3V2OA

Crystal structure of the peptide bound complex of the ankyrin repeat domains of human ankra2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
LSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ankyrin repeat family A protein 2
publication title Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3v2oA00
3B95A 4OAUC 1SW6A 2L6BA 5ENQD 4UUCA 5EILA 3TWWA 5FINA 2ETBA 4HQDA 3DEOA 4Z68A 1DCQA 2DZNA 5ENSD 4U96D 2KBXA 5ENPD 5KWDA 1N0QA 4HRMB 1MYOA 2MYOA 3UTMA 4U8YD 3IXEA 2XEHA 5JA4D 5AQBA 3NOGD 1K1BA 1N11A 2ZGDA 4G8LA 5CBNA 3F6QA 3LJNA 3V79K 4K5BA 4QQIA 3TWTA 4DRXE 2XENA 1YYHA 2BKGA 4HRLA 4ZFHA 5CERB 2BKKB 1BLXB 3TWXA 4BSZB 4DX1A 5AQ9A 5ENRD 5CECB 1IHBA 3AAAC 4GPMA 4YDYA 2XZDG 5HRYA 3TWSA 5ENTD 4DX5D 5BXUA 5EIBE 1BU9A 3V31A 1S70B 1MX6A 5AN8A 5KNGA 2HE0A 5ENOD 3TWVA 3V2XA 5CBOA 1DC2A 4F1PA 2J8SD 1NFIE 2PNNA 1K3ZD 1WDYA 2V5QC 3JXJA 4HB5A 1IXVA 5KBAA 2Y0BG 2V4HC 3EHRA 2B0OE 5D66A 3NBNB 1WG0A 5AQ7A 5FIOA 4HRNA 5EYLA 3ZKJA 3D9HA 5KNHD 2RFMA 5EIDA 2VGEA 2XEEA 1N0RA 4HLLA 2F37A 1IKND 3B7BA 4O60A 4J7WA 4B93B 4DX7D 1MJ0A 2ETAA 4A63B 3UXGA 3TWRA 4GMRA 5AARA 5ITZF 3JXIA 4LSZE 3HRAA 1YMPA 3JUEA 1OT8A 1BI7B 3TWQA 3ZNGA 2QC9A 5EYPF 3TWUA 4O1OA 1AP7A 4QFVA 5CEAA 2FO1E 4CZ2D 5AAOA 4C48B 1MX2A 1K1AA 4HNAD 1G3NB 2DVWA 2F8XK 4RLYA 3J5QB 4LNUD 3Q9NC 2XZTG 2AJAA 4HI9A 1SVXA 3J5PA 5EN5D 4BETA 1MX4A 2DZOA 4K5AB 1TR4A 4HBDA 2ETCA 5HKPA 2P2CP 3AJIA 2F8YA 2DWZA 1UOHA 4CYMD 4BERA 3W9FA 5AQAA 3SO8A 4LG6A 4ATZD 4BESA 3KEAA 5CEDB 1OY3D 2KXPC 4K5CA 4DUIA 4NIKA 2QYJA 3UI2A 1QYMA 4TUMA 4JB8P 4N5QA 4O1PA 3T9KA 3EU9A 5HS0A 5BXOA 3T8KA 2NYJA 4YDWA 3ZU7B 3DEPA 3HG0D 4G8KA 3ZUVB 4J8YA 1YCSB 2A5EA 3Q9UC 3EHQA 2JABA 2Y1LE 4BEPA 4U95D 2ZGGA 4ZHBA 1AWCB 1A5EA 3V2OA 1D9SA 2RFAA 4DX6D 3C5RA 4U8VD 3V30A 1BI8B 4OAVB 3W9GA 5JMND 3NOCD 4F6RD 4HI8A 1BD8A 4DX2A
chains in the Genus database with same CATH superfamily
3LVQE 3FUJA 3ZRHA 4U96D 2XEHA 4U7EB 4AIFA 3Q49B 3V79K 4DI4A 2XENA 4GTSA 5CERB 2VTBB 2VQ2A 2WVIA 4E85A 2YQ8A 5ENOD 4KBQA 3R9AB 3FUEA 3DWLG 4HFGA 2V5QC 2YHEA 3FUHA 3ESKA 3PREA 4YNDA 2B0OE 5D66A 5CRVA 3AS5A 1ZBPA 3PNLB 3PZ1A 3B7RL 3FTXA 1OT8A 3CSFA 4QFVA 4EBAG 1QZ2A 1HE8A 3HDXA 3UMVA 3EIJA 3J5QB 2XZTG 2AJAA 5E76A 5HQ8A 2YHCA 3QNKA 1Z3YA 4I17A 4G1TA 4PS7A 3TJPA 3RRNB 5AJDA 1MQSA 5BV0A 2GRMA 2FULA 1N4SA 3K9IA 4A1GA 4CT0A 4UI9J 1SA5A 3QB2A 2WMNA 3LY8A 4J8YA 3HXFA 2IF4A 4LEUA 4FP7A 3SZ7A 1KPSB 3CSTA 1IQRA 3V30A 1JWFA 3CIAA 1TYQG 4I2WA 4AP2A 1SW6A 2LUHA 4CDNA 1K8KG 3KSLA 2DCPA 3MKQA 4Q69A 1Z3XA 3N71A 4U8YD 3D3MA 5AQBA 3VTYA 1E7VA 1N11A 3ZW3A 3KAEA 3ZYKA 5EIBE 3NQPA 1BU9A 5A23A 1TNYA 3SFXA 3ULYA 5CCMA 3CHQA 2HE0A 1DC2A 2XCBA 1HG5A 4B8AA 2VGYA 3AG2E 3CHOA 4O6FA 2X6IA 4UWFA 1IKND 4JVSA 3IBEA 4J7WA 4B93B 1MJ0A 1IHGA 1BI7B 3HYMB 3ZNGA 3FU0A 2WXHA 3PUKA 2B6CA 3RSEG 1O5MA 3UUXA 4XI0A 4JL0A 3AG3E 3Q9NC 2XS8A 3NAWA 2R05A 3QC1A 3JQ0A 3AJIA 4GTTA 3LY7A 4I6GA 3VLEA 1UJJA 1W3BA 3SGHA 1N52A 2FBNA 5KJKA 1NP7A 2QYJA 1QYMA 4I9CA 1H2TC 3TXMA 3FTUA 4GZ6A 2DIWA 3FTVA 3OXFA 1LD8A 2A5EA 5LCWJ 4JA7A 2XGSA 2ZGGA 4TRQA 2QY7A 3E33A 3ULEG 2P9PG 5AIJA 5ENQD 3PDNA 3QK0A 4NQ0A 3D9NA 2ZISA 5C2YA 2WXIA 3FTWA 3AS8A 3CGHA 5ENNA 1TNZA 4GA0A 3AAAC 3TWSA 1H19A 1SQMA 3CV0A 3R7QA 3ZEFA 3UINC 4ILGA 5AN8A 1E96B 2X6JA 3ULQA 4UWHA 4G24A 2WPVA 4WWPA 4HRNA 1E8ZA 3DPDA 1HG2A 3E34A 2CHWA 2F37A 4FJYA 4L9PA 5AARA 3PUJA 5AENA 2RKKA 3D9IA 1RW2A 5EYPF 1AP7A 3PZ2A 2OVBA 1SZ9A 3ZYMA 3FUKA 3UPVA 3E4BA 3ZYQA 3EJNA 2EQXA 3DXKG 2WQ7A 1KZPA 4MRUA 1UW4B 4JB8P 3T9KA 3Q4AB 1H2VC 2VSYA 3FFLA 2Y69E 1Z6TA 5ARGA 4YDWA 4LNBA 2Y4UA 2GRQB 2H6GA 3HXEA 4I43A 1PY1A 3VLDA 1U3CA 4KT6B 1BI8B 1VDYA 4UWLA 3APDA 3MV2B 1HZ4A 4LRZA 3ZIMA 2J4BA 2WB2A 3I3NA 2I2OA 2OEVA 4N2QA 2IOSA 3ABME 3FUMA 3CK7A 2BKKB 1E7UA 3U64A 4YDYA 2IEJA 2XZDG 1ZB1A 2V8SE 1H6OA 4NURA 3TWVA 4A1SA 3ZHEB 4WAFA 2PNNA 2Y3AA 1OWLA 4GZ3A 3NBNB 4HOSA 1WG0A 3P1UA 1JWGA 3UKUG 3D9HA 5KNHD 4EBAA 2XEEA 3CVPA 1OUVA 1HFAA 3HVEA 3FHEA 4GU5A 5FJYA 2LAIA 3RRMB 5AAOA 1G3NB 4WNGA 2KATA 3SBTB 2WXMA 5JJ7A 3S7BA 2AVPA 4N2SA 4K5AB 5B3SE 4KZ0A 4GZCA 2P58C 1UOHA 1NI1A 5CEDB 5BPPA 1X5BA 3QWWA 3FP3A 4C0EA 3LYAA 3AS4A 3ZU7B 2DBAA 5FT9A 3QDNA 1V54E 4JC8A 4XI9A 3NOCD 1U3DA 2AXUA 4GZDA 4HRMB 4OVUA 1Y6IA 4J8DA 3UTMA 1TN7A 1DVPA 1EYHA 2ZGDA 2VJ8A 5AQ9A 2X3MA 3APFA 4JHRA 4L7TA 2BF0X 2KZTA 4I1AA 4RG6A 3JXJA 2V4HC 4TUUA 3CLJA 4MS6A 2HR2A 3TG5A 4CGWA 2J09A 2RFMA 4P29A 4ATGA 1JPLA 1YMPA 3JUEA 4CDRA 5CCLA 3SBSA 4AM9A 2PL2A 2JLBA 1FCHA 5G04C 4GTPA 4BY6A 5EN5D 5EX3A 1FT1A 3MV3B 4FC8A 2ETCA 3DSWA 4GPKA 2PQRA 1E90A 3ZXPA 2P9KG 2GRLA 3G2TA 3LY9A 4ANWA 2XGOA 4G8KA 2IO2C 4EZJA 2EIME 2WQHA 4OAVB 2FF4A 4F6RD 1IYGA 5BW8C 3FH8A 4UUCA 2JEKA 5FINA 2J08A 4UQZA 3BQOA 1TN6A 2Y4TA 2DYSE 3MA5A 2OV8A 3UM3A 2L9BA 3ZVVA 4URKA 3RIBA 3NF1A 2BKGA 2RD0A 4DJAA 5BT1A 4GCNA 4AV7A 1S70B 3RO3A 5FTPA 2X6KA 1NA3A 1IXVA 2CFZA 3HXBA 1H6KA 5C1DA 5AJLA 5AQ7A 5FQ6A 4O60A 4JZYA 2IQCA 4K03A 4FHKA 1N9AA 3L16A 4U8HA 3MKRA 2A5UA 4X8QA 3ONLA 3ONKA 4B94A 3URZA 3OXLA 2WXLA 4OYSA 4F1SA 4GA2A 5FQ7A 3T5XA 4FULA 2L6JA 2WMOA 4GMLA 3MKQB 1WM5A 3FTSA 3ASFA 3E37A 2XRYA 4ATZD 5CRUA 4O1PA 3UX4A 3DSXA 4Y6WA 3Q9UC 3BUAA 3AG4E 2LSVA 3EU5A 4UWGA 2R17C 4U8VD 4DLOA 2I6HA 3LS8A 4KVMA 4GCOA 2R2LA 5ENPD 3P2BA 2J07A 5T8IA 3G2VA 4DI3A 2J4DA 1RZ4A 3SY2A 1NL4A 3LJNA 3UM0A 2KCVA 4K5BA 1XNFA 5JHBA 4FA6A 1OCRE 2EIKE 3VLFA 4ABNA 2VTBA 3RJVA 5D0OD 2IONA 3AU4A 3GYZA 3Q79A 3MZLB 3RAUA 3CHRA 3Q5MA 5LP0A 2C0LA 3G2UA 4NRHB 3UXGA 3HRAA 1Y8MA 3CK8A 4C48B 3FU3A 4MLPA 4AY5A 2E0IA 2DZOA 3UKRG 3L54A 2WXQA 3AU5A 1P5QA 1DNPA 2P9UG 4G2VA 3FEXA 3ABKE 3UIOC 2R03A 1ZU2A 3T5VA 1LTXA 5T4YA 3CVVA 3LKUA 2DYRE 4I9EA 4ZHBA 4HORA 4GTVA 2FI7A 4ANUA 2NC9A 3SI5A 3CK9A 4FADA 3PVLA 4DX2A 3L82A 2YNQA 2OVFA 2V4LA 3QWPA 4AJWA 3FUNA 1KZOA 2XPYA 1N0QA 4ILHB 2MYOA 4TXQA 4BSZB 4DX1A 5CMWA 3OXGA 3FU5A 3L13A 4WNEA 2MOWA 4AVXA 3PE4A 3QARA 4GYWA 4ACKA 5EYLA 5ANRA 3RU0A 3B13A 4RQIA 4ILIA 3LDZA 4HOUA 2MHKA 2KCLA 3C3OA 2QYUA 4AXHA 5FZRA 4ME2A 3BG0B 3SFYA 1L5JA 3X2QE 1TJCA 4HNAD 3E30A 4WNFA 4A3TA 3OTNA 3L22A 4XEIG 3HHMA 5B1BE 4I2ZA 3FUIA 1Z5SC 2FO7A 3MCXA 4NIKA 2V0PA 4DUIA 4K0RA 3RK6A 4YVOA 3JUIA 3HIZA 5DBKA 4KVOA 2ZIRA 3ISMC 3TL5A 3LEWA 5JHAA 4BWRA 3W9GA 3JYSA 1H0AA 3QOUA 2PQNA 2YINA 3B95A 4DK5A 4Z68A 4ANXA 2CG2A 1MZCA 3I4RB 4U0SA 2XPZA 3IXEA 5JA4D 4U07A 2H6IA 4M3OA 3I5PA 3S7JA 3TWTA 3DXMG 3R9MA 5BV1A 4PUCA 2R5SA 5HI7A 5G05J 5LOZA 4YDOA 3E32A 5FIOA 3Q73A 4GMJA 3WG7E 4BX9A 1OWMA 2WQ6A 2HYZA 3TWRA 3ZFWA 5FQ8A 3APCA 2CHZA 1N4RA 1N54A 2QC9A 3Q7AA 4V3IA 3S2AA 3G2SA 4JXTA 4U04A 2XRZA 4H7XA 4BETA 1MX4A 3FTYA 3OAWA 4UWKA 5EDSA 5HKPA 3CQCB 2DWZA 1JCQA 3W9FA 4B0ZA 4WWNA 2IJGX 4UI9C 3EHNA 2LSUA 2VGXB 4I1OB 3Q78A 1N94A 3KS2A 4LNGA 4OVVA 3O48A 3SFZA 2KZTB 1UN9A 1HXIA 4CCAA 2XCCA 2XPIA 4XKCA 1MYOA 3C72A 3BG1B 3CQGB 2WXPA 2QZAA 3CVNA 4CT4A 4EZLA 3CR3A 2I9CA 2KC7A 3ASDA 3PZ4A 1U2VG 2KM4A 4GPMA 3V2XA 4TV3A 4ANVA 3Q7FA 4EZKA 4CDMA 3ZHEA 2M63A 2AWIA 4W9RA 4J8SA 3B7BA 3U3WA 1DCEA 1JCSA 3Q75A 3PH0C 4J6IA 3TG4A 2J49A 4O1OA 2J9QA 2EIJE 2UY1B 1MX2A 2GRPB 2DVWA 1PAQA 1UJKA 3C3RA 3FH5A 1HX8A 5FWQA 5KJNA 2P9NG 3L9TA 3L6AA 3CHPA 3ML9A 1JUQA 3FEYA 3DEPA 1GW6A 1NZNA 1WAO1 5LCWC 3ENEA 3EHQA 3TGOA 4U63A 4XZ4A 1D9SA 2WXKA 2IO3C 4F53A 4HI8A 2R59A 5CHEE 4BSXA 3KSQA 1DCQA 5FZQA 5ENSD 4N3AA 1E8YA 2H6HA 3PZDA 5KJMA 4H7YA 3SNXA 4G8LA 3S7FA 4BFRA 1FPPA 3MX3A 2I1JA 3TWXA 3D9OA 5HRYA 4DX5D 2VSNA 2VYIA 4J8FA 3D9PA 2J8SD 5ARFA 3CVUA 3D9KA 1FVFA 2OOEA 3DSTA 2BEDA 3IKOB 5IY5E 1O1SA 3CHMA 1EDUA 3U9WA 2HO1A 4A63B 3JXIA 1QQEA 4N3CA 4RSYA 4J0UA 4C0MA 3CKBA 4N39A 2WXOA 5DIZA 3PE3A 3RO2A 4UI9K 4GTQA 2LO6A 4APFA 4MKTA 4RG9A 2ZU6B 2GROB 1TR4A 2LXMA 2I1KA 4PDXA 4KZCA 1N95A 5LFAA 3ZXSA 2LNIA 5AQAA 3WXXA 3SQVA 1OY3D 2KXPC 3G2WA 3DPYA 4GZ5A 4GYOA 4FJZA 2R02A 2WXGA 2QFCA 4FHJA 1OWOA 4G23A 4XX5A 4BT8A 4UQYA 1TNOA 3L08A 4G26A 4DPRA 5G05C 2A4ZA 4U0UA 2MRIA 3D9MA 4JD2G 4IN3B 4JHJA 1XGWA 3ASHA 4KXKB 3NOGD 1TNBA 3C98A 1FVHA 4DRXE 1A17A 4BX8A 3FUDA 5BXUA 3ML8A 2GGFA 2L0IA 3FUFA 5KJLA 3EHRA 3PRZA 1ELWA 3IHVA 4AOFA 2GW1A 4YVQC 3PZ3A 2VGEA 1H6PA 3IEGA 2AW6A 4UQXA 4DX7D 3D9JA 4J8EA 2C2LA 4GTOA 3UQ3A 3VTXA 4PS3A 3ZPJA 3QJZA 4MBGA 2CHXA 4NACA 2KCKA 4BTAA 1S64A 3PEVB 2F8XK 2F0YA 4LCTA 4HLEA 3CVQA 4FLBA 4EPZA 3MGBA 3BEEA 4HBDA 2P2CP 5D2MC 4BERA 2IFUA 4APOA 4BTBA 3NB2A 4AY6A 3QWVA 1OCCE 1JCRA 3T8KA 2PM7A 2EINE 1HF8A 1YCSB 4HXIA 4WUYA 2LXLA 4HOQA 4LERA 2RG8A 4N5CA 4HOTA 4A55A 3Q15A 4OAUC 4ACLA 3DEOA 3ASOE 3GZ2A 4FLHA 1HU3A 5KWDA 1HH8A 5KCMA 3FY4A 4N3BA 5CMYA 3UT7A 4ZFHA 4JEUA 1BLXB 2WXJA 4G25A 1IHBA 3LVRE 3PEUB 1SA4A 3MEKA 5ENTD 4B89A 4CEMA 1HO8A 4KYOB 3SD5A 3ZGQA 3NZSA 5BNWA 5EX0A 4GTRA 5EIDA 1TEZA 4I1MA 1N0RA 1O1RA 1V55E 1EF1C 2UWJG 1N4PA 2WM9A 4LSZE 5G2NA 3KD7A 5M72A 2BTDA 5E75A 1OCZE 4CZ2D 3DBSA 3CHSA 2X38A 4U0ZA 4JA9A 5G04J 4B8CB 4HI9A 4F7AA 1QNFA 3HXCA 4I6EA 5JJTA 2AXVA 4E6HA 3FTZA 4LG6A 5FZSA 3ZN3A 3ZYLA 4TUMA 4N5QA 3EU9A 2GRNB 5HS0A 3B7SA 3ASGA 3HG0D 3CVYA 2NXPA 3FWVA 3IV0A 3CVWA 3NZUA 4RVBA 3PNTB 4HVBA 2PZIA 4JEHA 4DLQA 3T8MA 4XE0A 3HXDA 2L6BA 2ETBA 4L2LA 4JPSA 3L17A 1OWNA 2DZNA 3LPZA 5H7PA 2KBXA 3GW4A 3EDTB 1N4QA 5CBNA 5FQ4A 2ZXWE 1LD7A 3F6QA 3UIPC 4GTMA 2P9LG 4HRLA 5J90A 3V31A 5KNGA 3JCKC 1WY6A 3JQ1A 4HB5A 1B89A 4F3VA 3ZKJA 2VSXE 3HVEB 3DRAA 2VSOE 4YDEA 4TXRA 3FU6A 3DSUA 2ETAA 1UN8A 3CEQA 1KT1A 3U66A 1TJFA 4PS8A 3FULA 1NA0A 4R7LA 3TWUA 2XQ0A 5CEAA 3MYVA 1INZA 1K1AA 1O1TA 4LNUD 2ILRA 1SVXA 2P9IG 5G55A 1TNUA 5B1AE 4Y6CA 3KEAA 4K5CA 1HS6A 2LAHA 3UI2A 2ONDA 5BUZA 3DSSA 2EILE 5BXOA 2GRRB 3LCAA 3LXUX 3R7RA 4IYPA 2JABA 4BEPA 2X6HA 3ESLA 5LX8A 1IQUA 4GA1A 1X81A 5A7DB 2XEVA 4LUNU 5KBAA 5A6CA 4HQDA 2BUGA 1OWPA 3FDHA 3EHMA 4D10C 3CKCA 1LF8A 4Q94A 1K1BA 3PS6A 2WXNA 4QQIA 3SHFA 1YYHA 4HS2A 3EIQC 1E8WA 4A3VA 2V5FA 4EECA 5T3RA 3GZ1A 3UT8A 4GB9A 1WDYA 3MJWA 2HM8A 4L23A 1PC2A 3TAXA 2Y0BG 4BT9A 4AEZC 1S0PA 2XGMA 1S63A 3BU8A 4HLLA 4GYYA 2Q7FA 4GMRA 2IU1A 2CFUA 5EKQD 3RKVA 2E2EA 1FT2A 3UM1A 3QAQA 3UT4A 2L0TB 4KMOA 4RLYA 3AG1E 3J5PA 1EPUA 3TXNA 5AYWD 3D9LA 3O4ZA 4PH4B 5JJ6A 4EHMA 4CYMD 2H6FA 2NYJA 2P9SG 2WXRA 1Q2ZA 3ASNE 3B7TA 4U95D 3I4GA 4DX6D 1QBQA 2VGXA 1KT0A 1ELKA 5JMND 3EUVA 1BD8A 3Q47B 3C3QA 5EILA 3TWWA 1YA0A 5ANLA 1UG3A 4FU3A 2X6FA 1MHQA 4EQFA 4IRUA 3GZSA 1BPOA 4JW1A 5ENRD 5CECB 5J08A 1H2UA 2AXZA 1MX6A 1E8XA 1OCOE 5CBOA 4F1PA 1NFIE 2PM6A 4CRWA 1K3ZD 4GAAA 4I6JA 1D8EA 4L2YA 2FEZA 2C0MA 2IY0C 3UM2A 4IULA 2CG3A 3CVXA 5ITZF 3ABLE 1ELRA 3QKYA 1KLXA 3TWQA 2FO1E 2WXFA 3B7UX 3U4TA 4L1BA 4G11A 3LJ3A 2UY1A 4WNDA 1D8DA 4WWOA 3SF4A 2IOLA 5D0QD 2F8YA 3RRUA 3CVLA 2OCCE 3SO8A 4M7CA 4BESA 1TN8A 4TXPA 4XIFA 2NSZA 1SZAA 4C9BB 3ZUVB 3IHYA 3KEZA 2Y1LE 4XKBA 3FH7A 3S7DA 4Q96A 2XS1A 3DSVA 1AWCB 3V2OA 2OEWA 2RFAA 3C5RA 1OXJA 4JHKA 2XHEA 4CGVA 1A5EA
chains in the Genus database with same CATH topology
3B95A 4OAUC 1SW6A 2L6BA 5ENQD 4UUCA 5EILA 3TWWA 5FINA 2ETBA 4HQDA 3DEOA 4Z68A 1DCQA 2DZNA 5ENSD 4U96D 2KBXA 5ENPD 5KWDA 1N0QA 4HRMB 1MYOA 2MYOA 3UTMA 4U8YD 3IXEA 2XEHA 5JA4D 5AQBA 3NOGD 1K1BA 1N11A 2ZGDA 4G8LA 5CBNA 3F6QA 3LJNA 3V79K 4K5BA 4QQIA 3TWTA 4DRXE 2XENA 1YYHA 2BKGA 4HRLA 4ZFHA 5CERB 2BKKB 1BLXB 3TWXA 4BSZB 4DX1A 5AQ9A 5ENRD 5CECB 1IHBA 3AAAC 4GPMA 4YDYA 2XZDG 5HRYA 3TWSA 5ENTD 4DX5D 5BXUA 5EIBE 1BU9A 3V31A 1S70B 1MX6A 5AN8A 5KNGA 2HE0A 5ENOD 3TWVA 3V2XA 5CBOA 1DC2A 4F1PA 2J8SD 1NFIE 2PNNA 1K3ZD 1WDYA 2V5QC 3JXJA 4HB5A 1IXVA 5KBAA 2Y0BG 2V4HC 3EHRA 2B0OE 5D66A 3NBNB 1WG0A 5AQ7A 5FIOA 4HRNA 5EYLA 3ZKJA 3D9HA 5KNHD 2RFMA 5EIDA 2VGEA 2XEEA 1N0RA 4HLLA 2F37A 1IKND 3B7BA 4O60A 4J7WA 4B93B 4DX7D 1MJ0A 2ETAA 4A63B 3UXGA 3TWRA 4GMRA 5AARA 5ITZF 3JXIA 4LSZE 3HRAA 1YMPA 3JUEA 1OT8A 1BI7B 3TWQA 3ZNGA 2QC9A 5EYPF 3TWUA 4O1OA 1AP7A 4QFVA 5CEAA 2FO1E 4CZ2D 5AAOA 4C48B 1MX2A 1K1AA 4HNAD 1G3NB 2DVWA 2F8XK 4RLYA 3J5QB 4LNUD 3Q9NC 2XZTG 2AJAA 4HI9A 1SVXA 3J5PA 5EN5D 4BETA 1MX4A 2DZOA 4K5AB 1TR4A 4HBDA 2ETCA 5HKPA 2P2CP 3AJIA 2F8YA 2DWZA 1UOHA 4CYMD 4BERA 3W9FA 5AQAA 3SO8A 4LG6A 4ATZD 4BESA 3KEAA 5CEDB 1OY3D 2KXPC 4K5CA 4DUIA 4NIKA 2QYJA 3UI2A 1QYMA 4TUMA 4JB8P 4N5QA 4O1PA 3T9KA 3EU9A 5HS0A 5BXOA 3T8KA 2NYJA 4YDWA 3ZU7B 3DEPA 3HG0D 4G8KA 3ZUVB 4J8YA 1YCSB 2A5EA 3Q9UC 3EHQA 2JABA 2Y1LE 4BEPA 4U95D 2ZGGA 4ZHBA 1AWCB 1A5EA 3V2OA 1D9SA 2RFAA 4DX6D 3C5RA 4U8VD 3V30A 1BI8B 4OAVB 3W9GA 5JMND 3NOCD 4F6RD 4HI8A 1BD8A 4DX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B95 A;  4OAU C;  1SW6 A;  2L6B A;  5ENQ D;  4UUC A;  5EIL A;  3TWW A;  5FIN A;  2ETB A;  4HQD A;  3DEO A;  4Z68 A;  1DCQ A;  2DZN A;  5ENS D;  4U96 D;  2KBX A;  5ENP D;  5KWD A;  1N0Q A;  4HRM B;  1MYO A;  2MYO A;  3UTM A;  4U8Y D;  3IXE A;  2XEH A;  5JA4 D;  5AQB A;  3NOG D;  1K1B A;  1N11 A;  2ZGD A;  4G8L A;  5CBN A;  3F6Q A;  3LJN A;  3V79 K;  4K5B A;  4QQI A;  3TWT A;  4DRX E;  2XEN A;  1YYH A;  2BKG A;  4HRL A;  4ZFH A;  5CER B;  2BKK B;  1BLX B;  3TWX A;  4BSZ B;  4DX1 A;  5AQ9 A;  5ENR D;  5CEC B;  1IHB A;  3AAA C;  4GPM A;  4YDY A;  2XZD G;  5HRY A;  3TWS A;  5ENT D;  4DX5 D;  5BXU A;  5EIB E;  1BU9 A;  3V31 A;  1S70 B;  1MX6 A;  5AN8 A;  5KNG A;  2HE0 A;  5ENO D;  3TWV A;  3V2X A;  5CBO A;  1DC2 A;  4F1P A;  2J8S D;  1NFI E;  2PNN A;  1K3Z D;  1WDY A;  2V5Q C;  3JXJ A;  4HB5 A;  1IXV A;  5KBA A;  2Y0B G;  2V4H C;  3EHR A;  2B0O E;  5D66 A;  3NBN B;  1WG0 A;  5AQ7 A;  5FIO A;  4HRN A;  5EYL A;  3ZKJ A;  3D9H A;  5KNH D;  2RFM A;  5EID A;  2VGE A;  2XEE A;  1N0R A;  4HLL A;  2F37 A;  1IKN D;  3B7B A;  4O60 A;  4J7W A;  4B93 B;  4DX7 D;  1MJ0 A;  2ETA A;  4A63 B;  3UXG A;  3TWR A;  4GMR A;  5AAR A;  5ITZ F;  3JXI A;  4LSZ E;  3HRA A;  1YMP A;  3JUE A;  1OT8 A;  1BI7 B;  3TWQ A;  3ZNG A;  2QC9 A;  5EYP F;  3TWU A;  4O1O A;  1AP7 A;  4QFV A;  5CEA A;  2FO1 E;  4CZ2 D;  5AAO A;  4C48 B;  1MX2 A;  1K1A A;  4HNA D;  1G3N B;  2DVW A;  2F8X K;  4RLY A;  3J5Q B;  4LNU D;  3Q9N C;  2XZT G;  2AJA A;  4HI9 A;  1SVX A;  3J5P A;  5EN5 D;  4BET A;  1MX4 A;  2DZO A;  4K5A B;  1TR4 A;  4HBD A;  2ETC A;  5HKP A;  2P2C P;  3AJI A;  2F8Y A;  2DWZ A;  1UOH A;  4CYM D;  4BER A;  3W9F A;  5AQA A;  3SO8 A;  4LG6 A;  4ATZ D;  4BES A;  3KEA A;  5CED B;  1OY3 D;  2KXP C;  4K5C A;  4DUI A;  4NIK A;  2QYJ A;  3UI2 A;  1QYM A;  4TUM A;  4JB8 P;  4N5Q A;  4O1P A;  3T9K A;  3EU9 A;  5HS0 A;  5BXO A;  3T8K A;  2NYJ A;  4YDW A;  3ZU7 B;  3DEP A;  3HG0 D;  4G8K A;  3ZUV B;  4J8Y A;  1YCS B;  2A5E A;  3Q9U C;  3EHQ A;  2JAB A;  2Y1L E;  4BEP A;  4U95 D;  2ZGG A;  4ZHB A;  1AWC B;  1A5E A;  3V2O A;  1D9S A;  2RFA A;  4DX6 D;  3C5R A;  4U8V D;  3V30 A;  1BI8 B;  4OAV B;  3W9G A;  5JMN D;  3NOC D;  4F6R D;  4HI8 A;  1BD8 A;  4DX2 A; 
#chains in the Genus database with same CATH topology
 3LVQ E;  3FUJ A;  3ZRH A;  4U96 D;  2XEH A;  4U7E B;  4AIF A;  3Q49 B;  3V79 K;  4DI4 A;  2XEN A;  4GTS A;  5CER B;  2VTB B;  2VQ2 A;  2WVI A;  4E85 A;  2YQ8 A;  5ENO D;  4KBQ A;  3R9A B;  3FUE A;  3DWL G;  4HFG A;  2V5Q C;  2YHE A;  3FUH A;  3ESK A;  3PRE A;  4YND A;  2B0O E;  5D66 A;  5CRV A;  3AS5 A;  1ZBP A;  3PNL B;  3PZ1 A;  3B7R L;  3FTX A;  1OT8 A;  3CSF A;  4QFV A;  4EBA G;  1QZ2 A;  1HE8 A;  3HDX A;  3UMV A;  3EIJ A;  3J5Q B;  2XZT G;  2AJA A;  5E76 A;  5HQ8 A;  2YHC A;  3QNK A;  1Z3Y A;  4I17 A;  4G1T A;  4PS7 A;  3TJP A;  3RRN B;  5AJD A;  1MQS A;  5BV0 A;  2GRM A;  2FUL A;  1N4S A;  3K9I A;  4A1G A;  4CT0 A;  4UI9 J;  1SA5 A;  3QB2 A;  2WMN A;  3LY8 A;  4J8Y A;  3HXF A;  2IF4 A;  4LEU A;  4FP7 A;  3SZ7 A;  1KPS B;  3CST A;  1IQR A;  3V30 A;  1JWF A;  3CIA A;  1TYQ G;  4I2W A;  4AP2 A;  1SW6 A;  2LUH A;  4CDN A;  1K8K G;  3KSL A;  2DCP A;  3MKQ A;  4Q69 A;  1Z3X A;  3N71 A;  4U8Y D;  3D3M A;  5AQB A;  3VTY A;  1E7V A;  1N11 A;  3ZW3 A;  3KAE A;  3ZYK A;  5EIB E;  3NQP A;  1BU9 A;  5A23 A;  1TNY A;  3SFX A;  3ULY A;  5CCM A;  3CHQ A;  2HE0 A;  1DC2 A;  2XCB A;  1HG5 A;  4B8A A;  2VGY A;  3AG2 E;  3CHO A;  4O6F A;  2X6I A;  4UWF A;  1IKN D;  4JVS A;  3IBE A;  4J7W A;  4B93 B;  1MJ0 A;  1IHG A;  1BI7 B;  3HYM B;  3ZNG A;  3FU0 A;  2WXH A;  3PUK A;  2B6C A;  3RSE G;  1O5M A;  3UUX A;  4XI0 A;  4JL0 A;  3AG3 E;  3Q9N C;  2XS8 A;  3NAW A;  2R05 A;  3QC1 A;  3JQ0 A;  3AJI A;  4GTT A;  3LY7 A;  4I6G A;  3VLE A;  1UJJ A;  1W3B A;  3SGH A;  1N52 A;  2FBN A;  5KJK A;  1NP7 A;  2QYJ A;  1QYM A;  4I9C A;  1H2T C;  3TXM A;  3FTU A;  4GZ6 A;  2DIW A;  3FTV A;  3OXF A;  1LD8 A;  2A5E A;  5LCW J;  4JA7 A;  2XGS A;  2ZGG A;  4TRQ A;  2QY7 A;  3E33 A;  3ULE G;  2P9P G;  5AIJ A;  5ENQ D;  3PDN A;  3QK0 A;  4NQ0 A;  3D9N A;  2ZIS A;  5C2Y A;  2WXI A;  3FTW A;  3AS8 A;  3CGH A;  5ENN A;  1TNZ A;  4GA0 A;  3AAA C;  3TWS A;  1H19 A;  1SQM A;  3CV0 A;  3R7Q A;  3ZEF A;  3UIN C;  4ILG A;  5AN8 A;  1E96 B;  2X6J A;  3ULQ A;  4UWH A;  4G24 A;  2WPV A;  4WWP A;  4HRN A;  1E8Z A;  3DPD A;  1HG2 A;  3E34 A;  2CHW A;  2F37 A;  4FJY A;  4L9P A;  5AAR A;  3PUJ A;  5AEN A;  2RKK A;  3D9I A;  1RW2 A;  5EYP F;  1AP7 A;  3PZ2 A;  2OVB A;  1SZ9 A;  3ZYM A;  3FUK A;  3UPV A;  3E4B A;  3ZYQ A;  3EJN A;  2EQX A;  3DXK G;  2WQ7 A;  1KZP A;  4MRU A;  1UW4 B;  4JB8 P;  3T9K A;  3Q4A B;  1H2V C;  2VSY A;  3FFL A;  2Y69 E;  1Z6T A;  5ARG A;  4YDW A;  4LNB A;  2Y4U A;  2GRQ B;  2H6G A;  3HXE A;  4I43 A;  1PY1 A;  3VLD A;  1U3C A;  4KT6 B;  1BI8 B;  1VDY A;  4UWL A;  3APD A;  3MV2 B;  1HZ4 A;  4LRZ A;  3ZIM A;  2J4B A;  2WB2 A;  3I3N A;  2I2O A;  2OEV A;  4N2Q A;  2IOS A;  3ABM E;  3FUM A;  3CK7 A;  2BKK B;  1E7U A;  3U64 A;  4YDY A;  2IEJ A;  2XZD G;  1ZB1 A;  2V8S E;  1H6O A;  4NUR A;  3TWV A;  4A1S A;  3ZHE B;  4WAF A;  2PNN A;  2Y3A A;  1OWL A;  4GZ3 A;  3NBN B;  4HOS A;  1WG0 A;  3P1U A;  1JWG A;  3UKU G;  3D9H A;  5KNH D;  4EBA A;  2XEE A;  3CVP A;  1OUV A;  1HFA A;  3HVE A;  3FHE A;  4GU5 A;  5FJY A;  2LAI A;  3RRM B;  5AAO A;  1G3N B;  4WNG A;  2KAT A;  3SBT B;  2WXM A;  5JJ7 A;  3S7B A;  2AVP A;  4N2S A;  4K5A B;  5B3S E;  4KZ0 A;  4GZC A;  2P58 C;  1UOH A;  1NI1 A;  5CED B;  5BPP A;  1X5B A;  3QWW A;  3FP3 A;  4C0E A;  3LYA A;  3AS4 A;  3ZU7 B;  2DBA A;  5FT9 A;  3QDN A;  1V54 E;  4JC8 A;  4XI9 A;  3NOC D;  1U3D A;  2AXU A;  4GZD A;  4HRM B;  4OVU A;  1Y6I A;  4J8D A;  3UTM A;  1TN7 A;  1DVP A;  1EYH A;  2ZGD A;  2VJ8 A;  5AQ9 A;  2X3M A;  3APF A;  4JHR A;  4L7T A;  2BF0 X;  2KZT A;  4I1A A;  4RG6 A;  3JXJ A;  2V4H C;  4TUU A;  3CLJ A;  4MS6 A;  2HR2 A;  3TG5 A;  4CGW A;  2J09 A;  2RFM A;  4P29 A;  4ATG A;  1JPL A;  1YMP A;  3JUE A;  4CDR A;  5CCL A;  3SBS A;  4AM9 A;  2PL2 A;  2JLB A;  1FCH A;  5G04 C;  4GTP A;  4BY6 A;  5EN5 D;  5EX3 A;  1FT1 A;  3MV3 B;  4FC8 A;  2ETC A;  3DSW A;  4GPK A;  2PQR A;  1E90 A;  3ZXP A;  2P9K G;  2GRL A;  3G2T A;  3LY9 A;  4ANW A;  2XGO A;  4G8K A;  2IO2 C;  4EZJ A;  2EIM E;  2WQH A;  4OAV B;  2FF4 A;  4F6R D;  1IYG A;  5BW8 C;  3FH8 A;  4UUC A;  2JEK A;  5FIN A;  2J08 A;  4UQZ A;  3BQO A;  1TN6 A;  2Y4T A;  2DYS E;  3MA5 A;  2OV8 A;  3UM3 A;  2L9B A;  3ZVV A;  4URK A;  3RIB A;  3NF1 A;  2BKG A;  2RD0 A;  4DJA A;  5BT1 A;  4GCN A;  4AV7 A;  1S70 B;  3RO3 A;  5FTP A;  2X6K A;  1NA3 A;  1IXV A;  2CFZ A;  3HXB A;  1H6K A;  5C1D A;  5AJL A;  5AQ7 A;  5FQ6 A;  4O60 A;  4JZY A;  2IQC A;  4K03 A;  4FHK A;  1N9A A;  3L16 A;  4U8H A;  3MKR A;  2A5U A;  4X8Q A;  3ONL A;  3ONK A;  4B94 A;  3URZ A;  3OXL A;  2WXL A;  4OYS A;  4F1S A;  4GA2 A;  5FQ7 A;  3T5X A;  4FUL A;  2L6J A;  2WMO A;  4GML A;  3MKQ B;  1WM5 A;  3FTS A;  3ASF A;  3E37 A;  2XRY A;  4ATZ D;  5CRU A;  4O1P A;  3UX4 A;  3DSX A;  4Y6W A;  3Q9U C;  3BUA A;  3AG4 E;  2LSV A;  3EU5 A;  4UWG A;  2R17 C;  4U8V D;  4DLO A;  2I6H A;  3LS8 A;  4KVM A;  4GCO A;  2R2L A;  5ENP D;  3P2B A;  2J07 A;  5T8I A;  3G2V A;  4DI3 A;  2J4D A;  1RZ4 A;  3SY2 A;  1NL4 A;  3LJN A;  3UM0 A;  2KCV A;  4K5B A;  1XNF A;  5JHB A;  4FA6 A;  1OCR E;  2EIK E;  3VLF A;  4ABN A;  2VTB A;  3RJV A;  5D0O D;  2ION A;  3AU4 A;  3GYZ A;  3Q79 A;  3MZL B;  3RAU A;  3CHR A;  3Q5M A;  5LP0 A;  2C0L A;  3G2U A;  4NRH B;  3UXG A;  3HRA A;  1Y8M A;  3CK8 A;  4C48 B;  3FU3 A;  4MLP A;  4AY5 A;  2E0I A;  2DZO A;  3UKR G;  3L54 A;  2WXQ A;  3AU5 A;  1P5Q A;  1DNP A;  2P9U G;  4G2V A;  3FEX A;  3ABK E;  3UIO C;  2R03 A;  1ZU2 A;  3T5V A;  1LTX A;  5T4Y A;  3CVV A;  3LKU A;  2DYR E;  4I9E A;  4ZHB A;  4HOR A;  4GTV A;  2FI7 A;  4ANU A;  2NC9 A;  3SI5 A;  3CK9 A;  4FAD A;  3PVL A;  4DX2 A;  3L82 A;  2YNQ A;  2OVF A;  2V4L A;  3QWP A;  4AJW A;  3FUN A;  1KZO A;  2XPY A;  1N0Q A;  4ILH B;  2MYO A;  4TXQ A;  4BSZ B;  4DX1 A;  5CMW A;  3OXG A;  3FU5 A;  3L13 A;  4WNE A;  2MOW A;  4AVX A;  3PE4 A;  3QAR A;  4GYW A;  4ACK A;  5EYL A;  5ANR A;  3RU0 A;  3B13 A;  4RQI A;  4ILI A;  3LDZ A;  4HOU A;  2MHK A;  2KCL A;  3C3O A;  2QYU A;  4AXH A;  5FZR A;  4ME2 A;  3BG0 B;  3SFY A;  1L5J A;  3X2Q E;  1TJC A;  4HNA D;  3E30 A;  4WNF A;  4A3T A;  3OTN A;  3L22 A;  4XEI G;  3HHM A;  5B1B E;  4I2Z A;  3FUI A;  1Z5S C;  2FO7 A;  3MCX A;  4NIK A;  2V0P A;  4DUI A;  4K0R A;  3RK6 A;  4YVO A;  3JUI A;  3HIZ A;  5DBK A;  4KVO A;  2ZIR A;  3ISM C;  3TL5 A;  3LEW A;  5JHA A;  4BWR A;  3W9G A;  3JYS A;  1H0A A;  3QOU A;  2PQN A;  2YIN A;  3B95 A;  4DK5 A;  4Z68 A;  4ANX A;  2CG2 A;  1MZC A;  3I4R B;  4U0S A;  2XPZ A;  3IXE A;  5JA4 D;  4U07 A;  2H6I A;  4M3O A;  3I5P A;  3S7J A;  3TWT A;  3DXM G;  3R9M A;  5BV1 A;  4PUC A;  2R5S A;  5HI7 A;  5G05 J;  5LOZ A;  4YDO A;  3E32 A;  5FIO A;  3Q73 A;  4GMJ A;  3WG7 E;  4BX9 A;  1OWM A;  2WQ6 A;  2HYZ A;  3TWR A;  3ZFW A;  5FQ8 A;  3APC A;  2CHZ A;  1N4R A;  1N54 A;  2QC9 A;  3Q7A A;  4V3I A;  3S2A A;  3G2S A;  4JXT A;  4U04 A;  2XRZ A;  4H7X A;  4BET A;  1MX4 A;  3FTY A;  3OAW A;  4UWK A;  5EDS A;  5HKP A;  3CQC B;  2DWZ A;  1JCQ A;  3W9F A;  4B0Z A;  4WWN A;  2IJG X;  4UI9 C;  3EHN A;  2LSU A;  2VGX B;  4I1O B;  3Q78 A;  1N94 A;  3KS2 A;  4LNG A;  4OVV A;  3O48 A;  3SFZ A;  2KZT B;  1UN9 A;  1HXI A;  4CCA A;  2XCC A;  2XPI A;  4XKC A;  1MYO A;  3C72 A;  3BG1 B;  3CQG B;  2WXP A;  2QZA A;  3CVN A;  4CT4 A;  4EZL A;  3CR3 A;  2I9C A;  2KC7 A;  3ASD A;  3PZ4 A;  1U2V G;  2KM4 A;  4GPM A;  3V2X A;  4TV3 A;  4ANV A;  3Q7F A;  4EZK A;  4CDM A;  3ZHE A;  2M63 A;  2AWI A;  4W9R A;  4J8S A;  3B7B A;  3U3W A;  1DCE A;  1JCS A;  3Q75 A;  3PH0 C;  4J6I A;  3TG4 A;  2J49 A;  4O1O A;  2J9Q A;  2EIJ E;  2UY1 B;  1MX2 A;  2GRP B;  2DVW A;  1PAQ A;  1UJK A;  3C3R A;  3FH5 A;  1HX8 A;  5FWQ A;  5KJN A;  2P9N G;  3L9T A;  3L6A A;  3CHP A;  3ML9 A;  1JUQ A;  3FEY A;  3DEP A;  1GW6 A;  1NZN A;  1WAO 1;  5LCW C;  3ENE A;  3EHQ A;  3TGO A;  4U63 A;  4XZ4 A;  1D9S A;  2WXK A;  2IO3 C;  4F53 A;  4HI8 A;  2R59 A;  5CHE E;  4BSX A;  3KSQ A;  1DCQ A;  5FZQ A;  5ENS D;  4N3A A;  1E8Y A;  2H6H A;  3PZD A;  5KJM A;  4H7Y A;  3SNX A;  4G8L A;  3S7F A;  4BFR A;  1FPP A;  3MX3 A;  2I1J A;  3TWX A;  3D9O A;  5HRY A;  4DX5 D;  2VSN A;  2VYI A;  4J8F A;  3D9P A;  2J8S D;  5ARF A;  3CVU A;  3D9K A;  1FVF A;  2OOE A;  3DST A;  2BED A;  3IKO B;  5IY5 E;  1O1S A;  3CHM A;  1EDU A;  3U9W A;  2HO1 A;  4A63 B;  3JXI A;  1QQE A;  4N3C A;  4RSY A;  4J0U A;  4C0M A;  3CKB A;  4N39 A;  2WXO A;  5DIZ A;  3PE3 A;  3RO2 A;  4UI9 K;  4GTQ A;  2LO6 A;  4APF A;  4MKT A;  4RG9 A;  2ZU6 B;  2GRO B;  1TR4 A;  2LXM A;  2I1K A;  4PDX A;  4KZC A;  1N95 A;  5LFA A;  3ZXS A;  2LNI A;  5AQA A;  3WXX A;  3SQV A;  1OY3 D;  2KXP C;  3G2W A;  3DPY A;  4GZ5 A;  4GYO A;  4FJZ A;  2R02 A;  2WXG A;  2QFC A;  4FHJ A;  1OWO A;  4G23 A;  4XX5 A;  4BT8 A;  4UQY A;  1TNO A;  3L08 A;  4G26 A;  4DPR A;  5G05 C;  2A4Z A;  4U0U A;  2MRI A;  3D9M A;  4JD2 G;  4IN3 B;  4JHJ A;  1XGW A;  3ASH A;  4KXK B;  3NOG D;  1TNB A;  3C98 A;  1FVH A;  4DRX E;  1A17 A;  4BX8 A;  3FUD A;  5BXU A;  3ML8 A;  2GGF A;  2L0I A;  3FUF A;  5KJL A;  3EHR A;  3PRZ A;  1ELW A;  3IHV A;  4AOF A;  2GW1 A;  4YVQ C;  3PZ3 A;  2VGE A;  1H6P A;  3IEG A;  2AW6 A;  4UQX A;  4DX7 D;  3D9J A;  4J8E A;  2C2L A;  4GTO A;  3UQ3 A;  3VTX A;  4PS3 A;  3ZPJ A;  3QJZ A;  4MBG A;  2CHX A;  4NAC A;  2KCK A;  4BTA A;  1S64 A;  3PEV B;  2F8X K;  2F0Y A;  4LCT A;  4HLE A;  3CVQ A;  4FLB A;  4EPZ A;  3MGB A;  3BEE A;  4HBD A;  2P2C P;  5D2M C;  4BER A;  2IFU A;  4APO A;  4BTB A;  3NB2 A;  4AY6 A;  3QWV A;  1OCC E;  1JCR A;  3T8K A;  2PM7 A;  2EIN E;  1HF8 A;  1YCS B;  4HXI A;  4WUY A;  2LXL A;  4HOQ A;  4LER A;  2RG8 A;  4N5C A;  4HOT A;  4A55 A;  3Q15 A;  4OAU C;  4ACL A;  3DEO A;  3ASO E;  3GZ2 A;  4FLH A;  1HU3 A;  5KWD A;  1HH8 A;  5KCM A;  3FY4 A;  4N3B A;  5CMY A;  3UT7 A;  4ZFH A;  4JEU A;  1BLX B;  2WXJ A;  4G25 A;  1IHB A;  3LVR E;  3PEU B;  1SA4 A;  3MEK A;  5ENT D;  4B89 A;  4CEM A;  1HO8 A;  4KYO B;  3SD5 A;  3ZGQ A;  3NZS A;  5BNW A;  5EX0 A;  4GTR A;  5EID A;  1TEZ A;  4I1M A;  1N0R A;  1O1R A;  1V55 E;  1EF1 C;  2UWJ G;  1N4P A;  2WM9 A;  4LSZ E;  5G2N A;  3KD7 A;  5M72 A;  2BTD A;  5E75 A;  1OCZ E;  4CZ2 D;  3DBS A;  3CHS A;  2X38 A;  4U0Z A;  4JA9 A;  5G04 J;  4B8C B;  4HI9 A;  4F7A A;  1QNF A;  3HXC A;  4I6E A;  5JJT A;  2AXV A;  4E6H A;  3FTZ A;  4LG6 A;  5FZS A;  3ZN3 A;  3ZYL A;  4TUM A;  4N5Q A;  3EU9 A;  2GRN B;  5HS0 A;  3B7S A;  3ASG A;  3HG0 D;  3CVY A;  2NXP A;  3FWV A;  3IV0 A;  3CVW A;  3NZU A;  4RVB A;  3PNT B;  4HVB A;  2PZI A;  4JEH A;  4DLQ A;  3T8M A;  4XE0 A;  3HXD A;  2L6B A;  2ETB A;  4L2L A;  4JPS A;  3L17 A;  1OWN A;  2DZN A;  3LPZ A;  5H7P A;  2KBX A;  3GW4 A;  3EDT B;  1N4Q A;  5CBN A;  5FQ4 A;  2ZXW E;  1LD7 A;  3F6Q A;  3UIP C;  4GTM A;  2P9L G;  4HRL A;  5J90 A;  3V31 A;  5KNG A;  3JCK C;  1WY6 A;  3JQ1 A;  4HB5 A;  1B89 A;  4F3V A;  3ZKJ A;  2VSX E;  3HVE B;  3DRA A;  2VSO E;  4YDE A;  4TXR A;  3FU6 A;  3DSU A;  2ETA A;  1UN8 A;  3CEQ A;  1KT1 A;  3U66 A;  1TJF A;  4PS8 A;  3FUL A;  1NA0 A;  4R7L A;  3TWU A;  2XQ0 A;  5CEA A;  3MYV A;  1INZ A;  1K1A A;  1O1T A;  4LNU D;  2ILR A;  1SVX A;  2P9I G;  5G55 A;  1TNU A;  5B1A E;  4Y6C A;  3KEA A;  4K5C A;  1HS6 A;  2LAH A;  3UI2 A;  2OND A;  5BUZ A;  3DSS A;  2EIL E;  5BXO A;  2GRR B;  3LCA A;  3LXU X;  3R7R A;  4IYP A;  2JAB A;  4BEP A;  2X6H A;  3ESL A;  5LX8 A;  1IQU A;  4GA1 A;  1X81 A;  5A7D B;  2XEV A;  4LUN U;  5KBA A;  5A6C A;  4HQD A;  2BUG A;  1OWP A;  3FDH A;  3EHM A;  4D10 C;  3CKC A;  1LF8 A;  4Q94 A;  1K1B A;  3PS6 A;  2WXN A;  4QQI A;  3SHF A;  1YYH A;  4HS2 A;  3EIQ C;  1E8W A;  4A3V A;  2V5F A;  4EEC A;  5T3R A;  3GZ1 A;  3UT8 A;  4GB9 A;  1WDY A;  3MJW A;  2HM8 A;  4L23 A;  1PC2 A;  3TAX A;  2Y0B G;  4BT9 A;  4AEZ C;  1S0P A;  2XGM A;  1S63 A;  3BU8 A;  4HLL A;  4GYY A;  2Q7F A;  4GMR A;  2IU1 A;  2CFU A;  5EKQ D;  3RKV A;  2E2E A;  1FT2 A;  3UM1 A;  3QAQ A;  3UT4 A;  2L0T B;  4KMO A;  4RLY A;  3AG1 E;  3J5P A;  1EPU A;  3TXN A;  5AYW D;  3D9L A;  3O4Z A;  4PH4 B;  5JJ6 A;  4EHM A;  4CYM D;  2H6F A;  2NYJ A;  2P9S G;  2WXR A;  1Q2Z A;  3ASN E;  3B7T A;  4U95 D;  3I4G A;  4DX6 D;  1QBQ A;  2VGX A;  1KT0 A;  1ELK A;  5JMN D;  3EUV A;  1BD8 A;  3Q47 B;  3C3Q A;  5EIL A;  3TWW A;  1YA0 A;  5ANL A;  1UG3 A;  4FU3 A;  2X6F A;  1MHQ A;  4EQF A;  4IRU A;  3GZS A;  1BPO A;  4JW1 A;  5ENR D;  5CEC B;  5J08 A;  1H2U A;  2AXZ A;  1MX6 A;  1E8X A;  1OCO E;  5CBO A;  4F1P A;  1NFI E;  2PM6 A;  4CRW A;  1K3Z D;  4GAA A;  4I6J A;  1D8E A;  4L2Y A;  2FEZ A;  2C0M A;  2IY0 C;  3UM2 A;  4IUL A;  2CG3 A;  3CVX A;  5ITZ F;  3ABL E;  1ELR A;  3QKY A;  1KLX A;  3TWQ A;  2FO1 E;  2WXF A;  3B7U X;  3U4T A;  4L1B A;  4G11 A;  3LJ3 A;  2UY1 A;  4WND A;  1D8D A;  4WWO A;  3SF4 A;  2IOL A;  5D0Q D;  2F8Y A;  3RRU A;  3CVL A;  2OCC E;  3SO8 A;  4M7C A;  4BES A;  1TN8 A;  4TXP A;  4XIF A;  2NSZ A;  1SZA A;  4C9B B;  3ZUV B;  3IHY A;  3KEZ A;  2Y1L E;  4XKB A;  3FH7 A;  3S7D A;  4Q96 A;  2XS1 A;  3DSV A;  1AWC B;  3V2O A;  2OEW A;  2RFA A;  3C5R A;  1OXJ A;  4JHK A;  2XHE A;  4CGV A;  1A5E A; 
#chains in the Genus database with same CATH homology
 3B95 A;  4OAU C;  1SW6 A;  2L6B A;  5ENQ D;  4UUC A;  5EIL A;  3TWW A;  5FIN A;  2ETB A;  4HQD A;  3DEO A;  4Z68 A;  1DCQ A;  2DZN A;  5ENS D;  4U96 D;  2KBX A;  5ENP D;  5KWD A;  1N0Q A;  4HRM B;  1MYO A;  2MYO A;  3UTM A;  4U8Y D;  3IXE A;  2XEH A;  5JA4 D;  5AQB A;  3NOG D;  1K1B A;  1N11 A;  2ZGD A;  4G8L A;  5CBN A;  3F6Q A;  3LJN A;  3V79 K;  4K5B A;  4QQI A;  3TWT A;  4DRX E;  2XEN A;  1YYH A;  2BKG A;  4HRL A;  4ZFH A;  5CER B;  2BKK B;  1BLX B;  3TWX A;  4BSZ B;  4DX1 A;  5AQ9 A;  5ENR D;  5CEC B;  1IHB A;  3AAA C;  4GPM A;  4YDY A;  2XZD G;  5HRY A;  3TWS A;  5ENT D;  4DX5 D;  5BXU A;  5EIB E;  1BU9 A;  3V31 A;  1S70 B;  1MX6 A;  5AN8 A;  5KNG A;  2HE0 A;  5ENO D;  3TWV A;  3V2X A;  5CBO A;  1DC2 A;  4F1P A;  2J8S D;  1NFI E;  2PNN A;  1K3Z D;  1WDY A;  2V5Q C;  3JXJ A;  4HB5 A;  1IXV A;  5KBA A;  2Y0B G;  2V4H C;  3EHR A;  2B0O E;  5D66 A;  3NBN B;  1WG0 A;  5AQ7 A;  5FIO A;  4HRN A;  5EYL A;  3ZKJ A;  3D9H A;  5KNH D;  2RFM A;  5EID A;  2VGE A;  2XEE A;  1N0R A;  4HLL A;  2F37 A;  1IKN D;  3B7B A;  4O60 A;  4J7W A;  4B93 B;  4DX7 D;  1MJ0 A;  2ETA A;  4A63 B;  3UXG A;  3TWR A;  4GMR A;  5AAR A;  5ITZ F;  3JXI A;  4LSZ E;  3HRA A;  1YMP A;  3JUE A;  1OT8 A;  1BI7 B;  3TWQ A;  3ZNG A;  2QC9 A;  5EYP F;  3TWU A;  4O1O A;  1AP7 A;  4QFV A;  5CEA A;  2FO1 E;  4CZ2 D;  5AAO A;  4C48 B;  1MX2 A;  1K1A A;  4HNA D;  1G3N B;  2DVW A;  2F8X K;  4RLY A;  3J5Q B;  4LNU D;  3Q9N C;  2XZT G;  2AJA A;  4HI9 A;  1SVX A;  3J5P A;  5EN5 D;  4BET A;  1MX4 A;  2DZO A;  4K5A B;  1TR4 A;  4HBD A;  2ETC A;  5HKP A;  2P2C P;  3AJI A;  2F8Y A;  2DWZ A;  1UOH A;  4CYM D;  4BER A;  3W9F A;  5AQA A;  3SO8 A;  4LG6 A;  4ATZ D;  4BES A;  3KEA A;  5CED B;  1OY3 D;  2KXP C;  4K5C A;  4DUI A;  4NIK A;  2QYJ A;  3UI2 A;  1QYM A;  4TUM A;  4JB8 P;  4N5Q A;  4O1P A;  3T9K A;  3EU9 A;  5HS0 A;  5BXO A;  3T8K A;  2NYJ A;  4YDW A;  3ZU7 B;  3DEP A;  3HG0 D;  4G8K A;  3ZUV B;  4J8Y A;  1YCS B;  2A5E A;  3Q9U C;  3EHQ A;  2JAB A;  2Y1L E;  4BEP A;  4U95 D;  2ZGG A;  4ZHB A;  1AWC B;  1A5E A;  3V2O A;  1D9S A;  2RFA A;  4DX6 D;  3C5R A;  4U8V D;  3V30 A;  1BI8 B;  4OAV B;  3W9G A;  5JMN D;  3NOC D;  4F6R D;  4HI8 A;  1BD8 A;  4DX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...