2J4BA

Crystal structure of encephalitozoon cuniculi taf5 n-terminal domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
131
structure length
129
Chain Sequence
QMETSYVSLKTWIEDSLDLFKNDLLPLLYPLFIHIYFDLIQQNKTDEAKEFFEKYRGDHKSEEIKQFESIYTVQHIHENNFAYTFKNSKYHLSMGRYAFDLLINFLEERNLTYILKILNQHLDIKVYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 72/90-100 KDA
publication title Crystal Structure, Biochemical and Genetic Characterization of Yeast and E. Cuniculi Taf(II)5 N-Terminal Domain: Implications for TFIID Assembly.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 45
structure length 129
sequence length 131
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j4bA00
2J49A 2J4BA 2NXPA
chains in the Genus database with same CATH superfamily
3T5VA 1N4PA 2PZIA 4I2ZA 2XGSA 3B7SA 3ZW3A 5EYPF 2FF4A 1EPUA 3AS5A 4YDYA 3CHRA 3RK6A 2DYSE 2AVPA 2RFMA 1IHBA 4B0ZA 3FUDA 5JMND 2VSNA 1WDYA 3D9NA 4OAUC 4G2VA 1MQSA 3CHOA 4FA6A 1YMPA 2WXQA 1PC2A 4HI9A 4CGWA 1A17A 4WNEA 5CMWA 3UUXA 4A1SA 2AXUA 3CHMA 4I6GA 3ZGQA 2XGOA 5G55A 4D10C 4JA7A 3SBSA 1HE8A 3UM3A 4AIFA 1E7UA 3C3RA 1O5MA 4GB9A 2X38A 4CDNA 3FTWA 3CVLA 4ILGA 5LFAA 5JJTA 4O60A 1OCCE 4GTRA 4PUCA 4B8CB 3DWLG 4GCOA 1O1RA 5ENNA 4I1MA 1K8KG 4GCNA 3JUEA 3PREA 4L2LA 3EHMA 2F0YA 2IOLA 4XI9A 2LSUA 2P9UG 1X5BA 5ENPD 4ZFHA 1BD8A 1H6OA 5CBOA 3PZ4A 2AXZA 5CHEE 3BG1B 5IY5E 3ML8A 2GRMA 2J8SD 1W3BA 4FHJA 3JUIA 3DPYA 2VTBB 3MX3A 1BI7B 3FY4A 3R9MA 4GTSA 3FEXA 3FWVA 2IONA 4HOSA 4I43A 5A7DB 2OVBA 3CLJA 3JYSA 2WXKA 2EINE 2IEJA 3FULA 4JEUA 4N5QA 4I1AA 3CKBA 3APCA 2XPZA 3SFYA 3CVNA 3CSTA 1OXJA 5ARGA 2XENA 1NI1A 3FUNA 1SVXA 4J0UA 4JW1A 4BT9A 2R03A 3ASGA 2A5EA 2L0TB 1YA0A 5G04J 2M63A 2IU1A 1BU9A 3D9JA 3PZ2A 4JC8A 2WXIA 3ASFA 2AWIA 3GYZA 4GTPA 3TWTA 3RRNB 4NURA 4F6RD 4GTOA 2QC9A 3ABKE 4I6JA 3MKQB 2IO3C 5BT1A 3Q78A 3NQPA 4GYYA 4LNUD 5ANRA 2UY1B 2KZTB 1FPPA 4JHRA 1N94A 2YQ8A 5BNWA 2Y3AA 2R02A 5CEAA 2LXMA 3PVLA 3UX4A 2VGXA 3FTVA 2LO6A 1TNBA 3TL5A 4GA0A 3ZHEA 3ZVVA 3MEKA 4CDRA 3NZSA 5KCMA 3JQ0A 5AN8A 4WNFA 1LD7A 3TWUA 1TJFA 4DPRA 5KJLA 4IN3B 3FUFA 4XKBA 4DX2A 3ISMC 1MJ0A 4O1PA 2XRYA 4JA9A 3JXJA 3Q5MA 3FUEA 4JEHA 2DZOA 5H7PA 3CVYA 3E4BA 3ML9A 2JABA 4AVXA 3V30A 1KT0A 5KNHD 4K03A 3FTSA 3EU9A 4N2SA 4A55A 3CK7A 3ZPJA 2ZXWE 3AG3E 1JUQA 3ESLA 1IQRA 1E90A 2J08A 2IOSA 3S2AA 2R05A 3D9KA 4DK5A 4HRNA 1TN6A 3APDA 4J7WA 4HS2A 1NFIE 4GTVA 4DLQA 4UI9J 2GRNB 1MX4A 4U8YD 4I6EA 3FU0A 5DBKA 3TGOA 2H6FA 2WXLA 4IYPA 5AENA 1DCQA 3UM1A 2XEHA 2WXRA 4NRHB 3AG2E 1NZNA 3FU6A 3BG0B 4X8QA 1IHGA 3PDNA 3MKRA 4J8SA 5B3SE 3ASNE 5D0QD 4EZKA 1MX6A 5CMYA 3S7JA 1H19A 1N11A 2B0OE 2RKKA 3JQ1A 3MV3B 3QB2A 5FQ6A 4UQYA 3CVQA 5JA4D 1OWOA 2PQNA 2MYOA 2XPYA 3GZ2A 4KT6B 3CHPA 2ZU6B 5C1DA 4G8KA 2PM6A 2R17C 2HYZA 4N5CA 5J08A 4U0UA 1IXVA 4CRWA 3UTMA 3ESKA 4YVQC 3U9WA 4J6IA 2P9PG 5EIDA 5G04C 3FUHA 5T4YA 3LY8A 2CFUA 1D9SA 4YDEA 3J5QB 4GYWA 3ZFWA 2IFUA 3LVQE 1L5JA 2L0IA 4U0ZA 1U2VG 2EIKE 3SI5A 3QWVA 4KBQA 2J09A 3FTXA 4PH4B 2LAHA 4GA2A 4WWPA 4JZYA 2DBAA 3TWXA 3GZSA 4URKA 4LNGA 4WNDA 4UWKA 5M72A 4EBAG 2OVFA 4UI9K 4I9EA 2YHCA 4LG6A 3FTUA 3UIOC 1H2UA 2HE0A 2RD0A 1E7VA 3MJWA 4UWFA 4Y6WA 4DI3A 4WWNA 3NAWA 4IULA 3UI2A 3QAQA 1YYHA 3E34A 3HVEA 4PS7A 3UINC 3VLFA 5KJNA 4A3TA 3HXFA 4M7CA 4GZ3A 2V4HC 4AEZC 1JCRA 3TWWA 1DVPA 3TWSA 3IXEA 3V2XA 4F1PA 4DX7D 3T9KA 4HXIA 3RU0A 2Q7FA 2WMNA 3HXBA 2DCPA 3G2WA 2BTDA 3LJ3A 4HRMB 4DLOA 3P1UA 3MCXA 4CT4A 3DSXA 4G26A 3W9FA 4HOTA 3KAEA 2P2CP 3OXFA 2RFAA 2WQHA 3ZKJA 1H6KA 4BSZB 2XRZA 3EIJA 3RO2A 1QBQA 3ZIMA 1HG2A 3PUJA 3FH5A 4CCAA 2EIME 3ONLA 4L9PA 3FU3A 1ELRA 3G2TA 2DIWA 4XEIG 3ZYLA 2LSVA 3LY7A 5A6CA 1A5EA 5FQ7A 3SFXA 1JCQA 2LUHA 2YINA 1E8WA 5AYWD 3RKVA 2KCKA 3UKUG 3UMVA 4N39A 4EHMA 1ZU2A 4DX6D 5E76A 4YDOA 3PE4A 3EU5A 4G11A 3Q47B 5ITZF 1QQEA 5CEDB 1DNPA 2MRIA 2X6JA 4BEPA 4GA1A 3R7RA 3ZNGA 4PS8A 5CERB 3B7RL 3ULEG 5ANLA 2FO1E 3E37A 3SZ7A 3URZA 1OWMA 1OUVA 3DSTA 4C0EA 3CGHA 4N2QA 5LOZA 3CIAA 2MHKA 3ASHA 5FT9A 3D9MA 3FU5A 3MV2B 1QZ2A 2EQXA 3PRZA 3U4TA 3UT7A 1S63A 4NQ0A 3B7BA 1NA0A 4GPKA 1S64A 4JHKA 4O1OA 2E0IA 3HYMB 1TYQG 4XIFA 2WQ7A 3B7UX 4ANXA 3CK9A 3WXXA 4GAAA 1JWFA 3FUJA 4HBDA 3BUAA 3DEOA 4WWOA 4G1TA 4BX9A 3GW4A 4N3BA 2R5SA 4U0SA 4J8DA 2BUGA 4BESA 2LAIA 4I1OB 4Y6CA 1TJCA 4L2YA 3ABLE 4G25A 4U7EB 3LYAA 4LRZA 2XHEA 3FDHA 3LVRE 2IQCA 3I4GA 3LPZA 2KXPC 5AJDA 1OT8A 3IV0A 1KT1A 4ILHB 3HXCA 2ETCA 1Y6IA 4L1BA 2YNQA 1KZOA 5FINA 2QYJA 2PL2A 3W9GA 3KS2A 3B13A 3ZRHA 4ZHBA 1E96B 4E85A 3OXLA 2CHZA 3E32A 3Q9NC 5HRYA 3QNKA 1TEZA 2XS8A 4RLYA 1AWCB 2XEEA 4I9CA 2J07A 3ULQA 3TXNA 4TXRA 4BWRA 3EUVA 2JLBA 2WQ6A 2EIJE 3DSWA 4RVBA 4LEUA 3I4RB 4LUNU 5FWQA 3PZ1A 1N95A 3IEGA 3LJNA 3PUKA 3CKCA 3QC1A 1H2TC 2VGXB 4QFVA 4HNAD 5C2YA 3ZHEB 1HZ4A 3ZU7B 2Y4UA 2WVIA 3CVWA 3D9IA 3ZUVB 3NOGD 2OCCE 4GMLA 2I6HA 5CBNA 4CEMA 4EQFA 3RJVA 2X6KA 5BXUA 3AAAC 4GZDA 4BERA 1U3DA 4B93B 3V79K 1JWGA 2RG8A 4ILIA 2A4ZA 2MOWA 4LSZE 1JCSA 4N3AA 3CHQA 1KLXA 4JB8P 1PY1A 2P9IG 4PS3A 1TR4A 4A63B 2PNNA 2AXVA 3IHYA 3QJZA 4A1GA 4GTQA 3EDTB 5E75A 5T3RA 2GRLA 2FBNA 1WG0A 3UPVA 2WXJA 4N3CA 4GMRA 3SBTB 2XS1A 1NP7A 3D9PA 5ENOD 4R7LA 3IHVA 2XCCA 4KVOA 5FJYA 2ZISA 3SNXA 3TJPA 5BW8C 5FZRA 3LKUA 3EIQC 2V4LA 3G2VA 4J8YA 4F3VA 3MYVA 4CZ2D 5AAOA 4MRUA 3T5XA 4E6HA 3Q15A 2QZAA 2GRRB 3PEVB 4ATZD 3FUIA 3QDNA 3LEWA 2BKGA 1RW2A 2H6HA 5JJ6A 3ZXPA 1H0AA 2L9BA 3L6AA 3FTZA 1ELKA 4UUCA 1UN9A 4APFA 5J90A 3J5PA 2NSZA 4Q69A 2F8XK 3MA5A 1OY3D 1JPLA 1XGWA 4FADA 4L7TA 2QYUA 3AJIA 4TXQA 2NC9A 3C3QA 3UKRG 3EHRA 1QNFA 4APOA 5BPPA 3FEYA 3E33A 4FHKA 4FU3A 2YHEA 4XX5A 3C3OA 1K3ZD 2FI7A 3NBNB 3RIBA 4U07A 2C0MA 5LX8A 3C5RA 3HXEA 2WXOA 2GW1A 3PEUB 3FTYA 3OXGA 4RQIA 3L17A 5EKQD 4K5AB 3RRMB 2VGEA 4V3IA 4FP7A 4KZCA 2OEVA 2GRQB 2X6HA 5BV1A 1SA5A 4U8HA 4GTTA 3TG4A 3SD5A 2IF4A 3LCAA 5BXOA 1P5QA 4UWGA 3Q7AA 5AJLA 2AW6A 3L9TA 1HG5A 4AY6A 1N4QA 4L23A 2OEWA 1KZPA 4G23A 2J4BA 3QWPA 5CCMA 2CHXA 1ZB1A 2KCLA 3TXMA 3V2OA 2ONDA 3ZXSA 2X6IA 2IJGX 1FT2A 1MZCA 3JXIA 5EILA 4U96D 3QOUA 3HG0D 3LDZA 2WXHA 3E30A 3FUMA 3U66A 3Q4AB 2DWZA 4DRXE 3LY9A 3F6QA 3ASOE 3LXUX 3NZUA 4UQXA 5JHBA 4GMJA 3HVEB 3RSEG 4OVVA 2KC7A 1HX8A 2VQ2A 5EDSA 4EZLA 3Q79A 3EHQA 2F8YA 2Y1LE 4I17A 1AP7A 1OCRE 2WXMA 3CQGB 1N4SA 2KM4A 3SHFA 4BTBA 3DXMG 3SGHA 4BX8A 3Q75A 2PM7A 2ILRA 3U64A 1TNOA 1LF8A 4TRQA 4DX1A 5AQBA 4XKCA 4G24A 1Y8MA 3SY2A 3S7FA 4KYOB 5ENSD 4TXPA 4FJYA 4C9BB 3NF1A 3K9IA 1WY6A 3UT8A 4JPSA 2JEKA 1INZA 1IYGA 2XGMA 4WUYA 3SFZA 3HDXA 4O6FA 4HORA 1N9AA 1Z6TA 3RAUA 3I5PA 4AJWA 3O4ZA 3WG7E 2P9SG 5EX3A 3FH7A 3PNLB 4C48B 4DX5D 4RG9A 4TUMA 5LCWJ 3KEAA 4ANWA 2BEDA 4ME2A 2GRPB 2P9KG 1FVHA 1SZAA 3KSLA 1N54A 1N52A 3MGBA 3HHMA 1RZ4A 3B7TA 1V54E 2GROB 4YDWA 2NXPA 4FLHA 3ULYA 3OTNA 4JXTA 4YNDA 1TNUA 1NL4A 3RO3A 3S7BA 2L6JA 3UIPC 2I1JA 3IKOB 3MZLB 1HFAA 2KATA 3APFA 4HVBA 2VSXE 4CGVA 4GTMA 4HOUA 2H6IA 4UI9C 2VYIA 5ENQD 1FT1A 4WAFA 4H7YA 3O48A 3TWVA 4AY5A 2Y0BG 3R9AB 5A23A 3BU8A 2KBXA 1SA4A 2EILE 5JHAA 4JD2G 1UJKA 5HI7A 4FULA 3TG5A 4BETA 5FTPA 3DSSA 1HO8A 4LNBA 3UQ3A 3EJNA 2BKKB 2Y4TA 2I2OA 1H2VC 2WXFA 2WXPA 2PQRA 4G8LA 3HIZA 5B1AE 4ANVA 3G2UA 5D0OD 1QYMA 2CG2A 2CFZA 5FZSA 2QFCA 2V5FA 3CVUA 3ENEA 5B1BE 2ZIRA 4HQDA 4JHJA 4BFRA 4DJAA 3FH8A 2WM9A 2H6GA 1WM5A 5G2NA 1E8ZA 4UWLA 5HKPA 5FIOA 4YVOA 2V8SE 4NACA 4F1SA 4EECA 5AIJA 1OWLA 3VTXA 1GW6A 2WXNA 3AG4E 4KMOA 5JJ7A 5G05J 3ZN3A 1N0QA 1BLXB 2LNIA 4U04A 1IQUA 4AXHA 1B89A 3R7QA 4CT0A 2VGYA 1UJJA 4QQIA 3IBEA 4RG6A 3AG1E 4BT8A 1YCSB 4MBGA 2P9NG 4J8FA 1E8XA 4BSXA 3QWWA 3QKYA 1WAO1 4AM9A 3UXGA 2BF0X 3TAXA 2FEZA 2J49A 4ATGA 4F53A 5HS0A 1D8DA 2ZGDA 4ACKA 2VTBA 4B94A 5KNGA 1Z3YA 1K1BA 3CK8A 3SO8A 4WNGA 1MX2A 1HU3A 4A3VA 1HH8A 2OV8A 4XZ4A 1D8EA 2X3MA 2CHWA 3NB2A 3CV0A 2I1KA 4B8AA 2HM8A 1HXIA 3OAWA 3QARA 4HI8A 3C72A 1TNZA 3CQCB 4RSYA 2WXGA 3L08A 3DEPA 4Q94A 4I2WA 2VJ8A 3SF4A 2C2LA 3KEZA 3EHNA 4DUIA 5FZQA 5LCWC 3CHSA 1O1SA 2AJAA 2QY7A 2XQ0A 3LS8A 1MYOA 3L54A 2XZTG 3DSUA 5KJKA 1DCEA 4MLPA 3AU4A 3C98A 1LTXA 3U3WA 4OVUA 4NIKA 5BV0A 1EF1C 1N4RA 3MKQA 3CSFA 3D9OA 3BEEA 4HLEA 2WPVA 3UM2A 4EPZA 3PZ3A 2UY1A 2KZTA 2X6FA 2XPIA 5EN5D 2VSOE 2J9QA 3FP3A 3ZYKA 4UQZA 4UWHA 1ELWA 3V31A 4ABNA 4IRUA 1HF8A 1PAQA 5KWDA 3SQVA 1U3CA 2GGFA 3FHEA 2DVWA 2VSYA 4Z68A 4GPMA 4XI0A 2A5UA 1SZ9A 5CCLA 1S0PA 3CR3A 3L13A 1FCHA 5ARFA 4OYSA 2HO1A 1V55E 3B95A 4GZCA 2XCBA 3BQOA 3ZYMA 5FQ8A 3DBSA 3KSQA 1Z5SC 3L16A 1Q2ZA 3PZDA 3CVPA 4HOQA 4HB5A 2FO7A 4K5BA 4B89A 1OWPA 2DZNA 3QK0A 4EBAA 5DIZA 3T8MA 2HR2A 4EZJA 4K0RA 2IO2C 3UM0A 1N0RA 3D3MA 2CG3A 4P29A 3VLEA 3P2BA 1K1AA 2Y69E 3X2QE 5G05C 4FJZA 3RRUA 3CVVA 1ZBPA 4BTAA 1HS6A 5HQ8A 3TWQA 3I3NA 3ASDA 3ZYQA 4CDMA 2WMOA 5D66A 1OCOE 1BPOA 4GZ6A 4AOFA 3GZ1A 2XEVA 3DXKG 4ANUA 5ENTD 1IKND 4W9RA 1UW4B 4J8EA 4PDXA 4LCTA 1E8YA 2WB2A 3Q7FA 2C0LA 3D9HA 4GU5A 2ETBA 4CYMD 1UG3A 4HFGA 1EDUA 3VTYA 4LERA 1FVFA 3ONKA 2P9LG 3Q9UC 3FFLA 5T8IA 3JCKC 4JVSA 2NYJA 2IY0C 1DC2A 4TUUA 2ZGGA 1H6PA 4F7AA 4Q96A 3HRAA 3S7DA 4BY6A 2F37A 3VLDA 2B6CA 4MKTA 2I9CA 2E2EA 1OCZE 1SW6A 1XNFA 2FULA 4KXKB 1O1TA 1Z3XA 4H7XA 3PNTB 3KD7A 4KVMA 3ZEFA 3ABME 5FQ4A 3AS4A 4M3OA 4TV3A 5EX0A 1G3NB 2L6BA 5KJMA 1UN8A 4C0MA 4OAVB 3L82A 1TN7A 3AU5A 1VDYA 3PS6A 3T8KA 4HLLA 5CECB 4U95D 5ENRD 5AARA 3PH0C 4K5CA 5KBAA 1S70B 4AP2A 2XZDG 2P58C 2R59A 4KZ0A 4GZ5A 3FUKA 5AQ9A 1OWNA 1NA3A 3G2SA 3NOCD 5LP0A 2V0PA 4FC8A 5D2MC 3UT4A 1LD8A 4ACLA 2J4DA 4HRLA 2R2LA 5EYLA 3DPDA 3TWRA 2ETAA 3D9LA 2KCVA 5EIBE 1X81A 4XE0A 4GYOA 1TN8A 1SQMA 5BUZA 2V5QC 3DRAA 1KPSB 4FLBA 2DYRE 4U8VD 4DI4A 3L22A 3N71A 1TNYA 4JL0A 4MS6A 1EYHA 5CRUA 1BI8B 2UWJG 3PE3A 2OOEA 5CRVA 1UOHA 4AV7A 3CVXA 3Q49B 3DSVA 1MHQA 3CEQA 3AS8A 3Q73A 3HXDA 5AQAA 4U63A 5AQ7A 2LXLA
chains in the Genus database with same CATH topology
2J49A 4ATGA 3PEVB 1L5JA 3FUIA 4F53A 2L0IA 3T5VA 3QDNA 2PZIA 3LEWA 2XGSA 4I2ZA 4U0ZA 4ACKA 3B7SA 5JJ6A 2VTBA 3ZW3A 3SI5A 3QWVA 4B94A 4KBQA 1Z3YA 2J09A 1H0AA 2FF4A 3FTXA 1EPUA 2L9BA 3CK8A 3AS5A 4PH4B 2LAHA 3CHRA 4GA2A 4WNGA 3L6AA 3RK6A 3FTZA 2AVPA 4B0ZA 1ELKA 3FUDA 1UN9A 4WWPA 2VSNA 4APFA 3D9NA 5J90A 2NSZA 1MQSA 4G2VA 4Q69A 3MA5A 1HU3A 3CHOA 4JZYA 4FA6A 1JPLA 2DBAA 1XGWA 2WXQA 4A3VA 1HH8A 3GZSA 4FADA 4URKA 2OV8A 4XZ4A 1PC2A 4WNDA 2X3MA 2CHWA 4UWKA 4CGWA 5M72A 4L7TA 1A17A 4EBAG 2OVFA 4UI9K 4I9EA 2YHCA 3CV0A 4WNEA 2I1KA 3FTUA 5CMWA 4B8AA 3UUXA 4A1SA 2AXUA 1H2UA 3CHMA 4I6GA 2HM8A 1HXIA 3OAWA 2RD0A 3QARA 2XGOA 3ZGQA 1E7VA 3MJWA 4UWFA 5G55A 4Y6WA 4D10C 2NC9A 4JA7A 4DI3A 3SBSA 1QNFA 4APOA 1HE8A 3CQCB 4RSYA 2WXGA 4WWNA 3L08A 4Q94A 4IULA 4I2WA 2VJ8A 4AIFA 3SF4A 5BPPA 2C2LA 3FEYA 3KEZA 3EHNA 1E7UA 3QAQA 4FHKA 4GB9A 2X38A 4FU3A 5FZQA 2YHEA 4XX5A 4CDNA 3FTWA 3CVLA 5LCWC 2FI7A 3HVEA 4ILGA 4PS7A 5LFAA 3CHSA 3VLFA 5JJTA 5KJNA 4A3TA 3RIBA 4GZ3A 4PUCA 4U07A 4B8CB 2C0MA 5LX8A 4AEZC 1DVPA 4GCOA 2WXOA 5ENNA 4I1MA 4GCNA 2GW1A 2QY7A 2XQ0A 3PEUB 3LS8A 3FTYA 3OXGA 3PREA 3L54A 4HXIA 3RU0A 2Q7FA 2WMNA 3L17A 4L2LA 3EHMA 5KJKA 2IOLA 4MLPA 5EKQD 4XI9A 3RRMB 3AU4A 4V3IA 2LSUA 1X5BA 4FP7A 4KZCA 3C98A 3U3WA 2DCPA 4OVUA 3G2WA 2X6HA 5BV1A 2BTDA 5BV0A 1EF1C 4U8HA 2AXZA 5CHEE 3LJ3A 3TG4A 4DLOA 3BG1B 3MKQA 3SD5A 3P1UA 3MCXA 2IF4A 3CSFA 4CT4A 3ML8A 4G26A 3D9OA 2GRMA 3LCAA 3BEEA 4HLEA 2WPVA 4HOTA 1P5QA 4FHJA 3KAEA 4UWGA 3JUIA 2VTBB 3OXFA 3MX3A 4EPZA 2UY1A 5AJLA 2WQHA 2KZTA 2X6FA 2AW6A 2XPIA 1H6KA 1HG5A 2VSOE 2J9QA 3FY4A 3FP3A 3FEXA 4AY6A 3ZYKA 3FWVA 2IONA 4UQZA 4UWHA 4HOSA 1ELWA 4L23A 2XRZA 3EIJA 4I43A 4ABNA 4IRUA 1HF8A 4G23A 2J4BA 1PAQA 5A7DB 3QWPA 3RO2A 3ZIMA 1HG2A 3PUJA 5CCMA 3FH5A 2OVBA 2CHXA 4CCAA 3ONLA 1U3CA 2GGFA 3CLJA 2KCLA 3FHEA 3JYSA 3TXMA 3FU3A 2WXKA 1ELRA 3G2TA 2ONDA 2DIWA 3ZXSA 2X6IA 3FULA 4JEUA 3ZYLA 2VSYA 2LSVA 2IJGX 3LY7A 5A6CA 5FQ7A 2YINA 1E8WA 4I1AA 3CKBA 3APCA 4XI0A 5AYWD 2XPZA 3QOUA 2A5UA 1SZ9A 5CCLA 3RKVA 3LDZA 2KCKA 1S0PA 2WXHA 3UMVA 4N39A 3FUMA 3CR3A 1ZU2A 3L13A 3U66A 3Q4AB 1FCHA 3CVNA 5E76A 3CSTA 3LY9A 5ARGA 5ARFA 3PE4A 4OYSA 3LXUX 2HO1A 3FUNA 4J0UA 4JW1A 4BT9A 4G11A 3Q47B 3NZUA 1QQEA 4GZCA 2XCBA 1DNPA 2MRIA 3HVEB 4GMJA 2X6JA 4OVVA 4UQXA 5JHBA 4GA1A 3R7RA 3ZYMA 2KC7A 5FQ8A 3DBSA 1HX8A 2VQ2A 3ASGA 4PS8A 2L0TB 3L16A 5EDSA 3B7RL 3PZDA 4EZLA 5ANLA 1YA0A 5G04J 2M63A 3CVPA 4HOQA 3SZ7A 1OWMA 2IU1A 3URZA 4I17A 1OUVA 3D9JA 4C0EA 2WXMA 2FO7A 3CQGB 3CGHA 4JC8A 4B89A 4N2QA 2KM4A 2WXIA 3SHFA 5LOZA 3CIAA 3ASFA 2MHKA 3SGHA 4BTBA 4BX8A 2PM7A 2AWIA 1OWPA 3GYZA 3ASHA 2ILRA 3QK0A 5FT9A 3U64A 3D9MA 3FU5A 1LF8A 4EBAA 4TRQA 3MV2B 1QZ2A 3RRNB 2EQXA 5DIZA 3PRZA 4NURA 3U4TA 3UT7A 3T8MA 4NQ0A 2HR2A 4XKCA 4I6JA 4G24A 1Y8MA 3MKQB 4EZJA 4K0RA 3S7FA 4KYOB 1NA0A 4GPKA 3D3MA 4JHKA 2CG3A 4FJYA 4C9BB 4P29A 3VLEA 5BT1A 3NQPA 2E0IA 3P2BA 3NF1A 3K9IA 1WY6A 4GYYA 3UT8A 3HYMB 5ANRA 2UY1B 4XIFA 2WQ7A 3B7UX 2KZTB 5G05C 4ANXA 4JPSA 2JEKA 4FJZA 4JHRA 3CK9A 3RRUA 1INZA 2YQ8A 3CVVA 5BNWA 2Y3AA 1IYGA 2XGMA 3WXXA 1ZBPA 4BTAA 1HS6A 4WUYA 5HQ8A 3I3NA 4GAAA 3ASDA 3SFZA 3ZYQA 4CDMA 1JWFA 3FUJA 3HDXA 4O6FA 4HORA 3PVLA 1Z6TA 2WMOA 3I5PA 4WWOA 4G1TA 4BX9A 4AJWA 1BPOA 3GW4A 3O4ZA 4GZ6A 3UX4A 2VGXA 4AOFA 3GZ1A 2XEVA 4ANUA 3FTVA 4N3BA 4W9RA 2LO6A 2R5SA 5EX3A 1UW4B 3FH7A 3PNLB 4J8EA 4PDXA 4U0SA 4J8DA 4RG9A 4GA0A 3TL5A 3ZHEA 4LCTA 3ZVVA 2BUGA 5LCWJ 1E8YA 4ANWA 2WB2A 3MEKA 4CDRA 4ME2A 2C0LA 4GU5A 1UG3A 1FVHA 2LAIA 4HFGA 3NZSA 1TJCA 4I1OB 1SZAA 3JQ0A 4L2YA 4Y6CA 5KCMA 1EDUA 1N54A 4G25A 3VTYA 1N52A 3MGBA 3LYAA 3HHMA 4LERA 1FVFA 4WNFA 3ONKA 3B7TA 2XHEA 4LRZA 1TJFA 3FDHA 4DPRA 5KJLA 4IN3B 3FFLA 3LVRE 2IQCA 3FUFA 3I4GA 4XKBA 5T8IA 3LPZA 3JCKC 4JVSA 5AJDA 2NXPA 3IV0A 4FLHA 1KT1A 3OTNA 4ILHB 4JXTA 2XRYA 4TUUA 4F7AA 1Y6IA 4JA9A 2YNQA 4L1BA 4Q96A 4YNDA 2PL2A 3Q5MA 3FUEA 4JEHA 3RO3A 3KS2A 3S7DA 3S7BA 2L6JA 4BY6A 2I1JA 3B13A 3ZRHA 3IKOB 3MZLB 1E96B 1HFAA 4E85A 3CVYA 3VLDA 3E4BA 3OXLA 2KATA 3APFA 4HVBA 2VSXE 4CGVA 3ML9A 4HOUA 4MKTA 2I9CA 4AVXA 2E2EA 2CHZA 1XNFA 1KT0A 4K03A 3FTSA 2FULA 4UI9C 4KXKB 2VYIA 4N2SA 4WAFA 4H7YA 4A55A 3QNKA 3O48A 1TEZA 1Z3XA 3CK7A 4H7XA 3ZPJA 3PNTB 4I9CA 3KD7A 4AY5A 2J07A 3ULQA 4KVMA 3ZEFA 3R9AB 1JUQA 5A23A 3ESLA 5FQ4A 3TXNA 1IQRA 3AS4A 4M3OA 4TV3A 1E90A 4BWRA 5EX0A 2JLBA 2J08A 2IOSA 5KJMA 2WQ6A 3S2AA 5JHAA 4RVBA 1UN8A 4LEUA 4C0MA 3D9KA 3I4RB 4LUNU 1UJKA 4DK5A 5HI7A 4FULA 3TG5A 5FWQA 3AU5A 3IEGA 5FTPA 1VDYA 3PUKA 3CKCA 1HO8A 3QC1A 3APDA 3PS6A 1H2TC 3EJNA 2VGXB 4HS2A 3UQ3A 2Y4TA 4QFVA 2I2OA 4DLQA 1H2VC 4UI9J 5C2YA 2WXFA 2WXPA 2PQRA 3ZHEB 1HZ4A 3HIZA 4ANVA 2Y4UA 4I6EA 3PH0C 3G2UA 3FU0A 5D0OD 2WVIA 5DBKA 3CVWA 3TGOA 4AP2A 2WXLA 3D9IA 4IYPA 2CG2A 5AENA 2CFZA 4GMLA 5FZSA 2P58C 2I6HA 2QFCA 2R59A 2V5FA 3CVUA 4KZ0A 4CEMA 4GZ5A 3ENEA 2WXRA 4NRHB 4EQFA 3FUKA 3RJVA 1NZNA 4JHJA 2X6KA 3FU6A 4BFRA 3BG0B 1OWNA 4DJAA 3FH8A 1IHGA 1NA3A 3G2SA 5LP0A 3PDNA 2WM9A 3MKRA 2V0PA 4J8SA 4GZDA 4FC8A 1U3DA 5D0QD 4EZKA 5CMYA 3UT4A 1JWGA 2RG8A 3S7JA 4ILIA 1WM5A 1H19A 2A4ZA 2MOWA 3JQ1A 3MV3B 4N3AA 3CHQA 5G2NA 1E8ZA 1KLXA 4UWLA 4ACLA 2J4DA 4YVOA 2V8SE 3QB2A 1PY1A 5FQ6A 4PS3A 3DPDA 4NACA 4UQYA 4F1SA 3CVQA 1OWOA 4EECA 5AIJA 1OWLA 2PQNA 3VTXA 3LVQE 3D9LA 2KCVA 1GW6A 2XPYA 2AXVA 2WXNA 3IHYA 3QJZA 4GYOA 4XE0A 4A1GA 3EDTB 1SQMA 5E75A 3GZ2A 5T3RA 5BUZA 4KMOA 5JJ7A 5G05J 2GRLA 4FLBA 3ZN3A 4KT6B 2FBNA 2LNIA 3CHPA 3UPVA 2WXJA 4N3CA 1IQUA 3L22A 4U04A 3N71A 3SBTB 4DI4A 1NP7A 3D9PA 4R7LA 4AXHA 1B89A 3R7QA 2ZU6B 4JL0A 4MS6A 1EYHA 4CT0A 3IHVA 2XCCA 4KVOA 5FJYA 5C1DA 2PM6A 2R17C 3SNXA 3TJPA 2UWJG 5BW8C 2VGYA 1UJJA 5FZRA 3PE3A 2HYZA 3LKUA 2OOEA 3EIQC 4N5CA 4U0UA 5J08A 4AV7A 3IBEA 3CVXA 4RG6A 3Q49B 2V4LA 4BT8A 3G2VA 4CRWA 1MHQA 4F3VA 3MYVA 3ESKA 4YVQC 3U9WA 4J6IA 4J8FA 1E8XA 3CEQA 4BSXA 4MRUA 3T5XA 3QWWA 5G04C 3FUHA 5T4YA 3AS8A 4E6HA 3LY8A 2CFUA 3Q15A 1WAO1 3QKYA 4AM9A 4GYWA 4U63A 3ZFWA 2BF0X 3TAXA 2IFUA 2FEZA 1W3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J49 A;  2J4B A;  2NXP A; 
#chains in the Genus database with same CATH topology
 3T5V A;  1N4P A;  2PZI A;  4I2Z A;  2XGS A;  3B7S A;  3ZW3 A;  5EYP F;  2FF4 A;  1EPU A;  3AS5 A;  4YDY A;  3CHR A;  3RK6 A;  2DYS E;  2AVP A;  2RFM A;  1IHB A;  4B0Z A;  3FUD A;  5JMN D;  2VSN A;  1WDY A;  3D9N A;  4OAU C;  4G2V A;  1MQS A;  3CHO A;  4FA6 A;  1YMP A;  2WXQ A;  1PC2 A;  4HI9 A;  4CGW A;  1A17 A;  4WNE A;  5CMW A;  3UUX A;  4A1S A;  2AXU A;  3CHM A;  4I6G A;  3ZGQ A;  2XGO A;  5G55 A;  4D10 C;  4JA7 A;  3SBS A;  1HE8 A;  3UM3 A;  4AIF A;  1E7U A;  3C3R A;  1O5M A;  4GB9 A;  2X38 A;  4CDN A;  3FTW A;  3CVL A;  4ILG A;  5LFA A;  5JJT A;  4O60 A;  1OCC E;  4GTR A;  4PUC A;  4B8C B;  3DWL G;  4GCO A;  1O1R A;  5ENN A;  4I1M A;  1K8K G;  4GCN A;  3JUE A;  3PRE A;  4L2L A;  3EHM A;  2F0Y A;  2IOL A;  4XI9 A;  2LSU A;  2P9U G;  1X5B A;  5ENP D;  4ZFH A;  1BD8 A;  1H6O A;  5CBO A;  3PZ4 A;  2AXZ A;  5CHE E;  3BG1 B;  5IY5 E;  3ML8 A;  2GRM A;  2J8S D;  1W3B A;  4FHJ A;  3JUI A;  3DPY A;  2VTB B;  3MX3 A;  1BI7 B;  3FY4 A;  3R9M A;  4GTS A;  3FEX A;  3FWV A;  2ION A;  4HOS A;  4I43 A;  5A7D B;  2OVB A;  3CLJ A;  3JYS A;  2WXK A;  2EIN E;  2IEJ A;  3FUL A;  4JEU A;  4N5Q A;  4I1A A;  3CKB A;  3APC A;  2XPZ A;  3SFY A;  3CVN A;  3CST A;  1OXJ A;  5ARG A;  2XEN A;  1NI1 A;  3FUN A;  1SVX A;  4J0U A;  4JW1 A;  4BT9 A;  2R03 A;  3ASG A;  2A5E A;  2L0T B;  1YA0 A;  5G04 J;  2M63 A;  2IU1 A;  1BU9 A;  3D9J A;  3PZ2 A;  4JC8 A;  2WXI A;  3ASF A;  2AWI A;  3GYZ A;  4GTP A;  3TWT A;  3RRN B;  4NUR A;  4F6R D;  4GTO A;  2QC9 A;  3ABK E;  4I6J A;  3MKQ B;  2IO3 C;  5BT1 A;  3Q78 A;  3NQP A;  4GYY A;  4LNU D;  5ANR A;  2UY1 B;  2KZT B;  1FPP A;  4JHR A;  1N94 A;  2YQ8 A;  5BNW A;  2Y3A A;  2R02 A;  5CEA A;  2LXM A;  3PVL A;  3UX4 A;  2VGX A;  3FTV A;  2LO6 A;  1TNB A;  3TL5 A;  4GA0 A;  3ZHE A;  3ZVV A;  3MEK A;  4CDR A;  3NZS A;  5KCM A;  3JQ0 A;  5AN8 A;  4WNF A;  1LD7 A;  3TWU A;  1TJF A;  4DPR A;  5KJL A;  4IN3 B;  3FUF A;  4XKB A;  4DX2 A;  3ISM C;  1MJ0 A;  4O1P A;  2XRY A;  4JA9 A;  3JXJ A;  3Q5M A;  3FUE A;  4JEH A;  2DZO A;  5H7P A;  3CVY A;  3E4B A;  3ML9 A;  2JAB A;  4AVX A;  3V30 A;  1KT0 A;  5KNH D;  4K03 A;  3FTS A;  3EU9 A;  4N2S A;  4A55 A;  3CK7 A;  3ZPJ A;  2ZXW E;  3AG3 E;  1JUQ A;  3ESL A;  1IQR A;  1E90 A;  2J08 A;  2IOS A;  3S2A A;  2R05 A;  3D9K A;  4DK5 A;  4HRN A;  1TN6 A;  3APD A;  4J7W A;  4HS2 A;  1NFI E;  4GTV A;  4DLQ A;  4UI9 J;  2GRN B;  1MX4 A;  4U8Y D;  4I6E A;  3FU0 A;  5DBK A;  3TGO A;  2H6F A;  2WXL A;  4IYP A;  5AEN A;  1DCQ A;  3UM1 A;  2XEH A;  2WXR A;  4NRH B;  3AG2 E;  1NZN A;  3FU6 A;  3BG0 B;  4X8Q A;  1IHG A;  3PDN A;  3MKR A;  4J8S A;  5B3S E;  3ASN E;  5D0Q D;  4EZK A;  1MX6 A;  5CMY A;  3S7J A;  1H19 A;  1N11 A;  2B0O E;  2RKK A;  3JQ1 A;  3MV3 B;  3QB2 A;  5FQ6 A;  4UQY A;  3CVQ A;  5JA4 D;  1OWO A;  2PQN A;  2MYO A;  2XPY A;  3GZ2 A;  4KT6 B;  3CHP A;  2ZU6 B;  5C1D A;  4G8K A;  2PM6 A;  2R17 C;  2HYZ A;  4N5C A;  5J08 A;  4U0U A;  1IXV A;  4CRW A;  3UTM A;  3ESK A;  4YVQ C;  3U9W A;  4J6I A;  2P9P G;  5EID A;  5G04 C;  3FUH A;  5T4Y A;  3LY8 A;  2CFU A;  1D9S A;  4YDE A;  3J5Q B;  4GYW A;  3ZFW A;  2IFU A;  3LVQ E;  1L5J A;  2L0I A;  4U0Z A;  1U2V G;  2EIK E;  3SI5 A;  3QWV A;  4KBQ A;  2J09 A;  3FTX A;  4PH4 B;  2LAH A;  4GA2 A;  4WWP A;  4JZY A;  2DBA A;  3TWX A;  3GZS A;  4URK A;  4LNG A;  4WND A;  4UWK A;  5M72 A;  4EBA G;  2OVF A;  4UI9 K;  4I9E A;  2YHC A;  4LG6 A;  3FTU A;  3UIO C;  1H2U A;  2HE0 A;  2RD0 A;  1E7V A;  3MJW A;  4UWF A;  4Y6W A;  4DI3 A;  4WWN A;  3NAW A;  4IUL A;  3UI2 A;  3QAQ A;  1YYH A;  3E34 A;  3HVE A;  4PS7 A;  3UIN C;  3VLF A;  5KJN A;  4A3T A;  3HXF A;  4M7C A;  4GZ3 A;  2V4H C;  4AEZ C;  1JCR A;  3TWW A;  1DVP A;  3TWS A;  3IXE A;  3V2X A;  4F1P A;  4DX7 D;  3T9K A;  4HXI A;  3RU0 A;  2Q7F A;  2WMN A;  3HXB A;  2DCP A;  3G2W A;  2BTD A;  3LJ3 A;  4HRM B;  4DLO A;  3P1U A;  3MCX A;  4CT4 A;  3DSX A;  4G26 A;  3W9F A;  4HOT A;  3KAE A;  2P2C P;  3OXF A;  2RFA A;  2WQH A;  3ZKJ A;  1H6K A;  4BSZ B;  2XRZ A;  3EIJ A;  3RO2 A;  1QBQ A;  3ZIM A;  1HG2 A;  3PUJ A;  3FH5 A;  4CCA A;  2EIM E;  3ONL A;  4L9P A;  3FU3 A;  1ELR A;  3G2T A;  2DIW A;  4XEI G;  3ZYL A;  2LSV A;  3LY7 A;  5A6C A;  1A5E A;  5FQ7 A;  3SFX A;  1JCQ A;  2LUH A;  2YIN A;  1E8W A;  5AYW D;  3RKV A;  2KCK A;  3UKU G;  3UMV A;  4N39 A;  4EHM A;  1ZU2 A;  4DX6 D;  5E76 A;  4YDO A;  3PE4 A;  3EU5 A;  4G11 A;  3Q47 B;  5ITZ F;  1QQE A;  5CED B;  1DNP A;  2MRI A;  2X6J A;  4BEP A;  4GA1 A;  3R7R A;  3ZNG A;  4PS8 A;  5CER B;  3B7R L;  3ULE G;  5ANL A;  2FO1 E;  3E37 A;  3SZ7 A;  3URZ A;  1OWM A;  1OUV A;  3DST A;  4C0E A;  3CGH A;  4N2Q A;  5LOZ A;  3CIA A;  2MHK A;  3ASH A;  5FT9 A;  3D9M A;  3FU5 A;  3MV2 B;  1QZ2 A;  2EQX A;  3PRZ A;  3U4T A;  3UT7 A;  1S63 A;  4NQ0 A;  3B7B A;  1NA0 A;  4GPK A;  1S64 A;  4JHK A;  4O1O A;  2E0I A;  3HYM B;  1TYQ G;  4XIF A;  2WQ7 A;  3B7U X;  4ANX A;  3CK9 A;  3WXX A;  4GAA A;  1JWF A;  3FUJ A;  4HBD A;  3BUA A;  3DEO A;  4WWO A;  4G1T A;  4BX9 A;  3GW4 A;  4N3B A;  2R5S A;  4U0S A;  4J8D A;  2BUG A;  4BES A;  2LAI A;  4I1O B;  4Y6C A;  1TJC A;  4L2Y A;  3ABL E;  4G25 A;  4U7E B;  3LYA A;  4LRZ A;  2XHE A;  3FDH A;  3LVR E;  2IQC A;  3I4G A;  3LPZ A;  2KXP C;  5AJD A;  1OT8 A;  3IV0 A;  1KT1 A;  4ILH B;  3HXC A;  2ETC A;  1Y6I A;  4L1B A;  2YNQ A;  1KZO A;  5FIN A;  2QYJ A;  2PL2 A;  3W9G A;  3KS2 A;  3B13 A;  3ZRH A;  4ZHB A;  1E96 B;  4E85 A;  3OXL A;  2CHZ A;  3E32 A;  3Q9N C;  5HRY A;  3QNK A;  1TEZ A;  2XS8 A;  4RLY A;  1AWC B;  2XEE A;  4I9C A;  2J07 A;  3ULQ A;  3TXN A;  4TXR A;  4BWR A;  3EUV A;  2JLB A;  2WQ6 A;  2EIJ E;  3DSW A;  4RVB A;  4LEU A;  3I4R B;  4LUN U;  5FWQ A;  3PZ1 A;  1N95 A;  3IEG A;  3LJN A;  3PUK A;  3CKC A;  3QC1 A;  1H2T C;  2VGX B;  4QFV A;  4HNA D;  5C2Y A;  3ZHE B;  1HZ4 A;  3ZU7 B;  2Y4U A;  2WVI A;  3CVW A;  3D9I A;  3ZUV B;  3NOG D;  2OCC E;  4GML A;  2I6H A;  5CBN A;  4CEM A;  4EQF A;  3RJV A;  2X6K A;  5BXU A;  3AAA C;  4GZD A;  4BER A;  1U3D A;  4B93 B;  3V79 K;  1JWG A;  2RG8 A;  4ILI A;  2A4Z A;  2MOW A;  4LSZ E;  1JCS A;  4N3A A;  3CHQ A;  1KLX A;  4JB8 P;  1PY1 A;  2P9I G;  4PS3 A;  1TR4 A;  4A63 B;  2PNN A;  2AXV A;  3IHY A;  3QJZ A;  4A1G A;  4GTQ A;  3EDT B;  5E75 A;  5T3R A;  2GRL A;  2FBN A;  1WG0 A;  3UPV A;  2WXJ A;  4N3C A;  4GMR A;  3SBT B;  2XS1 A;  1NP7 A;  3D9P A;  5ENO D;  4R7L A;  3IHV A;  2XCC A;  4KVO A;  5FJY A;  2ZIS A;  3SNX A;  3TJP A;  5BW8 C;  5FZR A;  3LKU A;  3EIQ C;  2V4L A;  3G2V A;  4J8Y A;  4F3V A;  3MYV A;  4CZ2 D;  5AAO A;  4MRU A;  3T5X A;  4E6H A;  3Q15 A;  2QZA A;  2GRR B;  3PEV B;  4ATZ D;  3FUI A;  3QDN A;  3LEW A;  2BKG A;  1RW2 A;  2H6H A;  5JJ6 A;  3ZXP A;  1H0A A;  2L9B A;  3L6A A;  3FTZ A;  1ELK A;  4UUC A;  1UN9 A;  4APF A;  5J90 A;  3J5P A;  2NSZ A;  4Q69 A;  2F8X K;  3MA5 A;  1OY3 D;  1JPL A;  1XGW A;  4FAD A;  4L7T A;  2QYU A;  3AJI A;  4TXQ A;  2NC9 A;  3C3Q A;  3UKR G;  3EHR A;  1QNF A;  4APO A;  5BPP A;  3FEY A;  3E33 A;  4FHK A;  4FU3 A;  2YHE A;  4XX5 A;  3C3O A;  1K3Z D;  2FI7 A;  3NBN B;  3RIB A;  4U07 A;  2C0M A;  5LX8 A;  3C5R A;  3HXE A;  2WXO A;  2GW1 A;  3PEU B;  3FTY A;  3OXG A;  4RQI A;  3L17 A;  5EKQ D;  4K5A B;  3RRM B;  2VGE A;  4V3I A;  4FP7 A;  4KZC A;  2OEV A;  2GRQ B;  2X6H A;  5BV1 A;  1SA5 A;  4U8H A;  4GTT A;  3TG4 A;  3SD5 A;  2IF4 A;  3LCA A;  5BXO A;  1P5Q A;  4UWG A;  3Q7A A;  5AJL A;  2AW6 A;  3L9T A;  1HG5 A;  4AY6 A;  1N4Q A;  4L23 A;  2OEW A;  1KZP A;  4G23 A;  2J4B A;  3QWP A;  5CCM A;  2CHX A;  1ZB1 A;  2KCL A;  3TXM A;  3V2O A;  2OND A;  3ZXS A;  2X6I A;  2IJG X;  1FT2 A;  1MZC A;  3JXI A;  5EIL A;  4U96 D;  3QOU A;  3HG0 D;  3LDZ A;  2WXH A;  3E30 A;  3FUM A;  3U66 A;  3Q4A B;  2DWZ A;  4DRX E;  3LY9 A;  3F6Q A;  3ASO E;  3LXU X;  3NZU A;  4UQX A;  5JHB A;  4GMJ A;  3HVE B;  3RSE G;  4OVV A;  2KC7 A;  1HX8 A;  2VQ2 A;  5EDS A;  4EZL A;  3Q79 A;  3EHQ A;  2F8Y A;  2Y1L E;  4I17 A;  1AP7 A;  1OCR E;  2WXM A;  3CQG B;  1N4S A;  2KM4 A;  3SHF A;  4BTB A;  3DXM G;  3SGH A;  4BX8 A;  3Q75 A;  2PM7 A;  2ILR A;  3U64 A;  1TNO A;  1LF8 A;  4TRQ A;  4DX1 A;  5AQB A;  4XKC A;  4G24 A;  1Y8M A;  3SY2 A;  3S7F A;  4KYO B;  5ENS D;  4TXP A;  4FJY A;  4C9B B;  3NF1 A;  3K9I A;  1WY6 A;  3UT8 A;  4JPS A;  2JEK A;  1INZ A;  1IYG A;  2XGM A;  4WUY A;  3SFZ A;  3HDX A;  4O6F A;  4HOR A;  1N9A A;  1Z6T A;  3RAU A;  3I5P A;  4AJW A;  3O4Z A;  3WG7 E;  2P9S G;  5EX3 A;  3FH7 A;  3PNL B;  4C48 B;  4DX5 D;  4RG9 A;  4TUM A;  5LCW J;  3KEA A;  4ANW A;  2BED A;  4ME2 A;  2GRP B;  2P9K G;  1FVH A;  1SZA A;  3KSL A;  1N54 A;  1N52 A;  3MGB A;  3HHM A;  1RZ4 A;  3B7T A;  1V54 E;  2GRO B;  4YDW A;  2NXP A;  4FLH A;  3ULY A;  3OTN A;  4JXT A;  4YND A;  1TNU A;  1NL4 A;  3RO3 A;  3S7B A;  2L6J A;  3UIP C;  2I1J A;  3IKO B;  3MZL B;  1HFA A;  2KAT A;  3APF A;  4HVB A;  2VSX E;  4CGV A;  4GTM A;  4HOU A;  2H6I A;  4UI9 C;  2VYI A;  5ENQ D;  1FT1 A;  4WAF A;  4H7Y A;  3O48 A;  3TWV A;  4AY5 A;  2Y0B G;  3R9A B;  5A23 A;  3BU8 A;  2KBX A;  1SA4 A;  2EIL E;  5JHA A;  4JD2 G;  1UJK A;  5HI7 A;  4FUL A;  3TG5 A;  4BET A;  5FTP A;  3DSS A;  1HO8 A;  4LNB A;  3UQ3 A;  3EJN A;  2BKK B;  2Y4T A;  2I2O A;  1H2V C;  2WXF A;  2WXP A;  2PQR A;  4G8L A;  3HIZ A;  5B1A E;  4ANV A;  3G2U A;  5D0O D;  1QYM A;  2CG2 A;  2CFZ A;  5FZS A;  2QFC A;  2V5F A;  3CVU A;  3ENE A;  5B1B E;  2ZIR A;  4HQD A;  4JHJ A;  4BFR A;  4DJA A;  3FH8 A;  2WM9 A;  2H6G A;  1WM5 A;  5G2N A;  1E8Z A;  4UWL A;  5HKP A;  5FIO A;  4YVO A;  2V8S E;  4NAC A;  4F1S A;  4EEC A;  5AIJ A;  1OWL A;  3VTX A;  1GW6 A;  2WXN A;  3AG4 E;  4KMO A;  5JJ7 A;  5G05 J;  3ZN3 A;  1N0Q A;  1BLX B;  2LNI A;  4U04 A;  1IQU A;  4AXH A;  1B89 A;  3R7Q A;  4CT0 A;  2VGY A;  1UJJ A;  4QQI A;  3IBE A;  4RG6 A;  3AG1 E;  4BT8 A;  1YCS B;  4MBG A;  2P9N G;  4J8F A;  1E8X A;  4BSX A;  3QWW A;  3QKY A;  1WAO 1;  4AM9 A;  3UXG A;  2BF0 X;  3TAX A;  2FEZ A;  2J49 A;  4ATG A;  4F53 A;  5HS0 A;  1D8D A;  2ZGD A;  4ACK A;  2VTB A;  4B94 A;  5KNG A;  1Z3Y A;  1K1B A;  3CK8 A;  3SO8 A;  4WNG A;  1MX2 A;  1HU3 A;  4A3V A;  1HH8 A;  2OV8 A;  4XZ4 A;  1D8E A;  2X3M A;  2CHW A;  3NB2 A;  3CV0 A;  2I1K A;  4B8A A;  2HM8 A;  1HXI A;  3OAW A;  3QAR A;  4HI8 A;  3C72 A;  1TNZ A;  3CQC B;  4RSY A;  2WXG A;  3L08 A;  3DEP A;  4Q94 A;  4I2W A;  2VJ8 A;  3SF4 A;  2C2L A;  3KEZ A;  3EHN A;  4DUI A;  5FZQ A;  5LCW C;  3CHS A;  1O1S A;  2AJA A;  2QY7 A;  2XQ0 A;  3LS8 A;  1MYO A;  3L54 A;  2XZT G;  3DSU A;  5KJK A;  1DCE A;  4MLP A;  3AU4 A;  3C98 A;  1LTX A;  3U3W A;  4OVU A;  4NIK A;  5BV0 A;  1EF1 C;  1N4R A;  3MKQ A;  3CSF A;  3D9O A;  3BEE A;  4HLE A;  2WPV A;  3UM2 A;  4EPZ A;  3PZ3 A;  2UY1 A;  2KZT A;  2X6F A;  2XPI A;  5EN5 D;  2VSO E;  2J9Q A;  3FP3 A;  3ZYK A;  4UQZ A;  4UWH A;  1ELW A;  3V31 A;  4ABN A;  4IRU A;  1HF8 A;  1PAQ A;  5KWD A;  3SQV A;  1U3C A;  2GGF A;  3FHE A;  2DVW A;  2VSY A;  4Z68 A;  4GPM A;  4XI0 A;  2A5U A;  1SZ9 A;  5CCL A;  1S0P A;  3CR3 A;  3L13 A;  1FCH A;  5ARF A;  4OYS A;  2HO1 A;  1V55 E;  3B95 A;  4GZC A;  2XCB A;  3BQO A;  3ZYM A;  5FQ8 A;  3DBS A;  3KSQ A;  1Z5S C;  3L16 A;  1Q2Z A;  3PZD A;  3CVP A;  4HOQ A;  4HB5 A;  2FO7 A;  4K5B A;  4B89 A;  1OWP A;  2DZN A;  3QK0 A;  4EBA A;  5DIZ A;  3T8M A;  2HR2 A;  4EZJ A;  4K0R A;  2IO2 C;  3UM0 A;  1N0R A;  3D3M A;  2CG3 A;  4P29 A;  3VLE A;  3P2B A;  1K1A A;  2Y69 E;  3X2Q E;  5G05 C;  4FJZ A;  3RRU A;  3CVV A;  1ZBP A;  4BTA A;  1HS6 A;  5HQ8 A;  3TWQ A;  3I3N A;  3ASD A;  3ZYQ A;  4CDM A;  2WMO A;  5D66 A;  1OCO E;  1BPO A;  4GZ6 A;  4AOF A;  3GZ1 A;  2XEV A;  3DXK G;  4ANU A;  5ENT D;  1IKN D;  4W9R A;  1UW4 B;  4J8E A;  4PDX A;  4LCT A;  1E8Y A;  2WB2 A;  3Q7F A;  2C0L A;  3D9H A;  4GU5 A;  2ETB A;  4CYM D;  1UG3 A;  4HFG A;  1EDU A;  3VTY A;  4LER A;  1FVF A;  3ONK A;  2P9L G;  3Q9U C;  3FFL A;  5T8I A;  3JCK C;  4JVS A;  2NYJ A;  2IY0 C;  1DC2 A;  4TUU A;  2ZGG A;  1H6P A;  4F7A A;  4Q96 A;  3HRA A;  3S7D A;  4BY6 A;  2F37 A;  3VLD A;  2B6C A;  4MKT A;  2I9C A;  2E2E A;  1OCZ E;  1SW6 A;  1XNF A;  2FUL A;  4KXK B;  1O1T A;  1Z3X A;  4H7X A;  3PNT B;  3KD7 A;  4KVM A;  3ZEF A;  3ABM E;  5FQ4 A;  3AS4 A;  4M3O A;  4TV3 A;  5EX0 A;  1G3N B;  2L6B A;  5KJM A;  1UN8 A;  4C0M A;  4OAV B;  3L82 A;  1TN7 A;  3AU5 A;  1VDY A;  3PS6 A;  3T8K A;  4HLL A;  5CEC B;  4U95 D;  5ENR D;  5AAR A;  3PH0 C;  4K5C A;  5KBA A;  1S70 B;  4AP2 A;  2XZD G;  2P58 C;  2R59 A;  4KZ0 A;  4GZ5 A;  3FUK A;  5AQ9 A;  1OWN A;  1NA3 A;  3G2S A;  3NOC D;  5LP0 A;  2V0P A;  4FC8 A;  5D2M C;  3UT4 A;  1LD8 A;  4ACL A;  2J4D A;  4HRL A;  2R2L A;  5EYL A;  3DPD A;  3TWR A;  2ETA A;  3D9L A;  2KCV A;  5EIB E;  1X81 A;  4XE0 A;  4GYO A;  1TN8 A;  1SQM A;  5BUZ A;  2V5Q C;  3DRA A;  1KPS B;  4FLB A;  2DYR E;  4U8V D;  4DI4 A;  3L22 A;  3N71 A;  1TNY A;  4JL0 A;  4MS6 A;  1EYH A;  5CRU A;  1BI8 B;  2UWJ G;  3PE3 A;  2OOE A;  5CRV A;  1UOH A;  4AV7 A;  3CVX A;  3Q49 B;  3DSV A;  1MHQ A;  3CEQ A;  3AS8 A;  3Q73 A;  3HXD A;  5AQA A;  4U63 A;  5AQ7 A;  2LXL A; 
#chains in the Genus database with same CATH homology
 2J49 A;  4ATG A;  3PEV B;  1L5J A;  3FUI A;  4F53 A;  2L0I A;  3T5V A;  3QDN A;  2PZI A;  3LEW A;  2XGS A;  4I2Z A;  4U0Z A;  4ACK A;  3B7S A;  5JJ6 A;  2VTB A;  3ZW3 A;  3SI5 A;  3QWV A;  4B94 A;  4KBQ A;  1Z3Y A;  2J09 A;  1H0A A;  2FF4 A;  3FTX A;  1EPU A;  2L9B A;  3CK8 A;  3AS5 A;  4PH4 B;  2LAH A;  3CHR A;  4GA2 A;  4WNG A;  3L6A A;  3RK6 A;  3FTZ A;  2AVP A;  4B0Z A;  1ELK A;  3FUD A;  1UN9 A;  4WWP A;  2VSN A;  4APF A;  3D9N A;  5J90 A;  2NSZ A;  1MQS A;  4G2V A;  4Q69 A;  3MA5 A;  1HU3 A;  3CHO A;  4JZY A;  4FA6 A;  1JPL A;  2DBA A;  1XGW A;  2WXQ A;  4A3V A;  1HH8 A;  3GZS A;  4FAD A;  4URK A;  2OV8 A;  4XZ4 A;  1PC2 A;  4WND A;  2X3M A;  2CHW A;  4UWK A;  4CGW A;  5M72 A;  4L7T A;  1A17 A;  4EBA G;  2OVF A;  4UI9 K;  4I9E A;  2YHC A;  3CV0 A;  4WNE A;  2I1K A;  3FTU A;  5CMW A;  4B8A A;  3UUX A;  4A1S A;  2AXU A;  1H2U A;  3CHM A;  4I6G A;  2HM8 A;  1HXI A;  3OAW A;  2RD0 A;  3QAR A;  2XGO A;  3ZGQ A;  1E7V A;  3MJW A;  4UWF A;  5G55 A;  4Y6W A;  4D10 C;  2NC9 A;  4JA7 A;  4DI3 A;  3SBS A;  1QNF A;  4APO A;  1HE8 A;  3CQC B;  4RSY A;  2WXG A;  4WWN A;  3L08 A;  4Q94 A;  4IUL A;  4I2W A;  2VJ8 A;  4AIF A;  3SF4 A;  5BPP A;  2C2L A;  3FEY A;  3KEZ A;  3EHN A;  1E7U A;  3QAQ A;  4FHK A;  4GB9 A;  2X38 A;  4FU3 A;  5FZQ A;  2YHE A;  4XX5 A;  4CDN A;  3FTW A;  3CVL A;  5LCW C;  2FI7 A;  3HVE A;  4ILG A;  4PS7 A;  5LFA A;  3CHS A;  3VLF A;  5JJT A;  5KJN A;  4A3T A;  3RIB A;  4GZ3 A;  4PUC A;  4U07 A;  4B8C B;  2C0M A;  5LX8 A;  4AEZ C;  1DVP A;  4GCO A;  2WXO A;  5ENN A;  4I1M A;  4GCN A;  2GW1 A;  2QY7 A;  2XQ0 A;  3PEU B;  3LS8 A;  3FTY A;  3OXG A;  3PRE A;  3L54 A;  4HXI A;  3RU0 A;  2Q7F A;  2WMN A;  3L17 A;  4L2L A;  3EHM A;  5KJK A;  2IOL A;  4MLP A;  5EKQ D;  4XI9 A;  3RRM B;  3AU4 A;  4V3I A;  2LSU A;  1X5B A;  4FP7 A;  4KZC A;  3C98 A;  3U3W A;  2DCP A;  4OVU A;  3G2W A;  2X6H A;  5BV1 A;  2BTD A;  5BV0 A;  1EF1 C;  4U8H A;  2AXZ A;  5CHE E;  3LJ3 A;  3TG4 A;  4DLO A;  3BG1 B;  3MKQ A;  3SD5 A;  3P1U A;  3MCX A;  2IF4 A;  3CSF A;  4CT4 A;  3ML8 A;  4G26 A;  3D9O A;  2GRM A;  3LCA A;  3BEE A;  4HLE A;  2WPV A;  4HOT A;  1P5Q A;  4FHJ A;  3KAE A;  4UWG A;  3JUI A;  2VTB B;  3OXF A;  3MX3 A;  4EPZ A;  2UY1 A;  5AJL A;  2WQH A;  2KZT A;  2X6F A;  2AW6 A;  2XPI A;  1H6K A;  1HG5 A;  2VSO E;  2J9Q A;  3FY4 A;  3FP3 A;  3FEX A;  4AY6 A;  3ZYK A;  3FWV A;  2ION A;  4UQZ A;  4UWH A;  4HOS A;  1ELW A;  4L23 A;  2XRZ A;  3EIJ A;  4I43 A;  4ABN A;  4IRU A;  1HF8 A;  4G23 A;  2J4B A;  1PAQ A;  5A7D B;  3QWP A;  3RO2 A;  3ZIM A;  1HG2 A;  3PUJ A;  5CCM A;  3FH5 A;  2OVB A;  2CHX A;  4CCA A;  3ONL A;  1U3C A;  2GGF A;  3CLJ A;  2KCL A;  3FHE A;  3JYS A;  3TXM A;  3FU3 A;  2WXK A;  1ELR A;  3G2T A;  2OND A;  2DIW A;  3ZXS A;  2X6I A;  3FUL A;  4JEU A;  3ZYL A;  2VSY A;  2LSV A;  2IJG X;  3LY7 A;  5A6C A;  5FQ7 A;  2YIN A;  1E8W A;  4I1A A;  3CKB A;  3APC A;  4XI0 A;  5AYW D;  2XPZ A;  3QOU A;  2A5U A;  1SZ9 A;  5CCL A;  3RKV A;  3LDZ A;  2KCK A;  1S0P A;  2WXH A;  3UMV A;  4N39 A;  3FUM A;  3CR3 A;  1ZU2 A;  3L13 A;  3U66 A;  3Q4A B;  1FCH A;  3CVN A;  5E76 A;  3CST A;  3LY9 A;  5ARG A;  5ARF A;  3PE4 A;  4OYS A;  3LXU X;  2HO1 A;  3FUN A;  4J0U A;  4JW1 A;  4BT9 A;  4G11 A;  3Q47 B;  3NZU A;  1QQE A;  4GZC A;  2XCB A;  1DNP A;  2MRI A;  3HVE B;  4GMJ A;  2X6J A;  4OVV A;  4UQX A;  5JHB A;  4GA1 A;  3R7R A;  3ZYM A;  2KC7 A;  5FQ8 A;  3DBS A;  1HX8 A;  2VQ2 A;  3ASG A;  4PS8 A;  2L0T B;  3L16 A;  5EDS A;  3B7R L;  3PZD A;  4EZL A;  5ANL A;  1YA0 A;  5G04 J;  2M63 A;  3CVP A;  4HOQ A;  3SZ7 A;  1OWM A;  2IU1 A;  3URZ A;  4I17 A;  1OUV A;  3D9J A;  4C0E A;  2WXM A;  2FO7 A;  3CQG B;  3CGH A;  4JC8 A;  4B89 A;  4N2Q A;  2KM4 A;  2WXI A;  3SHF A;  5LOZ A;  3CIA A;  3ASF A;  2MHK A;  3SGH A;  4BTB A;  4BX8 A;  2PM7 A;  2AWI A;  1OWP A;  3GYZ A;  3ASH A;  2ILR A;  3QK0 A;  5FT9 A;  3U64 A;  3D9M A;  3FU5 A;  1LF8 A;  4EBA A;  4TRQ A;  3MV2 B;  1QZ2 A;  3RRN B;  2EQX A;  5DIZ A;  3PRZ A;  4NUR A;  3U4T A;  3UT7 A;  3T8M A;  4NQ0 A;  2HR2 A;  4XKC A;  4I6J A;  4G24 A;  1Y8M A;  3MKQ B;  4EZJ A;  4K0R A;  3S7F A;  4KYO B;  1NA0 A;  4GPK A;  3D3M A;  4JHK A;  2CG3 A;  4FJY A;  4C9B B;  4P29 A;  3VLE A;  5BT1 A;  3NQP A;  2E0I A;  3P2B A;  3NF1 A;  3K9I A;  1WY6 A;  4GYY A;  3UT8 A;  3HYM B;  5ANR A;  2UY1 B;  4XIF A;  2WQ7 A;  3B7U X;  2KZT B;  5G05 C;  4ANX A;  4JPS A;  2JEK A;  4FJZ A;  4JHR A;  3CK9 A;  3RRU A;  1INZ A;  2YQ8 A;  3CVV A;  5BNW A;  2Y3A A;  1IYG A;  2XGM A;  3WXX A;  1ZBP A;  4BTA A;  1HS6 A;  4WUY A;  5HQ8 A;  3I3N A;  4GAA A;  3ASD A;  3SFZ A;  3ZYQ A;  4CDM A;  1JWF A;  3FUJ A;  3HDX A;  4O6F A;  4HOR A;  3PVL A;  1Z6T A;  2WMO A;  3I5P A;  4WWO A;  4G1T A;  4BX9 A;  4AJW A;  1BPO A;  3GW4 A;  3O4Z A;  4GZ6 A;  3UX4 A;  2VGX A;  4AOF A;  3GZ1 A;  2XEV A;  4ANU A;  3FTV A;  4N3B A;  4W9R A;  2LO6 A;  2R5S A;  5EX3 A;  1UW4 B;  3FH7 A;  3PNL B;  4J8E A;  4PDX A;  4U0S A;  4J8D A;  4RG9 A;  4GA0 A;  3TL5 A;  3ZHE A;  4LCT A;  3ZVV A;  2BUG A;  5LCW J;  1E8Y A;  4ANW A;  2WB2 A;  3MEK A;  4CDR A;  4ME2 A;  2C0L A;  4GU5 A;  1UG3 A;  1FVH A;  2LAI A;  4HFG A;  3NZS A;  1TJC A;  4I1O B;  1SZA A;  3JQ0 A;  4L2Y A;  4Y6C A;  5KCM A;  1EDU A;  1N54 A;  4G25 A;  3VTY A;  1N52 A;  3MGB A;  3LYA A;  3HHM A;  4LER A;  1FVF A;  4WNF A;  3ONK A;  3B7T A;  2XHE A;  4LRZ A;  1TJF A;  3FDH A;  4DPR A;  5KJL A;  4IN3 B;  3FFL A;  3LVR E;  2IQC A;  3FUF A;  3I4G A;  4XKB A;  5T8I A;  3LPZ A;  3JCK C;  4JVS A;  5AJD A;  2NXP A;  3IV0 A;  4FLH A;  1KT1 A;  3OTN A;  4ILH B;  4JXT A;  2XRY A;  4TUU A;  4F7A A;  1Y6I A;  4JA9 A;  2YNQ A;  4L1B A;  4Q96 A;  4YND A;  2PL2 A;  3Q5M A;  3FUE A;  4JEH A;  3RO3 A;  3KS2 A;  3S7D A;  3S7B A;  2L6J A;  4BY6 A;  2I1J A;  3B13 A;  3ZRH A;  3IKO B;  3MZL B;  1E96 B;  1HFA A;  4E85 A;  3CVY A;  3VLD A;  3E4B A;  3OXL A;  2KAT A;  3APF A;  4HVB A;  2VSX E;  4CGV A;  3ML9 A;  4HOU A;  4MKT A;  2I9C A;  4AVX A;  2E2E A;  2CHZ A;  1XNF A;  1KT0 A;  4K03 A;  3FTS A;  2FUL A;  4UI9 C;  4KXK B;  2VYI A;  4N2S A;  4WAF A;  4H7Y A;  4A55 A;  3QNK A;  3O48 A;  1TEZ A;  1Z3X A;  3CK7 A;  4H7X A;  3ZPJ A;  3PNT B;  4I9C A;  3KD7 A;  4AY5 A;  2J07 A;  3ULQ A;  4KVM A;  3ZEF A;  3R9A B;  1JUQ A;  5A23 A;  3ESL A;  5FQ4 A;  3TXN A;  1IQR A;  3AS4 A;  4M3O A;  4TV3 A;  1E90 A;  4BWR A;  5EX0 A;  2JLB A;  2J08 A;  2IOS A;  5KJM A;  2WQ6 A;  3S2A A;  5JHA A;  4RVB A;  1UN8 A;  4LEU A;  4C0M A;  3D9K A;  3I4R B;  4LUN U;  1UJK A;  4DK5 A;  5HI7 A;  4FUL A;  3TG5 A;  5FWQ A;  3AU5 A;  3IEG A;  5FTP A;  1VDY A;  3PUK A;  3CKC A;  1HO8 A;  3QC1 A;  3APD A;  3PS6 A;  1H2T C;  3EJN A;  2VGX B;  4HS2 A;  3UQ3 A;  2Y4T A;  4QFV A;  2I2O A;  4DLQ A;  1H2V C;  4UI9 J;  5C2Y A;  2WXF A;  2WXP A;  2PQR A;  3ZHE B;  1HZ4 A;  3HIZ A;  4ANV A;  2Y4U A;  4I6E A;  3PH0 C;  3G2U A;  3FU0 A;  5D0O D;  2WVI A;  5DBK A;  3CVW A;  3TGO A;  4AP2 A;  2WXL A;  3D9I A;  4IYP A;  2CG2 A;  5AEN A;  2CFZ A;  4GML A;  5FZS A;  2P58 C;  2I6H A;  2QFC A;  2R59 A;  2V5F A;  3CVU A;  4KZ0 A;  4CEM A;  4GZ5 A;  3ENE A;  2WXR A;  4NRH B;  4EQF A;  3FUK A;  3RJV A;  1NZN A;  4JHJ A;  2X6K A;  3FU6 A;  4BFR A;  3BG0 B;  1OWN A;  4DJA A;  3FH8 A;  1IHG A;  1NA3 A;  3G2S A;  5LP0 A;  3PDN A;  2WM9 A;  3MKR A;  2V0P A;  4J8S A;  4GZD A;  4FC8 A;  1U3D A;  5D0Q D;  4EZK A;  5CMY A;  3UT4 A;  1JWG A;  2RG8 A;  3S7J A;  4ILI A;  1WM5 A;  1H19 A;  2A4Z A;  2MOW A;  3JQ1 A;  3MV3 B;  4N3A A;  3CHQ A;  5G2N A;  1E8Z A;  1KLX A;  4UWL A;  4ACL A;  2J4D A;  4YVO A;  2V8S E;  3QB2 A;  1PY1 A;  5FQ6 A;  4PS3 A;  3DPD A;  4NAC A;  4UQY A;  4F1S A;  3CVQ A;  1OWO A;  4EEC A;  5AIJ A;  1OWL A;  2PQN A;  3VTX A;  3LVQ E;  3D9L A;  2KCV A;  1GW6 A;  2XPY A;  2AXV A;  2WXN A;  3IHY A;  3QJZ A;  4GYO A;  4XE0 A;  4A1G A;  3EDT B;  1SQM A;  5E75 A;  3GZ2 A;  5T3R A;  5BUZ A;  4KMO A;  5JJ7 A;  5G05 J;  2GRL A;  4FLB A;  3ZN3 A;  4KT6 B;  2FBN A;  2LNI A;  3CHP A;  3UPV A;  2WXJ A;  4N3C A;  1IQU A;  3L22 A;  4U04 A;  3N71 A;  3SBT B;  4DI4 A;  1NP7 A;  3D9P A;  4R7L A;  4AXH A;  1B89 A;  3R7Q A;  2ZU6 B;  4JL0 A;  4MS6 A;  1EYH A;  4CT0 A;  3IHV A;  2XCC A;  4KVO A;  5FJY A;  5C1D A;  2PM6 A;  2R17 C;  3SNX A;  3TJP A;  2UWJ G;  5BW8 C;  2VGY A;  1UJJ A;  5FZR A;  3PE3 A;  2HYZ A;  3LKU A;  2OOE A;  3EIQ C;  4N5C A;  4U0U A;  5J08 A;  4AV7 A;  3IBE A;  3CVX A;  4RG6 A;  3Q49 B;  2V4L A;  4BT8 A;  3G2V A;  4CRW A;  1MHQ A;  4F3V A;  3MYV A;  3ESK A;  4YVQ C;  3U9W A;  4J6I A;  4J8F A;  1E8X A;  3CEQ A;  4BSX A;  4MRU A;  3T5X A;  3QWW A;  5G04 C;  3FUH A;  5T4Y A;  3AS8 A;  4E6H A;  3LY8 A;  2CFU A;  3Q15 A;  1WAO 1;  3QKY A;  4AM9 A;  4GYW A;  4U63 A;  3ZFW A;  2BF0 X;  3TAX A;  2IFU A;  2FEZ A;  1W3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...