2J4BA

Crystal structure of encephalitozoon cuniculi taf5 n-terminal domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
131
structure length
129
Chain Sequence
b'QMETSYVSLKTWIEDSLDLFKNDLLPLLYPLFIHIYFDLIQQNKTDEAKEFFEKYRGDHKSEEIKQFESIYTVQHIHENNFAYTFKNSKYHLSMGRYAFDLLINFLEERNLTYILKILNQHLDIKVYVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 72/90-100 KDA
publication title Crystal Structure, Biochemical and Genetic Characterization of Yeast and E. Cuniculi Taf(II)5 N-Terminal Domain: Implications for TFIID Assembly.
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 45
structure length 129
sequence length 131
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2006-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.500 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j4bA00
2J4BA 2J49A 2NXPA
chains in the Genus database with same CATH superfamily
1IYGA 4JA9A 3PNTB 3FUIA 4WNFA 5KJKA 5T3RA 4U8HA 3CR3A 1IXVA 3ZPJA 5A23A 4N2QA 3EJNA 1E7UA 2QYJA 3ZU7B 2PM7A 3DPDA 2GRNB 1V55E 4HRNA 1H2UA 3KS2A 3TAXA 5KNGA 3HHMA 2B0OE 4WNGA 2XRZA 4OVVA 3S7JA 4CT4A 1IQRA 2QC9A 4ZHBA 4WWPA 4C9BB 3CVUA 2V8SE 4H7XA 4L2YA 4HOUA 5BT1A 2VSYA 2RFMA 3HXFA 1HXIA 3I3NA 3QWWA 3EHMA 4O1OA 2J07A 1RW2A 3EUVA 3W9FA 3KEAA 2J09A 3Q5MA 2J49A 4G1TA 4K0RA 3ZIMA 3CKBA 4N3BA 2OVBA 4AM9A 3CLJA 3PNLB 5ENRD 3UKUG 4WNDA 2EQXA 4J0UA 4DLOA 4N5CA 2EIME 2X6HA 2KXPC 4JW1A 2VGXA 1UN8A 2VJ8A 3J5QB 3PREA 4FULA 3C3QA 2DWZA 3SBSA 2VSXE 2V5QC 3NOCD 3RRMB 3L54A 3RIBA 5T4YA 4UWLA 3D9NA 1V54E 2V0PA 4UUCA 4GA2A 4HORA 2Y4TA 1BPOA 1ELRA 1YYHA 1E8WA 3R7RA 3AG2E 4GZDA 4HB5A 4FP7A 3MV3B 4MS6A 1D9SA 3QWVA 4AJWA 5HKPA 4N2SA 1TN6A 4GTSA 1IQUA 2NSZA 2J4BA 2BTDA 3SNXA 3UT4A 2X6JA 3LJNA 4KT6B 5B3SE 1H6OA 2WXLA 2ZGGA 3JUEA 4JVSA 3ZKJA 2Y69E 3RSEG 3CHRA 5AJDA 1NI1A 2EIKE 4G2VA 2KM4A 3CVQA 4M7CA 4XE0A 2VGXB 3NOGD 3D9IA 2CG3A 3RO3A 3URZA 2GRQB 1TJCA 5ARGA 1LD7A 1JUQA 1WM5A 4DI4A 4BX8A 4FLBA 4AIFA 1OCOE 4ANVA 3CV0A 3QAQA 2WXGA 3L13A 2HO1A 4B94A 5A7DB 3NZUA 1L5JA 1EPUA 5D2MC 4EZLA 4A63B 3V2XA 1IHGA 4U0UA 3PS6A 3PEVB 1N0QA 2J8SD 5AENA 3ZVVA 1HU3A 2NXPA 3PZ3A 5FZRA 5FWQA 5G04C 2WXNA 5FZQA 5CBOA 1WG0A 4GZ5A 4NURA 2DIWA 5LFAA 1TNBA 2V5FA 2JEKA 1HH8A 2IY0C 3E30A 2WXKA 2AVPA 1KT1A 4NRHB 4GTOA 2IF4A 3CVLA 2LXMA 1VDYA 5ENSD 2DYRE 2KATA 4AXHA 4I43A 4Y6WA 1WY6A 4I6JA 4N39A 3ONKA 2X6KA 3PUJA 3N71A 3IHVA 4JB8P 2KCLA 4DX5D 3UM1A 1TR4A 3UM2A 5AQ9A 2KBXA 4IULA 3TWQA 3R9MA 4XKBA 2FULA 4XI9A 5JJ6A 1E90A 2VTBB 2OV8A 5AJLA 1QQEA 1HG5A 4ACLA 4CT0A 4HRMB 2IU1A 3CSFA 4J8DA 1LF8A 3ZEFA 5JJTA 1TJFA 2VSOE 2F37A 3E34A 1Z3YA 2VQ2A 4G8LA 1SA5A 3E37A 1FCHA 3FUEA 1TN8A 3FTWA 1KLXA 4U0ZA 4XIFA 5BV0A 3V31A 5CRVA 1X81A 3G2WA 3F6QA 4GZ3A 4ANWA 1Z3XA 2F0YA 3C3OA 5ANLA 1A17A 3AG1E 1ELKA 4I17A 1MHQA 2EINE 3DBSA 4ILHB 2KC7A 5FT9A 3FUDA 4C0EA 4O60A 3CKCA 3RJVA 2OEWA 5KWDA 4BWRA 2M63A 3T8KA 3GZSA 2I6HA 4UI9K 2Y3AA 2ILRA 1EYHA 1ELWA 3TL5A 3Q78A 3UINC 5CEDB 2P58C 4GTVA 4ILIA 1OWNA 2C2LA 1HZ4A 4YDEA 3UIPC 1Q2ZA 4C48B 4W9RA 4JEHA 2IEJA 2H6HA 3LCAA 2ZISA 3FUJA 4J8EA 5IY5E 4B8AA 1SZAA 1TYQG 4J8SA 4JZYA 5JA4D 1B89A 2FI7A 3IBEA 3LVQE 1UW4B 2YNQA 4G25A 3V79K 4LNGA 2P9NG 3PZ4A 4GTMA 5LX8A 4AOFA 4JL0A 2P9KG 4L1BA 1SZ9A 3SY2A 3OAWA 4GMJA 5LOZA 5ENOD 2XEVA 1U2VG 5HQ8A 4AVXA 4EBAA 2PQNA 3NF1A 3CHPA 2H6FA 2CHZA 4JHKA 3CVYA 4ATZD 3U3WA 4KVMA 4FU3A 1Y8MA 3IKOB 2R03A 3CK9A 4L7TA 4XI0A 1H2VC 2KCVA 3HVEA 4U07A 4EPZA 3CHQA 2OVFA 4FJYA 4TV3A 2IOSA 3RRNB 4HOQA 3PRZA 5BW8C 3DEOA 3TWRA 2JABA 4YDWA 4HLLA 2IQCA 5CHEE 2RFAA 1DNPA 2GRMA 3UXGA 4BFRA 4I1MA 4GA0A 1NZNA 3FH5A 4N3AA 3ML9A 3FTSA 3QNKA 1OY3D 3LKUA 5ENTD 3LXUX 3R9AB 5FQ6A 1O1RA 3DPYA 3FU3A 4CRWA 4NQ0A 3CVVA 4RQIA 3VTYA 4TXQA 2J9QA 3OTNA 3D9PA 4YVOA 2R59A 2WQ6A 3C3RA 2PL2A 3PDNA 1FPPA 3B7BA 3LPZA 4I2WA 2L0IA 4RLYA 2Y1LE 4Q96A 2Y4UA 1S0PA 2X6IA 4HVBA 4F1PA 2QFCA 1N9AA 2LAIA 2I1KA 3HVEB 3FUKA 1BI7B 1HG2A 4WUYA 2AJAA 2WM9A 3ULYA 4TXRA 3SF4A 2P9SG 4WWOA 1D8DA 1JCSA 3FTZA 3I4RB 3MEKA 2MHKA 2DCPA 3EDTB 3G2VA 1MX2A 3UQ3A 3QJZA 4K5BA 1NL4A 4TRQA 2B6CA 5AN8A 3UT8A 2E0IA 3DSUA 3B7RL 3TG4A 1HX8A 2P9LG 2R17C 3GZ1A 5AQ7A 4U7EB 3G2TA 1OWPA 3BG1B 3JXIA 3SFXA 1U3CA 3ULQA 3V30A 1UN9A 1PC2A 1BI8B 3CGHA 4CGWA 2OOEA 2ZU6B 4B0ZA 3TWSA 3NBNB 3P1UA 1PY1A 1BU9A 4L9PA 1HFAA 3FUNA 4JD2G 1H19A 4LNUD 4H7YA 4E6HA 5G2NA 5BV1A 4BY6A 3NB2A 3ONLA 4U63A 2GW1A 2GRPB 3QOUA 4BT9A 3AU5A 5HS0A 4G26A 2WXRA 4EBAG 2WXMA 1N94A 5T8IA 1ZU2A 3APCA 5FJYA 1H6PA 2XQ0A 2UWJG 2Y0BG 1HE8A 2MOWA 4LG6A 2CHWA 3OXFA 2YHEA 2R2LA 3D9KA 4CZ2D 3CVWA 3ABME 2DVWA 3S7BA 5FZSA 4IN3B 3FTXA 4KMOA 3KSQA 2BKKB 3SHFA 2FEZA 3Q79A 4MRUA 4BSXA 1N54A 3HXBA 2AWIA 4U96D 2AXZA 4EZKA 1P5QA 5G05C 2RG8A 3KAEA 2IOLA 4L2LA 3NQPA 3W9GA 4QQIA 1E96B 3ZHEA 5C1DA 3D9OA 4TUUA 2JLBA 4TUMA 5CMYA 4I2ZA 2QY7A 3ESLA 2GRLA 3OXLA 4K5AB 2VTBA 2WPVA 1TNYA 2XS8A 4A1GA 1TNOA 4UI9J 3KSLA 3SBTB 1A5EA 3TXMA 3EIQC 3PE3A 4HNAD 3T9KA 3DXMG 5CCMA 3JXJA 5EDSA 3ASGA 3GYZA 2KCKA 3ML8A 2ZGDA 3HIZA 5AAOA 4B8CB 3FDHA 2L6JA 4GYOA 5LCWC 4JXTA 1MZCA 1IKND 4I9EA 1ZBPA 4PH4B 3LY8A 3QK0A 3UUXA 1Z6TA 3X2QE 5C2YA 5ENQD 2WB2A 4J8FA 3KEZA 4I9CA 3FULA 2LAHA 1OCRE 4YVQC 3ISMC 4JEUA 5CRUA 2I9CA 2PM6A 4GA1A 4A3VA 3B13A 2XEEA 4N3CA 1FVHA 1PAQA 3SO8A 4GCOA 4ME2A 3TWVA 4ILGA 5ITZF 1K1BA 4U8VD 3BG0B 4FHJA 3ZHEB 4DPRA 3SQVA 5E76A 4DX1A 2AW6A 1SVXA 3TWXA 2J08A 2X3MA 5FIOA 1NFIE 1Y6IA 2IO2C 1LD8A 3HRAA 2BUGA 2FO7A 2WVIA 3PH0C 3EHRA 2MRIA 4FLHA 3IV0A 5FQ4A 4HBDA 3I5PA 4IRUA 5CERB 3Q7FA 1K3ZD 3AS4A 2VSNA 4P29A 4ANUA 2IONA 4MLPA 4AY5A 2AXUA 1MJ0A 1O1TA 2AXVA 4ACKA 3ASFA 2F8YA 3CVPA 3MYVA 4GTTA 2ZIRA 4HS2A 5BUZA 4G23A 3QC1A 2WXPA 3FUFA 5DBKA 3RRUA 1O1SA 4GB9A 4BETA 3L82A 4FJZA 3ZN3A 3ZGQA 3CVNA 5D0OD 3SI5A 4APOA 3K9IA 1XGWA 2CFZA 1YCSB 4JA7A 1NP7A 1UOHA 4KBQA 4BSZB 3RAUA 4HQDA 1OCZE 4G8KA 5EIDA 5HRYA 5HI7A 4J8YA 4PS8A 2H6IA 1BLXB 2L6BA 3LEWA 3E4BA 5LP0A 4HLEA 4APFA 4Q69A 2ETBA 4I6EA 2C0MA 2WXJA 3TG5A 3FTVA 1MYOA 2A5UA 5FQ8A 5D0QD 3JYSA 2XCCA 3CK7A 5EYLA 5CEAA 4U0SA 4O6FA 3ZRHA 3PZ2A 2PNNA 3LY7A 4C0MA 3PE4A 3RO2A 3D9LA 3MA5A 2VYIA 4GTRA 2DZNA 2XGOA 2I2OA 1E8XA 2GRRB 3Q4AB 1N4QA 3ASOE 3DSVA 4KZ0A 1GW6A 1WAO1 4K5CA 3LYAA 4HFGA 4DJAA 3T5XA 5CCLA 2DZOA 4OAUC 4URKA 4MKTA 5EIBE 5JHAA 5ARFA 5H7PA 1S63A 4XZ4A 2XENA 3JUIA 1DVPA 3DSXA 4NIKA 3FH7A 5A6CA 2J4DA 2MYOA 3D9JA 4F53A 1KT0A 4ATGA 4F3VA 4B89A 3CEQA 3FUMA 4CDNA 3U66A 3FU6A 1JWFA 5B1BE 1UG3A 4BT8A 1S70B 3J5PA 1DCEA 1WDYA 3EIJA 1IHBA 2FBNA 4Q94A 3MKQA 4F6RD 4A55A 2UY1B 4XX5A 2LUHA 2OEVA 3EU9A 3U64A 3MZLB 3L6AA 4FHKA 3IXEA 4U04A 1OXJA 1H6KA 3SFZA 3AAAC 3PZ1A 2XGMA 1W3BA 3AG4E 2P9PG 1N0RA 5EYPF 3AS8A 3CHMA 3S2AA 1SA4A 1KZPA 2Q7FA 1H0AA 3D9MA 4YDYA 4E85A 3ZNGA 4HXIA 2ZXWE 1DCQA 1KPSB 3ZYQA 4EZJA 5ENNA 4MBGA 1YA0A 3O48A 2X38A 3S7FA 4RG9A 2OCCE 3MGBA 1QNFA 4GYWA 5BXOA 3DWLG 1S64A 4DUIA 3DEPA 2XCBA 3B95A 3Q49B 3GZ2A 3ZW3A 3P2BA 1ZB1A 1K8KG 3ASHA 4J7WA 2YQ8A 4GCNA 4DX7D 1MQSA 3ASNE 4AP2A 3MKQB 4UQYA 3TWUA 5CECB 2CG2A 4M3OA 3FH8A 1G3NB 3CQGB 4Z68A 3LVRE 1YMPA 5KCMA 2FF4A 5KBAA 1BD8A 3ULEG 3L17A 2H6GA 3ZXPA 3DRAA 4HRLA 5LCWJ 3ABLE 3BUAA 2WXHA 3R7QA 4ZFHA 3TJPA 5G04J 3JQ1A 3CHOA 1N11A 2WXQA 4EHMA 4V3IA 2P2CP 3S7DA 5JJ7A 2E2EA 3QKYA 4J6IA 4DLQA 2XZDG 3O4ZA 4ABNA 3SZ7A 2EILE 4I1AA 4LUNU 3UI2A 4PDXA 2V4LA 3ZUVB 3B7TA 3AJIA 1N4RA 3CVXA 4KYOB 3SFYA 4G11A 3CSTA 3RU0A 3PZDA 4CYMD 1OT8A 4DX2A 3FHEA 3UM0A 3UX4A 3CK8A 4RSYA 2RD0A 3Q47B 4HI9A 3I4GA 1NA3A 1HF8A 3KD7A 3HG0D 3LJ3A 2QZAA 5BPPA 3LY9A 3E32A 2YHCA 2XPYA 2P9UG 3OXGA 3BQOA 3HXCA 4FADA 3RK6A 3U9WA 2LO6A 3ZYMA 5EKQD 2WMOA 3G2SA 3QWPA 1SW6A 3UT7A 1OUVA 4UQZA 4O1PA 1TEZA 3UMVA 4G24A 4UQXA 4ANXA 3V2OA 3Q15A 2P9IG 4CGVA 5AQAA 5D66A 3FWVA 2LSUA 4GMLA 1X5BA 4UWGA 4R7LA 3ESKA 2F8XK 3FEXA 4GAAA 3G2UA 3DXKG 4UWFA 3PEUB 4YNDA 4KZCA 2XS1A 2WQHA 3HDXA 3B7SA 3NZSA 1QZ2A 5CBNA 2A5EA 1TNZA 5DIZA 5J08A 5KJMA 4U8YD 2IFUA 4WNEA 3EU5A 4L23A 3PVLA 4LNBA 1FT2A 3L9TA 4JHJA 4HOTA 3E33A 2HM8A 3VLEA 2NC9A 2BEDA 4KXKB 2I1JA 3IEGA 2IO3C 4K03A 4EECA 2R5SA 4LSZE 4GZCA 1OWLA 4D10C 4BEPA 3FY4A 5G55A 3VLFA 5KJLA 3FU5A 1SQMA 4BTBA 3T5VA 3TWWA 3WG7E 2R02A 4BTAA 5ANRA 5ENPD 3RKVA 3FFLA 1NA0A 3JQ0A 3D9HA 5B1AE 1OCCE 3EHNA 2XZTG 2ETAA 4LERA 4JC8A 3HYMB 5BNWA 2C0LA 3ZYKA 3NAWA 4PS7A 2NYJA 2ETCA 2PZIA 3ABKE 4FC8A 4QFVA 3UPVA 2LSVA 5FQ7A 4NACA 4HI8A 4U95D 4F7AA 2V4HC 3ZYLA 1UJKA 4OVUA 4CDRA 3FUHA 3MV2B 3TXNA 2DYSE 3APDA 2R05A 3QDNA 3EHQA 1AWCB 4RG6A 2QYUA 2XPIA 3CQCB 4DI3A 4OYSA 3WXXA 4HOSA 3Q73A 2LXLA 4UWKA 3ENEA 5FINA 1RZ4A 2FO1E 4GPMA 3CHSA 3JCKC 1E7VA 4Y6CA 3FTUA 5JMND 1KZOA 4N5QA 5BXUA 1OWMA 1TNUA 3FP3A 2BF0X 4GYYA 3GW4A 1AP7A 4KVOA 4GMRA 1UJJA 1EF1C 2WXIA 3QB2A 5FTPA 1JCRA 1U3DA 3PUKA 1N95A 3Q7AA 2LNIA 4RVBA 2IJGX 1INZA 5JHBA 2HE0A 3BU8A 4LEUA 2GGFA 4F1SA 3TGOA 4JPSA 5AIJA 3L08A 4GZ6A 3MX3A 2KZTA 3MCXA 3C98A 4YDOA 4BX9A 2UY1A 3B7UX 1O5MA 4UI9C 1FT1A 1JCQA 2X6FA 2YINA 2VGEA 1MX4A 1N52A 1Z5SC 1QYMA 3L22A 4WAFA 2L9BA 4GTPA 4TXPA 2HYZA 5EN5D 5EX0A 3Q9UC 4DK5A 4CEMA 3UM3A 1HS6A 3L16A 2HR2A 3DSWA 3C72A 2PQRA 2A4ZA 1MX6A 4AV7A 3LS8A 1JPLA 4FA6A 5EX3A 5E75A 4GU5A 2GROB 4LCTA 1HO8A 4PS3A 5AARA 3BEEA 3ZFWA 1H2TC 4CCAA 1OWOA 1QBQA 2XPZA 4DRXE 3ZXSA 3CIAA 1LTXA 2XEHA 2VGYA 4XEIG 4DX6D 3AG3E 4JHRA 4A3TA 3SD5A 4UWHA 3UKRG 4I1OB 3C5RA 4IYPA 3U4TA 5M72A 5J90A 3UIOC 3TWTA 3DSTA 3FEYA 2WMNA 1JWGA 2WXOA 3VLDA 2KZTB 4CDMA 5CMWA 5EILA 2BKGA 3LDZA 4X8QA 2WQ7A 4GPKA 3Q9NC 3FTYA 3AS5A 4OAVB 3AU4A 1XNFA 3APFA 1K1AA 2EIJE 2L0TB 2ONDA 4A1SA 2XRYA 4BERA 4EQFA 5AQBA 4BESA 1TN7A 1N4PA 3FU0A 5AYWD 2CHXA 2XGSA 5KNHD 3SGHA 4LRZA 2RKKA 1E8ZA 4GTQA 1DC2A 3VTXA 4WWNA 2XHEA 2CFUA 4AEZC 5KJNA 3IHYA 3UTMA 3MKRA 1N4SA 4B93B 2WXFA 4I6GA 3ASDA 3T8MA 1E8YA 3MJWA 2DBAA 3HXDA 4AY6A 3HXEA 5G05J 1EDUA 3Q75A 3DSSA 4PUCA 4XKCA 1D8EA 3D3MA 1FVFA 3QARA
chains in the Genus database with same CATH topology
3I4GA 4J8SA 1NA3A 1HF8A 4N3CA 1FVHA 1IYGA 4JA9A 4JZYA 1PAQA 3PNTB 3KD7A 3FUIA 4WNFA 4GCOA 4ME2A 4B8AA 5T3RA 5KJKA 3LJ3A 4U8HA 4ILGA 3CR3A 5BPPA 1B89A 2FI7A 3ZPJA 3LY9A 3IBEA 5A23A 3BG0B 4FHJA 3LVQE 3ZHEB 4DPRA 2YHCA 1UW4B 4N2QA 2XPYA 2YNQA 3EJNA 4G25A 1E7UA 3OXGA 2PM7A 5E76A 3DPDA 2AW6A 1H2UA 3KS2A 3TAXA 4FADA 3HHMA 3RK6A 3U9WA 2J08A 2X3MA 2LO6A 3ZYMA 4WNGA 2XRZA 1Y6IA 5EKQD 4AOFA 5LX8A 2WMOA 4OVVA 2BUGA 2FO7A 2WVIA 3G2SA 3S7JA 4CT4A 4JL0A 1IQRA 3PH0C 3QWPA 3UT7A 2MRIA 4FLHA 3IV0A 4WWPA 1OUVA 4L1BA 4UQZA 5FQ4A 4C9BB 3CVUA 3I5PA 4IRUA 1TEZA 1SZ9A 4G24A 3UMVA 2V8SE 3OAWA 4H7XA 4L2YA 4HOUA 4GMJA 3AS4A 2VSNA 5BT1A 2VSYA 4UQXA 4ANXA 4P29A 4ANUA 5LOZA 2XEVA 5HQ8A 1HXIA 2IONA 3I3NA 4MLPA 4AVXA 4AY5A 3Q15A 4EBAA 4CGVA 2AXUA 2PQNA 3NF1A 3FWVA 2AXVA 2LSUA 1X5BA 3CHPA 3QWWA 3EHMA 4GMLA 4UWGA 2J07A 4R7LA 4ACKA 3ASFA 3ESKA 3CVPA 2CHZA 3FEXA 3MYVA 4GAAA 2J09A 3G2UA 4JHKA 3CVYA 5BUZA 4HS2A 4UWFA 3U3WA 4G23A 3QC1A 4KVMA 4FU3A 3PEUB 2WXPA 3FUFA 4YNDA 5DBKA 4KZCA 3Q5MA 1Y8MA 3RRUA 3IKOB 3CK9A 4L7TA 4XI0A 1H2VC 2KCVA 3HVEA 4GB9A 2J49A 4U07A 2WQHA 3HDXA 4G1TA 4EPZA 3B7SA 3NZSA 1QZ2A 3CHQA 2OVFA 4FJZA 4FJYA 4K0RA 4TV3A 2IOSA 3ZIMA 3ZN3A 3CKBA 4N3BA 3ZGQA 3RRNB 5DIZA 5J08A 5KJMA 3CVNA 4HOQA 5D0OD 2OVBA 3PRZA 2IFUA 5BW8C 3SI5A 4WNEA 4APOA 4AM9A 3CLJA 3K9IA 3PNLB 3PVLA 4L23A 1XGWA 2IQCA 5CHEE 2CFZA 4WNDA 2EQXA 1DNPA 4JA7A 1NP7A 4KBQA 4J0UA 4JHJA 2GRMA 4HOTA 2HM8A 4BFRA 4I1MA 4GA0A 1NZNA 4DLOA 3FH5A 4N5CA 4N3AA 2X6HA 3ML9A 4JW1A 3VLEA 2NC9A 2VGXA 5HI7A 1UN8A 3FTSA 3QNKA 4KXKB 4PS8A 2I1JA 3IEGA 2VJ8A 3LKUA 3LEWA 3E4BA 3LXUX 3PREA 4FULA 4K03A 4EECA 5LP0A 2R5SA 4HLEA 3R9AB 4GZCA 4APFA 5FQ6A 3SBSA 4Q69A 2VSXE 1OWLA 4D10C 4I6EA 2C0MA 3FU3A 4CRWA 2WXJA 3TG5A 3FY4A 3RRMB 5G55A 3VLFA 3FTVA 5KJLA 3FU5A 1SQMA 2A5UA 4BTBA 3L54A 5FQ8A 5D0QD 3JYSA 4NQ0A 2XCCA 3RIBA 3T5VA 3CVVA 3VTYA 4BTAA 3CK7A 5ANRA 3RKVA 5T4YA 2J9QA 3FFLA 4UWLA 3OTNA 1NA0A 3D9PA 4U0SA 3JQ0A 3D9NA 4YVOA 2R59A 2WQ6A 4O6FA 2V0PA 4GA2A 3ZRHA 4HORA 2PL2A 3EHNA 3PDNA 3LY7A 2Y4TA 1BPOA 4LERA 4C0MA 1ELRA 3PE4A 3RO2A 3D9LA 1E8WA 3LPZA 3MA5A 4I2WA 2VYIA 4JC8A 3HYMB 3R7RA 5BNWA 2XGOA 2L0IA 2C0LA 3ZYKA 4GZDA 2I2OA 1E8XA 2Y4UA 4Q96A 3Q4AB 4FP7A 3MV3B 1S0PA 2X6IA 4MS6A 4PS7A 4KZ0A 4HVBA 3QWVA 1GW6A 2PZIA 4FC8A 1WAO1 3LYAA 4QFVA 4AJWA 4N2SA 4HFGA 4DJAA 3UPVA 3T5XA 2LSVA 5CCLA 1IQUA 2NSZA 2J4BA 2QFCA 5FQ7A 4NACA 2LAIA 2I1KA 3HVEB 4URKA 4MKTA 2BTDA 5JHAA 5ARFA 3SNXA 4F7AA 3ZYLA 3FUKA 3UT4A 1UJKA 4OVUA 4CDRA 1HG2A 3FUHA 2X6JA 4WUYA 2WM9A 3MV2B 3TXNA 4KT6B 3SF4A 3APDA 3QDNA 4WWOA 3FTZA 4XZ4A 3I4RB 4RG6A 3MEKA 2MHKA 3JUIA 2WXLA 2XPIA 1DVPA 2DCPA 3EDTB 3G2VA 4JVSA 3CQCB 4DI3A 3UQ3A 4OYSA 3WXXA 4HOSA 3QJZA 4TRQA 3CHRA 4UWKA 5AJDA 3ENEA 3UT8A 3FH7A 5A6CA 2J4DA 4G2VA 2KM4A 2E0IA 3D9JA 4F53A 1KT0A 3CVQA 4XE0A 4ATGA 3B7RL 2VGXB 3TG4A 1HX8A 4F3VA 3CHSA 3D9IA 4B89A 3JCKC 3CEQA 1E7VA 2CG3A 3FUMA 4CDNA 4Y6CA 3U66A 3FU6A 2R17C 3FTUA 1JWFA 3GZ1A 1UG3A 4BT8A 3RO3A 3URZA 1OWMA 3EIJA 1OWPA 3G2TA 1TJCA 5ARGA 3BG1B 3FP3A 1U3CA 3ULQA 1JUQA 1WM5A 1UN9A 1PC2A 2FBNA 4Q94A 4DI4A 2BF0X 3MKQA 4GYYA 3GW4A 3CGHA 4BX8A 4CGWA 2OOEA 2ZU6B 4FLBA 4AIFA 4B0ZA 4ANVA 4KVOA 3P1UA 1UJJA 3CV0A 3QAQA 4A55A 1PY1A 2WXGA 1EF1C 2UY1B 3L13A 1HFAA 2WXIA 3FUNA 3QB2A 4XX5A 1H19A 2HO1A 5FTPA 4H7YA 4B94A 5A7DB 4E6HA 3U64A 5G2NA 3NZUA 1L5JA 3MZLB 1EPUA 5BV1A 1U3DA 3L6AA 3PUKA 4FHKA 4EZLA 4U04A 4BY6A 2LNIA 4RVBA 1IHGA 4U0UA 1H6KA 2IJGX 3SFZA 3PS6A 3ONLA 3PEVB 1INZA 4U63A 2GW1A 2XGMA 1W3BA 5JHBA 3QOUA 4LEUA 4BT9A 2GGFA 5AENA 3AU5A 4F1SA 3ZVVA 3TGOA 3AS8A 4JPSA 4G26A 1HU3A 2NXPA 5AIJA 5FZRA 5FWQA 3L08A 2WXRA 4GZ6A 3MX3A 3CHMA 2KZTA 2WXNA 3MCXA 5FZQA 3C98A 5G04C 3S2AA 2WXMA 4EBAG 2Q7FA 5T8IA 1H0AA 3D9MA 1ZU2A 4BX9A 4GZ5A 2UY1A 3APCA 3B7UX 4E85A 4UI9C 5FJYA 4HXIA 4NURA 2DIWA 3ZYQA 4EZJA 5ENNA 2XQ0A 1YA0A 2X6FA 2X38A 3O48A 2YINA 5LFAA 2UWJG 1HE8A 2MOWA 3S7FA 1N52A 2V5FA 4RG9A 3L22A 2CHWA 2JEKA 3MGBA 1QNFA 4WAFA 4GYWA 1HH8A 2L9BA 3OXFA 2WXKA 2YHEA 2AVPA 2HYZA 1KT1A 3D9KA 2XCBA 4NRHB 5EX0A 2IF4A 3CVLA 4DK5A 4CEMA 3CVWA 1VDYA 1HS6A 4I43A 2KATA 4Y6WA 3L16A 2HR2A 4AXHA 1WY6A 3Q49B 4I6JA 3GZ2A 2PQRA 2A4ZA 3ONKA 2X6KA 3PUJA 4N39A 3ZW3A 3S7BA 4AV7A 3N71A 3LS8A 3IHVA 3P2BA 3ASHA 2KCLA 5FZSA 4IN3B 3FTXA 1JPLA 2YQ8A 4KMOA 4FA6A 4GCNA 1MQSA 5EX3A 5E75A 3SHFA 4GU5A 4LCTA 2FEZA 4IULA 1HO8A 4MRUA 4AP2A 4XKBA 4PS3A 2FULA 4XI9A 5JJ6A 3MKQB 3BEEA 1E90A 1H2TC 3ZFWA 1OWOA 4CCAA 4BSXA 4UQYA 2VTBB 2OV8A 1N54A 2XPZA 3ZXSA 2AWIA 2AXZA 4EZKA 3CIAA 1P5QA 5AJLA 2CG2A 5G05C 2VGYA 3FH8A 3CQGB 4M3OA 3LVRE 2RG8A 3KAEA 5KCMA 1QQEA 2FF4A 1HG5A 4JHRA 4ACLA 4CT0A 2IOLA 4A3TA 4L2LA 2IU1A 3CSFA 4J8DA 3NQPA 4UWHA 3SD5A 4I1OB 1LF8A 4IYPA 3ZEFA 3L17A 1E96B 5JJTA 1TJFA 3ZHEA 5LCWJ 3U4TA 2VSOE 5M72A 5C1DA 2WXHA 3R7QA 3TJPA 3D9OA 4TUUA 5J90A 5G04J 2JLBA 4I2ZA 1Z3YA 2QY7A 2VQ2A 3CHOA 3JQ1A 2WXQA 3FEYA 4V3IA 5CMYA 2WMNA 3ESLA 3S7DA 5JJ7A 1JWGA 2E2EA 2GRLA 3OXLA 2WXOA 3QKYA 4J6IA 2WPVA 4DLQA 2VTBA 1FCHA 3FUEA 4A1GA 3VLDA 2KZTB 3FTWA 4UI9J 4CDMA 1KLXA 4U0ZA 4XIFA 3O4ZA 5BV0A 5CMWA 4ABNA 3LDZA 4GPKA 2WQ7A 3SBTB 3SZ7A 3FTYA 3AS5A 3G2WA 3TXMA 3AU4A 4GZ3A 1XNFA 3APFA 4I1AA 4LUNU 4ANWA 3EIQC 3PE3A 1Z3XA 2L0TB 4PDXA 5ANLA 1A17A 2ONDA 5CCMA 4A1SA 2XRYA 4EQFA 2V4LA 5EDSA 3ASGA 3GYZA 2KCKA 3B7TA 1ELKA 3ML8A 3FU0A 3HIZA 2CHXA 2XGSA 5AYWD 3SGHA 3CVXA 4LRZA 4I17A 1E8ZA 1MHQA 4B8CB 3DBSA 4KYOB 4ILHB 2KC7A 3VTXA 3FDHA 2L6JA 4GYOA 4WWNA 5FT9A 5LCWC 2XHEA 2CFUA 3FUDA 4JXTA 4AEZC 4C0EA 5KJNA 4G11A 3IHYA 4I9EA 1ZBPA 3CKCA 3CSTA 3PZDA 3RU0A 4PH4B 3MKRA 3RJVA 3LY8A 2WXFA 4BWRA 2M63A 4I6GA 3GZSA 2I6HA 3QK0A 2Y3AA 2ILRA 3ASDA 4UI9K 3UUXA 1Z6TA 1EYHA 1ELWA 1E8YA 3MJWA 3T8MA 3TL5A 2P58C 3FHEA 5C2YA 4ILIA 2DBAA 1OWNA 2WB2A 3UX4A 3CK8A 2C2LA 1HZ4A 4J8FA 3KEZA 4I9CA 4RSYA 4AY6A 3FULA 4W9RA 1EDUA 4JEHA 5G05J 2LAHA 4YVQC 2RD0A 3LCAA 3Q47B 3FUJA 4PUCA 4JEUA 4J8EA 2I9CA 4XKCA 2PM6A 4GA1A 4A3VA 3B13A 3D3MA 1SZAA 1FVFA 3QARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4B A;  2J49 A;  2NXP A; 
#chains in the Genus database with same CATH topology
 1IYG A;  4JA9 A;  3PNT B;  3FUI A;  4WNF A;  5KJK A;  5T3R A;  4U8H A;  3CR3 A;  1IXV A;  3ZPJ A;  5A23 A;  4N2Q A;  3EJN A;  1E7U A;  2QYJ A;  3ZU7 B;  2PM7 A;  3DPD A;  2GRN B;  1V55 E;  4HRN A;  1H2U A;  3KS2 A;  3TAX A;  5KNG A;  3HHM A;  2B0O E;  4WNG A;  2XRZ A;  4OVV A;  3S7J A;  4CT4 A;  1IQR A;  2QC9 A;  4ZHB A;  4WWP A;  4C9B B;  3CVU A;  2V8S E;  4H7X A;  4L2Y A;  4HOU A;  5BT1 A;  2VSY A;  2RFM A;  3HXF A;  1HXI A;  3I3N A;  3QWW A;  3EHM A;  4O1O A;  2J07 A;  1RW2 A;  3EUV A;  3W9F A;  3KEA A;  2J09 A;  3Q5M A;  2J49 A;  4G1T A;  4K0R A;  3ZIM A;  3CKB A;  4N3B A;  2OVB A;  4AM9 A;  3CLJ A;  3PNL B;  5ENR D;  3UKU G;  4WND A;  2EQX A;  4J0U A;  4DLO A;  4N5C A;  2EIM E;  2X6H A;  2KXP C;  4JW1 A;  2VGX A;  1UN8 A;  2VJ8 A;  3J5Q B;  3PRE A;  4FUL A;  3C3Q A;  2DWZ A;  3SBS A;  2VSX E;  2V5Q C;  3NOC D;  3RRM B;  3L54 A;  3RIB A;  5T4Y A;  4UWL A;  3D9N A;  1V54 E;  2V0P A;  4UUC A;  4GA2 A;  4HOR A;  2Y4T A;  1BPO A;  1ELR A;  1YYH A;  1E8W A;  3R7R A;  3AG2 E;  4GZD A;  4HB5 A;  4FP7 A;  3MV3 B;  4MS6 A;  1D9S A;  3QWV A;  4AJW A;  5HKP A;  4N2S A;  1TN6 A;  4GTS A;  1IQU A;  2NSZ A;  2J4B A;  2BTD A;  3SNX A;  3UT4 A;  2X6J A;  3LJN A;  4KT6 B;  5B3S E;  1H6O A;  2WXL A;  2ZGG A;  3JUE A;  4JVS A;  3ZKJ A;  2Y69 E;  3RSE G;  3CHR A;  5AJD A;  1NI1 A;  2EIK E;  4G2V A;  2KM4 A;  3CVQ A;  4M7C A;  4XE0 A;  2VGX B;  3NOG D;  3D9I A;  2CG3 A;  3RO3 A;  3URZ A;  2GRQ B;  1TJC A;  5ARG A;  1LD7 A;  1JUQ A;  1WM5 A;  4DI4 A;  4BX8 A;  4FLB A;  4AIF A;  1OCO E;  4ANV A;  3CV0 A;  3QAQ A;  2WXG A;  3L13 A;  2HO1 A;  4B94 A;  5A7D B;  3NZU A;  1L5J A;  1EPU A;  5D2M C;  4EZL A;  4A63 B;  3V2X A;  1IHG A;  4U0U A;  3PS6 A;  3PEV B;  1N0Q A;  2J8S D;  5AEN A;  3ZVV A;  1HU3 A;  2NXP A;  3PZ3 A;  5FZR A;  5FWQ A;  5G04 C;  2WXN A;  5FZQ A;  5CBO A;  1WG0 A;  4GZ5 A;  4NUR A;  2DIW A;  5LFA A;  1TNB A;  2V5F A;  2JEK A;  1HH8 A;  2IY0 C;  3E30 A;  2WXK A;  2AVP A;  1KT1 A;  4NRH B;  4GTO A;  2IF4 A;  3CVL A;  2LXM A;  1VDY A;  5ENS D;  2DYR E;  2KAT A;  4AXH A;  4I43 A;  4Y6W A;  1WY6 A;  4I6J A;  4N39 A;  3ONK A;  2X6K A;  3PUJ A;  3N71 A;  3IHV A;  4JB8 P;  2KCL A;  4DX5 D;  3UM1 A;  1TR4 A;  3UM2 A;  5AQ9 A;  2KBX A;  4IUL A;  3TWQ A;  3R9M A;  4XKB A;  2FUL A;  4XI9 A;  5JJ6 A;  1E90 A;  2VTB B;  2OV8 A;  5AJL A;  1QQE A;  1HG5 A;  4ACL A;  4CT0 A;  4HRM B;  2IU1 A;  3CSF A;  4J8D A;  1LF8 A;  3ZEF A;  5JJT A;  1TJF A;  2VSO E;  2F37 A;  3E34 A;  1Z3Y A;  2VQ2 A;  4G8L A;  1SA5 A;  3E37 A;  1FCH A;  3FUE A;  1TN8 A;  3FTW A;  1KLX A;  4U0Z A;  4XIF A;  5BV0 A;  3V31 A;  5CRV A;  1X81 A;  3G2W A;  3F6Q A;  4GZ3 A;  4ANW A;  1Z3X A;  2F0Y A;  3C3O A;  5ANL A;  1A17 A;  3AG1 E;  1ELK A;  4I17 A;  1MHQ A;  2EIN E;  3DBS A;  4ILH B;  2KC7 A;  5FT9 A;  3FUD A;  4C0E A;  4O60 A;  3CKC A;  3RJV A;  2OEW A;  5KWD A;  4BWR A;  2M63 A;  3T8K A;  3GZS A;  2I6H A;  4UI9 K;  2Y3A A;  2ILR A;  1EYH A;  1ELW A;  3TL5 A;  3Q78 A;  3UIN C;  5CED B;  2P58 C;  4GTV A;  4ILI A;  1OWN A;  2C2L A;  1HZ4 A;  4YDE A;  3UIP C;  1Q2Z A;  4C48 B;  4W9R A;  4JEH A;  2IEJ A;  2H6H A;  3LCA A;  2ZIS A;  3FUJ A;  4J8E A;  5IY5 E;  4B8A A;  1SZA A;  1TYQ G;  4J8S A;  4JZY A;  5JA4 D;  1B89 A;  2FI7 A;  3IBE A;  3LVQ E;  1UW4 B;  2YNQ A;  4G25 A;  3V79 K;  4LNG A;  2P9N G;  3PZ4 A;  4GTM A;  5LX8 A;  4AOF A;  4JL0 A;  2P9K G;  4L1B A;  1SZ9 A;  3SY2 A;  3OAW A;  4GMJ A;  5LOZ A;  5ENO D;  2XEV A;  1U2V G;  5HQ8 A;  4AVX A;  4EBA A;  2PQN A;  3NF1 A;  3CHP A;  2H6F A;  2CHZ A;  4JHK A;  3CVY A;  4ATZ D;  3U3W A;  4KVM A;  4FU3 A;  1Y8M A;  3IKO B;  2R03 A;  3CK9 A;  4L7T A;  4XI0 A;  1H2V C;  2KCV A;  3HVE A;  4U07 A;  4EPZ A;  3CHQ A;  2OVF A;  4FJY A;  4TV3 A;  2IOS A;  3RRN B;  4HOQ A;  3PRZ A;  5BW8 C;  3DEO A;  3TWR A;  2JAB A;  4YDW A;  4HLL A;  2IQC A;  5CHE E;  2RFA A;  1DNP A;  2GRM A;  3UXG A;  4BFR A;  4I1M A;  4GA0 A;  1NZN A;  3FH5 A;  4N3A A;  3ML9 A;  3FTS A;  3QNK A;  1OY3 D;  3LKU A;  5ENT D;  3LXU X;  3R9A B;  5FQ6 A;  1O1R A;  3DPY A;  3FU3 A;  4CRW A;  4NQ0 A;  3CVV A;  4RQI A;  3VTY A;  4TXQ A;  2J9Q A;  3OTN A;  3D9P A;  4YVO A;  2R59 A;  2WQ6 A;  3C3R A;  2PL2 A;  3PDN A;  1FPP A;  3B7B A;  3LPZ A;  4I2W A;  2L0I A;  4RLY A;  2Y1L E;  4Q96 A;  2Y4U A;  1S0P A;  2X6I A;  4HVB A;  4F1P A;  2QFC A;  1N9A A;  2LAI A;  2I1K A;  3HVE B;  3FUK A;  1BI7 B;  1HG2 A;  4WUY A;  2AJA A;  2WM9 A;  3ULY A;  4TXR A;  3SF4 A;  2P9S G;  4WWO A;  1D8D A;  1JCS A;  3FTZ A;  3I4R B;  3MEK A;  2MHK A;  2DCP A;  3EDT B;  3G2V A;  1MX2 A;  3UQ3 A;  3QJZ A;  4K5B A;  1NL4 A;  4TRQ A;  2B6C A;  5AN8 A;  3UT8 A;  2E0I A;  3DSU A;  3B7R L;  3TG4 A;  1HX8 A;  2P9L G;  2R17 C;  3GZ1 A;  5AQ7 A;  4U7E B;  3G2T A;  1OWP A;  3BG1 B;  3JXI A;  3SFX A;  1U3C A;  3ULQ A;  3V30 A;  1UN9 A;  1PC2 A;  1BI8 B;  3CGH A;  4CGW A;  2OOE A;  2ZU6 B;  4B0Z A;  3TWS A;  3NBN B;  3P1U A;  1PY1 A;  1BU9 A;  4L9P A;  1HFA A;  3FUN A;  4JD2 G;  1H19 A;  4LNU D;  4H7Y A;  4E6H A;  5G2N A;  5BV1 A;  4BY6 A;  3NB2 A;  3ONL A;  4U63 A;  2GW1 A;  2GRP B;  3QOU A;  4BT9 A;  3AU5 A;  5HS0 A;  4G26 A;  2WXR A;  4EBA G;  2WXM A;  1N94 A;  5T8I A;  1ZU2 A;  3APC A;  5FJY A;  1H6P A;  2XQ0 A;  2UWJ G;  2Y0B G;  1HE8 A;  2MOW A;  4LG6 A;  2CHW A;  3OXF A;  2YHE A;  2R2L A;  3D9K A;  4CZ2 D;  3CVW A;  3ABM E;  2DVW A;  3S7B A;  5FZS A;  4IN3 B;  3FTX A;  4KMO A;  3KSQ A;  2BKK B;  3SHF A;  2FEZ A;  3Q79 A;  4MRU A;  4BSX A;  1N54 A;  3HXB A;  2AWI A;  4U96 D;  2AXZ A;  4EZK A;  1P5Q A;  5G05 C;  2RG8 A;  3KAE A;  2IOL A;  4L2L A;  3NQP A;  3W9G A;  4QQI A;  1E96 B;  3ZHE A;  5C1D A;  3D9O A;  4TUU A;  2JLB A;  4TUM A;  5CMY A;  4I2Z A;  2QY7 A;  3ESL A;  2GRL A;  3OXL A;  4K5A B;  2VTB A;  2WPV A;  1TNY A;  2XS8 A;  4A1G A;  1TNO A;  4UI9 J;  3KSL A;  3SBT B;  1A5E A;  3TXM A;  3EIQ C;  3PE3 A;  4HNA D;  3T9K A;  3DXM G;  5CCM A;  3JXJ A;  5EDS A;  3ASG A;  3GYZ A;  2KCK A;  3ML8 A;  2ZGD A;  3HIZ A;  5AAO A;  4B8C B;  3FDH A;  2L6J A;  4GYO A;  5LCW C;  4JXT A;  1MZC A;  1IKN D;  4I9E A;  1ZBP A;  4PH4 B;  3LY8 A;  3QK0 A;  3UUX A;  1Z6T A;  3X2Q E;  5C2Y A;  5ENQ D;  2WB2 A;  4J8F A;  3KEZ A;  4I9C A;  3FUL A;  2LAH A;  1OCR E;  4YVQ C;  3ISM C;  4JEU A;  5CRU A;  2I9C A;  2PM6 A;  4GA1 A;  4A3V A;  3B13 A;  2XEE A;  4N3C A;  1FVH A;  1PAQ A;  3SO8 A;  4GCO A;  4ME2 A;  3TWV A;  4ILG A;  5ITZ F;  1K1B A;  4U8V D;  3BG0 B;  4FHJ A;  3ZHE B;  4DPR A;  3SQV A;  5E76 A;  4DX1 A;  2AW6 A;  1SVX A;  3TWX A;  2J08 A;  2X3M A;  5FIO A;  1NFI E;  1Y6I A;  2IO2 C;  1LD8 A;  3HRA A;  2BUG A;  2FO7 A;  2WVI A;  3PH0 C;  3EHR A;  2MRI A;  4FLH A;  3IV0 A;  5FQ4 A;  4HBD A;  3I5P A;  4IRU A;  5CER B;  3Q7F A;  1K3Z D;  3AS4 A;  2VSN A;  4P29 A;  4ANU A;  2ION A;  4MLP A;  4AY5 A;  2AXU A;  1MJ0 A;  1O1T A;  2AXV A;  4ACK A;  3ASF A;  2F8Y A;  3CVP A;  3MYV A;  4GTT A;  2ZIR A;  4HS2 A;  5BUZ A;  4G23 A;  3QC1 A;  2WXP A;  3FUF A;  5DBK A;  3RRU A;  1O1S A;  4GB9 A;  4BET A;  3L82 A;  4FJZ A;  3ZN3 A;  3ZGQ A;  3CVN A;  5D0O D;  3SI5 A;  4APO A;  3K9I A;  1XGW A;  2CFZ A;  1YCS B;  4JA7 A;  1NP7 A;  1UOH A;  4KBQ A;  4BSZ B;  3RAU A;  4HQD A;  1OCZ E;  4G8K A;  5EID A;  5HRY A;  5HI7 A;  4J8Y A;  4PS8 A;  2H6I A;  1BLX B;  2L6B A;  3LEW A;  3E4B A;  5LP0 A;  4HLE A;  4APF A;  4Q69 A;  2ETB A;  4I6E A;  2C0M A;  2WXJ A;  3TG5 A;  3FTV A;  1MYO A;  2A5U A;  5FQ8 A;  5D0Q D;  3JYS A;  2XCC A;  3CK7 A;  5EYL A;  5CEA A;  4U0S A;  4O6F A;  3ZRH A;  3PZ2 A;  2PNN A;  3LY7 A;  4C0M A;  3PE4 A;  3RO2 A;  3D9L A;  3MA5 A;  2VYI A;  4GTR A;  2DZN A;  2XGO A;  2I2O A;  1E8X A;  2GRR B;  3Q4A B;  1N4Q A;  3ASO E;  3DSV A;  4KZ0 A;  1GW6 A;  1WAO 1;  4K5C A;  3LYA A;  4HFG A;  4DJA A;  3T5X A;  5CCL A;  2DZO A;  4OAU C;  4URK A;  4MKT A;  5EIB E;  5JHA A;  5ARF A;  5H7P A;  1S63 A;  4XZ4 A;  2XEN A;  3JUI A;  1DVP A;  3DSX A;  4NIK A;  3FH7 A;  5A6C A;  2J4D A;  2MYO A;  3D9J A;  4F53 A;  1KT0 A;  4ATG A;  4F3V A;  4B89 A;  3CEQ A;  3FUM A;  4CDN A;  3U66 A;  3FU6 A;  1JWF A;  5B1B E;  1UG3 A;  4BT8 A;  1S70 B;  3J5P A;  1DCE A;  1WDY A;  3EIJ A;  1IHB A;  2FBN A;  4Q94 A;  3MKQ A;  4F6R D;  4A55 A;  2UY1 B;  4XX5 A;  2LUH A;  2OEV A;  3EU9 A;  3U64 A;  3MZL B;  3L6A A;  4FHK A;  3IXE A;  4U04 A;  1OXJ A;  1H6K A;  3SFZ A;  3AAA C;  3PZ1 A;  2XGM A;  1W3B A;  3AG4 E;  2P9P G;  1N0R A;  5EYP F;  3AS8 A;  3CHM A;  3S2A A;  1SA4 A;  1KZP A;  2Q7F A;  1H0A A;  3D9M A;  4YDY A;  4E85 A;  3ZNG A;  4HXI A;  2ZXW E;  1DCQ A;  1KPS B;  3ZYQ A;  4EZJ A;  5ENN A;  4MBG A;  1YA0 A;  3O48 A;  2X38 A;  3S7F A;  4RG9 A;  2OCC E;  3MGB A;  1QNF A;  4GYW A;  5BXO A;  3DWL G;  1S64 A;  4DUI A;  3DEP A;  2XCB A;  3B95 A;  3Q49 B;  3GZ2 A;  3ZW3 A;  3P2B A;  1ZB1 A;  1K8K G;  3ASH A;  4J7W A;  2YQ8 A;  4GCN A;  4DX7 D;  1MQS A;  3ASN E;  4AP2 A;  3MKQ B;  4UQY A;  3TWU A;  5CEC B;  2CG2 A;  4M3O A;  3FH8 A;  1G3N B;  3CQG B;  4Z68 A;  3LVR E;  1YMP A;  5KCM A;  2FF4 A;  5KBA A;  1BD8 A;  3ULE G;  3L17 A;  2H6G A;  3ZXP A;  3DRA A;  4HRL A;  5LCW J;  3ABL E;  3BUA A;  2WXH A;  3R7Q A;  4ZFH A;  3TJP A;  5G04 J;  3JQ1 A;  3CHO A;  1N11 A;  2WXQ A;  4EHM A;  4V3I A;  2P2C P;  3S7D A;  5JJ7 A;  2E2E A;  3QKY A;  4J6I A;  4DLQ A;  2XZD G;  3O4Z A;  4ABN A;  3SZ7 A;  2EIL E;  4I1A A;  4LUN U;  3UI2 A;  4PDX A;  2V4L A;  3ZUV B;  3B7T A;  3AJI A;  1N4R A;  3CVX A;  4KYO B;  3SFY A;  4G11 A;  3CST A;  3RU0 A;  3PZD A;  4CYM D;  1OT8 A;  4DX2 A;  3FHE A;  3UM0 A;  3UX4 A;  3CK8 A;  4RSY A;  2RD0 A;  3Q47 B;  4HI9 A;  3I4G A;  1NA3 A;  1HF8 A;  3KD7 A;  3HG0 D;  3LJ3 A;  2QZA A;  5BPP A;  3LY9 A;  3E32 A;  2YHC A;  2XPY A;  2P9U G;  3OXG A;  3BQO A;  3HXC A;  4FAD A;  3RK6 A;  3U9W A;  2LO6 A;  3ZYM A;  5EKQ D;  2WMO A;  3G2S A;  3QWP A;  1SW6 A;  3UT7 A;  1OUV A;  4UQZ A;  4O1P A;  1TEZ A;  3UMV A;  4G24 A;  4UQX A;  4ANX A;  3V2O A;  3Q15 A;  2P9I G;  4CGV A;  5AQA A;  5D66 A;  3FWV A;  2LSU A;  4GML A;  1X5B A;  4UWG A;  4R7L A;  3ESK A;  2F8X K;  3FEX A;  4GAA A;  3G2U A;  3DXK G;  4UWF A;  3PEU B;  4YND A;  4KZC A;  2XS1 A;  2WQH A;  3HDX A;  3B7S A;  3NZS A;  1QZ2 A;  5CBN A;  2A5E A;  1TNZ A;  5DIZ A;  5J08 A;  5KJM A;  4U8Y D;  2IFU A;  4WNE A;  3EU5 A;  4L23 A;  3PVL A;  4LNB A;  1FT2 A;  3L9T A;  4JHJ A;  4HOT A;  3E33 A;  2HM8 A;  3VLE A;  2NC9 A;  2BED A;  4KXK B;  2I1J A;  3IEG A;  2IO3 C;  4K03 A;  4EEC A;  2R5S A;  4LSZ E;  4GZC A;  1OWL A;  4D10 C;  4BEP A;  3FY4 A;  5G55 A;  3VLF A;  5KJL A;  3FU5 A;  1SQM A;  4BTB A;  3T5V A;  3TWW A;  3WG7 E;  2R02 A;  4BTA A;  5ANR A;  5ENP D;  3RKV A;  3FFL A;  1NA0 A;  3JQ0 A;  3D9H A;  5B1A E;  1OCC E;  3EHN A;  2XZT G;  2ETA A;  4LER A;  4JC8 A;  3HYM B;  5BNW A;  2C0L A;  3ZYK A;  3NAW A;  4PS7 A;  2NYJ A;  2ETC A;  2PZI A;  3ABK E;  4FC8 A;  4QFV A;  3UPV A;  2LSV A;  5FQ7 A;  4NAC A;  4HI8 A;  4U95 D;  4F7A A;  2V4H C;  3ZYL A;  1UJK A;  4OVU A;  4CDR A;  3FUH A;  3MV2 B;  3TXN A;  2DYS E;  3APD A;  2R05 A;  3QDN A;  3EHQ A;  1AWC B;  4RG6 A;  2QYU A;  2XPI A;  3CQC B;  4DI3 A;  4OYS A;  3WXX A;  4HOS A;  3Q73 A;  2LXL A;  4UWK A;  3ENE A;  5FIN A;  1RZ4 A;  2FO1 E;  4GPM A;  3CHS A;  3JCK C;  1E7V A;  4Y6C A;  3FTU A;  5JMN D;  1KZO A;  4N5Q A;  5BXU A;  1OWM A;  1TNU A;  3FP3 A;  2BF0 X;  4GYY A;  3GW4 A;  1AP7 A;  4KVO A;  4GMR A;  1UJJ A;  1EF1 C;  2WXI A;  3QB2 A;  5FTP A;  1JCR A;  1U3D A;  3PUK A;  1N95 A;  3Q7A A;  2LNI A;  4RVB A;  2IJG X;  1INZ A;  5JHB A;  2HE0 A;  3BU8 A;  4LEU A;  2GGF A;  4F1S A;  3TGO A;  4JPS A;  5AIJ A;  3L08 A;  4GZ6 A;  3MX3 A;  2KZT A;  3MCX A;  3C98 A;  4YDO A;  4BX9 A;  2UY1 A;  3B7U X;  1O5M A;  4UI9 C;  1FT1 A;  1JCQ A;  2X6F A;  2YIN A;  2VGE A;  1MX4 A;  1N52 A;  1Z5S C;  1QYM A;  3L22 A;  4WAF A;  2L9B A;  4GTP A;  4TXP A;  2HYZ A;  5EN5 D;  5EX0 A;  3Q9U C;  4DK5 A;  4CEM A;  3UM3 A;  1HS6 A;  3L16 A;  2HR2 A;  3DSW A;  3C72 A;  2PQR A;  2A4Z A;  1MX6 A;  4AV7 A;  3LS8 A;  1JPL A;  4FA6 A;  5EX3 A;  5E75 A;  4GU5 A;  2GRO B;  4LCT A;  1HO8 A;  4PS3 A;  5AAR A;  3BEE A;  3ZFW A;  1H2T C;  4CCA A;  1OWO A;  1QBQ A;  2XPZ A;  4DRX E;  3ZXS A;  3CIA A;  1LTX A;  2XEH A;  2VGY A;  4XEI G;  4DX6 D;  3AG3 E;  4JHR A;  4A3T A;  3SD5 A;  4UWH A;  3UKR G;  4I1O B;  3C5R A;  4IYP A;  3U4T A;  5M72 A;  5J90 A;  3UIO C;  3TWT A;  3DST A;  3FEY A;  2WMN A;  1JWG A;  2WXO A;  3VLD A;  2KZT B;  4CDM A;  5CMW A;  5EIL A;  2BKG A;  3LDZ A;  4X8Q A;  2WQ7 A;  4GPK A;  3Q9N C;  3FTY A;  3AS5 A;  4OAV B;  3AU4 A;  1XNF A;  3APF A;  1K1A A;  2EIJ E;  2L0T B;  2OND A;  4A1S A;  2XRY A;  4BER A;  4EQF A;  5AQB A;  4BES A;  1TN7 A;  1N4P A;  3FU0 A;  5AYW D;  2CHX A;  2XGS A;  5KNH D;  3SGH A;  4LRZ A;  2RKK A;  1E8Z A;  4GTQ A;  1DC2 A;  3VTX A;  4WWN A;  2XHE A;  2CFU A;  4AEZ C;  5KJN A;  3IHY A;  3UTM A;  3MKR A;  1N4S A;  4B93 B;  2WXF A;  4I6G A;  3ASD A;  3T8M A;  1E8Y A;  3MJW A;  2DBA A;  3HXD A;  4AY6 A;  3HXE A;  5G05 J;  1EDU A;  3Q75 A;  3DSS A;  4PUC A;  4XKC A;  1D8E A;  3D3M A;  1FVF A;  3QAR A; 
#chains in the Genus database with same CATH homology
 3I4G A;  4J8S A;  1NA3 A;  1HF8 A;  4N3C A;  1FVH A;  1IYG A;  4JA9 A;  4JZY A;  1PAQ A;  3PNT B;  3KD7 A;  3FUI A;  4WNF A;  4GCO A;  4ME2 A;  4B8A A;  5T3R A;  5KJK A;  3LJ3 A;  4U8H A;  4ILG A;  3CR3 A;  5BPP A;  1B89 A;  2FI7 A;  3ZPJ A;  3LY9 A;  3IBE A;  5A23 A;  3BG0 B;  4FHJ A;  3LVQ E;  3ZHE B;  4DPR A;  2YHC A;  1UW4 B;  4N2Q A;  2XPY A;  2YNQ A;  3EJN A;  4G25 A;  1E7U A;  3OXG A;  2PM7 A;  5E76 A;  3DPD A;  2AW6 A;  1H2U A;  3KS2 A;  3TAX A;  4FAD A;  3HHM A;  3RK6 A;  3U9W A;  2J08 A;  2X3M A;  2LO6 A;  3ZYM A;  4WNG A;  2XRZ A;  1Y6I A;  5EKQ D;  4AOF A;  5LX8 A;  2WMO A;  4OVV A;  2BUG A;  2FO7 A;  2WVI A;  3G2S A;  3S7J A;  4CT4 A;  4JL0 A;  1IQR A;  3PH0 C;  3QWP A;  3UT7 A;  2MRI A;  4FLH A;  3IV0 A;  4WWP A;  1OUV A;  4L1B A;  4UQZ A;  5FQ4 A;  4C9B B;  3CVU A;  3I5P A;  4IRU A;  1TEZ A;  1SZ9 A;  4G24 A;  3UMV A;  2V8S E;  3OAW A;  4H7X A;  4L2Y A;  4HOU A;  4GMJ A;  3AS4 A;  2VSN A;  5BT1 A;  2VSY A;  4UQX A;  4ANX A;  4P29 A;  4ANU A;  5LOZ A;  2XEV A;  5HQ8 A;  1HXI A;  2ION A;  3I3N A;  4MLP A;  4AVX A;  4AY5 A;  3Q15 A;  4EBA A;  4CGV A;  2AXU A;  2PQN A;  3NF1 A;  3FWV A;  2AXV A;  2LSU A;  1X5B A;  3CHP A;  3QWW A;  3EHM A;  4GML A;  4UWG A;  2J07 A;  4R7L A;  4ACK A;  3ASF A;  3ESK A;  3CVP A;  2CHZ A;  3FEX A;  3MYV A;  4GAA A;  2J09 A;  3G2U A;  4JHK A;  3CVY A;  5BUZ A;  4HS2 A;  4UWF A;  3U3W A;  4G23 A;  3QC1 A;  4KVM A;  4FU3 A;  3PEU B;  2WXP A;  3FUF A;  4YND A;  5DBK A;  4KZC A;  3Q5M A;  1Y8M A;  3RRU A;  3IKO B;  3CK9 A;  4L7T A;  4XI0 A;  1H2V C;  2KCV A;  3HVE A;  4GB9 A;  2J49 A;  4U07 A;  2WQH A;  3HDX A;  4G1T A;  4EPZ A;  3B7S A;  3NZS A;  1QZ2 A;  3CHQ A;  2OVF A;  4FJZ A;  4FJY A;  4K0R A;  4TV3 A;  2IOS A;  3ZIM A;  3ZN3 A;  3CKB A;  4N3B A;  3ZGQ A;  3RRN B;  5DIZ A;  5J08 A;  5KJM A;  3CVN A;  4HOQ A;  5D0O D;  2OVB A;  3PRZ A;  2IFU A;  5BW8 C;  3SI5 A;  4WNE A;  4APO A;  4AM9 A;  3CLJ A;  3K9I A;  3PNL B;  3PVL A;  4L23 A;  1XGW A;  2IQC A;  5CHE E;  2CFZ A;  4WND A;  2EQX A;  1DNP A;  4JA7 A;  1NP7 A;  4KBQ A;  4J0U A;  4JHJ A;  2GRM A;  4HOT A;  2HM8 A;  4BFR A;  4I1M A;  4GA0 A;  1NZN A;  4DLO A;  3FH5 A;  4N5C A;  4N3A A;  2X6H A;  3ML9 A;  4JW1 A;  3VLE A;  2NC9 A;  2VGX A;  5HI7 A;  1UN8 A;  3FTS A;  3QNK A;  4KXK B;  4PS8 A;  2I1J A;  3IEG A;  2VJ8 A;  3LKU A;  3LEW A;  3E4B A;  3LXU X;  3PRE A;  4FUL A;  4K03 A;  4EEC A;  5LP0 A;  2R5S A;  4HLE A;  3R9A B;  4GZC A;  4APF A;  5FQ6 A;  3SBS A;  4Q69 A;  2VSX E;  1OWL A;  4D10 C;  4I6E A;  2C0M A;  3FU3 A;  4CRW A;  2WXJ A;  3TG5 A;  3FY4 A;  3RRM B;  5G55 A;  3VLF A;  3FTV A;  5KJL A;  3FU5 A;  1SQM A;  2A5U A;  4BTB A;  3L54 A;  5FQ8 A;  5D0Q D;  3JYS A;  4NQ0 A;  2XCC A;  3RIB A;  3T5V A;  3CVV A;  3VTY A;  4BTA A;  3CK7 A;  5ANR A;  3RKV A;  5T4Y A;  2J9Q A;  3FFL A;  4UWL A;  3OTN A;  1NA0 A;  3D9P A;  4U0S A;  3JQ0 A;  3D9N A;  4YVO A;  2R59 A;  2WQ6 A;  4O6F A;  2V0P A;  4GA2 A;  3ZRH A;  4HOR A;  2PL2 A;  3EHN A;  3PDN A;  3LY7 A;  2Y4T A;  1BPO A;  4LER A;  4C0M A;  1ELR A;  3PE4 A;  3RO2 A;  3D9L A;  1E8W A;  3LPZ A;  3MA5 A;  4I2W A;  2VYI A;  4JC8 A;  3HYM B;  3R7R A;  5BNW A;  2XGO A;  2L0I A;  2C0L A;  3ZYK A;  4GZD A;  2I2O A;  1E8X A;  2Y4U A;  4Q96 A;  3Q4A B;  4FP7 A;  3MV3 B;  1S0P A;  2X6I A;  4MS6 A;  4PS7 A;  4KZ0 A;  4HVB A;  3QWV A;  1GW6 A;  2PZI A;  4FC8 A;  1WAO 1;  3LYA A;  4QFV A;  4AJW A;  4N2S A;  4HFG A;  4DJA A;  3UPV A;  3T5X A;  2LSV A;  5CCL A;  1IQU A;  2NSZ A;  2J4B A;  2QFC A;  5FQ7 A;  4NAC A;  2LAI A;  2I1K A;  3HVE B;  4URK A;  4MKT A;  2BTD A;  5JHA A;  5ARF A;  3SNX A;  4F7A A;  3ZYL A;  3FUK A;  3UT4 A;  1UJK A;  4OVU A;  4CDR A;  1HG2 A;  3FUH A;  2X6J A;  4WUY A;  2WM9 A;  3MV2 B;  3TXN A;  4KT6 B;  3SF4 A;  3APD A;  3QDN A;  4WWO A;  3FTZ A;  4XZ4 A;  3I4R B;  4RG6 A;  3MEK A;  2MHK A;  3JUI A;  2WXL A;  2XPI A;  1DVP A;  2DCP A;  3EDT B;  3G2V A;  4JVS A;  3CQC B;  4DI3 A;  3UQ3 A;  4OYS A;  3WXX A;  4HOS A;  3QJZ A;  4TRQ A;  3CHR A;  4UWK A;  5AJD A;  3ENE A;  3UT8 A;  3FH7 A;  5A6C A;  2J4D A;  4G2V A;  2KM4 A;  2E0I A;  3D9J A;  4F53 A;  1KT0 A;  3CVQ A;  4XE0 A;  4ATG A;  3B7R L;  2VGX B;  3TG4 A;  1HX8 A;  4F3V A;  3CHS A;  3D9I A;  4B89 A;  3JCK C;  3CEQ A;  1E7V A;  2CG3 A;  3FUM A;  4CDN A;  4Y6C A;  3U66 A;  3FU6 A;  2R17 C;  3FTU A;  1JWF A;  3GZ1 A;  1UG3 A;  4BT8 A;  3RO3 A;  3URZ A;  1OWM A;  3EIJ A;  1OWP A;  3G2T A;  1TJC A;  5ARG A;  3BG1 B;  3FP3 A;  1U3C A;  3ULQ A;  1JUQ A;  1WM5 A;  1UN9 A;  1PC2 A;  2FBN A;  4Q94 A;  4DI4 A;  2BF0 X;  3MKQ A;  4GYY A;  3GW4 A;  3CGH A;  4BX8 A;  4CGW A;  2OOE A;  2ZU6 B;  4FLB A;  4AIF A;  4B0Z A;  4ANV A;  4KVO A;  3P1U A;  1UJJ A;  3CV0 A;  3QAQ A;  4A55 A;  1PY1 A;  2WXG A;  1EF1 C;  2UY1 B;  3L13 A;  1HFA A;  2WXI A;  3FUN A;  3QB2 A;  4XX5 A;  1H19 A;  2HO1 A;  5FTP A;  4H7Y A;  4B94 A;  5A7D B;  4E6H A;  3U64 A;  5G2N A;  3NZU A;  1L5J A;  3MZL B;  1EPU A;  5BV1 A;  1U3D A;  3L6A A;  3PUK A;  4FHK A;  4EZL A;  4U04 A;  4BY6 A;  2LNI A;  4RVB A;  1IHG A;  4U0U A;  1H6K A;  2IJG X;  3SFZ A;  3PS6 A;  3ONL A;  3PEV B;  1INZ A;  4U63 A;  2GW1 A;  2XGM A;  1W3B A;  5JHB A;  3QOU A;  4LEU A;  4BT9 A;  2GGF A;  5AEN A;  3AU5 A;  4F1S A;  3ZVV A;  3TGO A;  3AS8 A;  4JPS A;  4G26 A;  1HU3 A;  2NXP A;  5AIJ A;  5FZR A;  5FWQ A;  3L08 A;  2WXR A;  4GZ6 A;  3MX3 A;  3CHM A;  2KZT A;  2WXN A;  3MCX A;  5FZQ A;  3C98 A;  5G04 C;  3S2A A;  2WXM A;  4EBA G;  2Q7F A;  5T8I A;  1H0A A;  3D9M A;  1ZU2 A;  4BX9 A;  4GZ5 A;  2UY1 A;  3APC A;  3B7U X;  4E85 A;  4UI9 C;  5FJY A;  4HXI A;  4NUR A;  2DIW A;  3ZYQ A;  4EZJ A;  5ENN A;  2XQ0 A;  1YA0 A;  2X6F A;  2X38 A;  3O48 A;  2YIN A;  5LFA A;  2UWJ G;  1HE8 A;  2MOW A;  3S7F A;  1N52 A;  2V5F A;  4RG9 A;  3L22 A;  2CHW A;  2JEK A;  3MGB A;  1QNF A;  4WAF A;  4GYW A;  1HH8 A;  2L9B A;  3OXF A;  2WXK A;  2YHE A;  2AVP A;  2HYZ A;  1KT1 A;  3D9K A;  2XCB A;  4NRH B;  5EX0 A;  2IF4 A;  3CVL A;  4DK5 A;  4CEM A;  3CVW A;  1VDY A;  1HS6 A;  4I43 A;  2KAT A;  4Y6W A;  3L16 A;  2HR2 A;  4AXH A;  1WY6 A;  3Q49 B;  4I6J A;  3GZ2 A;  2PQR A;  2A4Z A;  3ONK A;  2X6K A;  3PUJ A;  4N39 A;  3ZW3 A;  3S7B A;  4AV7 A;  3N71 A;  3LS8 A;  3IHV A;  3P2B A;  3ASH A;  2KCL A;  5FZS A;  4IN3 B;  3FTX A;  1JPL A;  2YQ8 A;  4KMO A;  4FA6 A;  4GCN A;  1MQS A;  5EX3 A;  5E75 A;  3SHF A;  4GU5 A;  4LCT A;  2FEZ A;  4IUL A;  1HO8 A;  4MRU A;  4AP2 A;  4XKB A;  4PS3 A;  2FUL A;  4XI9 A;  5JJ6 A;  3MKQ B;  3BEE A;  1E90 A;  1H2T C;  3ZFW A;  1OWO A;  4CCA A;  4BSX A;  4UQY A;  2VTB B;  2OV8 A;  1N54 A;  2XPZ A;  3ZXS A;  2AWI A;  2AXZ A;  4EZK A;  3CIA A;  1P5Q A;  5AJL A;  2CG2 A;  5G05 C;  2VGY A;  3FH8 A;  3CQG B;  4M3O A;  3LVR E;  2RG8 A;  3KAE A;  5KCM A;  1QQE A;  2FF4 A;  1HG5 A;  4JHR A;  4ACL A;  4CT0 A;  2IOL A;  4A3T A;  4L2L A;  2IU1 A;  3CSF A;  4J8D A;  3NQP A;  4UWH A;  3SD5 A;  4I1O B;  1LF8 A;  4IYP A;  3ZEF A;  3L17 A;  1E96 B;  5JJT A;  1TJF A;  3ZHE A;  5LCW J;  3U4T A;  2VSO E;  5M72 A;  5C1D A;  2WXH A;  3R7Q A;  3TJP A;  3D9O A;  4TUU A;  5J90 A;  5G04 J;  2JLB A;  4I2Z A;  1Z3Y A;  2QY7 A;  2VQ2 A;  3CHO A;  3JQ1 A;  2WXQ A;  3FEY A;  4V3I A;  5CMY A;  2WMN A;  3ESL A;  3S7D A;  5JJ7 A;  1JWG A;  2E2E A;  2GRL A;  3OXL A;  2WXO A;  3QKY A;  4J6I A;  2WPV A;  4DLQ A;  2VTB A;  1FCH A;  3FUE A;  4A1G A;  3VLD A;  2KZT B;  3FTW A;  4UI9 J;  4CDM A;  1KLX A;  4U0Z A;  4XIF A;  3O4Z A;  5BV0 A;  5CMW A;  4ABN A;  3LDZ A;  4GPK A;  2WQ7 A;  3SBT B;  3SZ7 A;  3FTY A;  3AS5 A;  3G2W A;  3TXM A;  3AU4 A;  4GZ3 A;  1XNF A;  3APF A;  4I1A A;  4LUN U;  4ANW A;  3EIQ C;  3PE3 A;  1Z3X A;  2L0T B;  4PDX A;  5ANL A;  1A17 A;  2OND A;  5CCM A;  4A1S A;  2XRY A;  4EQF A;  2V4L A;  5EDS A;  3ASG A;  3GYZ A;  2KCK A;  3B7T A;  1ELK A;  3ML8 A;  3FU0 A;  3HIZ A;  2CHX A;  2XGS A;  5AYW D;  3SGH A;  3CVX A;  4LRZ A;  4I17 A;  1E8Z A;  1MHQ A;  4B8C B;  3DBS A;  4KYO B;  4ILH B;  2KC7 A;  3VTX A;  3FDH A;  2L6J A;  4GYO A;  4WWN A;  5FT9 A;  5LCW C;  2XHE A;  2CFU A;  3FUD A;  4JXT A;  4AEZ C;  4C0E A;  5KJN A;  4G11 A;  3IHY A;  4I9E A;  1ZBP A;  3CKC A;  3CST A;  3PZD A;  3RU0 A;  4PH4 B;  3MKR A;  3RJV A;  3LY8 A;  2WXF A;  4BWR A;  2M63 A;  4I6G A;  3GZS A;  2I6H A;  3QK0 A;  2Y3A A;  2ILR A;  3ASD A;  4UI9 K;  3UUX A;  1Z6T A;  1EYH A;  1ELW A;  1E8Y A;  3MJW A;  3T8M A;  3TL5 A;  2P58 C;  3FHE A;  5C2Y A;  4ILI A;  2DBA A;  1OWN A;  2WB2 A;  3UX4 A;  3CK8 A;  2C2L A;  1HZ4 A;  4J8F A;  3KEZ A;  4I9C A;  4RSY A;  4AY6 A;  3FUL A;  4W9R A;  1EDU A;  4JEH A;  5G05 J;  2LAH A;  4YVQ C;  2RD0 A;  3LCA A;  3Q47 B;  3FUJ A;  4PUC A;  4JEU A;  4J8E A;  2I9C A;  4XKC A;  2PM6 A;  4GA1 A;  4A3V A;  3B13 A;  3D3M A;  1SZA A;  1FVF A;  3QAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...