2NSZA

1.15 angstrom crystal structure of the ma3 domain of pdcd4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for inhibition of translation by the tumor suppressor Pdcd4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antitumor protein
molecule keywords Programmed cell death protein 4
total genus 54
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nszA00
2KZTA 4CT4A 4C9BB 2I2OA 4GMJA 4B8AA 2VSXE 1UW4B 4GMLA 2RG8A 3L6AA 4B8CB 3FEYA 1H2VC 2IU1A 2GGFA 3D3MA 3JUIA 2NSZA 1HU3A 2ZU6B 3EIJA 4JHKA 5ANRA 1PAQA 1N54A 1H6KA 3FEXA 4IULA 2IONA 2HM8A 2KZTB 4B89A 1H2TC 4CEMA 2IOLA 3RK6A 3EIQC 1H2UA 4LUNU 1N52A 2VSOE 1UG3A 2IOSA 2FULA 4JHJA 4CRWA
chains in the Genus database with same CATH superfamily
1N0RA 5JJTA 4FHJA 3UM0A 3E37A 1TJCA 2IO3C 4BT9A 3LPZA 4I17A 4EZKA 3R9MA 4L1BA 2EIME 3PZ4A 3DRAA 3P2BA 2A5EA 5H7PA 4CT0A 2WPVA 4N5CA 3JQ0A 4KMOA 2BUGA 2GRPB 3MZLB 1BI8B 4R7LA 2WXFA 3CKCA 5KJNA 4M3OA 1E7UA 5CBOA 4GU5A 3OXGA 4N5QA 3ASGA 4ACKA 3L6AA 3PE4A 3SBSA 5FWQA 2AXVA 5CEDB 2H6GA 2ONDA 4ZHBA 3FTUA 4I1OB 4FJYA 1TNZA 4QQIA 5KNGA 3UKUG 3D9PA 1E7VA 2GRMA 3OAWA 1MHQA 5M72A 2YHEA 1NI1A 5CMWA 5CHEE 3LCAA 3OXLA 1JUQA 4U8YD 5A6CA 2HE0A 2PNNA 2AXUA 2MOWA 1ZBPA 3ASNE 2WXOA 4FC8A 4U63A 2VSOE 4J7WA 2QYUA 4FULA 4N2SA 3TL5A 4GA2A 3UM2A 1L5JA 2DCPA 2WXJA 3D9IA 2WQHA 5FQ8A 5EX0A 5AQBA 2CHWA 3CQCB 1WM5A 3IHVA 3Q9NC 2ZGDA 3J5QB 2OVFA 4EPZA 5B3SE 3VLDA 4F1PA 3G2UA 2XZDG 3L9TA 1QYMA 1OCZE 4DRXE 5KJLA 3C3OA 4DX7D 3SGHA 2WXLA 2XHEA 4AM9A 4DK5A 1K1BA 5EX3A 3TWUA 1H2TC 5D0OD 2PZIA 2XS1A 3L17A 3BG0B 4XI9A 5CEAA 4BTAA 3EU9A 1XGWA 1D8EA 3FWVA 4Q96A 2F37A 1OWPA 2X38A 4GTTA 5AQ9A 5ENSD 2WMNA 2AWIA 3SNXA 3TWVA 4YNDA 4MRUA 5AN8A 4L7TA 1FVFA 2WMOA 4JHKA 3NQPA 3PE3A 3TAXA 1WY6A 4ILIA 1MYOA 1IHBA 2KCVA 4J8YA 3ZXSA 4U0SA 3DSWA 4N3CA 4AEZC 4KZ0A 2IJGX 4QFVA 2VYIA 3EU5A 2XRZA 1IHGA 4HLEA 4FADA 4PH4B 3CVVA 1X5BA 4TV3A 4B89A 3CK8A 1TNBA 1IXVA 2XPZA 2EINE 1VDYA 2VSNA 4KVMA 4ANUA 3Q47B 3IBEA 3C72A 4J8SA 1FT1A 4H7YA 2NSZA 2FO1E 3PS6A 5AYWD 3FTSA 1O1SA 5ARFA 1BLXB 2XRYA 3AAAC 3KS2A 4G26A 2UY1B 2RD0A 1MX6A 3C3QA 4GZ3A 3ZYKA 4GCNA 1WG0A 3AS8A 4HB5A 5HRYA 3C5RA 1HXIA 4ANWA 1AP7A 2UWJG 4XX5A 3U9WA 3HG0D 5FTPA 2V4LA 3N71A 3QJZA 4F1SA 1FVHA 3TGOA 2Y1LE 2VSYA 3UINC 4G8LA 3JYSA 3RRMB 3RO2A 1OUVA 2DYRE 2CG2A 3C98A 4J8FA 2ETCA 4FLHA 5FQ6A 3SD5A 3Q7FA 4FHKA 2LUHA 4HOQA 4CZ2D 2V5QC 3PVLA 1LD8A 5D2MC 5J90A 4IN3B 3E34A 5EN5D 4G25A 2WXIA 4CT4A 3T5XA 2V5FA 3FTVA 4GMRA 3SZ7A 4EZJA 2OEVA 4APOA 4U95D 2V0PA 3LVRE 2QY7A 3BEEA 3PNTB 3OTNA 3GZ2A 3FUNA 4XIFA 1MX4A 2EQXA 2FEZA 1N0QA 2Y0BG 4JD2G 4I9EA 4AJWA 5G05C 4A3VA 2KCLA 2P58C 4G1TA 4PS8A 1RW2A 2YINA 1UJKA 2DWZA 4HOSA 5LCWJ 1Z5SC 4GZ6A 3UM1A 1U3CA 4JL0A 4G11A 3FTYA 3HXCA 4ILHB 3AG4E 1H19A 3D9JA 4G23A 4TXPA 4UWFA 4IULA 3HXDA 3U66A 1IYGA 3PREA 3UTMA 2HO1A 2XEEA 4HOUA 2H6IA 4YVOA 3QWPA 3Q79A 3MV2B 3R7RA 5B1BE 3TXMA 1NL4A 4FU3A 3G2SA 3RRNB 3PUJA 2KZTA 3AU4A 1NA3A 2RFMA 4GZCA 3B7UX 1NFIE 5AENA 2X3MA 2VGXA 3CLJA 2V8SE 2XCCA 3FU0A 2J9QA 4U8HA 1U3DA 2XPYA 3TG5A 1Q2ZA 4B93B 4UI9C 2JLBA 1OXJA 3OXFA 2WXNA 1XNFA 4PS3A 2B0OE 2EIKE 3ZNGA 3S7DA 4X8QA 4GCOA 1U2VG 1N94A 3LEWA 3VTXA 5LX8A 1MQSA 3B13A 3VTYA 2MRIA 2P2CP 3FU3A 1PC2A 3DXMG 5BXOA 3E4BA 3NZSA 4CGVA 4C0EA 2WXPA 3ONKA 1OCRE 2IQCA 2EILE 3PH0C 4F53A 5A7DB 3O48A 4Q69A 5G55A 3CK9A 3LKUA 3GZSA 3FH8A 3MKRA 3ZFWA 1TN6A 4KXKB 1JCSA 1EF1C 4WNGA 1B89A 2XGOA 4U96D 3L16A 3VLEA 1IQRA 4GA0A 2WXRA 1LD7A 3EDTB 4FJZA 4O60A 4DX5D 2ZGGA 4GMLA 4WUYA 5G05J 4G2VA 3URZA 2L6BA 5KBAA 4JVSA 2L9BA 4I1MA 4WNEA 3ZKJA 1N95A 4CDRA 1BI7B 4EBAG 4EZLA 4HRLA 2KCKA 4K5AB 4V3IA 3ZEFA 3FUIA 4K0RA 4GZ5A 3CHPA 5D0QD 2L6JA 4KZCA 1ZU2A 2R05A 4LNUD 3FY4A 3ZU7B 1K1AA 3I3NA 5BNWA 2IONA 4E6HA 1ELRA 1S0PA 5AIJA 4Q94A 1O1RA 3NOGD 4UUCA 1E8WA 1HE8A 3FHEA 4BTBA 3HYMB 2RG8A 2LXLA 2A4ZA 4FP7A 4ACLA 1PAQA 2OCCE 4FLBA 5EIBE 2ZXWE 2IO2C 2DIWA 1S63A 4DLQA 3MKQB 3FUJA 2YQ8A 2LAHA 2OOEA 3X2QE 4HI9A 4JEHA 4PDXA 3NZUA 3UUXA 4APFA 1MX2A 3RSEG 4N3BA 4AP2A 2X6KA 3RIBA 2P9UG 5FIOA 2VGEA 2WVIA 1D9SA 3BQOA 2ZISA 4TXQA 1E90A 5IY5E 2GRLA 1HG5A 3LJNA 1H6OA 1RZ4A 4KVOA 2IY0C 3ABLE 3KAEA 4ANXA 3RK6A 5BPPA 4GTOA 3AG2E 2KATA 4NIKA 1H6PA 5J08A 4U07A 3DSUA 4YDOA 4GMJA 3CVLA 3D9HA 1N11A 2FBNA 4WNDA 3ZRHA 4AIFA 2PM7A 5T3RA 2FF4A 4O6FA 3LS8A 3HRAA 5ENRD 2KXPC 3NB2A 3JCKC 4I1AA 1UN9A 5BW8C 2UY1A 3LY8A 4OAUC 5JMND 5HS0A 3NBNB 2QC9A 3GW4A 4BX9A 3PUKA 4BSXA 3CVQA 5BV0A 4J8DA 2BKGA 3UT8A 1JCRA 3UX4A 3CK7A 2WXHA 2GRQB 2VQ2A 5ITZF 2R02A 3APFA 4BY6A 2R5SA 3BG1B 3CV0A 1JWGA 4RQIA 2P9KG 1EYHA 3PEUB 5FJYA 4ILGA 2XENA 3MKQA 4HXIA 3SF4A 4RG6A 2ZU6B 3L08A 3G2WA 1H6KA 1HF8A 3FFLA 3MEKA 3JQ1A 2OV8A 3FUKA 2L0TB 4OYSA 3FTXA 3LY7A 4WWPA 3FH5A 1QBQA 4JA7A 3ZYQA 4CDNA 4G8KA 1NA0A 3B7SA 2JEKA 1OWMA 4ATGA 5LCWC 2CG3A 2OVBA 5JHAA 1UG3A 4OAVB 5AQ7A 1ZB1A 5G2NA 3IHYA 1KT1A 2XPIA 3CHSA 3ZYLA 3EIJA 3E30A 2P9LG 1YYHA 2P9IG 4A3TA 1Z6TA 1SZ9A 1FT2A 1GW6A 3CKBA 3O4ZA 4LNGA 4HQDA 4U8VD 5AJLA 2VJ8A 3SFYA 2VGYA 2Y3AA 5D66A 3LJ3A 1SW6A 1TEZA 1H2VC 2GGFA 5KWDA 2DYSE 4N3AA 4AY6A 3HIZA 3F6QA 2WM9A 1N4RA 3NOCD 5ARGA 1UOHA 1G3NB 1HH8A 3FDHA 2NC9A 4EHMA 3Q5MA 3ULYA 3EHRA 4GB9A 1TNYA 4U7EB 4O1PA 3UT4A 3P1UA 4B0ZA 2AJAA 2CHZA 1KT0A 3PZ2A 5G04J 5T4YA 3R9AB 2KZTB 1LF8A 5FINA 1A5EA 4IYPA 5C2YA 4AXHA 2IOSA 4JB8P 5CRUA 3TWRA 4DX6D 5B1AE 2J09A 4C48B 1TN8A 3Q7AA 3CVNA 3HHMA 3ABME 3QWWA 1HO8A 1AWCB 2J49A 3UPVA 1TNUA 2XZTG 3VLFA 2C0LA 1HZ4A 1O1TA 3DWLG 3DEOA 3E32A 4B8AA 2AW6A 2LSUA 3D9MA 1TNOA 1YMPA 2KM4A 4F7AA 5KNHD 1HFAA 3DSTA 3V31A 2HM8A 4DJAA 3L54A 3SY2A 3G2VA 3UKRG 1UN8A 3QAQA 3FP3A 3J5PA 3L22A 4YDWA 4HLLA 3ZHEA 2BTDA 4AOFA 5CCMA 2J4DA 5BUZA 3FEXA 4GYYA 1S70B 5C1DA 3ZVVA 3QDNA 1LTXA 1SA5A 2PQRA 2VGXB 2F8YA 1Y8MA 4GTVA 4E85A 3ONLA 3FUDA 5EKQD 3UXGA 3QKYA 3MV3B 4IRUA 2FI7A 4JHRA 4ZFHA 4JXTA 4WWOA 4HVBA 5ANRA 1UJJA 4RLYA 2DBAA 1E8YA 3DSXA 2Y4TA 3ZYMA 4TXRA 4HBDA 3V2XA 3TJPA 4MBGA 2RKKA 3CEQA 4GYWA 2MHKA 2B6CA 4MKTA 1ELWA 3JUIA 5EIDA 2X6FA 2YHCA 1V55E 3S7BA 5CMYA 3CVUA 2WQ6A 1O5MA 4JA9A 3CHRA 4RVBA 3PDNA 2XEHA 2F8XK 3ISMC 2HR2A 4F3VA 2ZIRA 3Q15A 3SBTB 2V4HC 3DXKG 1BPOA 3Q4AB 3UI2A 3HXEA 4DI4A 4BETA 2CHXA 4L2YA 1DNPA 3V30A 1H2UA 4UQXA 3UM3A 3TWXA 4JHJA 2ILRA 3S2AA 4GTSA 4C9BB 4I6JA 3IKOB 1WAO1 3DEPA 2KC7A 1MZCA 2I1KA 4HS2A 5BT1A 3HVEA 1HG2A 3CVWA 4DLOA 1DC2A 4BX8A 1N9AA 3BU8A 1N4SA 4LUNU 5CCLA 3T9KA 4BT8A 4ABNA 2WXGA 5EYLA 3DSVA 3LVQE 3TXNA 2EIJE 3FUEA 2X6IA 3ML9A 5KJMA 3D9NA 3GYZA 4U0ZA 5KJKA 3FUHA 4NRHB 1KPSB 3LY9A 4GZDA 2I2OA 5LFAA 4YDEA 3KSLA 4LCTA 4JEUA 2M63A 3B7BA 3RKVA 2XCBA 2E0IA 4GPMA 3AU5A 3FULA 2AXZA 3V2OA 2FULA 1YCSB 5HQ8A 1Z3XA 3D9OA 4AV7A 2ETBA 4EQFA 3I5PA 1DCQA 3AJIA 3APDA 2R17C 4H7XA 3C3RA 3WXXA 2DVWA 1MJ0A 3L13A 2CFUA 5ENNA 3SHFA 2Y69E 1NP7A 4BEPA 4BERA 3SI5A 2BKKB 2GROB 1IQUA 4GYOA 1OCOE 4JC8A 4OVVA 2NXPA 3PZ1A 4Y6WA 3Q75A 3LDZA 3LXUX 1KZPA 4K5BA 2AVPA 4BESA 1E8XA 4O1OA 4UQYA 3RO3A 1DCEA 4NACA 1EDUA 2H6HA 5CBNA 3L82A 4JZYA 4YVQC 5FT9A 5CECB 2R03A 3AG1E 3D9LA 3MJWA 3BUAA 2KBXA 4HOTA 3HDXA 5EYPF 2IEJA 3MGBA 2IOLA 4LG6A 2BEDA 4UI9K 2NYJA 3WG7E 5FZSA 3JUEA 4TUMA 4WAFA 3QARA 3IEGA 3TWSA 4WNFA 2XEVA 4MLPA 1KLXA 4HFGA 3TG4A 2WXMA 4XEIG 3FUMA 4XKBA 1SZAA 4NURA 3CVPA 3ULEG 5JJ7A 2C0MA 3RJVA 5FZRA 2JABA 4MS6A 3ESLA 1TN7A 3EHMA 5CRVA 4C0MA 2C2LA 1HS6A 3AS5A 1V54E 4TRQA 1TR4A 4U04A 2IFUA 2LSVA 5AARA 3ASHA 4GA1A 2PQNA 1N4QA 3CSFA 3KEAA 4B94A 3UT7A 1TYQG 1W3BA 3ZXPA 3B95A 4I9CA 4CCAA 3QNKA 1K3ZD 2PM6A 2BF0X 4A55A 4I2WA 4JPSA 3QC1A 5AQAA 3V79K 4XZ4A 4I6GA 3UIOC 3Q49B 3ESKA 2Q7FA 3NAWA 2CFZA 2F0YA 1INZA 4YDYA 2RFAA 3CQGB 1OWOA 2ETAA 3PZDA 4LRZA 3QOUA 1JCQA 2WXQA 3RAUA 3CVXA 1OT8A 3QWVA 3UIPC 3PEVB 4A63B 4UI9J 4UWHA 3CR3A 1NZNA 5G04C 4LNBA 3FEYA 1QNFA 3EHQA 4PS7A 2GW1A 3U64A 2J4BA 3EHNA 4N39A 2FO7A 3S7FA 4EBAA 3EUVA 3MYVA 1OWLA 5AJDA 5LP0A 4L9PA 3T5VA 4M7CA 5T8IA 3ZHEB 4KYOB 4BSZB 3UMVA 1SA4A 1HX8A 3D9KA 5LOZA 5FZQA 2IU1A 3KD7A 4NQ0A 2PL2A 1HU3A 4I6EA 3SFXA 3DBSA 4DX1A 1FCHA 1KZOA 4UWLA 1Y6IA 5DIZA 4EECA 2P9SG 3I4GA 3MA5A 2WQ7A 3MCXA 5KCMA 5ENPD 4DX2A 1S64A 2IF4A 4HNAD 3DSSA 1JWFA 1DVPA 4ME2A 2WB2A 3U3WA 1E8ZA 4GTRA 2J07A 2QFCA 3ASOE 4CEMA 2L0IA 4CGWA 4GAAA 4HRMB 1N52A 1SQMA 1FPPA 2I1JA 3ENEA 4K03A 4Z68A 4CYMD 3FU6A 3MX3A 3QB2A 4ANVA 3CIAA 1QZ2A 1Z3YA 4P29A 4KBQA 4FA6A 2XGMA 3CHOA 1H0AA 3SFZA 1YA0A 2A5UA 3Q78A 1WDYA 3B7TA 3PZ3A 1BD8A 3TWTA 5FQ4A 2P9NG 3S7JA 3ABKE 4GTQA 1OCCE 5HKPA 2J8SD 3KSQA 2GRNB 4XI0A 3CHQA 1OWNA 3TWQA 4I2ZA 2VTBB 3ZW3A 3G2TA 4UWKA 3FU5A 5JJ6A 4I43A 1P5QA 1TJFA 2QYJA 3ZIMA 2QZAA 3LYAA 1QQEA 3PNLB 3W9GA 4LSZE 3B7RL 5BV1A 3W9FA 5AAOA 2WXKA 2X6JA 1SVXA 3CSTA 1PY1A 3R7QA 4KT6B 4TUUA 3E33A 5E75A 2XS8A 4A1SA 2DZOA 3QK0A 5HI7A 1EPUA 4B8CB 3NF1A 3HXBA 2LNIA 2GRRB 4A1GA 3FTZA 2J08A 3U4TA 3ULQA 4OVUA 1IKND 3AS4A 4GTPA 4GPKA 4CDMA 4G24A 4AVXA 4BFRA 4U0UA 3ASDA 3SQVA 3JXJA 4PUCA 4AY5A 5E76A 4N2QA 2LAIA 3PRZA 5JHBA 3APCA 4K5CA 3CGHA 5FQ7A 5ANLA 2R59A 2OEWA 3EIQC 4F6RD 1X81A 4L23A 4CRWA 4RG9A 4HRNA 3RRUA 3D3MA 3Q9UC 1D8DA 3ZN3A 5JA4D 4HORA 1N54A 4J6IA 3TWWA 3T8MA 1JPLA 4L2LA 5DBKA 2I9CA 3CVYA 4WWNA 5A23A 2LXMA 4BWRA 4RSYA 3FUFA 3GZ1A 1UW4B 3ML8A 4JW1A 3SO8A 4J8EA 2Y4UA 3UQ3A 4W9RA 4J0UA 3AG3E 3ASFA 5ENTD 3EJNA 3ZUVB 2VTBA 3Q73A 4LERA 1K8KG 2E2EA 4UWGA 2R2LA 2XGSA 4DI3A 3ZGQA 2DZNA 5ENQD 4DUIA 3RU0A 5BXUA 5ENOD 3HVEB 3IV0A 4GTMA 3KEZA 2LO6A 3ZPJA 2VSXE 3CHMA 1E96B 3HXFA 2XQ0A 3T8KA 4ATZD 1A17A 3FH7A 2H6FA 3JXIA 1ELKA 4HI8A 3DPDA 2X6HA 4XKCA 4LEUA 4UQZA 4URKA 3FTWA 3I4RB 1BU9A 2I6HA 5EDSA 1N4PA 2P9PG 3DPYA 5EILA 1OY3D 4XE0A 5CERB 2YNQA 2HYZA 3K9IA 4DPRA 4D10C 3IXEA 2MYOA 4Y6CA
chains in the Genus database with same CATH topology
2KZTA 5JJTA 4TRQA 4FHJA 3AU4A 3UT4A 4U04A 1NA3A 3P1UA 2IFUA 2LSVA 4B0ZA 3ASHA 2CHZA 1TJCA 4GA1A 2PQNA 3B7UX 4GZCA 5AENA 1KT0A 2X3MA 3CSFA 2VGXA 4BT9A 3LPZA 5G04J 3CLJA 4B94A 5T4YA 3R9AB 2V8SE 3UT7A 4I17A 4EZKA 2XCCA 3FU0A 2J9QA 1W3BA 2KZTB 4L1BA 1LF8A 4U8HA 1U3DA 3P2BA 4IYPA 4I9CA 5C2YA 4CCAA 4AXHA 3QNKA 4CT0A 2IOSA 2WPVA 2XPYA 2PM6A 4N5CA 3JQ0A 2BF0X 4A55A 2J09A 4I2WA 4JPSA 4KMOA 2BUGA 3QC1A 3TG5A 4UI9C 3CVNA 2JLBA 3MZLB 3HHMA 4R7LA 4XZ4A 4I6GA 3OXFA 2WXNA 2WXFA 1XNFA 1HO8A 3QWWA 4PS3A 3Q49B 2J49A 3ESKA 2Q7FA 3UPVA 3CKCA 5KJNA 4M3OA 3VLFA 2CFZA 2C0LA 1E7UA 3S7DA 1HZ4A 1INZA 4GU5A 3OXGA 4GCOA 3LEWA 3VTXA 3CQGB 3ASGA 4B8AA 2AW6A 2LSUA 5LX8A 3D9MA 1MQSA 1OWOA 3B13A 4ACKA 3VTYA 3L6AA 3PE4A 3SBSA 2KM4A 5FWQA 2AXVA 3PZDA 2MRIA 4F7AA 4LRZA 1HFAA 3FU3A 2ONDA 3QOUA 1PC2A 3FTUA 4I1OB 4FJYA 3E4BA 3NZSA 2HM8A 4CGVA 2WXQA 4C0EA 4DJAA 3CVXA 3QWVA 3L54A 3D9PA 2WXPA 3ONKA 1E7VA 2GRMA 3PEVB 2IQCA 3G2VA 4UI9J 3OAWA 3PH0C 4UWHA 1MHQA 3CR3A 4F53A 1NZNA 1UN8A 2YHEA 3O48A 3FP3A 3QAQA 3L22A 5G04C 5A7DB 5M72A 4Q69A 5G55A 3CK9A 5CMWA 3FEYA 5CHEE 1QNFA 3ZHEA 2BTDA 3LKUA 1JUQA 3LCAA 3OXLA 2GW1A 3GZSA 4PS7A 3U64A 3FH8A 4AOFA 2J4BA 3EHNA 5A6CA 3MKRA 4N39A 5CCMA 3ZFWA 2J4DA 2FO7A 5BUZA 3FEXA 4KXKB 4GYYA 5C1DA 3ZVVA 2AXUA 3QDNA 1EF1C 3S7FA 4WNGA 4EBAA 1B89A 3MYVA 2MOWA 1ZBPA 2XGOA 2PQRA 1OWLA 2VGXB 5AJDA 5LP0A 3T5VA 2WXOA 3L16A 4FC8A 3VLEA 4U63A 2VSOE 5T8IA 3ZHEB 1Y8MA 4KYOB 1IQRA 4FULA 3ONLA 4GA0A 4E85A 2WXRA 3EDTB 4FJZA 3UMVA 4N2SA 3TL5A 3FUDA 5EKQD 4GA2A 1HX8A 4GMLA 4WUYA 5G05J 3D9KA 5LOZA 3QKYA 1L5JA 3MV3B 4IRUA 2DCPA 5FZQA 2IU1A 3KD7A 4NQ0A 2PL2A 2WXJA 2FI7A 3D9IA 2WQHA 4G2VA 4JHRA 3URZA 4JVSA 5FQ8A 1HU3A 4JXTA 2L9BA 4I6EA 4WWOA 5ANRA 4HVBA 3DBSA 1UJJA 4I1MA 5EX0A 1FCHA 2DBAA 1E8YA 4WNEA 2CHWA 3CQCB 1WM5A 2Y4TA 3IHVA 1Y6IA 4UWLA 5DIZA 4EECA 3ZYMA 4CDRA 3I4GA 4EBAG 3MA5A 4EZLA 2KCKA 2OVFA 4EPZA 4V3IA 2WQ7A 3VLDA 3TJPA 3FUIA 3G2UA 3MCXA 4K0RA 5KCMA 3ZEFA 4GZ5A 3CHPA 5D0QD 3CEQA 4GYWA 2MHKA 2IF4A 2L6JA 5KJLA 4KZCA 1ZU2A 4MKTA 1ELWA 1JWFA 3JUIA 1DVPA 3FY4A 4ME2A 3SGHA 2WB2A 2WXLA 2XHEA 4AM9A 3U3WA 2X6FA 3I3NA 4DK5A 5BNWA 1E8ZA 2IONA 4E6HA 2YHCA 2J07A 2QFCA 5EX3A 1ELRA 4CEMA 1H2TC 5D0OD 1S0PA 2L0IA 2PZIA 3S7BA 5CMYA 4CGWA 3CVUA 3L17A 4JA9A 3BG0B 4GAAA 3CHRA 4Q94A 4RVBA 5AIJA 2WQ6A 4XI9A 1N52A 4BTAA 3PDNA 1SQMA 2I1JA 1XGWA 3ENEA 1E8WA 1HE8A 3FHEA 2HR2A 3FWVA 4K03A 4Q96A 4BTBA 1OWPA 3FU6A 3MX3A 4F3VA 2X38A 3HYMB 2WMNA 2AWIA 2RG8A 3Q15A 3SBTB 3SNXA 3QB2A 4YNDA 4ANVA 4MRUA 3CIAA 4L7TA 1FVFA 1QZ2A 1Z3YA 1BPOA 2A4ZA 3Q4AB 2WMOA 4KBQA 4FP7A 4P29A 4FA6A 4JHKA 4ACLA 1PAQA 3NQPA 4DI4A 3PE3A 2CHXA 4FLBA 4L2YA 3TAXA 1DNPA 1WY6A 2XGMA 3CHOA 1H0AA 4ILIA 1H2UA 2DIWA 2KCVA 4UQXA 3ZXSA 3SFZA 1YA0A 4U0SA 2A5UA 4DLQA 3MKQB 3B7TA 4N3CA 4JHJA 2ILRA 3FUJA 2IJGX 2YQ8A 4KZ0A 4QFVA 5FQ4A 3S2AA 2LAHA 3S7JA 4C9BB 4I6JA 3IKOB 2OOEA 2VYIA 1WAO1 4XI0A 2KC7A 3CHQA 2XRZA 1IHGA 4HLEA 4JEHA 4PDXA 2I1KA 4HS2A 4FADA 5BT1A 1OWNA 3HVEA 3NZUA 1HG2A 3UUXA 4I2ZA 4APFA 4PH4B 3CVVA 2VTBB 4N3BA 4AP2A 3CVWA 4DLOA 2X6KA 1X5BA 3RIBA 4TV3A 4B89A 3ZW3A 3CK8A 4BX8A 2XPZA 3G2TA 4LUNU 4UWKA 1VDYA 2VSNA 3FU5A 4KVMA 5CCLA 2WVIA 5JJ6A 4I43A 1P5QA 1TJFA 3ZIMA 4BT8A 4ANUA 3LYAA 1QQEA 3Q47B 3PNLB 3IBEA 4ABNA 2WXGA 4J8SA 3B7RL 5BV1A 1E90A 4H7YA 3LVQE 2WXKA 3TXNA 2NSZA 2GRLA 2X6JA 1HG5A 3FUEA 3CSTA 2X6IA 3PS6A 4KVOA 5AYWD 1PY1A 3FTSA 3KAEA 3R7QA 4ANXA 3ML9A 5ARFA 5KJMA 4KT6B 3RK6A 4TUUA 5BPPA 3D9NA 2KATA 2XRYA 3GYZA 4U0ZA 3KS2A 4G26A 2UY1B 5E75A 3FUHA 5J08A 5KJKA 2RD0A 4U07A 4A1SA 3QK0A 4NRHB 3LY9A 4GZDA 2I2OA 4GMJA 5HI7A 3CVLA 4GZ3A 3ZYKA 2FBNA 4WNDA 1EPUA 5LFAA 4GCNA 4LCTA 3AS8A 4B8CB 4JEUA 3ZRHA 4AIFA 3NF1A 2M63A 2PM7A 2LNIA 1HXIA 5T3RA 4A1GA 4ANWA 3RKVA 2XCBA 2E0IA 3FTZA 2UWJG 4XX5A 3U9WA 2J08A 3AU5A 3FULA 2FF4A 4O6FA 5FTPA 3U4TA 3ULQA 2V4LA 4OVUA 3LS8A 3AS4A 3N71A 3QJZA 2AXZA 4F1SA 1FVHA 3JCKC 2FULA 4I1AA 3TGOA 4GPKA 2VSYA 1UN9A 5BW8C 4CDMA 4G24A 2UY1A 4AVXA 4BFRA 3LY8A 4U0UA 3ASDA 5HQ8A 1Z3XA 3D9OA 4PUCA 4AY5A 5E76A 4N2QA 2LAIA 4AV7A 3PRZA 3GW4A 5JHBA 3APCA 3CGHA 3JYSA 3RRMB 4BX9A 3RO2A 4EQFA 5FQ7A 5ANLA 1OUVA 2R59A 2CG2A 3PUKA 3C98A 3EIQC 3I5PA 4BSXA 4J8FA 4FLHA 5FQ6A 3CVQA 5BV0A 3APDA 4J8DA 4L23A 4CRWA 3SD5A 2R17C 4RG9A 3UT8A 4FHKA 4H7XA 4HOQA 3UX4A 4AEZC 3RRUA 3WXXA 3CK7A 3PVLA 2WXHA 3D3MA 3L13A 2CFUA 2VQ2A 3ZN3A 5J90A 4IN3B 5ENNA 4HORA 1N54A 4J6IA 3SHFA 3T8MA 1NP7A 3APFA 4BY6A 3SI5A 2R5SA 1JPLA 3BG1B 3CV0A 4L2LA 1JWGA 1IQUA 4GYOA 4G25A 5DBKA 1EYHA 4JC8A 3PEUB 4OVVA 5FJYA 2I9CA 2NXPA 4ILGA 2WXIA 3CVYA 4Y6WA 4WWNA 4CT4A 5A23A 3LDZA 3LXUX 3T5XA 3MKQA 4RSYA 2V5FA 3FTVA 3FUFA 4BWRA 3GZ1A 1UW4B 3ML8A 4JW1A 3SZ7A 2AVPA 4HXIA 1E8XA 4EZJA 4J8EA 2Y4UA 3UQ3A 4APOA 3SF4A 4UQYA 4W9RA 4RG6A 2V0PA 4J0UA 3RO3A 3LVRE 3ASFA 2QY7A 3BEEA 3PNTB 2ZU6B 4NACA 3L08A 3G2WA 1H6KA 3EJNA 1HF8A 3FFLA 3OTNA 3MEKA 1EDUA 3GZ2A 3JQ1A 3FUNA 4XIFA 2VTBA 2OV8A 4LERA 3FUKA 2L0TB 2E2EA 4JZYA 4UWGA 4YVQC 4OYSA 2EQXA 3FTXA 3LY7A 5FT9A 2XGSA 4WWPA 3FH5A 4DI3A 3ZGQA 2FEZA 4JA7A 3RU0A 3ZYQA 4CDNA 1NA0A 3B7SA 3D9LA 3HVEB 3MJWA 2JEKA 4I9EA 3IV0A 1OWMA 5G05C 4AJWA 4A3VA 4HOTA 2KCLA 2P58C 4ATGA 5LCWC 2CG3A 3HDXA 3MGBA 3KEZA 4G1TA 4PS8A 2YINA 1UJKA 2IOLA 2OVBA 5JHAA 4HOSA 2LO6A 5LCWJ 1UG3A 4UI9K 4GZ6A 1U3CA 3ZPJA 5FZSA 5G2NA 3IHYA 2VSXE 1KT1A 3QARA 4G11A 3FTYA 3IEGA 4JL0A 2XPIA 4WAFA 4WNFA 3CHSA 3CHMA 2XEVA 1E96B 4ILHB 2XQ0A 3D9JA 1H19A 4MLPA 1KLXA 3ZYLA 1A17A 3EIJA 4G23A 4UWFA 4IULA 3FH7A 4A3TA 1Z6TA 3U66A 1SZ9A 1ELKA 1GW6A 1IYGA 3CKBA 3DPDA 4HFGA 3TG4A 3O4ZA 2X6HA 2WXMA 4XKCA 3PREA 3FUMA 4XKBA 5AJLA 1SZAA 4LEUA 4UQZA 2VJ8A 4NURA 2VGYA 2Y3AA 2HO1A 3LJ3A 3FTWA 3I4RB 4URKA 1TEZA 1H2VC 2I6HA 2GGFA 4HOUA 3CVPA 5EDSA 5JJ7A 2C0MA 4N3AA 4YVOA 4AY6A 3QWPA 3RJVA 3HIZA 4XE0A 2WM9A 5FZRA 2YNQA 5ARGA 4MS6A 2HYZA 3ESLA 3MV2B 3EHMA 3R7RA 3K9IA 1HH8A 3FDHA 2NC9A 3Q5MA 3TXMA 4C0MA 4D10C 4DPRA 4FU3A 2C2LA 4Y6CA 3G2SA 3RRNB 4GB9A 1HS6A 3AS5A 3PUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZT A;  4CT4 A;  4C9B B;  2I2O A;  4GMJ A;  4B8A A;  2VSX E;  1UW4 B;  4GML A;  2RG8 A;  3L6A A;  4B8C B;  3FEY A;  1H2V C;  2IU1 A;  2GGF A;  3D3M A;  3JUI A;  2NSZ A;  1HU3 A;  2ZU6 B;  3EIJ A;  4JHK A;  5ANR A;  1PAQ A;  1N54 A;  1H6K A;  3FEX A;  4IUL A;  2ION A;  2HM8 A;  2KZT B;  4B89 A;  1H2T C;  4CEM A;  2IOL A;  3RK6 A;  3EIQ C;  1H2U A;  4LUN U;  1N52 A;  2VSO E;  1UG3 A;  2IOS A;  2FUL A;  4JHJ A;  4CRW A; 
#chains in the Genus database with same CATH topology
 1N0R A;  5JJT A;  4FHJ A;  3UM0 A;  3E37 A;  1TJC A;  2IO3 C;  4BT9 A;  3LPZ A;  4I17 A;  4EZK A;  3R9M A;  4L1B A;  2EIM E;  3PZ4 A;  3DRA A;  3P2B A;  2A5E A;  5H7P A;  4CT0 A;  2WPV A;  4N5C A;  3JQ0 A;  4KMO A;  2BUG A;  2GRP B;  3MZL B;  1BI8 B;  4R7L A;  2WXF A;  3CKC A;  5KJN A;  4M3O A;  1E7U A;  5CBO A;  4GU5 A;  3OXG A;  4N5Q A;  3ASG A;  4ACK A;  3L6A A;  3PE4 A;  3SBS A;  5FWQ A;  2AXV A;  5CED B;  2H6G A;  2OND A;  4ZHB A;  3FTU A;  4I1O B;  4FJY A;  1TNZ A;  4QQI A;  5KNG A;  3UKU G;  3D9P A;  1E7V A;  2GRM A;  3OAW A;  1MHQ A;  5M72 A;  2YHE A;  1NI1 A;  5CMW A;  5CHE E;  3LCA A;  3OXL A;  1JUQ A;  4U8Y D;  5A6C A;  2HE0 A;  2PNN A;  2AXU A;  2MOW A;  1ZBP A;  3ASN E;  2WXO A;  4FC8 A;  4U63 A;  2VSO E;  4J7W A;  2QYU A;  4FUL A;  4N2S A;  3TL5 A;  4GA2 A;  3UM2 A;  1L5J A;  2DCP A;  2WXJ A;  3D9I A;  2WQH A;  5FQ8 A;  5EX0 A;  5AQB A;  2CHW A;  3CQC B;  1WM5 A;  3IHV A;  3Q9N C;  2ZGD A;  3J5Q B;  2OVF A;  4EPZ A;  5B3S E;  3VLD A;  4F1P A;  3G2U A;  2XZD G;  3L9T A;  1QYM A;  1OCZ E;  4DRX E;  5KJL A;  3C3O A;  4DX7 D;  3SGH A;  2WXL A;  2XHE A;  4AM9 A;  4DK5 A;  1K1B A;  5EX3 A;  3TWU A;  1H2T C;  5D0O D;  2PZI A;  2XS1 A;  3L17 A;  3BG0 B;  4XI9 A;  5CEA A;  4BTA A;  3EU9 A;  1XGW A;  1D8E A;  3FWV A;  4Q96 A;  2F37 A;  1OWP A;  2X38 A;  4GTT A;  5AQ9 A;  5ENS D;  2WMN A;  2AWI A;  3SNX A;  3TWV A;  4YND A;  4MRU A;  5AN8 A;  4L7T A;  1FVF A;  2WMO A;  4JHK A;  3NQP A;  3PE3 A;  3TAX A;  1WY6 A;  4ILI A;  1MYO A;  1IHB A;  2KCV A;  4J8Y A;  3ZXS A;  4U0S A;  3DSW A;  4N3C A;  4AEZ C;  4KZ0 A;  2IJG X;  4QFV A;  2VYI A;  3EU5 A;  2XRZ A;  1IHG A;  4HLE A;  4FAD A;  4PH4 B;  3CVV A;  1X5B A;  4TV3 A;  4B89 A;  3CK8 A;  1TNB A;  1IXV A;  2XPZ A;  2EIN E;  1VDY A;  2VSN A;  4KVM A;  4ANU A;  3Q47 B;  3IBE A;  3C72 A;  4J8S A;  1FT1 A;  4H7Y A;  2NSZ A;  2FO1 E;  3PS6 A;  5AYW D;  3FTS A;  1O1S A;  5ARF A;  1BLX B;  2XRY A;  3AAA C;  3KS2 A;  4G26 A;  2UY1 B;  2RD0 A;  1MX6 A;  3C3Q A;  4GZ3 A;  3ZYK A;  4GCN A;  1WG0 A;  3AS8 A;  4HB5 A;  5HRY A;  3C5R A;  1HXI A;  4ANW A;  1AP7 A;  2UWJ G;  4XX5 A;  3U9W A;  3HG0 D;  5FTP A;  2V4L A;  3N71 A;  3QJZ A;  4F1S A;  1FVH A;  3TGO A;  2Y1L E;  2VSY A;  3UIN C;  4G8L A;  3JYS A;  3RRM B;  3RO2 A;  1OUV A;  2DYR E;  2CG2 A;  3C98 A;  4J8F A;  2ETC A;  4FLH A;  5FQ6 A;  3SD5 A;  3Q7F A;  4FHK A;  2LUH A;  4HOQ A;  4CZ2 D;  2V5Q C;  3PVL A;  1LD8 A;  5D2M C;  5J90 A;  4IN3 B;  3E34 A;  5EN5 D;  4G25 A;  2WXI A;  4CT4 A;  3T5X A;  2V5F A;  3FTV A;  4GMR A;  3SZ7 A;  4EZJ A;  2OEV A;  4APO A;  4U95 D;  2V0P A;  3LVR E;  2QY7 A;  3BEE A;  3PNT B;  3OTN A;  3GZ2 A;  3FUN A;  4XIF A;  1MX4 A;  2EQX A;  2FEZ A;  1N0Q A;  2Y0B G;  4JD2 G;  4I9E A;  4AJW A;  5G05 C;  4A3V A;  2KCL A;  2P58 C;  4G1T A;  4PS8 A;  1RW2 A;  2YIN A;  1UJK A;  2DWZ A;  4HOS A;  5LCW J;  1Z5S C;  4GZ6 A;  3UM1 A;  1U3C A;  4JL0 A;  4G11 A;  3FTY A;  3HXC A;  4ILH B;  3AG4 E;  1H19 A;  3D9J A;  4G23 A;  4TXP A;  4UWF A;  4IUL A;  3HXD A;  3U66 A;  1IYG A;  3PRE A;  3UTM A;  2HO1 A;  2XEE A;  4HOU A;  2H6I A;  4YVO A;  3QWP A;  3Q79 A;  3MV2 B;  3R7R A;  5B1B E;  3TXM A;  1NL4 A;  4FU3 A;  3G2S A;  3RRN B;  3PUJ A;  2KZT A;  3AU4 A;  1NA3 A;  2RFM A;  4GZC A;  3B7U X;  1NFI E;  5AEN A;  2X3M A;  2VGX A;  3CLJ A;  2V8S E;  2XCC A;  3FU0 A;  2J9Q A;  4U8H A;  1U3D A;  2XPY A;  3TG5 A;  1Q2Z A;  4B93 B;  4UI9 C;  2JLB A;  1OXJ A;  3OXF A;  2WXN A;  1XNF A;  4PS3 A;  2B0O E;  2EIK E;  3ZNG A;  3S7D A;  4X8Q A;  4GCO A;  1U2V G;  1N94 A;  3LEW A;  3VTX A;  5LX8 A;  1MQS A;  3B13 A;  3VTY A;  2MRI A;  2P2C P;  3FU3 A;  1PC2 A;  3DXM G;  5BXO A;  3E4B A;  3NZS A;  4CGV A;  4C0E A;  2WXP A;  3ONK A;  1OCR E;  2IQC A;  2EIL E;  3PH0 C;  4F53 A;  5A7D B;  3O48 A;  4Q69 A;  5G55 A;  3CK9 A;  3LKU A;  3GZS A;  3FH8 A;  3MKR A;  3ZFW A;  1TN6 A;  4KXK B;  1JCS A;  1EF1 C;  4WNG A;  1B89 A;  2XGO A;  4U96 D;  3L16 A;  3VLE A;  1IQR A;  4GA0 A;  2WXR A;  1LD7 A;  3EDT B;  4FJZ A;  4O60 A;  4DX5 D;  2ZGG A;  4GML A;  4WUY A;  5G05 J;  4G2V A;  3URZ A;  2L6B A;  5KBA A;  4JVS A;  2L9B A;  4I1M A;  4WNE A;  3ZKJ A;  1N95 A;  4CDR A;  1BI7 B;  4EBA G;  4EZL A;  4HRL A;  2KCK A;  4K5A B;  4V3I A;  3ZEF A;  3FUI A;  4K0R A;  4GZ5 A;  3CHP A;  5D0Q D;  2L6J A;  4KZC A;  1ZU2 A;  2R05 A;  4LNU D;  3FY4 A;  3ZU7 B;  1K1A A;  3I3N A;  5BNW A;  2ION A;  4E6H A;  1ELR A;  1S0P A;  5AIJ A;  4Q94 A;  1O1R A;  3NOG D;  4UUC A;  1E8W A;  1HE8 A;  3FHE A;  4BTB A;  3HYM B;  2RG8 A;  2LXL A;  2A4Z A;  4FP7 A;  4ACL A;  1PAQ A;  2OCC E;  4FLB A;  5EIB E;  2ZXW E;  2IO2 C;  2DIW A;  1S63 A;  4DLQ A;  3MKQ B;  3FUJ A;  2YQ8 A;  2LAH A;  2OOE A;  3X2Q E;  4HI9 A;  4JEH A;  4PDX A;  3NZU A;  3UUX A;  4APF A;  1MX2 A;  3RSE G;  4N3B A;  4AP2 A;  2X6K A;  3RIB A;  2P9U G;  5FIO A;  2VGE A;  2WVI A;  1D9S A;  3BQO A;  2ZIS A;  4TXQ A;  1E90 A;  5IY5 E;  2GRL A;  1HG5 A;  3LJN A;  1H6O A;  1RZ4 A;  4KVO A;  2IY0 C;  3ABL E;  3KAE A;  4ANX A;  3RK6 A;  5BPP A;  4GTO A;  3AG2 E;  2KAT A;  4NIK A;  1H6P A;  5J08 A;  4U07 A;  3DSU A;  4YDO A;  4GMJ A;  3CVL A;  3D9H A;  1N11 A;  2FBN A;  4WND A;  3ZRH A;  4AIF A;  2PM7 A;  5T3R A;  2FF4 A;  4O6F A;  3LS8 A;  3HRA A;  5ENR D;  2KXP C;  3NB2 A;  3JCK C;  4I1A A;  1UN9 A;  5BW8 C;  2UY1 A;  3LY8 A;  4OAU C;  5JMN D;  5HS0 A;  3NBN B;  2QC9 A;  3GW4 A;  4BX9 A;  3PUK A;  4BSX A;  3CVQ A;  5BV0 A;  4J8D A;  2BKG A;  3UT8 A;  1JCR A;  3UX4 A;  3CK7 A;  2WXH A;  2GRQ B;  2VQ2 A;  5ITZ F;  2R02 A;  3APF A;  4BY6 A;  2R5S A;  3BG1 B;  3CV0 A;  1JWG A;  4RQI A;  2P9K G;  1EYH A;  3PEU B;  5FJY A;  4ILG A;  2XEN A;  3MKQ A;  4HXI A;  3SF4 A;  4RG6 A;  2ZU6 B;  3L08 A;  3G2W A;  1H6K A;  1HF8 A;  3FFL A;  3MEK A;  3JQ1 A;  2OV8 A;  3FUK A;  2L0T B;  4OYS A;  3FTX A;  3LY7 A;  4WWP A;  3FH5 A;  1QBQ A;  4JA7 A;  3ZYQ A;  4CDN A;  4G8K A;  1NA0 A;  3B7S A;  2JEK A;  1OWM A;  4ATG A;  5LCW C;  2CG3 A;  2OVB A;  5JHA A;  1UG3 A;  4OAV B;  5AQ7 A;  1ZB1 A;  5G2N A;  3IHY A;  1KT1 A;  2XPI A;  3CHS A;  3ZYL A;  3EIJ A;  3E30 A;  2P9L G;  1YYH A;  2P9I G;  4A3T A;  1Z6T A;  1SZ9 A;  1FT2 A;  1GW6 A;  3CKB A;  3O4Z A;  4LNG A;  4HQD A;  4U8V D;  5AJL A;  2VJ8 A;  3SFY A;  2VGY A;  2Y3A A;  5D66 A;  3LJ3 A;  1SW6 A;  1TEZ A;  1H2V C;  2GGF A;  5KWD A;  2DYS E;  4N3A A;  4AY6 A;  3HIZ A;  3F6Q A;  2WM9 A;  1N4R A;  3NOC D;  5ARG A;  1UOH A;  1G3N B;  1HH8 A;  3FDH A;  2NC9 A;  4EHM A;  3Q5M A;  3ULY A;  3EHR A;  4GB9 A;  1TNY A;  4U7E B;  4O1P A;  3UT4 A;  3P1U A;  4B0Z A;  2AJA A;  2CHZ A;  1KT0 A;  3PZ2 A;  5G04 J;  5T4Y A;  3R9A B;  2KZT B;  1LF8 A;  5FIN A;  1A5E A;  4IYP A;  5C2Y A;  4AXH A;  2IOS A;  4JB8 P;  5CRU A;  3TWR A;  4DX6 D;  5B1A E;  2J09 A;  4C48 B;  1TN8 A;  3Q7A A;  3CVN A;  3HHM A;  3ABM E;  3QWW A;  1HO8 A;  1AWC B;  2J49 A;  3UPV A;  1TNU A;  2XZT G;  3VLF A;  2C0L A;  1HZ4 A;  1O1T A;  3DWL G;  3DEO A;  3E32 A;  4B8A A;  2AW6 A;  2LSU A;  3D9M A;  1TNO A;  1YMP A;  2KM4 A;  4F7A A;  5KNH D;  1HFA A;  3DST A;  3V31 A;  2HM8 A;  4DJA A;  3L54 A;  3SY2 A;  3G2V A;  3UKR G;  1UN8 A;  3QAQ A;  3FP3 A;  3J5P A;  3L22 A;  4YDW A;  4HLL A;  3ZHE A;  2BTD A;  4AOF A;  5CCM A;  2J4D A;  5BUZ A;  3FEX A;  4GYY A;  1S70 B;  5C1D A;  3ZVV A;  3QDN A;  1LTX A;  1SA5 A;  2PQR A;  2VGX B;  2F8Y A;  1Y8M A;  4GTV A;  4E85 A;  3ONL A;  3FUD A;  5EKQ D;  3UXG A;  3QKY A;  3MV3 B;  4IRU A;  2FI7 A;  4JHR A;  4ZFH A;  4JXT A;  4WWO A;  4HVB A;  5ANR A;  1UJJ A;  4RLY A;  2DBA A;  1E8Y A;  3DSX A;  2Y4T A;  3ZYM A;  4TXR A;  4HBD A;  3V2X A;  3TJP A;  4MBG A;  2RKK A;  3CEQ A;  4GYW A;  2MHK A;  2B6C A;  4MKT A;  1ELW A;  3JUI A;  5EID A;  2X6F A;  2YHC A;  1V55 E;  3S7B A;  5CMY A;  3CVU A;  2WQ6 A;  1O5M A;  4JA9 A;  3CHR A;  4RVB A;  3PDN A;  2XEH A;  2F8X K;  3ISM C;  2HR2 A;  4F3V A;  2ZIR A;  3Q15 A;  3SBT B;  2V4H C;  3DXK G;  1BPO A;  3Q4A B;  3UI2 A;  3HXE A;  4DI4 A;  4BET A;  2CHX A;  4L2Y A;  1DNP A;  3V30 A;  1H2U A;  4UQX A;  3UM3 A;  3TWX A;  4JHJ A;  2ILR A;  3S2A A;  4GTS A;  4C9B B;  4I6J A;  3IKO B;  1WAO 1;  3DEP A;  2KC7 A;  1MZC A;  2I1K A;  4HS2 A;  5BT1 A;  3HVE A;  1HG2 A;  3CVW A;  4DLO A;  1DC2 A;  4BX8 A;  1N9A A;  3BU8 A;  1N4S A;  4LUN U;  5CCL A;  3T9K A;  4BT8 A;  4ABN A;  2WXG A;  5EYL A;  3DSV A;  3LVQ E;  3TXN A;  2EIJ E;  3FUE A;  2X6I A;  3ML9 A;  5KJM A;  3D9N A;  3GYZ A;  4U0Z A;  5KJK A;  3FUH A;  4NRH B;  1KPS B;  3LY9 A;  4GZD A;  2I2O A;  5LFA A;  4YDE A;  3KSL A;  4LCT A;  4JEU A;  2M63 A;  3B7B A;  3RKV A;  2XCB A;  2E0I A;  4GPM A;  3AU5 A;  3FUL A;  2AXZ A;  3V2O A;  2FUL A;  1YCS B;  5HQ8 A;  1Z3X A;  3D9O A;  4AV7 A;  2ETB A;  4EQF A;  3I5P A;  1DCQ A;  3AJI A;  3APD A;  2R17 C;  4H7X A;  3C3R A;  3WXX A;  2DVW A;  1MJ0 A;  3L13 A;  2CFU A;  5ENN A;  3SHF A;  2Y69 E;  1NP7 A;  4BEP A;  4BER A;  3SI5 A;  2BKK B;  2GRO B;  1IQU A;  4GYO A;  1OCO E;  4JC8 A;  4OVV A;  2NXP A;  3PZ1 A;  4Y6W A;  3Q75 A;  3LDZ A;  3LXU X;  1KZP A;  4K5B A;  2AVP A;  4BES A;  1E8X A;  4O1O A;  4UQY A;  3RO3 A;  1DCE A;  4NAC A;  1EDU A;  2H6H A;  5CBN A;  3L82 A;  4JZY A;  4YVQ C;  5FT9 A;  5CEC B;  2R03 A;  3AG1 E;  3D9L A;  3MJW A;  3BUA A;  2KBX A;  4HOT A;  3HDX A;  5EYP F;  2IEJ A;  3MGB A;  2IOL A;  4LG6 A;  2BED A;  4UI9 K;  2NYJ A;  3WG7 E;  5FZS A;  3JUE A;  4TUM A;  4WAF A;  3QAR A;  3IEG A;  3TWS A;  4WNF A;  2XEV A;  4MLP A;  1KLX A;  4HFG A;  3TG4 A;  2WXM A;  4XEI G;  3FUM A;  4XKB A;  1SZA A;  4NUR A;  3CVP A;  3ULE G;  5JJ7 A;  2C0M A;  3RJV A;  5FZR A;  2JAB A;  4MS6 A;  3ESL A;  1TN7 A;  3EHM A;  5CRV A;  4C0M A;  2C2L A;  1HS6 A;  3AS5 A;  1V54 E;  4TRQ A;  1TR4 A;  4U04 A;  2IFU A;  2LSV A;  5AAR A;  3ASH A;  4GA1 A;  2PQN A;  1N4Q A;  3CSF A;  3KEA A;  4B94 A;  3UT7 A;  1TYQ G;  1W3B A;  3ZXP A;  3B95 A;  4I9C A;  4CCA A;  3QNK A;  1K3Z D;  2PM6 A;  2BF0 X;  4A55 A;  4I2W A;  4JPS A;  3QC1 A;  5AQA A;  3V79 K;  4XZ4 A;  4I6G A;  3UIO C;  3Q49 B;  3ESK A;  2Q7F A;  3NAW A;  2CFZ A;  2F0Y A;  1INZ A;  4YDY A;  2RFA A;  3CQG B;  1OWO A;  2ETA A;  3PZD A;  4LRZ A;  3QOU A;  1JCQ A;  2WXQ A;  3RAU A;  3CVX A;  1OT8 A;  3QWV A;  3UIP C;  3PEV B;  4A63 B;  4UI9 J;  4UWH A;  3CR3 A;  1NZN A;  5G04 C;  4LNB A;  3FEY A;  1QNF A;  3EHQ A;  4PS7 A;  2GW1 A;  3U64 A;  2J4B A;  3EHN A;  4N39 A;  2FO7 A;  3S7F A;  4EBA A;  3EUV A;  3MYV A;  1OWL A;  5AJD A;  5LP0 A;  4L9P A;  3T5V A;  4M7C A;  5T8I A;  3ZHE B;  4KYO B;  4BSZ B;  3UMV A;  1SA4 A;  1HX8 A;  3D9K A;  5LOZ A;  5FZQ A;  2IU1 A;  3KD7 A;  4NQ0 A;  2PL2 A;  1HU3 A;  4I6E A;  3SFX A;  3DBS A;  4DX1 A;  1FCH A;  1KZO A;  4UWL A;  1Y6I A;  5DIZ A;  4EEC A;  2P9S G;  3I4G A;  3MA5 A;  2WQ7 A;  3MCX A;  5KCM A;  5ENP D;  4DX2 A;  1S64 A;  2IF4 A;  4HNA D;  3DSS A;  1JWF A;  1DVP A;  4ME2 A;  2WB2 A;  3U3W A;  1E8Z A;  4GTR A;  2J07 A;  2QFC A;  3ASO E;  4CEM A;  2L0I A;  4CGW A;  4GAA A;  4HRM B;  1N52 A;  1SQM A;  1FPP A;  2I1J A;  3ENE A;  4K03 A;  4Z68 A;  4CYM D;  3FU6 A;  3MX3 A;  3QB2 A;  4ANV A;  3CIA A;  1QZ2 A;  1Z3Y A;  4P29 A;  4KBQ A;  4FA6 A;  2XGM A;  3CHO A;  1H0A A;  3SFZ A;  1YA0 A;  2A5U A;  3Q78 A;  1WDY A;  3B7T A;  3PZ3 A;  1BD8 A;  3TWT A;  5FQ4 A;  2P9N G;  3S7J A;  3ABK E;  4GTQ A;  1OCC E;  5HKP A;  2J8S D;  3KSQ A;  2GRN B;  4XI0 A;  3CHQ A;  1OWN A;  3TWQ A;  4I2Z A;  2VTB B;  3ZW3 A;  3G2T A;  4UWK A;  3FU5 A;  5JJ6 A;  4I43 A;  1P5Q A;  1TJF A;  2QYJ A;  3ZIM A;  2QZA A;  3LYA A;  1QQE A;  3PNL B;  3W9G A;  4LSZ E;  3B7R L;  5BV1 A;  3W9F A;  5AAO A;  2WXK A;  2X6J A;  1SVX A;  3CST A;  1PY1 A;  3R7Q A;  4KT6 B;  4TUU A;  3E33 A;  5E75 A;  2XS8 A;  4A1S A;  2DZO A;  3QK0 A;  5HI7 A;  1EPU A;  4B8C B;  3NF1 A;  3HXB A;  2LNI A;  2GRR B;  4A1G A;  3FTZ A;  2J08 A;  3U4T A;  3ULQ A;  4OVU A;  1IKN D;  3AS4 A;  4GTP A;  4GPK A;  4CDM A;  4G24 A;  4AVX A;  4BFR A;  4U0U A;  3ASD A;  3SQV A;  3JXJ A;  4PUC A;  4AY5 A;  5E76 A;  4N2Q A;  2LAI A;  3PRZ A;  5JHB A;  3APC A;  4K5C A;  3CGH A;  5FQ7 A;  5ANL A;  2R59 A;  2OEW A;  3EIQ C;  4F6R D;  1X81 A;  4L23 A;  4CRW A;  4RG9 A;  4HRN A;  3RRU A;  3D3M A;  3Q9U C;  1D8D A;  3ZN3 A;  5JA4 D;  4HOR A;  1N54 A;  4J6I A;  3TWW A;  3T8M A;  1JPL A;  4L2L A;  5DBK A;  2I9C A;  3CVY A;  4WWN A;  5A23 A;  2LXM A;  4BWR A;  4RSY A;  3FUF A;  3GZ1 A;  1UW4 B;  3ML8 A;  4JW1 A;  3SO8 A;  4J8E A;  2Y4U A;  3UQ3 A;  4W9R A;  4J0U A;  3AG3 E;  3ASF A;  5ENT D;  3EJN A;  3ZUV B;  2VTB A;  3Q73 A;  4LER A;  1K8K G;  2E2E A;  4UWG A;  2R2L A;  2XGS A;  4DI3 A;  3ZGQ A;  2DZN A;  5ENQ D;  4DUI A;  3RU0 A;  5BXU A;  5ENO D;  3HVE B;  3IV0 A;  4GTM A;  3KEZ A;  2LO6 A;  3ZPJ A;  2VSX E;  3CHM A;  1E96 B;  3HXF A;  2XQ0 A;  3T8K A;  4ATZ D;  1A17 A;  3FH7 A;  2H6F A;  3JXI A;  1ELK A;  4HI8 A;  3DPD A;  2X6H A;  4XKC A;  4LEU A;  4UQZ A;  4URK A;  3FTW A;  3I4R B;  1BU9 A;  2I6H A;  5EDS A;  1N4P A;  2P9P G;  3DPY A;  5EIL A;  1OY3 D;  4XE0 A;  5CER B;  2YNQ A;  2HYZ A;  3K9I A;  4DPR A;  4D10 C;  3IXE A;  2MYO A;  4Y6C A; 
#chains in the Genus database with same CATH homology
 2KZT A;  5JJT A;  4TRQ A;  4FHJ A;  3AU4 A;  3UT4 A;  4U04 A;  1NA3 A;  3P1U A;  2IFU A;  2LSV A;  4B0Z A;  3ASH A;  2CHZ A;  1TJC A;  4GA1 A;  2PQN A;  3B7U X;  4GZC A;  5AEN A;  1KT0 A;  2X3M A;  3CSF A;  2VGX A;  4BT9 A;  3LPZ A;  5G04 J;  3CLJ A;  4B94 A;  5T4Y A;  3R9A B;  2V8S E;  3UT7 A;  4I17 A;  4EZK A;  2XCC A;  3FU0 A;  2J9Q A;  1W3B A;  2KZT B;  4L1B A;  1LF8 A;  4U8H A;  1U3D A;  3P2B A;  4IYP A;  4I9C A;  5C2Y A;  4CCA A;  4AXH A;  3QNK A;  4CT0 A;  2IOS A;  2WPV A;  2XPY A;  2PM6 A;  4N5C A;  3JQ0 A;  2BF0 X;  4A55 A;  2J09 A;  4I2W A;  4JPS A;  4KMO A;  2BUG A;  3QC1 A;  3TG5 A;  4UI9 C;  3CVN A;  2JLB A;  3MZL B;  3HHM A;  4R7L A;  4XZ4 A;  4I6G A;  3OXF A;  2WXN A;  2WXF A;  1XNF A;  1HO8 A;  3QWW A;  4PS3 A;  3Q49 B;  2J49 A;  3ESK A;  2Q7F A;  3UPV A;  3CKC A;  5KJN A;  4M3O A;  3VLF A;  2CFZ A;  2C0L A;  1E7U A;  3S7D A;  1HZ4 A;  1INZ A;  4GU5 A;  3OXG A;  4GCO A;  3LEW A;  3VTX A;  3CQG B;  3ASG A;  4B8A A;  2AW6 A;  2LSU A;  5LX8 A;  3D9M A;  1MQS A;  1OWO A;  3B13 A;  4ACK A;  3VTY A;  3L6A A;  3PE4 A;  3SBS A;  2KM4 A;  5FWQ A;  2AXV A;  3PZD A;  2MRI A;  4F7A A;  4LRZ A;  1HFA A;  3FU3 A;  2OND A;  3QOU A;  1PC2 A;  3FTU A;  4I1O B;  4FJY A;  3E4B A;  3NZS A;  2HM8 A;  4CGV A;  2WXQ A;  4C0E A;  4DJA A;  3CVX A;  3QWV A;  3L54 A;  3D9P A;  2WXP A;  3ONK A;  1E7V A;  2GRM A;  3PEV B;  2IQC A;  3G2V A;  4UI9 J;  3OAW A;  3PH0 C;  4UWH A;  1MHQ A;  3CR3 A;  4F53 A;  1NZN A;  1UN8 A;  2YHE A;  3O48 A;  3FP3 A;  3QAQ A;  3L22 A;  5G04 C;  5A7D B;  5M72 A;  4Q69 A;  5G55 A;  3CK9 A;  5CMW A;  3FEY A;  5CHE E;  1QNF A;  3ZHE A;  2BTD A;  3LKU A;  1JUQ A;  3LCA A;  3OXL A;  2GW1 A;  3GZS A;  4PS7 A;  3U64 A;  3FH8 A;  4AOF A;  2J4B A;  3EHN A;  5A6C A;  3MKR A;  4N39 A;  5CCM A;  3ZFW A;  2J4D A;  2FO7 A;  5BUZ A;  3FEX A;  4KXK B;  4GYY A;  5C1D A;  3ZVV A;  2AXU A;  3QDN A;  1EF1 C;  3S7F A;  4WNG A;  4EBA A;  1B89 A;  3MYV A;  2MOW A;  1ZBP A;  2XGO A;  2PQR A;  1OWL A;  2VGX B;  5AJD A;  5LP0 A;  3T5V A;  2WXO A;  3L16 A;  4FC8 A;  3VLE A;  4U63 A;  2VSO E;  5T8I A;  3ZHE B;  1Y8M A;  4KYO B;  1IQR A;  4FUL A;  3ONL A;  4GA0 A;  4E85 A;  2WXR A;  3EDT B;  4FJZ A;  3UMV A;  4N2S A;  3TL5 A;  3FUD A;  5EKQ D;  4GA2 A;  1HX8 A;  4GML A;  4WUY A;  5G05 J;  3D9K A;  5LOZ A;  3QKY A;  1L5J A;  3MV3 B;  4IRU A;  2DCP A;  5FZQ A;  2IU1 A;  3KD7 A;  4NQ0 A;  2PL2 A;  2WXJ A;  2FI7 A;  3D9I A;  2WQH A;  4G2V A;  4JHR A;  3URZ A;  4JVS A;  5FQ8 A;  1HU3 A;  4JXT A;  2L9B A;  4I6E A;  4WWO A;  5ANR A;  4HVB A;  3DBS A;  1UJJ A;  4I1M A;  5EX0 A;  1FCH A;  2DBA A;  1E8Y A;  4WNE A;  2CHW A;  3CQC B;  1WM5 A;  2Y4T A;  3IHV A;  1Y6I A;  4UWL A;  5DIZ A;  4EEC A;  3ZYM A;  4CDR A;  3I4G A;  4EBA G;  3MA5 A;  4EZL A;  2KCK A;  2OVF A;  4EPZ A;  4V3I A;  2WQ7 A;  3VLD A;  3TJP A;  3FUI A;  3G2U A;  3MCX A;  4K0R A;  5KCM A;  3ZEF A;  4GZ5 A;  3CHP A;  5D0Q D;  3CEQ A;  4GYW A;  2MHK A;  2IF4 A;  2L6J A;  5KJL A;  4KZC A;  1ZU2 A;  4MKT A;  1ELW A;  1JWF A;  3JUI A;  1DVP A;  3FY4 A;  4ME2 A;  3SGH A;  2WB2 A;  2WXL A;  2XHE A;  4AM9 A;  3U3W A;  2X6F A;  3I3N A;  4DK5 A;  5BNW A;  1E8Z A;  2ION A;  4E6H A;  2YHC A;  2J07 A;  2QFC A;  5EX3 A;  1ELR A;  4CEM A;  1H2T C;  5D0O D;  1S0P A;  2L0I A;  2PZI A;  3S7B A;  5CMY A;  4CGW A;  3CVU A;  3L17 A;  4JA9 A;  3BG0 B;  4GAA A;  3CHR A;  4Q94 A;  4RVB A;  5AIJ A;  2WQ6 A;  4XI9 A;  1N52 A;  4BTA A;  3PDN A;  1SQM A;  2I1J A;  1XGW A;  3ENE A;  1E8W A;  1HE8 A;  3FHE A;  2HR2 A;  3FWV A;  4K03 A;  4Q96 A;  4BTB A;  1OWP A;  3FU6 A;  3MX3 A;  4F3V A;  2X38 A;  3HYM B;  2WMN A;  2AWI A;  2RG8 A;  3Q15 A;  3SBT B;  3SNX A;  3QB2 A;  4YND A;  4ANV A;  4MRU A;  3CIA A;  4L7T A;  1FVF A;  1QZ2 A;  1Z3Y A;  1BPO A;  2A4Z A;  3Q4A B;  2WMO A;  4KBQ A;  4FP7 A;  4P29 A;  4FA6 A;  4JHK A;  4ACL A;  1PAQ A;  3NQP A;  4DI4 A;  3PE3 A;  2CHX A;  4FLB A;  4L2Y A;  3TAX A;  1DNP A;  1WY6 A;  2XGM A;  3CHO A;  1H0A A;  4ILI A;  1H2U A;  2DIW A;  2KCV A;  4UQX A;  3ZXS A;  3SFZ A;  1YA0 A;  4U0S A;  2A5U A;  4DLQ A;  3MKQ B;  3B7T A;  4N3C A;  4JHJ A;  2ILR A;  3FUJ A;  2IJG X;  2YQ8 A;  4KZ0 A;  4QFV A;  5FQ4 A;  3S2A A;  2LAH A;  3S7J A;  4C9B B;  4I6J A;  3IKO B;  2OOE A;  2VYI A;  1WAO 1;  4XI0 A;  2KC7 A;  3CHQ A;  2XRZ A;  1IHG A;  4HLE A;  4JEH A;  4PDX A;  2I1K A;  4HS2 A;  4FAD A;  5BT1 A;  1OWN A;  3HVE A;  3NZU A;  1HG2 A;  3UUX A;  4I2Z A;  4APF A;  4PH4 B;  3CVV A;  2VTB B;  4N3B A;  4AP2 A;  3CVW A;  4DLO A;  2X6K A;  1X5B A;  3RIB A;  4TV3 A;  4B89 A;  3ZW3 A;  3CK8 A;  4BX8 A;  2XPZ A;  3G2T A;  4LUN U;  4UWK A;  1VDY A;  2VSN A;  3FU5 A;  4KVM A;  5CCL A;  2WVI A;  5JJ6 A;  4I43 A;  1P5Q A;  1TJF A;  3ZIM A;  4BT8 A;  4ANU A;  3LYA A;  1QQE A;  3Q47 B;  3PNL B;  3IBE A;  4ABN A;  2WXG A;  4J8S A;  3B7R L;  5BV1 A;  1E90 A;  4H7Y A;  3LVQ E;  2WXK A;  3TXN A;  2NSZ A;  2GRL A;  2X6J A;  1HG5 A;  3FUE A;  3CST A;  2X6I A;  3PS6 A;  4KVO A;  5AYW D;  1PY1 A;  3FTS A;  3KAE A;  3R7Q A;  4ANX A;  3ML9 A;  5ARF A;  5KJM A;  4KT6 B;  3RK6 A;  4TUU A;  5BPP A;  3D9N A;  2KAT A;  2XRY A;  3GYZ A;  4U0Z A;  3KS2 A;  4G26 A;  2UY1 B;  5E75 A;  3FUH A;  5J08 A;  5KJK A;  2RD0 A;  4U07 A;  4A1S A;  3QK0 A;  4NRH B;  3LY9 A;  4GZD A;  2I2O A;  4GMJ A;  5HI7 A;  3CVL A;  4GZ3 A;  3ZYK A;  2FBN A;  4WND A;  1EPU A;  5LFA A;  4GCN A;  4LCT A;  3AS8 A;  4B8C B;  4JEU A;  3ZRH A;  4AIF A;  3NF1 A;  2M63 A;  2PM7 A;  2LNI A;  1HXI A;  5T3R A;  4A1G A;  4ANW A;  3RKV A;  2XCB A;  2E0I A;  3FTZ A;  2UWJ G;  4XX5 A;  3U9W A;  2J08 A;  3AU5 A;  3FUL A;  2FF4 A;  4O6F A;  5FTP A;  3U4T A;  3ULQ A;  2V4L A;  4OVU A;  3LS8 A;  3AS4 A;  3N71 A;  3QJZ A;  2AXZ A;  4F1S A;  1FVH A;  3JCK C;  2FUL A;  4I1A A;  3TGO A;  4GPK A;  2VSY A;  1UN9 A;  5BW8 C;  4CDM A;  4G24 A;  2UY1 A;  4AVX A;  4BFR A;  3LY8 A;  4U0U A;  3ASD A;  5HQ8 A;  1Z3X A;  3D9O A;  4PUC A;  4AY5 A;  5E76 A;  4N2Q A;  2LAI A;  4AV7 A;  3PRZ A;  3GW4 A;  5JHB A;  3APC A;  3CGH A;  3JYS A;  3RRM B;  4BX9 A;  3RO2 A;  4EQF A;  5FQ7 A;  5ANL A;  1OUV A;  2R59 A;  2CG2 A;  3PUK A;  3C98 A;  3EIQ C;  3I5P A;  4BSX A;  4J8F A;  4FLH A;  5FQ6 A;  3CVQ A;  5BV0 A;  3APD A;  4J8D A;  4L23 A;  4CRW A;  3SD5 A;  2R17 C;  4RG9 A;  3UT8 A;  4FHK A;  4H7X A;  4HOQ A;  3UX4 A;  4AEZ C;  3RRU A;  3WXX A;  3CK7 A;  3PVL A;  2WXH A;  3D3M A;  3L13 A;  2CFU A;  2VQ2 A;  3ZN3 A;  5J90 A;  4IN3 B;  5ENN A;  4HOR A;  1N54 A;  4J6I A;  3SHF A;  3T8M A;  1NP7 A;  3APF A;  4BY6 A;  3SI5 A;  2R5S A;  1JPL A;  3BG1 B;  3CV0 A;  4L2L A;  1JWG A;  1IQU A;  4GYO A;  4G25 A;  5DBK A;  1EYH A;  4JC8 A;  3PEU B;  4OVV A;  5FJY A;  2I9C A;  2NXP A;  4ILG A;  2WXI A;  3CVY A;  4Y6W A;  4WWN A;  4CT4 A;  5A23 A;  3LDZ A;  3LXU X;  3T5X A;  3MKQ A;  4RSY A;  2V5F A;  3FTV A;  3FUF A;  4BWR A;  3GZ1 A;  1UW4 B;  3ML8 A;  4JW1 A;  3SZ7 A;  2AVP A;  4HXI A;  1E8X A;  4EZJ A;  4J8E A;  2Y4U A;  3UQ3 A;  4APO A;  3SF4 A;  4UQY A;  4W9R A;  4RG6 A;  2V0P A;  4J0U A;  3RO3 A;  3LVR E;  3ASF A;  2QY7 A;  3BEE A;  3PNT B;  2ZU6 B;  4NAC A;  3L08 A;  3G2W A;  1H6K A;  3EJN A;  1HF8 A;  3FFL A;  3OTN A;  3MEK A;  1EDU A;  3GZ2 A;  3JQ1 A;  3FUN A;  4XIF A;  2VTB A;  2OV8 A;  4LER A;  3FUK A;  2L0T B;  2E2E A;  4JZY A;  4UWG A;  4YVQ C;  4OYS A;  2EQX A;  3FTX A;  3LY7 A;  5FT9 A;  2XGS A;  4WWP A;  3FH5 A;  4DI3 A;  3ZGQ A;  2FEZ A;  4JA7 A;  3RU0 A;  3ZYQ A;  4CDN A;  1NA0 A;  3B7S A;  3D9L A;  3HVE B;  3MJW A;  2JEK A;  4I9E A;  3IV0 A;  1OWM A;  5G05 C;  4AJW A;  4A3V A;  4HOT A;  2KCL A;  2P58 C;  4ATG A;  5LCW C;  2CG3 A;  3HDX A;  3MGB A;  3KEZ A;  4G1T A;  4PS8 A;  2YIN A;  1UJK A;  2IOL A;  2OVB A;  5JHA A;  4HOS A;  2LO6 A;  5LCW J;  1UG3 A;  4UI9 K;  4GZ6 A;  1U3C A;  3ZPJ A;  5FZS A;  5G2N A;  3IHY A;  2VSX E;  1KT1 A;  3QAR A;  4G11 A;  3FTY A;  3IEG A;  4JL0 A;  2XPI A;  4WAF A;  4WNF A;  3CHS A;  3CHM A;  2XEV A;  1E96 B;  4ILH B;  2XQ0 A;  3D9J A;  1H19 A;  4MLP A;  1KLX A;  3ZYL A;  1A17 A;  3EIJ A;  4G23 A;  4UWF A;  4IUL A;  3FH7 A;  4A3T A;  1Z6T A;  3U66 A;  1SZ9 A;  1ELK A;  1GW6 A;  1IYG A;  3CKB A;  3DPD A;  4HFG A;  3TG4 A;  3O4Z A;  2X6H A;  2WXM A;  4XKC A;  3PRE A;  3FUM A;  4XKB A;  5AJL A;  1SZA A;  4LEU A;  4UQZ A;  2VJ8 A;  4NUR A;  2VGY A;  2Y3A A;  2HO1 A;  3LJ3 A;  3FTW A;  3I4R B;  4URK A;  1TEZ A;  1H2V C;  2I6H A;  2GGF A;  4HOU A;  3CVP A;  5EDS A;  5JJ7 A;  2C0M A;  4N3A A;  4YVO A;  4AY6 A;  3QWP A;  3RJV A;  3HIZ A;  4XE0 A;  2WM9 A;  5FZR A;  2YNQ A;  5ARG A;  4MS6 A;  2HYZ A;  3ESL A;  3MV2 B;  3EHM A;  3R7R A;  3K9I A;  1HH8 A;  3FDH A;  2NC9 A;  3Q5M A;  3TXM A;  4C0M A;  4D10 C;  4DPR A;  4FU3 A;  2C2L A;  4Y6C A;  3G2S A;  3RRN B;  4GB9 A;  1HS6 A;  3AS5 A;  3PUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...