3V2OA

Crystal structure of the peptide bound complex of the ankyrin repeat domains of human ankra2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
LSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ankyrin repeat family A protein 2
total genus 50
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3v2oA00
3KEAA 1N0QA 4NIKA 1UOHA 2XZDG 3HRAA 3NOGD 3B7BA 4HQDA 4BEPA 3Q9NC 4N5QA 1S70B 3D9HA 3UTMA 4ZHBA 2PNNA 1MX6A 4HLLA 5AQ9A 3LJNA 2ZGDA 4DX2A 3TWRA 4TUMA 5KNGA 2XEEA 4U96D 1BI8B 3SO8A 3TWTA 4YDYA 5ENSD 5KBAA 1YMPA 2ETBA 4LNUD 3TWSA 4K5BA 5ENTD 1DC2A 3B95A 2RFMA 2QC9A 5AN8A 4O1PA 3V2OA 3ZUVB 5FINA 4CYMD 5CBNA 2VGEA 4HB5A 4OAUC 5EIBE 4DRXE 5AQAA 3NBNB 2L6BA 4BERA 4UUCA 2FO1E 3J5PA 3F6QA 5EYPF 3T9KA 2J8SD 5JMND 1AWCB 4ZFHA 1N11A 2HE0A 3ZKJA 5D66A 3V31A 2RFAA 4HNAD 4HRMB 4BESA 2QYJA 1IXVA 5KWDA 2ETCA 1BLXB 2KXPC 3ZNGA 4GMRA 1WG0A 2DZOA 2Y1LE 1BI7B 4HI9A 5FIOA 3AAAC 5EIDA 3EU9A 5ENPD 5CECB 4LG6A 1MJ0A 3UXGA 4DX5D 1IKND 3V2XA 5EILA 2DVWA 1YCSB 2P2CP 2XEHA 1MYOA 3Q9UC 4J8YA 1YYHA 4O60A 3HG0D 4JB8P 3T8KA 5AAOA 3J5QB 3TWQA 2F8XK 5HKPA 2KBXA 4HI8A 1MX2A 2B0OE 3JXIA 5AQBA 1SVXA 1BU9A 4O1OA 2JABA 3C5RA 3V30A 1AP7A 2V5QC 4HRLA 1NFIE 4DX7D 4GPMA 3ZU7B 1OT8A 5BXUA 3TWVA 2BKKB 2NYJA 4RLYA 5JA4D 1D9SA 3DEOA 3EHQA 3NOCD 1K1AA 2ETAA 5EYLA 5CEAA 5ENQD 1MX4A 4J7WA 2Y0BG 1A5EA 2AJAA 5AARA 5BXOA 1OY3D 3TWWA 4QQIA 5KNHD 4BSZB 2A5EA 3DEPA 2MYOA 3JUEA 2V4HC 1BD8A 2DZNA 4QFVA 4DUIA 1N0RA 4G8LA 5CBOA 1K1BA 4HBDA 4DX6D 1K3ZD 1G3NB 4Z68A 4K5CA 5CERB 3EHRA 4U8VD 2XENA 5ENOD 4CZ2D 1DCQA 5CEDB 4OAVB 4K5AB 3V79K 5HS0A 4A63B 4LSZE 5EN5D 2ZGGA 5ITZF 3IXEA 1QYMA 3W9FA 2XZTG 4C48B 4ATZD 4B93B 4U8YD 2F8YA 3TWUA 3TWXA 1IHBA 1SW6A 1WDYA 3UI2A 4U95D 4YDWA 5AQ7A 4F6RD 5ENRD 2BKGA 4BETA 4HRNA 5HRYA 4G8KA 4F1PA 3W9GA 3AJIA 3JXJA 1TR4A 4DX1A 2F37A 2DWZA
chains in the Genus database with same CATH superfamily
4XI9A 3KEAA 3ZHEA 2I2OA 3VLEA 3MGBA 4ATGA 4EQFA 2FO7A 2KC7A 2IFUA 2AW6A 2J08A 2QY7A 3FTXA 4PS3A 3HDXA 3HXBA 3B95A 3V2OA 4CT0A 4BERA 2PQNA 4TUUA 5D66A 1NP7A 4H7XA 2GRPB 3CVNA 3ESLA 3E33A 2HYZA 3ZW3A 1YYHA 3UX4A 1SZ9A 2F8XK 1PY1A 5HKPA 2B0OE 3JXIA 3CK8A 4O1OA 5KJLA 3SBTB 4V3IA 3GW4A 3VLDA 5LOZA 3SFYA 3ZFWA 2P9NG 3ONLA 4GCOA 3N71A 3AG3E 3UM1A 4TXQA 1MX4A 2VSNA 3MJWA 3JUEA 3L9TA 3CVWA 4QFVA 1X81A 4J8DA 4G1TA 1DCQA 4LNGA 3QAQA 3V79K 3PZ2A 3SFXA 4OVVA 2XQ0A 2X6IA 3T5XA 1JUQA 3O48A 2UY1A 3FUKA 1TNUA 3GZ2A 4DX1A 4HVBA 4ILHB 3UQ3A 4N39A 4N5QA 1S70B 4WNDA 1ZB1A 3OXLA 4U0ZA 4PDXA 4I17A 4YVQC 3HVEB 5ENTD 2ZIRA 2Q7FA 3MV2B 4HB5A 2KZTA 2LXLA 2KCKA 1H6OA 3F6QA 2HM8A 3FUEA 3DSWA 1BLXB 5FZSA 3ZNGA 2UY1B 4LG6A 5KJKA 3HHMA 2XEHA 3E32A 2IF4A 3L6AA 3T8MA 5KCMA 3UM0A 4U0UA 4A3TA 1Q2ZA 4A1GA 2IOSA 3Q73A 2EIKE 4LRZA 2KM4A 2X3MA 2CFUA 4N3CA 4J7WA 1N4PA 3RK6A 3AG1E 4B8AA 4UI9J 3D9LA 1QNFA 3FP3A 1E8WA 3MEKA 2FF4A 3L54A 3ULQA 3TGOA 3URZA 3EHRA 2XS8A 2AXUA 5HS0A 3MA5A 2XZTG 4TXRA 2UWJG 1HFAA 4HORA 4JHJA 5CHEE 4GYYA 3P2BA 1WY6A 3KAEA 2OVFA 4C9BB 4AXHA 4E85A 4FLHA 2KCLA 2IO2C 2L0IA 2WPVA 4HQDA 3UTMA 1TJCA 1UG3A 2DBAA 2GRQB 4U96D 4AJWA 3NQPA 3B7UX 2MOWA 3EIQC 4HOQA 2VJ8A 2VSXE 1Y6IA 4I9EA 3FH5A 3EIJA 3MCXA 4BX9A 2LO6A 4HRMB 1SA5A 1IXVA 2ETCA 3DPYA 1KPSB 2XPYA 3TG4A 5FIOA 2H6FA 3PZ3A 3JYSA 2P2CP 4Q96A 3PH0C 5AAOA 5FT9A 3SFZA 1E8XA 1FT1A 2EINE 4G11A 3D3MA 2CHZA 2P9KG 1U3DA 1QQEA 4JEHA 3UT4A 4I6EA 4APFA 3CR3A 1NZNA 3SZ7A 5ENQD 4TXPA 3ASGA 4HLEA 3TAXA 3PEUB 4NACA 5FQ6A 5CMYA 4KZCA 4XZ4A 3CKBA 4MRUA 3LVQE 5FQ7A 1OWNA 2P9UG 4N2SA 4RVBA 2WXRA 3RAUA 5FWQA 3Q4AB 4B93B 4UI9C 1PC2A 3MV3B 5J08A 3FHEA 4G8KA 3LPZA 2L9BA 3ZIMA 3TL5A 2WB2A 1UOHA 2XZDG 4XE0A 2I1JA 3NOGD 3CVUA 3EHNA 2FBNA 3RSEG 2YHCA 1DC2A 2H6IA 3CVPA 4GA1A 1KT0A 3LDZA 3T5VA 4GA0A 1H6KA 2LAIA 4JHKA 2CFZA 3UM2A 1BI7B 1TN6A 3EU9A 4AM9A 3ONKA 3CV0A 2IO3C 4OYSA 1SZAA 3V30A 1UN8A 3FU6A 4CDMA 4U8HA 4DI3A 3DEOA 2V4LA 4B89A 1H2UA 3LKUA 1OY3D 3SI5A 1O1SA 5G2NA 2V4HC 1ZBPA 2C0MA 2XENA 4CZ2D 4XX5A 3P1UA 5BPPA 2X6HA 4LSZE 2DYSE 4NURA 1QYMA 3TJPA 2F8YA 4BY6A 3TWXA 4U07A 4YDWA 5B3SE 2KCVA 2PM7A 2OEWA 4FLBA 5FTPA 2XGMA 4NIKA 5EX0A 2J9QA 2GRMA 2CG3A 3S7JA 4DX2A 4JW1A 2XEEA 2KZTB 4AIFA 4LNUD 3PDNA 1IHGA 1NA0A 4OVUA 5EIBE 3UIPC 4C0EA 2FO1E 4UUCA 3RJVA 3DPDA 2DCPA 1D8DA 1O1TA 4PH4B 2RFAA 2CG2A 3Q78A 3MKQB 2VGXB 1LTXA 4FULA 1PAQA 3AAAC 5LP0A 4E6HA 5H7PA 4EHMA 1MJ0A 3UINC 4JVSA 1IYGA 4P29A 1MYOA 3D9OA 3ULYA 5T4YA 4HI8A 4XKCA 3I4RB 5D0QD 4IULA 5AYWD 2R03A 3DXMG 1NI1A 3LEWA 3C3OA 3NB2A 4KZ0A 3FWVA 2DZNA 4GZ3A 4G8LA 1K1BA 2WXPA 5A23A 2FULA 4ANWA 3PREA 2L0TB 3QDNA 4URKA 3CHPA 2NC9A 1UJKA 2WXKA 5LCWJ 3Q79A 1DNPA 3AG2E 4GA2A 4WNFA 2WXFA 1DCEA 2PM6A 3ZPJA 3S7DA 4A55A 2JLBA 3Q9NC 4ME2A 3D9HA 4WWNA 3U66A 3D9IA 4HLLA 4ABNA 3QWPA 3NAWA 3ZEFA 5AN8A 3ZUVB 1E8ZA 4I6GA 1INZA 2KATA 2E2EA 3ULEG 3HXEA 3Q5MA 3CKCA 4HNAD 2QYJA 1N4SA 1Z3YA 3ENEA 5AIJA 3HXCA 3O4ZA 4PS8A 3HYMB 3OAWA 5EILA 4CEMA 3MKQA 4FJYA 2QZAA 2X6FA 2KBXA 3FTWA 3KD7A 5CCMA 3QKYA 2IQCA 4AP2A 3GZ1A 3TWVA 2BKKB 1D9SA 1XGWA 3R9MA 3KSLA 4EPZA 5AENA 1HO8A 4JHRA 5ARGA 5EYLA 3APFA 4I1OB 4ILGA 1SQMA 3CEQA 1RW2A 5BNWA 4K03A 2WVIA 3CVVA 4I9CA 3CVYA 3RRUA 4A63B 3BG0B 4C48B 4UQYA 3APDA 4EZLA 1IQUA 3IHVA 1GW6A 2WQHA 1IHBA 1SW6A 2V0PA 3E30A 3ZHEB 4F6RD 5ENRD 3MKRA 2Y69E 5HRYA 2R59A 1TR4A 5DIZA 2LXMA 5C2YA 4U04A 3ZRHA 3LJNA 2JEKA 4F7AA 2GGFA 4UWKA 3B13A 3SO8A 1YMPA 1D8EA 4BT9A 3IHYA 5FINA 3S7BA 4HFGA 2CHXA 3JQ0A 2VQ2A 3CIAA 5B1BE 3T9KA 3DWLG 1TYQG 1N11A 4A1SA 3V31A 4BESA 2AXVA 5D0OD 5JHAA 2KXPC 4N3BA 2VSYA 1HH8A 3V2XA 3PNLB 3PRZA 3LY9A 4J8EA 2MRIA 3SBSA 1HZ4A 2ZXWE 4HRLA 1NFIE 4KYOB 2BF0X 2Y4TA 5HI7A 5FQ8A 2IONA 5D2MC 5E75A 3RRMB 5BXOA 3B7RL 3FUNA 2A5EA 3U9WA 4L2YA 3FUMA 1TNZA 3FUJA 3D9PA 3CHRA 4ANUA 2XCBA 4ACLA 4J8FA 2E0IA 3R7RA 3W9FA 3E4BA 2EIJE 3AU4A 4C0MA 1WDYA 5FJYA 3ZYMA 3EHMA 2OV8A 1TEZA 4WNGA 1N0QA 5EDSA 2VYIA 2WXQA 4L7TA 1V54E 2FEZA 2YHEA 5KBAA 3TWSA 4K5BA 2C0LA 4CRWA 3KS2A 3ZYLA 4LCTA 2DIWA 4O1PA 2VGEA 1UW4B 3IV0A 3G2TA 3AS5A 4EZJA 2X6KA 2J8SD 3JUIA 2HE0A 3ZKJA 1ZU2A 3DSTA 4UQXA 3BEEA 1A17A 4DX5D 3UXGA 3FTSA 4F1SA 4I1MA 1K8KG 3RO2A 3EDTB 4TRQA 4X8QA 4AY5A 3D9KA 3D9NA 4DLOA 3Q15A 5AJLA 4J8SA 3TWWA 4GTMA 1LF8A 2R02A 2DYRE 3QB2A 4U8VD 5FZRA 1EYHA 4G2VA 3FTUA 4FP7A 3DSUA 3PZ1A 3SGHA 2WXMA 3ML8A 1TNBA 1TN7A 4DPRA 2GRNB 4YDOA 4YVOA 1LD8A 3E34A 3VTYA 2ETBA 4HOTA 5CBNA 3L22A 2PZIA 2Y3AA 4CCAA 1KZPA 3DXKG 5JMND 3VTXA 4JD2G 3UMVA 3ABME 3SY2A 3FDHA 1JCRA 3L13A 3FFLA 2DZOA 2R2LA 1ELRA 5ENPD 4AV7A 4CGWA 5EKQD 1OXJA 5FQ4A 3QJZA 5BT1A 3EU5A 3SQVA 2JABA 3UT8A 3X2QE 3ZU7B 1OT8A 5BXUA 5JA4D 4A3VA 3HVEA 4Q94A 5G04C 3NOCD 4LNBA 3JCKC 3AS8A 4J0UA 3E37A 2V5FA 2Y0BG 2WQ6A 4UWFA 5KNHD 1HE8A 3B7TA 2MYOA 2IOLA 4MBGA 3CQGB 4K5AB 4GZDA 3CHSA 2R05A 3NZSA 2WXJA 1E8YA 1N4QA 3ASFA 3FH8A 4GTVA 2YNQA 3AJIA 4MS6A 4UI9K 2R5SA 2EIME 4MKTA 1N9AA 4AY6A 1WM5A 4ZHBA 2VTBA 1UJJA 4JC8A 3TWTA 2BUGA 2QC9A 5G05J 5G05C 3ASDA 3CK7A 3CVXA 3J5PA 2GRLA 2WQ7A 3Q75A 2B6CA 2IY0C 2YINA 4DLQA 3FY4A 1N54A 2J4BA 3BQOA 3C72A 2LUHA 1IKND 4KT6B 2DVWA 3D9JA 4GCNA 4J8YA 4G23A 2OOEA 5KJNA 3FU0A 3ZGQA 4J6IA 3FTZA 3CHOA 1VDYA 4FHJA 2VTBB 3CHMA 1BU9A 2WXIA 2WXOA 3C5RA 3NZUA 2I9CA 5LX8A 3PEVB 4GAAA 3FEYA 4UQZA 2HO1A 3MX3A 3Q47B 4CDNA 5A6CA 1FT2A 5CBOA 4M3OA 1K3ZD 1HS6A 1NL4A 3FUFA 1U3CA 3TXNA 1SA4A 4I6JA 3SD5A 3LYAA 3TWUA 3FULA 4U95D 5C1DA 3OXGA 4NRHB 4O6FA 2X38A 3PZDA 4L2LA 4GTQA 4FJZA 4GZ6A 1H0AA 4WAFA 4HOSA 3KSQA 5J90A 1Z6TA 2XGOA 3TWRA 1U2VG 1BI8B 4JZYA 2QFCA 4CT4A 4BTBA 4EBAA 3QWVA 1EDUA 4G24A 3GZSA 4ZFHA 1AWCB 3L17A 4GYWA 3AG4E 3IBEA 1E90A 4HI9A 3FTVA 5EIDA 2XS1A 4LEUA 4GU5A 5CRUA 4JA7A 3QWWA 2P9PG 3PE4A 3R9AB 5T8IA 3CVLA 2OVBA 2V5QC 4BWRA 4DX7D 3ZVVA 4G25A 4BTAA 4L23A 4ANVA 3IEGA 4RG9A 1XNFA 1N94A 2WXNA 5ARFA 1P5QA 2PL2A 4NQ0A 5CERB 5ENOD 2GRRB 5BV0A 4OAVB 5EN5D 5DBKA 4ATZD 4BT8A 4U7EB 4UWLA 2F0YA 3B7SA 1EF1C 3DSVA 4HRNA 3PZ4A 4LUNU 2F37A 3RKVA 3I4GA 5KJMA 1BPOA 1JCQA 3CSFA 5KNGA 3QARA 2WM9A 5ENSD 4EECA 3U64A 1S0PA 4EZKA 4PS7A 5G55A 1ELWA 4ILIA 3DSSA 3CQCB 3MZLB 1N52A 2ZISA 3LCAA 3Q7FA 3FU3A 1HG2A 2LAHA 4N5CA 4ACKA 4GTTA 1HU3A 5JJ6A 5CECB 5CMWA 2GW1A 4IYPA 3HG0D 1OCCE 3UKUG 3ISMC 2WMOA 2XGSA 2L6JA 5BUZA 3PUKA 3L16A 1H6PA 2J49A 1MHQA 3CLJA 2EQXA 3HXFA 2ZU6B 3WG7E 4GYOA 3KEZA 1IQRA 1TNOA 2GROB 1L5JA 1BD8A 4RG6A 4H7YA 1N0RA 4DK5A 4FHKA 1G3NB 4FU3A 5CRVA 2AWIA 1QZ2A 1V55E 5JJ7A 3RO3A 1JPLA 2XEVA 4HXIA 4EBAG 5E76A 4FC8A 3WXXA 1TN8A 5G04J 5AJDA 3JXJA 3Q7AA 5B1AE 1OCRE 5JHBA 2YQ8A 2BEDA 1OWMA 4GTOA 5AQ9A 1TNYA 3CGHA 3U3WA 2RFMA 4DRXE 1WAO1 2L6BA 2J07A 4B94A 5EYPF 2XPZA 5ANRA 5KWDA 5ANLA 3G2UA 2Y1LE 4AOFA 2A4ZA 2Y4UA 4XIFA 4KVMA 4DI4A 3Q9UC 3ABKE 3T8KA 3S2AA 4L9PA 4I1AA 3ZXSA 1MX2A 3VLFA 2WXHA 1SVXA 3S7FA 4WUYA 3RRNB 3DSXA 4YNDA 2C2LA 5T3RA 3EHQA 4GTPA 4D10C 3RIBA 2AVPA 3TXMA 2P9LG 4IRUA 4QQIA 4BSZB 4GPKA 2NXPA 3SHFA 1OUVA 4BFRA 1NA3A 1FVFA 4JL0A 4N3AA 2V8SE 4KBQA 1FCHA 1H2VC 4MLPA 4WWPA 2RD0A 3GYZA 4G26A 4XKBA 4YDEA 4GB9A 1UN9A 3TG5A 4U8YD 4DJAA 5LCWC 4AEZC 1FVHA 3ASOE 3LS8A 1OCZE 1KZOA 4R7LA 2DWZA 4F3VA 1YA0A 3ZYKA 4GMJA 4BEPA 1Y8MA 1Z5SC 4GTRA 4FADA 2RKKA 2PNNA 1OWLA 1W3BA 4PUCA 3PUJA 3G2VA 3OTNA 3QNKA 1JWFA 3ABLE 4OAUC 2ONDA 5AQAA 3NBNB 2LSUA 3CHQA 3FTYA 3ESKA 3LJ3A 3G2SA 4Q69A 3HIZA 3FU5A 4HOUA 4XI0A 3CVQA 4WNEA 4I2ZA 1YCSB 3MYVA 3BG1B 2H6GA 3UM3A 3C3RA 2VSOE 2VGXA 5A7DB 4HS2A 4KXKB 4GPMA 3UUXA 3LVRE 3FH7A 1DVPA 2WXGA 2XRYA 5FZQA 1K1AA 5CEAA 2CHWA 1MQSA 4CDRA 1Z3XA 5BV1A 3ASHA 4ANXA 3DEPA 4RQIA 3CK9A 4HBDA 3L82A 4Z68A 3I5PA 1E7VA 3DBSA 1O1RA 5IY5E 2MHKA 3IKOB 3QOUA 3JQ1A 4JPSA 2M63A 3ML9A 1O5MA 3UI2A 5AQ7A 4BSXA 4KMOA 1H19A 3CSTA 2J09A 4W9RA 3B7BA 2H6HA 3G2WA 1MX6A 2P9IG 2ZGDA 4IN3B 1JCSA 3RU0A 4TUMA 4AVXA 4FA6A 4YDYA 4U63A 4BX8A 4CYMD 1HG5A 3FUHA 3UIOC 2QYUA 1QBQA 1WG0A 1KLXA 4Y6WA 2BTDA 2XPIA 1KT1A 4K0RA 2LSVA 4O60A 2IEJA 3J5QB 3TWQA 4N2QA 3LXUX 5AQBA 1AP7A 3OXFA 2NYJA 3K9IA 2HR2A 3D9MA 2ETAA 1JWGA 2P9SG 3DRAA 1S64A 5EX3A 2AJAA 3HXDA 3EJNA 3ZYQA 5JJTA 2LNIA 3AS4A 5CCLA 4GZ5A 3R7QA 4DUIA 4DX6D 4L1BA 3QK0A 3UPVA 4Y6CA 4KVOA 4K5CA 4I2WA 2IU1A 5CEDB 1HF8A 2I6HA 3UT7A 3SNXA 4M7CA 3APCA 5ITZF 4U0SA 4B0ZA 1RZ4A 2IJGX 3Q49B 1ELKA 4BETA 2BKGA 4JEUA 3W9GA 3BU8A 4GMLA 2PQRA 3FUIA 3HRAA 1H2TC 4GZCA 4APOA 3FUDA 3LY7A 2FI7A 1B89A 2R17C 1S63A 3I3NA 3C98A 2AXZA 2X6JA 1HX8A 2OCCE 3ZN3A 1E96B 3UKRG 2A5UA 1N95A 4WWOA 1TJFA 1HXIA 3LY8A 4GMRA 4I43A 2XHEA 3ASNE 3PVLA 5M72A 4JA9A 3SF4A 5HQ8A 2VGYA 4JB8P 3PE3A 1E7UA 4UWHA 3BUAA 4JXTA 2OEVA 4CGVA 3ZXPA 4XEIG 1X5BA 2J4DA 4RLYA 3PS6A 3C3QA 4LERA 3NF1A 1LD7A 1OCOE 1FPPA 3L08A 1A5EA 5AARA 5BW8C 2RG8A 3U4TA 4GTSA 2ILRA 3PNTB 4UWGA 2EILE 3QC1A 2XCCA 3AU5A 1MZCA 2I1KA 4B8CB 2ZGGA 3IXEA 3EUVA 1EPUA 1OWPA 3FEXA 2P58C 5LFAA 2WMNA 1OWOA 2NSZA 2WXLA 4RSYA 4F1PA 4F53A 2XRZA 4TV3A 5ENNA 1N4RA
chains in the Genus database with same CATH topology
3KEAA 1N0QA 4NIKA 1UOHA 2XZDG 3HRAA 3NOGD 3B7BA 4HQDA 4BEPA 3Q9NC 4N5QA 1S70B 3D9HA 3UTMA 4ZHBA 2PNNA 1MX6A 4HLLA 5AQ9A 3LJNA 2ZGDA 4DX2A 3TWRA 4TUMA 5KNGA 2XEEA 4U96D 1BI8B 3SO8A 3TWTA 4YDYA 5ENSD 5KBAA 1YMPA 2ETBA 4LNUD 3TWSA 4K5BA 5ENTD 1DC2A 3B95A 2RFMA 2QC9A 5AN8A 4O1PA 3V2OA 3ZUVB 5FINA 4CYMD 5CBNA 2VGEA 4HB5A 4OAUC 5EIBE 4DRXE 5AQAA 3NBNB 2L6BA 4BERA 4UUCA 2FO1E 3J5PA 3F6QA 5EYPF 3T9KA 2J8SD 5JMND 1AWCB 4ZFHA 1N11A 2HE0A 3ZKJA 5D66A 3V31A 2RFAA 4HNAD 4HRMB 4BESA 2QYJA 1IXVA 5KWDA 2ETCA 1BLXB 2KXPC 3ZNGA 4GMRA 1WG0A 2DZOA 2Y1LE 1BI7B 4HI9A 5FIOA 3AAAC 5EIDA 3EU9A 5ENPD 5CECB 4LG6A 1MJ0A 3UXGA 4DX5D 1IKND 3V2XA 5EILA 2DVWA 1YCSB 2P2CP 2XEHA 1MYOA 3Q9UC 4J8YA 1YYHA 4O60A 3HG0D 4JB8P 3T8KA 5AAOA 3J5QB 3TWQA 2F8XK 5HKPA 2KBXA 4HI8A 1MX2A 2B0OE 3JXIA 5AQBA 1SVXA 1BU9A 4O1OA 2JABA 3C5RA 3V30A 1AP7A 2V5QC 4HRLA 1NFIE 4DX7D 4GPMA 3ZU7B 1OT8A 5BXUA 3TWVA 2BKKB 2NYJA 4RLYA 5JA4D 1D9SA 3DEOA 3EHQA 3NOCD 1K1AA 2ETAA 5EYLA 5CEAA 5ENQD 1MX4A 4J7WA 2Y0BG 1A5EA 2AJAA 5AARA 5BXOA 1OY3D 3TWWA 4QQIA 5KNHD 4BSZB 2A5EA 3DEPA 2MYOA 3JUEA 2V4HC 1BD8A 2DZNA 4QFVA 4DUIA 1N0RA 4G8LA 5CBOA 1K1BA 4HBDA 4DX6D 1K3ZD 1G3NB 4Z68A 4K5CA 5CERB 3EHRA 4U8VD 2XENA 5ENOD 4CZ2D 1DCQA 5CEDB 4OAVB 4K5AB 3V79K 5HS0A 4A63B 4LSZE 5EN5D 2ZGGA 5ITZF 3IXEA 1QYMA 3W9FA 2XZTG 4C48B 4ATZD 4B93B 4U8YD 2F8YA 3TWUA 3TWXA 1IHBA 1SW6A 1WDYA 3UI2A 4U95D 4YDWA 5AQ7A 4F6RD 5ENRD 2BKGA 4BETA 4HRNA 5HRYA 4G8KA 4F1PA 3W9GA 3AJIA 3JXJA 1TR4A 4DX1A 2F37A 2DWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEA A;  1N0Q A;  4NIK A;  1UOH A;  2XZD G;  3HRA A;  3NOG D;  3B7B A;  4HQD A;  4BEP A;  3Q9N C;  4N5Q A;  1S70 B;  3D9H A;  3UTM A;  4ZHB A;  2PNN A;  1MX6 A;  4HLL A;  5AQ9 A;  3LJN A;  2ZGD A;  4DX2 A;  3TWR A;  4TUM A;  5KNG A;  2XEE A;  4U96 D;  1BI8 B;  3SO8 A;  3TWT A;  4YDY A;  5ENS D;  5KBA A;  1YMP A;  2ETB A;  4LNU D;  3TWS A;  4K5B A;  5ENT D;  1DC2 A;  3B95 A;  2RFM A;  2QC9 A;  5AN8 A;  4O1P A;  3V2O A;  3ZUV B;  5FIN A;  4CYM D;  5CBN A;  2VGE A;  4HB5 A;  4OAU C;  5EIB E;  4DRX E;  5AQA A;  3NBN B;  2L6B A;  4BER A;  4UUC A;  2FO1 E;  3J5P A;  3F6Q A;  5EYP F;  3T9K A;  2J8S D;  5JMN D;  1AWC B;  4ZFH A;  1N11 A;  2HE0 A;  3ZKJ A;  5D66 A;  3V31 A;  2RFA A;  4HNA D;  4HRM B;  4BES A;  2QYJ A;  1IXV A;  5KWD A;  2ETC A;  1BLX B;  2KXP C;  3ZNG A;  4GMR A;  1WG0 A;  2DZO A;  2Y1L E;  1BI7 B;  4HI9 A;  5FIO A;  3AAA C;  5EID A;  3EU9 A;  5ENP D;  5CEC B;  4LG6 A;  1MJ0 A;  3UXG A;  4DX5 D;  1IKN D;  3V2X A;  5EIL A;  2DVW A;  1YCS B;  2P2C P;  2XEH A;  1MYO A;  3Q9U C;  4J8Y A;  1YYH A;  4O60 A;  3HG0 D;  4JB8 P;  3T8K A;  5AAO A;  3J5Q B;  3TWQ A;  2F8X K;  5HKP A;  2KBX A;  4HI8 A;  1MX2 A;  2B0O E;  3JXI A;  5AQB A;  1SVX A;  1BU9 A;  4O1O A;  2JAB A;  3C5R A;  3V30 A;  1AP7 A;  2V5Q C;  4HRL A;  1NFI E;  4DX7 D;  4GPM A;  3ZU7 B;  1OT8 A;  5BXU A;  3TWV A;  2BKK B;  2NYJ A;  4RLY A;  5JA4 D;  1D9S A;  3DEO A;  3EHQ A;  3NOC D;  1K1A A;  2ETA A;  5EYL A;  5CEA A;  5ENQ D;  1MX4 A;  4J7W A;  2Y0B G;  1A5E A;  2AJA A;  5AAR A;  5BXO A;  1OY3 D;  3TWW A;  4QQI A;  5KNH D;  4BSZ B;  2A5E A;  3DEP A;  2MYO A;  3JUE A;  2V4H C;  1BD8 A;  2DZN A;  4QFV A;  4DUI A;  1N0R A;  4G8L A;  5CBO A;  1K1B A;  4HBD A;  4DX6 D;  1K3Z D;  1G3N B;  4Z68 A;  4K5C A;  5CER B;  3EHR A;  4U8V D;  2XEN A;  5ENO D;  4CZ2 D;  1DCQ A;  5CED B;  4OAV B;  4K5A B;  3V79 K;  5HS0 A;  4A63 B;  4LSZ E;  5EN5 D;  2ZGG A;  5ITZ F;  3IXE A;  1QYM A;  3W9F A;  2XZT G;  4C48 B;  4ATZ D;  4B93 B;  4U8Y D;  2F8Y A;  3TWU A;  3TWX A;  1IHB A;  1SW6 A;  1WDY A;  3UI2 A;  4U95 D;  4YDW A;  5AQ7 A;  4F6R D;  5ENR D;  2BKG A;  4BET A;  4HRN A;  5HRY A;  4G8K A;  4F1P A;  3W9G A;  3AJI A;  3JXJ A;  1TR4 A;  4DX1 A;  2F37 A;  2DWZ A; 
#chains in the Genus database with same CATH topology
 4XI9 A;  3KEA A;  3ZHE A;  2I2O A;  3VLE A;  3MGB A;  4ATG A;  4EQF A;  2FO7 A;  2KC7 A;  2IFU A;  2AW6 A;  2J08 A;  2QY7 A;  3FTX A;  4PS3 A;  3HDX A;  3HXB A;  3B95 A;  3V2O A;  4CT0 A;  4BER A;  2PQN A;  4TUU A;  5D66 A;  1NP7 A;  4H7X A;  2GRP B;  3CVN A;  3ESL A;  3E33 A;  2HYZ A;  3ZW3 A;  1YYH A;  3UX4 A;  1SZ9 A;  2F8X K;  1PY1 A;  5HKP A;  2B0O E;  3JXI A;  3CK8 A;  4O1O A;  5KJL A;  3SBT B;  4V3I A;  3GW4 A;  3VLD A;  5LOZ A;  3SFY A;  3ZFW A;  2P9N G;  3ONL A;  4GCO A;  3N71 A;  3AG3 E;  3UM1 A;  4TXQ A;  1MX4 A;  2VSN A;  3MJW A;  3JUE A;  3L9T A;  3CVW A;  4QFV A;  1X81 A;  4J8D A;  4G1T A;  1DCQ A;  4LNG A;  3QAQ A;  3V79 K;  3PZ2 A;  3SFX A;  4OVV A;  2XQ0 A;  2X6I A;  3T5X A;  1JUQ A;  3O48 A;  2UY1 A;  3FUK A;  1TNU A;  3GZ2 A;  4DX1 A;  4HVB A;  4ILH B;  3UQ3 A;  4N39 A;  4N5Q A;  1S70 B;  4WND A;  1ZB1 A;  3OXL A;  4U0Z A;  4PDX A;  4I17 A;  4YVQ C;  3HVE B;  5ENT D;  2ZIR A;  2Q7F A;  3MV2 B;  4HB5 A;  2KZT A;  2LXL A;  2KCK A;  1H6O A;  3F6Q A;  2HM8 A;  3FUE A;  3DSW A;  1BLX B;  5FZS A;  3ZNG A;  2UY1 B;  4LG6 A;  5KJK A;  3HHM A;  2XEH A;  3E32 A;  2IF4 A;  3L6A A;  3T8M A;  5KCM A;  3UM0 A;  4U0U A;  4A3T A;  1Q2Z A;  4A1G A;  2IOS A;  3Q73 A;  2EIK E;  4LRZ A;  2KM4 A;  2X3M A;  2CFU A;  4N3C A;  4J7W A;  1N4P A;  3RK6 A;  3AG1 E;  4B8A A;  4UI9 J;  3D9L A;  1QNF A;  3FP3 A;  1E8W A;  3MEK A;  2FF4 A;  3L54 A;  3ULQ A;  3TGO A;  3URZ A;  3EHR A;  2XS8 A;  2AXU A;  5HS0 A;  3MA5 A;  2XZT G;  4TXR A;  2UWJ G;  1HFA A;  4HOR A;  4JHJ A;  5CHE E;  4GYY A;  3P2B A;  1WY6 A;  3KAE A;  2OVF A;  4C9B B;  4AXH A;  4E85 A;  4FLH A;  2KCL A;  2IO2 C;  2L0I A;  2WPV A;  4HQD A;  3UTM A;  1TJC A;  1UG3 A;  2DBA A;  2GRQ B;  4U96 D;  4AJW A;  3NQP A;  3B7U X;  2MOW A;  3EIQ C;  4HOQ A;  2VJ8 A;  2VSX E;  1Y6I A;  4I9E A;  3FH5 A;  3EIJ A;  3MCX A;  4BX9 A;  2LO6 A;  4HRM B;  1SA5 A;  1IXV A;  2ETC A;  3DPY A;  1KPS B;  2XPY A;  3TG4 A;  5FIO A;  2H6F A;  3PZ3 A;  3JYS A;  2P2C P;  4Q96 A;  3PH0 C;  5AAO A;  5FT9 A;  3SFZ A;  1E8X A;  1FT1 A;  2EIN E;  4G11 A;  3D3M A;  2CHZ A;  2P9K G;  1U3D A;  1QQE A;  4JEH A;  3UT4 A;  4I6E A;  4APF A;  3CR3 A;  1NZN A;  3SZ7 A;  5ENQ D;  4TXP A;  3ASG A;  4HLE A;  3TAX A;  3PEU B;  4NAC A;  5FQ6 A;  5CMY A;  4KZC A;  4XZ4 A;  3CKB A;  4MRU A;  3LVQ E;  5FQ7 A;  1OWN A;  2P9U G;  4N2S A;  4RVB A;  2WXR A;  3RAU A;  5FWQ A;  3Q4A B;  4B93 B;  4UI9 C;  1PC2 A;  3MV3 B;  5J08 A;  3FHE A;  4G8K A;  3LPZ A;  2L9B A;  3ZIM A;  3TL5 A;  2WB2 A;  1UOH A;  2XZD G;  4XE0 A;  2I1J A;  3NOG D;  3CVU A;  3EHN A;  2FBN A;  3RSE G;  2YHC A;  1DC2 A;  2H6I A;  3CVP A;  4GA1 A;  1KT0 A;  3LDZ A;  3T5V A;  4GA0 A;  1H6K A;  2LAI A;  4JHK A;  2CFZ A;  3UM2 A;  1BI7 B;  1TN6 A;  3EU9 A;  4AM9 A;  3ONK A;  3CV0 A;  2IO3 C;  4OYS A;  1SZA A;  3V30 A;  1UN8 A;  3FU6 A;  4CDM A;  4U8H A;  4DI3 A;  3DEO A;  2V4L A;  4B89 A;  1H2U A;  3LKU A;  1OY3 D;  3SI5 A;  1O1S A;  5G2N A;  2V4H C;  1ZBP A;  2C0M A;  2XEN A;  4CZ2 D;  4XX5 A;  3P1U A;  5BPP A;  2X6H A;  4LSZ E;  2DYS E;  4NUR A;  1QYM A;  3TJP A;  2F8Y A;  4BY6 A;  3TWX A;  4U07 A;  4YDW A;  5B3S E;  2KCV A;  2PM7 A;  2OEW A;  4FLB A;  5FTP A;  2XGM A;  4NIK A;  5EX0 A;  2J9Q A;  2GRM A;  2CG3 A;  3S7J A;  4DX2 A;  4JW1 A;  2XEE A;  2KZT B;  4AIF A;  4LNU D;  3PDN A;  1IHG A;  1NA0 A;  4OVU A;  5EIB E;  3UIP C;  4C0E A;  2FO1 E;  4UUC A;  3RJV A;  3DPD A;  2DCP A;  1D8D A;  1O1T A;  4PH4 B;  2RFA A;  2CG2 A;  3Q78 A;  3MKQ B;  2VGX B;  1LTX A;  4FUL A;  1PAQ A;  3AAA C;  5LP0 A;  4E6H A;  5H7P A;  4EHM A;  1MJ0 A;  3UIN C;  4JVS A;  1IYG A;  4P29 A;  1MYO A;  3D9O A;  3ULY A;  5T4Y A;  4HI8 A;  4XKC A;  3I4R B;  5D0Q D;  4IUL A;  5AYW D;  2R03 A;  3DXM G;  1NI1 A;  3LEW A;  3C3O A;  3NB2 A;  4KZ0 A;  3FWV A;  2DZN A;  4GZ3 A;  4G8L A;  1K1B A;  2WXP A;  5A23 A;  2FUL A;  4ANW A;  3PRE A;  2L0T B;  3QDN A;  4URK A;  3CHP A;  2NC9 A;  1UJK A;  2WXK A;  5LCW J;  3Q79 A;  1DNP A;  3AG2 E;  4GA2 A;  4WNF A;  2WXF A;  1DCE A;  2PM6 A;  3ZPJ A;  3S7D A;  4A55 A;  2JLB A;  3Q9N C;  4ME2 A;  3D9H A;  4WWN A;  3U66 A;  3D9I A;  4HLL A;  4ABN A;  3QWP A;  3NAW A;  3ZEF A;  5AN8 A;  3ZUV B;  1E8Z A;  4I6G A;  1INZ A;  2KAT A;  2E2E A;  3ULE G;  3HXE A;  3Q5M A;  3CKC A;  4HNA D;  2QYJ A;  1N4S A;  1Z3Y A;  3ENE A;  5AIJ A;  3HXC A;  3O4Z A;  4PS8 A;  3HYM B;  3OAW A;  5EIL A;  4CEM A;  3MKQ A;  4FJY A;  2QZA A;  2X6F A;  2KBX A;  3FTW A;  3KD7 A;  5CCM A;  3QKY A;  2IQC A;  4AP2 A;  3GZ1 A;  3TWV A;  2BKK B;  1D9S A;  1XGW A;  3R9M A;  3KSL A;  4EPZ A;  5AEN A;  1HO8 A;  4JHR A;  5ARG A;  5EYL A;  3APF A;  4I1O B;  4ILG A;  1SQM A;  3CEQ A;  1RW2 A;  5BNW A;  4K03 A;  2WVI A;  3CVV A;  4I9C A;  3CVY A;  3RRU A;  4A63 B;  3BG0 B;  4C48 B;  4UQY A;  3APD A;  4EZL A;  1IQU A;  3IHV A;  1GW6 A;  2WQH A;  1IHB A;  1SW6 A;  2V0P A;  3E30 A;  3ZHE B;  4F6R D;  5ENR D;  3MKR A;  2Y69 E;  5HRY A;  2R59 A;  1TR4 A;  5DIZ A;  2LXM A;  5C2Y A;  4U04 A;  3ZRH A;  3LJN A;  2JEK A;  4F7A A;  2GGF A;  4UWK A;  3B13 A;  3SO8 A;  1YMP A;  1D8E A;  4BT9 A;  3IHY A;  5FIN A;  3S7B A;  4HFG A;  2CHX A;  3JQ0 A;  2VQ2 A;  3CIA A;  5B1B E;  3T9K A;  3DWL G;  1TYQ G;  1N11 A;  4A1S A;  3V31 A;  4BES A;  2AXV A;  5D0O D;  5JHA A;  2KXP C;  4N3B A;  2VSY A;  1HH8 A;  3V2X A;  3PNL B;  3PRZ A;  3LY9 A;  4J8E A;  2MRI A;  3SBS A;  1HZ4 A;  2ZXW E;  4HRL A;  1NFI E;  4KYO B;  2BF0 X;  2Y4T A;  5HI7 A;  5FQ8 A;  2ION A;  5D2M C;  5E75 A;  3RRM B;  5BXO A;  3B7R L;  3FUN A;  2A5E A;  3U9W A;  4L2Y A;  3FUM A;  1TNZ A;  3FUJ A;  3D9P A;  3CHR A;  4ANU A;  2XCB A;  4ACL A;  4J8F A;  2E0I A;  3R7R A;  3W9F A;  3E4B A;  2EIJ E;  3AU4 A;  4C0M A;  1WDY A;  5FJY A;  3ZYM A;  3EHM A;  2OV8 A;  1TEZ A;  4WNG A;  1N0Q A;  5EDS A;  2VYI A;  2WXQ A;  4L7T A;  1V54 E;  2FEZ A;  2YHE A;  5KBA A;  3TWS A;  4K5B A;  2C0L A;  4CRW A;  3KS2 A;  3ZYL A;  4LCT A;  2DIW A;  4O1P A;  2VGE A;  1UW4 B;  3IV0 A;  3G2T A;  3AS5 A;  4EZJ A;  2X6K A;  2J8S D;  3JUI A;  2HE0 A;  3ZKJ A;  1ZU2 A;  3DST A;  4UQX A;  3BEE A;  1A17 A;  4DX5 D;  3UXG A;  3FTS A;  4F1S A;  4I1M A;  1K8K G;  3RO2 A;  3EDT B;  4TRQ A;  4X8Q A;  4AY5 A;  3D9K A;  3D9N A;  4DLO A;  3Q15 A;  5AJL A;  4J8S A;  3TWW A;  4GTM A;  1LF8 A;  2R02 A;  2DYR E;  3QB2 A;  4U8V D;  5FZR A;  1EYH A;  4G2V A;  3FTU A;  4FP7 A;  3DSU A;  3PZ1 A;  3SGH A;  2WXM A;  3ML8 A;  1TNB A;  1TN7 A;  4DPR A;  2GRN B;  4YDO A;  4YVO A;  1LD8 A;  3E34 A;  3VTY A;  2ETB A;  4HOT A;  5CBN A;  3L22 A;  2PZI A;  2Y3A A;  4CCA A;  1KZP A;  3DXK G;  5JMN D;  3VTX A;  4JD2 G;  3UMV A;  3ABM E;  3SY2 A;  3FDH A;  1JCR A;  3L13 A;  3FFL A;  2DZO A;  2R2L A;  1ELR A;  5ENP D;  4AV7 A;  4CGW A;  5EKQ D;  1OXJ A;  5FQ4 A;  3QJZ A;  5BT1 A;  3EU5 A;  3SQV A;  2JAB A;  3UT8 A;  3X2Q E;  3ZU7 B;  1OT8 A;  5BXU A;  5JA4 D;  4A3V A;  3HVE A;  4Q94 A;  5G04 C;  3NOC D;  4LNB A;  3JCK C;  3AS8 A;  4J0U A;  3E37 A;  2V5F A;  2Y0B G;  2WQ6 A;  4UWF A;  5KNH D;  1HE8 A;  3B7T A;  2MYO A;  2IOL A;  4MBG A;  3CQG B;  4K5A B;  4GZD A;  3CHS A;  2R05 A;  3NZS A;  2WXJ A;  1E8Y A;  1N4Q A;  3ASF A;  3FH8 A;  4GTV A;  2YNQ A;  3AJI A;  4MS6 A;  4UI9 K;  2R5S A;  2EIM E;  4MKT A;  1N9A A;  4AY6 A;  1WM5 A;  4ZHB A;  2VTB A;  1UJJ A;  4JC8 A;  3TWT A;  2BUG A;  2QC9 A;  5G05 J;  5G05 C;  3ASD A;  3CK7 A;  3CVX A;  3J5P A;  2GRL A;  2WQ7 A;  3Q75 A;  2B6C A;  2IY0 C;  2YIN A;  4DLQ A;  3FY4 A;  1N54 A;  2J4B A;  3BQO A;  3C72 A;  2LUH A;  1IKN D;  4KT6 B;  2DVW A;  3D9J A;  4GCN A;  4J8Y A;  4G23 A;  2OOE A;  5KJN A;  3FU0 A;  3ZGQ A;  4J6I A;  3FTZ A;  3CHO A;  1VDY A;  4FHJ A;  2VTB B;  3CHM A;  1BU9 A;  2WXI A;  2WXO A;  3C5R A;  3NZU A;  2I9C A;  5LX8 A;  3PEV B;  4GAA A;  3FEY A;  4UQZ A;  2HO1 A;  3MX3 A;  3Q47 B;  4CDN A;  5A6C A;  1FT2 A;  5CBO A;  4M3O A;  1K3Z D;  1HS6 A;  1NL4 A;  3FUF A;  1U3C A;  3TXN A;  1SA4 A;  4I6J A;  3SD5 A;  3LYA A;  3TWU A;  3FUL A;  4U95 D;  5C1D A;  3OXG A;  4NRH B;  4O6F A;  2X38 A;  3PZD A;  4L2L A;  4GTQ A;  4FJZ A;  4GZ6 A;  1H0A A;  4WAF A;  4HOS A;  3KSQ A;  5J90 A;  1Z6T A;  2XGO A;  3TWR A;  1U2V G;  1BI8 B;  4JZY A;  2QFC A;  4CT4 A;  4BTB A;  4EBA A;  3QWV A;  1EDU A;  4G24 A;  3GZS A;  4ZFH A;  1AWC B;  3L17 A;  4GYW A;  3AG4 E;  3IBE A;  1E90 A;  4HI9 A;  3FTV A;  5EID A;  2XS1 A;  4LEU A;  4GU5 A;  5CRU A;  4JA7 A;  3QWW A;  2P9P G;  3PE4 A;  3R9A B;  5T8I A;  3CVL A;  2OVB A;  2V5Q C;  4BWR A;  4DX7 D;  3ZVV A;  4G25 A;  4BTA A;  4L23 A;  4ANV A;  3IEG A;  4RG9 A;  1XNF A;  1N94 A;  2WXN A;  5ARF A;  1P5Q A;  2PL2 A;  4NQ0 A;  5CER B;  5ENO D;  2GRR B;  5BV0 A;  4OAV B;  5EN5 D;  5DBK A;  4ATZ D;  4BT8 A;  4U7E B;  4UWL A;  2F0Y A;  3B7S A;  1EF1 C;  3DSV A;  4HRN A;  3PZ4 A;  4LUN U;  2F37 A;  3RKV A;  3I4G A;  5KJM A;  1BPO A;  1JCQ A;  3CSF A;  5KNG A;  3QAR A;  2WM9 A;  5ENS D;  4EEC A;  3U64 A;  1S0P A;  4EZK A;  4PS7 A;  5G55 A;  1ELW A;  4ILI A;  3DSS A;  3CQC B;  3MZL B;  1N52 A;  2ZIS A;  3LCA A;  3Q7F A;  3FU3 A;  1HG2 A;  2LAH A;  4N5C A;  4ACK A;  4GTT A;  1HU3 A;  5JJ6 A;  5CEC B;  5CMW A;  2GW1 A;  4IYP A;  3HG0 D;  1OCC E;  3UKU G;  3ISM C;  2WMO A;  2XGS A;  2L6J A;  5BUZ A;  3PUK A;  3L16 A;  1H6P A;  2J49 A;  1MHQ A;  3CLJ A;  2EQX A;  3HXF A;  2ZU6 B;  3WG7 E;  4GYO A;  3KEZ A;  1IQR A;  1TNO A;  2GRO B;  1L5J A;  1BD8 A;  4RG6 A;  4H7Y A;  1N0R A;  4DK5 A;  4FHK A;  1G3N B;  4FU3 A;  5CRV A;  2AWI A;  1QZ2 A;  1V55 E;  5JJ7 A;  3RO3 A;  1JPL A;  2XEV A;  4HXI A;  4EBA G;  5E76 A;  4FC8 A;  3WXX A;  1TN8 A;  5G04 J;  5AJD A;  3JXJ A;  3Q7A A;  5B1A E;  1OCR E;  5JHB A;  2YQ8 A;  2BED A;  1OWM A;  4GTO A;  5AQ9 A;  1TNY A;  3CGH A;  3U3W A;  2RFM A;  4DRX E;  1WAO 1;  2L6B A;  2J07 A;  4B94 A;  5EYP F;  2XPZ A;  5ANR A;  5KWD A;  5ANL A;  3G2U A;  2Y1L E;  4AOF A;  2A4Z A;  2Y4U A;  4XIF A;  4KVM A;  4DI4 A;  3Q9U C;  3ABK E;  3T8K A;  3S2A A;  4L9P A;  4I1A A;  3ZXS A;  1MX2 A;  3VLF A;  2WXH A;  1SVX A;  3S7F A;  4WUY A;  3RRN B;  3DSX A;  4YND A;  2C2L A;  5T3R A;  3EHQ A;  4GTP A;  4D10 C;  3RIB A;  2AVP A;  3TXM A;  2P9L G;  4IRU A;  4QQI A;  4BSZ B;  4GPK A;  2NXP A;  3SHF A;  1OUV A;  4BFR A;  1NA3 A;  1FVF A;  4JL0 A;  4N3A A;  2V8S E;  4KBQ A;  1FCH A;  1H2V C;  4MLP A;  4WWP A;  2RD0 A;  3GYZ A;  4G26 A;  4XKB A;  4YDE A;  4GB9 A;  1UN9 A;  3TG5 A;  4U8Y D;  4DJA A;  5LCW C;  4AEZ C;  1FVH A;  3ASO E;  3LS8 A;  1OCZ E;  1KZO A;  4R7L A;  2DWZ A;  4F3V A;  1YA0 A;  3ZYK A;  4GMJ A;  4BEP A;  1Y8M A;  1Z5S C;  4GTR A;  4FAD A;  2RKK A;  2PNN A;  1OWL A;  1W3B A;  4PUC A;  3PUJ A;  3G2V A;  3OTN A;  3QNK A;  1JWF A;  3ABL E;  4OAU C;  2OND A;  5AQA A;  3NBN B;  2LSU A;  3CHQ A;  3FTY A;  3ESK A;  3LJ3 A;  3G2S A;  4Q69 A;  3HIZ A;  3FU5 A;  4HOU A;  4XI0 A;  3CVQ A;  4WNE A;  4I2Z A;  1YCS B;  3MYV A;  3BG1 B;  2H6G A;  3UM3 A;  3C3R A;  2VSO E;  2VGX A;  5A7D B;  4HS2 A;  4KXK B;  4GPM A;  3UUX A;  3LVR E;  3FH7 A;  1DVP A;  2WXG A;  2XRY A;  5FZQ A;  1K1A A;  5CEA A;  2CHW A;  1MQS A;  4CDR A;  1Z3X A;  5BV1 A;  3ASH A;  4ANX A;  3DEP A;  4RQI A;  3CK9 A;  4HBD A;  3L82 A;  4Z68 A;  3I5P A;  1E7V A;  3DBS A;  1O1R A;  5IY5 E;  2MHK A;  3IKO B;  3QOU A;  3JQ1 A;  4JPS A;  2M63 A;  3ML9 A;  1O5M A;  3UI2 A;  5AQ7 A;  4BSX A;  4KMO A;  1H19 A;  3CST A;  2J09 A;  4W9R A;  3B7B A;  2H6H A;  3G2W A;  1MX6 A;  2P9I G;  2ZGD A;  4IN3 B;  1JCS A;  3RU0 A;  4TUM A;  4AVX A;  4FA6 A;  4YDY A;  4U63 A;  4BX8 A;  4CYM D;  1HG5 A;  3FUH A;  3UIO C;  2QYU A;  1QBQ A;  1WG0 A;  1KLX A;  4Y6W A;  2BTD A;  2XPI A;  1KT1 A;  4K0R A;  2LSV A;  4O60 A;  2IEJ A;  3J5Q B;  3TWQ A;  4N2Q A;  3LXU X;  5AQB A;  1AP7 A;  3OXF A;  2NYJ A;  3K9I A;  2HR2 A;  3D9M A;  2ETA A;  1JWG A;  2P9S G;  3DRA A;  1S64 A;  5EX3 A;  2AJA A;  3HXD A;  3EJN A;  3ZYQ A;  5JJT A;  2LNI A;  3AS4 A;  5CCL A;  4GZ5 A;  3R7Q A;  4DUI A;  4DX6 D;  4L1B A;  3QK0 A;  3UPV A;  4Y6C A;  4KVO A;  4K5C A;  4I2W A;  2IU1 A;  5CED B;  1HF8 A;  2I6H A;  3UT7 A;  3SNX A;  4M7C A;  3APC A;  5ITZ F;  4U0S A;  4B0Z A;  1RZ4 A;  2IJG X;  3Q49 B;  1ELK A;  4BET A;  2BKG A;  4JEU A;  3W9G A;  3BU8 A;  4GML A;  2PQR A;  3FUI A;  3HRA A;  1H2T C;  4GZC A;  4APO A;  3FUD A;  3LY7 A;  2FI7 A;  1B89 A;  2R17 C;  1S63 A;  3I3N A;  3C98 A;  2AXZ A;  2X6J A;  1HX8 A;  2OCC E;  3ZN3 A;  1E96 B;  3UKR G;  2A5U A;  1N95 A;  4WWO A;  1TJF A;  1HXI A;  3LY8 A;  4GMR A;  4I43 A;  2XHE A;  3ASN E;  3PVL A;  5M72 A;  4JA9 A;  3SF4 A;  5HQ8 A;  2VGY A;  4JB8 P;  3PE3 A;  1E7U A;  4UWH A;  3BUA A;  4JXT A;  2OEV A;  4CGV A;  3ZXP A;  4XEI G;  1X5B A;  2J4D A;  4RLY A;  3PS6 A;  3C3Q A;  4LER A;  3NF1 A;  1LD7 A;  1OCO E;  1FPP A;  3L08 A;  1A5E A;  5AAR A;  5BW8 C;  2RG8 A;  3U4T A;  4GTS A;  2ILR A;  3PNT B;  4UWG A;  2EIL E;  3QC1 A;  2XCC A;  3AU5 A;  1MZC A;  2I1K A;  4B8C B;  2ZGG A;  3IXE A;  3EUV A;  1EPU A;  1OWP A;  3FEX A;  2P58 C;  5LFA A;  2WMN A;  1OWO A;  2NSZ A;  2WXL A;  4RSY A;  4F1P A;  4F53 A;  2XRZ A;  4TV3 A;  5ENN A;  1N4R A; 
#chains in the Genus database with same CATH homology
 3KEA A;  1N0Q A;  4NIK A;  1UOH A;  2XZD G;  3HRA A;  3NOG D;  3B7B A;  4HQD A;  4BEP A;  3Q9N C;  4N5Q A;  1S70 B;  3D9H A;  3UTM A;  4ZHB A;  2PNN A;  1MX6 A;  4HLL A;  5AQ9 A;  3LJN A;  2ZGD A;  4DX2 A;  3TWR A;  4TUM A;  5KNG A;  2XEE A;  4U96 D;  1BI8 B;  3SO8 A;  3TWT A;  4YDY A;  5ENS D;  5KBA A;  1YMP A;  2ETB A;  4LNU D;  3TWS A;  4K5B A;  5ENT D;  1DC2 A;  3B95 A;  2RFM A;  2QC9 A;  5AN8 A;  4O1P A;  3V2O A;  3ZUV B;  5FIN A;  4CYM D;  5CBN A;  2VGE A;  4HB5 A;  4OAU C;  5EIB E;  4DRX E;  5AQA A;  3NBN B;  2L6B A;  4BER A;  4UUC A;  2FO1 E;  3J5P A;  3F6Q A;  5EYP F;  3T9K A;  2J8S D;  5JMN D;  1AWC B;  4ZFH A;  1N11 A;  2HE0 A;  3ZKJ A;  5D66 A;  3V31 A;  2RFA A;  4HNA D;  4HRM B;  4BES A;  2QYJ A;  1IXV A;  5KWD A;  2ETC A;  1BLX B;  2KXP C;  3ZNG A;  4GMR A;  1WG0 A;  2DZO A;  2Y1L E;  1BI7 B;  4HI9 A;  5FIO A;  3AAA C;  5EID A;  3EU9 A;  5ENP D;  5CEC B;  4LG6 A;  1MJ0 A;  3UXG A;  4DX5 D;  1IKN D;  3V2X A;  5EIL A;  2DVW A;  1YCS B;  2P2C P;  2XEH A;  1MYO A;  3Q9U C;  4J8Y A;  1YYH A;  4O60 A;  3HG0 D;  4JB8 P;  3T8K A;  5AAO A;  3J5Q B;  3TWQ A;  2F8X K;  5HKP A;  2KBX A;  4HI8 A;  1MX2 A;  2B0O E;  3JXI A;  5AQB A;  1SVX A;  1BU9 A;  4O1O A;  2JAB A;  3C5R A;  3V30 A;  1AP7 A;  2V5Q C;  4HRL A;  1NFI E;  4DX7 D;  4GPM A;  3ZU7 B;  1OT8 A;  5BXU A;  3TWV A;  2BKK B;  2NYJ A;  4RLY A;  5JA4 D;  1D9S A;  3DEO A;  3EHQ A;  3NOC D;  1K1A A;  2ETA A;  5EYL A;  5CEA A;  5ENQ D;  1MX4 A;  4J7W A;  2Y0B G;  1A5E A;  2AJA A;  5AAR A;  5BXO A;  1OY3 D;  3TWW A;  4QQI A;  5KNH D;  4BSZ B;  2A5E A;  3DEP A;  2MYO A;  3JUE A;  2V4H C;  1BD8 A;  2DZN A;  4QFV A;  4DUI A;  1N0R A;  4G8L A;  5CBO A;  1K1B A;  4HBD A;  4DX6 D;  1K3Z D;  1G3N B;  4Z68 A;  4K5C A;  5CER B;  3EHR A;  4U8V D;  2XEN A;  5ENO D;  4CZ2 D;  1DCQ A;  5CED B;  4OAV B;  4K5A B;  3V79 K;  5HS0 A;  4A63 B;  4LSZ E;  5EN5 D;  2ZGG A;  5ITZ F;  3IXE A;  1QYM A;  3W9F A;  2XZT G;  4C48 B;  4ATZ D;  4B93 B;  4U8Y D;  2F8Y A;  3TWU A;  3TWX A;  1IHB A;  1SW6 A;  1WDY A;  3UI2 A;  4U95 D;  4YDW A;  5AQ7 A;  4F6R D;  5ENR D;  2BKG A;  4BET A;  4HRN A;  5HRY A;  4G8K A;  4F1P A;  3W9G A;  3AJI A;  3JXJ A;  1TR4 A;  4DX1 A;  2F37 A;  2DWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...