2J4BA

Crystal structure of encephalitozoon cuniculi taf5 n-terminal domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
131
structure length
129
Chain Sequence
QMETSYVSLKTWIEDSLDLFKNDLLPLLYPLFIHIYFDLIQQNKTDEAKEFFEKYRGDHKSEEIKQFESIYTVQHIHENNFAYTFKNSKYHLSMGRYAFDLLINFLEERNLTYILKILNQHLDIKVYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 72/90-100 KDA
publication title Crystal Structure, Biochemical and Genetic Characterization of Yeast and E. Cuniculi Taf(II)5 N-Terminal Domain: Implications for TFIID Assembly.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
total genus 45
structure length 129
sequence length 131
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j4bA00
2NXPA 2J49A 2J4BA
chains in the Genus database with same CATH superfamily
4ILGA 3W9GA 3TWUA 1SVXA 3DSTA 4KVMA 2KCVA 3GZ1A 3BEEA 1QYMA 2NC9A 1N94A 1FVHA 2CHZA 2L0TB 2GW1A 2CG2A 5AN8A 3AS8A 3SD5A 2DVWA 2WXIA 2IONA 2XRYA 5FIOA 4GPKA 4F6RD 4UI9C 5ENOD 3UTMA 4NIKA 2J4BA 1KZPA 3OXGA 4DX6D 3MKRA 4HOTA 3TXNA 3UPVA 3CK8A 4AV7A 4BERA 3Q7FA 3BU8A 2DZNA 3PZ1A 3ONLA 3ZU7B 4I17A 2WQ6A 1BPOA 5C1DA 1ZB1A 3DRAA 5T8IA 4TRQA 3LDZA 3RKVA 2VTBA 3SY2A 3PZDA 1IKND 3ZGQA 1HO8A 4WWPA 4MBGA 4UI9K 3UXGA 2KATA 2PQRA 1OWNA 1FCHA 2AWIA 2PL2A 1HE8A 1TN8A 3DSXA 2E0IA 3HXBA 4GZDA 4MS6A 2WVIA 2EIKE 1E90A 3EU9A 4ZHBA 1OXJA 1ZBPA 5LX8A 2GROB 4GMJA 4MLPA 3F6QA 3BQOA 4WNGA 5CRVA 1YCSB 4MKTA 5HI7A 2ZGGA 2LSVA 3NQPA 5A7DB 2YNQA 1IQRA 3CVQA 2WXHA 2WXNA 4LNBA 3CV0A 2EILE 3G2UA 2PM7A 3I5PA 1E7UA 3TGOA 1QNFA 4CGWA 4LEUA 2XS1A 2EIJE 3VTXA 1UJKA 1U2VG 2J09A 2PNNA 1OCZE 4PH4B 1K1BA 4FADA 2WPVA 3D9JA 1X81A 4R7LA 4RLYA 2H6HA 4NQ0A 5HRYA 4GYYA 1JPLA 5EX0A 4Y6WA 4FJZA 3RAUA 3L54A 1QBQA 2RFAA 3FTYA 3DSUA 3K9IA 3RJVA 1NA3A 3AG1E 1S64A 4I1OB 5ENNA 5FZSA 4XE0A 3ZRHA 4GA2A 1TN7A 1OCOE 4PS7A 1HXIA 3AS5A 4LRZA 3CR3A 4HLEA 2P2CP 2VYIA 4QQIA 4ZFHA 2WXKA 1N95A 4EBAG 3HXEA 3QWVA 3S7DA 2P9UG 2UWJG 3ZW3A 1NFIE 3DPDA 1B89A 4OVVA 1HS6A 1S63A 2H6GA 3EHQA 1ELKA 3NOCD 4U0UA 1MYOA 3OAWA 3R9MA 4GTPA 2LXLA 3FFLA 3QB2A 3APFA 4FA6A 3CVNA 2OEVA 3IEGA 4BFRA 2RG8A 3D9LA 3KSQA 3G2TA 2P9LG 3PS6A 4UQZA 2AXZA 1NZNA 4OYSA 2XCCA 3ZN3A 5BNWA 1MZCA 3ML9A 1FT2A 2QYUA 2AJAA 4GTMA 1S70B 5KJNA 3ULEG 1N11A 2B6CA 3UM2A 2GGFA 4GA0A 1IXVA 3FDHA 2X6HA 3UT8A 1P5QA 4DRXE 2V4LA 2WXOA 5CMWA 1WY6A 3LXUX 3APCA 4URKA 4JHKA 4TXRA 3U64A 4CDNA 5AQ7A 1UN9A 3SFXA 3I4GA 3PRZA 1QZ2A 3W9FA 5J08A 2XEEA 3FHEA 4A1SA 4BX8A 4YVQC 1AP7A 4AJWA 3ABME 1E7VA 5G04C 2DYSE 3TXMA 2Y1LE 5AIJA 3FH8A 3B7RL 4L2YA 3EIQC 1TEZA 2HE0A 4E6HA 4JXTA 4HVBA 5FQ6A 2EIME 3IBEA 2VSXE 2WM9A 4GB9A 5KNHD 3X2QE 1NL4A 3FUEA 4JHJA 4UUCA 2WMNA 1SZAA 3LYAA 3ZVVA 4LNUD 5M72A 3Q47B 2V0PA 4HQDA 2F0YA 3MX3A 4BY6A 3ZHEB 3DBSA 3WXXA 1BD8A 3HVEB 3PZ2A 4AIFA 4XKCA 1INZA 4DI4A 4DLOA 3QDNA 4BTBA 1FT1A 4UWHA 3AS4A 4ILHB 2Y3AA 2HO1A 1YA0A 1A17A 2MRIA 2MYOA 3C72A 1TJFA 3FUNA 5JJTA 1XNFA 2V4HC 1IHBA 3VLFA 2JEKA 4AVXA 3FUFA 2WQHA 2VSYA 5AAOA 1ELWA 2KZTB 4GU5A 3D9MA 4DLQA 4AY5A 3T9KA 3UI2A 3PDNA 4C0EA 4FULA 2Q7FA 5EYPF 4OVUA 5D0QD 1GW6A 5AQAA 4K5AB 2FEZA 3MGBA 4GTSA 4U8YD 3TWRA 1SA4A 3E33A 1KT1A 2DZOA 4DX2A 4WUYA 3FH7A 2HM8A 5CEAA 3ZYMA 1QQEA 2FI7A 3V2XA 4JHRA 3D3MA 4N3AA 2E2EA 4L7TA 5BT1A 2XEHA 3Q49B 1O5MA 3D9IA 4IYPA 4G25A 4XKBA 1BI8B 4GZ3A 4Z68A 3FU3A 2P9KG 4LERA 5FQ8A 2LNIA 4AXHA 3CSTA 2VTBB 4DK5A 4LCTA 4U96D 2QC9A 2ETAA 2A5EA 3O48A 4K5CA 4UI9J 3TWSA 3TL5A 3RO2A 5E75A 2P9IG 3FUHA 3L17A 2BUGA 4DX7D 5AJDA 5LOZA 5BV0A 3FTXA 3MKQA 1L5JA 5D2MC 4HOUA 1Z6TA 1TN6A 2OCCE 2WMOA 5T3RA 4XEIG 2ZXWE 1W3BA 1KPSB 3R7RA 3RRNB 3UUXA 3HXCA 3PZ4A 4ATZD 2XGSA 3QWPA 4WAFA 5CECB 4DPRA 4XI0A 4I2ZA 2IF4A 3UKUG 5CCMA 3JQ0A 3DEOA 2ONDA 3ZYQA 4U95D 2F37A 4FU3A 4G1TA 4UWGA 5ENPD 3E37A 1Y6IA 4J0UA 3AU4A 4M3OA 1HU3A 4W9RA 4B0ZA 2MOWA 4XX5A 2R17C 1NI1A 1BU9A 3RSEG 4NACA 4I2WA 4O1PA 5LFAA 2BKKB 4J8EA 3FULA 3E4BA 4JEHA 1H6KA 1V55E 4HXIA 3SF4A 5HS0A 3SHFA 3ISMC 1KZOA 4EQFA 3FUDA 1WAO1 5FZQA 5HQ8A 2XPZA 4G11A 3PH0C 4TXPA 4APFA 4FHJA 3JQ1A 4GTTA 3WG7E 3LEWA 3CVLA 4GYWA 3MA5A 3JYSA 3EHMA 3JUEA 3Q73A 4NRHB 4JA9A 4YDYA 4ACLA 4GAAA 3J5PA 3ASFA 5AQBA 5B1BE 5BXUA 4H7YA 3CSFA 2LO6A 1E8YA 1WM5A 3PNTB 2JLBA 1UW4B 4HOQA 4ANUA 5LCWJ 2QZAA 3AG3E 3C3QA 5KWDA 2L9BA 4LG6A 3ZFWA 4HRNA 1N54A 4GCNA 4FHKA 2B0OE 4GZ6A 4JB8P 5AENA 2Y69E 3GYZA 3U9WA 2IOLA 3ONKA 2IY0C 4U7EB 5JHAA 2KCKA 4DX1A 2NYJA 3FU0A 5AYWD 3RRMB 3B7UX 2V8SE 5G05J 5E76A 5KJLA 4HI9A 3KSLA 4KXKB 5CBNA 4I6EA 3NB2A 2C2LA 3CKBA 5CBOA 4I6JA 4EZKA 5ARFA 2R5SA 1U3CA 1EPUA 1LD7A 2YHEA 3VLEA 3FUJA 4CEMA 3LVQE 2LXMA 3ASHA 1DCQA 3ESKA 4E85A 4O1OA 1UN8A 3UIPC 2R05A 2XPIA 3NZSA 4KYOB 4GZCA 3QK0A 1K1AA 4I9CA 4L1BA 1JUQA 4J6IA 4C9BB 5BW8C 1TR4A 4HI8A 5LCWC 4KVOA 4BETA 4J8YA 3SBSA 1BLXB 5EDSA 4MRUA 3C98A 4CGVA 2I2OA 2ZISA 3ZXSA 3SO8A 3FTVA 4GYOA 4HB5A 4N39A 5G04J 1HG2A 3LKUA 4HOSA 5G05C 1DVPA 2KM4A 4BT9A 3LJ3A 2XRZA 2XCBA 2CHXA 2KC7A 5ITZF 3B7TA 3T5VA 2KCLA 2X6JA 3RK6A 1JCRA 2MHKA 3Q9UC 5AARA 2R02A 5EN5D 1HFAA 2WXLA 1E8XA 3ZEFA 1OWPA 4V3IA 5KJKA 4AY6A 1UG3A 4UWFA 2P58C 3D9OA 1EYHA 2IU1A 3Q7AA 3G2VA 2IQCA 3CLJA 4XI9A 1IQUA 1IYGA 4L9PA 2FF4A 5ANRA 3FEYA 4HRLA 3HDXA 3PEVB 5JA4D 3NF1A 4TUUA 4ANXA 1JWGA 3S7JA 3CHOA 3UM0A 1OCCE 3V79K 4JVSA 5KNGA 2KBXA 1HX8A 3SZ7A 2WXRA 2UY1A 4L23A 4I43A 4HLLA 5EKQD 2WXPA 3DEPA 4ABNA 3L13A 2AW6A 1WDYA 2L0IA 2KXPC 4RQIA 3HIZA 2RFMA 5AJLA 3OXLA 4U8VD 3ABKE 5AQ9A 2OOEA 2R2LA 3L08A 4EHMA 4M7CA 5J90A 5IY5E 3L22A 2AXVA 3FUKA 2XHEA 2J08A 3ASGA 2VQ2A 4PS8A 5FJYA 4JW1A 3EUVA 5D0OD 3T8MA 4OAUC 1O1SA 1H2UA 4PDXA 4AP2A 4FC8A 3FUIA 3MKQB 4JL0A 4JA7A 4I1MA 3R7QA 3P1UA 3Q78A 1OCRE 1OT8A 4XIFA 4P29A 5FINA 3SBTB 3LPZA 3C3OA 3APDA 3CGHA 1MX4A 3NOGD 1KT0A 5B3SE 3IHYA 3V31A 4FP7A 1N0RA 2Y4UA 2IO2C 3ASDA 2C0LA 2ZU6B 4FLHA 3GZSA 2ILRA 2XS8A 4WNEA 3KEZA 1PAQA 4I9EA 1E8ZA 2WXMA 4FLBA 1H2TC 4K5BA 1H0AA 2RKKA 3MV2B 2VJ8A 4ANVA 2Y4TA 2OVBA 5BPPA 4LNGA 2CHWA 5A6CA 1JCQA 1Q2ZA 3EIJA 1N9AA 4WWNA 1D8DA 4UWKA 3CVYA 1TNBA 1E96B 3JXJA 4TV3A 2ZGDA 1N0QA 2X3MA 3FTWA 4WNFA 4EZJA 4N2QA 4ANWA 2FO1E 3T5XA 2FBNA 1H2VC 3E34A 3IKOB 2BKGA 2V5FA 3CQGB 2IOSA 3NAWA 4WNDA 4A63B 4PS3A 1MHQA 4K0RA 3BUAA 3Q75A 5ENRD 1BI7B 5BXOA 3UKRG 1Z3XA 4EBAA 2WXGA 4LUNU 2X6FA 3ML8A 2IO3C 5JMND 2NXPA 2LSUA 4UQXA 2VSNA 1OWLA 3VLDA 4B94A 3D9NA 3C5RA 3CVWA 4IRUA 1H19A 5CMYA 5ARGA 2IEJA 3MCXA 2VGXA 4Q96A 2HYZA 2JABA 4HORA 3IHVA 3AU5A 1E8WA 4GTQA 1D9SA 1PC2A 3SNXA 2QFCA 4J8SA 3TWVA 3OXFA 3PZ3A 3C3RA 4K03A 3CHQA 4QFVA 3DPYA 1SZ9A 5KJMA 2J9QA 2OEWA 3BG1B 3EDTB 1NA0A 4A3TA 2NSZA 2ETBA 4GTOA 1FPPA 1YMPA 3B7BA 2WXQA 2YINA 4ILIA 4G23A 3KD7A 3UM3A 3AG4E 1N4SA 3AG2E 3EJNA 3ZIMA 3DSSA 1DC2A 2LAHA 5EILA 3LVRE 4BTAA 4HNAD 3FP3A 3DWLG 4DUIA 4GCOA 2PQNA 3DXKG 4O6FA 4RVBA 3ASNE 1OUVA 3FTUA 1O1RA 2EINE 4APOA 4B8CB 1JWFA 1S0PA 1MJ0A 3SI5A 3AJIA 3CHMA 4NURA 4H7XA 1FVFA 3TWQA 1TNZA 4CCAA 2CFZA 4CYMD 4DI3A 4UWLA 4N5CA 1N4PA 3AAAC 5DBKA 1Z5SC 2CFUA 3QC1A 4PUCA 4F7AA 1LD8A 3QARA 4N5QA 4JEUA 2FO7A 2F8XK 4WWOA 3TG5A 2GRQB 2M63A 5EIBE 4GZ5A 1G3NB 5JHBA 3J5QB 4GMRA 5D66A 4A55A 3SFYA 2WXFA 3CQCB 1LF8A 3LJNA 3Q15A 5H7PA 4U0SA 1D8EA 4BESA 1VDYA 3I3NA 2VGEA 3JXIA 3S7FA 3B95A 3UQ3A 5EX3A 3L6AA 2WB2A 2I1JA 4J8FA 3DXMG 3S2AA 1TNOA 3ULQA 4RG9A 1MX2A 1HZ4A 3KEAA 4YDEA 4U8HA 4N2SA 2J07A 3IXEA 4IN3B 3N71A 5DIZA 1LTXA 4CDRA 1DCEA 2AXUA 1TNYA 2LAIA 4AOFA 3KAEA 4KBQA 3ASOE 1OWOA 4GA1A 4UQYA 4F53A 4DX5D 1IHGA 4Q94A 3HG0D 5G55A 3QNKA 2R03A 3Q4AB 4YDWA 3PREA 2UY1B 4A1GA 2AVPA 1OWMA 3CK9A 3UX4A 1PY1A 5BV1A 4CT0A 3P2BA 1MQSA 3PE4A 3ZUVB 3CHPA 3CK7A 3URZA 1H6OA 1YYHA 3ULYA 4G8KA 3ENEA 4XZ4A 1H6PA 2C0MA 3MV3B 3QJZA 3UINC 3CIAA 3UMVA 4JC8A 2XZDG 3QOUA 4JPSA 2XEVA 3U66A 3CHSA 3ZNGA 3FTSA 5FZRA 4RSYA 1XGWA 4KT6B 3TWXA 4BX9A 3FTZA 2OVFA 5C2YA 4I6GA 1OY3D 3OTNA 2XGOA 3ZKJA 4EPZA 3IV0A 3CVPA 1JCSA 3FU5A 3V2OA 2V5QC 4F1PA 3QAQA 3T8KA 4JD2G 4GPMA 1N52A 1UOHA 3S7BA 4CT4A 2RD0A 2YHCA 2GRNB 3CVUA 5FT9A 1UJJA 3E30A 5EYLA 3HYMB 3JCKC 2QYJA 4C48B 4U0ZA 1AWCB 5EIDA 2OV8A 2R59A 1Y8MA 3ZYKA 4HFGA 2FULA 4GMLA 3G2SA 3MEKA 3LCAA 3UT4A 3FUMA 3B7SA 4G26A 2A4ZA 3FWVA 3RIBA 3QWWA 2HR2A 5B1AE 5HKPA 4JZYA 2X6IA 2A5UA 1EDUA 4J7WA 2DWZA 3UM1A 1TYQG 4RG6A 3HXFA 2L6BA 3FY4A 4TUMA 3LY9A 1N4QA 5FQ7A 2J49A 4ME2A 3G2WA 3VTYA 3CKCA 3FU6A 2XZTG 3NBNB 3L82A 5JJ6A 5T4YA 4I1AA 1X5BA 1NP7A 3CHRA 3ABLE 2LUHA 3RRUA 2H6FA 2WXJA 3MJWA 4FJYA 4ACKA 5ANLA 2DBAA 1ELRA 2P9NG 4HBDA 2WQ7A 4BT8A 2BF0X 3Q9NC 3Q79A 2YQ8A 3LY7A 2VSOE 5LP0A 4EZLA 3HRAA 4YVOA 3B13A 2J4DA 2L6JA 1SQMA 2GRMA 3EHNA 4Y6CA 4AEZC 3LS8A 1KLXA 3UT7A 5KCMA 3Q5MA 4X8QA 2QY7A 2VGXB 4U04A 1O1TA 4N3BA 4BSXA 5CHEE 2IFUA 1EF1C 3PNLB 3V30A 3KS2A 4L2LA 1HF8A 3O4ZA 2P9PG 3CVXA 3PUKA 1HH8A 4YNDA 1TNUA 3SGHA 2IJGX 3QKYA 1WG0A 2PM6A 3RU0A 1ZU2A 2XGMA 1V54E 4BEPA 4KMOA 3E32A 2I9CA 1U3DA 4U07A 2I6HA 5FQ4A 4GTRA 4N3CA 3UIOC 1SW6A 4IULA 1HG5A 5ENSD 5FWQA 3ZYLA 4J8DA 1N4RA 3TAXA 3CEQA 2GRRB 2J8SD 2BEDA 4EECA 2XENA 3DSVA 3L16A 2XQ0A 5FTPA 2VGYA 2F8YA 3HXDA 2XPYA 4HS2A 3HHMA 2P9SG 2H6IA 5CRUA 5KBAA 5JJ7A 2ZIRA 3TWTA 3D9KA 2I1KA 4TXQA 3NZUA 3CVVA 3SFZA 2X38A 3ZXPA 4BWRA 4DJAA 1RW2A 3GZ2A 1K8KG 1MX6A 3MYVA 4F3VA 3EU5A 3TG4A 4CRWA 5BUZA 3L9TA 1A5EA 5G2NA 3DSWA 1SA5A 4LSZE 3I4RB 4GTVA 4G2VA 4BSZB 3ZPJA 4OAVB 4C0MA 4B8AA 5CCLA 3BG0B 4G24A 4D10C 3TJPA 4A3VA 3D9PA 3FEXA 5ENTD 4B89A 2X6KA 4Q69A 4O60A 4B93B 4CDMA 2GRPB 3FH5A 4CZ2D 3D9HA 4KZ0A 4YDOA 3PE3A 1K3ZD 4G8LA 3RO3A 3ZHEA 2CG3A 4F1SA 3HVEA 4AM9A 3SQVA 3TWWA 2DIWA 3JUIA 3R9AB 3ESLA 4U63A 5CERB 3U4TA 3MZLB 3U3WA 2GRLA 1Z3YA 3EHRA 3LY8A 3PEUB 2DCPA 3GW4A 2EQXA 3PUJA 2DYRE 4HRMB 4ATGA 1TJCA 1DNPA 2BTDA 2ETCA 1RZ4A 2KZTA 4KZCA 5A23A 5CEDB 2PZIA 2Y0BG 3PVLA 5ENQD
chains in the Genus database with same CATH topology
3PEVB 3PDNA 1OWOA 4C0EA 4GA1A 3NF1A 4ILGA 4UQYA 4F53A 4TUUA 1IHGA 4ANXA 1JWGA 4FULA 4KVMA 2Q7FA 4OVUA 4Q94A 2KCVA 5D0QD 5G55A 1GW6A 3GZ1A 3BEEA 3QNKA 3S7JA 3Q4AB 3CHOA 2FEZA 3MGBA 4JVSA 3PREA 2UY1B 2NC9A 1HX8A 3SZ7A 1KT1A 4A1GA 1FVHA 2WXRA 2CHZA 4WUYA 2UY1A 3FH7A 4L23A 2AVPA 1OWMA 2HM8A 2GW1A 2L0TB 3CK9A 4I43A 1PY1A 5EKQD 2WXPA 3UX4A 4CT0A 5BV1A 3P2BA 4ABNA 2CG2A 3L13A 3AS8A 3ZYMA 1MQSA 3PE4A 1QQEA 2FI7A 3SD5A 2WXIA 2IONA 2XRYA 2AW6A 3CHPA 3CK7A 4GPKA 3URZA 4JHRA 4UI9C 3D3MA 2L0IA 4N3AA 2J4BA 2E2EA 3HIZA 4L7TA 5AJLA 3ENEA 3OXLA 4XZ4A 5BT1A 2C0MA 3OXGA 3Q49B 3MV3B 3QJZA 2OOEA 3D9IA 3MKRA 4HOTA 4IYPA 3TXNA 3UPVA 3CK8A 3CIAA 4AV7A 4G25A 3L08A 4XKBA 3UMVA 4GZ3A 4JC8A 3QOUA 3ONLA 3FU3A 4LERA 4I17A 2WQ6A 5J90A 4JPSA 1BPOA 3L22A 2AXVA 3FUKA 2XEVA 5FQ8A 5C1DA 3U66A 3CHSA 2LNIA 3FTSA 4AXHA 5T8IA 3CSTA 2XHEA 2J08A 4DK5A 2VTBB 3ASGA 4LCTA 4TRQA 2VQ2A 4PS8A 5FZRA 3LDZA 3RKVA 5FJYA 2VTBA 4RSYA 3PZDA 1XGWA 4JW1A 3O48A 4KT6B 3ZGQA 4BX9A 5D0OD 3T8MA 4UI9J 3FTZA 3TL5A 2OVFA 1H2UA 5C2YA 1HO8A 4I6GA 4PDXA 4WWPA 5E75A 3RO2A 3FUHA 3OTNA 4AP2A 3L17A 2BUGA 2XGOA 4UI9K 2KATA 2PQRA 5AJDA 4EPZA 4FC8A 3IV0A 3FUIA 3CVPA 3MKQB 1OWNA 5LOZA 5BV0A 4JL0A 3FU5A 3FTXA 4JA7A 1FCHA 4I1MA 2AWIA 3MKQA 2PL2A 1HE8A 1L5JA 3R7QA 2E0IA 3P1UA 4GZDA 4HOUA 2WVIA 3QAQA 1Z6TA 4MS6A 4XIFA 1E90A 5T3RA 2WMOA 1ZBPA 4P29A 5LX8A 4GMJA 1N52A 3SBTB 3LPZA 4MLPA 3S7BA 3APDA 3CGHA 1W3BA 4CT4A 2RD0A 2YHCA 1KT0A 4WNGA 3R7RA 3CVUA 3IHYA 4MKTA 5HI7A 5FT9A 1UJJA 2LSVA 3NQPA 3HYMB 3JCKC 5A7DB 3RRNB 4FP7A 2Y4UA 3UUXA 2YNQA 1IQRA 3CVQA 4U0ZA 2WXHA 2WXNA 2XGSA 3ASDA 2OV8A 3QWPA 3CV0A 2C0LA 4WAFA 2ZU6B 3G2UA 2R59A 2PM7A 4DPRA 1Y8MA 4FLHA 4XI0A 3I5PA 4I2ZA 1E7UA 2IF4A 3ZYKA 4HFGA 5CCMA 3JQ0A 3GZSA 3TGOA 2ILRA 2FULA 4GMLA 1QNFA 4CGWA 4LEUA 3G2SA 3MEKA 3LCAA 4WNEA 3UT4A 3FUMA 3KEZA 3VTXA 3B7SA 1PAQA 4I9EA 1E8ZA 4G26A 2A4ZA 1UJKA 2ONDA 3FWVA 3RIBA 3QWWA 2HR2A 2WXMA 4FLBA 1H2TC 2J09A 3ZYQA 1H0AA 3MV2B 4FU3A 2VJ8A 4JZYA 4PH4B 4ANVA 4G1TA 2Y4TA 4UWGA 4FADA 2OVBA 2WPVA 5BPPA 1Y6IA 2X6IA 2A5UA 4J0UA 1EDUA 3AU4A 3D9JA 4M3OA 1HU3A 2CHWA 4W9RA 4B0ZA 2MOWA 5A6CA 4XX5A 2R17C 4RG6A 3EIJA 4NACA 4I2WA 5LFAA 4WWNA 4R7LA 3FY4A 4J8EA 4UWKA 3CVYA 3FULA 3LY9A 1E96B 3E4BA 4NQ0A 4JEHA 1H6KA 4TV3A 5FQ7A 2J49A 4HXIA 3SF4A 4GYYA 2X3MA 3FTWA 4WNFA 4EZJA 4ME2A 3SHFA 3G2WA 4N2QA 4ANWA 3VTYA 1JPLA 3CKCA 3FU6A 3T5XA 2FBNA 5EX0A 4EQFA 1H2VC 3FUDA 1WAO1 4Y6WA 3IKOB 4I1AA 5JJ6A 5T4YA 1X5BA 4FJZA 1NP7A 2V5FA 3CHRA 5FZQA 5HQ8A 2XPZA 3CQGB 3L54A 3RRUA 4G11A 3FTYA 2IOSA 2WXJA 3K9IA 3MJWA 3PH0C 3RJVA 1NA3A 4WNDA 4FHJA 4FJYA 4PS3A 4APFA 1MHQA 3JQ1A 4K0RA 3LEWA 3CVLA 4I1OB 5ENNA 4GYWA 5FZSA 3MA5A 4XE0A 3JYSA 3ZRHA 3EHMA 4ACKA 5ANLA 4GA2A 2DBAA 4NRHB 1ELRA 4PS7A 1HXIA 2WQ7A 3AS5A 4BT8A 2BF0X 4JA9A 2YQ8A 3LY7A 4LRZA 3CR3A 4HLEA 2VSOE 5LP0A 2VYIA 4ACLA 2WXKA 4EZLA 4GAAA 1Z3XA 4YVOA 4EBAA 4EBAG 3B13A 3QWVA 2WXGA 2J4DA 2L6JA 3S7DA 4LUNU 3ASFA 2UWJG 1SQMA 3ZW3A 2X6FA 3ML8A 4H7YA 3DPDA 1B89A 3CSFA 2LO6A 2GRMA 2NXPA 3EHNA 1E8YA 2LSUA 4OVVA 1WM5A 3PNTB 4Y6CA 1HS6A 2JLBA 3LS8A 4AEZC 1UW4B 4HOQA 4UQXA 1KLXA 3UT7A 2VSNA 1ELKA 1OWLA 4ANUA 5LCWJ 3VLDA 3Q5MA 5KCMA 4U0UA 4B94A 3D9NA 3OAWA 2QY7A 3CVWA 4IRUA 1H19A 5CMYA 2VGXB 2L9BA 5ARGA 4U04A 3MCXA 4N3BA 3ZFWA 5CHEE 4BSXA 2IFUA 2VGXA 1EF1C 1N54A 3PNLB 3FFLA 4Q96A 3KS2A 4L2LA 1HF8A 3APFA 3QB2A 2HYZA 3O4ZA 4HORA 4GCNA 4FA6A 3CVNA 4FHKA 3IHVA 3CVXA 3PUKA 3IEGA 4GZ6A 2RG8A 3D9LA 3AU5A 4BFRA 1E8WA 1HH8A 4YNDA 1PC2A 3SNXA 3SGHA 2QFCA 5AENA 3G2TA 2IJGX 3GYZA 3QKYA 2PM6A 4J8SA 3PS6A 4UQZA 2IOLA 3OXFA 3U9WA 3ONKA 2AXZA 1NZNA 3RU0A 4OYSA 4K03A 2XCCA 1ZU2A 3ZN3A 5BNWA 2XGMA 5JHAA 3CHQA 4QFVA 2KCKA 1SZ9A 3FU0A 3ML9A 5KJMA 5AYWD 2J9QA 3RRMB 3B7UX 2V8SE 4KMOA 3BG1B 5G05J 5E76A 3EDTB 5KJLA 2I9CA 1NA0A 4A3TA 1U3DA 4U07A 2NSZA 5KJNA 2I6HA 4KXKB 5FQ4A 2WXQA 4I6EA 4N3CA 2GGFA 4GA0A 2C2LA 4IULA 2YINA 4ILIA 3CKBA 1HG5A 3FDHA 2X6HA 5FWQA 3ZYLA 4I6JA 4EZKA 4G23A 4J8DA 3UT8A 3TAXA 3KD7A 5ARFA 1P5QA 3CEQA 2R5SA 2V4LA 1U3CA 2WXOA 5CMWA 1WY6A 3EJNA 3ZIMA 3LXUX 1EPUA 4EECA 2YHEA 3APCA 2LAHA 3VLEA 4URKA 3FUJA 4JHKA 4CEMA 3L16A 2XQ0A 3LVQE 2VGYA 5FTPA 3U64A 3LVRE 4CDNA 2XPYA 4BTAA 3ASHA 3ESKA 4HS2A 1UN9A 3FP3A 3HHMA 3I4GA 4E85A 3PRZA 1QZ2A 1UN8A 5JJ7A 4GCOA 3D9KA 2I1KA 2PQNA 5J08A 3NZUA 4O6FA 3CVVA 3SFZA 3NZSA 2XPIA 3FHEA 4KYOB 4RVBA 4A1SA 1OUVA 4BX8A 3FTUA 4YVQC 2X38A 4GZCA 3QK0A 4I9CA 4L1BA 4BWRA 4AJWA 4DJAA 4APOA 1JUQA 4B8CB 1JWFA 1S0PA 4J6IA 4C9BB 5BW8C 3GZ2A 3SI5A 1E7VA 5G04C 5LCWC 3CHMA 3TXMA 5AIJA 3MYVA 4F3VA 4NURA 4H7XA 1FVFA 3FH8A 3B7RL 4KVOA 3TG4A 4CCAA 2CFZA 4DI3A 4CRWA 4L2YA 5BUZA 3EIQC 4UWLA 1TEZA 4N5CA 3SBSA 4E6HA 4JXTA 5EDSA 5G2NA 4HVBA 5DBKA 5FQ6A 3I4RB 4MRUA 3C98A 4G2VA 2CFUA 4CGVA 3IBEA 3QC1A 3ZPJA 2VSXE 2WM9A 2I2OA 4GB9A 4PUCA 4F7AA 3FUEA 4JHJA 3QARA 4JEUA 2FO7A 2WMNA 1SZAA 4C0MA 3LYAA 3ZXSA 4B8AA 5CCLA 3BG0B 4G24A 4WWOA 3TG5A 3FTVA 3TJPA 4A3VA 3ZVVA 4D10C 2M63A 4GYOA 3D9PA 3FEXA 4B89A 4N39A 4GZ5A 2X6KA 5JHBA 5M72A 5G04J 4Q69A 1HG2A 4CDMA 3LKUA 3Q47B 4HOSA 2V0PA 3FH5A 4A55A 3MX3A 4KZ0A 4BY6A 3ZHEB 5G05C 1DVPA 3DBSA 3PE3A 3WXXA 2KM4A 3HVEB 2WXFA 3CQCB 4BT9A 1LF8A 3RO3A 4XKCA 2CG3A 3Q15A 3ZHEA 4AIFA 4DI4A 4DLOA 4F1SA 1INZA 3QDNA 3HVEA 4AM9A 4BTBA 4U0SA 3LJ3A 2XRZA 2XCBA 1VDYA 2CHXA 2KC7A 4UWHA 2DIWA 3AS4A 3B7TA 3I3NA 4ILHB 3T5VA 2Y3AA 3JUIA 2HO1A 3R9AB 3ESLA 1YA0A 1A17A 3S7FA 2KCLA 2MRIA 3UQ3A 2X6JA 5EX3A 4U63A 3RK6A 3L6AA 2MHKA 1TJFA 3FUNA 1HFAA 5JJTA 2WB2A 3U4TA 3MZLB 1XNFA 2WXLA 2I1JA 1E8XA 4J8FA 3ZEFA 3U3WA 3VLFA 1OWPA 2JEKA 4AVXA 2GRLA 1Z3YA 3FUFA 3S2AA 3LY8A 3ULQA 3PEUB 2WQHA 4RG9A 4V3IA 5KJKA 2DCPA 4AY6A 1UG3A 2VSYA 3GW4A 1HZ4A 2EQXA 3PUJA 4UWFA 4U8HA 2P58C 3D9OA 4N2SA 1EYHA 1ELWA 2J07A 4IN3B 2IU1A 3N71A 4ATGA 2KZTB 1TJCA 1DNPA 3G2VA 5DIZA 2BTDA 2IQCA 3CLJA 4XI9A 1IQUA 1IYGA 4GU5A 2KZTA 4CDRA 3D9MA 4KZCA 5A23A 4DLQA 2FF4A 5ANRA 4AY5A 2AXUA 2PZIA 3FEYA 3PVLA 2LAIA 4AOFA 3KAEA 4KBQA 3HDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXP A;  2J49 A;  2J4B A; 
#chains in the Genus database with same CATH topology
 4ILG A;  3W9G A;  3TWU A;  1SVX A;  3DST A;  4KVM A;  2KCV A;  3GZ1 A;  3BEE A;  1QYM A;  2NC9 A;  1N94 A;  1FVH A;  2CHZ A;  2L0T B;  2GW1 A;  2CG2 A;  5AN8 A;  3AS8 A;  3SD5 A;  2DVW A;  2WXI A;  2ION A;  2XRY A;  5FIO A;  4GPK A;  4F6R D;  4UI9 C;  5ENO D;  3UTM A;  4NIK A;  2J4B A;  1KZP A;  3OXG A;  4DX6 D;  3MKR A;  4HOT A;  3TXN A;  3UPV A;  3CK8 A;  4AV7 A;  4BER A;  3Q7F A;  3BU8 A;  2DZN A;  3PZ1 A;  3ONL A;  3ZU7 B;  4I17 A;  2WQ6 A;  1BPO A;  5C1D A;  1ZB1 A;  3DRA A;  5T8I A;  4TRQ A;  3LDZ A;  3RKV A;  2VTB A;  3SY2 A;  3PZD A;  1IKN D;  3ZGQ A;  1HO8 A;  4WWP A;  4MBG A;  4UI9 K;  3UXG A;  2KAT A;  2PQR A;  1OWN A;  1FCH A;  2AWI A;  2PL2 A;  1HE8 A;  1TN8 A;  3DSX A;  2E0I A;  3HXB A;  4GZD A;  4MS6 A;  2WVI A;  2EIK E;  1E90 A;  3EU9 A;  4ZHB A;  1OXJ A;  1ZBP A;  5LX8 A;  2GRO B;  4GMJ A;  4MLP A;  3F6Q A;  3BQO A;  4WNG A;  5CRV A;  1YCS B;  4MKT A;  5HI7 A;  2ZGG A;  2LSV A;  3NQP A;  5A7D B;  2YNQ A;  1IQR A;  3CVQ A;  2WXH A;  2WXN A;  4LNB A;  3CV0 A;  2EIL E;  3G2U A;  2PM7 A;  3I5P A;  1E7U A;  3TGO A;  1QNF A;  4CGW A;  4LEU A;  2XS1 A;  2EIJ E;  3VTX A;  1UJK A;  1U2V G;  2J09 A;  2PNN A;  1OCZ E;  4PH4 B;  1K1B A;  4FAD A;  2WPV A;  3D9J A;  1X81 A;  4R7L A;  4RLY A;  2H6H A;  4NQ0 A;  5HRY A;  4GYY A;  1JPL A;  5EX0 A;  4Y6W A;  4FJZ A;  3RAU A;  3L54 A;  1QBQ A;  2RFA A;  3FTY A;  3DSU A;  3K9I A;  3RJV A;  1NA3 A;  3AG1 E;  1S64 A;  4I1O B;  5ENN A;  5FZS A;  4XE0 A;  3ZRH A;  4GA2 A;  1TN7 A;  1OCO E;  4PS7 A;  1HXI A;  3AS5 A;  4LRZ A;  3CR3 A;  4HLE A;  2P2C P;  2VYI A;  4QQI A;  4ZFH A;  2WXK A;  1N95 A;  4EBA G;  3HXE A;  3QWV A;  3S7D A;  2P9U G;  2UWJ G;  3ZW3 A;  1NFI E;  3DPD A;  1B89 A;  4OVV A;  1HS6 A;  1S63 A;  2H6G A;  3EHQ A;  1ELK A;  3NOC D;  4U0U A;  1MYO A;  3OAW A;  3R9M A;  4GTP A;  2LXL A;  3FFL A;  3QB2 A;  3APF A;  4FA6 A;  3CVN A;  2OEV A;  3IEG A;  4BFR A;  2RG8 A;  3D9L A;  3KSQ A;  3G2T A;  2P9L G;  3PS6 A;  4UQZ A;  2AXZ A;  1NZN A;  4OYS A;  2XCC A;  3ZN3 A;  5BNW A;  1MZC A;  3ML9 A;  1FT2 A;  2QYU A;  2AJA A;  4GTM A;  1S70 B;  5KJN A;  3ULE G;  1N11 A;  2B6C A;  3UM2 A;  2GGF A;  4GA0 A;  1IXV A;  3FDH A;  2X6H A;  3UT8 A;  1P5Q A;  4DRX E;  2V4L A;  2WXO A;  5CMW A;  1WY6 A;  3LXU X;  3APC A;  4URK A;  4JHK A;  4TXR A;  3U64 A;  4CDN A;  5AQ7 A;  1UN9 A;  3SFX A;  3I4G A;  3PRZ A;  1QZ2 A;  3W9F A;  5J08 A;  2XEE A;  3FHE A;  4A1S A;  4BX8 A;  4YVQ C;  1AP7 A;  4AJW A;  3ABM E;  1E7V A;  5G04 C;  2DYS E;  3TXM A;  2Y1L E;  5AIJ A;  3FH8 A;  3B7R L;  4L2Y A;  3EIQ C;  1TEZ A;  2HE0 A;  4E6H A;  4JXT A;  4HVB A;  5FQ6 A;  2EIM E;  3IBE A;  2VSX E;  2WM9 A;  4GB9 A;  5KNH D;  3X2Q E;  1NL4 A;  3FUE A;  4JHJ A;  4UUC A;  2WMN A;  1SZA A;  3LYA A;  3ZVV A;  4LNU D;  5M72 A;  3Q47 B;  2V0P A;  4HQD A;  2F0Y A;  3MX3 A;  4BY6 A;  3ZHE B;  3DBS A;  3WXX A;  1BD8 A;  3HVE B;  3PZ2 A;  4AIF A;  4XKC A;  1INZ A;  4DI4 A;  4DLO A;  3QDN A;  4BTB A;  1FT1 A;  4UWH A;  3AS4 A;  4ILH B;  2Y3A A;  2HO1 A;  1YA0 A;  1A17 A;  2MRI A;  2MYO A;  3C72 A;  1TJF A;  3FUN A;  5JJT A;  1XNF A;  2V4H C;  1IHB A;  3VLF A;  2JEK A;  4AVX A;  3FUF A;  2WQH A;  2VSY A;  5AAO A;  1ELW A;  2KZT B;  4GU5 A;  3D9M A;  4DLQ A;  4AY5 A;  3T9K A;  3UI2 A;  3PDN A;  4C0E A;  4FUL A;  2Q7F A;  5EYP F;  4OVU A;  5D0Q D;  1GW6 A;  5AQA A;  4K5A B;  2FEZ A;  3MGB A;  4GTS A;  4U8Y D;  3TWR A;  1SA4 A;  3E33 A;  1KT1 A;  2DZO A;  4DX2 A;  4WUY A;  3FH7 A;  2HM8 A;  5CEA A;  3ZYM A;  1QQE A;  2FI7 A;  3V2X A;  4JHR A;  3D3M A;  4N3A A;  2E2E A;  4L7T A;  5BT1 A;  2XEH A;  3Q49 B;  1O5M A;  3D9I A;  4IYP A;  4G25 A;  4XKB A;  1BI8 B;  4GZ3 A;  4Z68 A;  3FU3 A;  2P9K G;  4LER A;  5FQ8 A;  2LNI A;  4AXH A;  3CST A;  2VTB B;  4DK5 A;  4LCT A;  4U96 D;  2QC9 A;  2ETA A;  2A5E A;  3O48 A;  4K5C A;  4UI9 J;  3TWS A;  3TL5 A;  3RO2 A;  5E75 A;  2P9I G;  3FUH A;  3L17 A;  2BUG A;  4DX7 D;  5AJD A;  5LOZ A;  5BV0 A;  3FTX A;  3MKQ A;  1L5J A;  5D2M C;  4HOU A;  1Z6T A;  1TN6 A;  2OCC E;  2WMO A;  5T3R A;  4XEI G;  2ZXW E;  1W3B A;  1KPS B;  3R7R A;  3RRN B;  3UUX A;  3HXC A;  3PZ4 A;  4ATZ D;  2XGS A;  3QWP A;  4WAF A;  5CEC B;  4DPR A;  4XI0 A;  4I2Z A;  2IF4 A;  3UKU G;  5CCM A;  3JQ0 A;  3DEO A;  2OND A;  3ZYQ A;  4U95 D;  2F37 A;  4FU3 A;  4G1T A;  4UWG A;  5ENP D;  3E37 A;  1Y6I A;  4J0U A;  3AU4 A;  4M3O A;  1HU3 A;  4W9R A;  4B0Z A;  2MOW A;  4XX5 A;  2R17 C;  1NI1 A;  1BU9 A;  3RSE G;  4NAC A;  4I2W A;  4O1P A;  5LFA A;  2BKK B;  4J8E A;  3FUL A;  3E4B A;  4JEH A;  1H6K A;  1V55 E;  4HXI A;  3SF4 A;  5HS0 A;  3SHF A;  3ISM C;  1KZO A;  4EQF A;  3FUD A;  1WAO 1;  5FZQ A;  5HQ8 A;  2XPZ A;  4G11 A;  3PH0 C;  4TXP A;  4APF A;  4FHJ A;  3JQ1 A;  4GTT A;  3WG7 E;  3LEW A;  3CVL A;  4GYW A;  3MA5 A;  3JYS A;  3EHM A;  3JUE A;  3Q73 A;  4NRH B;  4JA9 A;  4YDY A;  4ACL A;  4GAA A;  3J5P A;  3ASF A;  5AQB A;  5B1B E;  5BXU A;  4H7Y A;  3CSF A;  2LO6 A;  1E8Y A;  1WM5 A;  3PNT B;  2JLB A;  1UW4 B;  4HOQ A;  4ANU A;  5LCW J;  2QZA A;  3AG3 E;  3C3Q A;  5KWD A;  2L9B A;  4LG6 A;  3ZFW A;  4HRN A;  1N54 A;  4GCN A;  4FHK A;  2B0O E;  4GZ6 A;  4JB8 P;  5AEN A;  2Y69 E;  3GYZ A;  3U9W A;  2IOL A;  3ONK A;  2IY0 C;  4U7E B;  5JHA A;  2KCK A;  4DX1 A;  2NYJ A;  3FU0 A;  5AYW D;  3RRM B;  3B7U X;  2V8S E;  5G05 J;  5E76 A;  5KJL A;  4HI9 A;  3KSL A;  4KXK B;  5CBN A;  4I6E A;  3NB2 A;  2C2L A;  3CKB A;  5CBO A;  4I6J A;  4EZK A;  5ARF A;  2R5S A;  1U3C A;  1EPU A;  1LD7 A;  2YHE A;  3VLE A;  3FUJ A;  4CEM A;  3LVQ E;  2LXM A;  3ASH A;  1DCQ A;  3ESK A;  4E85 A;  4O1O A;  1UN8 A;  3UIP C;  2R05 A;  2XPI A;  3NZS A;  4KYO B;  4GZC A;  3QK0 A;  1K1A A;  4I9C A;  4L1B A;  1JUQ A;  4J6I A;  4C9B B;  5BW8 C;  1TR4 A;  4HI8 A;  5LCW C;  4KVO A;  4BET A;  4J8Y A;  3SBS A;  1BLX B;  5EDS A;  4MRU A;  3C98 A;  4CGV A;  2I2O A;  2ZIS A;  3ZXS A;  3SO8 A;  3FTV A;  4GYO A;  4HB5 A;  4N39 A;  5G04 J;  1HG2 A;  3LKU A;  4HOS A;  5G05 C;  1DVP A;  2KM4 A;  4BT9 A;  3LJ3 A;  2XRZ A;  2XCB A;  2CHX A;  2KC7 A;  5ITZ F;  3B7T A;  3T5V A;  2KCL A;  2X6J A;  3RK6 A;  1JCR A;  2MHK A;  3Q9U C;  5AAR A;  2R02 A;  5EN5 D;  1HFA A;  2WXL A;  1E8X A;  3ZEF A;  1OWP A;  4V3I A;  5KJK A;  4AY6 A;  1UG3 A;  4UWF A;  2P58 C;  3D9O A;  1EYH A;  2IU1 A;  3Q7A A;  3G2V A;  2IQC A;  3CLJ A;  4XI9 A;  1IQU A;  1IYG A;  4L9P A;  2FF4 A;  5ANR A;  3FEY A;  4HRL A;  3HDX A;  3PEV B;  5JA4 D;  3NF1 A;  4TUU A;  4ANX A;  1JWG A;  3S7J A;  3CHO A;  3UM0 A;  1OCC E;  3V79 K;  4JVS A;  5KNG A;  2KBX A;  1HX8 A;  3SZ7 A;  2WXR A;  2UY1 A;  4L23 A;  4I43 A;  4HLL A;  5EKQ D;  2WXP A;  3DEP A;  4ABN A;  3L13 A;  2AW6 A;  1WDY A;  2L0I A;  2KXP C;  4RQI A;  3HIZ A;  2RFM A;  5AJL A;  3OXL A;  4U8V D;  3ABK E;  5AQ9 A;  2OOE A;  2R2L A;  3L08 A;  4EHM A;  4M7C A;  5J90 A;  5IY5 E;  3L22 A;  2AXV A;  3FUK A;  2XHE A;  2J08 A;  3ASG A;  2VQ2 A;  4PS8 A;  5FJY A;  4JW1 A;  3EUV A;  5D0O D;  3T8M A;  4OAU C;  1O1S A;  1H2U A;  4PDX A;  4AP2 A;  4FC8 A;  3FUI A;  3MKQ B;  4JL0 A;  4JA7 A;  4I1M A;  3R7Q A;  3P1U A;  3Q78 A;  1OCR E;  1OT8 A;  4XIF A;  4P29 A;  5FIN A;  3SBT B;  3LPZ A;  3C3O A;  3APD A;  3CGH A;  1MX4 A;  3NOG D;  1KT0 A;  5B3S E;  3IHY A;  3V31 A;  4FP7 A;  1N0R A;  2Y4U A;  2IO2 C;  3ASD A;  2C0L A;  2ZU6 B;  4FLH A;  3GZS A;  2ILR A;  2XS8 A;  4WNE A;  3KEZ A;  1PAQ A;  4I9E A;  1E8Z A;  2WXM A;  4FLB A;  1H2T C;  4K5B A;  1H0A A;  2RKK A;  3MV2 B;  2VJ8 A;  4ANV A;  2Y4T A;  2OVB A;  5BPP A;  4LNG A;  2CHW A;  5A6C A;  1JCQ A;  1Q2Z A;  3EIJ A;  1N9A A;  4WWN A;  1D8D A;  4UWK A;  3CVY A;  1TNB A;  1E96 B;  3JXJ A;  4TV3 A;  2ZGD A;  1N0Q A;  2X3M A;  3FTW A;  4WNF A;  4EZJ A;  4N2Q A;  4ANW A;  2FO1 E;  3T5X A;  2FBN A;  1H2V C;  3E34 A;  3IKO B;  2BKG A;  2V5F A;  3CQG B;  2IOS A;  3NAW A;  4WND A;  4A63 B;  4PS3 A;  1MHQ A;  4K0R A;  3BUA A;  3Q75 A;  5ENR D;  1BI7 B;  5BXO A;  3UKR G;  1Z3X A;  4EBA A;  2WXG A;  4LUN U;  2X6F A;  3ML8 A;  2IO3 C;  5JMN D;  2NXP A;  2LSU A;  4UQX A;  2VSN A;  1OWL A;  3VLD A;  4B94 A;  3D9N A;  3C5R A;  3CVW A;  4IRU A;  1H19 A;  5CMY A;  5ARG A;  2IEJ A;  3MCX A;  2VGX A;  4Q96 A;  2HYZ A;  2JAB A;  4HOR A;  3IHV A;  3AU5 A;  1E8W A;  4GTQ A;  1D9S A;  1PC2 A;  3SNX A;  2QFC A;  4J8S A;  3TWV A;  3OXF A;  3PZ3 A;  3C3R A;  4K03 A;  3CHQ A;  4QFV A;  3DPY A;  1SZ9 A;  5KJM A;  2J9Q A;  2OEW A;  3BG1 B;  3EDT B;  1NA0 A;  4A3T A;  2NSZ A;  2ETB A;  4GTO A;  1FPP A;  1YMP A;  3B7B A;  2WXQ A;  2YIN A;  4ILI A;  4G23 A;  3KD7 A;  3UM3 A;  3AG4 E;  1N4S A;  3AG2 E;  3EJN A;  3ZIM A;  3DSS A;  1DC2 A;  2LAH A;  5EIL A;  3LVR E;  4BTA A;  4HNA D;  3FP3 A;  3DWL G;  4DUI A;  4GCO A;  2PQN A;  3DXK G;  4O6F A;  4RVB A;  3ASN E;  1OUV A;  3FTU A;  1O1R A;  2EIN E;  4APO A;  4B8C B;  1JWF A;  1S0P A;  1MJ0 A;  3SI5 A;  3AJI A;  3CHM A;  4NUR A;  4H7X A;  1FVF A;  3TWQ A;  1TNZ A;  4CCA A;  2CFZ A;  4CYM D;  4DI3 A;  4UWL A;  4N5C A;  1N4P A;  3AAA C;  5DBK A;  1Z5S C;  2CFU A;  3QC1 A;  4PUC A;  4F7A A;  1LD8 A;  3QAR A;  4N5Q A;  4JEU A;  2FO7 A;  2F8X K;  4WWO A;  3TG5 A;  2GRQ B;  2M63 A;  5EIB E;  4GZ5 A;  1G3N B;  5JHB A;  3J5Q B;  4GMR A;  5D66 A;  4A55 A;  3SFY A;  2WXF A;  3CQC B;  1LF8 A;  3LJN A;  3Q15 A;  5H7P A;  4U0S A;  1D8E A;  4BES A;  1VDY A;  3I3N A;  2VGE A;  3JXI A;  3S7F A;  3B95 A;  3UQ3 A;  5EX3 A;  3L6A A;  2WB2 A;  2I1J A;  4J8F A;  3DXM G;  3S2A A;  1TNO A;  3ULQ A;  4RG9 A;  1MX2 A;  1HZ4 A;  3KEA A;  4YDE A;  4U8H A;  4N2S A;  2J07 A;  3IXE A;  4IN3 B;  3N71 A;  5DIZ A;  1LTX A;  4CDR A;  1DCE A;  2AXU A;  1TNY A;  2LAI A;  4AOF A;  3KAE A;  4KBQ A;  3ASO E;  1OWO A;  4GA1 A;  4UQY A;  4F53 A;  4DX5 D;  1IHG A;  4Q94 A;  3HG0 D;  5G55 A;  3QNK A;  2R03 A;  3Q4A B;  4YDW A;  3PRE A;  2UY1 B;  4A1G A;  2AVP A;  1OWM A;  3CK9 A;  3UX4 A;  1PY1 A;  5BV1 A;  4CT0 A;  3P2B A;  1MQS A;  3PE4 A;  3ZUV B;  3CHP A;  3CK7 A;  3URZ A;  1H6O A;  1YYH A;  3ULY A;  4G8K A;  3ENE A;  4XZ4 A;  1H6P A;  2C0M A;  3MV3 B;  3QJZ A;  3UIN C;  3CIA A;  3UMV A;  4JC8 A;  2XZD G;  3QOU A;  4JPS A;  2XEV A;  3U66 A;  3CHS A;  3ZNG A;  3FTS A;  5FZR A;  4RSY A;  1XGW A;  4KT6 B;  3TWX A;  4BX9 A;  3FTZ A;  2OVF A;  5C2Y A;  4I6G A;  1OY3 D;  3OTN A;  2XGO A;  3ZKJ A;  4EPZ A;  3IV0 A;  3CVP A;  1JCS A;  3FU5 A;  3V2O A;  2V5Q C;  4F1P A;  3QAQ A;  3T8K A;  4JD2 G;  4GPM A;  1N52 A;  1UOH A;  3S7B A;  4CT4 A;  2RD0 A;  2YHC A;  2GRN B;  3CVU A;  5FT9 A;  1UJJ A;  3E30 A;  5EYL A;  3HYM B;  3JCK C;  2QYJ A;  4C48 B;  4U0Z A;  1AWC B;  5EID A;  2OV8 A;  2R59 A;  1Y8M A;  3ZYK A;  4HFG A;  2FUL A;  4GML A;  3G2S A;  3MEK A;  3LCA A;  3UT4 A;  3FUM A;  3B7S A;  4G26 A;  2A4Z A;  3FWV A;  3RIB A;  3QWW A;  2HR2 A;  5B1A E;  5HKP A;  4JZY A;  2X6I A;  2A5U A;  1EDU A;  4J7W A;  2DWZ A;  3UM1 A;  1TYQ G;  4RG6 A;  3HXF A;  2L6B A;  3FY4 A;  4TUM A;  3LY9 A;  1N4Q A;  5FQ7 A;  2J49 A;  4ME2 A;  3G2W A;  3VTY A;  3CKC A;  3FU6 A;  2XZT G;  3NBN B;  3L82 A;  5JJ6 A;  5T4Y A;  4I1A A;  1X5B A;  1NP7 A;  3CHR A;  3ABL E;  2LUH A;  3RRU A;  2H6F A;  2WXJ A;  3MJW A;  4FJY A;  4ACK A;  5ANL A;  2DBA A;  1ELR A;  2P9N G;  4HBD A;  2WQ7 A;  4BT8 A;  2BF0 X;  3Q9N C;  3Q79 A;  2YQ8 A;  3LY7 A;  2VSO E;  5LP0 A;  4EZL A;  3HRA A;  4YVO A;  3B13 A;  2J4D A;  2L6J A;  1SQM A;  2GRM A;  3EHN A;  4Y6C A;  4AEZ C;  3LS8 A;  1KLX A;  3UT7 A;  5KCM A;  3Q5M A;  4X8Q A;  2QY7 A;  2VGX B;  4U04 A;  1O1T A;  4N3B A;  4BSX A;  5CHE E;  2IFU A;  1EF1 C;  3PNL B;  3V30 A;  3KS2 A;  4L2L A;  1HF8 A;  3O4Z A;  2P9P G;  3CVX A;  3PUK A;  1HH8 A;  4YND A;  1TNU A;  3SGH A;  2IJG X;  3QKY A;  1WG0 A;  2PM6 A;  3RU0 A;  1ZU2 A;  2XGM A;  1V54 E;  4BEP A;  4KMO A;  3E32 A;  2I9C A;  1U3D A;  4U07 A;  2I6H A;  5FQ4 A;  4GTR A;  4N3C A;  3UIO C;  1SW6 A;  4IUL A;  1HG5 A;  5ENS D;  5FWQ A;  3ZYL A;  4J8D A;  1N4R A;  3TAX A;  3CEQ A;  2GRR B;  2J8S D;  2BED A;  4EEC A;  2XEN A;  3DSV A;  3L16 A;  2XQ0 A;  5FTP A;  2VGY A;  2F8Y A;  3HXD A;  2XPY A;  4HS2 A;  3HHM A;  2P9S G;  2H6I A;  5CRU A;  5KBA A;  5JJ7 A;  2ZIR A;  3TWT A;  3D9K A;  2I1K A;  4TXQ A;  3NZU A;  3CVV A;  3SFZ A;  2X38 A;  3ZXP A;  4BWR A;  4DJA A;  1RW2 A;  3GZ2 A;  1K8K G;  1MX6 A;  3MYV A;  4F3V A;  3EU5 A;  3TG4 A;  4CRW A;  5BUZ A;  3L9T A;  1A5E A;  5G2N A;  3DSW A;  1SA5 A;  4LSZ E;  3I4R B;  4GTV A;  4G2V A;  4BSZ B;  3ZPJ A;  4OAV B;  4C0M A;  4B8A A;  5CCL A;  3BG0 B;  4G24 A;  4D10 C;  3TJP A;  4A3V A;  3D9P A;  3FEX A;  5ENT D;  4B89 A;  2X6K A;  4Q69 A;  4O60 A;  4B93 B;  4CDM A;  2GRP B;  3FH5 A;  4CZ2 D;  3D9H A;  4KZ0 A;  4YDO A;  3PE3 A;  1K3Z D;  4G8L A;  3RO3 A;  3ZHE A;  2CG3 A;  4F1S A;  3HVE A;  4AM9 A;  3SQV A;  3TWW A;  2DIW A;  3JUI A;  3R9A B;  3ESL A;  4U63 A;  5CER B;  3U4T A;  3MZL B;  3U3W A;  2GRL A;  1Z3Y A;  3EHR A;  3LY8 A;  3PEU B;  2DCP A;  3GW4 A;  2EQX A;  3PUJ A;  2DYR E;  4HRM B;  4ATG A;  1TJC A;  1DNP A;  2BTD A;  2ETC A;  1RZ4 A;  2KZT A;  4KZC A;  5A23 A;  5CED B;  2PZI A;  2Y0B G;  3PVL A;  5ENQ D; 
#chains in the Genus database with same CATH homology
 3PEV B;  3PDN A;  1OWO A;  4C0E A;  4GA1 A;  3NF1 A;  4ILG A;  4UQY A;  4F53 A;  4TUU A;  1IHG A;  4ANX A;  1JWG A;  4FUL A;  4KVM A;  2Q7F A;  4OVU A;  4Q94 A;  2KCV A;  5D0Q D;  5G55 A;  1GW6 A;  3GZ1 A;  3BEE A;  3QNK A;  3S7J A;  3Q4A B;  3CHO A;  2FEZ A;  3MGB A;  4JVS A;  3PRE A;  2UY1 B;  2NC9 A;  1HX8 A;  3SZ7 A;  1KT1 A;  4A1G A;  1FVH A;  2WXR A;  2CHZ A;  4WUY A;  2UY1 A;  3FH7 A;  4L23 A;  2AVP A;  1OWM A;  2HM8 A;  2GW1 A;  2L0T B;  3CK9 A;  4I43 A;  1PY1 A;  5EKQ D;  2WXP A;  3UX4 A;  4CT0 A;  5BV1 A;  3P2B A;  4ABN A;  2CG2 A;  3L13 A;  3AS8 A;  3ZYM A;  1MQS A;  3PE4 A;  1QQE A;  2FI7 A;  3SD5 A;  2WXI A;  2ION A;  2XRY A;  2AW6 A;  3CHP A;  3CK7 A;  4GPK A;  3URZ A;  4JHR A;  4UI9 C;  3D3M A;  2L0I A;  4N3A A;  2J4B A;  2E2E A;  3HIZ A;  4L7T A;  5AJL A;  3ENE A;  3OXL A;  4XZ4 A;  5BT1 A;  2C0M A;  3OXG A;  3Q49 B;  3MV3 B;  3QJZ A;  2OOE A;  3D9I A;  3MKR A;  4HOT A;  4IYP A;  3TXN A;  3UPV A;  3CK8 A;  3CIA A;  4AV7 A;  4G25 A;  3L08 A;  4XKB A;  3UMV A;  4GZ3 A;  4JC8 A;  3QOU A;  3ONL A;  3FU3 A;  4LER A;  4I17 A;  2WQ6 A;  5J90 A;  4JPS A;  1BPO A;  3L22 A;  2AXV A;  3FUK A;  2XEV A;  5FQ8 A;  5C1D A;  3U66 A;  3CHS A;  2LNI A;  3FTS A;  4AXH A;  5T8I A;  3CST A;  2XHE A;  2J08 A;  4DK5 A;  2VTB B;  3ASG A;  4LCT A;  4TRQ A;  2VQ2 A;  4PS8 A;  5FZR A;  3LDZ A;  3RKV A;  5FJY A;  2VTB A;  4RSY A;  3PZD A;  1XGW A;  4JW1 A;  3O48 A;  4KT6 B;  3ZGQ A;  4BX9 A;  5D0O D;  3T8M A;  4UI9 J;  3FTZ A;  3TL5 A;  2OVF A;  1H2U A;  5C2Y A;  1HO8 A;  4I6G A;  4PDX A;  4WWP A;  5E75 A;  3RO2 A;  3FUH A;  3OTN A;  4AP2 A;  3L17 A;  2BUG A;  2XGO A;  4UI9 K;  2KAT A;  2PQR A;  5AJD A;  4EPZ A;  4FC8 A;  3IV0 A;  3FUI A;  3CVP A;  3MKQ B;  1OWN A;  5LOZ A;  5BV0 A;  4JL0 A;  3FU5 A;  3FTX A;  4JA7 A;  1FCH A;  4I1M A;  2AWI A;  3MKQ A;  2PL2 A;  1HE8 A;  1L5J A;  3R7Q A;  2E0I A;  3P1U A;  4GZD A;  4HOU A;  2WVI A;  3QAQ A;  1Z6T A;  4MS6 A;  4XIF A;  1E90 A;  5T3R A;  2WMO A;  1ZBP A;  4P29 A;  5LX8 A;  4GMJ A;  1N52 A;  3SBT B;  3LPZ A;  4MLP A;  3S7B A;  3APD A;  3CGH A;  1W3B A;  4CT4 A;  2RD0 A;  2YHC A;  1KT0 A;  4WNG A;  3R7R A;  3CVU A;  3IHY A;  4MKT A;  5HI7 A;  5FT9 A;  1UJJ A;  2LSV A;  3NQP A;  3HYM B;  3JCK C;  5A7D B;  3RRN B;  4FP7 A;  2Y4U A;  3UUX A;  2YNQ A;  1IQR A;  3CVQ A;  4U0Z A;  2WXH A;  2WXN A;  2XGS A;  3ASD A;  2OV8 A;  3QWP A;  3CV0 A;  2C0L A;  4WAF A;  2ZU6 B;  3G2U A;  2R59 A;  2PM7 A;  4DPR A;  1Y8M A;  4FLH A;  4XI0 A;  3I5P A;  4I2Z A;  1E7U A;  2IF4 A;  3ZYK A;  4HFG A;  5CCM A;  3JQ0 A;  3GZS A;  3TGO A;  2ILR A;  2FUL A;  4GML A;  1QNF A;  4CGW A;  4LEU A;  3G2S A;  3MEK A;  3LCA A;  4WNE A;  3UT4 A;  3FUM A;  3KEZ A;  3VTX A;  3B7S A;  1PAQ A;  4I9E A;  1E8Z A;  4G26 A;  2A4Z A;  1UJK A;  2OND A;  3FWV A;  3RIB A;  3QWW A;  2HR2 A;  2WXM A;  4FLB A;  1H2T C;  2J09 A;  3ZYQ A;  1H0A A;  3MV2 B;  4FU3 A;  2VJ8 A;  4JZY A;  4PH4 B;  4ANV A;  4G1T A;  2Y4T A;  4UWG A;  4FAD A;  2OVB A;  2WPV A;  5BPP A;  1Y6I A;  2X6I A;  2A5U A;  4J0U A;  1EDU A;  3AU4 A;  3D9J A;  4M3O A;  1HU3 A;  2CHW A;  4W9R A;  4B0Z A;  2MOW A;  5A6C A;  4XX5 A;  2R17 C;  4RG6 A;  3EIJ A;  4NAC A;  4I2W A;  5LFA A;  4WWN A;  4R7L A;  3FY4 A;  4J8E A;  4UWK A;  3CVY A;  3FUL A;  3LY9 A;  1E96 B;  3E4B A;  4NQ0 A;  4JEH A;  1H6K A;  4TV3 A;  5FQ7 A;  2J49 A;  4HXI A;  3SF4 A;  4GYY A;  2X3M A;  3FTW A;  4WNF A;  4EZJ A;  4ME2 A;  3SHF A;  3G2W A;  4N2Q A;  4ANW A;  3VTY A;  1JPL A;  3CKC A;  3FU6 A;  3T5X A;  2FBN A;  5EX0 A;  4EQF A;  1H2V C;  3FUD A;  1WAO 1;  4Y6W A;  3IKO B;  4I1A A;  5JJ6 A;  5T4Y A;  1X5B A;  4FJZ A;  1NP7 A;  2V5F A;  3CHR A;  5FZQ A;  5HQ8 A;  2XPZ A;  3CQG B;  3L54 A;  3RRU A;  4G11 A;  3FTY A;  2IOS A;  2WXJ A;  3K9I A;  3MJW A;  3PH0 C;  3RJV A;  1NA3 A;  4WND A;  4FHJ A;  4FJY A;  4PS3 A;  4APF A;  1MHQ A;  3JQ1 A;  4K0R A;  3LEW A;  3CVL A;  4I1O B;  5ENN A;  4GYW A;  5FZS A;  3MA5 A;  4XE0 A;  3JYS A;  3ZRH A;  3EHM A;  4ACK A;  5ANL A;  4GA2 A;  2DBA A;  4NRH B;  1ELR A;  4PS7 A;  1HXI A;  2WQ7 A;  3AS5 A;  4BT8 A;  2BF0 X;  4JA9 A;  2YQ8 A;  3LY7 A;  4LRZ A;  3CR3 A;  4HLE A;  2VSO E;  5LP0 A;  2VYI A;  4ACL A;  2WXK A;  4EZL A;  4GAA A;  1Z3X A;  4YVO A;  4EBA A;  4EBA G;  3B13 A;  3QWV A;  2WXG A;  2J4D A;  2L6J A;  3S7D A;  4LUN U;  3ASF A;  2UWJ G;  1SQM A;  3ZW3 A;  2X6F A;  3ML8 A;  4H7Y A;  3DPD A;  1B89 A;  3CSF A;  2LO6 A;  2GRM A;  2NXP A;  3EHN A;  1E8Y A;  2LSU A;  4OVV A;  1WM5 A;  3PNT B;  4Y6C A;  1HS6 A;  2JLB A;  3LS8 A;  4AEZ C;  1UW4 B;  4HOQ A;  4UQX A;  1KLX A;  3UT7 A;  2VSN A;  1ELK A;  1OWL A;  4ANU A;  5LCW J;  3VLD A;  3Q5M A;  5KCM A;  4U0U A;  4B94 A;  3D9N A;  3OAW A;  2QY7 A;  3CVW A;  4IRU A;  1H19 A;  5CMY A;  2VGX B;  2L9B A;  5ARG A;  4U04 A;  3MCX A;  4N3B A;  3ZFW A;  5CHE E;  4BSX A;  2IFU A;  2VGX A;  1EF1 C;  1N54 A;  3PNL B;  3FFL A;  4Q96 A;  3KS2 A;  4L2L A;  1HF8 A;  3APF A;  3QB2 A;  2HYZ A;  3O4Z A;  4HOR A;  4GCN A;  4FA6 A;  3CVN A;  4FHK A;  3IHV A;  3CVX A;  3PUK A;  3IEG A;  4GZ6 A;  2RG8 A;  3D9L A;  3AU5 A;  4BFR A;  1E8W A;  1HH8 A;  4YND A;  1PC2 A;  3SNX A;  3SGH A;  2QFC A;  5AEN A;  3G2T A;  2IJG X;  3GYZ A;  3QKY A;  2PM6 A;  4J8S A;  3PS6 A;  4UQZ A;  2IOL A;  3OXF A;  3U9W A;  3ONK A;  2AXZ A;  1NZN A;  3RU0 A;  4OYS A;  4K03 A;  2XCC A;  1ZU2 A;  3ZN3 A;  5BNW A;  2XGM A;  5JHA A;  3CHQ A;  4QFV A;  2KCK A;  1SZ9 A;  3FU0 A;  3ML9 A;  5KJM A;  5AYW D;  2J9Q A;  3RRM B;  3B7U X;  2V8S E;  4KMO A;  3BG1 B;  5G05 J;  5E76 A;  3EDT B;  5KJL A;  2I9C A;  1NA0 A;  4A3T A;  1U3D A;  4U07 A;  2NSZ A;  5KJN A;  2I6H A;  4KXK B;  5FQ4 A;  2WXQ A;  4I6E A;  4N3C A;  2GGF A;  4GA0 A;  2C2L A;  4IUL A;  2YIN A;  4ILI A;  3CKB A;  1HG5 A;  3FDH A;  2X6H A;  5FWQ A;  3ZYL A;  4I6J A;  4EZK A;  4G23 A;  4J8D A;  3UT8 A;  3TAX A;  3KD7 A;  5ARF A;  1P5Q A;  3CEQ A;  2R5S A;  2V4L A;  1U3C A;  2WXO A;  5CMW A;  1WY6 A;  3EJN A;  3ZIM A;  3LXU X;  1EPU A;  4EEC A;  2YHE A;  3APC A;  2LAH A;  3VLE A;  4URK A;  3FUJ A;  4JHK A;  4CEM A;  3L16 A;  2XQ0 A;  3LVQ E;  2VGY A;  5FTP A;  3U64 A;  3LVR E;  4CDN A;  2XPY A;  4BTA A;  3ASH A;  3ESK A;  4HS2 A;  1UN9 A;  3FP3 A;  3HHM A;  3I4G A;  4E85 A;  3PRZ A;  1QZ2 A;  1UN8 A;  5JJ7 A;  4GCO A;  3D9K A;  2I1K A;  2PQN A;  5J08 A;  3NZU A;  4O6F A;  3CVV A;  3SFZ A;  3NZS A;  2XPI A;  3FHE A;  4KYO B;  4RVB A;  4A1S A;  1OUV A;  4BX8 A;  3FTU A;  4YVQ C;  2X38 A;  4GZC A;  3QK0 A;  4I9C A;  4L1B A;  4BWR A;  4AJW A;  4DJA A;  4APO A;  1JUQ A;  4B8C B;  1JWF A;  1S0P A;  4J6I A;  4C9B B;  5BW8 C;  3GZ2 A;  3SI5 A;  1E7V A;  5G04 C;  5LCW C;  3CHM A;  3TXM A;  5AIJ A;  3MYV A;  4F3V A;  4NUR A;  4H7X A;  1FVF A;  3FH8 A;  3B7R L;  4KVO A;  3TG4 A;  4CCA A;  2CFZ A;  4DI3 A;  4CRW A;  4L2Y A;  5BUZ A;  3EIQ C;  4UWL A;  1TEZ A;  4N5C A;  3SBS A;  4E6H A;  4JXT A;  5EDS A;  5G2N A;  4HVB A;  5DBK A;  5FQ6 A;  3I4R B;  4MRU A;  3C98 A;  4G2V A;  2CFU A;  4CGV A;  3IBE A;  3QC1 A;  3ZPJ A;  2VSX E;  2WM9 A;  2I2O A;  4GB9 A;  4PUC A;  4F7A A;  3FUE A;  4JHJ A;  3QAR A;  4JEU A;  2FO7 A;  2WMN A;  1SZA A;  4C0M A;  3LYA A;  3ZXS A;  4B8A A;  5CCL A;  3BG0 B;  4G24 A;  4WWO A;  3TG5 A;  3FTV A;  3TJP A;  4A3V A;  3ZVV A;  4D10 C;  2M63 A;  4GYO A;  3D9P A;  3FEX A;  4B89 A;  4N39 A;  4GZ5 A;  2X6K A;  5JHB A;  5M72 A;  5G04 J;  4Q69 A;  1HG2 A;  4CDM A;  3LKU A;  3Q47 B;  4HOS A;  2V0P A;  3FH5 A;  4A55 A;  3MX3 A;  4KZ0 A;  4BY6 A;  3ZHE B;  5G05 C;  1DVP A;  3DBS A;  3PE3 A;  3WXX A;  2KM4 A;  3HVE B;  2WXF A;  3CQC B;  4BT9 A;  1LF8 A;  3RO3 A;  4XKC A;  2CG3 A;  3Q15 A;  3ZHE A;  4AIF A;  4DI4 A;  4DLO A;  4F1S A;  1INZ A;  3QDN A;  3HVE A;  4AM9 A;  4BTB A;  4U0S A;  3LJ3 A;  2XRZ A;  2XCB A;  1VDY A;  2CHX A;  2KC7 A;  4UWH A;  2DIW A;  3AS4 A;  3B7T A;  3I3N A;  4ILH B;  3T5V A;  2Y3A A;  3JUI A;  2HO1 A;  3R9A B;  3ESL A;  1YA0 A;  1A17 A;  3S7F A;  2KCL A;  2MRI A;  3UQ3 A;  2X6J A;  5EX3 A;  4U63 A;  3RK6 A;  3L6A A;  2MHK A;  1TJF A;  3FUN A;  1HFA A;  5JJT A;  2WB2 A;  3U4T A;  3MZL B;  1XNF A;  2WXL A;  2I1J A;  1E8X A;  4J8F A;  3ZEF A;  3U3W A;  3VLF A;  1OWP A;  2JEK A;  4AVX A;  2GRL A;  1Z3Y A;  3FUF A;  3S2A A;  3LY8 A;  3ULQ A;  3PEU B;  2WQH A;  4RG9 A;  4V3I A;  5KJK A;  2DCP A;  4AY6 A;  1UG3 A;  2VSY A;  3GW4 A;  1HZ4 A;  2EQX A;  3PUJ A;  4UWF A;  4U8H A;  2P58 C;  3D9O A;  4N2S A;  1EYH A;  1ELW A;  2J07 A;  4IN3 B;  2IU1 A;  3N71 A;  4ATG A;  2KZT B;  1TJC A;  1DNP A;  3G2V A;  5DIZ A;  2BTD A;  2IQC A;  3CLJ A;  4XI9 A;  1IQU A;  1IYG A;  4GU5 A;  2KZT A;  4CDR A;  3D9M A;  4KZC A;  5A23 A;  4DLQ A;  2FF4 A;  5ANR A;  4AY5 A;  2AXU A;  2PZI A;  3FEY A;  3PVL A;  2LAI A;  4AOF A;  3KAE A;  4KBQ A;  3HDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...