3K9IA

Crystal structure of putative protein binding protein (np_241345.1) from bacillus halodurans at 2.71 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
110
structure length
110
Chain Sequence
b'AQAVPYYEKAIASGLQGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH0479 protein
publication title Crystal structure of Putative protein binding protein (NP_241345.1) from Bacillus halodurans at 2.71 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Protein binding
total genus 39
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3k9iA01
3TGOA 4XIFA 4N2SA 3QKYA 1E96B 2Q7FA 2GW1A 1P5QA 4I9CA 2P58C 5AYWD 2C2LA 3QOUA 4WNEA 3LKUA 3RO2A 1W3BA 3AS5A 4YVQC 3UUXA 3MEKA 3ZN3A 2C0MA 5KJLA 2V5FA 4N5CA 3RJVA 3ZGQA 3NF1A 3VTXA 3UPVA 4GYWA 3URZA 4Y6CA 4O6FA 3CKBA 3ULQA 2YHCA 3LYAA 2XCBA 3RU0A 5CHEE 2FEZA 4AY5A 2Y4UA 2VGYA 1NA0A 2KCKA 3JYSA 3LY9A 5ARGA 3IEGA 5JJ7A 5M72A 2WQHA 4HOQA 4Y6WA 4G24A 3FP3A 4HOSA 1QQEA 3KS2A 3MKRA 4WNDA 2E2EA 2HR2A 1NZNA 4UI9C 5FTPA 3TAXA 4UI9K 5KJNA 5KJKA 1ELRA 4YVOA 3CVLA 4BWRA 2FBNA 4U07A 3ASFA 1YA0A 1OUVA 2OOEA 4GZ3A 4GCNA 2L6JA 3HYMB 3MV3B 1XNFA 4I17A 3CK7A 4A1SA 3AS8A 2VSNA 2XGMA 4BTAA 3GZ1A 1IHGA 2XEVA 2QFCA 3O48A 2XPIA 2ONDA 2FF4A 5FZRA 5JJ6A 2FO7A 2HO1A 5FJYA 3ESKA 3PE3A 1A17A 4APOA 3LY7A 4GZ6A 4YNDA 4HORA 4GCOA 1ZU2A 5BNWA 1HH8A 1FCHA 3Q47B 5C1DA 5EX0A 2UY1B 2VSYA 5FZSA 5CCLA 2LSVA 3ASDA 5LCWC 2PL2A 5FT9A 2VQ2A 2UY1A 2BUGA 5HQ8A 2PQNA 4G2VA 4U0SA 4UQXA 4BTBA 1IYGA 4HOUA 1B89A 3UQ3A 3CEQA 5A7DB 3FFLA 3MV2B 3SZ7A 3VTYA 3TG5A 3CK8A 3Q5MA 2IF4A 2R5SA 4JL0A 2IFUA 3CKCA 4G26A 3WXXA 1KLXA 4LEUA 2VGXB 4XI0A 1QZ2A 4RG6A 3QWVA 5G04C 5DIZA 2VGXA 3GYZA 2PQRA 3RIBA 5KJMA 3AS4A 4ABNA 3QWWA 3KAEA 5HI7A 4JA7A 4J0UA 4IN3B 3K9IA 4WNFA 2MHKA 4HOTA 4H7XA 4U0ZA 5BT1A 4NRHB 2Y4TA 4CGVA 1NA3A 3ZFWA 3QWPA 3N71A 3U4TA 4UI9J 4XI9A 4WUYA 4U04A 2XGOA 2XCCA 3RO3A 2AVPA 3S7DA 4CGWA 3LPZA 3E4BA 2UWJG 3CK9A 4N3BA 3S7JA 3SF4A 3S7BA 5BW8C 3RKVA 4W9RA 5JJTA 2YQ8A 2NC9A 2KCVA 4B94A 5DBKA 2LSUA 4G25A 3CV0A 3ZHEB 4BT9A 2WPVA 4N3AA 3KD7A 1HXIA 4GYOA 4N39A 3MA5A 4UQYA 3GZ2A 4GA0A 3EDTB 3PE4A 3ZHEA 3U3WA 4I1AA 4J8DA 4G23A 1TJCA 3CVQA 4U0UA 5ARFA 2LNIA 5LCWJ 5EKQD 3OXLA 2KCLA 4JHRA 4GZ5A 2VYIA 1Y8MA 3ASHA 3CVPA 4GPKA 4AY6A 2KATA 4CDRA 2DBAA 2XGSA 4J8EA 2J9QA 5A6CA 3GW4A 2JLBA 2FI7A 4AM9A 4AIFA 2HYZA 2KC7A 3LY8A 3BEEA 5FZQA 1WAO1 3OXGA 1HZ4A 4WNGA 4GA1A 5G04J 4JA9A 3Q4AB 2I6HA 3QDNA 4H7YA 4UQZA 4GYYA 4KBQA 4BT8A 3LCAA 5G05C 5CCMA 1ELWA 2PZIA 4N2QA 1ZBPA 3FWVA 4RG9A 3CVNA 4I2ZA 4GA2A 4KYOB 3TG4A 1KT0A 3S7FA 4N3CA 4G1TA 2C0LA 4KXKB 4F3VA 5G05J 3OXFA 3ASGA 4I9EA 4I2WA 3ZPJA 4EQFA 4J8FA 4ME2A 3R9AB 4NQ0A 1WM5A 3Q49B 5EX3A 3Q15A 1KT1A 5D0OD 1PC2A 3PDNA 5D0QD
chains in the Genus database with same CATH superfamily
3TWRA 4GTQA 4DLQA 4GTVA 1P5QA 3PZ1A 2P58C 2MYOA 2C2LA 1E7UA 3QOUA 2I9CA 5B3SE 1TNYA 2ZU6B 1W3BA 3AS5A 3EIQC 4YVQC 2IO3C 1UW4B 3UUXA 2KZTB 3D9KA 3ZN3A 3B7TA 2IEJA 5KJLA 4L9PA 4N5CA 3URZA 3TWVA 2KZTA 4F6RD 3GZSA 3PRZA 3L82A 3ULQA 4NACA 2XCBA 4I43A 3RU0A 2FEZA 4B93B 4AY5A 4LERA 1H19A 4KT6B 3SGHA 1GW6A 2RFAA 5ARGA 4FA6A 5JJ7A 2AW6A 3DEPA 3R9MA 4HOSA 2F8YA 4GTRA 1QQEA 3MKRA 1NZNA 3NZSA 2WQ7A 1TN6A 3NQPA 5FTPA 5JHBA 2ETCA 1ELRA 3LJNA 3CVLA 2ETBA 1MX2A 1OUVA 4FLHA 2OOEA 4GZ3A 2KBXA 3SFYA 3MGBA 4PUCA 3TWSA 3HYMB 2F8XK 3MV3B 2V4HC 5H7PA 4A1SA 3Q7AA 2VSNA 3IHVA 4BX9A 3GZ1A 3C98A 2XEVA 4LNUD 3ML8A 3SNXA 2YNQA 3O48A 4A3VA 3ABLE 5FZRA 1DNPA 2Y1LE 1N9AA 3IBEA 3ZNGA 4AEZC 3ESKA 2IQCA 3PE3A 3ZRHA 1IKND 3IHYA 4FULA 1YCSB 4F53A 4YNDA 1A5EA 2GRRB 2AXVA 3Q47B 4F7AA 4GTSA 5C1DA 5EX0A 3DSVA 4C0EA 4U8HA 1SZAA 5T4YA 1OWNA 2IU1A 1OWOA 5LCWC 5AQAA 5BUZA 4G2VA 1N54A 1QBQA 4UQXA 4BTBA 4LNBA 2XQ0A 1Q2ZA 3E37A 1IYGA 2A4ZA 2XHEA 2LO6A 3FUIA 3CEQA 4ANUA 4G11A 1BLXB 1E90A 1HF8A 2X6JA 3FUNA 3PZDA 2OCCE 1H2TC 4ANXA 3MZLB 5BV1A 3FUHA 4GZDA 3T5XA 1TNOA 4IYPA 3CVYA 4DPRA 2X6FA 5J90A 4U63A 4LEUA 2OEVA 1OWLA 3C72A 1QZ2A 3HVEB 4JZYA 2BKKB 3HXFA 3GYZA 2PQRA 3CHMA 3RIBA 3G2UA 5EILA 3HVEA 2WXKA 2R02A 2ZGGA 3QWWA 3T8MA 3KAEA 5HI7A 3UM2A 4JA7A 4IN3B 3RK6A 4U0ZA 5BT1A 4TV3A 4J6IA 4V3IA 2X6KA 1H6OA 5FQ6A 3QWPA 2CG2A 3FU5A 3CVVA 1K1BA 3J5QB 1L5JA 3PREA 3S7DA 4B8CB 1RZ4A 3HHMA 4CGWA 3LPZA 3E4BA 2EQXA 4MS6A 5G2NA 1G3NB 3NOGD 2BKGA 3SFXA 4HRNA 4M3OA 4W9RA 3FUFA 2YQ8A 2KCVA 2NXPA 4B94A 2IO2C 4JD2G 4G8LA 3ZHEB 4BT9A 2I2OA 2OV8A 4U7EB 1MX6A 3ZIMA 3MA5A 3NAWA 3ZU7B 1JCQA 3R7RA 4KVOA 3ZHEA 3TWTA 3TWUA 5KBAA 4J8DA 3MJWA 5A23A 1Z6TA 2PNNA 3V2XA 5AENA 2EIME 2F0YA 2EILE 5AARA 2P9LG 2LXLA 3D9LA 4GAAA 3WG7E 2GGFA 3U64A 3G2SA 2V4LA 1RW2A 3B7BA 1SW6A 2H6GA 3V79K 3Q75A 1Z5SC 4ACKA 1N4PA 4AY6A 3HIZA 4CDRA 1HX8A 2J9QA 4HBDA 5A6CA 2FI7A 1PAQA 4EECA 1IQRA 2AJAA 5FZQA 3NZUA 1WAO1 1HG2A 1U2VG 1HZ4A 2WXIA 4WNGA 3UTMA 5G04J 5AAOA 3Q4AB 3UM3A 2I6HA 3QDNA 1UJKA 2GRQB 5EYLA 4FJYA 4BT8A 5AJDA 5CCMA 2PZIA 4L23A 3ZYKA 4PDXA 3EU5A 3B95A 1FVFA 1SVXA 5D2MC 4HI8A 1E8XA 1AP7A 1N0RA 1KT0A 2NYJA 3BG1B 3S7FA 4B8AA 3AG2E 4B89A 4KXKB 4K5AB 2DZOA 4I2WA 3ZPJA 4YDYA 4GPMA 1PY1A 3FTXA 4RSYA 4U95D 1O1SA 1WM5A 3Q49B 3UT4A 1S64A 4IULA 3DSWA 2IJGX 3CHSA 3ZW3A 3EHMA 5ENSD 1EF1C 1N0QA 4I9CA 3DSXA 4WNEA 4K03A 4BSZB 2GRNB 1UG3A 4KVMA 1Z3XA 5FQ8A 2E0IA 3V30A 4J8SA 3MEKA 1NL4A 2BF0X 3RRMB 3NF1A 3VTXA 4O6FA 2VSXE 4D10C 2GROB 5AJLA 2YHCA 2WMOA 4EHMA 2LAIA 5CHEE 4DLOA 4DJAA 1NA0A 5M72A 4A63B 2WQHA 1SA5A 3D3MA 3F6QA 4Y6WA 3ULEG 4G24A 3UKUG 3FY4A 3KS2A 1TN7A 3TJPA 4DX6D 3I5PA 3TAXA 2FO1E 3G2VA 5KJKA 3FH5A 1Y6IA 4UUCA 5BXUA 1N94A 1UOHA 5EIDA 5KNHD 2KXPC 2J8SD 2L6JA 3D9NA 5CECB 4CDNA 4I17A 2EIKE 2WXQA 2PM6A 2AWIA 3CK7A 1H6KA 4OYSA 2HM8A 3JXJA 3E30A 3D9HA 2L0IA 5CRUA 2XGMA 2B0OE 3P1UA 1IHGA 4FC8A 2QFCA 3L6AA 4XKBA 3L16A 3Q73A 2FF4A 5JJ6A 2HO1A 2WB2A 5FJYA 3E32A 3PUKA 5E76A 3PEUB 1A17A 4APOA 3ZKJA 5ENOD 4RLYA 3LY7A 3IKOB 1WG0A 3B13A 3FUEA 4LG6A 3ZUVB 3UT7A 4I1MA 4GCOA 3MYVA 3EHQA 4APFA 1DVPA 1ZU2A 4HORA 2P9UG 1FCHA 5ENRD 3FH7A 4FJZA 2UY1B 4UWLA 2ETAA 5CCLA 3JXIA 3JUIA 2Y69E 5ENNA 2UY1A 5CBOA 3EJNA 3UMVA 4F1PA 4U0SA 1TR4A 1V54E 3FTWA 1DCQA 5A7DB 3PVLA 3VTYA 5ITZF 3FU0A 4DX2A 4WWOA 1K8KG 3VLDA 3CK8A 4E6HA 3VLFA 2RKKA 3UINC 3ABME 3UM0A 2V0PA 5LP0A 5LFAA 4G26A 3FULA 3WXXA 4URKA 3DWLG 4HXIA 1OCOE 1TEZA 4DK5A 3DSSA 5HS0A 4M7CA 3PS6A 3NOCD 3FEXA 3AJIA 1Z3YA 3QWVA 5G04C 4JC8A 4BEPA 3KEAA 3I4GA 4ABNA 4Q94A 4HLEA 3AG3E 3ML9A 4L7TA 1BI8B 3RAUA 4NIKA 2CFUA 4WNFA 2MHKA 4NRHB 2Y4TA 3PEVB 3ZFWA 3LJ3A 3U4TA 3B7SA 4UI9J 4WUYA 5ANLA 3DPYA 4BSXA 1BU9A 3G2WA 4CYMD 1TNZA 1N52A 4C9BB 2P9PG 1TNBA 2P9KG 3CK9A 3BU8A 2VTBB 2IOSA 3S7BA 5BW8C 3ZYLA 3R7QA 4ACLA 2F37A 3IXEA 4GMLA 2J08A 2VTBA 5DBKA 2OVFA 2LXMA 3ASOE 4N3AA 3KD7A 1AWCB 3ZYMA 3TWQA 4GYOA 3ZVVA 1U3CA 2IONA 2DZNA 3SBSA 5AIJA 4K5CA 3QB2A 3U66A 5CEDB 4PS3A 4TUUA 2V5QC 3AG1E 5G55A 3L08A 1LF8A 4O1PA 5KCMA 3PZ3A 5CERB 2AXZA 4JHRA 4HRMB 4GZ5A 2VYIA 2QZAA 4JPSA 4F1SA 5JMND 3BG0B 3ASHA 3CVPA 2R17C 4PS7A 2WM9A 4GPKA 1JWGA 4AP2A 2IY0C 2QC9A 4BESA 4CDMA 1FT2A 2MRIA 4BETA 1HU3A 3GW4A 2FULA 4TXRA 3CSTA 2DCPA 4HFGA 4AIFA 2HE0A 2XPYA 3LY8A 2J4DA 5LX8A 3BEEA 1MX4A 4EBAA 1TYQG 3OXGA 3UIOC 2V8SE 2DYRE 4JA9A 2DVWA 4CRWA 5IY5E 2H6IA 2L6BA 4EZKA 1OWPA 1OCRE 5LOZA 3FHEA 4Z68A 1ZBPA 3VLEA 4AVXA 4BFRA 4HRLA 2XENA 2JEKA 3APDA 3FTUA 3TG4A 1EPUA 2P9IG 3Q9UC 5G05J 1MQSA 3TWXA 4P29A 1OCZE 3OXFA 3ASGA 4Q96A 3IV0A 4EQFA 2XPZA 1TNUA 4J8FA 2LUHA 1HE8A 1UN8A 1H6PA 5BPPA 2H6FA 4HVBA 4N2SA 4I6EA 1E96B 2Q7FA 3RRUA 1X81A 5AYWD 3LKUA 3RO2A 4A1GA 1JPLA 3EUVA 1HO8A 4JEUA 3MKQB 2V5FA 4GYWA 3HXEA 4JHKA 4DUIA 2NSZA 1LTXA 1LD8A 1OCCE 3MKQA 3LYAA 1ZB1A 4AV7A 4HI9A 2Y4UA 3ESLA 2VGYA 1KPSB 3JYSA 3TXMA 3LY9A 4GTTA 2KM4A 3ULYA 4JEHA 4WNDA 2E2EA 2CHXA 2HR2A 5AQ7A 4UI9C 5KJNA 2WVIA 4YVOA 3HXBA 4BWRA 4U07A 3B7RL 3ASFA 4TXPA 2J49A 4DI3A 3JQ0A 3FU3A 3O4ZA 1X5BA 4BERA 3HRAA 5JA4D 2P9NG 4BTAA 4ANWA 4YDWA 3PZ4A 2VGEA 4HNAD 3ISMC 3NB2A 5CEAA 2XPIA 2P2CP 2VSOE 2FO7A 2YHEA 5C2YA 4GZ6A 3PNTB 2J07A 4C48B 3L13A 1DC2A 2VSYA 2XS1A 1NI1A 2OEWA 5FZSA 1D9SA 3C3QA 1SA4A 5FQ7A 3ONKA 4QQIA 2VJ8A 3ASDA 2PL2A 5FT9A 2VQ2A 4GU5A 2BUGA 4JVSA 4QFVA 4UWGA 1MYOA 3UQ3A 2GRMA 5AN8A 3DRAA 3CGHA 3FFLA 1WDYA 3TXNA 1MJ0A 3CR3A 3SZ7A 3HG0D 3APFA 1QNFA 3TG5A 4ILHB 4O60A 2R5SA 4JXTA 1O1TA 2IFUA 3CKCA 2VGXB 4ZFHA 3Q9NC 1K3ZD 3L54A 3D9MA 2ZIRA 1IXVA 5DIZA 2ILRA 5J08A 1ELKA 2VGXA 3ZEFA 4DX1A 3FUDA 2JABA 3ZYQA 3UX4A 5D66A 2WXRA 5KJMA 4OVVA 4C0MA 2OVBA 3EIJA 3SHFA 3CVXA 1JCRA 4LCTA 2ZGDA 1FVHA 3K9IA 3OTNA 3EHNA 3C3RA 1NA3A 1KZPA 4L2LA 2J09A 2X6IA 2ZISA 2DWZA 4U04A 2WXNA 2XGOA 2XCCA 4J7WA 5AQ9A 3S7JA 1INZA 1E8WA 2RFMA 5EYPF 4E85A 4U8YD 3RKVA 2EINE 5JJTA 4BX8A 2WXJA 3DSTA 2LSUA 3FUJA 4G25A 4RQIA 3G2TA 2MOWA 1JWFA 2WXPA 3SY2A 1HFAA 4N39A 4UQYA 3GZ2A 4GA0A 3AG4E 2R03A 3PE4A 3SQVA 1IHBA 3SO8A 3DBSA 3V31A 4G23A 5CRVA 4HLLA 2P9SG 5ARFA 5FINA 2LNIA 5B1BE 5EKQD 3OXLA 2H6HA 3QNKA 3CVWA 3QAQA 2EIJE 1BPOA 1Y8MA 4OAVB 1N11A 4XKCA 2X38A 4Q69A 3Q79A 2WXGA 3BQOA 3CHRA 3QC1A 1OY3D 2KATA 2DBAA 5FQ4A 2GRLA 2XGSA 4GZCA 1IQUA 4J8EA 5ENPD 4FHKA 4KZCA 4AM9A 4XE0A 4UWFA 4EZLA 2HYZA 2XS8A 2XRZA 3I4RB 1O1RA 1UN9A 2B6CA 2A5EA 3V2OA 2WMNA 5BXOA 4H7YA 3PNLB 4UQZA 4GYYA 3LCAA 1NFIE 4N2QA 4BY6A 1MHQA 2WXFA 3U9WA 3EU9A 4JHJA 3D9OA 4RG9A 3CVNA 4GA2A 4CCAA 4KYOB 1S70B 2CHZA 1EYHA 5T8IA 2R05A 3UT8A 5HRYA 4LNGA 4N3CA 4G1TA 4EBAG 2C0LA 3UXGA 3S2AA 3E33A 3NBNB 4K0RA 4I9EA 4NURA 1MZCA 4OVUA 4A3TA 1OT8A 3DXMG 4ME2A 4NQ0A 1KT1A 5AQBA 5D0OD 1PC2A 3TGOA 4XIFA 3QKYA 4GTOA 2DYSE 2GW1A 3LVQE 1H0AA 3SD5A 3AAAC 4U96D 1LD7A 1YYHA 3D9IA 2L0TB 2R2LA 3LDZA 5FWQA 3B7UX 2C0MA 1S0PA 4MBGA 3RJVA 3ZGQA 3MX3A 5FIOA 1U3DA 3UPVA 4Y6CA 3LXUX 3AU5A 3CKBA 3JQ1A 4LRZA 2R59A 5B1AE 4MRUA 4J8YA 4XEIG 2KCKA 2QYJA 3IEGA 5KWDA 4HOQA 3HXCA 2LAHA 3FP3A 3Q78A 4EPZA 4DX7D 5ANRA 4UI9K 4CT0A 5CMWA 3L17A 2XZDG 2FBNA 4I6GA 1YA0A 3ZXSA 4GCNA 3ZXPA 2L9BA 1EDUA 3TWWA 4ANVA 4AOFA 1XNFA 4MLPA 1NP7A 3CSFA 4FP7A 3L9TA 2BEDA 4GMJA 2I1JA 4U8VD 3AS8A 4IRUA 3T9KA 4XZ4A 2QYUA 3ABKE 2Y3AA 1BD8A 4JB8P 2ONDA 5ENQD 2WXHA 4YDOA 4LSZE 1DCEA 1UJJA 4L2YA 4TRQA 1O5MA 3ONLA 2M63A 1N4QA 1KZOA 2XZTG 4MKTA 4YDEA 2WXLA 1SQMA 5BNWA 1HH8A 2I1KA 3I3NA 2J4BA 2DIWA 4R7LA 4EZJA 3CIAA 3ASNE 4KZ0A 1TN8A 5E75A 5BV0A 2LSVA 1BI7B 5JHAA 4TUMA 3FEYA 5HQ8A 2PQNA 5EIBE 3OAWA 3APCA 1N4RA 4HOUA 4XX5A 1B89A 3BUAA 2CHWA 4HB5A 3FTZA 2WQ6A 1K1AA 3MV2B 3FU6A 2RD0A 3Q7FA 4RVBA 3Q5MA 4UWHA 2IF4A 2A5UA 2GRPB 4I6JA 4GMRA 3UIPC 4ATZD 4JL0A 1KLXA 3AU4A 2CG3A 4XI0A 3CQGB 3QARA 4ILGA 3SFZA 1E8ZA 3CHQA 1D8DA 4RG6A 1H2VC 4FHJA 1TJFA 2XEHA 4DX5D 3MCXA 3W9GA 3AS4A 1E8YA 4I1OB 3JUEA 4HS2A 3ENEA 4J0UA 4UWKA 4HOTA 4H7XA 4O1OA 4WWPA 4CGVA 1SZ9A 2X6HA 3FTVA 4CEMA 3D9JA 4FADA 3N71A 4XI9A 4ATGA 3LEWA 4LUNU 3RO3A 4WAFA 2AVPA 3LS8A 4A55A 3D9PA 2UWJG 3UI2A 3UKRG 3DXKG 4X8QA 3DEOA 1JCSA 2RG8A 4N3BA 3SF4A 4FU3A 2YINA 1OWMA 3E34A 4DI4A 3RSEG 2AXUA 4HQDA 4G8KA 2NC9A 4DRXE 4OAUC 5CMYA 3CV0A 2XRYA 1E7VA 2WPVA 3QJZA 4JW1A 3FUMA 1HXIA 3CHPA 1D8EA 4ZHBA 3EDTB 2XEEA 3CVUA 4KMOA 3U3WA 4I1AA 5T3RA 2WXOA 3UM1A 4L1BA 1TJCA 1HG5A 3CVQA 4U0UA 3DSUA 4CZ2D 1QYMA 5EDSA 1N95A 1V55E 1OXJA 5LCWJ 4WWNA 2KCLA 3KEZA 1VDYA 1FT1A 1N4SA 4FLBA 2CFZA 5CBNA 3J5PA 3FDHA 4GTMA 4K5BA 4B0ZA 2IOLA 1XGWA 3W9FA 3T5VA 3FUKA 3SBTB 1S63A 3FTYA 3C5RA 3T8KA 4PH4B 3EHRA 2JLBA 3PZ2A 2QY7A 1JUQA 1H2UA 3CHOA 2KC7A 4GA1A 3CLJA 2WXMA 4ILIA 4PS8A 2BTDA 4KBQA 3DPDA 3KSLA 5G05C 3PUJA 1ELWA 1WY6A 2X3MA 3HDXA 1FPPA 5EN5D 3FWVA 4GTPA 4I2ZA 3FH8A 3QK0A 2Y0BG 1YMPA 5ENTD 4N5QA 3JCKC 3RRNB 4F3VA 4AXHA 4TXQA 3P2BA 3C3OA 3FTSA 3KSQA 4CT4A 3PH0C 5HKPA 3L22A 3X2QE 1HS6A 3SI5A 4GB9A 3R9AB 5KNGA 2ZXWE 3CQCB 3HXDA 5EX3A 3Q15A 3LVRE 3TL5A 4AJWA 2PM7A 3PDNA 5D0QD
chains in the Genus database with same CATH topology
2IJGX 3TGOA 4XIFA 4HVBA 4N2SA 3CHSA 4I6EA 3ZW3A 3QKYA 3EHMA 1E96B 1EF1C 2Q7FA 2GW1A 3LVQE 4DLQA 1H0AA 1P5QA 4I9CA 3RRUA 3SD5A 2P58C 5AYWD 2C2LA 1E7UA 3QOUA 4WNEA 2I9CA 4K03A 3LKUA 2ZU6B 3RO2A 1W3BA 1UG3A 4A1GA 3AS5A 3D9IA 3EIQC 4YVQC 1JPLA 2L0TB 4KVMA 1Z3XA 5FQ8A 2E0IA 1UW4B 1HO8A 4J8SA 3LDZA 2KZTB 3UUXA 3MEKA 3D9KA 5FWQA 4JEUA 3B7UX 3ZN3A 2C0MA 3B7TA 5KJLA 1S0PA 2BF0X 2V5FA 3MKQB 4N5CA 3RJVA 3RRMB 3ZGQA 3MX3A 3NF1A 1U3DA 3VTXA 3UPVA 4GYWA 3URZA 4Y6CA 4O6FA 2KZTA 2VSXE 3LXUX 3AU5A 3CKBA 4JHKA 2NSZA 3GZSA 4D10C 5J90A 3JQ1A 4LRZA 3PRZA 3ULQA 3MKQA 4NACA 2YHCA 3LYAA 5AJLA 2R59A 2XCBA 2WMOA 4AV7A 2LAIA 4I43A 3RU0A 5CHEE 2FEZA 4MRUA 4AY5A 2Y4UA 3ESLA 4DLOA 4LERA 1H19A 4DJAA 2VGYA 1NA0A 2KCKA 4KT6B 1GW6A 3SGHA 3JYSA 3TXMA 3LY9A 5ARGA 3IEGA 2KM4A 4FA6A 5JJ7A 5M72A 2WQHA 3D3MA 2AW6A 4HOQA 4Y6WA 4G24A 2LAHA 3FP3A 4HOSA 4JEHA 4EPZA 1QQEA 3FY4A 3KS2A 3MKRA 4WNDA 2E2EA 2CHXA 2HR2A 1NZNA 3NZSA 3TJPA 2WQ7A 3I5PA 3NQPA 4UI9C 5FTPA 5ANRA 3TAXA 3G2VA 4UI9K 5JHBA 5KJNA 1ELRA 5KJKA 2WVIA 4YVOA 4CT0A 5CMWA 3L17A 3CVLA 3FH5A 4BWRA 1Y6IA 2FBNA 4U07A 3B7RL 3ASFA 4I6GA 1YA0A 1OUVA 4FLHA 2OOEA 3ZXSA 4GZ3A 4GCNA 2J49A 2L6JA 1EDUA 2L9BA 3D9NA 3MGBA 4PUCA 4DI3A 3HYMB 4ANVA 3MV3B 4AOFA 1XNFA 4MLPA 4CDNA 3JQ0A 1NP7A 3CSFA 4I17A 2WXQA 4FP7A 2PM6A 2AWIA 3CK7A 3FU3A 1X5BA 3O4ZA 1H6KA 4OYSA 4GMJA 4A1SA 2I1JA 2HM8A 3AS8A 2L0IA 2VSNA 4IRUA 2XGMA 3IHVA 4BTAA 4ANWA 4BX9A 3P1UA 4XZ4A 3GZ1A 1IHGA 3C98A 4FC8A 2XEVA 2Y3AA 2QFCA 3L6AA 3ML8A 4XKBA 3SNXA 2YNQA 3L16A 3O48A 2XPIA 2ONDA 4A3VA 2FF4A 5FZRA 1DNPA 2VSOE 5JJ6A 2FO7A 2YHEA 5C2YA 2HO1A 2WB2A 2WXHA 3IBEA 5FJYA 3PUKA 5E76A 4AEZC 1UJJA 3ESKA 2IQCA 3PE3A 3PEUB 1A17A 4L2YA 4APOA 4TRQA 3ZRHA 3LY7A 3IHYA 3IKOB 4FULA 3ONLA 2M63A 4GZ6A 4F53A 3B13A 3FUEA 3PNTB 4MKTA 4YNDA 3UT7A 4I1MA 2WXLA 1SQMA 2AXVA 2J07A 1DVPA 1ZU2A 3MYVA 1HH8A 2I1KA 4GCOA 4APFA 5BNWA 1FCHA 3Q47B 4F7AA 5C1DA 5EX0A 3FH7A 3I3NA 3L13A 4FJZA 2UY1B 2J4BA 2VSYA 4UWLA 2DIWA 4R7LA 4C0EA 4EZJA 5FZSA 4U8HA 1SZAA 3CIAA 5T4YA 5CCLA 4HORA 4KZ0A 5FQ7A 1OWNA 3ONKA 3JUIA 5E75A 5BV0A 2IU1A 1OWOA 2VJ8A 2LSVA 3ASDA 5LCWC 2PL2A 5FT9A 5JHAA 5BUZA 2VQ2A 4GU5A 3FEYA 2UY1A 5ENNA 2BUGA 5HQ8A 2PQNA 4G2VA 3EJNA 3UMVA 1N54A 3OAWA 4JVSA 4U0SA 4UQXA 3APCA 2XQ0A 4HOUA 4QFVA 4UWGA 4BTBA 4XX5A 1IYGA 3FTWA 1B89A 2A4ZA 2XHEA 3UQ3A 2CHWA 2LO6A 3FUIA 3CEQA 2GRMA 4ANUA 4G11A 5A7DB 3FTZA 2WQ6A 1E90A 3CGHA 3FFLA 1HF8A 3TXNA 2X6JA 3FUNA 3CR3A 3PZDA 3MV2B 3PVLA 3FU6A 2RD0A 3SZ7A 3VTYA 3FU0A 1H2TC 4ANXA 4WWOA 3APFA 4RVBA 3MZLB 5BV1A 1QNFA 3FUHA 4GZDA 3VLDA 3TG5A 3CK8A 3Q5MA 4E6HA 4UWHA 2IF4A 2A5UA 3T5XA 3VLFA 4ILHB 4I6JA 2R5SA 4JXTA 4IYPA 3CVYA 2V0PA 5LP0A 4JL0A 2X6FA 2IFUA 3CKCA 4DPRA 4G26A 5LFAA 3FULA 3WXXA 4URKA 1KLXA 3AU4A 4LEUA 4U63A 2CG3A 2VGXB 4HXIA 4XI0A 3CQGB 3QARA 4ILGA 3SFZA 4DK5A 1TEZA 1OWLA 1E8ZA 3CHQA 3L54A 1QZ2A 3PS6A 3D9MA 3HVEB 3FEXA 4RG6A 1H2VC 1Z3YA 4FHJA 4JZYA 1TJFA 3QWVA 5G04C 5DIZA 4JC8A 2ILRA 5J08A 1ELKA 2VGXA 3ZEFA 3GYZA 2PQRA 3FUDA 3CHMA 3ZYQA 3MCXA 3UX4A 3I4GA 3RIBA 3G2UA 2WXRA 5KJMA 3HVEA 3AS4A 2WXKA 1E8YA 4ABNA 4I1OB 4OVVA 3QWWA 4C0MA 4Q94A 2OVBA 3EIJA 3T8MA 4HLEA 3SHFA 3KAEA 3ML9A 4L7TA 5HI7A 3CVXA 4HS2A 4JA7A 4LCTA 3ENEA 4J0UA 4IN3B 1FVHA 2CFUA 3K9IA 3OTNA 4UWKA 2MHKA 4WNFA 3EHNA 4H7XA 3RK6A 4WWPA 4HOTA 4U0ZA 5BT1A 4NRHB 4TV3A 2Y4TA 4J6IA 3PEVB 2X6KA 4V3IA 4CGVA 1NA3A 1SZ9A 5FQ6A 3QWPA 2X6HA 3ZFWA 4L2LA 2J09A 3FTVA 4CEMA 3LJ3A 2X6IA 3D9JA 4FADA 2CG2A 3N71A 3U4TA 3B7SA 4UI9J 3FU5A 4XI9A 4WUYA 4ATGA 3CVVA 4U04A 5ANLA 3LEWA 2WXNA 4BSXA 2XGOA 2XCCA 1L5JA 3PREA 4LUNU 3RO3A 3G2WA 4WAFA 2AVPA 3S7DA 4B8CB 3HHMA 3LS8A 4CGWA 3LPZA 4A55A 3E4BA 3D9PA 2UWJG 1N52A 4C9BB 2EQXA 4MS6A 3CK9A 5G2NA 2RG8A 4N3BA 3S7JA 3SF4A 1E8WA 2VTBB 1INZA 2IOSA 4FU3A 3S7BA 2YINA 4E85A 5BW8C 3ZYLA 1OWMA 3RKVA 3R7QA 4DI4A 4ACLA 4M3OA 4W9RA 5JJTA 3FUFA 2AXUA 2YQ8A 4GMLA 2NC9A 2J08A 2KCVA 2NXPA 4B94A 2WXJA 4BX8A 5DBKA 2VTBA 2LSUA 2OVFA 3FUJA 4G25A 5CMYA 3CV0A 2XRYA 3ZHEB 4BT9A 1E7VA 2I2OA 2OV8A 2WPVA 3G2TA 3QJZA 4JW1A 3KD7A 4N3AA 3FUMA 1HXIA 1JWFA 2MOWA 2WXPA 3CHPA 3ZYMA 4GYOA 1HFAA 4N39A 3ZVVA 3ZIMA 3MA5A 4UQYA 3GZ2A 4GA0A 1U3CA 3EDTB 2IONA 3R7RA 3CVUA 4KVOA 3PE4A 4KMOA 3ZHEA 3U3WA 3SBSA 5AIJA 4I1AA 5T3RA 2WXOA 4J8DA 3QB2A 3MJWA 3U66A 4L1BA 3DBSA 4G23A 1TJCA 1HG5A 3CVQA 1Z6TA 4PS3A 5A23A 4TUUA 4U0UA 5G55A 3L08A 5AENA 1LF8A 5ARFA 5EDSA 5KCMA 2LNIA 5LCWJ 5EKQD 3OXLA 4WWNA 2KCLA 2AXZA 3KEZA 3D9LA 1VDYA 4GAAA 3QNKA 4JHRA 2GGFA 3CVWA 3U64A 3QAQA 4FLBA 3G2SA 4GZ5A 2VYIA 2CFZA 1BPOA 4JPSA 4F1SA 1Y8MA 2V4LA 3BG0B 3FDHA 3ASHA 3CVPA 4B0ZA 2IOLA 1XGWA 2R17C 4PS7A 4XKCA 2WM9A 2X38A 4Q69A 4GPKA 1JWGA 2WXGA 4AP2A 3CHRA 4ACKA 3T5VA 3FUKA 3SBTB 4AY6A 3QC1A 3FTYA 3HIZA 2KATA 4CDRA 2DBAA 5FQ4A 2GRLA 2XGSA 4GZCA 1IQUA 4J8EA 4CDMA 1HX8A 2MRIA 2J9QA 4FHKA 4PH4B 5A6CA 1HU3A 3GW4A 2FULA 2FI7A 2JLBA 3CSTA 2DCPA 4KZCA 4AM9A 1PAQA 4XE0A 4EECA 1IQRA 4UWFA 2QY7A 4EZLA 4HFGA 1JUQA 4AIFA 2HYZA 1H2UA 3CHOA 2XPYA 2XRZA 2KC7A 2J4DA 3LY8A 3BEEA 5LX8A 3I4RB 5FZQA 3NZUA 1WAO1 4EBAA 1HG2A 1UN9A 3OXGA 1HZ4A 2WXIA 4WNGA 2V8SE 4GA1A 5G04J 4JA9A 3CLJA 3Q4AB 2WMNA 2I6HA 4CRWA 3QDNA 2WXMA 4H7YA 4ILIA 3PNLB 4UQZA 4PS8A 4GYYA 1UJKA 2BTDA 4EZKA 4KBQA 3DPDA 4FJYA 4BT8A 3LCAA 5AJDA 3PUJA 5G05C 5CCMA 1ELWA 2PZIA 4L23A 1WY6A 1OWPA 4N2QA 4BY6A 1MHQA 2WXFA 2X3MA 5LOZA 3HDXA 3FHEA 3ZYKA 3U9WA 1ZBPA 3FWVA 4PDXA 4JHJA 3D9OA 4RG9A 1FVFA 3CVNA 4I2ZA 4GA2A 3VLEA 4CCAA 4AVXA 4KYOB 4BFRA 1E8XA 3FH8A 3FTUA 2CHZA 2JEKA 1EYHA 3APDA 3QK0A 3TG4A 1EPUA 5T8IA 1KT0A 3UT8A 3BG1B 3S7FA 4B8AA 4B89A 3JCKC 3RRNB 4N3CA 4G1TA 5BPPA 4EBAG 2C0LA 4KXKB 4F3VA 3S2AA 5G05J 1MQSA 4AXHA 4P29A 3OXFA 3ASGA 3P2BA 4K0RA 3FTSA 4I9EA 4I2WA 3ZPJA 4Q96A 3PH0C 4CT4A 3L22A 4NURA 3IV0A 4EQFA 2XPZA 1HS6A 4OVUA 4A3TA 3SI5A 4J8FA 1PY1A 3FTXA 4GB9A 4RSYA 4ME2A 1HE8A 4NQ0A 3R9AB 1WM5A 3CQCB 3Q49B 5EX3A 3Q15A 3LVRE 1KT1A 1UN8A 3TL5A 4AJWA 3UT4A 5D0OD 4IULA 1PC2A 2PM7A 3PDNA 5D0QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGO A;  4XIF A;  4N2S A;  3QKY A;  1E96 B;  2Q7F A;  2GW1 A;  1P5Q A;  4I9C A;  2P58 C;  5AYW D;  2C2L A;  3QOU A;  4WNE A;  3LKU A;  3RO2 A;  1W3B A;  3AS5 A;  4YVQ C;  3UUX A;  3MEK A;  3ZN3 A;  2C0M A;  5KJL A;  2V5F A;  4N5C A;  3RJV A;  3ZGQ A;  3NF1 A;  3VTX A;  3UPV A;  4GYW A;  3URZ A;  4Y6C A;  4O6F A;  3CKB A;  3ULQ A;  2YHC A;  3LYA A;  2XCB A;  3RU0 A;  5CHE E;  2FEZ A;  4AY5 A;  2Y4U A;  2VGY A;  1NA0 A;  2KCK A;  3JYS A;  3LY9 A;  5ARG A;  3IEG A;  5JJ7 A;  5M72 A;  2WQH A;  4HOQ A;  4Y6W A;  4G24 A;  3FP3 A;  4HOS A;  1QQE A;  3KS2 A;  3MKR A;  4WND A;  2E2E A;  2HR2 A;  1NZN A;  4UI9 C;  5FTP A;  3TAX A;  4UI9 K;  5KJN A;  5KJK A;  1ELR A;  4YVO A;  3CVL A;  4BWR A;  2FBN A;  4U07 A;  3ASF A;  1YA0 A;  1OUV A;  2OOE A;  4GZ3 A;  4GCN A;  2L6J A;  3HYM B;  3MV3 B;  1XNF A;  4I17 A;  3CK7 A;  4A1S A;  3AS8 A;  2VSN A;  2XGM A;  4BTA A;  3GZ1 A;  1IHG A;  2XEV A;  2QFC A;  3O48 A;  2XPI A;  2OND A;  2FF4 A;  5FZR A;  5JJ6 A;  2FO7 A;  2HO1 A;  5FJY A;  3ESK A;  3PE3 A;  1A17 A;  4APO A;  3LY7 A;  4GZ6 A;  4YND A;  4HOR A;  4GCO A;  1ZU2 A;  5BNW A;  1HH8 A;  1FCH A;  3Q47 B;  5C1D A;  5EX0 A;  2UY1 B;  2VSY A;  5FZS A;  5CCL A;  2LSV A;  3ASD A;  5LCW C;  2PL2 A;  5FT9 A;  2VQ2 A;  2UY1 A;  2BUG A;  5HQ8 A;  2PQN A;  4G2V A;  4U0S A;  4UQX A;  4BTB A;  1IYG A;  4HOU A;  1B89 A;  3UQ3 A;  3CEQ A;  5A7D B;  3FFL A;  3MV2 B;  3SZ7 A;  3VTY A;  3TG5 A;  3CK8 A;  3Q5M A;  2IF4 A;  2R5S A;  4JL0 A;  2IFU A;  3CKC A;  4G26 A;  3WXX A;  1KLX A;  4LEU A;  2VGX B;  4XI0 A;  1QZ2 A;  4RG6 A;  3QWV A;  5G04 C;  5DIZ A;  2VGX A;  3GYZ A;  2PQR A;  3RIB A;  5KJM A;  3AS4 A;  4ABN A;  3QWW A;  3KAE A;  5HI7 A;  4JA7 A;  4J0U A;  4IN3 B;  3K9I A;  4WNF A;  2MHK A;  4HOT A;  4H7X A;  4U0Z A;  5BT1 A;  4NRH B;  2Y4T A;  4CGV A;  1NA3 A;  3ZFW A;  3QWP A;  3N71 A;  3U4T A;  4UI9 J;  4XI9 A;  4WUY A;  4U04 A;  2XGO A;  2XCC A;  3RO3 A;  2AVP A;  3S7D A;  4CGW A;  3LPZ A;  3E4B A;  2UWJ G;  3CK9 A;  4N3B A;  3S7J A;  3SF4 A;  3S7B A;  5BW8 C;  3RKV A;  4W9R A;  5JJT A;  2YQ8 A;  2NC9 A;  2KCV A;  4B94 A;  5DBK A;  2LSU A;  4G25 A;  3CV0 A;  3ZHE B;  4BT9 A;  2WPV A;  4N3A A;  3KD7 A;  1HXI A;  4GYO A;  4N39 A;  3MA5 A;  4UQY A;  3GZ2 A;  4GA0 A;  3EDT B;  3PE4 A;  3ZHE A;  3U3W A;  4I1A A;  4J8D A;  4G23 A;  1TJC A;  3CVQ A;  4U0U A;  5ARF A;  2LNI A;  5LCW J;  5EKQ D;  3OXL A;  2KCL A;  4JHR A;  4GZ5 A;  2VYI A;  1Y8M A;  3ASH A;  3CVP A;  4GPK A;  4AY6 A;  2KAT A;  4CDR A;  2DBA A;  2XGS A;  4J8E A;  2J9Q A;  5A6C A;  3GW4 A;  2JLB A;  2FI7 A;  4AM9 A;  4AIF A;  2HYZ A;  2KC7 A;  3LY8 A;  3BEE A;  5FZQ A;  1WAO 1;  3OXG A;  1HZ4 A;  4WNG A;  4GA1 A;  5G04 J;  4JA9 A;  3Q4A B;  2I6H A;  3QDN A;  4H7Y A;  4UQZ A;  4GYY A;  4KBQ A;  4BT8 A;  3LCA A;  5G05 C;  5CCM A;  1ELW A;  2PZI A;  4N2Q A;  1ZBP A;  3FWV A;  4RG9 A;  3CVN A;  4I2Z A;  4GA2 A;  4KYO B;  3TG4 A;  1KT0 A;  3S7F A;  4N3C A;  4G1T A;  2C0L A;  4KXK B;  4F3V A;  5G05 J;  3OXF A;  3ASG A;  4I9E A;  4I2W A;  3ZPJ A;  4EQF A;  4J8F A;  4ME2 A;  3R9A B;  4NQ0 A;  1WM5 A;  3Q49 B;  5EX3 A;  3Q15 A;  1KT1 A;  5D0O D;  1PC2 A;  3PDN A;  5D0Q D; 
#chains in the Genus database with same CATH topology
 3TWR A;  4GTQ A;  4DLQ A;  4GTV A;  1P5Q A;  3PZ1 A;  2P58 C;  2MYO A;  2C2L A;  1E7U A;  3QOU A;  2I9C A;  5B3S E;  1TNY A;  2ZU6 B;  1W3B A;  3AS5 A;  3EIQ C;  4YVQ C;  2IO3 C;  1UW4 B;  3UUX A;  2KZT B;  3D9K A;  3ZN3 A;  3B7T A;  2IEJ A;  5KJL A;  4L9P A;  4N5C A;  3URZ A;  3TWV A;  2KZT A;  4F6R D;  3GZS A;  3PRZ A;  3L82 A;  3ULQ A;  4NAC A;  2XCB A;  4I43 A;  3RU0 A;  2FEZ A;  4B93 B;  4AY5 A;  4LER A;  1H19 A;  4KT6 B;  3SGH A;  1GW6 A;  2RFA A;  5ARG A;  4FA6 A;  5JJ7 A;  2AW6 A;  3DEP A;  3R9M A;  4HOS A;  2F8Y A;  4GTR A;  1QQE A;  3MKR A;  1NZN A;  3NZS A;  2WQ7 A;  1TN6 A;  3NQP A;  5FTP A;  5JHB A;  2ETC A;  1ELR A;  3LJN A;  3CVL A;  2ETB A;  1MX2 A;  1OUV A;  4FLH A;  2OOE A;  4GZ3 A;  2KBX A;  3SFY A;  3MGB A;  4PUC A;  3TWS A;  3HYM B;  2F8X K;  3MV3 B;  2V4H C;  5H7P A;  4A1S A;  3Q7A A;  2VSN A;  3IHV A;  4BX9 A;  3GZ1 A;  3C98 A;  2XEV A;  4LNU D;  3ML8 A;  3SNX A;  2YNQ A;  3O48 A;  4A3V A;  3ABL E;  5FZR A;  1DNP A;  2Y1L E;  1N9A A;  3IBE A;  3ZNG A;  4AEZ C;  3ESK A;  2IQC A;  3PE3 A;  3ZRH A;  1IKN D;  3IHY A;  4FUL A;  1YCS B;  4F53 A;  4YND A;  1A5E A;  2GRR B;  2AXV A;  3Q47 B;  4F7A A;  4GTS A;  5C1D A;  5EX0 A;  3DSV A;  4C0E A;  4U8H A;  1SZA A;  5T4Y A;  1OWN A;  2IU1 A;  1OWO A;  5LCW C;  5AQA A;  5BUZ A;  4G2V A;  1N54 A;  1QBQ A;  4UQX A;  4BTB A;  4LNB A;  2XQ0 A;  1Q2Z A;  3E37 A;  1IYG A;  2A4Z A;  2XHE A;  2LO6 A;  3FUI A;  3CEQ A;  4ANU A;  4G11 A;  1BLX B;  1E90 A;  1HF8 A;  2X6J A;  3FUN A;  3PZD A;  2OCC E;  1H2T C;  4ANX A;  3MZL B;  5BV1 A;  3FUH A;  4GZD A;  3T5X A;  1TNO A;  4IYP A;  3CVY A;  4DPR A;  2X6F A;  5J90 A;  4U63 A;  4LEU A;  2OEV A;  1OWL A;  3C72 A;  1QZ2 A;  3HVE B;  4JZY A;  2BKK B;  3HXF A;  3GYZ A;  2PQR A;  3CHM A;  3RIB A;  3G2U A;  5EIL A;  3HVE A;  2WXK A;  2R02 A;  2ZGG A;  3QWW A;  3T8M A;  3KAE A;  5HI7 A;  3UM2 A;  4JA7 A;  4IN3 B;  3RK6 A;  4U0Z A;  5BT1 A;  4TV3 A;  4J6I A;  4V3I A;  2X6K A;  1H6O A;  5FQ6 A;  3QWP A;  2CG2 A;  3FU5 A;  3CVV A;  1K1B A;  3J5Q B;  1L5J A;  3PRE A;  3S7D A;  4B8C B;  1RZ4 A;  3HHM A;  4CGW A;  3LPZ A;  3E4B A;  2EQX A;  4MS6 A;  5G2N A;  1G3N B;  3NOG D;  2BKG A;  3SFX A;  4HRN A;  4M3O A;  4W9R A;  3FUF A;  2YQ8 A;  2KCV A;  2NXP A;  4B94 A;  2IO2 C;  4JD2 G;  4G8L A;  3ZHE B;  4BT9 A;  2I2O A;  2OV8 A;  4U7E B;  1MX6 A;  3ZIM A;  3MA5 A;  3NAW A;  3ZU7 B;  1JCQ A;  3R7R A;  4KVO A;  3ZHE A;  3TWT A;  3TWU A;  5KBA A;  4J8D A;  3MJW A;  5A23 A;  1Z6T A;  2PNN A;  3V2X A;  5AEN A;  2EIM E;  2F0Y A;  2EIL E;  5AAR A;  2P9L G;  2LXL A;  3D9L A;  4GAA A;  3WG7 E;  2GGF A;  3U64 A;  3G2S A;  2V4L A;  1RW2 A;  3B7B A;  1SW6 A;  2H6G A;  3V79 K;  3Q75 A;  1Z5S C;  4ACK A;  1N4P A;  4AY6 A;  3HIZ A;  4CDR A;  1HX8 A;  2J9Q A;  4HBD A;  5A6C A;  2FI7 A;  1PAQ A;  4EEC A;  1IQR A;  2AJA A;  5FZQ A;  3NZU A;  1WAO 1;  1HG2 A;  1U2V G;  1HZ4 A;  2WXI A;  4WNG A;  3UTM A;  5G04 J;  5AAO A;  3Q4A B;  3UM3 A;  2I6H A;  3QDN A;  1UJK A;  2GRQ B;  5EYL A;  4FJY A;  4BT8 A;  5AJD A;  5CCM A;  2PZI A;  4L23 A;  3ZYK A;  4PDX A;  3EU5 A;  3B95 A;  1FVF A;  1SVX A;  5D2M C;  4HI8 A;  1E8X A;  1AP7 A;  1N0R A;  1KT0 A;  2NYJ A;  3BG1 B;  3S7F A;  4B8A A;  3AG2 E;  4B89 A;  4KXK B;  4K5A B;  2DZO A;  4I2W A;  3ZPJ A;  4YDY A;  4GPM A;  1PY1 A;  3FTX A;  4RSY A;  4U95 D;  1O1S A;  1WM5 A;  3Q49 B;  3UT4 A;  1S64 A;  4IUL A;  3DSW A;  2IJG X;  3CHS A;  3ZW3 A;  3EHM A;  5ENS D;  1EF1 C;  1N0Q A;  4I9C A;  3DSX A;  4WNE A;  4K03 A;  4BSZ B;  2GRN B;  1UG3 A;  4KVM A;  1Z3X A;  5FQ8 A;  2E0I A;  3V30 A;  4J8S A;  3MEK A;  1NL4 A;  2BF0 X;  3RRM B;  3NF1 A;  3VTX A;  4O6F A;  2VSX E;  4D10 C;  2GRO B;  5AJL A;  2YHC A;  2WMO A;  4EHM A;  2LAI A;  5CHE E;  4DLO A;  4DJA A;  1NA0 A;  5M72 A;  4A63 B;  2WQH A;  1SA5 A;  3D3M A;  3F6Q A;  4Y6W A;  3ULE G;  4G24 A;  3UKU G;  3FY4 A;  3KS2 A;  1TN7 A;  3TJP A;  4DX6 D;  3I5P A;  3TAX A;  2FO1 E;  3G2V A;  5KJK A;  3FH5 A;  1Y6I A;  4UUC A;  5BXU A;  1N94 A;  1UOH A;  5EID A;  5KNH D;  2KXP C;  2J8S D;  2L6J A;  3D9N A;  5CEC B;  4CDN A;  4I17 A;  2EIK E;  2WXQ A;  2PM6 A;  2AWI A;  3CK7 A;  1H6K A;  4OYS A;  2HM8 A;  3JXJ A;  3E30 A;  3D9H A;  2L0I A;  5CRU A;  2XGM A;  2B0O E;  3P1U A;  1IHG A;  4FC8 A;  2QFC A;  3L6A A;  4XKB A;  3L16 A;  3Q73 A;  2FF4 A;  5JJ6 A;  2HO1 A;  2WB2 A;  5FJY A;  3E32 A;  3PUK A;  5E76 A;  3PEU B;  1A17 A;  4APO A;  3ZKJ A;  5ENO D;  4RLY A;  3LY7 A;  3IKO B;  1WG0 A;  3B13 A;  3FUE A;  4LG6 A;  3ZUV B;  3UT7 A;  4I1M A;  4GCO A;  3MYV A;  3EHQ A;  4APF A;  1DVP A;  1ZU2 A;  4HOR A;  2P9U G;  1FCH A;  5ENR D;  3FH7 A;  4FJZ A;  2UY1 B;  4UWL A;  2ETA A;  5CCL A;  3JXI A;  3JUI A;  2Y69 E;  5ENN A;  2UY1 A;  5CBO A;  3EJN A;  3UMV A;  4F1P A;  4U0S A;  1TR4 A;  1V54 E;  3FTW A;  1DCQ A;  5A7D B;  3PVL A;  3VTY A;  5ITZ F;  3FU0 A;  4DX2 A;  4WWO A;  1K8K G;  3VLD A;  3CK8 A;  4E6H A;  3VLF A;  2RKK A;  3UIN C;  3ABM E;  3UM0 A;  2V0P A;  5LP0 A;  5LFA A;  4G26 A;  3FUL A;  3WXX A;  4URK A;  3DWL G;  4HXI A;  1OCO E;  1TEZ A;  4DK5 A;  3DSS A;  5HS0 A;  4M7C A;  3PS6 A;  3NOC D;  3FEX A;  3AJI A;  1Z3Y A;  3QWV A;  5G04 C;  4JC8 A;  4BEP A;  3KEA A;  3I4G A;  4ABN A;  4Q94 A;  4HLE A;  3AG3 E;  3ML9 A;  4L7T A;  1BI8 B;  3RAU A;  4NIK A;  2CFU A;  4WNF A;  2MHK A;  4NRH B;  2Y4T A;  3PEV B;  3ZFW A;  3LJ3 A;  3U4T A;  3B7S A;  4UI9 J;  4WUY A;  5ANL A;  3DPY A;  4BSX A;  1BU9 A;  3G2W A;  4CYM D;  1TNZ A;  1N52 A;  4C9B B;  2P9P G;  1TNB A;  2P9K G;  3CK9 A;  3BU8 A;  2VTB B;  2IOS A;  3S7B A;  5BW8 C;  3ZYL A;  3R7Q A;  4ACL A;  2F37 A;  3IXE A;  4GML A;  2J08 A;  2VTB A;  5DBK A;  2OVF A;  2LXM A;  3ASO E;  4N3A A;  3KD7 A;  1AWC B;  3ZYM A;  3TWQ A;  4GYO A;  3ZVV A;  1U3C A;  2ION A;  2DZN A;  3SBS A;  5AIJ A;  4K5C A;  3QB2 A;  3U66 A;  5CED B;  4PS3 A;  4TUU A;  2V5Q C;  3AG1 E;  5G55 A;  3L08 A;  1LF8 A;  4O1P A;  5KCM A;  3PZ3 A;  5CER B;  2AXZ A;  4JHR A;  4HRM B;  4GZ5 A;  2VYI A;  2QZA A;  4JPS A;  4F1S A;  5JMN D;  3BG0 B;  3ASH A;  3CVP A;  2R17 C;  4PS7 A;  2WM9 A;  4GPK A;  1JWG A;  4AP2 A;  2IY0 C;  2QC9 A;  4BES A;  4CDM A;  1FT2 A;  2MRI A;  4BET A;  1HU3 A;  3GW4 A;  2FUL A;  4TXR A;  3CST A;  2DCP A;  4HFG A;  4AIF A;  2HE0 A;  2XPY A;  3LY8 A;  2J4D A;  5LX8 A;  3BEE A;  1MX4 A;  4EBA A;  1TYQ G;  3OXG A;  3UIO C;  2V8S E;  2DYR E;  4JA9 A;  2DVW A;  4CRW A;  5IY5 E;  2H6I A;  2L6B A;  4EZK A;  1OWP A;  1OCR E;  5LOZ A;  3FHE A;  4Z68 A;  1ZBP A;  3VLE A;  4AVX A;  4BFR A;  4HRL A;  2XEN A;  2JEK A;  3APD A;  3FTU A;  3TG4 A;  1EPU A;  2P9I G;  3Q9U C;  5G05 J;  1MQS A;  3TWX A;  4P29 A;  1OCZ E;  3OXF A;  3ASG A;  4Q96 A;  3IV0 A;  4EQF A;  2XPZ A;  1TNU A;  4J8F A;  2LUH A;  1HE8 A;  1UN8 A;  1H6P A;  5BPP A;  2H6F A;  4HVB A;  4N2S A;  4I6E A;  1E96 B;  2Q7F A;  3RRU A;  1X81 A;  5AYW D;  3LKU A;  3RO2 A;  4A1G A;  1JPL A;  3EUV A;  1HO8 A;  4JEU A;  3MKQ B;  2V5F A;  4GYW A;  3HXE A;  4JHK A;  4DUI A;  2NSZ A;  1LTX A;  1LD8 A;  1OCC E;  3MKQ A;  3LYA A;  1ZB1 A;  4AV7 A;  4HI9 A;  2Y4U A;  3ESL A;  2VGY A;  1KPS B;  3JYS A;  3TXM A;  3LY9 A;  4GTT A;  2KM4 A;  3ULY A;  4JEH A;  4WND A;  2E2E A;  2CHX A;  2HR2 A;  5AQ7 A;  4UI9 C;  5KJN A;  2WVI A;  4YVO A;  3HXB A;  4BWR A;  4U07 A;  3B7R L;  3ASF A;  4TXP A;  2J49 A;  4DI3 A;  3JQ0 A;  3FU3 A;  3O4Z A;  1X5B A;  4BER A;  3HRA A;  5JA4 D;  2P9N G;  4BTA A;  4ANW A;  4YDW A;  3PZ4 A;  2VGE A;  4HNA D;  3ISM C;  3NB2 A;  5CEA A;  2XPI A;  2P2C P;  2VSO E;  2FO7 A;  2YHE A;  5C2Y A;  4GZ6 A;  3PNT B;  2J07 A;  4C48 B;  3L13 A;  1DC2 A;  2VSY A;  2XS1 A;  1NI1 A;  2OEW A;  5FZS A;  1D9S A;  3C3Q A;  1SA4 A;  5FQ7 A;  3ONK A;  4QQI A;  2VJ8 A;  3ASD A;  2PL2 A;  5FT9 A;  2VQ2 A;  4GU5 A;  2BUG A;  4JVS A;  4QFV A;  4UWG A;  1MYO A;  3UQ3 A;  2GRM A;  5AN8 A;  3DRA A;  3CGH A;  3FFL A;  1WDY A;  3TXN A;  1MJ0 A;  3CR3 A;  3SZ7 A;  3HG0 D;  3APF A;  1QNF A;  3TG5 A;  4ILH B;  4O60 A;  2R5S A;  4JXT A;  1O1T A;  2IFU A;  3CKC A;  2VGX B;  4ZFH A;  3Q9N C;  1K3Z D;  3L54 A;  3D9M A;  2ZIR A;  1IXV A;  5DIZ A;  2ILR A;  5J08 A;  1ELK A;  2VGX A;  3ZEF A;  4DX1 A;  3FUD A;  2JAB A;  3ZYQ A;  3UX4 A;  5D66 A;  2WXR A;  5KJM A;  4OVV A;  4C0M A;  2OVB A;  3EIJ A;  3SHF A;  3CVX A;  1JCR A;  4LCT A;  2ZGD A;  1FVH A;  3K9I A;  3OTN A;  3EHN A;  3C3R A;  1NA3 A;  1KZP A;  4L2L A;  2J09 A;  2X6I A;  2ZIS A;  2DWZ A;  4U04 A;  2WXN A;  2XGO A;  2XCC A;  4J7W A;  5AQ9 A;  3S7J A;  1INZ A;  1E8W A;  2RFM A;  5EYP F;  4E85 A;  4U8Y D;  3RKV A;  2EIN E;  5JJT A;  4BX8 A;  2WXJ A;  3DST A;  2LSU A;  3FUJ A;  4G25 A;  4RQI A;  3G2T A;  2MOW A;  1JWF A;  2WXP A;  3SY2 A;  1HFA A;  4N39 A;  4UQY A;  3GZ2 A;  4GA0 A;  3AG4 E;  2R03 A;  3PE4 A;  3SQV A;  1IHB A;  3SO8 A;  3DBS A;  3V31 A;  4G23 A;  5CRV A;  4HLL A;  2P9S G;  5ARF A;  5FIN A;  2LNI A;  5B1B E;  5EKQ D;  3OXL A;  2H6H A;  3QNK A;  3CVW A;  3QAQ A;  2EIJ E;  1BPO A;  1Y8M A;  4OAV B;  1N11 A;  4XKC A;  2X38 A;  4Q69 A;  3Q79 A;  2WXG A;  3BQO A;  3CHR A;  3QC1 A;  1OY3 D;  2KAT A;  2DBA A;  5FQ4 A;  2GRL A;  2XGS A;  4GZC A;  1IQU A;  4J8E A;  5ENP D;  4FHK A;  4KZC A;  4AM9 A;  4XE0 A;  4UWF A;  4EZL A;  2HYZ A;  2XS8 A;  2XRZ A;  3I4R B;  1O1R A;  1UN9 A;  2B6C A;  2A5E A;  3V2O A;  2WMN A;  5BXO A;  4H7Y A;  3PNL B;  4UQZ A;  4GYY A;  3LCA A;  1NFI E;  4N2Q A;  4BY6 A;  1MHQ A;  2WXF A;  3U9W A;  3EU9 A;  4JHJ A;  3D9O A;  4RG9 A;  3CVN A;  4GA2 A;  4CCA A;  4KYO B;  1S70 B;  2CHZ A;  1EYH A;  5T8I A;  2R05 A;  3UT8 A;  5HRY A;  4LNG A;  4N3C A;  4G1T A;  4EBA G;  2C0L A;  3UXG A;  3S2A A;  3E33 A;  3NBN B;  4K0R A;  4I9E A;  4NUR A;  1MZC A;  4OVU A;  4A3T A;  1OT8 A;  3DXM G;  4ME2 A;  4NQ0 A;  1KT1 A;  5AQB A;  5D0O D;  1PC2 A;  3TGO A;  4XIF A;  3QKY A;  4GTO A;  2DYS E;  2GW1 A;  3LVQ E;  1H0A A;  3SD5 A;  3AAA C;  4U96 D;  1LD7 A;  1YYH A;  3D9I A;  2L0T B;  2R2L A;  3LDZ A;  5FWQ A;  3B7U X;  2C0M A;  1S0P A;  4MBG A;  3RJV A;  3ZGQ A;  3MX3 A;  5FIO A;  1U3D A;  3UPV A;  4Y6C A;  3LXU X;  3AU5 A;  3CKB A;  3JQ1 A;  4LRZ A;  2R59 A;  5B1A E;  4MRU A;  4J8Y A;  4XEI G;  2KCK A;  2QYJ A;  3IEG A;  5KWD A;  4HOQ A;  3HXC A;  2LAH A;  3FP3 A;  3Q78 A;  4EPZ A;  4DX7 D;  5ANR A;  4UI9 K;  4CT0 A;  5CMW A;  3L17 A;  2XZD G;  2FBN A;  4I6G A;  1YA0 A;  3ZXS A;  4GCN A;  3ZXP A;  2L9B A;  1EDU A;  3TWW A;  4ANV A;  4AOF A;  1XNF A;  4MLP A;  1NP7 A;  3CSF A;  4FP7 A;  3L9T A;  2BED A;  4GMJ A;  2I1J A;  4U8V D;  3AS8 A;  4IRU A;  3T9K A;  4XZ4 A;  2QYU A;  3ABK E;  2Y3A A;  1BD8 A;  4JB8 P;  2OND A;  5ENQ D;  2WXH A;  4YDO A;  4LSZ E;  1DCE A;  1UJJ A;  4L2Y A;  4TRQ A;  1O5M A;  3ONL A;  2M63 A;  1N4Q A;  1KZO A;  2XZT G;  4MKT A;  4YDE A;  2WXL A;  1SQM A;  5BNW A;  1HH8 A;  2I1K A;  3I3N A;  2J4B A;  2DIW A;  4R7L A;  4EZJ A;  3CIA A;  3ASN E;  4KZ0 A;  1TN8 A;  5E75 A;  5BV0 A;  2LSV A;  1BI7 B;  5JHA A;  4TUM A;  3FEY A;  5HQ8 A;  2PQN A;  5EIB E;  3OAW A;  3APC A;  1N4R A;  4HOU A;  4XX5 A;  1B89 A;  3BUA A;  2CHW A;  4HB5 A;  3FTZ A;  2WQ6 A;  1K1A A;  3MV2 B;  3FU6 A;  2RD0 A;  3Q7F A;  4RVB A;  3Q5M A;  4UWH A;  2IF4 A;  2A5U A;  2GRP B;  4I6J A;  4GMR A;  3UIP C;  4ATZ D;  4JL0 A;  1KLX A;  3AU4 A;  2CG3 A;  4XI0 A;  3CQG B;  3QAR A;  4ILG A;  3SFZ A;  1E8Z A;  3CHQ A;  1D8D A;  4RG6 A;  1H2V C;  4FHJ A;  1TJF A;  2XEH A;  4DX5 D;  3MCX A;  3W9G A;  3AS4 A;  1E8Y A;  4I1O B;  3JUE A;  4HS2 A;  3ENE A;  4J0U A;  4UWK A;  4HOT A;  4H7X A;  4O1O A;  4WWP A;  4CGV A;  1SZ9 A;  2X6H A;  3FTV A;  4CEM A;  3D9J A;  4FAD A;  3N71 A;  4XI9 A;  4ATG A;  3LEW A;  4LUN U;  3RO3 A;  4WAF A;  2AVP A;  3LS8 A;  4A55 A;  3D9P A;  2UWJ G;  3UI2 A;  3UKR G;  3DXK G;  4X8Q A;  3DEO A;  1JCS A;  2RG8 A;  4N3B A;  3SF4 A;  4FU3 A;  2YIN A;  1OWM A;  3E34 A;  4DI4 A;  3RSE G;  2AXU A;  4HQD A;  4G8K A;  2NC9 A;  4DRX E;  4OAU C;  5CMY A;  3CV0 A;  2XRY A;  1E7V A;  2WPV A;  3QJZ A;  4JW1 A;  3FUM A;  1HXI A;  3CHP A;  1D8E A;  4ZHB A;  3EDT B;  2XEE A;  3CVU A;  4KMO A;  3U3W A;  4I1A A;  5T3R A;  2WXO A;  3UM1 A;  4L1B A;  1TJC A;  1HG5 A;  3CVQ A;  4U0U A;  3DSU A;  4CZ2 D;  1QYM A;  5EDS A;  1N95 A;  1V55 E;  1OXJ A;  5LCW J;  4WWN A;  2KCL A;  3KEZ A;  1VDY A;  1FT1 A;  1N4S A;  4FLB A;  2CFZ A;  5CBN A;  3J5P A;  3FDH A;  4GTM A;  4K5B A;  4B0Z A;  2IOL A;  1XGW A;  3W9F A;  3T5V A;  3FUK A;  3SBT B;  1S63 A;  3FTY A;  3C5R A;  3T8K A;  4PH4 B;  3EHR A;  2JLB A;  3PZ2 A;  2QY7 A;  1JUQ A;  1H2U A;  3CHO A;  2KC7 A;  4GA1 A;  3CLJ A;  2WXM A;  4ILI A;  4PS8 A;  2BTD A;  4KBQ A;  3DPD A;  3KSL A;  5G05 C;  3PUJ A;  1ELW A;  1WY6 A;  2X3M A;  3HDX A;  1FPP A;  5EN5 D;  3FWV A;  4GTP A;  4I2Z A;  3FH8 A;  3QK0 A;  2Y0B G;  1YMP A;  5ENT D;  4N5Q A;  3JCK C;  3RRN B;  4F3V A;  4AXH A;  4TXQ A;  3P2B A;  3C3O A;  3FTS A;  3KSQ A;  4CT4 A;  3PH0 C;  5HKP A;  3L22 A;  3X2Q E;  1HS6 A;  3SI5 A;  4GB9 A;  3R9A B;  5KNG A;  2ZXW E;  3CQC B;  3HXD A;  5EX3 A;  3Q15 A;  3LVR E;  3TL5 A;  4AJW A;  2PM7 A;  3PDN A;  5D0Q D; 
#chains in the Genus database with same CATH homology
 2IJG X;  3TGO A;  4XIF A;  4HVB A;  4N2S A;  3CHS A;  4I6E A;  3ZW3 A;  3QKY A;  3EHM A;  1E96 B;  1EF1 C;  2Q7F A;  2GW1 A;  3LVQ E;  4DLQ A;  1H0A A;  1P5Q A;  4I9C A;  3RRU A;  3SD5 A;  2P58 C;  5AYW D;  2C2L A;  1E7U A;  3QOU A;  4WNE A;  2I9C A;  4K03 A;  3LKU A;  2ZU6 B;  3RO2 A;  1W3B A;  1UG3 A;  4A1G A;  3AS5 A;  3D9I A;  3EIQ C;  4YVQ C;  1JPL A;  2L0T B;  4KVM A;  1Z3X A;  5FQ8 A;  2E0I A;  1UW4 B;  1HO8 A;  4J8S A;  3LDZ A;  2KZT B;  3UUX A;  3MEK A;  3D9K A;  5FWQ A;  4JEU A;  3B7U X;  3ZN3 A;  2C0M A;  3B7T A;  5KJL A;  1S0P A;  2BF0 X;  2V5F A;  3MKQ B;  4N5C A;  3RJV A;  3RRM B;  3ZGQ A;  3MX3 A;  3NF1 A;  1U3D A;  3VTX A;  3UPV A;  4GYW A;  3URZ A;  4Y6C A;  4O6F A;  2KZT A;  2VSX E;  3LXU X;  3AU5 A;  3CKB A;  4JHK A;  2NSZ A;  3GZS A;  4D10 C;  5J90 A;  3JQ1 A;  4LRZ A;  3PRZ A;  3ULQ A;  3MKQ A;  4NAC A;  2YHC A;  3LYA A;  5AJL A;  2R59 A;  2XCB A;  2WMO A;  4AV7 A;  2LAI A;  4I43 A;  3RU0 A;  5CHE E;  2FEZ A;  4MRU A;  4AY5 A;  2Y4U A;  3ESL A;  4DLO A;  4LER A;  1H19 A;  4DJA A;  2VGY A;  1NA0 A;  2KCK A;  4KT6 B;  1GW6 A;  3SGH A;  3JYS A;  3TXM A;  3LY9 A;  5ARG A;  3IEG A;  2KM4 A;  4FA6 A;  5JJ7 A;  5M72 A;  2WQH A;  3D3M A;  2AW6 A;  4HOQ A;  4Y6W A;  4G24 A;  2LAH A;  3FP3 A;  4HOS A;  4JEH A;  4EPZ A;  1QQE A;  3FY4 A;  3KS2 A;  3MKR A;  4WND A;  2E2E A;  2CHX A;  2HR2 A;  1NZN A;  3NZS A;  3TJP A;  2WQ7 A;  3I5P A;  3NQP A;  4UI9 C;  5FTP A;  5ANR A;  3TAX A;  3G2V A;  4UI9 K;  5JHB A;  5KJN A;  1ELR A;  5KJK A;  2WVI A;  4YVO A;  4CT0 A;  5CMW A;  3L17 A;  3CVL A;  3FH5 A;  4BWR A;  1Y6I A;  2FBN A;  4U07 A;  3B7R L;  3ASF A;  4I6G A;  1YA0 A;  1OUV A;  4FLH A;  2OOE A;  3ZXS A;  4GZ3 A;  4GCN A;  2J49 A;  2L6J A;  1EDU A;  2L9B A;  3D9N A;  3MGB A;  4PUC A;  4DI3 A;  3HYM B;  4ANV A;  3MV3 B;  4AOF A;  1XNF A;  4MLP A;  4CDN A;  3JQ0 A;  1NP7 A;  3CSF A;  4I17 A;  2WXQ A;  4FP7 A;  2PM6 A;  2AWI A;  3CK7 A;  3FU3 A;  1X5B A;  3O4Z A;  1H6K A;  4OYS A;  4GMJ A;  4A1S A;  2I1J A;  2HM8 A;  3AS8 A;  2L0I A;  2VSN A;  4IRU A;  2XGM A;  3IHV A;  4BTA A;  4ANW A;  4BX9 A;  3P1U A;  4XZ4 A;  3GZ1 A;  1IHG A;  3C98 A;  4FC8 A;  2XEV A;  2Y3A A;  2QFC A;  3L6A A;  3ML8 A;  4XKB A;  3SNX A;  2YNQ A;  3L16 A;  3O48 A;  2XPI A;  2OND A;  4A3V A;  2FF4 A;  5FZR A;  1DNP A;  2VSO E;  5JJ6 A;  2FO7 A;  2YHE A;  5C2Y A;  2HO1 A;  2WB2 A;  2WXH A;  3IBE A;  5FJY A;  3PUK A;  5E76 A;  4AEZ C;  1UJJ A;  3ESK A;  2IQC A;  3PE3 A;  3PEU B;  1A17 A;  4L2Y A;  4APO A;  4TRQ A;  3ZRH A;  3LY7 A;  3IHY A;  3IKO B;  4FUL A;  3ONL A;  2M63 A;  4GZ6 A;  4F53 A;  3B13 A;  3FUE A;  3PNT B;  4MKT A;  4YND A;  3UT7 A;  4I1M A;  2WXL A;  1SQM A;  2AXV A;  2J07 A;  1DVP A;  1ZU2 A;  3MYV A;  1HH8 A;  2I1K A;  4GCO A;  4APF A;  5BNW A;  1FCH A;  3Q47 B;  4F7A A;  5C1D A;  5EX0 A;  3FH7 A;  3I3N A;  3L13 A;  4FJZ A;  2UY1 B;  2J4B A;  2VSY A;  4UWL A;  2DIW A;  4R7L A;  4C0E A;  4EZJ A;  5FZS A;  4U8H A;  1SZA A;  3CIA A;  5T4Y A;  5CCL A;  4HOR A;  4KZ0 A;  5FQ7 A;  1OWN A;  3ONK A;  3JUI A;  5E75 A;  5BV0 A;  2IU1 A;  1OWO A;  2VJ8 A;  2LSV A;  3ASD A;  5LCW C;  2PL2 A;  5FT9 A;  5JHA A;  5BUZ A;  2VQ2 A;  4GU5 A;  3FEY A;  2UY1 A;  5ENN A;  2BUG A;  5HQ8 A;  2PQN A;  4G2V A;  3EJN A;  3UMV A;  1N54 A;  3OAW A;  4JVS A;  4U0S A;  4UQX A;  3APC A;  2XQ0 A;  4HOU A;  4QFV A;  4UWG A;  4BTB A;  4XX5 A;  1IYG A;  3FTW A;  1B89 A;  2A4Z A;  2XHE A;  3UQ3 A;  2CHW A;  2LO6 A;  3FUI A;  3CEQ A;  2GRM A;  4ANU A;  4G11 A;  5A7D B;  3FTZ A;  2WQ6 A;  1E90 A;  3CGH A;  3FFL A;  1HF8 A;  3TXN A;  2X6J A;  3FUN A;  3CR3 A;  3PZD A;  3MV2 B;  3PVL A;  3FU6 A;  2RD0 A;  3SZ7 A;  3VTY A;  3FU0 A;  1H2T C;  4ANX A;  4WWO A;  3APF A;  4RVB A;  3MZL B;  5BV1 A;  1QNF A;  3FUH A;  4GZD A;  3VLD A;  3TG5 A;  3CK8 A;  3Q5M A;  4E6H A;  4UWH A;  2IF4 A;  2A5U A;  3T5X A;  3VLF A;  4ILH B;  4I6J A;  2R5S A;  4JXT A;  4IYP A;  3CVY A;  2V0P A;  5LP0 A;  4JL0 A;  2X6F A;  2IFU A;  3CKC A;  4DPR A;  4G26 A;  5LFA A;  3FUL A;  3WXX A;  4URK A;  1KLX A;  3AU4 A;  4LEU A;  4U63 A;  2CG3 A;  2VGX B;  4HXI A;  4XI0 A;  3CQG B;  3QAR A;  4ILG A;  3SFZ A;  4DK5 A;  1TEZ A;  1OWL A;  1E8Z A;  3CHQ A;  3L54 A;  1QZ2 A;  3PS6 A;  3D9M A;  3HVE B;  3FEX A;  4RG6 A;  1H2V C;  1Z3Y A;  4FHJ A;  4JZY A;  1TJF A;  3QWV A;  5G04 C;  5DIZ A;  4JC8 A;  2ILR A;  5J08 A;  1ELK A;  2VGX A;  3ZEF A;  3GYZ A;  2PQR A;  3FUD A;  3CHM A;  3ZYQ A;  3MCX A;  3UX4 A;  3I4G A;  3RIB A;  3G2U A;  2WXR A;  5KJM A;  3HVE A;  3AS4 A;  2WXK A;  1E8Y A;  4ABN A;  4I1O B;  4OVV A;  3QWW A;  4C0M A;  4Q94 A;  2OVB A;  3EIJ A;  3T8M A;  4HLE A;  3SHF A;  3KAE A;  3ML9 A;  4L7T A;  5HI7 A;  3CVX A;  4HS2 A;  4JA7 A;  4LCT A;  3ENE A;  4J0U A;  4IN3 B;  1FVH A;  2CFU A;  3K9I A;  3OTN A;  4UWK A;  2MHK A;  4WNF A;  3EHN A;  4H7X A;  3RK6 A;  4WWP A;  4HOT A;  4U0Z A;  5BT1 A;  4NRH B;  4TV3 A;  2Y4T A;  4J6I A;  3PEV B;  2X6K A;  4V3I A;  4CGV A;  1NA3 A;  1SZ9 A;  5FQ6 A;  3QWP A;  2X6H A;  3ZFW A;  4L2L A;  2J09 A;  3FTV A;  4CEM A;  3LJ3 A;  2X6I A;  3D9J A;  4FAD A;  2CG2 A;  3N71 A;  3U4T A;  3B7S A;  4UI9 J;  3FU5 A;  4XI9 A;  4WUY A;  4ATG A;  3CVV A;  4U04 A;  5ANL A;  3LEW A;  2WXN A;  4BSX A;  2XGO A;  2XCC A;  1L5J A;  3PRE A;  4LUN U;  3RO3 A;  3G2W A;  4WAF A;  2AVP A;  3S7D A;  4B8C B;  3HHM A;  3LS8 A;  4CGW A;  3LPZ A;  4A55 A;  3E4B A;  3D9P A;  2UWJ G;  1N52 A;  4C9B B;  2EQX A;  4MS6 A;  3CK9 A;  5G2N A;  2RG8 A;  4N3B A;  3S7J A;  3SF4 A;  1E8W A;  2VTB B;  1INZ A;  2IOS A;  4FU3 A;  3S7B A;  2YIN A;  4E85 A;  5BW8 C;  3ZYL A;  1OWM A;  3RKV A;  3R7Q A;  4DI4 A;  4ACL A;  4M3O A;  4W9R A;  5JJT A;  3FUF A;  2AXU A;  2YQ8 A;  4GML A;  2NC9 A;  2J08 A;  2KCV A;  2NXP A;  4B94 A;  2WXJ A;  4BX8 A;  5DBK A;  2VTB A;  2LSU A;  2OVF A;  3FUJ A;  4G25 A;  5CMY A;  3CV0 A;  2XRY A;  3ZHE B;  4BT9 A;  1E7V A;  2I2O A;  2OV8 A;  2WPV A;  3G2T A;  3QJZ A;  4JW1 A;  3KD7 A;  4N3A A;  3FUM A;  1HXI A;  1JWF A;  2MOW A;  2WXP A;  3CHP A;  3ZYM A;  4GYO A;  1HFA A;  4N39 A;  3ZVV A;  3ZIM A;  3MA5 A;  4UQY A;  3GZ2 A;  4GA0 A;  1U3C A;  3EDT B;  2ION A;  3R7R A;  3CVU A;  4KVO A;  3PE4 A;  4KMO A;  3ZHE A;  3U3W A;  3SBS A;  5AIJ A;  4I1A A;  5T3R A;  2WXO A;  4J8D A;  3QB2 A;  3MJW A;  3U66 A;  4L1B A;  3DBS A;  4G23 A;  1TJC A;  1HG5 A;  3CVQ A;  1Z6T A;  4PS3 A;  5A23 A;  4TUU A;  4U0U A;  5G55 A;  3L08 A;  5AEN A;  1LF8 A;  5ARF A;  5EDS A;  5KCM A;  2LNI A;  5LCW J;  5EKQ D;  3OXL A;  4WWN A;  2KCL A;  2AXZ A;  3KEZ A;  3D9L A;  1VDY A;  4GAA A;  3QNK A;  4JHR A;  2GGF A;  3CVW A;  3U64 A;  3QAQ A;  4FLB A;  3G2S A;  4GZ5 A;  2VYI A;  2CFZ A;  1BPO A;  4JPS A;  4F1S A;  1Y8M A;  2V4L A;  3BG0 B;  3FDH A;  3ASH A;  3CVP A;  4B0Z A;  2IOL A;  1XGW A;  2R17 C;  4PS7 A;  4XKC A;  2WM9 A;  2X38 A;  4Q69 A;  4GPK A;  1JWG A;  2WXG A;  4AP2 A;  3CHR A;  4ACK A;  3T5V A;  3FUK A;  3SBT B;  4AY6 A;  3QC1 A;  3FTY A;  3HIZ A;  2KAT A;  4CDR A;  2DBA A;  5FQ4 A;  2GRL A;  2XGS A;  4GZC A;  1IQU A;  4J8E A;  4CDM A;  1HX8 A;  2MRI A;  2J9Q A;  4FHK A;  4PH4 B;  5A6C A;  1HU3 A;  3GW4 A;  2FUL A;  2FI7 A;  2JLB A;  3CST A;  2DCP A;  4KZC A;  4AM9 A;  1PAQ A;  4XE0 A;  4EEC A;  1IQR A;  4UWF A;  2QY7 A;  4EZL A;  4HFG A;  1JUQ A;  4AIF A;  2HYZ A;  1H2U A;  3CHO A;  2XPY A;  2XRZ A;  2KC7 A;  2J4D A;  3LY8 A;  3BEE A;  5LX8 A;  3I4R B;  5FZQ A;  3NZU A;  1WAO 1;  4EBA A;  1HG2 A;  1UN9 A;  3OXG A;  1HZ4 A;  2WXI A;  4WNG A;  2V8S E;  4GA1 A;  5G04 J;  4JA9 A;  3CLJ A;  3Q4A B;  2WMN A;  2I6H A;  4CRW A;  3QDN A;  2WXM A;  4H7Y A;  4ILI A;  3PNL B;  4UQZ A;  4PS8 A;  4GYY A;  1UJK A;  2BTD A;  4EZK A;  4KBQ A;  3DPD A;  4FJY A;  4BT8 A;  3LCA A;  5AJD A;  3PUJ A;  5G05 C;  5CCM A;  1ELW A;  2PZI A;  4L23 A;  1WY6 A;  1OWP A;  4N2Q A;  4BY6 A;  1MHQ A;  2WXF A;  2X3M A;  5LOZ A;  3HDX A;  3FHE A;  3ZYK A;  3U9W A;  1ZBP A;  3FWV A;  4PDX A;  4JHJ A;  3D9O A;  4RG9 A;  1FVF A;  3CVN A;  4I2Z A;  4GA2 A;  3VLE A;  4CCA A;  4AVX A;  4KYO B;  4BFR A;  1E8X A;  3FH8 A;  3FTU A;  2CHZ A;  2JEK A;  1EYH A;  3APD A;  3QK0 A;  3TG4 A;  1EPU A;  5T8I A;  1KT0 A;  3UT8 A;  3BG1 B;  3S7F A;  4B8A A;  4B89 A;  3JCK C;  3RRN B;  4N3C A;  4G1T A;  5BPP A;  4EBA G;  2C0L A;  4KXK B;  4F3V A;  3S2A A;  5G05 J;  1MQS A;  4AXH A;  4P29 A;  3OXF A;  3ASG A;  3P2B A;  4K0R A;  3FTS A;  4I9E A;  4I2W A;  3ZPJ A;  4Q96 A;  3PH0 C;  4CT4 A;  3L22 A;  4NUR A;  3IV0 A;  4EQF A;  2XPZ A;  1HS6 A;  4OVU A;  4A3T A;  3SI5 A;  4J8F A;  1PY1 A;  3FTX A;  4GB9 A;  4RSY A;  4ME2 A;  1HE8 A;  4NQ0 A;  3R9A B;  1WM5 A;  3CQC B;  3Q49 B;  5EX3 A;  3Q15 A;  3LVR E;  1KT1 A;  1UN8 A;  3TL5 A;  4AJW A;  3UT4 A;  5D0O D;  4IUL A;  1PC2 A;  2PM7 A;  3PDN A;  5D0Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...