QK0A 2I2OA 4UI9C 3B7TA 3MKQA 4H7YA 5AJLA 2VJ8A 3B7UX 1HX8A 4G26A 1JWGA 4G2VA 4ILHB 4PS3A 4W9RA 4GB9A 2I6HA 4TRQA 2J08A 3QARA 4I6GA 4L2LA 5JHBA 2VGXB 3G2UA 3CKCA 4Q94A 4JPSA 2WB2A 3R7QA 4EZLA 2WXMA 5CHEE 3R7RA 3P2BA 4FULA 3LY9A 2KCVA 3PDNA 2YHCA 3GZ2A 3ZN3A 3RKVA 1H2VC 5CCMA 4BX8A 2V5FA 3ESKA 3VLEA 4JW1A 4Q96A 2DBAA 1PAQA 4I1AA 1QNFA 2WQ6A 4UWFA 3FTVA 4WAFA 3RO2A 1JWFA 3MKQB 4KBQA 4D10C 5A7DB 1W3BA 3WXXA 3BG0B 2OV8A 3FTWA 3T8MA 3LDZA 3FEXA 1N54A 2VQ2A 4FADA 4A3TA 3CVVA 3TJPA 4RG6A 3RU0A 3ZIMA 5BPPA 2WXFA 1E7UA 4XE0A 3L6AA 5T8IA 3KEZA 3VTXA 4APOA 3I3NA 3ZHEA 5FZQA 3CK7A 4WNEA 4L7TA 2BF0X 1OWMA 3FUHA 1ELWA 5LP0A 2IOSA 2AWIA 2V4LA 4G23A 2FBNA 3QDNA 4ANXA 3RRNB 3LXUX 3UPVA 3LYAA 3OTNA 4IN3B 4KVMA 1OWOA 3QKYA 3LCAA 4I2WA 3UT7A 4BTAA 4GMLA 3LJ3A 3PUJA 3PREA 2WXRA 4IULA 2YQ8A 3SF4A 5M72A 3TG5A 2XGOA 2WXJA 4YVOA 3ZHEB 4JHRA 4Y6WA 5E75A 3GW4A 3PRZA 4FC8A 5T3RA 3O4ZA 1OWNA 4GA2A 4A1GA 2XHEA 1S0PA 4AXHA 3ZPJA 3ML9A 1KT0A 3CHOA 1E7VA 1H19A 3ULQA 4ILIA 4JZYA 4J8FA 3SGHA 2CG2A 4GCNA 5BW8C 3FTYA 3I4GA 4KVOA 2OVBA 3URZA 2NXPA 2AXVA 4ME2A 4GZ6A 4KT6B 3CVUA 4BFRA 5FZRA 3FWVA 4GZCA 2PM7A 4UWKA 4EPZA 2E2EA 2FEZA 3FUNA 3SD5A 3EJNA 5FQ8A 2J4BA 5LCWJ 3LY8A 4G25A 2KCKA 4ANWA 5G05C 4KMOA 3FTSA 3UQ3A 1OWLA 2X38A 3RIBA 5C2YA 2WXKA 1BPOA 5JJ6A 4G1TA 4I6JA 3CR3A 4U0ZA 3ZFWA 5AJDA 4XKCA 3U64A 1Z3XA 3PE4A 3ASDA 2KZTA 4JEUA 2JLBA 4I9EA 3ZYQA 3U4TA 4GAAA 2X6FA 3O48A 4GA0A 3S7FA 3OXFA 4JXTA 4EQFA 3BEEA 2YINA 3FUDA 4BT8A 4CDMA 2WXIA 2I1KA 5JHAA 4TV3A 3S2AA 2VYIA 3NZSA 4XZ4A 5FZSA 1QZ2A 4GPKA 3I4RB 5FQ4A 4FU3A 4WNDA 4K0RA 2NC9A 3AU5A 3IV0A 3ZYKA 5A6CA 4N3AA 1JPLA 5CMWA 2IJGX 2VGXA 3FFLA 3SZ7A 5BV0A 1VDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GA1 A;  4F3V A;  2XEV A;  4GYY A;  4J0U A;  5KJL A;  1XNF A;  2AVP A;  3CK8 A;  4BTB A;  3KD7 A;  1HXI A;  5LCW C;  1OUV A;  2L6J A;  1B89 A;  2XGM A;  3S7B A;  4AY6 A;  2C0M A;  3CVQ A;  2IF4 A;  1NZN A;  2MHK A;  4UQY A;  4UQZ A;  4NRH B;  3MV3 B;  5BT1 A;  1WM5 A;  3RO3 A;  3QOU A;  5EX3 A;  2GW1 A;  2KAT A;  4RG9 A;  4GYO A;  5AYW D;  4JA9 A;  3CV0 A;  1HZ4 A;  1IYG A;  1IHG A;  5DIZ A;  4N3B A;  4ABN A;  1HH8 A;  2PQR A;  3ZGQ A;  1WAO 1;  4O6F A;  3JYS A;  4J8D A;  1A17 A;  4YND A;  3AS5 A;  1FCH A;  1ZBP A;  5KJN A;  5JJ7 A;  4GZ3 A;  4CGW A;  2WPV A;  5KJK A;  4GYW A;  2IFU A;  3Q47 B;  5FJY A;  4UQX A;  5G04 J;  4HOU A;  4KXK B;  3ASF A;  4JL0 A;  3NF1 A;  4UI9 J;  3CEQ A;  2C2L A;  3R9A B;  4GZ5 A;  3TG4 A;  3MEK A;  5DBK A;  1KLX A;  3LKU A;  3U3W A;  3Q4A B;  4HOT A;  1NA0 A;  5KJM A;  5D0Q D;  2Y4U A;  3MA5 A;  3VTY A;  3OXG A;  1E96 B;  3LY7 A;  4GCO A;  5HQ8 A;  3N71 A;  3TGO A;  1ZU2 A;  2LNI A;  5ARF A;  2LSV A;  4U07 A;  4AIF A;  2UY1 B;  1NA3 A;  3GZ1 A;  3ASH A;  3QWV A;  2FO7 A;  4YVQ C;  4N2Q A;  5EX0 A;  2XGS A;  4WNF A;  2VSY A;  4WUY A;  4N39 A;  5CCL A;  3UUX A;  2HYZ A;  5JJT A;  4B94 A;  3EDT B;  3GYZ A;  4BT9 A;  4AY5 A;  5G05 J;  3S7D A;  3QWW A;  3MKR A;  1P5Q A;  4HOR A;  4U0U A;  1TJC A;  3MV2 B;  4N5C A;  4XIF A;  3Q15 A;  4JA7 A;  3CVL A;  4NQ0 A;  4U0S A;  4N3C A;  2XCC A;  2PZI A;  3HYM B;  3IEG A;  2LSU A;  5EKQ D;  5BNW A;  1YA0 A;  3ASG A;  2XCB A;  4KYO B;  4A1S A;  4WNG A;  2R5S A;  2OOE A;  1QQE A;  4XI9 A;  5FTP A;  3CVN A;  3S7J A;  2VGY A;  4H7X A;  4HOQ A;  2WQH A;  5ARG A;  5C1D A;  5D0O D;  2VSN A;  2HO1 A;  1Y8M A;  4Y6C A;  3CKB A;  2BUG A;  2P58 C;  4U04 A;  2FI7 A;  2QFC A;  2FF4 A;  3FP3 A;  4CGV A;  4G24 A;  3KAE A;  4UI9 K;  4XI0 A;  5FT9 A;  3Q49 B;  4CDR A;  3AS8 A;  3RJV A;  3PE3 A;  2J9Q A;  1ELR A;  3QWP A;  2PL2 A;  4LEU A;  2XPI A;  3Q5M A;  2KC7 A;  4I9C A;  3LPZ A;  4HOS A;  3AS4 A;  2UY1 A;  4I2Z A;  5HI7 A;  2UWJ G;  3CK9 A;  4N2S A;  2PQN A;  3KS2 A;  2Q7F A;  2Y4T A;  2OND A;  2C0L A;  2KCL A;  4I17 A;  3E4B A;  5G04 C;  4J8E A;  3TAX A;  1KT1 A;  1PC2 A;  3CVP A;  4BWR A;  2HR2 A;  3K9I A;  3OXL A;  4AM9 A;  4UI9 C;  4H7Y A;  4G26 A;  4G2V A;  4W9R A;  2I6H A;  2VGX B;  3CKC A;  5CHE E;  3LY9 A;  2KCV A;  3PDN A;  2YHC A;  3GZ2 A;  3ZN3 A;  3RKV A;  5CCM A;  2V5F A;  3ESK A;  4I1A A;  2DBA A;  3RO2 A;  4KBQ A;  5A7D B;  1W3B A;  3WXX A;  2VQ2 A;  4RG6 A;  3RU0 A;  3VTX A;  4APO A;  3ZHE A;  5FZQ A;  3CK7 A;  4WNE A;  1ELW A;  4G23 A;  2FBN A;  3QDN A;  3UPV A;  3LYA A;  4IN3 B;  3QKY A;  3LCA A;  4I2W A;  4BTA A;  2YQ8 A;  3SF4 A;  5M72 A;  3TG5 A;  2XGO A;  4YVO A;  3ZHE B;  4JHR A;  4Y6W A;  3GW4 A;  4GA2 A;  3ZPJ A;  1KT0 A;  3ULQ A;  4J8F A;  4GCN A;  5BW8 C;  3URZ A;  4ME2 A;  4GZ6 A;  5FZR A;  3FWV A;  2E2E A;  2FEZ A;  5LCW J;  3LY8 A;  4G25 A;  2KCK A;  5G05 C;  3UQ3 A;  3RIB A;  5JJ6 A;  4G1T A;  4U0Z A;  3ZFW A;  3PE4 A;  3ASD A;  2JLB A;  4I9E A;  3U4T A;  3O48 A;  4GA0 A;  3S7F A;  3OXF A;  4EQF A;  3BEE A;  4BT8 A;  2VYI A;  5FZS A;  1QZ2 A;  4GPK A;  4WND A;  2NC9 A;  5A6C A;  4N3A A;  2VGX A;  3FFL A;  3SZ7 A; 
#chains in the Genus database with same CATH topology
 4F3V A;  3HVE A;  3CHQ A;  3QC1 A;  2P9S G;  4OYS A;  3CHM A;  4DUI A;  3JXJ A;  5KJL A;  2AVP A;  4PDX A;  4BTB A;  2AXU A;  1OWP A;  3LJN A;  5ENO D;  1K1A A;  1BD8 A;  5EDS A;  5LCW C;  5LX8 A;  1OUV A;  2XGM A;  3T5V A;  3PEV B;  1D8E A;  5EIB E;  3NAW A;  3TWX A;  4FJY A;  2I1J A;  1SA4 A;  1NZN A;  5FQ7 A;  4DX7 D;  3WG7 E;  3FDH A;  4O60 A;  3AG3 E;  4JC8 A;  4LER A;  3TXM A;  5FIO A;  2LAI A;  5EX3 A;  2ETB A;  4LRZ A;  3TWQ A;  4U95 D;  3VLF A;  5AYW D;  2XEN A;  2WXP A;  1HZ4 A;  3ZYL A;  1IYG A;  1HH8 A;  4AVX A;  3D9I A;  3JYS A;  4EEC A;  1Q2Z A;  1UJJ A;  3UM2 A;  3D9J A;  2OEV A;  2Y0B G;  3UKR G;  3C3R A;  5AQ7 A;  2LXM A;  4CEM A;  5CBN A;  5KJK A;  1N4P A;  3Q47 B;  3FUF A;  5KBA A;  2XZT G;  3ZVV A;  5D66 A;  1SQM A;  2A4Z A;  3ASF A;  3UKU G;  3FU0 A;  3AU4 A;  3FTZ A;  2P9L G;  4UI9 J;  3FUI A;  4BY6 A;  5J08 A;  1GW6 A;  3HIZ A;  2B6C A;  3D9H A;  3MEK A;  3ZKJ A;  5ENQ D;  2JEK A;  3U3W A;  1FT1 A;  4HQD A;  1N95 A;  1U3C A;  4AOF A;  1NA0 A;  3UIP C;  2WMN A;  1H0A A;  4NUR A;  2Y4U A;  3MA5 A;  4I6E A;  2M63 A;  5ENN A;  3VTY A;  1FPP A;  3LY7 A;  4AJW A;  5HQ8 A;  5ENS D;  3RRU A;  2XS8 A;  3JCK C;  2LNI A;  3EU9 A;  5EYL A;  1SZA A;  2CHW A;  1EF1 C;  4HI8 A;  2DYR E;  1X5B A;  4DJA A;  2CG3 A;  4AIF A;  3V30 A;  4ATG A;  4YVQ C;  3U66 A;  4L23 A;  4WUY A;  4N39 A;  2B0O E;  3B13 A;  1E8W A;  4ZFH A;  2HYZ A;  1TEZ A;  4XEI G;  5G05 J;  3QWW A;  3MKR A;  3D9K A;  4GTT A;  4GTP A;  4A63 B;  1XGW A;  4GZD A;  3L08 A;  5ENR D;  4U63 A;  3Q73 A;  2NYJ A;  3T5X A;  4JA7 A;  3CVL A;  4NQ0 A;  3MJW A;  4U0S A;  4C0M A;  4CT4 A;  4ILG A;  3ABM E;  3FH7 A;  2PZI A;  4RQI A;  5BNW A;  4F53 A;  5AEN A;  3ASG A;  2F8Y A;  4A1S A;  1TN8 A;  3BQO A;  4XI9 A;  4RVB A;  2HM8 A;  3CVN A;  3S7J A;  2VGY A;  3MGB A;  4HOQ A;  2WQH A;  4C9B B;  1Z6T A;  4Y6C A;  4DPR A;  2BUG A;  2P58 C;  2P9U G;  3TL5 A;  2QFC A;  3JQ0 A;  3DXM G;  4U8V D;  3KAE A;  4F1S A;  1FT2 A;  2IEJ A;  5FT9 A;  2XRY A;  4CDR A;  2DIW A;  3AS8 A;  3PE3 A;  3QWP A;  4XKB A;  4JD2 G;  4U8Y D;  3L82 A;  3UI2 A;  3JQ1 A;  2EIJ E;  3D9M A;  4I9C A;  1TN7 A;  2XS1 A;  4OAU C;  4HOS A;  3AS4 A;  3PS6 A;  3PZ4 A;  4I2Z A;  2OVF A;  3CGH A;  3CK9 A;  2X6H A;  2QC9 A;  2Y4T A;  2ZIS A;  4I17 A;  4J8E A;  2WVI A;  1PC2 A;  3DSS A;  4BWR A;  3KSL A;  3K9I A;  3OXL A;  1NP7 A;  4HB5 A;  4PS3 A;  4W9R A;  4GB9 A;  2I6H A;  1N94 A;  4TRQ A;  1TNY A;  1S63 A;  3CKC A;  4EZL A;  3GZ2 A;  4ZHB A;  3ZN3 A;  3RKV A;  1H2V C;  3Q7A A;  4BX8 A;  3ESK A;  4JW1 A;  1PAQ A;  3E30 A;  4UWF A;  1JWF A;  3MKQ B;  3EHR A;  4D10 C;  5A7D B;  2R02 A;  3BG0 B;  2DZN A;  2VQ2 A;  4A3T A;  3CVV A;  1MJ0 A;  3RU0 A;  5BPP A;  4XE0 A;  3L6A A;  2ZXW E;  4APO A;  3I3N A;  3ZHE A;  1LD8 A;  2BF0 X;  2R2L A;  3QDN A;  1OWO A;  4LNG A;  4BTA A;  2XGO A;  3GW4 A;  1OWN A;  4GA2 A;  2EIK E;  3DSW A;  4QQI A;  5BW8 C;  3FTY A;  1OT8 A;  2P9P G;  3URZ A;  2AXV A;  4ME2 A;  4GZ6 A;  4DX2 A;  4GZC A;  3TWU A;  2E2E A;  3TWV A;  2J4B A;  3LY8 A;  2A5E A;  1OWL A;  4U0Z A;  3NBN B;  4JEU A;  2JLB A;  4I9E A;  3O48 A;  4GA0 A;  5B1A E;  3OXF A;  4JXT A;  2YIN A;  3FUD A;  4XZ4 A;  5FZS A;  5FQ4 A;  2NC9 A;  1ZB1 A;  3ABL E;  1VDY A;  2GRO B;  3PH0 C;  1IQU A;  1E90 A;  2XEV A;  4HBD A;  2GRQ B;  4K5C A;  3DSX A;  3DWL G;  2XPZ A;  3CK8 A;  2L9B A;  3KD7 A;  2J8S D;  3UX4 A;  4G8L A;  4A55 A;  1UN8 A;  2L6J A;  1B89 A;  3ASO E;  3SI5 A;  2H6G A;  4I1M A;  3FTU A;  2JAB A;  1TN6 A;  4DX1 A;  2KXP C;  2HE0 A;  1EYH A;  1Z3Y A;  3MV3 B;  5BT1 A;  2CFU A;  3RO3 A;  5JA4 D;  3DBS A;  4U7E B;  3QOU A;  2J09 A;  2XRZ A;  5G2N A;  2GRM A;  2NSZ A;  5CMY A;  4O1P A;  4HFG A;  4ACK A;  4UUC A;  3CV0 A;  5DIZ A;  3D9L A;  4N3B A;  1INZ A;  2XQ0 A;  2R17 C;  4FP7 A;  4GMR A;  1OY3 D;  4L2Y A;  1WAO 1;  2IU1 A;  4O6F A;  4J8D A;  4YND A;  4KZ0 A;  2E0I A;  5KJN A;  5JJ7 A;  3Q78 A;  3HXC A;  1YMP A;  2QY7 A;  3CQG B;  2CFZ A;  4GYW A;  2IFU A;  4M7C A;  5FJY A;  3B7R L;  5G04 J;  3CVY A;  1TJF A;  1YCS B;  4KXK B;  3CVX A;  3ZEF A;  4JL0 A;  4NIK A;  3ZXS A;  4DK5 A;  2IOL A;  3BG1 B;  1Y6I A;  1JUQ A;  3UMV A;  2C2L A;  2WXG A;  3FU5 A;  1UJK A;  4E6H A;  2F37 A;  1H6P A;  5BV1 A;  3ZXP A;  4LUN U;  2XEH A;  1AWC B;  3FUM A;  3UT8 A;  3QJZ A;  5KJM A;  1WDY A;  2WXQ A;  4B89 A;  5B3S E;  4JEH A;  5AAR A;  4CCA A;  4GCO A;  4CZ2 D;  3Q7F A;  2BKK B;  3HDX A;  2YNQ A;  3N71 A;  4Q69 A;  3APF A;  4YDE A;  3FTX A;  1LTX A;  1SZ9 A;  3FEY A;  1LD7 A;  2LSV A;  3MZL B;  4G11 A;  5AQA A;  5IY5 E;  5FWQ A;  1WG0 A;  1E8Z A;  4A3V A;  3AG2 E;  3PZD A;  5EX0 A;  3V79 K;  3U9W A;  2XGS A;  2FUL A;  4LNB A;  1N0R A;  1X81 A;  3PEU B;  3W9G A;  1HS6 A;  3G2V A;  4J8Y A;  3EDT B;  4AY5 A;  4F1P A;  3S7D A;  1HF8 A;  2PM6 A;  3RSE G;  1O1T A;  4HOR A;  4OVV A;  4AP2 A;  1K3Z D;  3B7B A;  1TNU A;  1LF8 A;  1O1R A;  1V55 E;  2VTB A;  4DRX E;  1OCC E;  4K03 A;  4J6I A;  4N3C A;  1HG5 A;  2XCC A;  3RAU A;  1DVP A;  3CLJ A;  1YA0 A;  2WXL A;  2XPY A;  2XCB A;  4CDN A;  1N4S A;  5KNH D;  4BX9 A;  3UIN C;  4FA6 A;  5FTP A;  4QFV A;  4H7X A;  5D0O D;  2HO1 A;  4FHJ A;  3ESL A;  4U04 A;  3DPY A;  2RFM A;  4UWG A;  4B93 B;  2ILR A;  4CGV A;  4G24 A;  1HO8 A;  3SY2 A;  1EDU A;  3CHR A;  1BU9 A;  3Q9N C;  3UT4 A;  3ZYM A;  4LEU A;  3FUJ A;  3ULE G;  3FUL A;  1UG3 A;  3Q9U C;  3LPZ A;  2J07 A;  2UY1 A;  5KCM A;  2ZU6 B;  2OCC E;  2UWJ G;  2BTD A;  2KZT B;  4CT0 A;  5CEA A;  1KT1 A;  2H6F A;  4DLO A;  1UN9 A;  3CST A;  2XZD G;  2I2O A;  4UI9 C;  3DSV A;  3MKQ A;  5AJL A;  2VJ8 A;  3ZUV B;  1HX8 A;  4G26 A;  4G2V A;  4L2L A;  3QAR A;  4Q94 A;  4JPS A;  3AAA C;  5CHE E;  3UM0 A;  3P2B A;  3PDN A;  3DEP A;  5CCM A;  2BED A;  4BES A;  1QNF A;  2ETA A;  5CER B;  4G8K A;  3WXX A;  1IHB A;  3LDZ A;  3T8K A;  4JB8 P;  4FAD A;  4YDW A;  3ZIM A;  3F6Q A;  2FO1 E;  2WXF A;  3VTX A;  3C3Q A;  4L7T A;  2MYO A;  4BEP A;  5LP0 A;  1N4R A;  2V4L A;  4ANX A;  4C48 B;  3UPV A;  3LCA A;  4I2W A;  3UT7 A;  4HI9 A;  1IKN D;  3LJ3 A;  2WXR A;  4IUL A;  3SF4 A;  4Z68 A;  3PRZ A;  5T3R A;  3O4Z A;  1S0P A;  4AXH A;  2OEW A;  1E7V A;  5HRY A;  4ILI A;  2CG2 A;  2NXP A;  4KT6 B;  4BFR A;  3FWV A;  2PM7 A;  5EID A;  4G25 A;  2KCK A;  4ANW A;  3T9K A;  5G05 C;  3FTS A;  2X38 A;  4HNA D;  5JJ6 A;  3R9M A;  3ZFW A;  1JCQ A;  1Z3X A;  5HKP A;  4EHM A;  4BET A;  3BEE A;  4BT8 A;  3Q79 A;  2VYI A;  3NZS A;  4FU3 A;  1OCZ E;  3IV0 A;  4N3A A;  2VGX A;  2L0T B;  4ANV A;  2VSO E;  3FU6 A;  1H2T C;  4TXQ A;  1XNF A;  3DEO A;  3HXD A;  3PNL B;  3FU3 A;  3CSF A;  3JUE A;  5EYP F;  5ANR A;  4AEZ C;  4F7A A;  3L22 A;  3S7B A;  4AY6 A;  2RD0 A;  3PVL A;  3CVQ A;  3AJI A;  4GTV A;  2X6K A;  4DX5 D;  2MHK A;  4UQY A;  1L5J A;  5ITZ F;  4UQZ A;  2BKG A;  3SFX A;  4HS2 A;  1HE8 A;  3SBS A;  2WXN A;  3CHP A;  1WM5 A;  2V4H C;  4N5Q A;  4NAC A;  1HU3 A;  2ZIR A;  2GW1 A;  3FUK A;  2KAT A;  4RG9 A;  3LVR E;  3JUI A;  1O1S A;  1IHG A;  2WXH A;  4ABN A;  4E85 A;  4DI4 A;  2ETC A;  4EZJ A;  5A23 A;  4B0Z A;  2PQR A;  3ZGQ A;  4ANU A;  3DRA A;  3ENE A;  2Y1L E;  3RK6 A;  4YDO A;  4C0E A;  1FCH A;  3JXI A;  2Y69 E;  4GZ3 A;  3LEW A;  5KWD A;  1JCR A;  2IQC A;  3UTM A;  1U2V G;  3TWT A;  2P9I G;  3NF1 A;  4HRN A;  1UW4 B;  3APC A;  1YYH A;  4GZ5 A;  5B1B E;  3TG4 A;  3FY4 A;  3DST A;  2AW6 A;  5DBK A;  1KLX A;  3LKU A;  1EPU A;  3E37 A;  2P2C P;  1Z5S C;  3Q4A B;  1HG2 A;  3E32 A;  4PS8 A;  4HOT A;  5AIJ A;  1MYO A;  1HFA A;  1JCS A;  3FUE A;  3PZ2 A;  3APD A;  1QYM A;  3OAW A;  2EIN E;  3SQV A;  4U8H A;  3ONL A;  2V8S E;  4WWO A;  3TGO A;  3MYV A;  4MKT A;  3D9N A;  4DLQ A;  3C72 A;  3L16 A;  4CRW A;  4GTO A;  4K5A B;  5HS0 A;  4V3I A;  5FIN A;  1S70 B;  1OXJ A;  3NZU A;  5D2M C;  2QZA A;  4U07 A;  4HLE A;  4LCT A;  1E8X A;  4HVB A;  3BU8 A;  1NA3 A;  3C5R A;  3C98 A;  4L1B A;  3GZ1 A;  3G2S A;  4EBA A;  4F6R D;  3ASH A;  3IBE A;  2FO7 A;  4B8A A;  2WMO A;  2VSY A;  1S64 A;  5CCL A;  4YDY A;  3UUX A;  1O5M A;  2R59 A;  3GYZ A;  2IY0 C;  4BT9 A;  2V5Q C;  2CHZ A;  3D9O A;  1P5Q A;  2V0P A;  4HLL A;  3MV2 B;  5ENP D;  4N5C A;  2RG8 A;  4XIF A;  5G55 A;  3J5Q B;  2LXL A;  3L54 A;  3EIQ C;  5LOZ A;  3SO8 A;  4HRL A;  3HYM B;  3EU5 A;  1D9S A;  4KYO B;  3B7S A;  1MX4 A;  3FH5 A;  4WNG A;  2J4D A;  2R5S A;  3UIO C;  3TXN A;  5T4Y A;  3ABK E;  4GTM A;  4GTR A;  4FHK A;  5ARG A;  2VSN A;  1Y8M A;  3NOG D;  4PUC A;  3CKB A;  3D9P A;  4J8S A;  1RZ4 A;  4JVS A;  2GRN B;  3EHM A;  5AAO A;  2L0I A;  4GTQ A;  3G2W A;  2GRL A;  3CVW A;  4B8C B;  2FF4 A;  2ION A;  4MS6 A;  1NFI E;  3IKO B;  2AJA A;  4PS7 A;  3Q49 B;  4M3O A;  3RJV A;  1ELR A;  3TWW A;  4KZC A;  2PL2 A;  3PUK A;  2XPI A;  5EN5 D;  4FLB A;  2AXZ A;  3AG4 E;  4R7L A;  3ML8 A;  4CYM D;  4RLY A;  5ANL A;  3ASN E;  4ACL A;  2IO3 C;  4JHJ A;  2VGE A;  3ZW3 A;  2PQN A;  3LS8 A;  2C0L A;  2EQX A;  5G04 C;  2X6I A;  3NB2 A;  5BXO A;  3NQP A;  2X3M A;  2A5U A;  3FH8 A;  2HR2 A;  4AM9 A;  3B7T A;  4H7Y A;  3B7U X;  5AQ9 A;  5JHB A;  2WB2 A;  2WXM A;  4FUL A;  3LY9 A;  3BUA A;  2RFA A;  2V5F A;  4Q96 A;  2DBA A;  2WQ6 A;  3FTV A;  4WAF A;  3RO2 A;  4KBQ A;  1W3B A;  5AQB A;  2OV8 A;  3T8M A;  1N54 A;  3TJP A;  2PNN A;  4BER A;  3KEZ A;  3V2O A;  2H6H A;  3CK7 A;  4WNE A;  1OWM A;  3FUH A;  2AWI A;  4G23 A;  2FBN A;  4IN3 B;  1UOH A;  3QKY A;  1TNB A;  3PUJ A;  2KBX A;  5M72 A;  3TG5 A;  3EHQ A;  4JHR A;  4A1G A;  3ZPJ A;  1KT0 A;  3CHO A;  1H19 A;  4J8F A;  3SGH A;  4GCN A;  3J5P A;  4KVO A;  3CVU A;  1TNZ A;  5FZR A;  1QBQ A;  5KNG A;  4UWK A;  4EPZ A;  2FEZ A;  3FUN A;  3SD5 A;  1N11 A;  4KMO A;  2IO2 C;  1NL4 A;  3UQ3 A;  3RIB A;  1BPO A;  4I6J A;  3ISM C;  5AJD A;  4XKC A;  3U64 A;  3ASD A;  3U4T A;  4GAA A;  4DX6 D;  2ZGD A;  3UM1 A;  3S7F A;  2WXI A;  3B95 A;  2I1K A;  1KPS B;  4TV3 A;  3E34 A;  4GPK A;  4HRM B;  4WND A;  4K0R A;  3ZYK A;  1JPL A;  2IJG X;  1N0Q A;  5BV0 A;  3I5P A;  4GA1 A;  1K8K G;  1TNO A;  2LUH A;  4ATZ D;  3VLD A;  4GYY A;  4J0U A;  2QYJ A;  4FLH A;  1HXI A;  2DYS E;  2GRR B;  5CRU A;  1FVF A;  3HVE B;  2YHE A;  4I1O B;  3CHS A;  2C0M A;  2IF4 A;  3EHN A;  3QAQ A;  2F0Y A;  4IRU A;  4GTS A;  3GZS A;  4NRH B;  3RRM B;  1K1B A;  1DNP A;  3CQC B;  1N52 A;  4GYO A;  4JA9 A;  2DWZ A;  2I9C A;  3IHY A;  2VSX E;  1FVH A;  1U3D A;  1H6K A;  4OVU A;  1BI8 B;  1A17 A;  4APF A;  3AS5 A;  1ZBP A;  1H6O A;  1OCR E;  1DC2 A;  3SFZ A;  4CGW A;  4WWP A;  3EIJ A;  2VTB B;  2WPV A;  2DVW A;  4UQX A;  1RW2 A;  3D3M A;  4HOU A;  3CIA A;  2XEE A;  3ZRH A;  2GRP B;  3DXK G;  4X8Q A;  4LG6 A;  2MOW A;  3QNK A;  3CEQ A;  2WXO A;  4TXR A;  3SBT B;  3R9A B;  3V31 A;  3W9F A;  2KM4 A;  4WWN A;  2MRI A;  4L9P A;  2Y3A A;  3V2X A;  1E8Y A;  1WY6 A;  4BSZ B;  5H7P A;  5D0Q D;  2R05 A;  1MHQ A;  3SHF A;  2LO6 A;  4P29 A;  3OXG A;  1E96 B;  5AN8 A;  4MLP A;  3PZ3 A;  4K5B A;  4MBG A;  3MX3 A;  3HXF A;  1IQR A;  4I43 A;  5J90 A;  3HG0 D;  3DSU A;  1A5E A;  3ONK A;  3C3O A;  1ZU2 A;  4AV7 A;  4RSY A;  5CBO A;  5ARF A;  4XX5 A;  4BSX A;  3PZ1 A;  1H2U A;  1KZO A;  2P9K G;  2UY1 B;  4HXI A;  2L6B A;  1MX6 A;  4EZK A;  4MRU A;  3QWV A;  4N2Q A;  4WNF A;  1G3N B;  3G2T A;  4GU5 A;  1BI7 B;  4FJZ A;  5JJT A;  4B94 A;  1SA5 A;  1D8D A;  5FQ6 A;  2DZO A;  4TUU A;  1MQS A;  2WQ7 A;  4U0U A;  3FHE A;  1TR4 A;  1TJC A;  4GPM A;  4EBA G;  2QYU A;  3Q15 A;  3HXB A;  1AP7 A;  5CEC B;  4GMJ A;  2H6I A;  4U96 D;  3IEG A;  2GGF A;  2LSU A;  2P9N G;  5EKQ D;  1N9A A;  3UM3 A;  3KSQ A;  4JHK A;  5CED B;  3PNT B;  2LAH A;  2OOE A;  3QB2 A;  1QQE A;  2CHX A;  1PY1 A;  4J7W A;  4TUM A;  4URK A;  3HXE A;  1NI1 A;  5JMN D;  5C1D A;  2X6J A;  4PH4 B;  3L17 A;  5EIL A;  3SFY A;  5LFA A;  5E76 A;  3L9T A;  2FI7 A;  3IXE A;  3L13 A;  3LVQ E;  4TXP A;  3FP3 A;  4IYP A;  1ELK A;  4LSZ E;  3DPD A;  1KZP A;  4UI9 K;  4XI0 A;  3X2Q E;  3IHV A;  2J9Q A;  4UWH A;  3SNX A;  2DCP A;  1DCQ A;  3Q5M A;  3HHM A;  2KC7 A;  3ZNG A;  5HI7 A;  4UWL A;  4N2S A;  5BUZ A;  2WM9 A;  3KS2 A;  2Q7F A;  3P1U A;  2OND A;  2KCL A;  3E4B A;  4DI3 A;  3TAX A;  3MCX A;  2J49 A;  3CVP A;  1MZC A;  3NOC D;  1TYQ G;  1N4Q A;  1IXV A;  3QK0 A;  4ILH B;  1JWG A;  2R03 A;  4LNU D;  2J08 A;  4I6G A;  2VGX B;  3G2U A;  3R7Q A;  3R7R A;  2KCV A;  2YHC A;  3VLE A;  4I1A A;  3Q75 A;  3FTW A;  2ZGG A;  3FEX A;  5ENT D;  3UXG A;  4RG6 A;  5CRV A;  1E7U A;  5T8I A;  3TWS A;  4O1O A;  5FZQ A;  1ELW A;  2IOS A;  3AG1 E;  1DCE A;  3RRN B;  3LXU X;  3LYA A;  3OTN A;  1SW6 A;  4KVM A;  5BXU A;  3ZU7 B;  4GML A;  3PRE A;  2YQ8 A;  2WXJ A;  4YVO A;  3ZHE B;  3TWR A;  4Y6W A;  5E75 A;  4FC8 A;  3EUV A;  2XHE A;  3ML9 A;  3ULQ A;  4JZY A;  4OAV B;  3I4G A;  2OVB A;  3KEA A;  3E33 A;  2EIM E;  3EJN A;  1BLX B;  5FQ8 A;  5LCW J;  3ULY A;  5C2Y A;  2WXK A;  2F8X K;  4G1T A;  3CR3 A;  2EIL E;  3PE4 A;  3HRA A;  2KZT A;  3ZYQ A;  1MX2 A;  2X6F A;  4EQF A;  4CDM A;  1SVX A;  5JHA A;  3S2A A;  1QZ2 A;  1OCO E;  3I4R B;  3AU5 A;  5A6C A;  5CMW A;  1V54 E;  2RKK A;  3FFL A;  3SZ7 A; 
#chains in the Genus database with same CATH homology
 3I5P A;  3PH0 C;  1IQU A;  4GA1 A;  4F3V A;  1E90 A;  2L0T B;  3HVE A;  3CHQ A;  3QC1 A;  2XEV A;  3VLD A;  4ANV A;  4GYY A;  4OYS A;  4J0U A;  3CHM A;  2VSO E;  3FU6 A;  1H2T C;  5KJL A;  1XNF A;  2XPZ A;  2AVP A;  4FLH A;  3CK8 A;  4PDX A;  3PNL B;  2L9B A;  2AXU A;  4BTB A;  3KD7 A;  3FU3 A;  1OWP A;  1HXI A;  3CSF A;  3UX4 A;  5ANR A;  4A55 A;  5EDS A;  4AEZ C;  5LCW C;  5LX8 A;  1OUV A;  1UN8 A;  2L6J A;  1B89 A;  1FVF A;  2XGM A;  3HVE B;  4F7A A;  3L22 A;  3SI5 A;  3T5V A;  2YHE A;  3S7B A;  4I1O B;  4AY6 A;  3PEV B;  2RD0 A;  4I1M A;  3FTU A;  3CHS A;  4FJY A;  2C0M A;  2I1J A;  3PVL A;  3CVQ A;  2IF4 A;  3EHN A;  3QAQ A;  1NZN A;  2X6K A;  2MHK A;  4IRU A;  4UQY A;  5FQ7 A;  1L5J A;  4UQZ A;  3FDH A;  1EYH A;  3GZS A;  4NRH B;  1Z3Y A;  1HE8 A;  4HS2 A;  4JC8 A;  3RRM B;  3SBS A;  2WXN A;  3MV3 B;  5BT1 A;  3CHP A;  1WM5 A;  2CFU A;  4LER A;  3RO3 A;  3TXM A;  1DNP A;  3DBS A;  4NAC A;  3QOU A;  1HU3 A;  2J09 A;  2LAI A;  2XRZ A;  3CQC B;  5G2N A;  5EX3 A;  2GW1 A;  3FUK A;  1N52 A;  4LRZ A;  2KAT A;  4RG9 A;  2GRM A;  2NSZ A;  3LVR E;  4GYO A;  3JUI A;  5CMY A;  4HFG A;  3VLF A;  4ACK A;  5AYW D;  4JA9 A;  2WXP A;  3CV0 A;  1HZ4 A;  3ZYL A;  1IYG A;  1IHG A;  2I9C A;  3D9L A;  4N3B A;  3IHY A;  2WXH A;  5DIZ A;  2XQ0 A;  4ABN A;  4DI4 A;  2R17 C;  4E85 A;  1INZ A;  4FP7 A;  2VSX E;  1FVH A;  1HH8 A;  1U3D A;  4EZJ A;  5A23 A;  4AVX A;  1H6K A;  4B0Z A;  2PQR A;  3ZGQ A;  4L2Y A;  4ANU A;  1WAO 1;  2IU1 A;  3D9I A;  4O6F A;  4OVU A;  3JYS A;  4J8D A;  1A17 A;  3ENE A;  3RK6 A;  4YND A;  4KZ0 A;  4APF A;  2E0I A;  4EEC A;  3AS5 A;  1UJJ A;  4C0E A;  1FCH A;  3D9J A;  1ZBP A;  5KJN A;  5JJ7 A;  4GZ3 A;  3SFZ A;  4CGW A;  4WWP A;  3LEW A;  3EIJ A;  2VTB B;  2QY7 A;  2IQC A;  3CQG B;  2WPV A;  4CEM A;  5KJK A;  2CFZ A;  4GYW A;  2IFU A;  3Q47 B;  3FUF A;  5FJY A;  3B7R L;  4UQX A;  5G04 J;  3CVY A;  1TJF A;  3D3M A;  4HOU A;  4KXK B;  3ZVV A;  3CIA A;  3CVX A;  1SQM A;  3ZRH A;  3ZEF A;  2A4Z A;  3ASF A;  4JL0 A;  3ZXS A;  3FU0 A;  3NF1 A;  3AU4 A;  2IOL A;  4DK5 A;  3BG1 B;  3FTZ A;  1Y6I A;  2MOW A;  3QNK A;  1UW4 B;  4UI9 J;  3CEQ A;  2WXO A;  3APC A;  3FUI A;  1JUQ A;  3UMV A;  4BY6 A;  2C2L A;  3SBT B;  3R9A B;  2WXG A;  4GZ5 A;  5J08 A;  1GW6 A;  3FU5 A;  3TG4 A;  3FY4 A;  3HIZ A;  2KM4 A;  1UJK A;  4E6H A;  2AW6 A;  3MEK A;  2MRI A;  4WWN A;  1KLX A;  3LKU A;  5DBK A;  2JEK A;  1EPU A;  3U3W A;  5BV1 A;  2Y3A A;  1U3C A;  4LUN U;  3Q4A B;  1E8Y A;  1WY6 A;  3FUM A;  1HG2 A;  4PS8 A;  4AOF A;  4HOT A;  3UT8 A;  3QJZ A;  1NA0 A;  5AIJ A;  5KJM A;  5D0Q D;  2WMN A;  1H0A A;  1MHQ A;  2WXQ A;  2Y4U A;  4NUR A;  3SHF A;  2LO6 A;  1HFA A;  3MA5 A;  4B89 A;  4I6E A;  2M63 A;  3FUE A;  4JEH A;  3APD A;  4P29 A;  5ENN A;  3VTY A;  3OXG A;  1E96 B;  4CCA A;  3LY7 A;  4GCO A;  3OAW A;  4MLP A;  4AJW A;  4U8H A;  3MX3 A;  3ONL A;  1IQR A;  3HDX A;  5HQ8 A;  4I43 A;  5J90 A;  2V8S E;  2YNQ A;  3N71 A;  3RRU A;  4WWO A;  3TGO A;  3MYV A;  4MKT A;  3D9N A;  3ONK A;  3JCK C;  1ZU2 A;  3APF A;  4DLQ A;  4Q69 A;  4AV7 A;  4RSY A;  3FTX A;  2LNI A;  3L16 A;  4CRW A;  1SZA A;  2CHW A;  5ARF A;  4XX5 A;  1EF1 C;  4V3I A;  1SZ9 A;  3FEY A;  4BSX A;  2LSV A;  3MZL B;  3NZU A;  1H2U A;  1X5B A;  4G11 A;  4U07 A;  4HLE A;  4LCT A;  1E8X A;  4DJA A;  4HVB A;  2CG3 A;  4AIF A;  5FWQ A;  2UY1 B;  4HXI A;  1E8Z A;  1NA3 A;  3C98 A;  4A3V A;  4L1B A;  3GZ1 A;  3G2S A;  4EBA A;  3ASH A;  3IBE A;  4ATG A;  4EZK A;  4MRU A;  3QWV A;  2FO7 A;  4YVQ C;  4N2Q A;  3U66 A;  3PZD A;  5EX0 A;  4B8A A;  3U9W A;  2XGS A;  4WNF A;  2FUL A;  2WMO A;  4L23 A;  3G2T A;  4GU5 A;  2VSY A;  3PEU B;  4WUY A;  4N39 A;  5CCL A;  3UUX A;  3B13 A;  1E8W A;  2HYZ A;  1TEZ A;  4FJZ A;  1HS6 A;  5JJT A;  3G2V A;  4B94 A;  2R59 A;  3EDT B;  3GYZ A;  4BT9 A;  4AY5 A;  2CHZ A;  3D9O A;  5G05 J;  3S7D A;  3QWW A;  1HF8 A;  3MKR A;  5FQ6 A;  3D9K A;  4TUU A;  1MQS A;  2PM6 A;  1P5Q A;  2WQ7 A;  4HOR A;  4U0U A;  2V0P A;  3FHE A;  4OVV A;  4AP2 A;  1TJC A;  1XGW A;  3MV2 B;  4GZD A;  3L08 A;  2RG8 A;  4N5C A;  4XIF A;  5G55 A;  4EBA G;  4U63 A;  3L54 A;  3T5X A;  3Q15 A;  4JA7 A;  1LF8 A;  2VTB A;  3CVL A;  3EIQ C;  4K03 A;  4J6I A;  5LOZ A;  4GMJ A;  4NQ0 A;  3MJW A;  4U0S A;  4C0M A;  4CT4 A;  4N3C A;  1HG5 A;  2XCC A;  4ILG A;  3FH7 A;  2PZI A;  3HYM B;  3IEG A;  2GGF A;  2LSU A;  1DVP A;  5EKQ D;  3CLJ A;  5BNW A;  1YA0 A;  4JHK A;  2WXL A;  4F53 A;  5AEN A;  3ASG A;  2XPY A;  2XCB A;  4KYO B;  3B7S A;  4A1S A;  3FH5 A;  3PNT B;  2LAH A;  4CDN A;  4WNG A;  2J4D A;  2R5S A;  2OOE A;  3TXN A;  3QB2 A;  1QQE A;  2CHX A;  5T4Y A;  1PY1 A;  4BX9 A;  4XI9 A;  4RVB A;  4FA6 A;  4URK A;  5FTP A;  2HM8 A;  3CVN A;  3S7J A;  2VGY A;  4QFV A;  4H7X A;  3MGB A;  4HOQ A;  2WQH A;  4FHK A;  4C9B B;  5ARG A;  1Z6T A;  5C1D A;  5D0O D;  2VSN A;  2HO1 A;  1Y8M A;  2X6J A;  4PUC A;  4Y6C A;  4FHJ A;  4PH4 B;  3L17 A;  3CKB A;  3D9P A;  4DPR A;  5LFA A;  2BUG A;  3ESL A;  4J8S A;  5E76 A;  2P58 C;  4U04 A;  4JVS A;  2FI7 A;  3EHM A;  3TL5 A;  2L0I A;  3L13 A;  3LVQ E;  3G2W A;  2GRL A;  3CVW A;  2QFC A;  3JQ0 A;  4B8C B;  4UWG A;  2FF4 A;  2ION A;  2ILR A;  3FP3 A;  4IYP A;  1ELK A;  4CGV A;  4G24 A;  1HO8 A;  4MS6 A;  3IKO B;  3DPD A;  3KAE A;  4F1S A;  4UI9 K;  4XI0 A;  1EDU A;  4PS7 A;  3IHV A;  5FT9 A;  2XRY A;  3Q49 B;  4CDR A;  3CHR A;  4M3O A;  2DIW A;  3AS8 A;  3RJV A;  3UT4 A;  3ZYM A;  3PE3 A;  2J9Q A;  1ELR A;  3QWP A;  4UWH A;  3SNX A;  4KZC A;  2PL2 A;  3PUK A;  2DCP A;  3FUJ A;  4LEU A;  4XKB A;  2XPI A;  3Q5M A;  3FUL A;  4FLB A;  2AXZ A;  3HHM A;  2KC7 A;  3JQ1 A;  4R7L A;  1UG3 A;  3D9M A;  3ML8 A;  4I9C A;  3LPZ A;  5ANL A;  2J07 A;  4ACL A;  4HOS A;  3AS4 A;  3PS6 A;  2UY1 A;  5KCM A;  2ZU6 B;  4JHJ A;  4I2Z A;  5HI7 A;  4UWL A;  2OVF A;  2UWJ G;  2BTD A;  3CGH A;  3CK9 A;  4N2S A;  2KZT B;  3ZW3 A;  2PQN A;  5BUZ A;  3LS8 A;  2WM9 A;  2X6H A;  3KS2 A;  4CT0 A;  2Q7F A;  2Y4T A;  3P1U A;  2OND A;  2C0L A;  2KCL A;  4I17 A;  3E4B A;  2EQX A;  5G04 C;  2X6I A;  4J8E A;  4DI3 A;  3NQP A;  2X3M A;  3MCX A;  1KT1 A;  2J49 A;  3TAX A;  2A5U A;  2WVI A;  1PC2 A;  4DLO A;  3CVP A;  4BWR A;  3FH8 A;  1UN9 A;  2HR2 A;  3K9I A;  3OXL A;  3CST A;  4AM9 A;  1NP7 A;  3QK0 A;  2I2O A;  4UI9 C;  3B7T A;  3MKQ A;  4H7Y A;  5AJL A;  2VJ8 A;  3B7U X;  1HX8 A;  4G26 A;  1JWG A;  4G2V A;  4ILH B;  4PS3 A;  4W9R A;  4GB9 A;  2I6H A;  4TRQ A;  2J08 A;  3QAR A;  4I6G A;  4L2L A;  5JHB A;  2VGX B;  3G2U A;  3CKC A;  4Q94 A;  4JPS A;  2WB2 A;  3R7Q A;  4EZL A;  2WXM A;  5CHE E;  3R7R A;  3P2B A;  4FUL A;  3LY9 A;  2KCV A;  3PDN A;  2YHC A;  3GZ2 A;  3ZN3 A;  3RKV A;  1H2V C;  5CCM A;  4BX8 A;  2V5F A;  3ESK A;  3VLE A;  4JW1 A;  4Q96 A;  2DBA A;  1PAQ A;  4I1A A;  1QNF A;  2WQ6 A;  4UWF A;  3FTV A;  4WAF A;  3RO2 A;  1JWF A;  3MKQ B;  4KBQ A;  4D10 C;  5A7D B;  1W3B A;  3WXX A;  3BG0 B;  2OV8 A;  3FTW A;  3T8M A;  3LDZ A;  3FEX A;  1N54 A;  2VQ2 A;  4FAD A;  4A3T A;  3CVV A;  3TJP A;  4RG6 A;  3RU0 A;  3ZIM A;  5BPP A;  2WXF A;  1E7U A;  4XE0 A;  3L6A A;  5T8I A;  3KEZ A;  3VTX A;  4APO A;  3I3N A;  3ZHE A;  5FZQ A;  3CK7 A;  4WNE A;  4L7T A;  2BF0 X;  1OWM A;  3FUH A;  1ELW A;  5LP0 A;  2IOS A;  2AWI A;  2V4L A;  4G23 A;  2FBN A;  3QDN A;  4ANX A;  3RRN B;  3LXU X;  3UPV A;  3LYA A;  3OTN A;  4IN3 B;  4KVM A;  1OWO A;  3QKY A;  3LCA A;  4I2W A;  3UT7 A;  4BTA A;  4GML A;  3LJ3 A;  3PUJ A;  3PRE A;  2WXR A;  4IUL A;  2YQ8 A;  3SF4 A;  5M72 A;  3TG5 A;  2XGO A;  2WXJ A;  4YVO A;  3ZHE B;  4JHR A;  4Y6W A;  5E75 A;  3GW4 A;  3PRZ A;  4FC8 A;  5T3R A;  3O4Z A;  1OWN A;  4GA2 A;  4A1G A;  2XHE A;  1S0P A;  4AXH A;  3ZPJ A;  3ML9 A;  1KT0 A;  3CHO A;  1E7V A;  1H19 A;  3ULQ A;  4ILI A;  4JZY A;  4J8F A;  3SGH A;  2CG2 A;  4GCN A;  5BW8 C;  3FTY A;  3I4G A;  4KVO A;  2OVB A;  3URZ A;  2NXP A;  2AXV A;  4ME2 A;  4GZ6 A;  4KT6 B;  3CVU A;  4BFR A;  5FZR A;  3FWV A;  4GZC A;  2PM7 A;  4UWK A;  4EPZ A;  2E2E A;  2FEZ A;  3FUN A;  3SD5 A;  3EJN A;  5FQ8 A;  2J4B A;  5LCW J;  3LY8 A;  4G25 A;  2KCK A;  4ANW A;  5G05 C;  4KMO A;  3FTS A;  3UQ3 A;  1OWL A;  2X38 A;  3RIB A;  5C2Y A;  2WXK A;  1BPO A;  5JJ6 A;  4G1T A;  4I6J A;  3CR3 A;  4U0Z A;  3ZFW A;  5AJD A;  4XKC A;  3U64 A;  1Z3X A;  3PE4 A;  3ASD A;  2KZT A;  4JEU A;  2JLB A;  4I9E A;  3ZYQ A;  3U4T A;  4GAA A;  2X6F A;  3O48 A;  4GA0 A;  3S7F A;  3OXF A;  4JXT A;  4EQF A;  3BEE A;  2YIN A;  3FUD A;  4BT8 A;  4CDM A;  2WXI A;  2I1K A;  5JHA A;  4TV3 A;  3S2A A;  2VYI A;  3NZS A;  4XZ4 A;  5FZS A;  1QZ2 A;  4GPK A;  3I4R B;  5FQ4 A;  4FU3 A;  4WND A;  4K0R A;  2NC9 A;  3AU5 A;  3IV0 A;  3ZYK A;  5A6C A;  4N3A A;  1JPL A;  5CMW A;  2IJG X;  2VGX A;  3FFL A;  3SZ7 A;  5BV0 A;  1VDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...