3K9IA

Crystal structure of putative protein binding protein (np_241345.1) from bacillus halodurans at 2.71 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
110
structure length
110
Chain Sequence
AQAVPYYEKAIASGLQGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative protein binding protein (NP_241345.1) from Bacillus halodurans at 2.71 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Protein binding
molecule keywords BH0479 protein
total genus 39
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3k9iA01
1ZBPA 2VQ2A 1NZNA 3FP3A 5FTPA 2WPVA 3PE4A 3QWPA 5JJ6A 3R9AB 4CGVA 5G04C 4N39A 4XIFA 1KT1A 5A7DB 4NRHB 1P5QA 2C0LA 4I1AA 5ARGA 4GYYA 5JJ7A 4G23A 2OOEA 4U0SA 4BWRA 2LSVA 2IF4A 2R5SA 2VGXB 3GW4A 3QWVA 1IHGA 3ZHEB 4N3AA 5EX3A 4GYWA 5EX0A 3S7FA 3SF4A 3PDNA 4U04A 3KD7A 5BNWA 4RG6A 2PL2A 3KS2A 4UQZA 2Y4UA 1QQEA 2HO1A 2PQNA 3MA5A 5DBKA 4GPKA 1IYGA 3ASHA 2FBNA 2ONDA 4UQXA 1TJCA 3ASGA 3LY9A 3QOUA 4U0ZA 2WQHA 3BEEA 3UUXA 4AM9A 3VTXA 3ZGQA 2KCLA 4G1TA 3TGOA 1HXIA 1WM5A 1OUVA 4HOQA 4U07A 4U0UA 4H7YA 2PQRA 4KXKB 1ZU2A 5FZRA 4H7XA 3WXXA 3UPVA 4UI9C 4WNGA 2E2EA 2FEZA 2XGMA 4KYOB 4UI9J 4EQFA 3CKBA 4N5CA 4WNFA 3LYAA 4A1SA 4ABNA 4F3VA 5LCWC 5D0QD 3EDTB 4APOA 4I2WA 5CCMA 2NC9A 3MV3B 2FI7A 3RO3A 4JHRA 1HZ4A 4G25A 4G26A 4WNDA 4XI0A 5G05C 3SZ7A 3Q49B 3QDNA 4YNDA 1Y8MA 4B94A 2HYZA 3CK9A 3LY8A 3NF1A 3LY7A 5FZSA 1QZ2A 2HR2A 3ESKA 1NA3A 4G2VA 2V5FA 1HH8A 3CVPA 4GCNA 5DIZA 2C2LA 2I6HA 5FT9A 3TG5A 1B89A 4W9RA 3CVNA 4N3CA 5AYWD 3TAXA 4GZ3A 2AVPA 4GZ5A 3Q15A 5D0OD 5G05J 4BT8A 4JL0A 4N3BA 2LSUA 4GZ6A 2FO7A 4I9CA 3LCAA 3RKVA 4JA9A 3URZA 3ASDA 4I17A 2L6JA 4G24A 4XI9A 4UQYA 4J8DA 4GA0A 5G04J 5JJTA 2IFUA 2YQ8A 4I9EA 5KJKA 4UI9K 3OXLA 4HORA 3AS4A 3S7BA 4WNEA 2VGYA 4CDRA 3RU0A 4YVQC 2UY1A 1WAO1 3ZHEA 2UWJG 2Y4TA 5FZQA 4KBQA 4ME2A 5HQ8A 2YHCA 2DBAA 2LNIA 3ZN3A 3AS5A 5LCWJ 4NQ0A 4AY6A 4Y6CA 3UQ3A 1ELRA 3RO2A 4CGWA 2VSNA 4J8EA 5KJMA 5C1DA 3ZPJA 4GA2A 3OXFA 3AS8A 3ULQA 4GA1A 3CVQA 2BUGA 4GYOA 3Q47B 5BW8C 3ZFWA 2KCVA 5KJNA 3OXGA 3LPZA 4IN3B 3RJVA 2GW1A 4BTBA 4LEUA 2KC7A 2XPIA 3MKRA 3VTYA 4WUYA 3KAEA 1YA0A 5HI7A 5A6CA 3CK8A 3MV2B 2KCKA 1FCHA 3LKUA 3HYMB 4GCOA 4O6FA 5FJYA 3U4TA 3U3WA 3IEGA 5ARFA 4AIFA 2KATA 3GZ2A 2PZIA 4YVOA 4N2SA 2XGSA 3K9IA 4J8FA 2JLBA 4BTAA 2VGXA 3CK7A 3MEKA 4Y6WA 3TG4A 1KLXA 3Q5MA 4J0UA 1NA0A 5CHEE 3RIBA 2XCCA 1A17A 2XGOA 3N71A 4N2QA 2P58C 3QWWA 3JYSA 1E96B 3CKCA 2FF4A 3CV0A 3O48A 3E4BA 2VSYA 2Q7FA 4HOUA 5M72A 2VYIA 3GZ1A 3Q4AB 3CEQA 4BT9A 4HOTA 2UY1B 5KJLA 1KT0A 5EKQD 1XNFA 3FFLA 2XEVA 1PC2A 3PE3A 2C0MA 2QFCA 2MHKA 3S7JA 3QKYA 1W3BA 4JA7A 3S7DA 5BT1A 3ASFA 1ELWA 4I2ZA 4RG9A 5CCLA 3FWVA 4AY5A 3CVLA 2J9QA 4HOSA 3GYZA 2XCBA
chains in the Genus database with same CATH superfamily
2VQ2A 3TWSA 4B0ZA 3C98A 3CVWA 4GTOA 2LSVA 3DPDA 2WQ6A 5CRUA 2XQ0A 4PS7A 3DSVA 3VTXA 1HXIA 3OAWA 4HXIA 3WXXA 2E2EA 3RSEG 3R9MA 4I2WA 3FHEA 4U63A 4C9BB 1QNFA 4A3TA 3SZ7A 1SZ9A 2XZDG 3QDNA 1DC2A 4XX5A 5EDSA 3NF1A 3W9FA 4DK5A 4AV7A 3GZSA 4N3CA 4AXHA 2AVPA 4TXRA 4GZ6A 4BX9A 2Y69E 4A1GA 4EZLA 3PEVB 3FTUA 2IFUA 3LJNA 3OXLA 4HORA 4HS2A 4E6HA 1INZA 4CZ2D 5ITZF 3CVQA 2BUGA 2OCCE 5KJNA 2J08A 2P9KG 3FH5A 2CHXA 2QY7A 3MKRA 1YA0A 1HO8A 4GCOA 4BX8A 2VJ8A 3RRUA 3G2VA 3ZXSA 2JLBA 3CK7A 3WG7E 3B7UX 3SGHA 1E96B 4EZJA 2Q7FA 2JABA 5EKQD 1FT2A 2IU1A 4AP2A 4RLYA 2P9PG 4G23A 1ELKA 3PDNA 4U04A 4MKTA 4I6EA 1NI1A 4DUIA 3CVYA 1LTXA 2GRPB 3T9KA 5CBOA 2WQHA 3TWWA 3IHVA 2PQRA 2IO3C 3B13A 4LNGA 4HBDA 3DEOA 5D0QD 5FIOA 1K1AA 3MV3B 2B6CA 4G26A 1UW4B 2F37A 2GRLA 4YNDA 4KT6B 4LNUD 3J5PA 2X6FA 3U3WA 4B93B 1OT8A 4I17A 4ILHB 3SNXA 2WXKA 4HRMB 4AEZC 5JHAA 2F8XK 3T8MA 3P1UA 3B7TA 5BXUA 5HRYA 5JMND 4EHMA 2DBAA 3ZN3A 4OYSA 2VSNA 3Q73A 3DXMG 2LXLA 5BW8C 4BTBA 1WG0A 2CG2A 3DSWA 2CFUA 5EN5D 3C3OA 4V3IA 5B3SE 4C0MA 4TXQA 5AQ7A 3TWRA 3JYSA 4JD2G 3ML8A 3FU0A 3C3RA 3AG1E 2MHKA 1W3BA 1O5MA 3FU3A 2J9QA 5ENRD 3FP3A 3T8KA 5CEAA 4WWNA 1N52A 4JEUA 4N3AA 1BI7B 1DCEA 4LUNU 3BG1B 2XPYA 3RRNB 2ZU6B 3TGOA 2KXPC 4K0RA 3CVUA 1TYQG 3B7BA 4UI9C 3IKOB 4NIKA 1N0RA 4UUCA 5CCMA 2JEKA 3Q49B 1SA5A 2VTBA 3CVPA 2C2LA 3CSTA 1Z3YA 3UKRG 2L0IA 4XI9A 4QFVA 3D9OA 2R02A 3KEAA 5AN8A 2LO6A 2UY1A 3L82A 2UWJG 1JWGA 2ZIRA 3LDZA 4I43A 2HM8A 4J8EA 4BSZB 5C2YA 3RJVA 3DXKG 2GW1A 3HHMA 3IV0A 3VTYA 4TXPA 3X2QE 4O6FA 1OXJA 5HKPA 1KLXA 3FUNA 2XS1A 4DX5D 3KEZA 3E34A 2DIWA 3Q7AA 5T8IA 3E4BA 4HOUA 3GZ1A 3FFLA 4AJWA 3B7RL 4JA7A 3TWUA 5LP0A 1S70B 4O1OA 2BF0X 2WQ7A 3G2UA 5JJ7A 5EX3A 3KD7A 4RG6A 2PQNA 3MA5A 2E0IA 5ENTD 3APCA 2J4BA 1PAQA 3PZDA 2WXNA 4RQIA 1TR4A 4U07A 3NZSA 1N54A 3FUKA 3MZLB 1E8XA 3UPVA 3SI5A 3UTMA 3PRZA 5KNGA 2RD0A 2RKKA 3V2OA 2XPZA 1DVPA 2IJGX 3EHMA 3D9PA 2I6HA 1OCRE 3TAXA 3VLFA 1V54E 3UX4A 1Q2ZA 4JA9A 4EECA 3E30A 3HG0D 4WNEA 1E8ZA 2VGYA 4GMLA 4XEIG 3NQPA 3DBSA 2WXLA 1ELRA 2P2CP 2RG8A 5EYLA 4M3OA 3UXGA 5HI7A 4A63B 3EHQA 2CHZA 1S0PA 4BTAA 3Q78A 3L22A 4J0UA 4J6IA 4D10C 4O1PA 1YMPA 5CECB 2P9UG 2VYIA 2F8YA 1X81A 3S7JA 1Z5SC 4HNAD 4Q94A 3L9TA 5BV1A 3CVVA 1NZNA 3D9HA 4L23A 1P5QA 5CEDB 1AWCB 3ZXPA 3CHMA 2Y4UA 3U66A 1SQMA 3UIOC 1NL4A 4L9PA 3ZGQA 3F6QA 3ZYQA 2V8SE 3UM2A 1E7VA 4Z68A 4JB8P 2WMOA 4HLLA 1N4SA 5CERB 3EIJA 1H6PA 3MKQA 2QZAA 4G25A 2V4HC 4FC8A 1Y8MA 1DCQA 3U9WA 4I1MA 3NB2A 3SO8A 2LUHA 2WXJA 3FU6A 4BT8A 1HF8A 1MX6A 3ABKE 2ZGGA 1LF8A 5HS0A 1SZAA 5KJKA 2BKKB 3JCKC 1N4QA 3L54A 4IULA 3W9GA 4AY6A 3AS5A 4XZ4A 2QYJA 2L0TB 3UT8A 2WXQA 3ULQA 4GYOA 4HI8A 3KSLA 4PUCA 2KCKA 1FCHA 1RZ4A 4C0EA 3N71A 3G2SA 4IRUA 4MLPA 2FF4A 1NP7A 1JUQA 3CVXA 4ZHBA 3HRAA 2AXZA 4CRWA 1K3ZD 2R03A 2XCBA 1ZBPA 4F1PA 1L5JA 3PE4A 1TN7A 5AARA 1H6KA 2DVWA 1UJKA 1IYGA 2X6HA 1XGWA 2YINA 2HO1A 4CCAA 1H2UA 5AQAA 3ZW3A 4FHJA 3QC1A 4IYPA 2A5EA 2KCLA 3FTXA 3LVQE 2YNQA 4KZCA 4LERA 4ANWA 1EF1C 1U3CA 1OWPA 2FEZA 1VDYA 4I1OB 3EDTB 2NC9A 1LD7A 1HFAA 1H19A 3L16A 3FUJA 3PUJA 2GRMA 1TN8A 3APDA 3LY8A 4DX2A 4L7TA 2ZISA 5CMYA 3R7RA 4YDYA 2J09A 4GZ5A 4F6RD 1N11A 4JL0A 5EILA 1OWNA 3D9IA 3URZA 4GMRA 4K5AB 3D9MA 3PREA 3EJNA 5FQ7A 3AG2E 4CDRA 2R05A 3ZHEA 1N4PA 2EIME 4GTPA 2A4ZA 3UT4A 4ATZD 3IBEA 2OV8A 2L6BA 3TWVA 5KJMA 3NZUA 3Q47B 3JUEA 2XPIA 5KCMA 2CHWA 4ATGA 3K9IA 2P9LG 3MEKA 1H6OA 4ACKA 2AJAA 3FTZA 3AG4E 1A17A 1MJ0A 5M72A 3ISMC 1E8WA 4FLBA 1U3DA 4J8SA 3TWXA 2WPVA 4EBAG 2RFAA 4N39A 5ENQD 4JHKA 3FTVA 2OOEA 4BWRA 3QWVA 3QB2A 5ENSD 2J4DA 2L9BA 4WWPA 2PL2A 5J08A 5ENPD 1TJCA 1LD8A 4HOQA 3ULYA 3JXJA 5FZRA 3T5VA 1BD8A 2M63A 3BUAA 5FQ4A 3SFXA 4B8CB 2BKGA 4TRQA 5G05C 2GRNB 3QNKA 5T3RA 3CHQA 4XKCA 1PY1A 2AWIA 2OEWA 4N3BA 3EHRA 1X5BA 3LCAA 5KWDA 3ULEG 2X6IA 4GTQA 3D9NA 3UKUG 4FADA 4YVQC 3PUKA 5CMWA 4TUUA 2J8SD 5CBNA 2YHCA 2LNIA 1SVXA 3ASOE 1ZB1A 3I3NA 4X8QA 4LEUA 1UG3A 3LKUA 1IKND 5FJYA 4YVOA 1N0QA 3ABME 3HDXA 3TG4A 3HVEB 5BUZA 1IHBA 2NSZA 3KSQA 4OVVA 4HOTA 2XEVA 3ZKJA 4J8YA 3FWVA 3CSFA 5FQ8A 1TNYA 5G04C 2IF4A 3KS2A 3APFA 2P9SG 4GTMA 1E90A 3FUHA 3PS6A 1HS6A 1K8KG 1HG2A 4H7XA 3JQ1A 3BU8A 1O1TA 3ML9A 3I4RB 2HYZA 3ZVVA 5FZSA 3FEXA 2XRYA 3HXFA 2V5FA 4U95D 3QJZA 1N4RA 4GZ3A 5D0OD 4EBAA 5J90A 2L6JA 2MOWA 4HQDA 4J8DA 5FWQA 2I2OA 3E33A 1HX8A 5LCWJ 4HB5A 3ASNE 3UM1A 2XHEA 4JXTA 3FUFA 2WVIA 4YDEA 2CFZA 4CT0A 4UWLA 3CK8A 3PEUB 4FULA 4Y6WA 3AAAC 2VTBB 1A5EA 1KT0A 4J7WA 3V2XA 3DWLG 3V79K 2PNNA 3S7DA 5B1AE 3ASFA 4UQXA 4F1SA 5A7DB 5EIBE 4MS6A 4G8KA 3IXEA 4GYYA 4Q69A 4CDNA 1TJFA 3SF4A 1SA4A 3QOUA 2WXOA 3L08A 4Q96A 5IY5E 3DSTA 4U8YD 1OCOE 1IQRA 3FULA 2WMNA 2GROB 3TXMA 3ESLA 1GW6A 4RVBA 3AU5A 3JUIA 1QZ2A 1NA3A 1BPOA 3QK0A 4B8AA 4PDXA 1UOHA 3RK6A 3FUEA 1DNPA 3T5XA 5LFAA 3CHRA 5G04J 5JJTA 4G8LA 3FUDA 1V55E 3AG3E 4O60A 2Y4TA 4PS8A 4KBQA 4JW1A 2VSXE 2IY0C 1OY3D 4GA2A 2MRIA 3OXFA 2AW6A 4CDMA 3LPZA 2KC7A 1E8YA 4JEHA 3FU5A 4FHKA 3EUVA 5KBAA 3FEYA 5BXOA 2BTDA 2OVFA 3JXIA 2Y1LE 2VSYA 2EIKE 3TJPA 3CEQA 2X6KA 3PE3A 4MRUA 3MX3A 3V31A 5FQ6A 1HU3A 4CGVA 4DLQA 4RSYA 5D2MC 1OWMA 3ZRHA 4XIFA 4M7CA 5FINA 2R5SA 2VGXB 5LX8A 5AENA 4GPKA 2Y3AA 2ONDA 1N9AA 3LY9A 3BEEA 1WM5A 1OUVA 3CHSA 3LXUX 4KXKB 4A3VA 3LYAA 4LG6A 3E32A 3SBSA 1FPPA 3D9KA 2XZTG 3LY7A 3ZUVB 5EYPF 3RRMB 2QYUA 2WXPA 2P9NG 3Q15A 4F53A 4G24A 4LRZA 4GA0A 3L13A 3HXDA 4UI9K 3G2WA 4DPRA 2I1KA 2XRZA 5FZQA 2YHEA 4GTSA 1OWOA 4CGWA 2DZNA 3AS8A 3OXGA 5A6CA 4GTTA 1QYMA 5EIDA 4BETA 3IEGA 3SD5A 4UWGA 2X6JA 2OEVA 1N95A 1O1SA 2DWZA 3QWWA 4YDOA 3Q9UC 2WM9A 1JCRA 2QFCA 5BV0A 1ELWA 1JWFA 1TNZA 5JJ6A 3QWPA 1OCCE 5AQBA 4DRXE 2NYJA 2C0LA 3ABLE 4LNBA 2V0PA 4GYWA 1KZPA 3EU5A 1Z3XA 4L2LA 2MYOA 4JC8A 4DI3A 2B0OE 3CQCB 4UWKA 2VSOE 4WNGA 4F3VA 4U7EB 3PNTB 4JHRA 1HZ4A 1AP7A 3CK9A 4DX6D 3VLEA 3DSUA 4GCNA 5DIZA 1JPLA 4W9RA 3CVNA 5B1BE 3C5RA 2X38A 2FO7A 1SW6A 2OVBA 2DYSE 1TNUA 4R7LA 3R7QA 2ETAA 2XENA 3MKQB 4GAAA 4ME2A 1K1BA 5LOZA 4B89A 3UI2A 3EU9A 3FTSA 3HXBA 3FUIA 2Y0BG 3U4TA 2KATA 2PZIA 1RW2A 2R59A 3QARA 3CQGB 3UIPC 3SY2A 3UMVA 3V30A 1EDUA 4HOSA 1D8EA 2C0MA 3QKYA 3P2BA 3UT7A 2LAIA 2HE0A 3GYZA 3DSXA 2IQCA 3R9AB 5FTPA 4N5QA 4KVOA 3PNLB 2IONA 4NRHB 5ARGA 3UINC 4OAVB 4K5BA 1E7UA 4U8VD 4GTRA 4UQZA 3CIAA 3NOCD 2FO1E 2I9CA 3ASGA 1O1RA 2ZXWE 3AU4A 1ZU2A 1IXVA 2H6HA 5LCWC 2WXHA 3O4ZA 4WNDA 2V4LA 2WXIA 4G2VA 5G55A 4BY6A 1B89A 3RKVA 4I9CA 2KBXA 2DCPA 4BESA 1WY6A 1WDYA 3RU0A 4HVBA 4XE0A 4LSZE 4KVMA 2AXVA 1KPSB 1EYHA 4L2YA 4FJYA 4TV3A 4GZCA 1MX2A 2H6GA 3DSSA 1UN9A 3GZ2A 4N2SA 2ILRA 5CRVA 4PH4B 5E75A 1H0AA 1NA0A 1S64A 4HFGA 4YDWA 2P58C 3BQOA 1JCQA 3CKCA 2UY1B 3PVLA 1PC2A 3BG0B 5BT1A 2ETCA 1S63A 5CCLA 3FUMA 4ABNA 3CVLA 4DX1A 3B95A 3OTNA 4GPMA 4I1AA 4U0SA 4JHJA 3S7FA 3SHFA 3G2TA 3ENEA 3PZ2A 3IHYA 4AM9A 4G1TA 4U96D 4GTVA 2H6FA 4U0UA 1EPUA 2WB2A 4KYOB 2WXFA 4APOA 2KZTA 3C72A 4XI0A 4ANXA 1OCZE 3Q9NC 3ZIMA 2X3MA 3ESKA 5AQ9A 4GZDA 3TG5A 2IO2C 4ILGA 3MGBA 2V5QC 1Z6TA 2FULA 3SBTB 4E85A 2IOLA 3ASDA 1D9SA 3CLJA 3C3QA 4I9EA 2EIJE 4JVSA 3S7BA 2VGEA 1MHQA 3LS8A 1OWLA 4ZFHA 3B7SA 5HQ8A 3FTYA 4K03A 4JZYA 2EILE 2R17C 4AVXA 3ONLA 5C1DA 4JPSA 4GA1A 1YCSB 3ZNGA 1TNOA 4HRLA 4UWFA 3SFZA 4AIFA 5T4YA 4L1BA 3U64A 3CGHA 3Q5MA 5CHEE 1TN6A 4FLHA 2EQXA 3PZ1A 3CHOA 3O48A 3ZYMA 3Q4AB 1TEZA 1XNFA 3E37A 5AJDA 4RG9A 4XKBA 4WAFA 4KMOA 3UM0A 4OAUC 1HG5A 4AOFA 1BU9A 4P29A 1MX4A 5EX0A 4BSXA 5BNWA 4CYMD 3ASHA 1JCSA 3UUXA 1KZOA 3NBNB 4H7YA 4CT4A 1MQSA 5JA4D 2F0YA 2QC9A 3DPYA 5ENNA 3Q79A 4UI9J 4N5CA 4WNFA 2XEHA 3PZ4A 4HRNA 3EHNA 3ONKA 1FT1A 3L17A 4K5CA 5A23A 2LSUA 2R2LA 3UM3A 3MYVA 3ZYLA 5AJLA 2AXUA 1WAO1 2CG3A 2IEJA 3UQ3A 3D9JA 1Y6IA 4QQIA 2ETBA 3ZPJA 3ZFWA 2KCVA 1G3NB 3I5PA 3JQ0A 3SFYA 2J49A 5ENOD 1BLXB 2PM6A 4PS3A 2LAHA 3PZ3A 1U2VG 3LJ3A 3MJWA 4GB9A 2IOSA 1D8DA 4AY5A 2GGFA 3Q75A 5KJLA 4ILIA 3QAQA 4FJZA 3DRAA 1IHGA 1NFIE 4I6GA 4GMJA 2H6IA 3NOGD 3SQVA 3HXEA 1MYOA 4U0ZA 4URKA 4I6JA 1UN8A 4FU3A 5KNHD 3TWQA 2EINE 4FP7A 1TNBA 2J07A 4N2QA 1UJJA 4A1SA 2GRRB 1FVHA 3S2AA 2LXMA 2FI7A 2KM4A 2NXPA 3ZYKA 2A5UA 4B94A 4G11A 1HH8A 3DEPA 5AYWD 5ANRA 3TL5A 1HE8A 3ZU7B 2YQ8A 3CHPA 3AS4A 2PM7A 3FY4A 2WXMA 1H2VC 1FVFA 4NQ0A 3RO2A 5ANLA 4DX7D 4IN3B 4WUYA 3KAEA 5D66A 4APFA 4LCTA 3FH7A 4NURA 3TWTA 2DZOA 2XGSA 4DLOA 2VGXA 4BEPA 2XGOA 3CR3A 4DI4A 3RAUA 4ANUA 4GU5A 3HXCA 4BT9A 2XEEA 4DJAA 2BEDA 1IQUA 1MZCA 1KT1A 3VLDA 4NACA 3GW4A 3ZEFA 5BPPA 3L6AA 3ZHEB 2WXGA 2DYRE 4FA6A 4HI9A 1QQEA 5G2NA 1YYHA 5DBKA 2FBNA 3Q7FA 3D9LA 5AAOA 1H2TC 3I4GA 3LEWA 2RFMA 4BERA 2I1JA 4F7AA 4EZKA 3AJIA 4KZ0A 2XGMA 4EQFA 3CKBA 3FDHA 3RO3A 3PH0C 3NAWA 4MBGA 2HR2A 1BI8B 5FT9A 4BFRA 3EIQC 5G05J 3D3MA 4A55A 4OVUA 4HLEA 4UQYA 3MCXA 4UWHA 3HVEA 3LVRE 4Y6CA 2ZGDA 5AIJA 1QBQA 4U8HA 2P9IG 4TUMA 3MV2B 4CEMA 3HYMB 5ARFA 5E76A 3TXNA 4C48B 2WXRA 4J8FA 2KZTB 4ACLA 4EPZA 3RIBA 2XCCA 5H7PA 3FTWA 3J5QB 3CV0A 3HIZA 4WWOA 4ANVA 1N94A 2GRQB 2XS8A 3FH8A 5JHBA 4I2ZA
chains in the Genus database with same CATH topology
5BV1A 2VQ2A 1NZNA 3CVVA 4B0ZA 4L23A 3OTNA 4F1SA 5A7DB 3C98A 4MS6A 1P5QA 4I1AA 4GYYA 4Q69A 3CVWA 4U0SA 2LSVA 3DPDA 2WQ6A 4CDNA 1TJFA 4JHJA 3S7FA 3SF4A 3CHMA 3SHFA 2Y4UA 3G2TA 2XQ0A 3U66A 1SQMA 3ENEA 4PS7A 3IHYA 3QOUA 2WXOA 4AM9A 3VTXA 3ZGQA 4G1TA 1HXIA 3OAWA 3L08A 3ZYQA 4U0UA 4HXIA 1EPUA 4Q96A 2WB2A 3WXXA 2V8SE 1E7VA 2E2EA 4KYOB 2WMOA 2WXFA 1IQRA 3EIJA 3FULA 4APOA 4I2WA 3FHEA 4U63A 4C9BB 2KZTA 2WMNA 3MKQA 4XI0A 1QNFA 4G25A 3TXMA 4A3TA 3SZ7A 4ANXA 4FC8A 3ESLA 1SZ9A 3QDNA 3ZIMA 1Y8MA 1GW6A 4RVBA 4XX5A 3AU5A 5EDSA 2X3MA 3JUIA 3NF1A 1QZ2A 3ESKA 3U9WA 1NA3A 1BPOA 4I1MA 3QK0A 4B8AA 4GZDA 4DK5A 4AV7A 3TG5A 4PDXA 3GZSA 4ILGA 4N3CA 4AXHA 2AVPA 2WXJA 3FU6A 3MGBA 1HF8A 4BT8A 3RK6A 1Z6TA 2FULA 4GZ6A 3SBTB 2IOLA 4BX9A 4E85A 3FUEA 1DNPA 3ASDA 3T5XA 4A1GA 5LFAA 3CHRA 1LF8A 3CLJA 4EZLA 3PEVB 3FTUA 5G04J 5JJTA 2IFUA 1SZAA 4I9EA 3FUDA 5KJKA 3OXLA 4HORA 4JVSA 3S7BA 4HS2A 1MHQA 3LS8A 3JCKC 3L54A 4IULA 1OWLA 2Y4TA 4PS8A 4KBQA 4JW1A 3B7SA 2VSXE 5HQ8A 4E6HA 4AY6A 3AS5A 4XZ4A 3FTYA 4K03A 1INZA 4JZYA 2R17C 4AVXA 2L0TB 3ONLA 3UT8A 5C1DA 2WXQA 2MRIA 3OXFA 4GA2A 4JPSA 4GA1A 3CVQA 2BUGA 4GYOA 3ULQA 2AW6A 4CDMA 5KJNA 3LPZA 2J08A 2KC7A 3FH5A 2CHXA 2QY7A 3MKRA 1E8YA 1YA0A 4JEHA 4PUCA 2KCKA 3FU5A 1HO8A 1FCHA 4FHKA 4UWFA 4GCOA 4BX8A 3SFZA 2VJ8A 5T4YA 4AIFA 3RRUA 3FEYA 4C0EA 3G2VA 4L1BA 2JLBA 3CGHA 3U64A 3CK7A 3ZXSA 3B7UX 3Q5MA 5CHEE 3SGHA 2BTDA 2OVFA 3N71A 3G2SA 4IRUA 1E96B 4MLPA 4FLHA 2EQXA 4EZJA 2FF4A 3CHOA 3O48A 2VSYA 2Q7FA 3ZYMA 3TJPA 1NP7A 3CEQA 3Q4AB 1TEZA 1JUQA 3CVXA 2X6KA 1XNFA 5EKQD 3PE3A 4MRUA 3MX3A 2AXZA 5AJDA 4RG9A 4CRWA 4XKBA 5FQ6A 4WAFA 4KMOA 2XCBA 2IU1A 1HU3A 1ZBPA 1L5JA 3PE4A 4CGVA 4DLQA 4RSYA 3ZRHA 1OWMA 1HG5A 4AP2A 4XIFA 1H6KA 1UJKA 4AOFA 4G23A 1ELKA 2R5SA 4P29A 2VGXB 1IYGA 5EX0A 5LX8A 3PDNA 4U04A 4MKTA 4BSXA 5BNWA 2X6HA 1XGWA 2YINA 4I6EA 5AENA 2HO1A 3CVYA 2Y3AA 4GPKA 4CCAA 1H2UA 3ASHA 2ONDA 4UQXA 3ZW3A 3LY9A 4FHJA 2WQHA 3BEEA 3QC1A 4IYPA 3UUXA 2KCLA 1WM5A 3FTXA 1OUVA 3LVQE 2YNQA 3CHSA 3LXUX 4KZCA 4LERA 3IHVA 4H7YA 2PQRA 1MQSA 4KXKB 1EF1C 3B13A 4ANWA 4CT4A 1U3CA 5ENNA 1OWPA 2FEZA 1VDYA 4UI9J 4N5CA 4WNFA 4A3VA 3LYAA 4I1OB 5D0QD 3EDTB 2NC9A 3SBSA 3MV3B 3EHNA 1HFAA 4G26A 1H19A 1UW4B 3D9KA 3ONKA 3L16A 3FUJA 2GRLA 4YNDA 3PUJA 4KT6B 2GRMA 3APDA 3L17A 3LY8A 3LY7A 2X6FA 4L7TA 5CMYA 5A23A 3R7RA 3RRMB 2WXPA 3U3WA 2J09A 4GZ5A 3Q15A 4JL0A 2LSUA 4F53A 1OWNA 3D9IA 3URZA 4I17A 4ILHB 4G24A 3SNXA 2WXKA 4LRZA 4AEZC 5JHAA 3D9MA 3PREA 3MYVA 4GA0A 3EJNA 3L13A 3B7TA 3P1UA 3T8MA 3ZYLA 4UI9K 3G2WA 5FQ7A 5AJLA 4DPRA 2I1KA 4CDRA 2AXUA 2XRZA 1WAO1 3ZHEA 2CG3A 5FZQA 2A4ZA 3UT4A 2DBAA 2YHEA 3ZN3A 1OWOA 3IBEA 2OV8A 3UQ3A 3D9JA 4OYSA 2VSNA 4CGWA 1Y6IA 5KJMA 3NZUA 3ZPJA 3AS8A 3ZFWA 3Q47B 5BW8C 2KCVA 3OXGA 4BTBA 3I5PA 2CG2A 2XPIA 3JQ0A 2CHWA 5KCMA 5A6CA 2CFUA 4ATGA 2J49A 4V3IA 3IEGA 2PM6A 4PS3A 4C0MA 3K9IA 3SD5A 4UWGA 2X6JA 3MEKA 2LAHA 4ACKA 3FTZA 1A17A 3QWWA 3LJ3A 3JYSA 3MJWA 4GB9A 3ML8A 5M72A 2WM9A 1E8WA 3FU0A 4FLBA 1U3DA 2IOSA 2QFCA 2MHKA 1W3BA 4J8SA 5BV0A 1ELWA 4AY5A 3FU3A 2J9QA 1JWFA 2GGFA 5KJLA 3FP3A 5JJ6A 4ILIA 2WPVA 3QWPA 4EBAG 4N39A 2C0LA 4JHKA 4WWNA 3QAQA 4FJZA 3FTVA 1N52A 2OOEA 4JEUA 2V0PA 4BWRA 3QWVA 1IHGA 3QB2A 4N3AA 4GYWA 2J4DA 2L9BA 4I6GA 4GMJA 1Z3XA 4WWPA 2PL2A 4L2LA 5J08A 4LUNU 1TJCA 4U0ZA 4JC8A 3BG1B 2XPYA 3RRNB 2ZU6B 4DI3A 4URKA 3TGOA 4HOQA 4I6JA 1UN8A 4FU3A 4K0RA 5FZRA 3T5VA 4FP7A 3CVUA 4UI9C 3CQCB 4UWKA 2VSOE 2J07A 4WNGA 4N2QA 3FUMA 1UJJA 3IKOB 4F3VA 4A1SA 2M63A 5FQ4A 1FVHA 3S2AA 4B8CB 5CCMA 2JEKA 2FI7A 4TRQA 2KM4A 3PNTB 4JHRA 1HZ4A 5G05C 3QNKA 3Q49B 2NXPA 3ZYKA 2A5UA 4B94A 3CK9A 2VTBA 4G11A 5T3RA 3CHQA 3VLEA 4XKCA 1PY1A 2AWIA 1HH8A 3CVPA 4GCNA 1JPLA 2C2LA 5DIZA 4W9RA 3CVNA 5AYWD 3CSTA 5ANRA 3TL5A 2X38A 4N3BA 1Z3YA 1X5BA 2FO7A 1HE8A 3LCAA 2OVBA 2L0IA 4XI9A 4QFVA 2X6IA 2YQ8A 3D9OA 3CHPA 4R7LA 3AS4A 3R7QA 3D9NA 2LO6A 4FADA 4YVQC 2UY1A 3PUKA 2PM7A 2UWJG 5CMWA 3MKQB 4TUUA 1JWGA 4GAAA 3FY4A 2WXMA 1H2VC 4ME2A 2YHCA 2LNIA 1FVFA 3LDZA 5LOZA 4NQ0A 4I43A 2HM8A 3RO2A 5ANLA 4J8EA 4B89A 5C2YA 3I3NA 4IN3B 3RJVA 3FTSA 2GW1A 4LEUA 3HHMA 3FUIA 3IV0A 3VTYA 4WUYA 3KAEA 1UG3A 4APFA 3LKUA 4LCTA 4O6FA 5FJYA 3U4TA 3FH7A 4NURA 2KATA 4YVOA 2PZIA 2XGSA 4DLOA 3HDXA 2R59A 2VGXA 3QARA 3CQGB 3TG4A 1KLXA 3FUNA 3HVEB 3KEZA 2XGOA 5BUZA 3CR3A 4DI4A 2DIWA 5T8IA 2NSZA 3E4BA 4HOUA 3UMVA 4ANUA 4GU5A 3GZ1A 4OVVA 4BT9A 4HOTA 1EDUA 4HOSA 3FFLA 2XEVA 4AJWA 3B7RL 2C0MA 4DJAA 3QKYA 4JA7A 3P2BA 3UT7A 5LP0A 2LAIA 3FWVA 3CSFA 1IQUA 3GYZA 2IQCA 2BF0X 2WQ7A 3R9AB 5FTPA 3G2UA 5FQ8A 4KVOA 5G04C 3PNLB 1KT1A 3VLDA 2IONA 4NRHB 5ARGA 4NACA 5JJ7A 3GW4A 2IF4A 3ZEFA 5BPPA 3L6AA 3ZHEB 5EX3A 3KD7A 1E7UA 2WXGA 4RG6A 3KS2A 4UQZA 4FA6A 1QQEA 2PQNA 3CIAA 3APFA 3MA5A 2E0IA 5DBKA 5G2NA 2FBNA 3APCA 3D9LA 2J4BA 2I9CA 3ASGA 1PAQA 1E90A 1H2TC 3FUHA 3I4GA 3PZDA 2WXNA 3LEWA 3PS6A 1HS6A 4U07A 2I1JA 4F7AA 3NZSA 4EZKA 3AU4A 1ZU2A 1HG2A 4H7XA 1N54A 3FUKA 3MZLB 1E8XA 3JQ1A 3UPVA 4KZ0A 2XGMA 3SI5A 5LCWC 4EQFA 3CKBA 3FDHA 2WXHA 3O4ZA 3PRZA 3ML9A 2RD0A 3RO3A 4WNDA 3I4RB 3PH0C 2V4LA 2HYZA 2WXIA 3ZVVA 5FZSA 3FEXA 2XPZA 2HR2A 1DVPA 2XRYA 4G2VA 2V5FA 2IJGX 3EHMA 5G55A 5FT9A 3D9PA 2I6HA 4BY6A 1B89A 3QJZA 3TAXA 4GZ3A 3EIQC 5G05J 4BFRA 5D0OD 3VLFA 3D3MA 4A55A 3UX4A 4EBAA 3RKVA 4I9CA 4OVUA 4HLEA 4JA9A 5J90A 2L6JA 2MOWA 2DCPA 4UQYA 4J8DA 3MCXA 4UWHA 5FWQA 4EECA 1WY6A 2I2OA 3HVEA 1HX8A 1E8ZA 2VGYA 4WNEA 4GMLA 3RU0A 4HVBA 3NQPA 3LVRE 4XE0A 5LCWJ 3DBSA 4KVMA 2WXLA 4Y6CA 1ELRA 2AXVA 2RG8A 2XHEA 4JXTA 1EYHA 3FUFA 2WVIA 4M3OA 4L2YA 5AIJA 2CFZA 4FJYA 4U8HA 4TV3A 4CT0A 4UWLA 5HI7A 4GZCA 3CK8A 3MV2B 3PEUB 4CEMA 3HYMB 1UN9A 5ARFA 3GZ2A 5E76A 3TXNA 4N2SA 2CHZA 2ILRA 1S0PA 2WXRA 4FULA 4J8FA 4PH4B 4BTAA 2KZTB 4Y6WA 5E75A 1H0AA 4ACLA 3L22A 4J0UA 1NA0A 3RIBA 4EPZA 2XCCA 4J6IA 4D10C 4HFGA 2P58C 3FTWA 2VTBB 3CKCA 3CV0A 3HIZA 4WWOA 2VYIA 4ANVA 2UY1B 3PVLA 1KT0A 3S7JA 1PC2A 3BG0B 5BT1A 3S7DA 3FH8A 5JHBA 3ASFA 4I2ZA 5CCLA 4Q94A 3CVLA 4ABNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBP A;  2VQ2 A;  1NZN A;  3FP3 A;  5FTP A;  2WPV A;  3PE4 A;  3QWP A;  5JJ6 A;  3R9A B;  4CGV A;  5G04 C;  4N39 A;  4XIF A;  1KT1 A;  5A7D B;  4NRH B;  1P5Q A;  2C0L A;  4I1A A;  5ARG A;  4GYY A;  5JJ7 A;  4G23 A;  2OOE A;  4U0S A;  4BWR A;  2LSV A;  2IF4 A;  2R5S A;  2VGX B;  3GW4 A;  3QWV A;  1IHG A;  3ZHE B;  4N3A A;  5EX3 A;  4GYW A;  5EX0 A;  3S7F A;  3SF4 A;  3PDN A;  4U04 A;  3KD7 A;  5BNW A;  4RG6 A;  2PL2 A;  3KS2 A;  4UQZ A;  2Y4U A;  1QQE A;  2HO1 A;  2PQN A;  3MA5 A;  5DBK A;  4GPK A;  1IYG A;  3ASH A;  2FBN A;  2OND A;  4UQX A;  1TJC A;  3ASG A;  3LY9 A;  3QOU A;  4U0Z A;  2WQH A;  3BEE A;  3UUX A;  4AM9 A;  3VTX A;  3ZGQ A;  2KCL A;  4G1T A;  3TGO A;  1HXI A;  1WM5 A;  1OUV A;  4HOQ A;  4U07 A;  4U0U A;  4H7Y A;  2PQR A;  4KXK B;  1ZU2 A;  5FZR A;  4H7X A;  3WXX A;  3UPV A;  4UI9 C;  4WNG A;  2E2E A;  2FEZ A;  2XGM A;  4KYO B;  4UI9 J;  4EQF A;  3CKB A;  4N5C A;  4WNF A;  3LYA A;  4A1S A;  4ABN A;  4F3V A;  5LCW C;  5D0Q D;  3EDT B;  4APO A;  4I2W A;  5CCM A;  2NC9 A;  3MV3 B;  2FI7 A;  3RO3 A;  4JHR A;  1HZ4 A;  4G25 A;  4G26 A;  4WND A;  4XI0 A;  5G05 C;  3SZ7 A;  3Q49 B;  3QDN A;  4YND A;  1Y8M A;  4B94 A;  2HYZ A;  3CK9 A;  3LY8 A;  3NF1 A;  3LY7 A;  5FZS A;  1QZ2 A;  2HR2 A;  3ESK A;  1NA3 A;  4G2V A;  2V5F A;  1HH8 A;  3CVP A;  4GCN A;  5DIZ A;  2C2L A;  2I6H A;  5FT9 A;  3TG5 A;  1B89 A;  4W9R A;  3CVN A;  4N3C A;  5AYW D;  3TAX A;  4GZ3 A;  2AVP A;  4GZ5 A;  3Q15 A;  5D0O D;  5G05 J;  4BT8 A;  4JL0 A;  4N3B A;  2LSU A;  4GZ6 A;  2FO7 A;  4I9C A;  3LCA A;  3RKV A;  4JA9 A;  3URZ A;  3ASD A;  4I17 A;  2L6J A;  4G24 A;  4XI9 A;  4UQY A;  4J8D A;  4GA0 A;  5G04 J;  5JJT A;  2IFU A;  2YQ8 A;  4I9E A;  5KJK A;  4UI9 K;  3OXL A;  4HOR A;  3AS4 A;  3S7B A;  4WNE A;  2VGY A;  4CDR A;  3RU0 A;  4YVQ C;  2UY1 A;  1WAO 1;  3ZHE A;  2UWJ G;  2Y4T A;  5FZQ A;  4KBQ A;  4ME2 A;  5HQ8 A;  2YHC A;  2DBA A;  2LNI A;  3ZN3 A;  3AS5 A;  5LCW J;  4NQ0 A;  4AY6 A;  4Y6C A;  3UQ3 A;  1ELR A;  3RO2 A;  4CGW A;  2VSN A;  4J8E A;  5KJM A;  5C1D A;  3ZPJ A;  4GA2 A;  3OXF A;  3AS8 A;  3ULQ A;  4GA1 A;  3CVQ A;  2BUG A;  4GYO A;  3Q47 B;  5BW8 C;  3ZFW A;  2KCV A;  5KJN A;  3OXG A;  3LPZ A;  4IN3 B;  3RJV A;  2GW1 A;  4BTB A;  4LEU A;  2KC7 A;  2XPI A;  3MKR A;  3VTY A;  4WUY A;  3KAE A;  1YA0 A;  5HI7 A;  5A6C A;  3CK8 A;  3MV2 B;  2KCK A;  1FCH A;  3LKU A;  3HYM B;  4GCO A;  4O6F A;  5FJY A;  3U4T A;  3U3W A;  3IEG A;  5ARF A;  4AIF A;  2KAT A;  3GZ2 A;  2PZI A;  4YVO A;  4N2S A;  2XGS A;  3K9I A;  4J8F A;  2JLB A;  4BTA A;  2VGX A;  3CK7 A;  3MEK A;  4Y6W A;  3TG4 A;  1KLX A;  3Q5M A;  4J0U A;  1NA0 A;  5CHE E;  3RIB A;  2XCC A;  1A17 A;  2XGO A;  3N71 A;  4N2Q A;  2P58 C;  3QWW A;  3JYS A;  1E96 B;  3CKC A;  2FF4 A;  3CV0 A;  3O48 A;  3E4B A;  2VSY A;  2Q7F A;  4HOU A;  5M72 A;  2VYI A;  3GZ1 A;  3Q4A B;  3CEQ A;  4BT9 A;  4HOT A;  2UY1 B;  5KJL A;  1KT0 A;  5EKQ D;  1XNF A;  3FFL A;  2XEV A;  1PC2 A;  3PE3 A;  2C0M A;  2QFC A;  2MHK A;  3S7J A;  3QKY A;  1W3B A;  4JA7 A;  3S7D A;  5BT1 A;  3ASF A;  1ELW A;  4I2Z A;  4RG9 A;  5CCL A;  3FWV A;  4AY5 A;  3CVL A;  2J9Q A;  4HOS A;  3GYZ A;  2XCB A; 
#chains in the Genus database with same CATH topology
 2VQ2 A;  3TWS A;  4B0Z A;  3C98 A;  3CVW A;  4GTO A;  2LSV A;  3DPD A;  2WQ6 A;  5CRU A;  2XQ0 A;  4PS7 A;  3DSV A;  3VTX A;  1HXI A;  3OAW A;  4HXI A;  3WXX A;  2E2E A;  3RSE G;  3R9M A;  4I2W A;  3FHE A;  4U63 A;  4C9B B;  1QNF A;  4A3T A;  3SZ7 A;  1SZ9 A;  2XZD G;  3QDN A;  1DC2 A;  4XX5 A;  5EDS A;  3NF1 A;  3W9F A;  4DK5 A;  4AV7 A;  3GZS A;  4N3C A;  4AXH A;  2AVP A;  4TXR A;  4GZ6 A;  4BX9 A;  2Y69 E;  4A1G A;  4EZL A;  3PEV B;  3FTU A;  2IFU A;  3LJN A;  3OXL A;  4HOR A;  4HS2 A;  4E6H A;  1INZ A;  4CZ2 D;  5ITZ F;  3CVQ A;  2BUG A;  2OCC E;  5KJN A;  2J08 A;  2P9K G;  3FH5 A;  2CHX A;  2QY7 A;  3MKR A;  1YA0 A;  1HO8 A;  4GCO A;  4BX8 A;  2VJ8 A;  3RRU A;  3G2V A;  3ZXS A;  2JLB A;  3CK7 A;  3WG7 E;  3B7U X;  3SGH A;  1E96 B;  4EZJ A;  2Q7F A;  2JAB A;  5EKQ D;  1FT2 A;  2IU1 A;  4AP2 A;  4RLY A;  2P9P G;  4G23 A;  1ELK A;  3PDN A;  4U04 A;  4MKT A;  4I6E A;  1NI1 A;  4DUI A;  3CVY A;  1LTX A;  2GRP B;  3T9K A;  5CBO A;  2WQH A;  3TWW A;  3IHV A;  2PQR A;  2IO3 C;  3B13 A;  4LNG A;  4HBD A;  3DEO A;  5D0Q D;  5FIO A;  1K1A A;  3MV3 B;  2B6C A;  4G26 A;  1UW4 B;  2F37 A;  2GRL A;  4YND A;  4KT6 B;  4LNU D;  3J5P A;  2X6F A;  3U3W A;  4B93 B;  1OT8 A;  4I17 A;  4ILH B;  3SNX A;  2WXK A;  4HRM B;  4AEZ C;  5JHA A;  2F8X K;  3T8M A;  3P1U A;  3B7T A;  5BXU A;  5HRY A;  5JMN D;  4EHM A;  2DBA A;  3ZN3 A;  4OYS A;  2VSN A;  3Q73 A;  3DXM G;  2LXL A;  5BW8 C;  4BTB A;  1WG0 A;  2CG2 A;  3DSW A;  2CFU A;  5EN5 D;  3C3O A;  4V3I A;  5B3S E;  4C0M A;  4TXQ A;  5AQ7 A;  3TWR A;  3JYS A;  4JD2 G;  3ML8 A;  3FU0 A;  3C3R A;  3AG1 E;  2MHK A;  1W3B A;  1O5M A;  3FU3 A;  2J9Q A;  5ENR D;  3FP3 A;  3T8K A;  5CEA A;  4WWN A;  1N52 A;  4JEU A;  4N3A A;  1BI7 B;  1DCE A;  4LUN U;  3BG1 B;  2XPY A;  3RRN B;  2ZU6 B;  3TGO A;  2KXP C;  4K0R A;  3CVU A;  1TYQ G;  3B7B A;  4UI9 C;  3IKO B;  4NIK A;  1N0R A;  4UUC A;  5CCM A;  2JEK A;  3Q49 B;  1SA5 A;  2VTB A;  3CVP A;  2C2L A;  3CST A;  1Z3Y A;  3UKR G;  2L0I A;  4XI9 A;  4QFV A;  3D9O A;  2R02 A;  3KEA A;  5AN8 A;  2LO6 A;  2UY1 A;  3L82 A;  2UWJ G;  1JWG A;  2ZIR A;  3LDZ A;  4I43 A;  2HM8 A;  4J8E A;  4BSZ B;  5C2Y A;  3RJV A;  3DXK G;  2GW1 A;  3HHM A;  3IV0 A;  3VTY A;  4TXP A;  3X2Q E;  4O6F A;  1OXJ A;  5HKP A;  1KLX A;  3FUN A;  2XS1 A;  4DX5 D;  3KEZ A;  3E34 A;  2DIW A;  3Q7A A;  5T8I A;  3E4B A;  4HOU A;  3GZ1 A;  3FFL A;  4AJW A;  3B7R L;  4JA7 A;  3TWU A;  5LP0 A;  1S70 B;  4O1O A;  2BF0 X;  2WQ7 A;  3G2U A;  5JJ7 A;  5EX3 A;  3KD7 A;  4RG6 A;  2PQN A;  3MA5 A;  2E0I A;  5ENT D;  3APC A;  2J4B A;  1PAQ A;  3PZD A;  2WXN A;  4RQI A;  1TR4 A;  4U07 A;  3NZS A;  1N54 A;  3FUK A;  3MZL B;  1E8X A;  3UPV A;  3SI5 A;  3UTM A;  3PRZ A;  5KNG A;  2RD0 A;  2RKK A;  3V2O A;  2XPZ A;  1DVP A;  2IJG X;  3EHM A;  3D9P A;  2I6H A;  1OCR E;  3TAX A;  3VLF A;  1V54 E;  3UX4 A;  1Q2Z A;  4JA9 A;  4EEC A;  3E30 A;  3HG0 D;  4WNE A;  1E8Z A;  2VGY A;  4GML A;  4XEI G;  3NQP A;  3DBS A;  2WXL A;  1ELR A;  2P2C P;  2RG8 A;  5EYL A;  4M3O A;  3UXG A;  5HI7 A;  4A63 B;  3EHQ A;  2CHZ A;  1S0P A;  4BTA A;  3Q78 A;  3L22 A;  4J0U A;  4J6I A;  4D10 C;  4O1P A;  1YMP A;  5CEC B;  2P9U G;  2VYI A;  2F8Y A;  1X81 A;  3S7J A;  1Z5S C;  4HNA D;  4Q94 A;  3L9T A;  5BV1 A;  3CVV A;  1NZN A;  3D9H A;  4L23 A;  1P5Q A;  5CED B;  1AWC B;  3ZXP A;  3CHM A;  2Y4U A;  3U66 A;  1SQM A;  3UIO C;  1NL4 A;  4L9P A;  3ZGQ A;  3F6Q A;  3ZYQ A;  2V8S E;  3UM2 A;  1E7V A;  4Z68 A;  4JB8 P;  2WMO A;  4HLL A;  1N4S A;  5CER B;  3EIJ A;  1H6P A;  3MKQ A;  2QZA A;  4G25 A;  2V4H C;  4FC8 A;  1Y8M A;  1DCQ A;  3U9W A;  4I1M A;  3NB2 A;  3SO8 A;  2LUH A;  2WXJ A;  3FU6 A;  4BT8 A;  1HF8 A;  1MX6 A;  3ABK E;  2ZGG A;  1LF8 A;  5HS0 A;  1SZA A;  5KJK A;  2BKK B;  3JCK C;  1N4Q A;  3L54 A;  4IUL A;  3W9G A;  4AY6 A;  3AS5 A;  4XZ4 A;  2QYJ A;  2L0T B;  3UT8 A;  2WXQ A;  3ULQ A;  4GYO A;  4HI8 A;  3KSL A;  4PUC A;  2KCK A;  1FCH A;  1RZ4 A;  4C0E A;  3N71 A;  3G2S A;  4IRU A;  4MLP A;  2FF4 A;  1NP7 A;  1JUQ A;  3CVX A;  4ZHB A;  3HRA A;  2AXZ A;  4CRW A;  1K3Z D;  2R03 A;  2XCB A;  1ZBP A;  4F1P A;  1L5J A;  3PE4 A;  1TN7 A;  5AAR A;  1H6K A;  2DVW A;  1UJK A;  1IYG A;  2X6H A;  1XGW A;  2YIN A;  2HO1 A;  4CCA A;  1H2U A;  5AQA A;  3ZW3 A;  4FHJ A;  3QC1 A;  4IYP A;  2A5E A;  2KCL A;  3FTX A;  3LVQ E;  2YNQ A;  4KZC A;  4LER A;  4ANW A;  1EF1 C;  1U3C A;  1OWP A;  2FEZ A;  1VDY A;  4I1O B;  3EDT B;  2NC9 A;  1LD7 A;  1HFA A;  1H19 A;  3L16 A;  3FUJ A;  3PUJ A;  2GRM A;  1TN8 A;  3APD A;  3LY8 A;  4DX2 A;  4L7T A;  2ZIS A;  5CMY A;  3R7R A;  4YDY A;  2J09 A;  4GZ5 A;  4F6R D;  1N11 A;  4JL0 A;  5EIL A;  1OWN A;  3D9I A;  3URZ A;  4GMR A;  4K5A B;  3D9M A;  3PRE A;  3EJN A;  5FQ7 A;  3AG2 E;  4CDR A;  2R05 A;  3ZHE A;  1N4P A;  2EIM E;  4GTP A;  2A4Z A;  3UT4 A;  4ATZ D;  3IBE A;  2OV8 A;  2L6B A;  3TWV A;  5KJM A;  3NZU A;  3Q47 B;  3JUE A;  2XPI A;  5KCM A;  2CHW A;  4ATG A;  3K9I A;  2P9L G;  3MEK A;  1H6O A;  4ACK A;  2AJA A;  3FTZ A;  3AG4 E;  1A17 A;  1MJ0 A;  5M72 A;  3ISM C;  1E8W A;  4FLB A;  1U3D A;  4J8S A;  3TWX A;  2WPV A;  4EBA G;  2RFA A;  4N39 A;  5ENQ D;  4JHK A;  3FTV A;  2OOE A;  4BWR A;  3QWV A;  3QB2 A;  5ENS D;  2J4D A;  2L9B A;  4WWP A;  2PL2 A;  5J08 A;  5ENP D;  1TJC A;  1LD8 A;  4HOQ A;  3ULY A;  3JXJ A;  5FZR A;  3T5V A;  1BD8 A;  2M63 A;  3BUA A;  5FQ4 A;  3SFX A;  4B8C B;  2BKG A;  4TRQ A;  5G05 C;  2GRN B;  3QNK A;  5T3R A;  3CHQ A;  4XKC A;  1PY1 A;  2AWI A;  2OEW A;  4N3B A;  3EHR A;  1X5B A;  3LCA A;  5KWD A;  3ULE G;  2X6I A;  4GTQ A;  3D9N A;  3UKU G;  4FAD A;  4YVQ C;  3PUK A;  5CMW A;  4TUU A;  2J8S D;  5CBN A;  2YHC A;  2LNI A;  1SVX A;  3ASO E;  1ZB1 A;  3I3N A;  4X8Q A;  4LEU A;  1UG3 A;  3LKU A;  1IKN D;  5FJY A;  4YVO A;  1N0Q A;  3ABM E;  3HDX A;  3TG4 A;  3HVE B;  5BUZ A;  1IHB A;  2NSZ A;  3KSQ A;  4OVV A;  4HOT A;  2XEV A;  3ZKJ A;  4J8Y A;  3FWV A;  3CSF A;  5FQ8 A;  1TNY A;  5G04 C;  2IF4 A;  3KS2 A;  3APF A;  2P9S G;  4GTM A;  1E90 A;  3FUH A;  3PS6 A;  1HS6 A;  1K8K G;  1HG2 A;  4H7X A;  3JQ1 A;  3BU8 A;  1O1T A;  3ML9 A;  3I4R B;  2HYZ A;  3ZVV A;  5FZS A;  3FEX A;  2XRY A;  3HXF A;  2V5F A;  4U95 D;  3QJZ A;  1N4R A;  4GZ3 A;  5D0O D;  4EBA A;  5J90 A;  2L6J A;  2MOW A;  4HQD A;  4J8D A;  5FWQ A;  2I2O A;  3E33 A;  1HX8 A;  5LCW J;  4HB5 A;  3ASN E;  3UM1 A;  2XHE A;  4JXT A;  3FUF A;  2WVI A;  4YDE A;  2CFZ A;  4CT0 A;  4UWL A;  3CK8 A;  3PEU B;  4FUL A;  4Y6W A;  3AAA C;  2VTB B;  1A5E A;  1KT0 A;  4J7W A;  3V2X A;  3DWL G;  3V79 K;  2PNN A;  3S7D A;  5B1A E;  3ASF A;  4UQX A;  4F1S A;  5A7D B;  5EIB E;  4MS6 A;  4G8K A;  3IXE A;  4GYY A;  4Q69 A;  4CDN A;  1TJF A;  3SF4 A;  1SA4 A;  3QOU A;  2WXO A;  3L08 A;  4Q96 A;  5IY5 E;  3DST A;  4U8Y D;  1OCO E;  1IQR A;  3FUL A;  2WMN A;  2GRO B;  3TXM A;  3ESL A;  1GW6 A;  4RVB A;  3AU5 A;  3JUI A;  1QZ2 A;  1NA3 A;  1BPO A;  3QK0 A;  4B8A A;  4PDX A;  1UOH A;  3RK6 A;  3FUE A;  1DNP A;  3T5X A;  5LFA A;  3CHR A;  5G04 J;  5JJT A;  4G8L A;  3FUD A;  1V55 E;  3AG3 E;  4O60 A;  2Y4T A;  4PS8 A;  4KBQ A;  4JW1 A;  2VSX E;  2IY0 C;  1OY3 D;  4GA2 A;  2MRI A;  3OXF A;  2AW6 A;  4CDM A;  3LPZ A;  2KC7 A;  1E8Y A;  4JEH A;  3FU5 A;  4FHK A;  3EUV A;  5KBA A;  3FEY A;  5BXO A;  2BTD A;  2OVF A;  3JXI A;  2Y1L E;  2VSY A;  2EIK E;  3TJP A;  3CEQ A;  2X6K A;  3PE3 A;  4MRU A;  3MX3 A;  3V31 A;  5FQ6 A;  1HU3 A;  4CGV A;  4DLQ A;  4RSY A;  5D2M C;  1OWM A;  3ZRH A;  4XIF A;  4M7C A;  5FIN A;  2R5S A;  2VGX B;  5LX8 A;  5AEN A;  4GPK A;  2Y3A A;  2OND A;  1N9A A;  3LY9 A;  3BEE A;  1WM5 A;  1OUV A;  3CHS A;  3LXU X;  4KXK B;  4A3V A;  3LYA A;  4LG6 A;  3E32 A;  3SBS A;  1FPP A;  3D9K A;  2XZT G;  3LY7 A;  3ZUV B;  5EYP F;  3RRM B;  2QYU A;  2WXP A;  2P9N G;  3Q15 A;  4F53 A;  4G24 A;  4LRZ A;  4GA0 A;  3L13 A;  3HXD A;  4UI9 K;  3G2W A;  4DPR A;  2I1K A;  2XRZ A;  5FZQ A;  2YHE A;  4GTS A;  1OWO A;  4CGW A;  2DZN A;  3AS8 A;  3OXG A;  5A6C A;  4GTT A;  1QYM A;  5EID A;  4BET A;  3IEG A;  3SD5 A;  4UWG A;  2X6J A;  2OEV A;  1N95 A;  1O1S A;  2DWZ A;  3QWW A;  4YDO A;  3Q9U C;  2WM9 A;  1JCR A;  2QFC A;  5BV0 A;  1ELW A;  1JWF A;  1TNZ A;  5JJ6 A;  3QWP A;  1OCC E;  5AQB A;  4DRX E;  2NYJ A;  2C0L A;  3ABL E;  4LNB A;  2V0P A;  4GYW A;  1KZP A;  3EU5 A;  1Z3X A;  4L2L A;  2MYO A;  4JC8 A;  4DI3 A;  2B0O E;  3CQC B;  4UWK A;  2VSO E;  4WNG A;  4F3V A;  4U7E B;  3PNT B;  4JHR A;  1HZ4 A;  1AP7 A;  3CK9 A;  4DX6 D;  3VLE A;  3DSU A;  4GCN A;  5DIZ A;  1JPL A;  4W9R A;  3CVN A;  5B1B E;  3C5R A;  2X38 A;  2FO7 A;  1SW6 A;  2OVB A;  2DYS E;  1TNU A;  4R7L A;  3R7Q A;  2ETA A;  2XEN A;  3MKQ B;  4GAA A;  4ME2 A;  1K1B A;  5LOZ A;  4B89 A;  3UI2 A;  3EU9 A;  3FTS A;  3HXB A;  3FUI A;  2Y0B G;  3U4T A;  2KAT A;  2PZI A;  1RW2 A;  2R59 A;  3QAR A;  3CQG B;  3UIP C;  3SY2 A;  3UMV A;  3V30 A;  1EDU A;  4HOS A;  1D8E A;  2C0M A;  3QKY A;  3P2B A;  3UT7 A;  2LAI A;  2HE0 A;  3GYZ A;  3DSX A;  2IQC A;  3R9A B;  5FTP A;  4N5Q A;  4KVO A;  3PNL B;  2ION A;  4NRH B;  5ARG A;  3UIN C;  4OAV B;  4K5B A;  1E7U A;  4U8V D;  4GTR A;  4UQZ A;  3CIA A;  3NOC D;  2FO1 E;  2I9C A;  3ASG A;  1O1R A;  2ZXW E;  3AU4 A;  1ZU2 A;  1IXV A;  2H6H A;  5LCW C;  2WXH A;  3O4Z A;  4WND A;  2V4L A;  2WXI A;  4G2V A;  5G55 A;  4BY6 A;  1B89 A;  3RKV A;  4I9C A;  2KBX A;  2DCP A;  4BES A;  1WY6 A;  1WDY A;  3RU0 A;  4HVB A;  4XE0 A;  4LSZ E;  4KVM A;  2AXV A;  1KPS B;  1EYH A;  4L2Y A;  4FJY A;  4TV3 A;  4GZC A;  1MX2 A;  2H6G A;  3DSS A;  1UN9 A;  3GZ2 A;  4N2S A;  2ILR A;  5CRV A;  4PH4 B;  5E75 A;  1H0A A;  1NA0 A;  1S64 A;  4HFG A;  4YDW A;  2P58 C;  3BQO A;  1JCQ A;  3CKC A;  2UY1 B;  3PVL A;  1PC2 A;  3BG0 B;  5BT1 A;  2ETC A;  1S63 A;  5CCL A;  3FUM A;  4ABN A;  3CVL A;  4DX1 A;  3B95 A;  3OTN A;  4GPM A;  4I1A A;  4U0S A;  4JHJ A;  3S7F A;  3SHF A;  3G2T A;  3ENE A;  3PZ2 A;  3IHY A;  4AM9 A;  4G1T A;  4U96 D;  4GTV A;  2H6F A;  4U0U A;  1EPU A;  2WB2 A;  4KYO B;  2WXF A;  4APO A;  2KZT A;  3C72 A;  4XI0 A;  4ANX A;  1OCZ E;  3Q9N C;  3ZIM A;  2X3M A;  3ESK A;  5AQ9 A;  4GZD A;  3TG5 A;  2IO2 C;  4ILG A;  3MGB A;  2V5Q C;  1Z6T A;  2FUL A;  3SBT B;  4E85 A;  2IOL A;  3ASD A;  1D9S A;  3CLJ A;  3C3Q A;  4I9E A;  2EIJ E;  4JVS A;  3S7B A;  2VGE A;  1MHQ A;  3LS8 A;  1OWL A;  4ZFH A;  3B7S A;  5HQ8 A;  3FTY A;  4K03 A;  4JZY A;  2EIL E;  2R17 C;  4AVX A;  3ONL A;  5C1D A;  4JPS A;  4GA1 A;  1YCS B;  3ZNG A;  1TNO A;  4HRL A;  4UWF A;  3SFZ A;  4AIF A;  5T4Y A;  4L1B A;  3U64 A;  3CGH A;  3Q5M A;  5CHE E;  1TN6 A;  4FLH A;  2EQX A;  3PZ1 A;  3CHO A;  3O48 A;  3ZYM A;  3Q4A B;  1TEZ A;  1XNF A;  3E37 A;  5AJD A;  4RG9 A;  4XKB A;  4WAF A;  4KMO A;  3UM0 A;  4OAU C;  1HG5 A;  4AOF A;  1BU9 A;  4P29 A;  1MX4 A;  5EX0 A;  4BSX A;  5BNW A;  4CYM D;  3ASH A;  1JCS A;  3UUX A;  1KZO A;  3NBN B;  4H7Y A;  4CT4 A;  1MQS A;  5JA4 D;  2F0Y A;  2QC9 A;  3DPY A;  5ENN A;  3Q79 A;  4UI9 J;  4N5C A;  4WNF A;  2XEH A;  3PZ4 A;  4HRN A;  3EHN A;  3ONK A;  1FT1 A;  3L17 A;  4K5C A;  5A23 A;  2LSU A;  2R2L A;  3UM3 A;  3MYV A;  3ZYL A;  5AJL A;  2AXU A;  1WAO 1;  2CG3 A;  2IEJ A;  3UQ3 A;  3D9J A;  1Y6I A;  4QQI A;  2ETB A;  3ZPJ A;  3ZFW A;  2KCV A;  1G3N B;  3I5P A;  3JQ0 A;  3SFY A;  2J49 A;  5ENO D;  1BLX B;  2PM6 A;  4PS3 A;  2LAH A;  3PZ3 A;  1U2V G;  3LJ3 A;  3MJW A;  4GB9 A;  2IOS A;  1D8D A;  4AY5 A;  2GGF A;  3Q75 A;  5KJL A;  4ILI A;  3QAQ A;  4FJZ A;  3DRA A;  1IHG A;  1NFI E;  4I6G A;  4GMJ A;  2H6I A;  3NOG D;  3SQV A;  3HXE A;  1MYO A;  4U0Z A;  4URK A;  4I6J A;  1UN8 A;  4FU3 A;  5KNH D;  3TWQ A;  2EIN E;  4FP7 A;  1TNB A;  2J07 A;  4N2Q A;  1UJJ A;  4A1S A;  2GRR B;  1FVH A;  3S2A A;  2LXM A;  2FI7 A;  2KM4 A;  2NXP A;  3ZYK A;  2A5U A;  4B94 A;  4G11 A;  1HH8 A;  3DEP A;  5AYW D;  5ANR A;  3TL5 A;  1HE8 A;  3ZU7 B;  2YQ8 A;  3CHP A;  3AS4 A;  2PM7 A;  3FY4 A;  2WXM A;  1H2V C;  1FVF A;  4NQ0 A;  3RO2 A;  5ANL A;  4DX7 D;  4IN3 B;  4WUY A;  3KAE A;  5D66 A;  4APF A;  4LCT A;  3FH7 A;  4NUR A;  3TWT A;  2DZO A;  2XGS A;  4DLO A;  2VGX A;  4BEP A;  2XGO A;  3CR3 A;  4DI4 A;  3RAU A;  4ANU A;  4GU5 A;  3HXC A;  4BT9 A;  2XEE A;  4DJA A;  2BED A;  1IQU A;  1MZC A;  1KT1 A;  3VLD A;  4NAC A;  3GW4 A;  3ZEF A;  5BPP A;  3L6A A;  3ZHE B;  2WXG A;  2DYR E;  4FA6 A;  4HI9 A;  1QQE A;  5G2N A;  1YYH A;  5DBK A;  2FBN A;  3Q7F A;  3D9L A;  5AAO A;  1H2T C;  3I4G A;  3LEW A;  2RFM A;  4BER A;  2I1J A;  4F7A A;  4EZK A;  3AJI A;  4KZ0 A;  2XGM A;  4EQF A;  3CKB A;  3FDH A;  3RO3 A;  3PH0 C;  3NAW A;  4MBG A;  2HR2 A;  1BI8 B;  5FT9 A;  4BFR A;  3EIQ C;  5G05 J;  3D3M A;  4A55 A;  4OVU A;  4HLE A;  4UQY A;  3MCX A;  4UWH A;  3HVE A;  3LVR E;  4Y6C A;  2ZGD A;  5AIJ A;  1QBQ A;  4U8H A;  2P9I G;  4TUM A;  3MV2 B;  4CEM A;  3HYM B;  5ARF A;  5E76 A;  3TXN A;  4C48 B;  2WXR A;  4J8F A;  2KZT B;  4ACL A;  4EPZ A;  3RIB A;  2XCC A;  5H7P A;  3FTW A;  3J5Q B;  3CV0 A;  3HIZ A;  4WWO A;  4ANV A;  1N94 A;  2GRQ B;  2XS8 A;  3FH8 A;  5JHB A;  4I2Z A; 
#chains in the Genus database with same CATH homology
 5BV1 A;  2VQ2 A;  1NZN A;  3CVV A;  4B0Z A;  4L23 A;  3OTN A;  4F1S A;  5A7D B;  3C98 A;  4MS6 A;  1P5Q A;  4I1A A;  4GYY A;  4Q69 A;  3CVW A;  4U0S A;  2LSV A;  3DPD A;  2WQ6 A;  4CDN A;  1TJF A;  4JHJ A;  3S7F A;  3SF4 A;  3CHM A;  3SHF A;  2Y4U A;  3G2T A;  2XQ0 A;  3U66 A;  1SQM A;  3ENE A;  4PS7 A;  3IHY A;  3QOU A;  2WXO A;  4AM9 A;  3VTX A;  3ZGQ A;  4G1T A;  1HXI A;  3OAW A;  3L08 A;  3ZYQ A;  4U0U A;  4HXI A;  1EPU A;  4Q96 A;  2WB2 A;  3WXX A;  2V8S E;  1E7V A;  2E2E A;  4KYO B;  2WMO A;  2WXF A;  1IQR A;  3EIJ A;  3FUL A;  4APO A;  4I2W A;  3FHE A;  4U63 A;  4C9B B;  2KZT A;  2WMN A;  3MKQ A;  4XI0 A;  1QNF A;  4G25 A;  3TXM A;  4A3T A;  3SZ7 A;  4ANX A;  4FC8 A;  3ESL A;  1SZ9 A;  3QDN A;  3ZIM A;  1Y8M A;  1GW6 A;  4RVB A;  4XX5 A;  3AU5 A;  5EDS A;  2X3M A;  3JUI A;  3NF1 A;  1QZ2 A;  3ESK A;  3U9W A;  1NA3 A;  1BPO A;  4I1M A;  3QK0 A;  4B8A A;  4GZD A;  4DK5 A;  4AV7 A;  3TG5 A;  4PDX A;  3GZS A;  4ILG A;  4N3C A;  4AXH A;  2AVP A;  2WXJ A;  3FU6 A;  3MGB A;  1HF8 A;  4BT8 A;  3RK6 A;  1Z6T A;  2FUL A;  4GZ6 A;  3SBT B;  2IOL A;  4BX9 A;  4E85 A;  3FUE A;  1DNP A;  3ASD A;  3T5X A;  4A1G A;  5LFA A;  3CHR A;  1LF8 A;  3CLJ A;  4EZL A;  3PEV B;  3FTU A;  5G04 J;  5JJT A;  2IFU A;  1SZA A;  4I9E A;  3FUD A;  5KJK A;  3OXL A;  4HOR A;  4JVS A;  3S7B A;  4HS2 A;  1MHQ A;  3LS8 A;  3JCK C;  3L54 A;  4IUL A;  1OWL A;  2Y4T A;  4PS8 A;  4KBQ A;  4JW1 A;  3B7S A;  2VSX E;  5HQ8 A;  4E6H A;  4AY6 A;  3AS5 A;  4XZ4 A;  3FTY A;  4K03 A;  1INZ A;  4JZY A;  2R17 C;  4AVX A;  2L0T B;  3ONL A;  3UT8 A;  5C1D A;  2WXQ A;  2MRI A;  3OXF A;  4GA2 A;  4JPS A;  4GA1 A;  3CVQ A;  2BUG A;  4GYO A;  3ULQ A;  2AW6 A;  4CDM A;  5KJN A;  3LPZ A;  2J08 A;  2KC7 A;  3FH5 A;  2CHX A;  2QY7 A;  3MKR A;  1E8Y A;  1YA0 A;  4JEH A;  4PUC A;  2KCK A;  3FU5 A;  1HO8 A;  1FCH A;  4FHK A;  4UWF A;  4GCO A;  4BX8 A;  3SFZ A;  2VJ8 A;  5T4Y A;  4AIF A;  3RRU A;  3FEY A;  4C0E A;  3G2V A;  4L1B A;  2JLB A;  3CGH A;  3U64 A;  3CK7 A;  3ZXS A;  3B7U X;  3Q5M A;  5CHE E;  3SGH A;  2BTD A;  2OVF A;  3N71 A;  3G2S A;  4IRU A;  1E96 B;  4MLP A;  4FLH A;  2EQX A;  4EZJ A;  2FF4 A;  3CHO A;  3O48 A;  2VSY A;  2Q7F A;  3ZYM A;  3TJP A;  1NP7 A;  3CEQ A;  3Q4A B;  1TEZ A;  1JUQ A;  3CVX A;  2X6K A;  1XNF A;  5EKQ D;  3PE3 A;  4MRU A;  3MX3 A;  2AXZ A;  5AJD A;  4RG9 A;  4CRW A;  4XKB A;  5FQ6 A;  4WAF A;  4KMO A;  2XCB A;  2IU1 A;  1HU3 A;  1ZBP A;  1L5J A;  3PE4 A;  4CGV A;  4DLQ A;  4RSY A;  3ZRH A;  1OWM A;  1HG5 A;  4AP2 A;  4XIF A;  1H6K A;  1UJK A;  4AOF A;  4G23 A;  1ELK A;  2R5S A;  4P29 A;  2VGX B;  1IYG A;  5EX0 A;  5LX8 A;  3PDN A;  4U04 A;  4MKT A;  4BSX A;  5BNW A;  2X6H A;  1XGW A;  2YIN A;  4I6E A;  5AEN A;  2HO1 A;  3CVY A;  2Y3A A;  4GPK A;  4CCA A;  1H2U A;  3ASH A;  2OND A;  4UQX A;  3ZW3 A;  3LY9 A;  4FHJ A;  2WQH A;  3BEE A;  3QC1 A;  4IYP A;  3UUX A;  2KCL A;  1WM5 A;  3FTX A;  1OUV A;  3LVQ E;  2YNQ A;  3CHS A;  3LXU X;  4KZC A;  4LER A;  3IHV A;  4H7Y A;  2PQR A;  1MQS A;  4KXK B;  1EF1 C;  3B13 A;  4ANW A;  4CT4 A;  1U3C A;  5ENN A;  1OWP A;  2FEZ A;  1VDY A;  4UI9 J;  4N5C A;  4WNF A;  4A3V A;  3LYA A;  4I1O B;  5D0Q D;  3EDT B;  2NC9 A;  3SBS A;  3MV3 B;  3EHN A;  1HFA A;  4G26 A;  1H19 A;  1UW4 B;  3D9K A;  3ONK A;  3L16 A;  3FUJ A;  2GRL A;  4YND A;  3PUJ A;  4KT6 B;  2GRM A;  3APD A;  3L17 A;  3LY8 A;  3LY7 A;  2X6F A;  4L7T A;  5CMY A;  5A23 A;  3R7R A;  3RRM B;  2WXP A;  3U3W A;  2J09 A;  4GZ5 A;  3Q15 A;  4JL0 A;  2LSU A;  4F53 A;  1OWN A;  3D9I A;  3URZ A;  4I17 A;  4ILH B;  4G24 A;  3SNX A;  2WXK A;  4LRZ A;  4AEZ C;  5JHA A;  3D9M A;  3PRE A;  3MYV A;  4GA0 A;  3EJN A;  3L13 A;  3B7T A;  3P1U A;  3T8M A;  3ZYL A;  4UI9 K;  3G2W A;  5FQ7 A;  5AJL A;  4DPR A;  2I1K A;  4CDR A;  2AXU A;  2XRZ A;  1WAO 1;  3ZHE A;  2CG3 A;  5FZQ A;  2A4Z A;  3UT4 A;  2DBA A;  2YHE A;  3ZN3 A;  1OWO A;  3IBE A;  2OV8 A;  3UQ3 A;  3D9J A;  4OYS A;  2VSN A;  4CGW A;  1Y6I A;  5KJM A;  3NZU A;  3ZPJ A;  3AS8 A;  3ZFW A;  3Q47 B;  5BW8 C;  2KCV A;  3OXG A;  4BTB A;  3I5P A;  2CG2 A;  2XPI A;  3JQ0 A;  2CHW A;  5KCM A;  5A6C A;  2CFU A;  4ATG A;  2J49 A;  4V3I A;  3IEG A;  2PM6 A;  4PS3 A;  4C0M A;  3K9I A;  3SD5 A;  4UWG A;  2X6J A;  3MEK A;  2LAH A;  4ACK A;  3FTZ A;  1A17 A;  3QWW A;  3LJ3 A;  3JYS A;  3MJW A;  4GB9 A;  3ML8 A;  5M72 A;  2WM9 A;  1E8W A;  3FU0 A;  4FLB A;  1U3D A;  2IOS A;  2QFC A;  2MHK A;  1W3B A;  4J8S A;  5BV0 A;  1ELW A;  4AY5 A;  3FU3 A;  2J9Q A;  1JWF A;  2GGF A;  5KJL A;  3FP3 A;  5JJ6 A;  4ILI A;  2WPV A;  3QWP A;  4EBA G;  4N39 A;  2C0L A;  4JHK A;  4WWN A;  3QAQ A;  4FJZ A;  3FTV A;  1N52 A;  2OOE A;  4JEU A;  2V0P A;  4BWR A;  3QWV A;  1IHG A;  3QB2 A;  4N3A A;  4GYW A;  2J4D A;  2L9B A;  4I6G A;  4GMJ A;  1Z3X A;  4WWP A;  2PL2 A;  4L2L A;  5J08 A;  4LUN U;  1TJC A;  4U0Z A;  4JC8 A;  3BG1 B;  2XPY A;  3RRN B;  2ZU6 B;  4DI3 A;  4URK A;  3TGO A;  4HOQ A;  4I6J A;  1UN8 A;  4FU3 A;  4K0R A;  5FZR A;  3T5V A;  4FP7 A;  3CVU A;  4UI9 C;  3CQC B;  4UWK A;  2VSO E;  2J07 A;  4WNG A;  4N2Q A;  3FUM A;  1UJJ A;  3IKO B;  4F3V A;  4A1S A;  2M63 A;  5FQ4 A;  1FVH A;  3S2A A;  4B8C B;  5CCM A;  2JEK A;  2FI7 A;  4TRQ A;  2KM4 A;  3PNT B;  4JHR A;  1HZ4 A;  5G05 C;  3QNK A;  3Q49 B;  2NXP A;  3ZYK A;  2A5U A;  4B94 A;  3CK9 A;  2VTB A;  4G11 A;  5T3R A;  3CHQ A;  3VLE A;  4XKC A;  1PY1 A;  2AWI A;  1HH8 A;  3CVP A;  4GCN A;  1JPL A;  2C2L A;  5DIZ A;  4W9R A;  3CVN A;  5AYW D;  3CST A;  5ANR A;  3TL5 A;  2X38 A;  4N3B A;  1Z3Y A;  1X5B A;  2FO7 A;  1HE8 A;  3LCA A;  2OVB A;  2L0I A;  4XI9 A;  4QFV A;  2X6I A;  2YQ8 A;  3D9O A;  3CHP A;  4R7L A;  3AS4 A;  3R7Q A;  3D9N A;  2LO6 A;  4FAD A;  4YVQ C;  2UY1 A;  3PUK A;  2PM7 A;  2UWJ G;  5CMW A;  3MKQ B;  4TUU A;  1JWG A;  4GAA A;  3FY4 A;  2WXM A;  1H2V C;  4ME2 A;  2YHC A;  2LNI A;  1FVF A;  3LDZ A;  5LOZ A;  4NQ0 A;  4I43 A;  2HM8 A;  3RO2 A;  5ANL A;  4J8E A;  4B89 A;  5C2Y A;  3I3N A;  4IN3 B;  3RJV A;  3FTS A;  2GW1 A;  4LEU A;  3HHM A;  3FUI A;  3IV0 A;  3VTY A;  4WUY A;  3KAE A;  1UG3 A;  4APF A;  3LKU A;  4LCT A;  4O6F A;  5FJY A;  3U4T A;  3FH7 A;  4NUR A;  2KAT A;  4YVO A;  2PZI A;  2XGS A;  4DLO A;  3HDX A;  2R59 A;  2VGX A;  3QAR A;  3CQG B;  3TG4 A;  1KLX A;  3FUN A;  3HVE B;  3KEZ A;  2XGO A;  5BUZ A;  3CR3 A;  4DI4 A;  2DIW A;  5T8I A;  2NSZ A;  3E4B A;  4HOU A;  3UMV A;  4ANU A;  4GU5 A;  3GZ1 A;  4OVV A;  4BT9 A;  4HOT A;  1EDU A;  4HOS A;  3FFL A;  2XEV A;  4AJW A;  3B7R L;  2C0M A;  4DJA A;  3QKY A;  4JA7 A;  3P2B A;  3UT7 A;  5LP0 A;  2LAI A;  3FWV A;  3CSF A;  1IQU A;  3GYZ A;  2IQC A;  2BF0 X;  2WQ7 A;  3R9A B;  5FTP A;  3G2U A;  5FQ8 A;  4KVO A;  5G04 C;  3PNL B;  1KT1 A;  3VLD A;  2ION A;  4NRH B;  5ARG A;  4NAC A;  5JJ7 A;  3GW4 A;  2IF4 A;  3ZEF A;  5BPP A;  3L6A A;  3ZHE B;  5EX3 A;  3KD7 A;  1E7U A;  2WXG A;  4RG6 A;  3KS2 A;  4UQZ A;  4FA6 A;  1QQE A;  2PQN A;  3CIA A;  3APF A;  3MA5 A;  2E0I A;  5DBK A;  5G2N A;  2FBN A;  3APC A;  3D9L A;  2J4B A;  2I9C A;  3ASG A;  1PAQ A;  1E90 A;  1H2T C;  3FUH A;  3I4G A;  3PZD A;  2WXN A;  3LEW A;  3PS6 A;  1HS6 A;  4U07 A;  2I1J A;  4F7A A;  3NZS A;  4EZK A;  3AU4 A;  1ZU2 A;  1HG2 A;  4H7X A;  1N54 A;  3FUK A;  3MZL B;  1E8X A;  3JQ1 A;  3UPV A;  4KZ0 A;  2XGM A;  3SI5 A;  5LCW C;  4EQF A;  3CKB A;  3FDH A;  2WXH A;  3O4Z A;  3PRZ A;  3ML9 A;  2RD0 A;  3RO3 A;  4WND A;  3I4R B;  3PH0 C;  2V4L A;  2HYZ A;  2WXI A;  3ZVV A;  5FZS A;  3FEX A;  2XPZ A;  2HR2 A;  1DVP A;  2XRY A;  4G2V A;  2V5F A;  2IJG X;  3EHM A;  5G55 A;  5FT9 A;  3D9P A;  2I6H A;  4BY6 A;  1B89 A;  3QJZ A;  3TAX A;  4GZ3 A;  3EIQ C;  5G05 J;  4BFR A;  5D0O D;  3VLF A;  3D3M A;  4A55 A;  3UX4 A;  4EBA A;  3RKV A;  4I9C A;  4OVU A;  4HLE A;  4JA9 A;  5J90 A;  2L6J A;  2MOW A;  2DCP A;  4UQY A;  4J8D A;  3MCX A;  4UWH A;  5FWQ A;  4EEC A;  1WY6 A;  2I2O A;  3HVE A;  1HX8 A;  1E8Z A;  2VGY A;  4WNE A;  4GML A;  3RU0 A;  4HVB A;  3NQP A;  3LVR E;  4XE0 A;  5LCW J;  3DBS A;  4KVM A;  2WXL A;  4Y6C A;  1ELR A;  2AXV A;  2RG8 A;  2XHE A;  4JXT A;  1EYH A;  3FUF A;  2WVI A;  4M3O A;  4L2Y A;  5AIJ A;  2CFZ A;  4FJY A;  4U8H A;  4TV3 A;  4CT0 A;  4UWL A;  5HI7 A;  4GZC A;  3CK8 A;  3MV2 B;  3PEU B;  4CEM A;  3HYM B;  1UN9 A;  5ARF A;  3GZ2 A;  5E76 A;  3TXN A;  4N2S A;  2CHZ A;  2ILR A;  1S0P A;  2WXR A;  4FUL A;  4J8F A;  4PH4 B;  4BTA A;  2KZT B;  4Y6W A;  5E75 A;  1H0A A;  4ACL A;  3L22 A;  4J0U A;  1NA0 A;  3RIB A;  4EPZ A;  2XCC A;  4J6I A;  4D10 C;  4HFG A;  2P58 C;  3FTW A;  2VTB B;  3CKC A;  3CV0 A;  3HIZ A;  4WWO A;  2VYI A;  4ANV A;  2UY1 B;  3PVL A;  1KT0 A;  3S7J A;  1PC2 A;  3BG0 B;  5BT1 A;  3S7D A;  3FH8 A;  5JHB A;  3ASF A;  4I2Z A;  5CCL A;  4Q94 A;  3CVL A;  4ABN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...