2NSZA

1.15 angstrom crystal structure of the ma3 domain of pdcd4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antitumor protein
molecule keywords Programmed cell death protein 4
publication title Structural basis for inhibition of translation by the tumor suppressor Pdcd4.
pubmed doi rcsb
source organism Mus musculus
total genus 54
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nszA00
3FEYA 1N52A 3L6AA 4CRWA 2IU1A 4IULA 4GMLA 1HU3A 1H2VC 4LUNU 2I2OA 5ANRA 3RK6A 2VSXE 3EIQC 4CEMA 2IOSA 4CT4A 1H2UA 1UW4B 2VSOE 4JHJA 3D3MA 2IONA 2KZTB 3EIJA 1UG3A 4B89A 4B8AA 4C9BB 2KZTA 3JUIA 4B8CB 1N54A 3FEXA 4JHKA 4GMJA 2IOLA 2GGFA 2ZU6B 1H6KA 2FULA 2RG8A 2HM8A 1PAQA 2NSZA 1H2TC
chains in the Genus database with same CATH superfamily
3UQ3A 3HHMA 3PREA 2EIKE 2L0IA 3FU5A 2VTBA 1BU9A 1ELRA 2IOSA 3PZ3A 3MKQA 3NF1A 4L2YA 3RO2A 5ENOD 2WXLA 3ZPJA 4BTBA 2WPVA 1RZ4A 3KEZA 2OEVA 3ASDA 1SQMA 3GZ2A 3HRAA 3QARA 2XZDG 3PZ4A 4YDEA 4TXRA 3U66A 1LD8A 3UKUG 4DK5A 4RG9A 3CVPA 4JW1A 4URKA 4HI9A 2DCPA 2FULA 2XPIA 4GU5A 1X81A 2VSXE 4U0SA 5KNGA 2MOWA 2P9NG 3ZUVB 3NZUA 5AENA 3RRNB 3QJZA 4L7TA 1OCCE 3UPVA 1UN9A 3LY7A 2B6CA 4APFA 3RAUA 4N5QA 2XCCA 2P9LG 5BUZA 4KXKB 5EIDA 2EILE 3HIZA 1IYGA 4DI4A 1UG3A 2F8XK 3E30A 5E76A 2AXZA 4AXHA 2X3MA 3L17A 3WG7E 1A5EA 2CFZA 1B89A 3E33A 3EHQA 2IO2C 3Q5MA 3QB2A 4WWNA 4L1BA 3RJVA 4GZDA 3ZXSA 3JXIA 3Q75A 2IOLA 2IFUA 4HORA 4HRNA 1QQEA 4LCTA 2WXIA 1WM5A 2VGXB 2J4DA 3U4TA 1HO8A 3VLDA 4JXTA 2ETBA 3FU3A 2FBNA 1U3CA 4GZ3A 4ACLA 2KXPC 4ILIA 3G2VA 2DIWA 3AG4E 5J08A 3FTUA 3S7DA 1MYOA 2WQHA 3MV2B 1INZA 4Q96A 2ZISA 3VTYA 4K03A 4G2VA 1TJCA 3QNKA 3TWUA 3LYAA 3ZHEB 4I2WA 4L9PA 5CRVA 2CG2A 1H2UA 4DJAA 3NZSA 3ZEFA 4PUCA 1Z3XA 4LNGA 2P9SG 5B1AE 4D10C 4UWLA 4BTAA 4N5CA 1WAO1 3AG1E 4DX5D 1O1RA 4CDNA 4GZ6A 3JUEA 2FEZA 3RRMB 2FI7A 2QYJA 3RSEG 4JHJA 3UM1A 4ABNA 1YMPA 3LKUA 4JB8P 1Z6TA 3MGBA 3G2SA 3V30A 3P2BA 4TXPA 3G2UA 3DSVA 4QQIA 3W9FA 4NRHB 4B93B 3IEGA 4AOFA 2UY1B 3FUJA 4J8DA 4EBAA 4XIFA 3Q15A 3AG2E 1ZBPA 2V5FA 1UN8A 4HI8A 1KZOA 2LO6A 2XEEA 3ASNE 5BV1A 4P29A 3NAWA 2WXRA 2XEVA 3KD7A 5LP0A 2B0OE 4GTTA 5CCMA 5EX3A 3EHMA 4FC8A 4DX1A 4J6IA 3L16A 4HLLA 4NURA 4U95D 3SGHA 4AY5A 5AN8A 5JHBA 1TJFA 3JUIA 3UT4A 2I1JA 3L22A 5JJTA 4GA2A 3ESKA 3PNLB 5LFAA 4XE0A 4FADA 2QY7A 1WDYA 4B8CB 4KVOA 4I1AA 3R9AB 2RD0A 4DRXE 5CEDB 4WWOA 5KBAA 3W9GA 3AS5A 1D9SA 1VDYA 4F6RD 3B7BA 3ASGA 4HOSA 4TV3A 3ML8A 2GRPB 2LSUA 4GTSA 3SFYA 2NYJA 3UTMA 3VTXA 2LXLA 4I17A 5BV0A 2GRRB 1K3ZD 3ZGQA 4CCAA 4CDMA 3U64A 4KYOB 4UI9K 5AJDA 3DXKG 5A7DB 2BUGA 1PC2A 2ZGGA 4AVXA 1LF8A 2R59A 5EN5D 4N3CA 5FQ4A 4GA1A 4I1OB 2R5SA 1U3DA 3LS8A 2WXMA 3FH5A 1D8EA 4CRWA 2VGXA 2QZAA 1TYQG 3I3NA 2HE0A 3CVLA 2F0YA 4EHMA 4FLHA 4HFGA 2EIJE 1FVFA 4C9BB 1NA0A 3HVEB 2C0MA 4F7AA 4KZ0A 4ME2A 4U0ZA 2Y4TA 5KJLA 4U96D 3CEQA 2AW6A 4MKTA 3O48A 5IY5E 3NOGD 4EPZA 2XENA 2KCKA 3UM3A 1O5MA 3ZHEA 1NZNA 2I6HA 5EDSA 1FVHA 3EJNA 2X6JA 4CGVA 3TWVA 4PS3A 3CKCA 3AG3E 4EZLA 2RG8A 3JCKC 2IF4A 2E0IA 1GW6A 4PDXA 3HXBA 1YYHA 3PVLA 2LXMA 4G8KA 1OT8A 3CVYA 4GA0A 4UI9J 3EIJA 2P2CP 3PNTB 4H7XA 4YNDA 3ZYMA 3CSTA 3AU4A 1Z5SC 2UWJG 4H7YA 3FTWA 4BX8A 3FUIA 2AXVA 5T4YA 3D9LA 3UM2A 3FUFA 3LJ3A 5G04J 4U8HA 1A17A 5LCWJ 2UY1A 1KPSB 3E4BA 5B1BE 2IJGX 3OXGA 4NIKA 3ZIMA 2PQNA 3DRAA 3ESLA 1TEZA 4G25A 4GAAA 5HQ8A 4RVBA 3FUDA 2RKKA 4FHJA 3ZRHA 3NB2A 4ILGA 4N2QA 3J5PA 5FWQA 5JJ7A 1LD7A 5CEAA 1XNFA 2P9IG 1E7VA 4KBQA 1TN7A 2I1KA 3NBNB 2BTDA 3D9NA 2XQ0A 3UUXA 2HYZA 3I4RB 4A63B 4J8YA 3MX3A 3R9MA 3FEXA 3RO3A 3SHFA 3C5RA 2ZXWE 4TRQA 3EU5A 4JEUA 4YDOA 2V4LA 3IBEA 2Y69E 3AAAC 5ANLA 4HXIA 3B7TA 4A3VA 3DSTA 4R7LA 2GROB 3JQ1A 2KBXA 2YINA 1N4QA 4PH4B 4YVQC 1N94A 3CVVA 1IHBA 1JCSA 3B7RL 4I9CA 3SZ7A 4OYSA 4C0MA 4GMLA 4HOUA 4CGWA 3MCXA 2PM6A 3QWWA 5BPPA 4MRUA 5DIZA 3BG0B 1YCSB 3I4GA 3UT7A 1SZAA 4HRLA 4ANXA 3L9TA 5FQ6A 4LERA 3TXNA 4DX6D 4LUNU 1NL4A 3MKRA 4FU3A 2MHKA 4UWGA 4I6EA 3EUVA 3T5VA 5T3RA 4WWPA 4O6FA 4BY6A 3L6AA 1EDUA 2RFMA 4WNFA 1MQSA 4YVOA 1E8XA 3PH0C 3C3RA 3HXEA 5ITZF 3FH8A 4AJWA 4I2ZA 3LVQE 2VGEA 3L08A 2J09A 1UOHA 3HVEA 2XRZA 3BEEA 2WXPA 5BT1A 1V54E 1Z3YA 3E32A 1KT0A 2X6KA 2R03A 3DPYA 3TL5A 1Q2ZA 2QC9A 1AWCB 1OY3D 5FTPA 5FT9A 4LG6A 2WXQA 4JA9A 2GRMA 1H6KA 3TG4A 4BWRA 3OXFA 4Y6WA 2VQ2A 2R02A 3PEUB 1EPUA 3VLFA 4DX2A 3GZSA 3V79K 1Y6IA 5ENRD 5HI7A 4GZCA 4GTQA 3FP3A 2OVFA 3J5QB 4U63A 5G05J 1HH8A 5CBOA 4BEPA 3FEYA 2A5UA 2YNQA 3Q9UC 4ILHB 2IEJA 4EECA 3FDHA 1U2VG 3O4ZA 4CT4A 1HX8A 1JCQA 3MJWA 3CK7A 2E2EA 4MLPA 2XPYA 3CLJA 3HXDA 4DUIA 1MZCA 2NC9A 2DYSE 2DZOA 4ACKA 3ZVVA 3QWVA 2WMOA 3ENEA 4GTPA 4RLYA 4PS8A 1MX2A 3SO8A 4O60A 2EINE 1HU3A 1H2VC 4MBGA 3TWQA 4U8VD 3S7BA 3HXFA 2WXJA 4UI9C 4XEIG 3PEVB 2WB2A 2BKKB 4J7WA 1DNPA 2GRNB 4EZKA 4GYWA 1TR4A 2ILRA 3QK0A 1D8DA 1HE8A 4CYMD 3N71A 2HR2A 5EKQD 5G04C 1OWMA 4I9EA 2CG3A 3ZYQA 5LCWC 4FLBA 2A4ZA 4ZFHA 5EX0A 2VSNA 4U04A 2XCBA 3UX4A 2EIME 1H0AA 4J8SA 4HRMB 5T8IA 1X5BA 3ABKE 2WQ7A 3TGOA 1AP7A 3GYZA 4E85A 4O1PA 3TWXA 1JPLA 1V55E 4FJYA 4WNGA 3ONLA 2XS8A 4JHRA 3S2AA 1DVPA 2X38A 1DCQA 2KC7A 4GTRA 4M7CA 2Y4UA 3EU9A 5H7PA 4Q69A 3CR3A 3JQ0A 3D9PA 3L82A 4GCNA 2XS1A 2OV8A 4OAVB 2ZIRA 3K9IA 3T8MA 4A1GA 5CMWA 3IXEA 3SI5A 5JMND 2R05A 2VJ8A 3DPDA 2XZTG 2PNNA 4N39A 1EYHA 2IO3C 3D9KA 3DXMG 4L23A 2KATA 2WQ6A 5AJLA 1E8ZA 2X6IA 5HS0A 3B95A 3PRZA 1QBQA 3TG5A 3HYMB 5AYWD 5AQ9A 1K8KG 4Y6CA 3MV3B 4W9RA 2KZTB 2R2LA 4OVUA 3ABLE 3P1UA 4X8QA 3ZFWA 2NSZA 1E96B 2AXUA 1OWNA 2H6FA 2V8SE 1OWLA 4HLEA 5AQAA 1OUVA 1TNOA 5C1DA 3DWLG 2BF0X 5CRUA 3L13A 2P9PG 2Y1LE 1MX4A 2WXOA 3S7JA 2KM4A 1KLXA 2HM8A 3SNXA 4N3AA 1H2TC 4KVMA 3B13A 3Q49B 3S7FA 2L6JA 2J08A 2M63A 2KCVA 4TUMA 2FO7A 4I6JA 4U07A 3KAEA 2QYUA 3DSSA 4BFRA 3CHSA 3DEPA 4OAUC 1UJJA 1N0RA 4BESA 3U3WA 4U7EB 2NXPA 3CK8A 3T9KA 3I5PA 3FTZA 3FTXA 4WUYA 2AVPA 3KS2A 1MHQA 5D0QD 2H6HA 3CK9A 3DSUA 4JC8A 3PUKA 2ZGDA 4GB9A 4FJZA 2RFAA 4J0UA 3TJPA 3C98A 2OOEA 5CHEE 3FUNA 4J8EA 1JWGA 3ZKJA 4C0EA 3LDZA 3D3MA 4XI9A 4CT0A 5G05C 1TN8A 4EQFA 3SFZA 2WM9A 2WXFA 4DLOA 4UQXA 3QWPA 5D2MC 3GZ1A 3VLEA 5G55A 4BSZB 3G2WA 1TNZA 3T5XA 1HG2A 1HXIA 3C3QA 3E37A 2MRIA 4EBAG 2JLBA 4HBDA 3LEWA 3TXMA 4QFVA 2J8SD 1G3NB 5AQBA 2DYRE 3RKVA 2J07A 4KT6B 4BT8A 5ARGA 5HRYA 3HXCA 3LJNA 3CHQA 3SQVA 2FF4A 3MZLB 1NI1A 3UMVA 1SVXA 5EYPF 3AJIA 3FTSA 5CBNA 3LXUX 3T8KA 2XRYA 5FZSA 3V31A 3PE3A 5J90A 3OTNA 3PE4A 3Q47B 3CVQA 3FFLA 1NFIE 3FU6A 4CDRA 4FHKA 3SBTB 5ENTD 1TNBA 3Q7FA 5AIJA 2VSYA 5KJMA 3UINC 4WAFA 5LOZA 1L5JA 2J49A 3CQCB 3EDTB 3CVUA 4LNUD 5FINA 1FPPA 3D9HA 4LNBA 4HVBA 2R17C 4JZYA 5FZQA 1OWOA 1O1SA 2VGYA 3HG0D 3LY8A 2GRLA 1OWPA 2ETCA 4FA6A 1W3BA 3LPZA 4GCOA 2GRQB 1Y8MA 3HDXA 1IXVA 3G2TA 3PDNA 2KZTA 5M72A 4GTOA 3KEAA 3JYSA 3KSQA 1BLXB 2I2OA 3ASOE 1H6PA 2H6IA 3IV0A 5FQ8A 3TAXA 3SFXA 2VSOE 3IHVA 1ELKA 1YA0A 2PQRA 4WNDA 2X6FA 3QC1A 4B8AA 3Q4AB 5ENNA 3V2OA 3FUEA 4AM9A 1KZPA 2P9KG 4UQYA 4B94A 2A5EA 3ML9A 4N3BA 5B3SE 4HNAD 1N95A 3APFA 3CKBA 3TWSA 5BXOA 2Q7FA 2YHCA 1QZ2A 5JJ6A 3PUJA 2DWZA 2BKGA 1N4SA 3WXXA 1OCRE 3FH7A 4ANUA 4KMOA 5LX8A 4B0ZA 3IHYA 4JVSA 1HF8A 4IRUA 2DZNA 3QDNA 3D9MA 4G26A 4UWHA 2XEHA 4RSYA 4ANVA 3Q7AA 4A1SA 1S64A 3C3OA 4HOTA 4C48B 5JA4D 5HKPA 4DPRA 5BXUA 3C72A 1TN6A 4YDWA 1EF1C 4RG6A 4CEMA 3FULA 2Y3AA 2YHEA 4AIFA 2IONA 4B89A 1BD8A 3R7RA 2WXGA 4GMJA 3PS6A 4K5BA 3BU8A 1N9AA 2LUHA 5AARA 3QOUA 2Y0BG 2GW1A 1OCOE 3D9OA 3URZA 1JUQA 1K1AA 5CCLA 1BI7B 4M3OA 1N4PA 5FJYA 1NA3A 2GGFA 2XHEA 3UKRG 3ONKA 4HB5A 3MA5A 4DX7D 5ARFA 1S70B 3IKOB 2DBAA 2F8YA 3NQPA 3CVNA 4GPKA 1N11A 2OCCE 3CIAA 3Q78A 3SY2A 1S0PA 1KT1A 3CHOA 4F3VA 4GYOA 3EHNA 4GMRA 1FT1A 3B7SA 1SA5A 2LNIA 2PL2A 3TWWA 3UIOC 4I1MA 1H19A 5EILA 2WXNA 4I6GA 4AV7A 3AU5A 3L54A 5ENSD 2YQ8A 3ZYKA 1NP7A 5DBKA 4U0UA 3JXJA 5CERB 1RW2A 2J4BA 4L2LA 4K5AB 5AQ7A 3DSXA 5CMYA 2CFUA 2WXHA 4XX5A 5FZRA 3R7QA 5BW8C 5KNHD 1HG5A 2XGSA 4GPMA 4FP7A 2L0TB 3ASFA 2CHXA 1H6OA 2XPZA 2MYOA 2JEKA 3D9IA 4HQDA 1OCZE 5CECB 3PZ1A 4ZHBA 3CGHA 3AS8A 1IKND 2VYIA 5E75A 1E8WA 4RQIA 3UM0A 3SF4A 1QYMA 2DVWA 3KSLA 4O1OA 1S63A 3EHRA 3BG1B 4TXQA 3TWRA 4K0RA 1O1TA 3APDA 4AY6A 1WG0A 3FY4A 3UIPC 2V4HC 1E90A 2C0LA 4DI3A 4JL0A 3RRUA 4F1PA 2KCLA 5C2YA 4XKCA 2ONDA 4F1SA 4DLQA 3BUAA 3U9WA 3FUMA 3LCAA 5AAOA 2AWIA 2EQXA 4BERA 2FO1E 3QAQA 4XZ4A 3RIBA 3X2QE 4BETA 3CVXA 1IQRA 1MX6A 1MJ0A 4J8FA 1PAQA 4JD2G 1N0QA 2H6GA 4E6HA 2LAIA 4ATGA 1BPOA 3SBSA 3UT8A 2WMNA 3EIQC 3FUHA 3ZN3A 3CHPA 4HOQA 1ZU2A 1HS6A 5KWDA 4Q94A 2X6HA 4OVVA 1DCEA 2ZU6B 1QNFA 3CVWA 2OEWA 4CZ2D 4IYPA 3D9JA 3ULQA 3LVRE 3F6QA 3APCA 2CHWA 2L9BA 2ETAA 3FU0A 3RK6A 2VTBB 4GTMA 4U8YD 3MKQB 3SD5A 1UW4B 2IQCA 2C2LA 3GW4A 5JHAA 3FTVA 2WVIA 4APOA 4G8LA 1N52A 4BT9A 4UQZA 4UUCA 1E7UA 1UJKA 4IULA 4F53A 3DBSA 1E8YA 1TNUA 5D0OD 3ULEG 5KCMA 4KZCA 1DC2A 1TNYA 1SW6A 2L6BA 4MS6A 3Q73A 3DSWA 1N4RA 4BSXA 2CHZA 2LAHA 4AP2A 1SA4A 4Z68A 3ABME 5G2NA 3ULYA 3NOCD 3ZW3A 1LTXA 3FUKA 3CV0A 2P9UG 2IU1A 2BEDA 2I9CA 3PZDA 4A55A 4JPSA 1HFAA 4GZ5A 4ATZD 3AS4A 4WNEA 2V0PA 3Q79A 4XKBA 1PY1A 4FULA 3CHMA 3LY9A 4K5CA 1JCRA 3Q9NC 4G1TA 3DEOA 3UI2A 4UWKA 1IHGA 3MYVA 4HS2A 5EIBE 4JEHA 3QKYA 3CSFA 4G23A 1BI8B 4GTVA 2AJAA 2PZIA 4PS7A 4I43A 5ENQD 3FTYA 1FCHA 3RU0A 2HO1A 3FHEA 4EZJA 4UWFA 1XGWA 1OXJA 4XI0A 2P58C 1K1BA 5A23A 3BQOA 1HZ4A 2WXKA 3B7UX 2J9QA 1SZ9A 1FT2A 3TWTA 3ISMC 1WY6A 2XGMA 3UXGA 3ZU7B 3E34A 4LRZA 4ANWA 2F37A 1ELWA 2JABA 2LSVA 5KJKA 3MEKA 5ENPD 5D66A 4TUUA 3OXLA 3V2XA 4GYYA 4LEUA 4BX9A 4AEZC 3CQGB 5ANRA 4N2SA 4YDYA 4G11A 2IY0C 2V5QC 4A3TA 5EYLA 5A6CA 3FWVA 5FIOA 1IQUA 4IN3B 1N54A 2OVBA 2PM7A 4NQ0A 2XGOA 5FQ7A 5BNWA 4NACA 4G24A 3CHRA 3OAWA 1JWFA 3ZXPA 1ZB1A 3PZ2A 4JA7A 3ZNGA 3ZYLA 4LSZE 1P5QA 5KJNA 4JHKA 2QFCA 3ASHA 4V3IA
chains in the Genus database with same CATH topology
3UQ3A 2E0IA 3HHMA 1GW6A 3MA5A 3PREA 4BTBA 3K9IA 2L0IA 3T8MA 5ARFA 4PDXA 4A1GA 5CMWA 3FU5A 3PVLA 3SI5A 1ELRA 2VTBA 2IOSA 3CVYA 4GA0A 3MKQA 3NF1A 4UI9J 4L2YA 2VJ8A 2DBAA 3EIJA 3IKOB 3DPDA 3NQPA 4N39A 3CVNA 4GPKA 3RO2A 3CIAA 3PNTB 1S0PA 2WXLA 4H7XA 1EYHA 3D9KA 3ZPJA 4YNDA 4L23A 2KATA 3CSTA 2WPVA 1KT1A 3ZYMA 3CHOA 1E8ZA 5AJLA 3AU4A 3KEZA 4F3VA 2WQ6A 3ASDA 2X6IA 1SQMA 4GYOA 3GZ2A 3PRZA 3TG5A 3EHNA 2UWJG 4H7YA 3HYMB 3QARA 3FTWA 5AYWD 4BX8A 3FUIA 2AXVA 5T4YA 3D9LA 4Y6CA 3MV3B 3B7SA 3U66A 3FUFA 4W9RA 2LNIA 2KZTB 2PL2A 3LJ3A 4OVUA 5G04J 4U8HA 1A17A 4I1MA 4DK5A 4RG9A 5LCWJ 1H19A 3CVPA 2UY1A 2WXNA 4JW1A 4URKA 3P1UA 2DCPA 2FULA 2XPIA 3E4BA 2IJGX 3ZFWA 3OXGA 4I6GA 4GU5A 2NSZA 4AV7A 3AU5A 3L54A 2YQ8A 3ZYKA 1E96B 2AXUA 3ZIMA 1NP7A 5DBKA 2IF4A 2PQNA 2VSXE 3ESLA 4U0SA 1TEZA 4G25A 4GAAA 4U0UA 1OWNA 2V8SE 1OWLA 5HQ8A 4HLEA 2MOWA 3FUDA 4RVBA 2J4BA 1OUVA 4L2LA 5C1DA 4FHJA 3ZRHA 2BF0X 3NZUA 5AENA 4ILGA 3QJZA 5CMYA 3RRNB 2CFUA 4L7TA 2WXHA 3L13A 4XX5A 5FZRA 3R7QA 4N2QA 5BW8C 1HG5A 1UN9A 2WXOA 2KM4A 3LY7A 5FWQA 3S7JA 3UPVA 1KLXA 2HM8A 3SNXA 5JJ7A 2XGSA 4N3AA 1H2TC 4FP7A 2L0TB 4KVMA 4APFA 1XNFA 3B13A 3Q49B 1E7VA 2L6JA 3S7FA 4KBQA 3ASFA 2J08A 2M63A 2KCVA 2CHXA 2I1KA 2BTDA 2FO7A 2XCCA 2XPZA 3D9NA 2XQ0A 3KAEA 4I6JA 4U07A 3UUXA 4KXKB 2JEKA 5BUZA 3HIZA 1IYGA 2HYZA 3D9IA 4BFRA 3I4RB 3CHSA 4DI4A 1UG3A 3MX3A 1UJJA 3CGHA 3U3WA 3AS8A 2NXPA 3CK8A 2VYIA 3FEXA 5E75A 5E76A 2AXZA 3RO3A 4AXHA 3SHFA 1E8WA 4TRQA 2X3MA 3I5PA 3FTZA 3FTXA 3L17A 4JEUA 4WUYA 2V4LA 2AVPA 3IBEA 2CFZA 3SF4A 1B89A 3KS2A 1MHQA 5D0QD 5ANLA 3Q5MA 4HXIA 3QB2A 3BG1B 4WWNA 4K0RA 3CK9A 3B7TA 4A3VA 4R7LA 3JQ1A 3APDA 4AY6A 4JC8A 2YINA 3FY4A 4L1BA 4PH4B 4YVQC 3RJVA 1E90A 3PUKA 2C0LA 4GZDA 3ZXSA 4DI3A 4JL0A 3RRUA 2KCLA 3CVVA 2IOLA 5C2YA 4GB9A 4XKCA 2IFUA 3B7RL 2ONDA 1QQEA 4I9CA 3SZ7A 4FJZA 4DLQA 4F1SA 4LCTA 4HORA 2WXIA 4J0UA 1WM5A 2VGXB 2J4DA 4OYSA 3TJPA 3U4TA 3U9WA 1HO8A 4C0MA 3VLDA 3C98A 4GMLA 3FUMA 3LCAA 4JXTA 3FU3A 2AWIA 2FBNA 4HOUA 2OOEA 5CHEE 4CGWA 1U3CA 3FUNA 4J8EA 1JWGA 3MCXA 2EQXA 4GZ3A 4ACLA 4C0EA 3LDZA 3QAQA 2PM6A 3D3MA 3QWWA 4ILIA 4XZ4A 3RIBA 5BPPA 4MRUA 5DIZA 3G2VA 2DIWA 4XI9A 5J08A 3BG0B 3FTUA 3S7DA 3CVXA 4CT0A 5G05C 1IQRA 3I4GA 3UT7A 4EQFA 2WQHA 3MV2B 2WM9A 3SFZA 1SZAA 4ANXA 1INZA 4J8FA 2WXFA 4Q96A 1PAQA 3VTYA 4DLOA 4K03A 5FQ6A 4LERA 4UQXA 3TXNA 4G2VA 1TJCA 3QNKA 4E6HA 3QWPA 2LAIA 4LUNU 3LYAA 3ZHEB 4ATGA 1BPOA 3GZ1A 4I2WA 3SBSA 3UT8A 2WMNA 3EIQC 3FUHA 3ZN3A 2CG2A 3CHPA 1H2UA 4DJAA 3VLEA 3NZSA 3MKRA 5G55A 4FU3A 4HOQA 3ZEFA 2MHKA 4UWGA 4I6EA 4PUCA 3G2WA 4EBAA 1ZU2A 3T5XA 1HS6A 1Z3XA 1HG2A 1HXIA 4Q94A 2X6HA 4D10C 4UWLA 4BTAA 3T5VA 4OVVA 4N5CA 4WWPA 1WAO1 2ZU6B 5T3RA 1QNFA 2MRIA 3CVWA 4EBAG 4O6FA 4BY6A 4IYPA 3D9JA 3ULQA 2JLBA 3L6AA 3LVRE 4CDNA 3APCA 2CHWA 1EDUA 2L9BA 3LEWA 4GZ6A 4QFVA 3TXMA 3FU0A 3RK6A 4WNFA 2VTBB 1MQSA 2FEZA 4YVOA 3RRMB 1E8XA 3PH0C 3MKQB 2FI7A 3SD5A 1UW4B 2IQCA 4JHJA 3FH8A 4AJWA 2C2LA 4I2ZA 4ABNA 3RKVA 2J07A 3LVQE 3LKUA 3GW4A 3L08A 4KT6B 2J09A 4BT8A 5JHAA 1Z6TA 3HVEA 3FTVA 2XRZA 5ARGA 2WVIA 3MGBA 4APOA 3BEEA 2WXPA 3CHQA 5BT1A 1Z3YA 2FF4A 3MZLB 1KT0A 1N52A 3G2SA 4UQZA 4BT9A 1E7UA 2X6KA 1UJKA 4IULA 3UMVA 3DBSA 4F53A 1E8YA 3P2BA 5D0OD 3G2UA 5KCMA 4KZCA 3TL5A 3FTSA 4NRHB 3IEGA 3LXUX 4AOFA 2XRYA 5FZSA 5FTPA 5FT9A 2UY1B 3PE3A 2WXQA 3FUJA 4JA9A 5J90A 3OTNA 3PE4A 3Q47B 2GRMA 3CVQA 1H6KA 4J8DA 3TG4A 4BWRA 3OXFA 4Y6WA 3FFLA 4MS6A 4XIFA 3FU6A 3Q15A 4BSXA 4FHKA 2CHZA 2LAHA 2VQ2A 3SBTB 4CDRA 4AP2A 5AIJA 1ZBPA 2VSYA 3PEUB 5KJMA 2V5FA 1UN8A 1EPUA 3VLFA 4WAFA 5LOZA 3GZSA 2LO6A 1L5JA 5G2NA 2J49A 3ZW3A 3CQCB 3EDTB 4P29A 5BV1A 1Y6IA 3CVUA 5HI7A 2WXRA 2XEVA 4GZCA 3FUKA 3FP3A 2OVFA 3KD7A 4U63A 5LP0A 4HVBA 2R17C 4JZYA 5FZQA 3CV0A 5G05J 1OWOA 1HH8A 5CCMA 2VGYA 5EX3A 3FEYA 3EHMA 2A5UA 2YNQA 2IU1A 4FC8A 3LY8A 4ILHB 4J6IA 3L16A 2GRLA 4NURA 2I9CA 3PZDA 4A55A 4EECA 4JPSA 1HFAA 3SGHA 1OWPA 3FDHA 4FA6A 4GZ5A 1W3BA 3O4ZA 3AS4A 3LPZA 4CT4A 4GCOA 4WNEA 1Y8MA 3HDXA 1HX8A 2V0PA 3MJWA 4XKBA 3G2TA 3CK7A 2E2EA 4AY5A 3PDNA 5JHBA 1TJFA 1PY1A 2KZTA 3JUIA 4MLPA 4FULA 3UT4A 3CHMA 2I1JA 3L22A 5M72A 2XPYA 3CLJA 2NC9A 5JJTA 3LY9A 4GA2A 3JYSA 4G1TA 4ACKA 2I2OA 3QWVA 3ZVVA 4UWKA 1IHGA 3ESKA 3MYVA 3PNLB 4HS2A 5LFAA 3IV0A 4XE0A 5FQ8A 3TAXA 2WMOA 3ENEA 4JEHA 2VSOE 3CSFA 3IHVA 1ELKA 1YA0A 3QKYA 2PQRA 4FADA 2QY7A 4PS8A 4WNDA 2X6FA 3QC1A 4G23A 3Q4AB 5ENNA 4B8AA 4B8CB 4KVOA 3FUEA 4AM9A 4I1AA 3R9AB 2RD0A 4UQYA 4B94A 2PZIA 4WWOA 4PS7A 3ML9A 4I43A 4N3BA 3AS5A 3FTYA 1VDYA 1FCHA 3RU0A 2HO1A 3ASGA 4HOSA 3APFA 3FHEA 4TV3A 4EZJA 3ML8A 1HU3A 1H2VC 4UWFA 1XGWA 3CKBA 3S7BA 2LSUA 2WXJA 4UI9C 3VTXA 4I17A 5BV0A 2Q7FA 2YHCA 1QZ2A 3PEVB 4XI0A 2P58C 5JJ6A 3ZGQA 2WB2A 5A23A 3PUJA 4CCAA 1HZ4A 4CDMA 2WXKA 3B7UX 3WXXA 2J9QA 1SZ9A 3FH7A 1DNPA 4ANUA 4KMOA 5LX8A 1WY6A 2XGMA 3U64A 3IHYA 4B0ZA 4JVSA 4EZKA 1HF8A 4KYOB 4LRZA 4UI9K 5AJDA 4GYWA 5A7DB 2BUGA 1PC2A 2ILRA 4IRUA 4ANWA 1ELWA 3QDNA 3D9MA 1HE8A 2LSVA 3QK0A 4AVXA 1LF8A 2R59A 3N71A 2HR2A 4G26A 4UWHA 4N3CA 5EKQD 5G04C 1OWMA 5FQ4A 4I9EA 2CG3A 3ZYQA 5KJKA 4RSYA 4GA1A 5LCWC 4FLBA 3MEKA 4I1OB 2R5SA 4ANVA 4A1SA 2A4ZA 1U3DA 5EX0A 3LS8A 2VSNA 2WXMA 4U04A 4HOTA 2XCBA 3FH5A 4TUUA 3UX4A 3OXLA 4GYYA 4LEUA 4BX9A 4AEZC 4DPRA 3CQGB 4CRWA 1H0AA 2VGXA 5ANRA 4N2SA 4G11A 1EF1C 4J8SA 4RG6A 3I3NA 4A3TA 4CEMA 5T8IA 3CVLA 1X5BA 3FULA 2WQ7A 2Y3AA 4FLHA 2YHEA 4AIFA 3TGOA 2IONA 4HFGA 4B89A 5A6CA 3FWVA 1FVFA 4C9BB 1NA0A 3R7RA 3HVEB 2C0MA 2WXGA 4F7AA 4KZ0A 3GYZA 4ME2A 4GMJA 4U0ZA 4E85A 1IQUA 1JPLA 4IN3B 1N54A 2Y4TA 3PS6A 2OVBA 5KJLA 2PM7A 4NQ0A 3CEQA 2AW6A 4FJYA 4MKTA 2XGOA 3O48A 4WNGA 4EPZA 5FQ7A 3ONLA 2KCKA 3QOUA 4JHRA 3S2AA 5BNWA 4NACA 3ZHEA 4G24A 1NZNA 2I6HA 3CHRA 3OAWA 1DVPA 2GW1A 2X38A 3D9OA 1JWFA 3URZA 1JUQA 5EDSA 5CCLA 4JA7A 1FVHA 2KC7A 3ZYLA 2Y4UA 4Q69A 3EJNA 1P5QA 4M3OA 2X6JA 3CR3A 3JQ0A 4CGVA 4JHKA 5KJNA 5FJYA 3D9PA 4PS3A 1NA3A 2QFCA 2GGFA 3CKCA 4EZLA 4GCNA 2RG8A 3JCKC 3ASHA 2OV8A 2XHEA 4V3IA 3ONKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEY A;  1N52 A;  3L6A A;  4CRW A;  2IU1 A;  4IUL A;  4GML A;  1HU3 A;  1H2V C;  4LUN U;  2I2O A;  5ANR A;  3RK6 A;  2VSX E;  3EIQ C;  4CEM A;  2IOS A;  4CT4 A;  1H2U A;  1UW4 B;  2VSO E;  4JHJ A;  3D3M A;  2ION A;  2KZT B;  3EIJ A;  1UG3 A;  4B89 A;  4B8A A;  4C9B B;  2KZT A;  3JUI A;  4B8C B;  1N54 A;  3FEX A;  4JHK A;  4GMJ A;  2IOL A;  2GGF A;  2ZU6 B;  1H6K A;  2FUL A;  2RG8 A;  2HM8 A;  1PAQ A;  2NSZ A;  1H2T C; 
#chains in the Genus database with same CATH topology
 3UQ3 A;  3HHM A;  3PRE A;  2EIK E;  2L0I A;  3FU5 A;  2VTB A;  1BU9 A;  1ELR A;  2IOS A;  3PZ3 A;  3MKQ A;  3NF1 A;  4L2Y A;  3RO2 A;  5ENO D;  2WXL A;  3ZPJ A;  4BTB A;  2WPV A;  1RZ4 A;  3KEZ A;  2OEV A;  3ASD A;  1SQM A;  3GZ2 A;  3HRA A;  3QAR A;  2XZD G;  3PZ4 A;  4YDE A;  4TXR A;  3U66 A;  1LD8 A;  3UKU G;  4DK5 A;  4RG9 A;  3CVP A;  4JW1 A;  4URK A;  4HI9 A;  2DCP A;  2FUL A;  2XPI A;  4GU5 A;  1X81 A;  2VSX E;  4U0S A;  5KNG A;  2MOW A;  2P9N G;  3ZUV B;  3NZU A;  5AEN A;  3RRN B;  3QJZ A;  4L7T A;  1OCC E;  3UPV A;  1UN9 A;  3LY7 A;  2B6C A;  4APF A;  3RAU A;  4N5Q A;  2XCC A;  2P9L G;  5BUZ A;  4KXK B;  5EID A;  2EIL E;  3HIZ A;  1IYG A;  4DI4 A;  1UG3 A;  2F8X K;  3E30 A;  5E76 A;  2AXZ A;  4AXH A;  2X3M A;  3L17 A;  3WG7 E;  1A5E A;  2CFZ A;  1B89 A;  3E33 A;  3EHQ A;  2IO2 C;  3Q5M A;  3QB2 A;  4WWN A;  4L1B A;  3RJV A;  4GZD A;  3ZXS A;  3JXI A;  3Q75 A;  2IOL A;  2IFU A;  4HOR A;  4HRN A;  1QQE A;  4LCT A;  2WXI A;  1WM5 A;  2VGX B;  2J4D A;  3U4T A;  1HO8 A;  3VLD A;  4JXT A;  2ETB A;  3FU3 A;  2FBN A;  1U3C A;  4GZ3 A;  4ACL A;  2KXP C;  4ILI A;  3G2V A;  2DIW A;  3AG4 E;  5J08 A;  3FTU A;  3S7D A;  1MYO A;  2WQH A;  3MV2 B;  1INZ A;  4Q96 A;  2ZIS A;  3VTY A;  4K03 A;  4G2V A;  1TJC A;  3QNK A;  3TWU A;  3LYA A;  3ZHE B;  4I2W A;  4L9P A;  5CRV A;  2CG2 A;  1H2U A;  4DJA A;  3NZS A;  3ZEF A;  4PUC A;  1Z3X A;  4LNG A;  2P9S G;  5B1A E;  4D10 C;  4UWL A;  4BTA A;  4N5C A;  1WAO 1;  3AG1 E;  4DX5 D;  1O1R A;  4CDN A;  4GZ6 A;  3JUE A;  2FEZ A;  3RRM B;  2FI7 A;  2QYJ A;  3RSE G;  4JHJ A;  3UM1 A;  4ABN A;  1YMP A;  3LKU A;  4JB8 P;  1Z6T A;  3MGB A;  3G2S A;  3V30 A;  3P2B A;  4TXP A;  3G2U A;  3DSV A;  4QQI A;  3W9F A;  4NRH B;  4B93 B;  3IEG A;  4AOF A;  2UY1 B;  3FUJ A;  4J8D A;  4EBA A;  4XIF A;  3Q15 A;  3AG2 E;  1ZBP A;  2V5F A;  1UN8 A;  4HI8 A;  1KZO A;  2LO6 A;  2XEE A;  3ASN E;  5BV1 A;  4P29 A;  3NAW A;  2WXR A;  2XEV A;  3KD7 A;  5LP0 A;  2B0O E;  4GTT A;  5CCM A;  5EX3 A;  3EHM A;  4FC8 A;  4DX1 A;  4J6I A;  3L16 A;  4HLL A;  4NUR A;  4U95 D;  3SGH A;  4AY5 A;  5AN8 A;  5JHB A;  1TJF A;  3JUI A;  3UT4 A;  2I1J A;  3L22 A;  5JJT A;  4GA2 A;  3ESK A;  3PNL B;  5LFA A;  4XE0 A;  4FAD A;  2QY7 A;  1WDY A;  4B8C B;  4KVO A;  4I1A A;  3R9A B;  2RD0 A;  4DRX E;  5CED B;  4WWO A;  5KBA A;  3W9G A;  3AS5 A;  1D9S A;  1VDY A;  4F6R D;  3B7B A;  3ASG A;  4HOS A;  4TV3 A;  3ML8 A;  2GRP B;  2LSU A;  4GTS A;  3SFY A;  2NYJ A;  3UTM A;  3VTX A;  2LXL A;  4I17 A;  5BV0 A;  2GRR B;  1K3Z D;  3ZGQ A;  4CCA A;  4CDM A;  3U64 A;  4KYO B;  4UI9 K;  5AJD A;  3DXK G;  5A7D B;  2BUG A;  1PC2 A;  2ZGG A;  4AVX A;  1LF8 A;  2R59 A;  5EN5 D;  4N3C A;  5FQ4 A;  4GA1 A;  4I1O B;  2R5S A;  1U3D A;  3LS8 A;  2WXM A;  3FH5 A;  1D8E A;  4CRW A;  2VGX A;  2QZA A;  1TYQ G;  3I3N A;  2HE0 A;  3CVL A;  2F0Y A;  4EHM A;  4FLH A;  4HFG A;  2EIJ E;  1FVF A;  4C9B B;  1NA0 A;  3HVE B;  2C0M A;  4F7A A;  4KZ0 A;  4ME2 A;  4U0Z A;  2Y4T A;  5KJL A;  4U96 D;  3CEQ A;  2AW6 A;  4MKT A;  3O48 A;  5IY5 E;  3NOG D;  4EPZ A;  2XEN A;  2KCK A;  3UM3 A;  1O5M A;  3ZHE A;  1NZN A;  2I6H A;  5EDS A;  1FVH A;  3EJN A;  2X6J A;  4CGV A;  3TWV A;  4PS3 A;  3CKC A;  3AG3 E;  4EZL A;  2RG8 A;  3JCK C;  2IF4 A;  2E0I A;  1GW6 A;  4PDX A;  3HXB A;  1YYH A;  3PVL A;  2LXM A;  4G8K A;  1OT8 A;  3CVY A;  4GA0 A;  4UI9 J;  3EIJ A;  2P2C P;  3PNT B;  4H7X A;  4YND A;  3ZYM A;  3CST A;  3AU4 A;  1Z5S C;  2UWJ G;  4H7Y A;  3FTW A;  4BX8 A;  3FUI A;  2AXV A;  5T4Y A;  3D9L A;  3UM2 A;  3FUF A;  3LJ3 A;  5G04 J;  4U8H A;  1A17 A;  5LCW J;  2UY1 A;  1KPS B;  3E4B A;  5B1B E;  2IJG X;  3OXG A;  4NIK A;  3ZIM A;  2PQN A;  3DRA A;  3ESL A;  1TEZ A;  4G25 A;  4GAA A;  5HQ8 A;  4RVB A;  3FUD A;  2RKK A;  4FHJ A;  3ZRH A;  3NB2 A;  4ILG A;  4N2Q A;  3J5P A;  5FWQ A;  5JJ7 A;  1LD7 A;  5CEA A;  1XNF A;  2P9I G;  1E7V A;  4KBQ A;  1TN7 A;  2I1K A;  3NBN B;  2BTD A;  3D9N A;  2XQ0 A;  3UUX A;  2HYZ A;  3I4R B;  4A63 B;  4J8Y A;  3MX3 A;  3R9M A;  3FEX A;  3RO3 A;  3SHF A;  3C5R A;  2ZXW E;  4TRQ A;  3EU5 A;  4JEU A;  4YDO A;  2V4L A;  3IBE A;  2Y69 E;  3AAA C;  5ANL A;  4HXI A;  3B7T A;  4A3V A;  3DST A;  4R7L A;  2GRO B;  3JQ1 A;  2KBX A;  2YIN A;  1N4Q A;  4PH4 B;  4YVQ C;  1N94 A;  3CVV A;  1IHB A;  1JCS A;  3B7R L;  4I9C A;  3SZ7 A;  4OYS A;  4C0M A;  4GML A;  4HOU A;  4CGW A;  3MCX A;  2PM6 A;  3QWW A;  5BPP A;  4MRU A;  5DIZ A;  3BG0 B;  1YCS B;  3I4G A;  3UT7 A;  1SZA A;  4HRL A;  4ANX A;  3L9T A;  5FQ6 A;  4LER A;  3TXN A;  4DX6 D;  4LUN U;  1NL4 A;  3MKR A;  4FU3 A;  2MHK A;  4UWG A;  4I6E A;  3EUV A;  3T5V A;  5T3R A;  4WWP A;  4O6F A;  4BY6 A;  3L6A A;  1EDU A;  2RFM A;  4WNF A;  1MQS A;  4YVO A;  1E8X A;  3PH0 C;  3C3R A;  3HXE A;  5ITZ F;  3FH8 A;  4AJW A;  4I2Z A;  3LVQ E;  2VGE A;  3L08 A;  2J09 A;  1UOH A;  3HVE A;  2XRZ A;  3BEE A;  2WXP A;  5BT1 A;  1V54 E;  1Z3Y A;  3E32 A;  1KT0 A;  2X6K A;  2R03 A;  3DPY A;  3TL5 A;  1Q2Z A;  2QC9 A;  1AWC B;  1OY3 D;  5FTP A;  5FT9 A;  4LG6 A;  2WXQ A;  4JA9 A;  2GRM A;  1H6K A;  3TG4 A;  4BWR A;  3OXF A;  4Y6W A;  2VQ2 A;  2R02 A;  3PEU B;  1EPU A;  3VLF A;  4DX2 A;  3GZS A;  3V79 K;  1Y6I A;  5ENR D;  5HI7 A;  4GZC A;  4GTQ A;  3FP3 A;  2OVF A;  3J5Q B;  4U63 A;  5G05 J;  1HH8 A;  5CBO A;  4BEP A;  3FEY A;  2A5U A;  2YNQ A;  3Q9U C;  4ILH B;  2IEJ A;  4EEC A;  3FDH A;  1U2V G;  3O4Z A;  4CT4 A;  1HX8 A;  1JCQ A;  3MJW A;  3CK7 A;  2E2E A;  4MLP A;  2XPY A;  3CLJ A;  3HXD A;  4DUI A;  1MZC A;  2NC9 A;  2DYS E;  2DZO A;  4ACK A;  3ZVV A;  3QWV A;  2WMO A;  3ENE A;  4GTP A;  4RLY A;  4PS8 A;  1MX2 A;  3SO8 A;  4O60 A;  2EIN E;  1HU3 A;  1H2V C;  4MBG A;  3TWQ A;  4U8V D;  3S7B A;  3HXF A;  2WXJ A;  4UI9 C;  4XEI G;  3PEV B;  2WB2 A;  2BKK B;  4J7W A;  1DNP A;  2GRN B;  4EZK A;  4GYW A;  1TR4 A;  2ILR A;  3QK0 A;  1D8D A;  1HE8 A;  4CYM D;  3N71 A;  2HR2 A;  5EKQ D;  5G04 C;  1OWM A;  4I9E A;  2CG3 A;  3ZYQ A;  5LCW C;  4FLB A;  2A4Z A;  4ZFH A;  5EX0 A;  2VSN A;  4U04 A;  2XCB A;  3UX4 A;  2EIM E;  1H0A A;  4J8S A;  4HRM B;  5T8I A;  1X5B A;  3ABK E;  2WQ7 A;  3TGO A;  1AP7 A;  3GYZ A;  4E85 A;  4O1P A;  3TWX A;  1JPL A;  1V55 E;  4FJY A;  4WNG A;  3ONL A;  2XS8 A;  4JHR A;  3S2A A;  1DVP A;  2X38 A;  1DCQ A;  2KC7 A;  4GTR A;  4M7C A;  2Y4U A;  3EU9 A;  5H7P A;  4Q69 A;  3CR3 A;  3JQ0 A;  3D9P A;  3L82 A;  4GCN A;  2XS1 A;  2OV8 A;  4OAV B;  2ZIR A;  3K9I A;  3T8M A;  4A1G A;  5CMW A;  3IXE A;  3SI5 A;  5JMN D;  2R05 A;  2VJ8 A;  3DPD A;  2XZT G;  2PNN A;  4N39 A;  1EYH A;  2IO3 C;  3D9K A;  3DXM G;  4L23 A;  2KAT A;  2WQ6 A;  5AJL A;  1E8Z A;  2X6I A;  5HS0 A;  3B95 A;  3PRZ A;  1QBQ A;  3TG5 A;  3HYM B;  5AYW D;  5AQ9 A;  1K8K G;  4Y6C A;  3MV3 B;  4W9R A;  2KZT B;  2R2L A;  4OVU A;  3ABL E;  3P1U A;  4X8Q A;  3ZFW A;  2NSZ A;  1E96 B;  2AXU A;  1OWN A;  2H6F A;  2V8S E;  1OWL A;  4HLE A;  5AQA A;  1OUV A;  1TNO A;  5C1D A;  3DWL G;  2BF0 X;  5CRU A;  3L13 A;  2P9P G;  2Y1L E;  1MX4 A;  2WXO A;  3S7J A;  2KM4 A;  1KLX A;  2HM8 A;  3SNX A;  4N3A A;  1H2T C;  4KVM A;  3B13 A;  3Q49 B;  3S7F A;  2L6J A;  2J08 A;  2M63 A;  2KCV A;  4TUM A;  2FO7 A;  4I6J A;  4U07 A;  3KAE A;  2QYU A;  3DSS A;  4BFR A;  3CHS A;  3DEP A;  4OAU C;  1UJJ A;  1N0R A;  4BES A;  3U3W A;  4U7E B;  2NXP A;  3CK8 A;  3T9K A;  3I5P A;  3FTZ A;  3FTX A;  4WUY A;  2AVP A;  3KS2 A;  1MHQ A;  5D0Q D;  2H6H A;  3CK9 A;  3DSU A;  4JC8 A;  3PUK A;  2ZGD A;  4GB9 A;  4FJZ A;  2RFA A;  4J0U A;  3TJP A;  3C98 A;  2OOE A;  5CHE E;  3FUN A;  4J8E A;  1JWG A;  3ZKJ A;  4C0E A;  3LDZ A;  3D3M A;  4XI9 A;  4CT0 A;  5G05 C;  1TN8 A;  4EQF A;  3SFZ A;  2WM9 A;  2WXF A;  4DLO A;  4UQX A;  3QWP A;  5D2M C;  3GZ1 A;  3VLE A;  5G55 A;  4BSZ B;  3G2W A;  1TNZ A;  3T5X A;  1HG2 A;  1HXI A;  3C3Q A;  3E37 A;  2MRI A;  4EBA G;  2JLB A;  4HBD A;  3LEW A;  3TXM A;  4QFV A;  2J8S D;  1G3N B;  5AQB A;  2DYR E;  3RKV A;  2J07 A;  4KT6 B;  4BT8 A;  5ARG A;  5HRY A;  3HXC A;  3LJN A;  3CHQ A;  3SQV A;  2FF4 A;  3MZL B;  1NI1 A;  3UMV A;  1SVX A;  5EYP F;  3AJI A;  3FTS A;  5CBN A;  3LXU X;  3T8K A;  2XRY A;  5FZS A;  3V31 A;  3PE3 A;  5J90 A;  3OTN A;  3PE4 A;  3Q47 B;  3CVQ A;  3FFL A;  1NFI E;  3FU6 A;  4CDR A;  4FHK A;  3SBT B;  5ENT D;  1TNB A;  3Q7F A;  5AIJ A;  2VSY A;  5KJM A;  3UIN C;  4WAF A;  5LOZ A;  1L5J A;  2J49 A;  3CQC B;  3EDT B;  3CVU A;  4LNU D;  5FIN A;  1FPP A;  3D9H A;  4LNB A;  4HVB A;  2R17 C;  4JZY A;  5FZQ A;  1OWO A;  1O1S A;  2VGY A;  3HG0 D;  3LY8 A;  2GRL A;  1OWP A;  2ETC A;  4FA6 A;  1W3B A;  3LPZ A;  4GCO A;  2GRQ B;  1Y8M A;  3HDX A;  1IXV A;  3G2T A;  3PDN A;  2KZT A;  5M72 A;  4GTO A;  3KEA A;  3JYS A;  3KSQ A;  1BLX B;  2I2O A;  3ASO E;  1H6P A;  2H6I A;  3IV0 A;  5FQ8 A;  3TAX A;  3SFX A;  2VSO E;  3IHV A;  1ELK A;  1YA0 A;  2PQR A;  4WND A;  2X6F A;  3QC1 A;  4B8A A;  3Q4A B;  5ENN A;  3V2O A;  3FUE A;  4AM9 A;  1KZP A;  2P9K G;  4UQY A;  4B94 A;  2A5E A;  3ML9 A;  4N3B A;  5B3S E;  4HNA D;  1N95 A;  3APF A;  3CKB A;  3TWS A;  5BXO A;  2Q7F A;  2YHC A;  1QZ2 A;  5JJ6 A;  3PUJ A;  2DWZ A;  2BKG A;  1N4S A;  3WXX A;  1OCR E;  3FH7 A;  4ANU A;  4KMO A;  5LX8 A;  4B0Z A;  3IHY A;  4JVS A;  1HF8 A;  4IRU A;  2DZN A;  3QDN A;  3D9M A;  4G26 A;  4UWH A;  2XEH A;  4RSY A;  4ANV A;  3Q7A A;  4A1S A;  1S64 A;  3C3O A;  4HOT A;  4C48 B;  5JA4 D;  5HKP A;  4DPR A;  5BXU A;  3C72 A;  1TN6 A;  4YDW A;  1EF1 C;  4RG6 A;  4CEM A;  3FUL A;  2Y3A A;  2YHE A;  4AIF A;  2ION A;  4B89 A;  1BD8 A;  3R7R A;  2WXG A;  4GMJ A;  3PS6 A;  4K5B A;  3BU8 A;  1N9A A;  2LUH A;  5AAR A;  3QOU A;  2Y0B G;  2GW1 A;  1OCO E;  3D9O A;  3URZ A;  1JUQ A;  1K1A A;  5CCL A;  1BI7 B;  4M3O A;  1N4P A;  5FJY A;  1NA3 A;  2GGF A;  2XHE A;  3UKR G;  3ONK A;  4HB5 A;  3MA5 A;  4DX7 D;  5ARF A;  1S70 B;  3IKO B;  2DBA A;  2F8Y A;  3NQP A;  3CVN A;  4GPK A;  1N11 A;  2OCC E;  3CIA A;  3Q78 A;  3SY2 A;  1S0P A;  1KT1 A;  3CHO A;  4F3V A;  4GYO A;  3EHN A;  4GMR A;  1FT1 A;  3B7S A;  1SA5 A;  2LNI A;  2PL2 A;  3TWW A;  3UIO C;  4I1M A;  1H19 A;  5EIL A;  2WXN A;  4I6G A;  4AV7 A;  3AU5 A;  3L54 A;  5ENS D;  2YQ8 A;  3ZYK A;  1NP7 A;  5DBK A;  4U0U A;  3JXJ A;  5CER B;  1RW2 A;  2J4B A;  4L2L A;  4K5A B;  5AQ7 A;  3DSX A;  5CMY A;  2CFU A;  2WXH A;  4XX5 A;  5FZR A;  3R7Q A;  5BW8 C;  5KNH D;  1HG5 A;  2XGS A;  4GPM A;  4FP7 A;  2L0T B;  3ASF A;  2CHX A;  1H6O A;  2XPZ A;  2MYO A;  2JEK A;  3D9I A;  4HQD A;  1OCZ E;  5CEC B;  3PZ1 A;  4ZHB A;  3CGH A;  3AS8 A;  1IKN D;  2VYI A;  5E75 A;  1E8W A;  4RQI A;  3UM0 A;  3SF4 A;  1QYM A;  2DVW A;  3KSL A;  4O1O A;  1S63 A;  3EHR A;  3BG1 B;  4TXQ A;  3TWR A;  4K0R A;  1O1T A;  3APD A;  4AY6 A;  1WG0 A;  3FY4 A;  3UIP C;  2V4H C;  1E90 A;  2C0L A;  4DI3 A;  4JL0 A;  3RRU A;  4F1P A;  2KCL A;  5C2Y A;  4XKC A;  2OND A;  4F1S A;  4DLQ A;  3BUA A;  3U9W A;  3FUM A;  3LCA A;  5AAO A;  2AWI A;  2EQX A;  4BER A;  2FO1 E;  3QAQ A;  4XZ4 A;  3RIB A;  3X2Q E;  4BET A;  3CVX A;  1IQR A;  1MX6 A;  1MJ0 A;  4J8F A;  1PAQ A;  4JD2 G;  1N0Q A;  2H6G A;  4E6H A;  2LAI A;  4ATG A;  1BPO A;  3SBS A;  3UT8 A;  2WMN A;  3EIQ C;  3FUH A;  3ZN3 A;  3CHP A;  4HOQ A;  1ZU2 A;  1HS6 A;  5KWD A;  4Q94 A;  2X6H A;  4OVV A;  1DCE A;  2ZU6 B;  1QNF A;  3CVW A;  2OEW A;  4CZ2 D;  4IYP A;  3D9J A;  3ULQ A;  3LVR E;  3F6Q A;  3APC A;  2CHW A;  2L9B A;  2ETA A;  3FU0 A;  3RK6 A;  2VTB B;  4GTM A;  4U8Y D;  3MKQ B;  3SD5 A;  1UW4 B;  2IQC A;  2C2L A;  3GW4 A;  5JHA A;  3FTV A;  2WVI A;  4APO A;  4G8L A;  1N52 A;  4BT9 A;  4UQZ A;  4UUC A;  1E7U A;  1UJK A;  4IUL A;  4F53 A;  3DBS A;  1E8Y A;  1TNU A;  5D0O D;  3ULE G;  5KCM A;  4KZC A;  1DC2 A;  1TNY A;  1SW6 A;  2L6B A;  4MS6 A;  3Q73 A;  3DSW A;  1N4R A;  4BSX A;  2CHZ A;  2LAH A;  4AP2 A;  1SA4 A;  4Z68 A;  3ABM E;  5G2N A;  3ULY A;  3NOC D;  3ZW3 A;  1LTX A;  3FUK A;  3CV0 A;  2P9U G;  2IU1 A;  2BED A;  2I9C A;  3PZD A;  4A55 A;  4JPS A;  1HFA A;  4GZ5 A;  4ATZ D;  3AS4 A;  4WNE A;  2V0P A;  3Q79 A;  4XKB A;  1PY1 A;  4FUL A;  3CHM A;  3LY9 A;  4K5C A;  1JCR A;  3Q9N C;  4G1T A;  3DEO A;  3UI2 A;  4UWK A;  1IHG A;  3MYV A;  4HS2 A;  5EIB E;  4JEH A;  3QKY A;  3CSF A;  4G23 A;  1BI8 B;  4GTV A;  2AJA A;  2PZI A;  4PS7 A;  4I43 A;  5ENQ D;  3FTY A;  1FCH A;  3RU0 A;  2HO1 A;  3FHE A;  4EZJ A;  4UWF A;  1XGW A;  1OXJ A;  4XI0 A;  2P58 C;  1K1B A;  5A23 A;  3BQO A;  1HZ4 A;  2WXK A;  3B7U X;  2J9Q A;  1SZ9 A;  1FT2 A;  3TWT A;  3ISM C;  1WY6 A;  2XGM A;  3UXG A;  3ZU7 B;  3E34 A;  4LRZ A;  4ANW A;  2F37 A;  1ELW A;  2JAB A;  2LSV A;  5KJK A;  3MEK A;  5ENP D;  5D66 A;  4TUU A;  3OXL A;  3V2X A;  4GYY A;  4LEU A;  4BX9 A;  4AEZ C;  3CQG B;  5ANR A;  4N2S A;  4YDY A;  4G11 A;  2IY0 C;  2V5Q C;  4A3T A;  5EYL A;  5A6C A;  3FWV A;  5FIO A;  1IQU A;  4IN3 B;  1N54 A;  2OVB A;  2PM7 A;  4NQ0 A;  2XGO A;  5FQ7 A;  5BNW A;  4NAC A;  4G24 A;  3CHR A;  3OAW A;  1JWF A;  3ZXP A;  1ZB1 A;  3PZ2 A;  4JA7 A;  3ZNG A;  3ZYL A;  4LSZ E;  1P5Q A;  5KJN A;  4JHK A;  2QFC A;  3ASH A;  4V3I A; 
#chains in the Genus database with same CATH homology
 3UQ3 A;  2E0I A;  3HHM A;  1GW6 A;  3MA5 A;  3PRE A;  4BTB A;  3K9I A;  2L0I A;  3T8M A;  5ARF A;  4PDX A;  4A1G A;  5CMW A;  3FU5 A;  3PVL A;  3SI5 A;  1ELR A;  2VTB A;  2IOS A;  3CVY A;  4GA0 A;  3MKQ A;  3NF1 A;  4UI9 J;  4L2Y A;  2VJ8 A;  2DBA A;  3EIJ A;  3IKO B;  3DPD A;  3NQP A;  4N39 A;  3CVN A;  4GPK A;  3RO2 A;  3CIA A;  3PNT B;  1S0P A;  2WXL A;  4H7X A;  1EYH A;  3D9K A;  3ZPJ A;  4YND A;  4L23 A;  2KAT A;  3CST A;  2WPV A;  1KT1 A;  3ZYM A;  3CHO A;  1E8Z A;  5AJL A;  3AU4 A;  3KEZ A;  4F3V A;  2WQ6 A;  3ASD A;  2X6I A;  1SQM A;  4GYO A;  3GZ2 A;  3PRZ A;  3TG5 A;  3EHN A;  2UWJ G;  4H7Y A;  3HYM B;  3QAR A;  3FTW A;  5AYW D;  4BX8 A;  3FUI A;  2AXV A;  5T4Y A;  3D9L A;  4Y6C A;  3MV3 B;  3B7S A;  3U66 A;  3FUF A;  4W9R A;  2LNI A;  2KZT B;  2PL2 A;  3LJ3 A;  4OVU A;  5G04 J;  4U8H A;  1A17 A;  4I1M A;  4DK5 A;  4RG9 A;  5LCW J;  1H19 A;  3CVP A;  2UY1 A;  2WXN A;  4JW1 A;  4URK A;  3P1U A;  2DCP A;  2FUL A;  2XPI A;  3E4B A;  2IJG X;  3ZFW A;  3OXG A;  4I6G A;  4GU5 A;  2NSZ A;  4AV7 A;  3AU5 A;  3L54 A;  2YQ8 A;  3ZYK A;  1E96 B;  2AXU A;  3ZIM A;  1NP7 A;  5DBK A;  2IF4 A;  2PQN A;  2VSX E;  3ESL A;  4U0S A;  1TEZ A;  4G25 A;  4GAA A;  4U0U A;  1OWN A;  2V8S E;  1OWL A;  5HQ8 A;  4HLE A;  2MOW A;  3FUD A;  4RVB A;  2J4B A;  1OUV A;  4L2L A;  5C1D A;  4FHJ A;  3ZRH A;  2BF0 X;  3NZU A;  5AEN A;  4ILG A;  3QJZ A;  5CMY A;  3RRN B;  2CFU A;  4L7T A;  2WXH A;  3L13 A;  4XX5 A;  5FZR A;  3R7Q A;  4N2Q A;  5BW8 C;  1HG5 A;  1UN9 A;  2WXO A;  2KM4 A;  3LY7 A;  5FWQ A;  3S7J A;  3UPV A;  1KLX A;  2HM8 A;  3SNX A;  5JJ7 A;  2XGS A;  4N3A A;  1H2T C;  4FP7 A;  2L0T B;  4KVM A;  4APF A;  1XNF A;  3B13 A;  3Q49 B;  1E7V A;  2L6J A;  3S7F A;  4KBQ A;  3ASF A;  2J08 A;  2M63 A;  2KCV A;  2CHX A;  2I1K A;  2BTD A;  2FO7 A;  2XCC A;  2XPZ A;  3D9N A;  2XQ0 A;  3KAE A;  4I6J A;  4U07 A;  3UUX A;  4KXK B;  2JEK A;  5BUZ A;  3HIZ A;  1IYG A;  2HYZ A;  3D9I A;  4BFR A;  3I4R B;  3CHS A;  4DI4 A;  1UG3 A;  3MX3 A;  1UJJ A;  3CGH A;  3U3W A;  3AS8 A;  2NXP A;  3CK8 A;  2VYI A;  3FEX A;  5E75 A;  5E76 A;  2AXZ A;  3RO3 A;  4AXH A;  3SHF A;  1E8W A;  4TRQ A;  2X3M A;  3I5P A;  3FTZ A;  3FTX A;  3L17 A;  4JEU A;  4WUY A;  2V4L A;  2AVP A;  3IBE A;  2CFZ A;  3SF4 A;  1B89 A;  3KS2 A;  1MHQ A;  5D0Q D;  5ANL A;  3Q5M A;  4HXI A;  3QB2 A;  3BG1 B;  4WWN A;  4K0R A;  3CK9 A;  3B7T A;  4A3V A;  4R7L A;  3JQ1 A;  3APD A;  4AY6 A;  4JC8 A;  2YIN A;  3FY4 A;  4L1B A;  4PH4 B;  4YVQ C;  3RJV A;  1E90 A;  3PUK A;  2C0L A;  4GZD A;  3ZXS A;  4DI3 A;  4JL0 A;  3RRU A;  2KCL A;  3CVV A;  2IOL A;  5C2Y A;  4GB9 A;  4XKC A;  2IFU A;  3B7R L;  2OND A;  1QQE A;  4I9C A;  3SZ7 A;  4FJZ A;  4DLQ A;  4F1S A;  4LCT A;  4HOR A;  2WXI A;  4J0U A;  1WM5 A;  2VGX B;  2J4D A;  4OYS A;  3TJP A;  3U4T A;  3U9W A;  1HO8 A;  4C0M A;  3VLD A;  3C98 A;  4GML A;  3FUM A;  3LCA A;  4JXT A;  3FU3 A;  2AWI A;  2FBN A;  4HOU A;  2OOE A;  5CHE E;  4CGW A;  1U3C A;  3FUN A;  4J8E A;  1JWG A;  3MCX A;  2EQX A;  4GZ3 A;  4ACL A;  4C0E A;  3LDZ A;  3QAQ A;  2PM6 A;  3D3M A;  3QWW A;  4ILI A;  4XZ4 A;  3RIB A;  5BPP A;  4MRU A;  5DIZ A;  3G2V A;  2DIW A;  4XI9 A;  5J08 A;  3BG0 B;  3FTU A;  3S7D A;  3CVX A;  4CT0 A;  5G05 C;  1IQR A;  3I4G A;  3UT7 A;  4EQF A;  2WQH A;  3MV2 B;  2WM9 A;  3SFZ A;  1SZA A;  4ANX A;  1INZ A;  4J8F A;  2WXF A;  4Q96 A;  1PAQ A;  3VTY A;  4DLO A;  4K03 A;  5FQ6 A;  4LER A;  4UQX A;  3TXN A;  4G2V A;  1TJC A;  3QNK A;  4E6H A;  3QWP A;  2LAI A;  4LUN U;  3LYA A;  3ZHE B;  4ATG A;  1BPO A;  3GZ1 A;  4I2W A;  3SBS A;  3UT8 A;  2WMN A;  3EIQ C;  3FUH A;  3ZN3 A;  2CG2 A;  3CHP A;  1H2U A;  4DJA A;  3VLE A;  3NZS A;  3MKR A;  5G55 A;  4FU3 A;  4HOQ A;  3ZEF A;  2MHK A;  4UWG A;  4I6E A;  4PUC A;  3G2W A;  4EBA A;  1ZU2 A;  3T5X A;  1HS6 A;  1Z3X A;  1HG2 A;  1HXI A;  4Q94 A;  2X6H A;  4D10 C;  4UWL A;  4BTA A;  3T5V A;  4OVV A;  4N5C A;  4WWP A;  1WAO 1;  2ZU6 B;  5T3R A;  1QNF A;  2MRI A;  3CVW A;  4EBA G;  4O6F A;  4BY6 A;  4IYP A;  3D9J A;  3ULQ A;  2JLB A;  3L6A A;  3LVR E;  4CDN A;  3APC A;  2CHW A;  1EDU A;  2L9B A;  3LEW A;  4GZ6 A;  4QFV A;  3TXM A;  3FU0 A;  3RK6 A;  4WNF A;  2VTB B;  1MQS A;  2FEZ A;  4YVO A;  3RRM B;  1E8X A;  3PH0 C;  3MKQ B;  2FI7 A;  3SD5 A;  1UW4 B;  2IQC A;  4JHJ A;  3FH8 A;  4AJW A;  2C2L A;  4I2Z A;  4ABN A;  3RKV A;  2J07 A;  3LVQ E;  3LKU A;  3GW4 A;  3L08 A;  4KT6 B;  2J09 A;  4BT8 A;  5JHA A;  1Z6T A;  3HVE A;  3FTV A;  2XRZ A;  5ARG A;  2WVI A;  3MGB A;  4APO A;  3BEE A;  2WXP A;  3CHQ A;  5BT1 A;  1Z3Y A;  2FF4 A;  3MZL B;  1KT0 A;  1N52 A;  3G2S A;  4UQZ A;  4BT9 A;  1E7U A;  2X6K A;  1UJK A;  4IUL A;  3UMV A;  3DBS A;  4F53 A;  1E8Y A;  3P2B A;  5D0O D;  3G2U A;  5KCM A;  4KZC A;  3TL5 A;  3FTS A;  4NRH B;  3IEG A;  3LXU X;  4AOF A;  2XRY A;  5FZS A;  5FTP A;  5FT9 A;  2UY1 B;  3PE3 A;  2WXQ A;  3FUJ A;  4JA9 A;  5J90 A;  3OTN A;  3PE4 A;  3Q47 B;  2GRM A;  3CVQ A;  1H6K A;  4J8D A;  3TG4 A;  4BWR A;  3OXF A;  4Y6W A;  3FFL A;  4MS6 A;  4XIF A;  3FU6 A;  3Q15 A;  4BSX A;  4FHK A;  2CHZ A;  2LAH A;  2VQ2 A;  3SBT B;  4CDR A;  4AP2 A;  5AIJ A;  1ZBP A;  2VSY A;  3PEU B;  5KJM A;  2V5F A;  1UN8 A;  1EPU A;  3VLF A;  4WAF A;  5LOZ A;  3GZS A;  2LO6 A;  1L5J A;  5G2N A;  2J49 A;  3ZW3 A;  3CQC B;  3EDT B;  4P29 A;  5BV1 A;  1Y6I A;  3CVU A;  5HI7 A;  2WXR A;  2XEV A;  4GZC A;  3FUK A;  3FP3 A;  2OVF A;  3KD7 A;  4U63 A;  5LP0 A;  4HVB A;  2R17 C;  4JZY A;  5FZQ A;  3CV0 A;  5G05 J;  1OWO A;  1HH8 A;  5CCM A;  2VGY A;  5EX3 A;  3FEY A;  3EHM A;  2A5U A;  2YNQ A;  2IU1 A;  4FC8 A;  3LY8 A;  4ILH B;  4J6I A;  3L16 A;  2GRL A;  4NUR A;  2I9C A;  3PZD A;  4A55 A;  4EEC A;  4JPS A;  1HFA A;  3SGH A;  1OWP A;  3FDH A;  4FA6 A;  4GZ5 A;  1W3B A;  3O4Z A;  3AS4 A;  3LPZ A;  4CT4 A;  4GCO A;  4WNE A;  1Y8M A;  3HDX A;  1HX8 A;  2V0P A;  3MJW A;  4XKB A;  3G2T A;  3CK7 A;  2E2E A;  4AY5 A;  3PDN A;  5JHB A;  1TJF A;  1PY1 A;  2KZT A;  3JUI A;  4MLP A;  4FUL A;  3UT4 A;  3CHM A;  2I1J A;  3L22 A;  5M72 A;  2XPY A;  3CLJ A;  2NC9 A;  5JJT A;  3LY9 A;  4GA2 A;  3JYS A;  4G1T A;  4ACK A;  2I2O A;  3QWV A;  3ZVV A;  4UWK A;  1IHG A;  3ESK A;  3MYV A;  3PNL B;  4HS2 A;  5LFA A;  3IV0 A;  4XE0 A;  5FQ8 A;  3TAX A;  2WMO A;  3ENE A;  4JEH A;  2VSO E;  3CSF A;  3IHV A;  1ELK A;  1YA0 A;  3QKY A;  2PQR A;  4FAD A;  2QY7 A;  4PS8 A;  4WND A;  2X6F A;  3QC1 A;  4G23 A;  3Q4A B;  5ENN A;  4B8A A;  4B8C B;  4KVO A;  3FUE A;  4AM9 A;  4I1A A;  3R9A B;  2RD0 A;  4UQY A;  4B94 A;  2PZI A;  4WWO A;  4PS7 A;  3ML9 A;  4I43 A;  4N3B A;  3AS5 A;  3FTY A;  1VDY A;  1FCH A;  3RU0 A;  2HO1 A;  3ASG A;  4HOS A;  3APF A;  3FHE A;  4TV3 A;  4EZJ A;  3ML8 A;  1HU3 A;  1H2V C;  4UWF A;  1XGW A;  3CKB A;  3S7B A;  2LSU A;  2WXJ A;  4UI9 C;  3VTX A;  4I17 A;  5BV0 A;  2Q7F A;  2YHC A;  1QZ2 A;  3PEV B;  4XI0 A;  2P58 C;  5JJ6 A;  3ZGQ A;  2WB2 A;  5A23 A;  3PUJ A;  4CCA A;  1HZ4 A;  4CDM A;  2WXK A;  3B7U X;  3WXX A;  2J9Q A;  1SZ9 A;  3FH7 A;  1DNP A;  4ANU A;  4KMO A;  5LX8 A;  1WY6 A;  2XGM A;  3U64 A;  3IHY A;  4B0Z A;  4JVS A;  4EZK A;  1HF8 A;  4KYO B;  4LRZ A;  4UI9 K;  5AJD A;  4GYW A;  5A7D B;  2BUG A;  1PC2 A;  2ILR A;  4IRU A;  4ANW A;  1ELW A;  3QDN A;  3D9M A;  1HE8 A;  2LSV A;  3QK0 A;  4AVX A;  1LF8 A;  2R59 A;  3N71 A;  2HR2 A;  4G26 A;  4UWH A;  4N3C A;  5EKQ D;  5G04 C;  1OWM A;  5FQ4 A;  4I9E A;  2CG3 A;  3ZYQ A;  5KJK A;  4RSY A;  4GA1 A;  5LCW C;  4FLB A;  3MEK A;  4I1O B;  2R5S A;  4ANV A;  4A1S A;  2A4Z A;  1U3D A;  5EX0 A;  3LS8 A;  2VSN A;  2WXM A;  4U04 A;  4HOT A;  2XCB A;  3FH5 A;  4TUU A;  3UX4 A;  3OXL A;  4GYY A;  4LEU A;  4BX9 A;  4AEZ C;  4DPR A;  3CQG B;  4CRW A;  1H0A A;  2VGX A;  5ANR A;  4N2S A;  4G11 A;  1EF1 C;  4J8S A;  4RG6 A;  3I3N A;  4A3T A;  4CEM A;  5T8I A;  3CVL A;  1X5B A;  3FUL A;  2WQ7 A;  2Y3A A;  4FLH A;  2YHE A;  4AIF A;  3TGO A;  2ION A;  4HFG A;  4B89 A;  5A6C A;  3FWV A;  1FVF A;  4C9B B;  1NA0 A;  3R7R A;  3HVE B;  2C0M A;  2WXG A;  4F7A A;  4KZ0 A;  3GYZ A;  4ME2 A;  4GMJ A;  4U0Z A;  4E85 A;  1IQU A;  1JPL A;  4IN3 B;  1N54 A;  2Y4T A;  3PS6 A;  2OVB A;  5KJL A;  2PM7 A;  4NQ0 A;  3CEQ A;  2AW6 A;  4FJY A;  4MKT A;  2XGO A;  3O48 A;  4WNG A;  4EPZ A;  5FQ7 A;  3ONL A;  2KCK A;  3QOU A;  4JHR A;  3S2A A;  5BNW A;  4NAC A;  3ZHE A;  4G24 A;  1NZN A;  2I6H A;  3CHR A;  3OAW A;  1DVP A;  2GW1 A;  2X38 A;  3D9O A;  1JWF A;  3URZ A;  1JUQ A;  5EDS A;  5CCL A;  4JA7 A;  1FVH A;  2KC7 A;  3ZYL A;  2Y4U A;  4Q69 A;  3EJN A;  1P5Q A;  4M3O A;  2X6J A;  3CR3 A;  3JQ0 A;  4CGV A;  4JHK A;  5KJN A;  5FJY A;  3D9P A;  4PS3 A;  1NA3 A;  2QFC A;  2GGF A;  3CKC A;  4EZL A;  4GCN A;  2RG8 A;  3JCK C;  3ASH A;  2OV8 A;  2XHE A;  4V3I A;  3ONK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...