3K9IA

Crystal structure of putative protein binding protein (np_241345.1) from bacillus halodurans at 2.71 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
110
structure length
110
Chain Sequence
AQAVPYYEKAIASGLQGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative protein binding protein (NP_241345.1) from Bacillus halodurans at 2.71 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Protein binding
molecule keywords BH0479 protein
total genus 39
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3k9iA01
3RO2A 4N5CA 3ULQA 2IFUA 3GZ2A 3UUXA 4H7XA 1OUVA 3Q4AB 1ELWA 3LPZA 3WXXA 3ASFA 4ME2A 5EX3A 2FF4A 3CKBA 4GZ3A 4GYWA 4JHRA 2LNIA 5EX0A 4I17A 4N39A 4XIFA 3AS5A 4NRHB 4LEUA 5G04J 4CGWA 3K9IA 4CGVA 2XCCA 3MKRA 4GYYA 4N3CA 5LCWJ 3UPVA 2I6HA 4Y6WA 1XNFA 1NA3A 4GZ6A 5AYWD 1FCHA 5BW8C 3QOUA 4BTBA 3LCAA 3ASDA 3SF4A 5LCWC 5KJKA 2UWJG 2FI7A 3KD7A 4HOUA 1NZNA 5G04C 4KBQA 2VGXA 4GA2A 3LY8A 2LSUA 3OXLA 4WNDA 2FO7A 3LY7A 1KLXA 3ASGA 3RO3A 4N2QA 2Q7FA 3UQ3A 3EDTB 3ESKA 1IHGA 3LYAA 4G26A 2XCBA 2QFCA 1P5QA 4I2ZA 4XI9A 2LSVA 4GA0A 5EKQD 3TAXA 4I2WA 3CK7A 5BT1A 4GZ5A 4I9EA 2YQ8A 3QKYA 4U04A 4G23A 2KCKA 3LY9A 3Q47B 4ABNA 4G24A 4GCNA 3S7BA 2GW1A 4EQFA 2VYIA 3TGOA 4HOSA 1QQEA 1QZ2A 4U07A 4HOTA 2AVPA 4NQ0A 2WQHA 2XGMA 3PDNA 4G2VA 5KJLA 1Y8MA 2IF4A 3OXFA 3FWVA 4JA9A 5JJ7A 4KYOB 3OXGA 3URZA 1HH8A 2KATA 3ASHA 4RG9A 5CHEE 3FFLA 5DBKA 3PE3A 4WNFA 4UQXA 3HYMB 4N3BA 5D0QD 2ONDA 4WUYA 3GZ1A 4HOQA 4XI0A 1KT1A 3S7JA 2PQRA 2XEVA 3KS2A 3CVPA 5JJTA 3CK9A 3VTYA 1E96B 1KT0A 2UY1B 2BUGA 2YHCA 1ZBPA 3RKVA 2Y4UA 2PL2A 3NF1A 4A1SA 3FP3A 5ARFA 2PQNA 2R5SA 4IN3B 4U0SA 3ZPJA 4F3VA 3Q5MA 4HORA 5D0OD 5G05J 3QWWA 4WNGA 3VTXA 3GW4A 3MA5A 3E4BA 3ZFWA 3AS4A 4J8FA 1HZ4A 3QDNA 5G05C 2HR2A 3CVLA 3IEGA 5C1DA 4GCOA 3GYZA 4GPKA 3TG5A 2WPVA 1A17A 5FTPA 4YNDA 5BNWA 4UI9J 5CCLA 4AY5A 1HXIA 5CCMA 4H7YA 2XPIA 4J8EA 4GYOA 4O6FA 3S7DA 4Y6CA 1NA0A 1ELRA 2NC9A 3ZN3A 2C2LA 4AM9A 2VGXB 2VQ2A 3O48A 4CDRA 1ZU2A 4UI9C 3RU0A 4W9RA 3Q49B 4WNEA 2VSYA 1IYGA 4I1AA 5JJ6A 1WAO1 3AS8A 2KCLA 1W3BA 4UQZA 4APOA 2KCVA 2XGSA 3CV0A 3LKUA 5HQ8A 5M72A 4U0UA 2DBAA 4BWRA 4JA7A 5FZSA 2UY1A 3MV3B 1B89A 3BEEA 2PZIA 2E2EA 2MHKA 1YA0A 2XGOA 4U0ZA 4B94A 4AY6A 4GA1A 1PC2A 4J8DA 3ZGQA 5A6CA 2FBNA 4JL0A 2KC7A 3CVQA 4G1TA 4YVQC 4I9CA 5HI7A 2FEZA 3JYSA 5DIZA 3N71A 3S7FA 3TG4A 2HYZA 5KJMA 2VGYA 3MEKA 4UQYA 3QWVA 4N3AA 5KJNA 3U3WA 3RJVA 3CEQA 2Y4TA 5FJYA 3U4TA 3ZHEB 4BT9A 1WM5A 2JLBA 2L6JA 5ARGA 3R9AB 2VSNA 3Q15A 5FZQA 3RIBA 2J9QA 2V5FA 4KXKB 5FZRA 2C0MA 3CVNA 3KAEA 5A7DB 2P58C 4J0UA 1TJCA 3ZHEA 3PE4A 4BTAA 3MV2B 3CK8A 3CKCA 4RG6A 4UI9K 4AIFA 2HO1A 4N2SA 5FT9A 4G25A 3SZ7A 2OOEA 4YVOA 3QWPA 2C0LA 4BT8A
chains in the Genus database with same CATH superfamily
3AJIA 1UJKA 3FUJA 1EF1C 2QY7A 2UWJG 2FI7A 1H2VC 3LY8A 2LSUA 3UT4A 3LXUX 1Y6IA 3EDTB 2BKGA 2XCBA 3TAXA 5AENA 5AJDA 2XEEA 2OVFA 2F0YA 4BESA 2XEHA 4FADA 4LNUD 1WDYA 1TEZA 3ZIMA 4AEZC 3TL5A 2CHWA 3FP3A 3Q9NC 3VLFA 3FUDA 3CSFA 4JVSA 2XZDG 3GYZA 3E33A 4L2LA 3TG5A 3O4ZA 2QYUA 4M7CA 4UI9C 4W9RA 5HS0A 3CQCB 4LCTA 3CV0A 2WXIA 1L5JA 2BEDA 1HO8A 4U0ZA 3IBEA 4EECA 3CEQA 2P9PG 3QK0A 2C0MA 2DWZA 4CT4A 3JCKC 1K3ZD 1UG3A 4KT6B 4JHJA 3RO2A 2MOWA 3ESLA 4GTTA 3UIPC 3QJZA 4GTPA 1OY3D 4QFVA 1MX6A 3Q78A 1FPPA 3UPVA 5AN8A 2I1KA 3C5RA 3EJNA 4HLEA 4GA2A 4N2QA 4G11A 1E90A 1N0QA 1O1TA 3UT7A 2YQ8A 4KZ0A 1OWLA 4ABNA 2IU1A 1K1BA 1QZ2A 3ENEA 1TN7A 2JABA 2HM8A 2VSXE 4N3BA 4WUYA 5EDSA 5FQ4A 3V79K 5JHBA 1HFAA 3C72A 5ARFA 2H6IA 2X6KA 4FHJA 2AW6A 4WNGA 4IYPA 3E4BA 2A5UA 4HFGA 4U8VD 3FUEA 4HB5A 4O6FA 1ELRA 5CEDB 3G2UA 3J5PA 3CHPA 1NFIE 3JXIA 3FU3A 1N4RA 4ILIA 4FHKA 4O1OA 2KC7A 4G1TA 4GTSA 3JQ1A 4A3TA 3EHNA 2CFZA 3B7RL 4BT9A 3R9AB 3LJ3A 3D9OA 1MX2A 3UKRG 3C3OA 3OTNA 3SZ7A 4AJWA 3VLDA 1SVXA 1N4SA 5B3SE 4JHRA 3DXKG 1TNZA 1UN9A 4N39A 4F7AA 2X3MA 5FINA 4JXTA 3CGHA 4YDWA 4PUCA 2IEJA 3FY4A 2QYJA 1OCCE 2V0PA 1HH8A 1HU3A 4Z68A 2XS8A 3SFXA 2PL2A 5LX8A 3UXGA 4A3VA 1G3NB 3FTWA 1HZ4A 1O1RA 3ZU7B 4FLHA 3L9TA 1Q2ZA 3E30A 3B95A 3U9WA 5CCLA 3ZYKA 3EIJA 2WXNA 3JUEA 5D2MC 4PH4B 2KXPC 4PS7A 5FZSA 4WAFA 3ZYQA 2MHKA 2XGOA 4JEUA 2ETCA 4I9CA 3FH5A 3AG1E 2HYZA 4LSZE 2EILE 3FTSA 3G2TA 3EU5A 2J9QA 2GRQB 4XKBA 2P58C 1K8KG 3AU4A 3CKCA 4UWFA 2XRZA 4K5BA 3DSXA 3IV0A 3R7QA 3ULQA 1NP7A 3HVEB 2P2CP 1H19A 3WXXA 2V4LA 3CKBA 3L08A 3ONKA 4RVBA 1SZAA 2OV8A 3SF4A 5KJKA 2LAHA 2GRRB 1BU9A 1N11A 5A23A 1TYQG 4C48B 5HRYA 4HBDA 5AIJA 3ESKA 2P9NG 1SZ9A 5T8IA 2PNNA 5BT1A 3QKYA 3CQGB 3D9KA 4APFA 2A4ZA 4B8CB 3OXFA 4B0ZA 1S63A 3AG4E 4JC8A 3HYMB 2VJ8A 1Z3XA 1YCSB 3KS2A 4G8LA 3FU5A 4Q69A 1OWNA 4IN3B 1E8WA 4CDMA 4F3VA 3Q5MA 2AJAA 3FDHA 2IOLA 4J8FA 4UUCA 3LVRE 5EYPF 1FT1A 1HS6A 4UI9J 3D9JA 5ENOD 4AM9A 2VGXB 3UM3A 4WWPA 3FUFA 4APOA 2KCVA 4C9BB 4I43A 5ITZF 5FQ6A 2V8SE 5HI7A 3JYSA 2WXPA 2J49A 1KZPA 3ZHEB 4DUIA 4GTOA 1TNUA 4R7LA 4OYSA 1GW6A 3CHSA 3QWPA 3CVUA 4EHMA 3GZ2A 2X38A 5EILA 4ANUA 3W9FA 4FC8A 1N52A 4JD2G 1H6KA 2RD0A 1N4QA 4I17A 4FA6A 4LEUA 3C3RA 1XNFA 2P9SG 4TUMA 2LXLA 4BTBA 2VTBA 3PZ4A 2EINE 4KBQA 3UKUG 2EIKE 4L23A 4FJYA 3LY7A 4DX1A 3LYAA 1O1SA 1JUQA 4HLLA 1OT8A 4I2WA 4TRQA 3LY9A 4HI8A 2GW1A 5ANRA 2L9BA 4UWHA 3DEPA 5JJ7A 4KYOB 4RG9A 5CHEE 3I4GA 2IQCA 2YHCA 5ENQD 5D66A 2L0TB 2PQNA 3T5VA 3CHMA 3VTXA 3TWQA 2HR2A 3CVLA 3EIQC 4TV3A 3QARA 3FTZA 4BETA 2KBXA 2C2LA 3HHMA 3RU0A 2GRNB 4LNGA 3U66A 4F6RD 1B89A 3BEEA 1MYOA 1TNBA 3D9HA 2HE0A 5CMWA 1YA0A 2P9LG 3ZXSA 3MYVA 3ZXPA 3QWVA 2WMNA 3U4TA 4ILGA 4Q96A 4LUNU 3KAEA 1SW6A 3AAAC 4UI9K 3PEUB 5G55A 2M63A 3DRAA 3L54A 1U3DA 3UUXA 1OUVA 4AXHA 4U8HA 2IO2C 5LCWJ 3QOUA 3QB2A 3ZYLA 5LCWC 1RW2A 3KD7A 4HOUA 5G04C 5ENSD 3ZRHA 4J8SA 4ZFHA 3P2BA 3MKQB 5HKPA 4JEHA 2WXRA 3HXBA 4G23A 4GCNA 3HRAA 1QQEA 3MKQA 5CBOA 2XGMA 3PDNA 1Y8MA 2R59A 1SA5A 4WNFA 2ZIRA 5LP0A 4PS3A 3JXJA 5ENRD 2ETAA 2DYSE 5E75A 4HXIA 3FUHA 2CFUA 2R02A 2XPIA 4XEIG 4CDRA 5B1BE 1WAO1 2KCLA 4U0UA 4BWRA 2UY1A 2I9CA 3F6QA 3X2QE 3ZGQA 4MLPA 2LO6A 3TWTA 1OXJA 3RRNB 4UQYA 2Y4TA 3SHFA 3FHEA 2WVIA 4GMJA 1FVHA 5KNGA 4HRLA 1DNPA 3RRUA 1TR4A 4HS2A 4UWLA 4GYWA 1OWOA 2LNIA 5CMYA 2DCPA 2X6IA 3EU9A 4FJZA 2XHEA 4ANWA 3TXNA 2NSZA 3PEVB 3DEOA 2XZTG 5CRVA 3E37A 5BV1A 1UN8A 4XI9A 3FUIA 3PREA 1EPUA 4G24A 3WG7E 2VSOE 2WQHA 3FWVA 5DBKA 2KZTA 3EHMA 2Y3AA 4HOQA 4WWNA 3ULEG 4DX2A 2IJGX 3VTYA 5B1AE 5EYLA 3I4RB 2AXUA 4DK5A 3EHQA 3GW4A 3MA5A 2GROB 1IKND 4BFRA 1FVFA 4BY6A 1TNYA 3ABLE 1H0AA 2DZNA 3QC1A 4J8EA 2NC9A 4B93B 5HQ8A 3PZ2A 3NOCD 1OCRE 4ZHBA 3MV3B 3PZ3A 1E8XA 2J8SD 4BEPA 3ULYA 2AWIA 3AG2E 3AU5A 3RJVA 4ANXA 1LD8A 2L6JA 3SFZA 2V5FA 5JA4D 3G2VA 4BTAA 2J4BA 2R2LA 4GZDA 3W9GA 3BG1B 2C0LA 2J07A 1ELWA 3SQVA 1N9AA 2FF4A 3SI5A 1U2VG 4GYYA 4K5CA 1PAQA 1NA3A 1HG2A 4GTVA 2NXPA 1D8EA 1NZNA 4HVBA 2VGXA 2FO7A 2ZXWE 1VDYA 5G2NA 3SNXA 5EKQD 3APDA 3RRMB 3EUVA 1AP7A 4U95D 4G2VA 5J08A 3KSQA 4DI4A 3Q7AA 4FP7A 5JJTA 1MHQA 1KT0A 2QZAA 2Y4UA 3NF1A 4HORA 2WB2A 2XENA 2WXJA 4GZCA 4DRXE 3NQPA 4A1GA 4BSXA 4A63B 3OAWA 2PM7A 4AVXA 1ZU2A 4L9PA 3FU0A 3AS8A 4AOFA 2WXGA 4XKCA 4B89A 1UOHA 4AY6A 3B13A 5A6CA 4JL0A 3CVQA 3DSVA 3UIOC 3KEZA 3LVQE 4C0MA 5AJLA 1WM5A 2JLBA 3C98A 1BLXB 3RIBA 1JCSA 4KXKB 3ONLA 3FTYA 3ZHEA 4LERA 5BPPA 3Q4AB 2RKKA 3MX3A 4J7WA 4GZ3A 3D9PA 2FO1E 2Y0BG 4L7TA 4CGWA 4BERA 2XCCA 3MKRA 4N3CA 5AYWD 3KSLA 4JHKA 3ASDA 3CHQA 2R05A 2LUHA 1IHGA 4BT8A 2IO3C 3CK7A 3CVXA 4DI3A 3JUIA 3BU8A 2CHZA 2CG2A 3DWLG 1ELKA 4HQDA 4TXRA 5KCMA 4JZYA 1JCRA 4OVVA 4EPZA 4XE0A 3FTVA 1IHBA 3QWWA 3HXFA 2ZU6B 2WXMA 1H2UA 3QDNA 4ACKA 2GGFA 3MGBA 1UJJA 5FWQA 3RK6A 5CCMA 3SFYA 3E32A 2GRPB 2WMOA 4Y6CA 1DCEA 1QBQA 3ZN3A 1INZA 4JPSA 3Q49B 3RAUA 2VSYA 2Y1LE 4F1PA 3L13A 5AQAA 4B94A 4JB8P 1OWPA 3ZNGA 3NB2A 4YDYA 3U64A 1S64A 5FJYA 4MKTA 3FUKA 2BKKB 4I6EA 4NIKA 1Z5SC 2EIJE 4J0UA 1MJ0A 3ZUVB 2MRIA 4XX5A 4UWKA 4OVUA 5BXUA 3FEYA 1UW4B 5E76A 4CGVA 2LAIA 3LCAA 5JMND 5EN5D 3UT8A 2WM9A 2V5QC 2WXLA 3ASGA 4L1BA 1D8DA 4I2ZA 3J5QB 3G2SA 4CRWA 3T8MA 3Q47B 2DVWA 2Y69E 4G8KA 4NQ0A 2CG3A 3TWVA 4JA9A 2IF4A 1IQRA 3HXCA 4CEMA 4DLOA 3SBSA 3S2AA 3L82A 4OAUC 2X6FA 2UY1B 3RKVA 1E8YA 5EIDA 2R5SA 3CR3A 4U0SA 3FUMA 3BUAA 4P29A 2WQ6A 3CVYA 4GCOA 4IRUA 4YNDA 4DX6D 1Z3YA 3LS8A 4PDXA 1H6PA 4HOTA 4AV7A 4U7EB 4LNBA 1DVPA 4FULA 3PUJA 4GA1A 2FEZA 1N94A 4U96D 5KJNA 3DBSA 4I1MA 3NZUA 5ARGA 1HF8A 2R03A 5FQ8A 2MYOA 2OEWA 3ZVVA 2WXHA 3ML8A 2VTBB 1HG5A 4CCAA 2ZGDA 3UTMA 3B7UX 5EX0A 1N4PA 5CEAA 3DXMG 4BX9A 4Y6WA 3PH0C 4E85A 5BW8C 3ZYMA 1X5BA 5T3RA 2P9KG 1X81A 3IHVA 2Q7FA 4HRNA 2E0IA 2GRLA 1YMPA 1P5QA 3NAWA 3IKOB 1PY1A 3ASHA 4GTMA 4EBAG 3R7RA 2ONDA 5JHAA 2PQRA 3V2OA 3AG3E 4WWOA 2LXMA 1U3CA 2KZTB 2XQ0A 3CIAA 4C0EA 4TXPA 1JCQA 1N95A 3UM1A 5C1DA 3MCXA 5AARA 1NA0A 4AP2A 3UX4A 1LF8A 5CRUA 4WNEA 5J90A 2AXZA 2XGSA 3LKUA 3DSSA 3FTUA 4JW1A 3LJNA 2E2EA 2KM4A 1YYHA 3ZKJA 4J8DA 1PC2A 2FBNA 3P1UA 4YVQC 1OCZE 3ISMC 4GPKA 4F1SA 4K0RA 3FH7A 3CVNA 4GMRA 1TJCA 4CT0A 5ANLA 5FT9A 4N2SA 4G25A 2RG8A 4MS6A 3Q9UC 3L16A 3ASFA 5G04J 3AS5A 2AXVA 3DSTA 4DX7D 5AQBA 3DSWA 5LOZA 5ENPD 1RZ4A 4WNDA 1NI1A 2LSVA 4GA0A 4D10C 1N54A 3PVLA 1IXVA 1EYHA 4U07A 3URZA 2KATA 3FFLA 3PE3A 4UQXA 3PNLB 3UMVA 3CVPA 3I3NA 4K5AB 2IY0C 3ZPJA 4RSYA 5G05J 3FEXA 2J08A 5G05C 2YNQA 3SBTB 4KZCA 2A5EA 3S7DA 1E7VA 3SGHA 3O48A 5CECB 2ETBA 2F8XK 1W3BA 1FT2A 1V54E 3RSEG 2GRMA 3PZDA 1OCOE 4ATZD 4HRMB 3LEWA 3BQOA 4HNAD 3NOGD 4RLYA 5ENTD 1WG0A 3CK8A 3Q7FA 2L0IA 2I2OA 5AQ9A 4HI9A 3LPZA 2DIWA 3KEAA 5CERB 3PZ1A 1TJFA 1H6OA 1JWFA 3ASNE 2I6HA 2XPYA 4V3IA 5T4YA 2DZOA 4F53A 2X6JA 5ENNA 3HDXA 1QNFA 1S0PA 3HIZA 3FU6A 1QYMA 4A55A 3V30A 3TWRA 2EQXA 4I9EA 4U04A 5KWDA 2H6HA 4NURA 4DLQA 4GU5A 2F37A 2AVPA 5KJLA 3Q73A 3D3MA 3QNKA 4GTQA 3DPYA 4B8AA 4XI0A 1E96B 2WQ7A 3DPDA 2FULA 2OVBA 3APCA 3IEGA 4IULA 5KNHD 2XS1A 4K03A 1A17A 4DX5D 2QC9A 3GZSA 2VQ2A 4GB9A 4YDOA 3TXMA 2R17C 5FQ7A 5M72A 2DBAA 4DPRA 3LDZA 1BPOA 3ABKE 4TUUA 2J09A 5DIZA 3S7FA 3U3WA 1EDUA 1D9SA 1WY6A 4FLBA 2WXQA 4EZJA 3C3QA 2YHEA 4GPMA 3B7BA 5A7DB 3IXEA 2DYRE 2XRYA 4URKA 2HO1A 3R9MA 3G2WA 2RFMA 4EBAA 5EX3A 4GMLA 2NYJA 2PM6A 3UI2A 4QQIA 3UM0A 4GTRA 3UQ3A 3PNTB 1MQSA 2QFCA 4GZ5A 2H6FA 4N5QA 3CLJA 2WXKA 4HOSA 4UWGA 4LRZA 3FH8A 1O5MA 5D0QD 1ZB1A 3V31A 2F8YA 1XGWA 4ILHB 1KT1A 2I1JA 2XEVA 3B7TA 3S7JA 3L22A 3CK9A 2BUGA 1ZBPA 1DC2A 2ILRA 1S70B 3ZFWA 3PS6A 4MRUA 1TN8A 4GAAA 3HXDA 2WPVA 2CHXA 3DSUA 4EZKA 3ASOE 2RFAA 5BNWA 3BG0B 4I6GA 3T5XA 1IYGA 3IHYA 2B6CA 4X8QA 4UQZA 4EZLA 1MX4A 3I5PA 2PZIA 4NACA 4U8YD 4PS8A 3N71A 2P9UG 1Z6TA 1JWGA 4N3AA 2WXOA 5C2YA 2ZISA 5FZRA 3APFA 5IY5E 4O1PA 3MV2B 4RG6A 2OEVA 3L17A 4YVOA 1KPSB 3ABME 4N5CA 2IFUA 3UINC 4H7XA 1V55E 4TXQA 3D9LA 4ME2A 2EIME 4Q94A 4L2YA 2BF0X 3FUNA 3K9IA 1N0RA 2WXFA 1FCHA 5AQ7A 2BTDA 5CBNA 3OXLA 4ANVA 2V4HC 3PRZA 2VGEA 3FULA 1E8ZA 4J6IA 2KCKA 3S7BA 3SY2A 2VYIA 3CHOA 1OWMA 3TWSA 2B0OE 3TWXA 3GZ1A 1TNOA 5BUZA 4KVOA 4A1SA 1BI7B 5AAOA 4ACLA 5D0OD 4M3OA 2IONA 1K1AA 3MZLB 2P9IG 3MJWA 4AY5A 4H7YA 5LFAA 2J4DA 4I1AA 5JJ6A 1SA4A 1SQMA 1HX8A 3CSTA 3TG4A 5KJMA 2VGYA 1BI8B 4BSZB 5BXOA 3SD5A 3D9NA 5FZQA 1TN6A 1E7UA 4CZ2D 3D9IA 3PE4A 4AIFA 5FIOA 3VLEA 2OCCE 3ZW3A 3ZEFA 3TWWA 4KMOA 4KVMA 1BD8A 4J8YA 1DCQA 4XIFA 4NRHB 3CVVA 3PUKA 2JEKA 3JQ0A 3Q79A 2H6GA 4GZ6A 3L6AA 2IOSA 1KZOA 3UM2A 4DJAA 4U63A 1LD7A 3D9MA 3RO3A 1KLXA 2L6BA 4G26A 2X6HA 2XPZA 5BV0A 3HG0D 1HE8A 4EQFA 3TGOA 4LG6A 4CDNA 3OXGA 1NL4A 3E34A 1LTXA 1AWCB 3V2XA 4I6JA 4CYMD 1A5EA 4RQIA 3AS4A 4YDEA 2YINA 5FTPA 4BX8A 4E6HA 3HXEA 1HXIA 4GYOA 3TWUA 4MBGA 3B7SA 4OAVB 3T9KA 3NBNB 4I1OB 4ATGA 4JA7A 1MZCA 3FTXA 3SO8A 5H7PA 3EHRA 1H2TC 3NZSA 3TJPA 2ZGGA 4O60A 5KBAA 3QAQA 3MEKA 3HVEA 1JPLA 3CHRA 2VSNA 3Q15A 4XZ4A 3CVWA 4FU3A 3Q75A 1IQUA 5EIBE 3ML9A 3T8KA 2OOEA
chains in the Genus database with same CATH topology
2L0IA 2I2OA 3GZ2A 2X38A 4ANUA 3Q4AB 1UJKA 3MX3A 4FC8A 1N52A 3LPZA 2DIWA 1H6KA 4GZ3A 3D9PA 4L7TA 2RD0A 4I17A 4CGWA 1TJFA 4FA6A 4LEUA 2XCCA 1JWFA 3FUJA 3MKRA 4N3CA 1EF1C 2I6HA 1XNFA 2XPYA 4V3IA 5T4YA 5AYWD 2QY7A 4F53A 4JHKA 4BTBA 3ASDA 2VTBA 2X6JA 5ENNA 2UWJG 2FI7A 3CHQA 4KBQA 3HDXA 1QNFA 1H2VC 1S0PA 2LSUA 3LY8A 4FJYA 4L23A 3HIZA 3LY7A 3UT4A 3FU6A 3LXUX 4A55A 1Y6IA 3EDTB 1IHGA 3LYAA 4BT8A 2XCBA 3TAXA 1JUQA 4I2WA 4TRQA 5AENA 3CK7A 2EQXA 4I9EA 4DI3A 3CVXA 5AJDA 3JUIA 4U04A 3LY9A 2CHZA 2CG2A 1ELKA 4NURA 4DLQA 2OVFA 2GW1A 4GU5A 5ANRA 5KCMA 2L9BA 4UWHA 2AVPA 4JZYA 5KJLA 5JJ7A 3D3MA 4KYOB 4OVVA 3QNKA 4RG9A 5CHEE 4FADA 3I4GA 2IQCA 4B8AA 4EPZA 4XI0A 1TEZA 4XE0A 3ZIMA 4AEZC 1E96B 2YHCA 3TL5A 2WQ7A 2L0TB 2CHWA 3DPDA 3FTVA 3FP3A 2PQNA 3T5VA 2FULA 3VLFA 3CHMA 3QWWA 3VTXA 2ZU6B 3FUDA 2WXMA 1H2UA 3CSFA 3QDNA 2OVBA 2HR2A 3APCA 3CVLA 3IEGA 4IULA 4JVSA 4ACKA 3EIQC 2GGFA 3GYZA 4K03A 3MGBA 4L2LA 3TG5A 4TV3A 1A17A 1UJJA 3QARA 5FWQA 3RK6A 3O4ZA 3FTZA 5CCMA 3GZSA 2WMOA 4Y6CA 3ZN3A 1INZA 2C2LA 2VQ2A 3HHMA 4JPSA 4GB9A 4UI9C 3RU0A 4W9RA 3Q49B 3TXMA 2VSYA 3CQCB 2R17C 4LCTA 5FQ7A 3CV0A 3U66A 5M72A 2DBAA 2WXIA 3L13A 4DPRA 3LDZA 1L5JA 1B89A 3BEEA 1BPOA 1HO8A 4U0ZA 1YA0A 4B94A 5CMWA 1OWPA 3IBEA 3ZXSA 3MYVA 4TUUA 2J09A 5DIZA 3S7FA 3U64A 3QWVA 4EECA 3U3WA 3CEQA 5FJYA 1EDUA 2WMNA 3U4TA 1WY6A 4FLBA 4MKTA 2WXQA 3QK0A 4EZJA 2C0MA 2YHEA 3FUKA 4ILGA 4Q96A 4CT4A 4I6EA 3KAEA 4LUNU 5A7DB 4J0UA 3JCKC 2XRYA 4URKA 4UI9K 3PEUB 2MRIA 2HO1A 5G55A 2M63A 1UG3A 4XX5A 3L54A 1U3DA 4KT6B 4JHJA 3RO2A 4UWKA 2MOWA 3ESLA 4OVUA 3UUXA 3FEYA 1OUVA 3G2WA 4AXHA 3QJZA 4U8HA 4EBAA 5EX3A 1UW4B 4QFVA 4GMLA 5E76A 3UPVA 4CGVA 5LCWJ 2I1KA 2LAIA 2PM6A 3QOUA 3LCAA 3QB2A 3EJNA 3ZYLA 5LCWC 3KD7A 4HOUA 4HLEA 3UT8A 5G04C 2WM9A 4GA2A 2WXLA 3ZRHA 4N2QA 3ASGA 4J8SA 3UQ3A 4G11A 3PNTB 1MQSA 3P2BA 3MKQB 4I2ZA 2QFCA 4L1BA 1E90A 4JEHA 4GZ5A 3UT7A 3G2SA 2WXRA 2YQ8A 4KZ0A 1OWLA 3CLJA 3T8MA 4G23A 4CRWA 2WXKA 3Q47B 2IU1A 4GCNA 4ABNA 4HOSA 1QQEA 1QZ2A 3MKQA 3ENEA 4NQ0A 2CG3A 2XGMA 3PDNA 1Y8MA 2IF4A 4JA9A 2R59A 4UWGA 1IQRA 2HM8A 2VSXE 4LRZA 3FH8A 4CEMA 4WNFA 5D0QD 4DLOA 4N3BA 5LP0A 4PS3A 4WUYA 3SBSA 1XGWA 3S2AA 4ILHB 1KT1A 2I1JA 2XEVA 3B7TA 3S7JA 2X6FA 3L22A 3CK9A 5EDSA 5FQ4A 2BUGA 2UY1B 3RKVA 1ZBPA 5JHBA 1E8YA 1HFAA 5ARFA 2R5SA 2X6KA 2ILRA 3CR3A 4FHJA 3FUMA 4U0SA 2AW6A 4WNGA 4P29A 4IYPA 2WQ6A 3E4BA 5E75A 3ZFWA 3PS6A 4HXIA 3FUHA 2A5UA 4MRUA 4GAAA 3CVYA 4GCOA 2CFUA 4HFGA 2WPVA 2CHXA 4IRUA 4EZKA 4YNDA 5BNWA 3FUEA 1Z3YA 3LS8A 3BG0B 2XPIA 4O6FA 1ELRA 4PDXA 4CDRA 4I6GA 3T5XA 3G2UA 1IYGA 3IHYA 1WAO1 4UQZA 2KCLA 4EZLA 4HOTA 4U0UA 4AV7A 4BWRA 3I5PA 3CHPA 2UY1A 2PZIA 2I9CA 4NACA 1DVPA 4FULA 3FU3A 3PUJA 4GA1A 4ILIA 3ZGQA 4FHKA 2KC7A 4G1TA 4A3TA 3JQ1A 3EHNA 4MLPA 2LO6A 2FEZA 4PS8A 3RRNB 3N71A 2CFZA 3B7RL 1Z6TA 4UQYA 1JWGA 4N3AA 3DBSA 2WXOA 4I1MA 2Y4TA 3SHFA 4BT9A 5KJNA 5C2YA 3NZUA 5ARGA 1HF8A 3R9AB 3LJ3A 5FQ8A 5FZRA 3D9OA 3APFA 3FHEA 2WVIA 4GMJA 1FVHA 3ZVVA 3MV2B 4RG6A 3L17A 3OTNA 3SZ7A 4YVOA 4AJWA 3VLDA 2WXHA 1DNPA 3ML8A 3RRUA 2VTBB 4N5CA 1HG5A 2IFUA 4H7XA 4HS2A 4CCAA 3D9LA 4ME2A 4UWLA 4GYWA 3B7UX 4JHRA 1OWOA 2LNIA 4Q94A 2DCPA 5CMYA 5EX0A 4L2YA 1UN9A 4N39A 2BF0X 2X6IA 3FUNA 3K9IA 4F7AA 4FJZA 4BX9A 2X3MA 4Y6WA 2XHEA 3PH0C 4ANWA 4E85A 2WXFA 1FCHA 5BW8C 3TXNA 2NSZA 3ZYMA 3PEVB 4JXTA 1X5BA 5T3RA 2BTDA 3CGHA 3OXLA 5BV1A 1UN8A 3IHVA 2Q7FA 4ANVA 2E0IA 2GRLA 4XI9A 1P5QA 3FUIA 3PRZA 3PREA 4PUCA 3FULA 1EPUA 1E8ZA 4J6IA 2KCKA 4G24A 3FY4A 3S7BA 2VYIA 3IKOB 1PY1A 2VSOE 3CHOA 2WQHA 1OWMA 3FWVA 2V0PA 1HH8A 3ASHA 5DBKA 2KZTA 3EHMA 2Y3AA 4EBAG 1HU3A 3R7RA 2ONDA 5JHAA 3GZ1A 4HOQA 4WWNA 2PQRA 5BUZA 2IJGX 3VTYA 4KVOA 4WWOA 2PL2A 5LX8A 4A1SA 1U3CA 3I4RB 2KZTB 4A3VA 2AXUA 2XQ0A 3CIAA 4ACLA 4C0EA 4DK5A 5D0OD 3FTWA 4M3OA 3GW4A 3MA5A 2IONA 1HZ4A 4BFRA 5C1DA 4FLHA 1FVFA 3MCXA 4BY6A 3MZLB 1H0AA 3U9WA 5CCLA 3MJWA 3QC1A 3ZYKA 4AY5A 4H7YA 4J8EA 5LFAA 3EIJA 1NA0A 2WXNA 2NC9A 4AP2A 2J4DA 3UX4A 4PH4B 1LF8A 4WNEA 5J90A 4I1AA 4PS7A 2AXZA 5JJ6A 5HQ8A 2XGSA 3LKUA 1SQMA 5FZSA 3FTUA 1HX8A 4WAFA 3MV3B 4JW1A 3ZYQA 2E2EA 2KM4A 2MHKA 2XGOA 4JEUA 1E8XA 1PC2A 4J8DA 2FBNA 3P1UA 4YVQC 3CSTA 4I9CA 3FH5A 3TG4A 2AWIA 2HYZA 2VGYA 5KJMA 3AU5A 4GPKA 3FTSA 3RJVA 4ANXA 3G2TA 3SD5A 4F1SA 2L6JA 3SFZA 3D9NA 4K0RA 5FZQA 2J9QA 2V5FA 3FH7A 3CVNA 3G2VA 4XKBA 1E7UA 2P58C 1TJCA 3D9IA 3PE4A 3AU4A 2J4BA 3CKCA 4BTAA 4UWFA 4AIFA 2XRZA 4GZDA 3VLEA 5ANLA 5FT9A 4CT0A 4N2SA 4G25A 2RG8A 3BG1B 3IV0A 2C0LA 3R7QA 3ZW3A 3ULQA 1NP7A 2J07A 3HVEB 3ZEFA 4MS6A 1H19A 1ELWA 3L16A 3WXXA 3ASFA 4KMOA 2V4LA 2FF4A 3CKBA 4KVMA 3SI5A 3L08A 3ONKA 4XIFA 5G04J 3AS5A 4NRHB 3CVVA 3PUKA 2JEKA 4GYYA 4RVBA 3JQ0A 1PAQA 1NA3A 1SZAA 4GZ6A 2OV8A 1HG2A 3L6AA 3SF4A 2AXVA 2NXPA 5KJKA 2IOSA 2LAHA 4DJAA 1NZNA 4U63A 3D9MA 4HVBA 2VGXA 5LOZA 4WNDA 5A23A 2FO7A 3RO3A 1KLXA 5AIJA 3ESKA 4G26A 5G2NA 1VDYA 3SNXA 1SZ9A 2LSVA 4GA0A 5EKQD 5T8IA 2X6HA 4D10C 5BT1A 2XPZA 3APDA 1N54A 3RRMB 5BV0A 3QKYA 3PVLA 1EYHA 1HE8A 3CQGB 3D9KA 4APFA 4EQFA 3TGOA 2A4ZA 4U07A 4G2VA 4B8CB 3OXFA 4CDNA 3URZA 3OXGA 5J08A 2KATA 4DI4A 4B0ZA 3FFLA 3PE3A 4JC8A 4UQXA 3HYMB 2VJ8A 3PNLB 1Z3XA 4FP7A 3UMVA 3KS2A 5JJTA 3CVPA 1MHQA 3I3NA 1KT0A 3FU5A 2Y4UA 3NF1A 4Q69A 1OWNA 4HORA 4IN3B 1E8WA 4CDMA 4I6JA 3ZPJA 3Q5MA 4F3VA 2WB2A 4RSYA 5G05J 2WXJA 4GZCA 3FDHA 3FEXA 3NQPA 2IOLA 2J08A 3AS4A 4J8FA 5G05C 2YNQA 3LVRE 2YINA 3SBTB 4A1GA 5FTPA 4BSXA 1HS6A 4BX8A 4E6HA 4UI9J 4KZCA 1HXIA 3D9JA 3S7DA 4GYOA 1E7VA 3SGHA 3B7SA 3OAWA 2PM7A 4AVXA 4AM9A 2VGXB 3O48A 1ZU2A 4I1OB 4WWPA 3FUFA 3FU0A 3AS8A 4APOA 4ATGA 1W3BA 2KCVA 4JA7A 4C9BB 4I43A 4AOFA 3FTXA 2WXGA 4XKCA 1H2TC 4B89A 4AY6A 3NZSA 5FQ6A 3B13A 3TJPA 4JL0A 3CVQA 5A6CA 2V8SE 5HI7A 3KEZA 3LVQE 4C0MA 3JYSA 2WXPA 2J49A 3QAQA 3MEKA 5AJLA 2GRMA 3HVEA 3PZDA 3ZHEB 1JPLA 1WM5A 2JLBA 3LEWA 3C98A 3CHRA 2VSNA 3Q15A 4XZ4A 3CVWA 3RIBA 4FU3A 4KXKB 1IQUA 3ONLA 3FTYA 3ZHEA 3CK8A 3ML9A 4R7LA 4LERA 4OYSA 1GW6A 5BPPA 2OOEA 3CHSA 3QWPA 3CVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RO2 A;  4N5C A;  3ULQ A;  2IFU A;  3GZ2 A;  3UUX A;  4H7X A;  1OUV A;  3Q4A B;  1ELW A;  3LPZ A;  3WXX A;  3ASF A;  4ME2 A;  5EX3 A;  2FF4 A;  3CKB A;  4GZ3 A;  4GYW A;  4JHR A;  2LNI A;  5EX0 A;  4I17 A;  4N39 A;  4XIF A;  3AS5 A;  4NRH B;  4LEU A;  5G04 J;  4CGW A;  3K9I A;  4CGV A;  2XCC A;  3MKR A;  4GYY A;  4N3C A;  5LCW J;  3UPV A;  2I6H A;  4Y6W A;  1XNF A;  1NA3 A;  4GZ6 A;  5AYW D;  1FCH A;  5BW8 C;  3QOU A;  4BTB A;  3LCA A;  3ASD A;  3SF4 A;  5LCW C;  5KJK A;  2UWJ G;  2FI7 A;  3KD7 A;  4HOU A;  1NZN A;  5G04 C;  4KBQ A;  2VGX A;  4GA2 A;  3LY8 A;  2LSU A;  3OXL A;  4WND A;  2FO7 A;  3LY7 A;  1KLX A;  3ASG A;  3RO3 A;  4N2Q A;  2Q7F A;  3UQ3 A;  3EDT B;  3ESK A;  1IHG A;  3LYA A;  4G26 A;  2XCB A;  2QFC A;  1P5Q A;  4I2Z A;  4XI9 A;  2LSV A;  4GA0 A;  5EKQ D;  3TAX A;  4I2W A;  3CK7 A;  5BT1 A;  4GZ5 A;  4I9E A;  2YQ8 A;  3QKY A;  4U04 A;  4G23 A;  2KCK A;  3LY9 A;  3Q47 B;  4ABN A;  4G24 A;  4GCN A;  3S7B A;  2GW1 A;  4EQF A;  2VYI A;  3TGO A;  4HOS A;  1QQE A;  1QZ2 A;  4U07 A;  4HOT A;  2AVP A;  4NQ0 A;  2WQH A;  2XGM A;  3PDN A;  4G2V A;  5KJL A;  1Y8M A;  2IF4 A;  3OXF A;  3FWV A;  4JA9 A;  5JJ7 A;  4KYO B;  3OXG A;  3URZ A;  1HH8 A;  2KAT A;  3ASH A;  4RG9 A;  5CHE E;  3FFL A;  5DBK A;  3PE3 A;  4WNF A;  4UQX A;  3HYM B;  4N3B A;  5D0Q D;  2OND A;  4WUY A;  3GZ1 A;  4HOQ A;  4XI0 A;  1KT1 A;  3S7J A;  2PQR A;  2XEV A;  3KS2 A;  3CVP A;  5JJT A;  3CK9 A;  3VTY A;  1E96 B;  1KT0 A;  2UY1 B;  2BUG A;  2YHC A;  1ZBP A;  3RKV A;  2Y4U A;  2PL2 A;  3NF1 A;  4A1S A;  3FP3 A;  5ARF A;  2PQN A;  2R5S A;  4IN3 B;  4U0S A;  3ZPJ A;  4F3V A;  3Q5M A;  4HOR A;  5D0O D;  5G05 J;  3QWW A;  4WNG A;  3VTX A;  3GW4 A;  3MA5 A;  3E4B A;  3ZFW A;  3AS4 A;  4J8F A;  1HZ4 A;  3QDN A;  5G05 C;  2HR2 A;  3CVL A;  3IEG A;  5C1D A;  4GCO A;  3GYZ A;  4GPK A;  3TG5 A;  2WPV A;  1A17 A;  5FTP A;  4YND A;  5BNW A;  4UI9 J;  5CCL A;  4AY5 A;  1HXI A;  5CCM A;  4H7Y A;  2XPI A;  4J8E A;  4GYO A;  4O6F A;  3S7D A;  4Y6C A;  1NA0 A;  1ELR A;  2NC9 A;  3ZN3 A;  2C2L A;  4AM9 A;  2VGX B;  2VQ2 A;  3O48 A;  4CDR A;  1ZU2 A;  4UI9 C;  3RU0 A;  4W9R A;  3Q49 B;  4WNE A;  2VSY A;  1IYG A;  4I1A A;  5JJ6 A;  1WAO 1;  3AS8 A;  2KCL A;  1W3B A;  4UQZ A;  4APO A;  2KCV A;  2XGS A;  3CV0 A;  3LKU A;  5HQ8 A;  5M72 A;  4U0U A;  2DBA A;  4BWR A;  4JA7 A;  5FZS A;  2UY1 A;  3MV3 B;  1B89 A;  3BEE A;  2PZI A;  2E2E A;  2MHK A;  1YA0 A;  2XGO A;  4U0Z A;  4B94 A;  4AY6 A;  4GA1 A;  1PC2 A;  4J8D A;  3ZGQ A;  5A6C A;  2FBN A;  4JL0 A;  2KC7 A;  3CVQ A;  4G1T A;  4YVQ C;  4I9C A;  5HI7 A;  2FEZ A;  3JYS A;  5DIZ A;  3N71 A;  3S7F A;  3TG4 A;  2HYZ A;  5KJM A;  2VGY A;  3MEK A;  4UQY A;  3QWV A;  4N3A A;  5KJN A;  3U3W A;  3RJV A;  3CEQ A;  2Y4T A;  5FJY A;  3U4T A;  3ZHE B;  4BT9 A;  1WM5 A;  2JLB A;  2L6J A;  5ARG A;  3R9A B;  2VSN A;  3Q15 A;  5FZQ A;  3RIB A;  2J9Q A;  2V5F A;  4KXK B;  5FZR A;  2C0M A;  3CVN A;  3KAE A;  5A7D B;  2P58 C;  4J0U A;  1TJC A;  3ZHE A;  3PE4 A;  4BTA A;  3MV2 B;  3CK8 A;  3CKC A;  4RG6 A;  4UI9 K;  4AIF A;  2HO1 A;  4N2S A;  5FT9 A;  4G25 A;  3SZ7 A;  2OOE A;  4YVO A;  3QWP A;  2C0L A;  4BT8 A; 
#chains in the Genus database with same CATH topology
 3AJI A;  1UJK A;  3FUJ A;  1EF1 C;  2QY7 A;  2UWJ G;  2FI7 A;  1H2V C;  3LY8 A;  2LSU A;  3UT4 A;  3LXU X;  1Y6I A;  3EDT B;  2BKG A;  2XCB A;  3TAX A;  5AEN A;  5AJD A;  2XEE A;  2OVF A;  2F0Y A;  4BES A;  2XEH A;  4FAD A;  4LNU D;  1WDY A;  1TEZ A;  3ZIM A;  4AEZ C;  3TL5 A;  2CHW A;  3FP3 A;  3Q9N C;  3VLF A;  3FUD A;  3CSF A;  4JVS A;  2XZD G;  3GYZ A;  3E33 A;  4L2L A;  3TG5 A;  3O4Z A;  2QYU A;  4M7C A;  4UI9 C;  4W9R A;  5HS0 A;  3CQC B;  4LCT A;  3CV0 A;  2WXI A;  1L5J A;  2BED A;  1HO8 A;  4U0Z A;  3IBE A;  4EEC A;  3CEQ A;  2P9P G;  3QK0 A;  2C0M A;  2DWZ A;  4CT4 A;  3JCK C;  1K3Z D;  1UG3 A;  4KT6 B;  4JHJ A;  3RO2 A;  2MOW A;  3ESL A;  4GTT A;  3UIP C;  3QJZ A;  4GTP A;  1OY3 D;  4QFV A;  1MX6 A;  3Q78 A;  1FPP A;  3UPV A;  5AN8 A;  2I1K A;  3C5R A;  3EJN A;  4HLE A;  4GA2 A;  4N2Q A;  4G11 A;  1E90 A;  1N0Q A;  1O1T A;  3UT7 A;  2YQ8 A;  4KZ0 A;  1OWL A;  4ABN A;  2IU1 A;  1K1B A;  1QZ2 A;  3ENE A;  1TN7 A;  2JAB A;  2HM8 A;  2VSX E;  4N3B A;  4WUY A;  5EDS A;  5FQ4 A;  3V79 K;  5JHB A;  1HFA A;  3C72 A;  5ARF A;  2H6I A;  2X6K A;  4FHJ A;  2AW6 A;  4WNG A;  4IYP A;  3E4B A;  2A5U A;  4HFG A;  4U8V D;  3FUE A;  4HB5 A;  4O6F A;  1ELR A;  5CED B;  3G2U A;  3J5P A;  3CHP A;  1NFI E;  3JXI A;  3FU3 A;  1N4R A;  4ILI A;  4FHK A;  4O1O A;  2KC7 A;  4G1T A;  4GTS A;  3JQ1 A;  4A3T A;  3EHN A;  2CFZ A;  3B7R L;  4BT9 A;  3R9A B;  3LJ3 A;  3D9O A;  1MX2 A;  3UKR G;  3C3O A;  3OTN A;  3SZ7 A;  4AJW A;  3VLD A;  1SVX A;  1N4S A;  5B3S E;  4JHR A;  3DXK G;  1TNZ A;  1UN9 A;  4N39 A;  4F7A A;  2X3M A;  5FIN A;  4JXT A;  3CGH A;  4YDW A;  4PUC A;  2IEJ A;  3FY4 A;  2QYJ A;  1OCC E;  2V0P A;  1HH8 A;  1HU3 A;  4Z68 A;  2XS8 A;  3SFX A;  2PL2 A;  5LX8 A;  3UXG A;  4A3V A;  1G3N B;  3FTW A;  1HZ4 A;  1O1R A;  3ZU7 B;  4FLH A;  3L9T A;  1Q2Z A;  3E30 A;  3B95 A;  3U9W A;  5CCL A;  3ZYK A;  3EIJ A;  2WXN A;  3JUE A;  5D2M C;  4PH4 B;  2KXP C;  4PS7 A;  5FZS A;  4WAF A;  3ZYQ A;  2MHK A;  2XGO A;  4JEU A;  2ETC A;  4I9C A;  3FH5 A;  3AG1 E;  2HYZ A;  4LSZ E;  2EIL E;  3FTS A;  3G2T A;  3EU5 A;  2J9Q A;  2GRQ B;  4XKB A;  2P58 C;  1K8K G;  3AU4 A;  3CKC A;  4UWF A;  2XRZ A;  4K5B A;  3DSX A;  3IV0 A;  3R7Q A;  3ULQ A;  1NP7 A;  3HVE B;  2P2C P;  1H19 A;  3WXX A;  2V4L A;  3CKB A;  3L08 A;  3ONK A;  4RVB A;  1SZA A;  2OV8 A;  3SF4 A;  5KJK A;  2LAH A;  2GRR B;  1BU9 A;  1N11 A;  5A23 A;  1TYQ G;  4C48 B;  5HRY A;  4HBD A;  5AIJ A;  3ESK A;  2P9N G;  1SZ9 A;  5T8I A;  2PNN A;  5BT1 A;  3QKY A;  3CQG B;  3D9K A;  4APF A;  2A4Z A;  4B8C B;  3OXF A;  4B0Z A;  1S63 A;  3AG4 E;  4JC8 A;  3HYM B;  2VJ8 A;  1Z3X A;  1YCS B;  3KS2 A;  4G8L A;  3FU5 A;  4Q69 A;  1OWN A;  4IN3 B;  1E8W A;  4CDM A;  4F3V A;  3Q5M A;  2AJA A;  3FDH A;  2IOL A;  4J8F A;  4UUC A;  3LVR E;  5EYP F;  1FT1 A;  1HS6 A;  4UI9 J;  3D9J A;  5ENO D;  4AM9 A;  2VGX B;  3UM3 A;  4WWP A;  3FUF A;  4APO A;  2KCV A;  4C9B B;  4I43 A;  5ITZ F;  5FQ6 A;  2V8S E;  5HI7 A;  3JYS A;  2WXP A;  2J49 A;  1KZP A;  3ZHE B;  4DUI A;  4GTO A;  1TNU A;  4R7L A;  4OYS A;  1GW6 A;  3CHS A;  3QWP A;  3CVU A;  4EHM A;  3GZ2 A;  2X38 A;  5EIL A;  4ANU A;  3W9F A;  4FC8 A;  1N52 A;  4JD2 G;  1H6K A;  2RD0 A;  1N4Q A;  4I17 A;  4FA6 A;  4LEU A;  3C3R A;  1XNF A;  2P9S G;  4TUM A;  2LXL A;  4BTB A;  2VTB A;  3PZ4 A;  2EIN E;  4KBQ A;  3UKU G;  2EIK E;  4L23 A;  4FJY A;  3LY7 A;  4DX1 A;  3LYA A;  1O1S A;  1JUQ A;  4HLL A;  1OT8 A;  4I2W A;  4TRQ A;  3LY9 A;  4HI8 A;  2GW1 A;  5ANR A;  2L9B A;  4UWH A;  3DEP A;  5JJ7 A;  4KYO B;  4RG9 A;  5CHE E;  3I4G A;  2IQC A;  2YHC A;  5ENQ D;  5D66 A;  2L0T B;  2PQN A;  3T5V A;  3CHM A;  3VTX A;  3TWQ A;  2HR2 A;  3CVL A;  3EIQ C;  4TV3 A;  3QAR A;  3FTZ A;  4BET A;  2KBX A;  2C2L A;  3HHM A;  3RU0 A;  2GRN B;  4LNG A;  3U66 A;  4F6R D;  1B89 A;  3BEE A;  1MYO A;  1TNB A;  3D9H A;  2HE0 A;  5CMW A;  1YA0 A;  2P9L G;  3ZXS A;  3MYV A;  3ZXP A;  3QWV A;  2WMN A;  3U4T A;  4ILG A;  4Q96 A;  4LUN U;  3KAE A;  1SW6 A;  3AAA C;  4UI9 K;  3PEU B;  5G55 A;  2M63 A;  3DRA A;  3L54 A;  1U3D A;  3UUX A;  1OUV A;  4AXH A;  4U8H A;  2IO2 C;  5LCW J;  3QOU A;  3QB2 A;  3ZYL A;  5LCW C;  1RW2 A;  3KD7 A;  4HOU A;  5G04 C;  5ENS D;  3ZRH A;  4J8S A;  4ZFH A;  3P2B A;  3MKQ B;  5HKP A;  4JEH A;  2WXR A;  3HXB A;  4G23 A;  4GCN A;  3HRA A;  1QQE A;  3MKQ A;  5CBO A;  2XGM A;  3PDN A;  1Y8M A;  2R59 A;  1SA5 A;  4WNF A;  2ZIR A;  5LP0 A;  4PS3 A;  3JXJ A;  5ENR D;  2ETA A;  2DYS E;  5E75 A;  4HXI A;  3FUH A;  2CFU A;  2R02 A;  2XPI A;  4XEI G;  4CDR A;  5B1B E;  1WAO 1;  2KCL A;  4U0U A;  4BWR A;  2UY1 A;  2I9C A;  3F6Q A;  3X2Q E;  3ZGQ A;  4MLP A;  2LO6 A;  3TWT A;  1OXJ A;  3RRN B;  4UQY A;  2Y4T A;  3SHF A;  3FHE A;  2WVI A;  4GMJ A;  1FVH A;  5KNG A;  4HRL A;  1DNP A;  3RRU A;  1TR4 A;  4HS2 A;  4UWL A;  4GYW A;  1OWO A;  2LNI A;  5CMY A;  2DCP A;  2X6I A;  3EU9 A;  4FJZ A;  2XHE A;  4ANW A;  3TXN A;  2NSZ A;  3PEV B;  3DEO A;  2XZT G;  5CRV A;  3E37 A;  5BV1 A;  1UN8 A;  4XI9 A;  3FUI A;  3PRE A;  1EPU A;  4G24 A;  3WG7 E;  2VSO E;  2WQH A;  3FWV A;  5DBK A;  2KZT A;  3EHM A;  2Y3A A;  4HOQ A;  4WWN A;  3ULE G;  4DX2 A;  2IJG X;  3VTY A;  5B1A E;  5EYL A;  3I4R B;  2AXU A;  4DK5 A;  3EHQ A;  3GW4 A;  3MA5 A;  2GRO B;  1IKN D;  4BFR A;  1FVF A;  4BY6 A;  1TNY A;  3ABL E;  1H0A A;  2DZN A;  3QC1 A;  4J8E A;  2NC9 A;  4B93 B;  5HQ8 A;  3PZ2 A;  3NOC D;  1OCR E;  4ZHB A;  3MV3 B;  3PZ3 A;  1E8X A;  2J8S D;  4BEP A;  3ULY A;  2AWI A;  3AG2 E;  3AU5 A;  3RJV A;  4ANX A;  1LD8 A;  2L6J A;  3SFZ A;  2V5F A;  5JA4 D;  3G2V A;  4BTA A;  2J4B A;  2R2L A;  4GZD A;  3W9G A;  3BG1 B;  2C0L A;  2J07 A;  1ELW A;  3SQV A;  1N9A A;  2FF4 A;  3SI5 A;  1U2V G;  4GYY A;  4K5C A;  1PAQ A;  1NA3 A;  1HG2 A;  4GTV A;  2NXP A;  1D8E A;  1NZN A;  4HVB A;  2VGX A;  2FO7 A;  2ZXW E;  1VDY A;  5G2N A;  3SNX A;  5EKQ D;  3APD A;  3RRM B;  3EUV A;  1AP7 A;  4U95 D;  4G2V A;  5J08 A;  3KSQ A;  4DI4 A;  3Q7A A;  4FP7 A;  5JJT A;  1MHQ A;  1KT0 A;  2QZA A;  2Y4U A;  3NF1 A;  4HOR A;  2WB2 A;  2XEN A;  2WXJ A;  4GZC A;  4DRX E;  3NQP A;  4A1G A;  4BSX A;  4A63 B;  3OAW A;  2PM7 A;  4AVX A;  1ZU2 A;  4L9P A;  3FU0 A;  3AS8 A;  4AOF A;  2WXG A;  4XKC A;  4B89 A;  1UOH A;  4AY6 A;  3B13 A;  5A6C A;  4JL0 A;  3CVQ A;  3DSV A;  3UIO C;  3KEZ A;  3LVQ E;  4C0M A;  5AJL A;  1WM5 A;  2JLB A;  3C98 A;  1BLX B;  3RIB A;  1JCS A;  4KXK B;  3ONL A;  3FTY A;  3ZHE A;  4LER A;  5BPP A;  3Q4A B;  2RKK A;  3MX3 A;  4J7W A;  4GZ3 A;  3D9P A;  2FO1 E;  2Y0B G;  4L7T A;  4CGW A;  4BER A;  2XCC A;  3MKR A;  4N3C A;  5AYW D;  3KSL A;  4JHK A;  3ASD A;  3CHQ A;  2R05 A;  2LUH A;  1IHG A;  4BT8 A;  2IO3 C;  3CK7 A;  3CVX A;  4DI3 A;  3JUI A;  3BU8 A;  2CHZ A;  2CG2 A;  3DWL G;  1ELK A;  4HQD A;  4TXR A;  5KCM A;  4JZY A;  1JCR A;  4OVV A;  4EPZ A;  4XE0 A;  3FTV A;  1IHB A;  3QWW A;  3HXF A;  2ZU6 B;  2WXM A;  1H2U A;  3QDN A;  4ACK A;  2GGF A;  3MGB A;  1UJJ A;  5FWQ A;  3RK6 A;  5CCM A;  3SFY A;  3E32 A;  2GRP B;  2WMO A;  4Y6C A;  1DCE A;  1QBQ A;  3ZN3 A;  1INZ A;  4JPS A;  3Q49 B;  3RAU A;  2VSY A;  2Y1L E;  4F1P A;  3L13 A;  5AQA A;  4B94 A;  4JB8 P;  1OWP A;  3ZNG A;  3NB2 A;  4YDY A;  3U64 A;  1S64 A;  5FJY A;  4MKT A;  3FUK A;  2BKK B;  4I6E A;  4NIK A;  1Z5S C;  2EIJ E;  4J0U A;  1MJ0 A;  3ZUV B;  2MRI A;  4XX5 A;  4UWK A;  4OVU A;  5BXU A;  3FEY A;  1UW4 B;  5E76 A;  4CGV A;  2LAI A;  3LCA A;  5JMN D;  5EN5 D;  3UT8 A;  2WM9 A;  2V5Q C;  2WXL A;  3ASG A;  4L1B A;  1D8D A;  4I2Z A;  3J5Q B;  3G2S A;  4CRW A;  3T8M A;  3Q47 B;  2DVW A;  2Y69 E;  4G8K A;  4NQ0 A;  2CG3 A;  3TWV A;  4JA9 A;  2IF4 A;  1IQR A;  3HXC A;  4CEM A;  4DLO A;  3SBS A;  3S2A A;  3L82 A;  4OAU C;  2X6F A;  2UY1 B;  3RKV A;  1E8Y A;  5EID A;  2R5S A;  3CR3 A;  4U0S A;  3FUM A;  3BUA A;  4P29 A;  2WQ6 A;  3CVY A;  4GCO A;  4IRU A;  4YND A;  4DX6 D;  1Z3Y A;  3LS8 A;  4PDX A;  1H6P A;  4HOT A;  4AV7 A;  4U7E B;  4LNB A;  1DVP A;  4FUL A;  3PUJ A;  4GA1 A;  2FEZ A;  1N94 A;  4U96 D;  5KJN A;  3DBS A;  4I1M A;  3NZU A;  5ARG A;  1HF8 A;  2R03 A;  5FQ8 A;  2MYO A;  2OEW A;  3ZVV A;  2WXH A;  3ML8 A;  2VTB B;  1HG5 A;  4CCA A;  2ZGD A;  3UTM A;  3B7U X;  5EX0 A;  1N4P A;  5CEA A;  3DXM G;  4BX9 A;  4Y6W A;  3PH0 C;  4E85 A;  5BW8 C;  3ZYM A;  1X5B A;  5T3R A;  2P9K G;  1X81 A;  3IHV A;  2Q7F A;  4HRN A;  2E0I A;  2GRL A;  1YMP A;  1P5Q A;  3NAW A;  3IKO B;  1PY1 A;  3ASH A;  4GTM A;  4EBA G;  3R7R A;  2OND A;  5JHA A;  2PQR A;  3V2O A;  3AG3 E;  4WWO A;  2LXM A;  1U3C A;  2KZT B;  2XQ0 A;  3CIA A;  4C0E A;  4TXP A;  1JCQ A;  1N95 A;  3UM1 A;  5C1D A;  3MCX A;  5AAR A;  1NA0 A;  4AP2 A;  3UX4 A;  1LF8 A;  5CRU A;  4WNE A;  5J90 A;  2AXZ A;  2XGS A;  3LKU A;  3DSS A;  3FTU A;  4JW1 A;  3LJN A;  2E2E A;  2KM4 A;  1YYH A;  3ZKJ A;  4J8D A;  1PC2 A;  2FBN A;  3P1U A;  4YVQ C;  1OCZ E;  3ISM C;  4GPK A;  4F1S A;  4K0R A;  3FH7 A;  3CVN A;  4GMR A;  1TJC A;  4CT0 A;  5ANL A;  5FT9 A;  4N2S A;  4G25 A;  2RG8 A;  4MS6 A;  3Q9U C;  3L16 A;  3ASF A;  5G04 J;  3AS5 A;  2AXV A;  3DST A;  4DX7 D;  5AQB A;  3DSW A;  5LOZ A;  5ENP D;  1RZ4 A;  4WND A;  1NI1 A;  2LSV A;  4GA0 A;  4D10 C;  1N54 A;  3PVL A;  1IXV A;  1EYH A;  4U07 A;  3URZ A;  2KAT A;  3FFL A;  3PE3 A;  4UQX A;  3PNL B;  3UMV A;  3CVP A;  3I3N A;  4K5A B;  2IY0 C;  3ZPJ A;  4RSY A;  5G05 J;  3FEX A;  2J08 A;  5G05 C;  2YNQ A;  3SBT B;  4KZC A;  2A5E A;  3S7D A;  1E7V A;  3SGH A;  3O48 A;  5CEC B;  2ETB A;  2F8X K;  1W3B A;  1FT2 A;  1V54 E;  3RSE G;  2GRM A;  3PZD A;  1OCO E;  4ATZ D;  4HRM B;  3LEW A;  3BQO A;  4HNA D;  3NOG D;  4RLY A;  5ENT D;  1WG0 A;  3CK8 A;  3Q7F A;  2L0I A;  2I2O A;  5AQ9 A;  4HI9 A;  3LPZ A;  2DIW A;  3KEA A;  5CER B;  3PZ1 A;  1TJF A;  1H6O A;  1JWF A;  3ASN E;  2I6H A;  2XPY A;  4V3I A;  5T4Y A;  2DZO A;  4F53 A;  2X6J A;  5ENN A;  3HDX A;  1QNF A;  1S0P A;  3HIZ A;  3FU6 A;  1QYM A;  4A55 A;  3V30 A;  3TWR A;  2EQX A;  4I9E A;  4U04 A;  5KWD A;  2H6H A;  4NUR A;  4DLQ A;  4GU5 A;  2F37 A;  2AVP A;  5KJL A;  3Q73 A;  3D3M A;  3QNK A;  4GTQ A;  3DPY A;  4B8A A;  4XI0 A;  1E96 B;  2WQ7 A;  3DPD A;  2FUL A;  2OVB A;  3APC A;  3IEG A;  4IUL A;  5KNH D;  2XS1 A;  4K03 A;  1A17 A;  4DX5 D;  2QC9 A;  3GZS A;  2VQ2 A;  4GB9 A;  4YDO A;  3TXM A;  2R17 C;  5FQ7 A;  5M72 A;  2DBA A;  4DPR A;  3LDZ A;  1BPO A;  3ABK E;  4TUU A;  2J09 A;  5DIZ A;  3S7F A;  3U3W A;  1EDU A;  1D9S A;  1WY6 A;  4FLB A;  2WXQ A;  4EZJ A;  3C3Q A;  2YHE A;  4GPM A;  3B7B A;  5A7D B;  3IXE A;  2DYR E;  2XRY A;  4URK A;  2HO1 A;  3R9M A;  3G2W A;  2RFM A;  4EBA A;  5EX3 A;  4GML A;  2NYJ A;  2PM6 A;  3UI2 A;  4QQI A;  3UM0 A;  4GTR A;  3UQ3 A;  3PNT B;  1MQS A;  2QFC A;  4GZ5 A;  2H6F A;  4N5Q A;  3CLJ A;  2WXK A;  4HOS A;  4UWG A;  4LRZ A;  3FH8 A;  1O5M A;  5D0Q D;  1ZB1 A;  3V31 A;  2F8Y A;  1XGW A;  4ILH B;  1KT1 A;  2I1J A;  2XEV A;  3B7T A;  3S7J A;  3L22 A;  3CK9 A;  2BUG A;  1ZBP A;  1DC2 A;  2ILR A;  1S70 B;  3ZFW A;  3PS6 A;  4MRU A;  1TN8 A;  4GAA A;  3HXD A;  2WPV A;  2CHX A;  3DSU A;  4EZK A;  3ASO E;  2RFA A;  5BNW A;  3BG0 B;  4I6G A;  3T5X A;  1IYG A;  3IHY A;  2B6C A;  4X8Q A;  4UQZ A;  4EZL A;  1MX4 A;  3I5P A;  2PZI A;  4NAC A;  4U8Y D;  4PS8 A;  3N71 A;  2P9U G;  1Z6T A;  1JWG A;  4N3A A;  2WXO A;  5C2Y A;  2ZIS A;  5FZR A;  3APF A;  5IY5 E;  4O1P A;  3MV2 B;  4RG6 A;  2OEV A;  3L17 A;  4YVO A;  1KPS B;  3ABM E;  4N5C A;  2IFU A;  3UIN C;  4H7X A;  1V55 E;  4TXQ A;  3D9L A;  4ME2 A;  2EIM E;  4Q94 A;  4L2Y A;  2BF0 X;  3FUN A;  3K9I A;  1N0R A;  2WXF A;  1FCH A;  5AQ7 A;  2BTD A;  5CBN A;  3OXL A;  4ANV A;  2V4H C;  3PRZ A;  2VGE A;  3FUL A;  1E8Z A;  4J6I A;  2KCK A;  3S7B A;  3SY2 A;  2VYI A;  3CHO A;  1OWM A;  3TWS A;  2B0O E;  3TWX A;  3GZ1 A;  1TNO A;  5BUZ A;  4KVO A;  4A1S A;  1BI7 B;  5AAO A;  4ACL A;  5D0O D;  4M3O A;  2ION A;  1K1A A;  3MZL B;  2P9I G;  3MJW A;  4AY5 A;  4H7Y A;  5LFA A;  2J4D A;  4I1A A;  5JJ6 A;  1SA4 A;  1SQM A;  1HX8 A;  3CST A;  3TG4 A;  5KJM A;  2VGY A;  1BI8 B;  4BSZ B;  5BXO A;  3SD5 A;  3D9N A;  5FZQ A;  1TN6 A;  1E7U A;  4CZ2 D;  3D9I A;  3PE4 A;  4AIF A;  5FIO A;  3VLE A;  2OCC E;  3ZW3 A;  3ZEF A;  3TWW A;  4KMO A;  4KVM A;  1BD8 A;  4J8Y A;  1DCQ A;  4XIF A;  4NRH B;  3CVV A;  3PUK A;  2JEK A;  3JQ0 A;  3Q79 A;  2H6G A;  4GZ6 A;  3L6A A;  2IOS A;  1KZO A;  3UM2 A;  4DJA A;  4U63 A;  1LD7 A;  3D9M A;  3RO3 A;  1KLX A;  2L6B A;  4G26 A;  2X6H A;  2XPZ A;  5BV0 A;  3HG0 D;  1HE8 A;  4EQF A;  3TGO A;  4LG6 A;  4CDN A;  3OXG A;  1NL4 A;  3E34 A;  1LTX A;  1AWC B;  3V2X A;  4I6J A;  4CYM D;  1A5E A;  4RQI A;  3AS4 A;  4YDE A;  2YIN A;  5FTP A;  4BX8 A;  4E6H A;  3HXE A;  1HXI A;  4GYO A;  3TWU A;  4MBG A;  3B7S A;  4OAV B;  3T9K A;  3NBN B;  4I1O B;  4ATG A;  4JA7 A;  1MZC A;  3FTX A;  3SO8 A;  5H7P A;  3EHR A;  1H2T C;  3NZS A;  3TJP A;  2ZGG A;  4O60 A;  5KBA A;  3QAQ A;  3MEK A;  3HVE A;  1JPL A;  3CHR A;  2VSN A;  3Q15 A;  4XZ4 A;  3CVW A;  4FU3 A;  3Q75 A;  1IQU A;  5EIB E;  3ML9 A;  3T8K A;  2OOE A; 
#chains in the Genus database with same CATH homology
 2L0I A;  2I2O A;  3GZ2 A;  2X38 A;  4ANU A;  3Q4A B;  1UJK A;  3MX3 A;  4FC8 A;  1N52 A;  3LPZ A;  2DIW A;  1H6K A;  4GZ3 A;  3D9P A;  4L7T A;  2RD0 A;  4I17 A;  4CGW A;  1TJF A;  4FA6 A;  4LEU A;  2XCC A;  1JWF A;  3FUJ A;  3MKR A;  4N3C A;  1EF1 C;  2I6H A;  1XNF A;  2XPY A;  4V3I A;  5T4Y A;  5AYW D;  2QY7 A;  4F53 A;  4JHK A;  4BTB A;  3ASD A;  2VTB A;  2X6J A;  5ENN A;  2UWJ G;  2FI7 A;  3CHQ A;  4KBQ A;  3HDX A;  1QNF A;  1H2V C;  1S0P A;  2LSU A;  3LY8 A;  4FJY A;  4L23 A;  3HIZ A;  3LY7 A;  3UT4 A;  3FU6 A;  3LXU X;  4A55 A;  1Y6I A;  3EDT B;  1IHG A;  3LYA A;  4BT8 A;  2XCB A;  3TAX A;  1JUQ A;  4I2W A;  4TRQ A;  5AEN A;  3CK7 A;  2EQX A;  4I9E A;  4DI3 A;  3CVX A;  5AJD A;  3JUI A;  4U04 A;  3LY9 A;  2CHZ A;  2CG2 A;  1ELK A;  4NUR A;  4DLQ A;  2OVF A;  2GW1 A;  4GU5 A;  5ANR A;  5KCM A;  2L9B A;  4UWH A;  2AVP A;  4JZY A;  5KJL A;  5JJ7 A;  3D3M A;  4KYO B;  4OVV A;  3QNK A;  4RG9 A;  5CHE E;  4FAD A;  3I4G A;  2IQC A;  4B8A A;  4EPZ A;  4XI0 A;  1TEZ A;  4XE0 A;  3ZIM A;  4AEZ C;  1E96 B;  2YHC A;  3TL5 A;  2WQ7 A;  2L0T B;  2CHW A;  3DPD A;  3FTV A;  3FP3 A;  2PQN A;  3T5V A;  2FUL A;  3VLF A;  3CHM A;  3QWW A;  3VTX A;  2ZU6 B;  3FUD A;  2WXM A;  1H2U A;  3CSF A;  3QDN A;  2OVB A;  2HR2 A;  3APC A;  3CVL A;  3IEG A;  4IUL A;  4JVS A;  4ACK A;  3EIQ C;  2GGF A;  3GYZ A;  4K03 A;  3MGB A;  4L2L A;  3TG5 A;  4TV3 A;  1A17 A;  1UJJ A;  3QAR A;  5FWQ A;  3RK6 A;  3O4Z A;  3FTZ A;  5CCM A;  3GZS A;  2WMO A;  4Y6C A;  3ZN3 A;  1INZ A;  2C2L A;  2VQ2 A;  3HHM A;  4JPS A;  4GB9 A;  4UI9 C;  3RU0 A;  4W9R A;  3Q49 B;  3TXM A;  2VSY A;  3CQC B;  2R17 C;  4LCT A;  5FQ7 A;  3CV0 A;  3U66 A;  5M72 A;  2DBA A;  2WXI A;  3L13 A;  4DPR A;  3LDZ A;  1L5J A;  1B89 A;  3BEE A;  1BPO A;  1HO8 A;  4U0Z A;  1YA0 A;  4B94 A;  5CMW A;  1OWP A;  3IBE A;  3ZXS A;  3MYV A;  4TUU A;  2J09 A;  5DIZ A;  3S7F A;  3U64 A;  3QWV A;  4EEC A;  3U3W A;  3CEQ A;  5FJY A;  1EDU A;  2WMN A;  3U4T A;  1WY6 A;  4FLB A;  4MKT A;  2WXQ A;  3QK0 A;  4EZJ A;  2C0M A;  2YHE A;  3FUK A;  4ILG A;  4Q96 A;  4CT4 A;  4I6E A;  3KAE A;  4LUN U;  5A7D B;  4J0U A;  3JCK C;  2XRY A;  4URK A;  4UI9 K;  3PEU B;  2MRI A;  2HO1 A;  5G55 A;  2M63 A;  1UG3 A;  4XX5 A;  3L54 A;  1U3D A;  4KT6 B;  4JHJ A;  3RO2 A;  4UWK A;  2MOW A;  3ESL A;  4OVU A;  3UUX A;  3FEY A;  1OUV A;  3G2W A;  4AXH A;  3QJZ A;  4U8H A;  4EBA A;  5EX3 A;  1UW4 B;  4QFV A;  4GML A;  5E76 A;  3UPV A;  4CGV A;  5LCW J;  2I1K A;  2LAI A;  2PM6 A;  3QOU A;  3LCA A;  3QB2 A;  3EJN A;  3ZYL A;  5LCW C;  3KD7 A;  4HOU A;  4HLE A;  3UT8 A;  5G04 C;  2WM9 A;  4GA2 A;  2WXL A;  3ZRH A;  4N2Q A;  3ASG A;  4J8S A;  3UQ3 A;  4G11 A;  3PNT B;  1MQS A;  3P2B A;  3MKQ B;  4I2Z A;  2QFC A;  4L1B A;  1E90 A;  4JEH A;  4GZ5 A;  3UT7 A;  3G2S A;  2WXR A;  2YQ8 A;  4KZ0 A;  1OWL A;  3CLJ A;  3T8M A;  4G23 A;  4CRW A;  2WXK A;  3Q47 B;  2IU1 A;  4GCN A;  4ABN A;  4HOS A;  1QQE A;  1QZ2 A;  3MKQ A;  3ENE A;  4NQ0 A;  2CG3 A;  2XGM A;  3PDN A;  1Y8M A;  2IF4 A;  4JA9 A;  2R59 A;  4UWG A;  1IQR A;  2HM8 A;  2VSX E;  4LRZ A;  3FH8 A;  4CEM A;  4WNF A;  5D0Q D;  4DLO A;  4N3B A;  5LP0 A;  4PS3 A;  4WUY A;  3SBS A;  1XGW A;  3S2A A;  4ILH B;  1KT1 A;  2I1J A;  2XEV A;  3B7T A;  3S7J A;  2X6F A;  3L22 A;  3CK9 A;  5EDS A;  5FQ4 A;  2BUG A;  2UY1 B;  3RKV A;  1ZBP A;  5JHB A;  1E8Y A;  1HFA A;  5ARF A;  2R5S A;  2X6K A;  2ILR A;  3CR3 A;  4FHJ A;  3FUM A;  4U0S A;  2AW6 A;  4WNG A;  4P29 A;  4IYP A;  2WQ6 A;  3E4B A;  5E75 A;  3ZFW A;  3PS6 A;  4HXI A;  3FUH A;  2A5U A;  4MRU A;  4GAA A;  3CVY A;  4GCO A;  2CFU A;  4HFG A;  2WPV A;  2CHX A;  4IRU A;  4EZK A;  4YND A;  5BNW A;  3FUE A;  1Z3Y A;  3LS8 A;  3BG0 B;  2XPI A;  4O6F A;  1ELR A;  4PDX A;  4CDR A;  4I6G A;  3T5X A;  3G2U A;  1IYG A;  3IHY A;  1WAO 1;  4UQZ A;  2KCL A;  4EZL A;  4HOT A;  4U0U A;  4AV7 A;  4BWR A;  3I5P A;  3CHP A;  2UY1 A;  2PZI A;  2I9C A;  4NAC A;  1DVP A;  4FUL A;  3FU3 A;  3PUJ A;  4GA1 A;  4ILI A;  3ZGQ A;  4FHK A;  2KC7 A;  4G1T A;  4A3T A;  3JQ1 A;  3EHN A;  4MLP A;  2LO6 A;  2FEZ A;  4PS8 A;  3RRN B;  3N71 A;  2CFZ A;  3B7R L;  1Z6T A;  4UQY A;  1JWG A;  4N3A A;  3DBS A;  2WXO A;  4I1M A;  2Y4T A;  3SHF A;  4BT9 A;  5KJN A;  5C2Y A;  3NZU A;  5ARG A;  1HF8 A;  3R9A B;  3LJ3 A;  5FQ8 A;  5FZR A;  3D9O A;  3APF A;  3FHE A;  2WVI A;  4GMJ A;  1FVH A;  3ZVV A;  3MV2 B;  4RG6 A;  3L17 A;  3OTN A;  3SZ7 A;  4YVO A;  4AJW A;  3VLD A;  2WXH A;  1DNP A;  3ML8 A;  3RRU A;  2VTB B;  4N5C A;  1HG5 A;  2IFU A;  4H7X A;  4HS2 A;  4CCA A;  3D9L A;  4ME2 A;  4UWL A;  4GYW A;  3B7U X;  4JHR A;  1OWO A;  2LNI A;  4Q94 A;  2DCP A;  5CMY A;  5EX0 A;  4L2Y A;  1UN9 A;  4N39 A;  2BF0 X;  2X6I A;  3FUN A;  3K9I A;  4F7A A;  4FJZ A;  4BX9 A;  2X3M A;  4Y6W A;  2XHE A;  3PH0 C;  4ANW A;  4E85 A;  2WXF A;  1FCH A;  5BW8 C;  3TXN A;  2NSZ A;  3ZYM A;  3PEV B;  4JXT A;  1X5B A;  5T3R A;  2BTD A;  3CGH A;  3OXL A;  5BV1 A;  1UN8 A;  3IHV A;  2Q7F A;  4ANV A;  2E0I A;  2GRL A;  4XI9 A;  1P5Q A;  3FUI A;  3PRZ A;  3PRE A;  4PUC A;  3FUL A;  1EPU A;  1E8Z A;  4J6I A;  2KCK A;  4G24 A;  3FY4 A;  3S7B A;  2VYI A;  3IKO B;  1PY1 A;  2VSO E;  3CHO A;  2WQH A;  1OWM A;  3FWV A;  2V0P A;  1HH8 A;  3ASH A;  5DBK A;  2KZT A;  3EHM A;  2Y3A A;  4EBA G;  1HU3 A;  3R7R A;  2OND A;  5JHA A;  3GZ1 A;  4HOQ A;  4WWN A;  2PQR A;  5BUZ A;  2IJG X;  3VTY A;  4KVO A;  4WWO A;  2PL2 A;  5LX8 A;  4A1S A;  1U3C A;  3I4R B;  2KZT B;  4A3V A;  2AXU A;  2XQ0 A;  3CIA A;  4ACL A;  4C0E A;  4DK5 A;  5D0O D;  3FTW A;  4M3O A;  3GW4 A;  3MA5 A;  2ION A;  1HZ4 A;  4BFR A;  5C1D A;  4FLH A;  1FVF A;  3MCX A;  4BY6 A;  3MZL B;  1H0A A;  3U9W A;  5CCL A;  3MJW A;  3QC1 A;  3ZYK A;  4AY5 A;  4H7Y A;  4J8E A;  5LFA A;  3EIJ A;  1NA0 A;  2WXN A;  2NC9 A;  4AP2 A;  2J4D A;  3UX4 A;  4PH4 B;  1LF8 A;  4WNE A;  5J90 A;  4I1A A;  4PS7 A;  2AXZ A;  5JJ6 A;  5HQ8 A;  2XGS A;  3LKU A;  1SQM A;  5FZS A;  3FTU A;  1HX8 A;  4WAF A;  3MV3 B;  4JW1 A;  3ZYQ A;  2E2E A;  2KM4 A;  2MHK A;  2XGO A;  4JEU A;  1E8X A;  1PC2 A;  4J8D A;  2FBN A;  3P1U A;  4YVQ C;  3CST A;  4I9C A;  3FH5 A;  3TG4 A;  2AWI A;  2HYZ A;  2VGY A;  5KJM A;  3AU5 A;  4GPK A;  3FTS A;  3RJV A;  4ANX A;  3G2T A;  3SD5 A;  4F1S A;  2L6J A;  3SFZ A;  3D9N A;  4K0R A;  5FZQ A;  2J9Q A;  2V5F A;  3FH7 A;  3CVN A;  3G2V A;  4XKB A;  1E7U A;  2P58 C;  1TJC A;  3D9I A;  3PE4 A;  3AU4 A;  2J4B A;  3CKC A;  4BTA A;  4UWF A;  4AIF A;  2XRZ A;  4GZD A;  3VLE A;  5ANL A;  5FT9 A;  4CT0 A;  4N2S A;  4G25 A;  2RG8 A;  3BG1 B;  3IV0 A;  2C0L A;  3R7Q A;  3ZW3 A;  3ULQ A;  1NP7 A;  2J07 A;  3HVE B;  3ZEF A;  4MS6 A;  1H19 A;  1ELW A;  3L16 A;  3WXX A;  3ASF A;  4KMO A;  2V4L A;  2FF4 A;  3CKB A;  4KVM A;  3SI5 A;  3L08 A;  3ONK A;  4XIF A;  5G04 J;  3AS5 A;  4NRH B;  3CVV A;  3PUK A;  2JEK A;  4GYY A;  4RVB A;  3JQ0 A;  1PAQ A;  1NA3 A;  1SZA A;  4GZ6 A;  2OV8 A;  1HG2 A;  3L6A A;  3SF4 A;  2AXV A;  2NXP A;  5KJK A;  2IOS A;  2LAH A;  4DJA A;  1NZN A;  4U63 A;  3D9M A;  4HVB A;  2VGX A;  5LOZ A;  4WND A;  5A23 A;  2FO7 A;  3RO3 A;  1KLX A;  5AIJ A;  3ESK A;  4G26 A;  5G2N A;  1VDY A;  3SNX A;  1SZ9 A;  2LSV A;  4GA0 A;  5EKQ D;  5T8I A;  2X6H A;  4D10 C;  5BT1 A;  2XPZ A;  3APD A;  1N54 A;  3RRM B;  5BV0 A;  3QKY A;  3PVL A;  1EYH A;  1HE8 A;  3CQG B;  3D9K A;  4APF A;  4EQF A;  3TGO A;  2A4Z A;  4U07 A;  4G2V A;  4B8C B;  3OXF A;  4CDN A;  3URZ A;  3OXG A;  5J08 A;  2KAT A;  4DI4 A;  4B0Z A;  3FFL A;  3PE3 A;  4JC8 A;  4UQX A;  3HYM B;  2VJ8 A;  3PNL B;  1Z3X A;  4FP7 A;  3UMV A;  3KS2 A;  5JJT A;  3CVP A;  1MHQ A;  3I3N A;  1KT0 A;  3FU5 A;  2Y4U A;  3NF1 A;  4Q69 A;  1OWN A;  4HOR A;  4IN3 B;  1E8W A;  4CDM A;  4I6J A;  3ZPJ A;  3Q5M A;  4F3V A;  2WB2 A;  4RSY A;  5G05 J;  2WXJ A;  4GZC A;  3FDH A;  3FEX A;  3NQP A;  2IOL A;  2J08 A;  3AS4 A;  4J8F A;  5G05 C;  2YNQ A;  3LVR E;  2YIN A;  3SBT B;  4A1G A;  5FTP A;  4BSX A;  1HS6 A;  4BX8 A;  4E6H A;  4UI9 J;  4KZC A;  1HXI A;  3D9J A;  3S7D A;  4GYO A;  1E7V A;  3SGH A;  3B7S A;  3OAW A;  2PM7 A;  4AVX A;  4AM9 A;  2VGX B;  3O48 A;  1ZU2 A;  4I1O B;  4WWP A;  3FUF A;  3FU0 A;  3AS8 A;  4APO A;  4ATG A;  1W3B A;  2KCV A;  4JA7 A;  4C9B B;  4I43 A;  4AOF A;  3FTX A;  2WXG A;  4XKC A;  1H2T C;  4B89 A;  4AY6 A;  3NZS A;  5FQ6 A;  3B13 A;  3TJP A;  4JL0 A;  3CVQ A;  5A6C A;  2V8S E;  5HI7 A;  3KEZ A;  3LVQ E;  4C0M A;  3JYS A;  2WXP A;  2J49 A;  3QAQ A;  3MEK A;  5AJL A;  2GRM A;  3HVE A;  3PZD A;  3ZHE B;  1JPL A;  1WM5 A;  2JLB A;  3LEW A;  3C98 A;  3CHR A;  2VSN A;  3Q15 A;  4XZ4 A;  3CVW A;  3RIB A;  4FU3 A;  4KXK B;  1IQU A;  3ONL A;  3FTY A;  3ZHE A;  3CK8 A;  3ML9 A;  4R7L A;  4LER A;  4OYS A;  1GW6 A;  5BPP A;  2OOE A;  3CHS A;  3QWP A;  3CVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...