2NSZA

1.15 angstrom crystal structure of the ma3 domain of pdcd4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death protein 4
publication title Structural basis for inhibition of translation by the tumor suppressor Pdcd4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antitumor protein
total genus 54
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nszA00
1PAQA 3FEXA 2VSXE 4CRWA 4JHKA 4IULA 2IU1A 3FEYA 2I2OA 4CT4A 1H2TC 2ZU6B 2HM8A 4B8AA 2VSOE 1UG3A 2GGFA 1H2VC 3L6AA 4GMJA 4LUNU 4C9BB 2KZTB 3D3MA 1UW4B 2IOSA 1N52A 2IONA 2KZTA 4B8CB 1N54A 4GMLA 4JHJA 2IOLA 1H6KA 4CEMA 5ANRA 3EIJA 1H2UA 3JUIA 2FULA 3EIQC 3RK6A 4B89A 2RG8A 2NSZA 1HU3A
chains in the Genus database with same CATH superfamily
4RG9A 2ONDA 4C48B 4Y6CA 4HBDA 2FO1E 3KSLA 2BF0X 1EF1C 4JVSA 4WUYA 2I9CA 1H0AA 1TNUA 2FF4A 3OAWA 4UQXA 3LDZA 5CRVA 5BPPA 2L9BA 2LXMA 3ZU7B 1HF8A 4HQDA 3MCXA 4LNUD 2X6KA 4HORA 3QWWA 3DSTA 3BEEA 4IRUA 4BESA 3IHYA 4GTQA 4GA1A 3EIQC 2M63A 3UQ3A 1FCHA 4OAVB 4YVOA 4EBAG 4O1OA 4EZKA 2HYZA 3FTVA 4OYSA 2J8SD 4Y6WA 2NC9A 2VYIA 4GYWA 5G04C 4GZ5A 4Q96A 4J8FA 3EJNA 4DRXE 4I9CA 4QFVA 1ZU2A 4PDXA 2C2LA 4AV7A 4EZLA 4AY5A 1FT2A 2OVFA 2GRRB 4EPZA 3L16A 1HZ4A 3E32A 5ENTD 3CV0A 4TRQA 4O1PA 4RVBA 3TXMA 4HS2A 1GW6A 2J4DA 4F7AA 3UT7A 1TNYA 3LXUX 4JZYA 5BW8C 2J08A 3EU5A 3UXGA 4GCOA 3QNKA 5FZSA 3G2WA 2YHEA 2GRMA 4NACA 3VLEA 2IO3C 2OV8A 3WXXA 2JLBA 3GZ1A 2R17C 3NBNB 1OCOE 4A1GA 3B7BA 3RAUA 3CVUA 4Q94A 3NZSA 3PEVB 4N2QA 4YNDA 2Y0BG 4DX2A 3HHMA 1G3NB 2IONA 3ULEG 5EDSA 3ASOE 3PUKA 3NOCD 4RSYA 5ANRA 4XE0A 4JPSA 1BI8B 4APFA 4JHKA 4UWKA 1TNZA 4U8HA 5DIZA 4AJWA 4ANUA 3OXLA 4U0SA 2Y3AA 3ULQA 3ZNGA 2L6JA 4G2VA 4HRMB 2FO7A 3LPZA 2Y69E 3SD5A 2OEWA 1E8ZA 3TGOA 2PQRA 3D9MA 1BLXB 3B95A 2XS1A 3UT8A 2AJAA 5T3RA 4A3VA 1P5QA 4AXHA 3CQGB 1UN9A 1X5BA 1EDUA 2IU1A 2V5FA 1JCSA 1LTXA 1JPLA 4Q69A 4GA0A 3GW4A 3FUKA 3CHSA 3G2VA 4OVVA 2WXHA 3IBEA 2VSNA 3CK9A 2PM6A 3ZFWA 1Z5SC 2DYRE 1LD7A 3ESKA 2PL2A 1HH8A 3PEUB 3UUXA 4CT4A 1UG3A 1TR4A 4CGVA 4DLOA 3DXKG 3ONLA 4GTPA 4U04A 2PM7A 3CLJA 2XPYA 5CMYA 3Q47B 4TUMA 4I17A 2DVWA 1YCSB 4FLHA 4HRNA 3CHRA 4J0UA 5FQ7A 3MKRA 2KXPC 1QNFA 1KLXA 3I5PA 2J07A 2A5EA 4XI9A 1RW2A 3PH0C 4LNBA 3AS5A 4C0EA 3SBTB 1BPOA 2QZAA 1JWGA 3MKQA 1U2VG 2H6HA 4MLPA 3EHRA 4N5QA 2YNQA 2XCCA 3B7RL 3FULA 2P9NG 4JC8A 5JHBA 4CDNA 5KNHD 4HNAD 2WXMA 2BKKB 4EBAA 2GRPB 4F1PA 3D9IA 3MGBA 1WY6A 2DIWA 2BTDA 2WQ6A 2OVBA 4GYOA 4J6IA 4FJZA 1E8XA 5HKPA 2QYJA 2QFCA 4DX7D 1AWCB 3DSWA 1ELWA 3L9TA 3SFYA 2I2OA 2AXVA 2F0YA 2J09A 3RKVA 1XGWA 3ZN3A 3GZ2A 4AM9A 2ETAA 2NXPA 3D3MA 1W3BA 2IY0C 4KVMA 2CHZA 4YDOA 3C3OA 3CSTA 3FU6A 3P1UA 1BD8A 2XEHA 2RFMA 2X6IA 3E33A 4XI0A 5D0OD 3JQ1A 3TL5A 2E0IA 3S7JA 3D9OA 4CGWA 1SVXA 1H2VC 5AJDA 1E7VA 3ASNE 3LEWA 4N39A 3FHEA 3IEGA 1ZB1A 3RRUA 2KBXA 1WDYA 1DCQA 2XHEA 2RFAA 2EQXA 2EINE 3QARA 2LSVA 1NP7A 5CEAA 3QKYA 3IHVA 2ZIRA 5AIJA 2WMOA 2Y1LE 1N4PA 1N4RA 5CRUA 5EYLA 4URKA 1INZA 2WXPA 3ASFA 2RD0A 2R03A 4PUCA 3QDNA 2X6JA 4PS7A 4FU3A 4BFRA 2XZTG 3ASHA 2P9SG 2L0TB 4F3VA 2HE0A 1YA0A 3CHPA 4GTRA 4HB5A 3L82A 3NOGD 4NRHB 4MRUA 3V79K 5FZQA 5KBAA 1PAQA 1WAO1 1E96B 4LG6A 2P9KG 4I43A 3Q78A 3MEKA 2AW6A 2FI7A 4EQFA 4HI8A 3FTSA 4BWRA 4KXKB 3TG4A 4DX1A 3V2OA 5FZRA 2H6GA 3C5RA 1LD8A 1S64A 3LCAA 4ACKA 3ABME 4HOTA 3NAWA 4LUNU 4KZ0A 3DSXA 4LEUA 4WWNA 2MHKA 1EPUA 5AQ9A 3B7TA 1H2UA 4ACLA 1V55E 3G2TA 3LY8A 4CZ2D 4ABNA 1NZNA 3TWTA 4OVUA 3ASGA 3LKUA 1PC2A 2P9IG 3V31A 2F8XK 3TWQA 3G2UA 4U07A 1E90A 4WWPA 1FPPA 3FWVA 4GZDA 1MJ0A 5LOZA 2XGOA 4BX9A 1N0RA 2WVIA 3TAXA 3LYAA 3VTXA 2AXUA 3UIOC 1N94A 4UWFA 3LVRE 2C0LA 4GTTA 5HQ8A 3CR3A 3HXEA 2WXQA 5CECB 3T5XA 4E85A 1H19A 3C3QA 2Y4TA 4Z68A 4TXQA 1JUQA 5FQ6A 1TN6A 3G2SA 1Q2ZA 1TJCA 1MX4A 2QYUA 3UM0A 1L5JA 5A7DB 1N95A 3APDA 4G26A 1TJFA 3UKRG 3PS6A 4LNGA 3T8KA 3SHFA 3ASDA 5IY5E 3RIBA 4WNDA 5LCWJ 2XQ0A 4EZJA 4FP7A 5JMND 1UJKA 3QOUA 5KJMA 3DEOA 4WAFA 1DNPA 4K5BA 4CEMA 3JXJA 2MOWA 4BERA 4U63A 3QWVA 3FU3A 1DC2A 5CBNA 2IJGX 4UQZA 2YQ8A 2ZISA 1V54E 5CCMA 2CG2A 3PVLA 4PS3A 2CHWA 3HVEA 1IQUA 3NB2A 5JJ6A 4JHJA 1KT0A 3AJIA 3EIJA 4HOQA 2LUHA 1WG0A 3DEPA 1ZBPA 2LXLA 2XEVA 4DUIA 5ENOD 2OEVA 2GRLA 3BU8A 4BT9A 3DBSA 4BSZB 3U4TA 4AEZC 3VTYA 3URZA 3LVQE 4F6RD 3BG1B 2CG3A 1MZCA 3HYMB 3PRZA 3PZ1A 1MHQA 4JD2G 5FJYA 3CHOA 4BETA 4MBGA 3D9NA 4DI4A 1D8DA 3J5QB 5EKQD 3LY9A 3NZUA 4ZHBA 2KM4A 4I2ZA 1TN7A 4YDEA 2EIJE 4U96D 3MKQB 4ZFHA 3MJWA 3FUMA 3ZYLA 3DXMG 1H6KA 3FTUA 2FULA 5J08A 3S2AA 4CDRA 3Q7AA 1OXJA 1O1TA 3ABLE 3KEZA 3UINC 3PDNA 2JABA 1QYMA 4K03A 2WXNA 2PNNA 4D10C 3E34A 5E76A 2V5QC 1FVHA 2DZNA 3KS2A 2DCPA 4B0ZA 5AQAA 2KCKA 4M7CA 2XRZA 4JB8P 2WM9A 4LSZE 4APOA 4GMJA 3Q4AB 3JYSA 2BUGA 3S7FA 4U0ZA 3RRMB 4XIFA 1SA5A 2WMNA 4PH4B 4BSXA 5JHAA 4WNFA 4I1MA 3I3NA 1U3DA 4GTSA 4GPKA 4GZ3A 2ZXWE 2GRNB 4ILGA 2X6FA 3SFZA 1N52A 3EUVA 5B3SE 4LERA 3QB2A 3I4RB 1N4SA 4UWHA 2AXZA 3TXNA 2IOLA 1UN8A 4XKBA 2VGXA 3R7RA 1NL4A 2V4LA 2FEZA 1OWPA 2XENA 1ELRA 4X8QA 3ZXSA 4FA6A 4GZCA 3NQPA 2XRYA 3RO2A 5KCMA 5KNGA 3V2XA 2P9UG 3Q79A 1VDYA 3SGHA 2R05A 4A3TA 3O4ZA 5CMWA 2HO1A 4ANXA 3APCA 4J8YA 3JUEA 3P2BA 3RSEG 1O1RA 3CK8A 2EIKE 3SZ7A 2P58C 3QAQA 4G23A 4EECA 2H6FA 4I1OB 3APFA 2ETBA 2KATA 5BUZA 2V4HC 2H6IA 1D8EA 5FIOA 2L0IA 1H2TC 3D9JA 3IV0A 5ENNA 3EHMA 4GU5A 1E7UA 1HS6A 2VGYA 2IFUA 1JCQA 3S7BA 3C72A 1JCRA 4JW1A 1IHBA 4NIKA 5ENPD 3FUEA 4GMRA 1OCRE 3UM3A 2IF4A 4ATGA 4BTAA 3CEQA 4GA2A 4WWOA 1E8WA 3SFXA 4I9EA 4BY6A 2GGFA 1FVFA 1UW4B 5BXUA 4HXIA 3JCKC 2R5SA 1SA4A 3UI2A 3K9IA 5D2MC 2EILE 2J4BA 2WXFA 3UPVA 4GCNA 2XGMA 2VJ8A 3E37A 3FP3A 3R9MA 3RU0A 4R7LA 3J5PA 2DBAA 3FH5A 3MYVA 2LO6A 1MX6A 2HM8A 3T8MA 4K5CA 4A63B 5J90A 3FH8A 4XEIG 3SNXA 4I6GA 1IHGA 4QQIA 3T9KA 4FULA 3CSFA 2P9LG 3ML9A 3PNLB 5D66A 3AG1E 3L08A 3TWUA 4N3BA 4IYPA 4CRWA 1E8YA 3UIPC 1UJJA 5EIDA 3LJNA 4HRLA 3UM2A 3VLDA 2XZDG 3FUHA 5FWQA 3CVNA 1QQEA 3ZKJA 2GROB 2XPZA 5T4YA 3RK6A 2LNIA 1YYHA 3IXEA 1OCCE 3RRNB 3AS4A 3ZYQA 5EN5D 5KJNA 2ZGDA 4XKCA 4WNEA 3ZIMA 4L7TA 3Q9NC 4O60A 1N11A 3W9GA 2WXOA 4U0UA 1A5EA 1K8KG 1SQMA 5LP0A 5KJKA 3B7SA 3D9PA 1NFIE 4V3IA 1S63A 3TWSA 2L6BA 4MS6A 5FQ8A 5EILA 3HVEB 3DSUA 3UM1A 5ITZF 5HS0A 2OOEA 1ELKA 4LRZA 3FUFA 5LCWC 1RZ4A 5G2NA 2QY7A 4B93B 3Q75A 3KSQA 3EU9A 4F1SA 4KYOB 5EIBE 3OTNA 3VLFA 4BEPA 4M3OA 3ZGQA 3FDHA 5AQ7A 3AS8A 4L2YA 3L54A 4N3CA 2BEDA 1IXVA 2WB2A 2IEJA 3FU5A 1SZ9A 1KZPA 4N5CA 3UTMA 3U9WA 2CHXA 3TWXA 3BG0B 3TG5A 1TNOA 3FY4A 4NURA 5B1AE 2UY1A 1OT8A 4CYMD 3HXBA 5EX3A 4AOFA 3TWWA 1X81A 5CBOA 5EX0A 3ZUVB 2VTBA 3FTXA 2I1KA 5JJ7A 1QZ2A 1XNFA 2HR2A 1N4QA 2B0OE 1Z6TA 4LCTA 2KZTA 4EHMA 3V30A 3ESLA 4KT6B 5C1DA 4MKTA 3DPDA 3PZ2A 4UWLA 3RO3A 2VSXE 3L13A 3FTYA 4AVXA 3CKBA 4I1AA 3BQOA 3UT4A 5DBKA 2ETCA 3PNTB 5H7PA 4KBQA 2LSUA 1D9SA 5ARFA 1EYHA 2LAHA 5BXOA 4U8YD 4AIFA 5CEDB 2P2CP 2IOSA 3Q73A 3PREA 3TWRA 3Q5MA 3ENEA 4JXTA 4YDWA 2LAIA 3UKUG 3O48A 2C0MA 1OY3D 2X6HA 4P29A 3ZYMA 1KT1A 2A4ZA 4UQYA 2QC9A 4ILIA 3DSSA 4B8AA 3E30A 4KVOA 4GPMA 1K1BA 1NA0A 2ILRA 3PZ4A 3QC1A 4HOUA 3PZ3A 4U8VD 3DPYA 3CVXA 2CFUA 2VGXB 5KWDA 3F6QA 4U95D 2JEKA 2F37A 1NA3A 1OUVA 4GYYA 4L1BA 3AG4E 3AG2E 3CVLA 2WPVA 4HI9A 5G05J 3L6AA 3ULYA 1IKND 2DYSE 4JL0A 4I2WA 4AY6A 3DWLG 1S0PA 3PZDA 4HFGA 4ANWA 1N9AA 4YDYA 3FFLA 4J7WA 5ENRD 5G55A 3JXIA 3MZLB 2NYJA 1MX2A 3FEYA 3GYZA 4U7EB 1K1AA 3U64A 1FT1A 3ONKA 5CCLA 3QK0A 4UWGA 5E75A 3PUJA 3ZPJA 4KZCA 3ZHEA 2NSZA 3KEAA 2PQNA 4YVQC 4ATZD 1OWNA 2J49A 2V8SE 3U66A 1KPSB 3FUNA 2BKGA 4KMOA 1YMPA 4UI9J 1DVPA 3DSVA 3MA5A 4XZ4A 1O5MA 4L2LA 4FLBA 4ANVA 3FUJA 4BTBA 5AJLA 2XGSA 3TJPA 3OXGA 3Q49B 3EDTB 3WG7E 2KCVA 3HRAA 3CVPA 2VSYA 3X2QE 4C9BB 4DX6D 5AQBA 4HVBA 3QJZA 2R59A 3ABKE 2WXKA 3EHQA 5AAOA 5ENSD 2V0PA 1Z3XA 2WXIA 4CDMA 4XX5A 1TN8A 2DWZA 1Y8MA 4F53A 3LS8A 4IULA 4NQ0A 3N71A 5KJLA 3ZEFA 3CVYA 2J9QA 4J8EA 5T8IA 4C0MA 3FH7A 2WQHA 3HDXA 5G04J 4G8KA 1JWFA 4TXPA 3ISMC 3Q9UC 1HFAA 3MV3B 5FT9A 5M72A 4JEUA 4A55A 4RLYA 3ML8A 1HE8A 4L23A 2GRQB 1QBQA 2DZOA 3UX4A 1N0QA 3E4BA 5D0QD 5FINA 1MYOA 4JA9A 2P9PG 2A5UA 5ANLA 3CIAA 3FUDA 1TNBA 2XS8A 5BV0A 3DRAA 3U3WA 3OXFA 4I6EA 4WNGA 3ZW3A 1SZAA 4TV3A 3JQ0A 2R02A 3CGHA 3CKCA 2IO2C 3FU0A 4N2SA 1H6OA 5A23A 5AENA 1HG5A 2WXRA 2WQ7A 3EHNA 2VGEA 3KD7A 3C98A 4ME2A 2YINA 5ARGA 2XCBA 4G24A 4GAAA 4CCAA 4DI3A 1OWMA 4OAUC 3D9KA 2RG8A 2KCLA 3HXFA 5FTPA 3IKOB 5HRYA 3ZXPA 2OCCE 3SO8A 4GMLA 3C3RA 3D9LA 1HO8A 4W9RA 2MYOA 2WXJA 5BV1A 5AN8A 3MX3A 3CVVA 3B7UX 3FUIA 2AWIA 1OWOA 1LF8A 3L22A 1IYGA 4HLLA 1SW6A 3PE4A 5AARA 4G11A 2R2LA 4UI9K 2XEEA 3NF1A 4DX5D 2E2EA 3ZYKA 5AYWD 2WXGA 3CK7A 4N3AA 3LY7A 1AP7A 4GTVA 1UOHA 3SI5A 3SF4A 3AAAC 3R9AB 4FHJA 2UY1B 4GB9A 1B89A 1BU9A 4E6HA 4DLQA 2VTBB 1IQRA 2YHCA 2Y4UA 2X3MA 4HOSA 3AU4A 4G25A 4FJYA 1A17A 4JEHA 3ZRHA 4HLEA 2KZTB 4J8DA 3FTZA 5BT1A 2IQCA 3QWPA 4UUCA 1OWLA 4JHRA 4DK5A 1HXIA 2AVPA 4JA7A 4AP2A 2VSOE 1TEZA 1MQSA 1PY1A 4H7YA 1K3ZD 1DCEA 3AU5A 5JJTA 1WM5A 5CHEE 2Q7FA 1HU3A 4TUUA 3Q15A 3CHQA 1HG2A 2B6CA 3CQCB 3D9HA 5HI7A 2ZU6B 1U3CA 4A1SA 2GW1A 4G8LA 4FADA 5A6CA 3MV2B 1H6PA 4RQIA 3B13A 3SY2A 2ZGGA 2UWJG 3W9FA 3FEXA 4G1TA 3SBSA 3HXCA 3LJ3A 4L9PA 1N54A 4CT0A 2XPIA 4TXRA 2MRIA 3JUIA 2RKKA 3R7QA 4RG6A 1Z3YA 5B1BE 3AG3E 3TWVA 2I6HA 4J8SA 3CVWA 1S70B 1TYQG 4K0RA 3L17A 3UMVA 3KAEA 5LFAA 2F8YA 2VQ2A 1BI7B 4DPRA 4BT8A 1KZOA 4B89A 4GTOA 4ILHB 4BX8A 3S7DA 4K5AB 2CFZA 4FHKA 5FQ4A 1O1SA 2I1JA 5LX8A 3ZHEB 3BUAA 5G05C 3HG0D 3Q7FA 2FBNA 3CHMA 5CERB 4B94A 2X38A 4I6JA 1NI1A 4B8CB 3HXDA 3RJVA 1OCZE 3T5VA 5JA4D 2PZIA 2WXLA 2EIME 2KC7A 4DJAA 3FTWA 3PE3A 4FC8A 4H7XA 1HX8A 3SQVA 5C2YA 3I4GA 3GZSA 5ENQD 5EYPF 3ZVVA 4PS8A 5BNWA 4GTMA 4O6FA 3CVQA 4IN3B 3HIZA 4GZ6A 4UI9C 1Y6IA
chains in the Genus database with same CATH topology
2KATA 4RG9A 5BUZA 2ONDA 2XGSA 3QDNA 3TJPA 3OXGA 3Q49B 4Y6CA 3EDTB 2L0IA 2KCVA 2X6JA 1H2TC 4PS7A 3CVPA 4FU3A 3D9JA 2BF0X 3IV0A 1EF1C 2VSYA 3EHMA 5ENNA 4BFRA 4JVSA 4C9BB 3ASHA 4WUYA 2I9CA 2L0TB 4F3VA 1H0AA 4GU5A 1YA0A 4HVBA 3CHPA 1E7UA 2FF4A 3QJZA 2R59A 2WXKA 3OAWA 4UQXA 1HS6A 3LDZA 4NRHB 4MRUA 5BPPA 2VGYA 2L9BA 5FZQA 2V0PA 2IFUA 1Z3XA 1HF8A 2WXIA 4CDMA 4XX5A 1PAQA 3S7BA 3MCXA 1WAO1 1E96B 1Y8MA 2X6KA 4F53A 3LS8A 4IULA 4HORA 3QWWA 4I43A 3BEEA 4JW1A 3MEKA 4NQ0A 2AW6A 4IRUA 2FI7A 3N71A 5KJLA 3ZEFA 3CVYA 2J9QA 3FUEA 4J8EA 5T8IA 3IHYA 4C0MA 4EQFA 2IF4A 3FTSA 4BWRA 4KXKB 3TG4A 3FH7A 4GA1A 4ATGA 5FZRA 3EIQC 2WQHA 2M63A 3UQ3A 3CEQA 1FCHA 3HDXA 4BTAA 4YVOA 4GA2A 5G04J 4EBAG 1JWFA 4EZKA 4WWOA 2HYZA 1E8WA 3LCAA 1HFAA 3FTVA 4I9EA 4OYSA 3MV3B 5FT9A 4BY6A 4Y6WA 5M72A 4ACKA 4JEUA 4A55A 2NC9A 2GGFA 3ML8A 4HOTA 1HE8A 4LUNU 2VYIA 1FVFA 4GYWA 4KZ0A 4L23A 4LEUA 1UW4B 5G04C 4WWNA 4GZ5A 4HXIA 3JCKC 4Q96A 2R5SA 2MHKA 1EPUA 3UX4A 4J8FA 3B7TA 5D0QD 3E4BA 3K9IA 1H2UA 4JA9A 4ACLA 3EJNA 2J4BA 2WXFA 3G2TA 4I9CA 3UPVA 4GCNA 2XGMA 3LY8A 2VJ8A 4QFVA 1ZU2A 4PDXA 4ABNA 3FP3A 1NZNA 2A5UA 2C2LA 4OVUA 3RU0A 3ASGA 4AV7A 3LKUA 4EZLA 4R7LA 1PC2A 2DBAA 3FH5A 3MYVA 5ANLA 4AY5A 2OVFA 2LO6A 3CIAA 4EPZA 2HM8A 3FUDA 3G2UA 5BV0A 3T8MA 4U07A 1E90A 4WWPA 5J90A 3FH8A 3FWVA 3L16A 3SNXA 4GZDA 3U3WA 3OXFA 4I6EA 4I6GA 4WNGA 1IHGA 3ZW3A 1HZ4A 1SZAA 4FULA 4TV3A 3JQ0A 5LOZA 3CSFA 3ML9A 3PNLB 3CV0A 3CGHA 4TRQA 4RVBA 2XGOA 3CKCA 3TXMA 3FU0A 4N2SA 4HS2A 1GW6A 3L08A 2J4DA 4BX9A 4F7AA 3UT7A 2WVIA 3TAXA 5A23A 4N3BA 5AENA 4IYPA 4CRWA 1HG5A 3LYAA 1E8YA 3LXUX 4JZYA 2WXRA 1UJJA 3VTXA 5BW8C 2WQ7A 3EHNA 2J08A 2AXUA 3KD7A 3C98A 4ME2A 3VLDA 4GCOA 3QNKA 3FUHA 4UWFA 3LVRE 2C0LA 2YINA 5ARGA 5FZSA 5FWQA 3CVNA 5HQ8A 2XCBA 3G2WA 4G24A 1QQEA 2YHEA 2GRMA 3CR3A 4NACA 4GAAA 3VLEA 4CCAA 2WXQA 2OV8A 3WXXA 2XPZA 4DI3A 1OWMA 2JLBA 3GZ1A 3D9KA 2R17C 2LNIA 5T4YA 2RG8A 3RK6A 3T5XA 4E85A 1H19A 2KCLA 3RRNB 3AS4A 4A1GA 2Y4TA 3CVUA 4Q94A 3NZSA 5AJLA 5FTPA 1JUQA 3IKOB 3PEVB 3ZYQA 4N2QA 4YNDA 5FQ6A 5KJNA 3HHMA 2IONA 4XKCA 4WNEA 4GMLA 3ZIMA 4L7TA 5EDSA 3G2SA 3PUKA 3D9LA 4RSYA 1TJCA 5ANRA 1HO8A 2WXOA 4U0UA 4XE0A 4W9RA 1L5JA 5A7DB 4JPSA 1SQMA 5LP0A 2WXJA 3APDA 5KJKA 3B7SA 5BV1A 4G26A 3D9PA 1TJFA 3MX3A 3PS6A 3CVVA 3B7UX 4APFA 4V3IA 3SHFA 4JHKA 3FUIA 2AWIA 1OWOA 4UWKA 3ASDA 3RIBA 4MS6A 1LF8A 4U8HA 4WNDA 5DIZA 3L22A 5FQ8A 5LCWJ 2XQ0A 4EZJA 3HVEB 4FP7A 4PUCA 4AJWA 1IYGA 1UJKA 3QOUA 5KJMA 3PE4A 4G11A 4ANUA 3OXLA 4U0SA 2Y3AA 3ULQA 4WAFA 2OOEA 1DNPA 4UI9K 4CEMA 3NF1A 2E2EA 2L6JA 2MOWA 4G2VA 3ZYKA 5AYWD 4U63A 1ELKA 3QWVA 4LRZA 2WXGA 3FUFA 5LCWC 3FU3A 2FO7A 3LPZA 5G2NA 2QY7A 3CK7A 4N3AA 2IJGX 3SD5A 4UQZA 3LY7A 2YQ8A 1E8ZA 3TGOA 4F1SA 4KYOB 2PQRA 3OTNA 5CCMA 3SI5A 2CG2A 3VLFA 3PVLA 4M3OA 3R9AB 3SF4A 4PS3A 4FHJA 2UY1B 2CHWA 3D9MA 3HVEA 3FDHA 4GB9A 1IQUA 3ZGQA 1B89A 5JJ6A 3AS8A 4JHJA 1KT0A 4L2YA 3UT8A 3L54A 3EIJA 4N3CA 4HOQA 4E6HA 4DLQA 2VTBB 5T3RA 1IQRA 2WB2A 4A3VA 1P5QA 4AXHA 3CQGB 1ZBPA 2XEVA 2YHCA 1UN9A 1X5BA 1SZ9A 3FU5A 1EDUA 2Y4UA 2X3MA 2IU1A 4HOSA 3AU4A 2V5FA 4G25A 4FJYA 1A17A 4JEHA 3ZRHA 4N5CA 3U9WA 2CHXA 2GRLA 3BG0B 3TG5A 4HLEA 2KZTB 1JPLA 3FY4A 4J8DA 3FTZA 4BT9A 3DBSA 4NURA 4Q69A 5BT1A 4GA0A 2UY1A 3GW4A 3U4TA 4AEZC 3FUKA 3CHSA 3G2VA 4OVVA 5EX3A 3VTYA 4AOFA 2WXHA 3URZA 2IQCA 3IBEA 2VSNA 3CK9A 3QWPA 2PM6A 3LVQE 3ZFWA 1OWLA 3BG1B 5EX0A 2VTBA 2CG3A 4JHRA 3ESKA 2PL2A 3HYMB 3FTXA 2I1KA 4DK5A 3PRZA 1HXIA 1HH8A 5JJ7A 3PEUB 1QZ2A 1XNFA 2AVPA 2HR2A 4JA7A 4AP2A 3UUXA 1MHQA 4CT4A 2VSOE 5FJYA 1UG3A 1TEZA 1MQSA 3CHOA 1PY1A 1Z6TA 4CGVA 4LCTA 4H7YA 4DLOA 2KZTA 3ONLA 3D9NA 3ESLA 4U04A 4DI4A 2PM7A 3CLJA 3AU5A 4KT6B 5EKQD 5C1DA 2XPYA 5JJTA 1WM5A 3LY9A 4MKTA 5CMYA 3DPDA 3NZUA 3Q47B 5CHEE 2Q7FA 1HU3A 4I17A 4TUUA 2KM4A 4I2ZA 4FLHA 3Q15A 4UWLA 3CHQA 3RO3A 2VSXE 1HG2A 3CHRA 3CQCB 3L13A 3FTYA 4J0UA 5FQ7A 3MKQB 5HI7A 4AVXA 3MKRA 2ZU6B 1U3CA 3CKBA 4I1AA 4A1SA 2GW1A 1QNFA 3MJWA 3UT4A 5DBKA 4FADA 5A6CA 3PNTB 3MV2B 3FUMA 3ZYLA 1H6KA 3B13A 4KBQA 3FTUA 1KLXA 3I5PA 2FULA 2LSUA 5J08A 2J07A 3S2AA 4XI9A 3PH0C 4CDRA 5ARFA 1EYHA 2UWJG 3AS5A 2LAHA 3FEXA 4C0EA 4G1TA 3SBTB 1BPOA 4AIFA 3KEZA 3SBSA 3PDNA 3LJ3A 1JWGA 3MKQA 4K03A 2WXNA 4D10C 2IOSA 4MLPA 3PREA 5E76A 1N54A 2YNQA 4CT0A 2XCCA 2XPIA 3Q5MA 2MRIA 3ENEA 1FVHA 3B7RL 3JUIA 3R7QA 4JXTA 3FULA 2LAIA 4RG6A 1Z3YA 3KS2A 2DCPA 4JC8A 3O48A 5JHBA 2C0MA 4B0ZA 4CDNA 2KCKA 2X6HA 2I6HA 4J8SA 3CVWA 2XRZA 4P29A 3ZYMA 1KT1A 4K0RA 2A4ZA 2WXMA 4UQYA 4ILIA 3L17A 4EBAA 3UMVA 4B8AA 2WM9A 3KAEA 4APOA 4GMJA 4KVOA 3Q4AB 5LFAA 3JYSA 2BUGA 3D9IA 3MGBA 3S7FA 1NA0A 1WY6A 2ILRA 2DIWA 2BTDA 2VQ2A 4U0ZA 3RRMB 2WQ6A 3QC1A 4DPRA 2OVBA 4GYOA 4HOUA 4J6IA 4FJZA 4XIFA 1E8XA 4BT8A 3CVXA 2CFUA 2VGXB 2WMNA 4PH4B 4BSXA 2QFCA 4B89A 2JEKA 5JHAA 1NA3A 4WNFA 1OUVA 4I1MA 4ILHB 4BX8A 4GYYA 4L1BA 3I3NA 1U3DA 3S7DA 1ELWA 4GPKA 2I2OA 4GZ3A 2AXVA 3CVLA 2J09A 3RKVA 2WPVA 1XGWA 3ZN3A 3GZ2A 2CFZA 4AM9A 5G05J 3L6AA 2NXPA 4FHKA 4ILGA 2X6FA 3D3MA 3SFZA 1N52A 1W3BA 4LERA 3QB2A 3I4RB 4KVMA 2CHZA 4UWHA 3CSTA 2AXZA 4JL0A 3TXNA 2IOLA 3FU6A 3P1UA 2I1JA 4I2WA 5FQ4A 1S0PA 4AY6A 1UN8A 3PZDA 2X6IA 4XKBA 4HFGA 3ZHEB 4ANWA 5LX8A 3FFLA 2VGXA 5G55A 5G05C 3R7RA 2V4LA 4XI0A 2FEZA 5D0OD 2FBNA 3JQ1A 3MZLB 1OWPA 3TL5A 2E0IA 1ELRA 3CHMA 3S7JA 3D9OA 3FEYA 3ZXSA 3GYZA 4B94A 2X38A 4CGWA 4I6JA 1H2VC 5AJDA 1E7VA 4GZCA 3U64A 4FA6A 3NQPA 3LEWA 4N39A 3FHEA 2XRYA 3IEGA 3RO2A 3RRUA 4B8CB 5KCMA 3ONKA 3RJVA 5CCLA 3QK0A 4UWGA 3T5VA 4I1OB 2PZIA 3PUJA 2XHEA 5E75A 1VDYA 3ZPJA 2WXLA 4KZCA 3ZHEA 2EQXA 2KC7A 2NSZA 4DJAA 3SGHA 2PQNA 4YVQC 3FTWA 1OWNA 2J49A 3O4ZA 2V8SE 3PE3A 4A3TA 4FC8A 4H7XA 3U66A 1HX8A 3FUNA 3QARA 5C2YA 2LSVA 1NP7A 4KMOA 3I4GA 5CMWA 3GZSA 3QKYA 4UI9J 3IHVA 5AIJA 1DVPA 2WMOA 2HO1A 3ZVVA 4ANXA 3APCA 3MA5A 4PS8A 3P2BA 5BNWA 4O6FA 3CVQA 4IN3B 4XZ4A 3HIZA 3CK8A 4L2LA 3SZ7A 4URKA 4FLBA 2P58C 2WXPA 1INZA 3ASFA 4ANVA 3QAQA 2RD0A 4G23A 4EECA 3FUJA 4GZ6A 4BTBA 4UI9C 3APFA 1Y6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAQ A;  3FEX A;  2VSX E;  4CRW A;  4JHK A;  4IUL A;  2IU1 A;  3FEY A;  2I2O A;  4CT4 A;  1H2T C;  2ZU6 B;  2HM8 A;  4B8A A;  2VSO E;  1UG3 A;  2GGF A;  1H2V C;  3L6A A;  4GMJ A;  4LUN U;  4C9B B;  2KZT B;  3D3M A;  1UW4 B;  2IOS A;  1N52 A;  2ION A;  2KZT A;  4B8C B;  1N54 A;  4GML A;  4JHJ A;  2IOL A;  1H6K A;  4CEM A;  5ANR A;  3EIJ A;  1H2U A;  3JUI A;  2FUL A;  3EIQ C;  3RK6 A;  4B89 A;  2RG8 A;  2NSZ A;  1HU3 A; 
#chains in the Genus database with same CATH topology
 4RG9 A;  2OND A;  4C48 B;  4Y6C A;  4HBD A;  2FO1 E;  3KSL A;  2BF0 X;  1EF1 C;  4JVS A;  4WUY A;  2I9C A;  1H0A A;  1TNU A;  2FF4 A;  3OAW A;  4UQX A;  3LDZ A;  5CRV A;  5BPP A;  2L9B A;  2LXM A;  3ZU7 B;  1HF8 A;  4HQD A;  3MCX A;  4LNU D;  2X6K A;  4HOR A;  3QWW A;  3DST A;  3BEE A;  4IRU A;  4BES A;  3IHY A;  4GTQ A;  4GA1 A;  3EIQ C;  2M63 A;  3UQ3 A;  1FCH A;  4OAV B;  4YVO A;  4EBA G;  4O1O A;  4EZK A;  2HYZ A;  3FTV A;  4OYS A;  2J8S D;  4Y6W A;  2NC9 A;  2VYI A;  4GYW A;  5G04 C;  4GZ5 A;  4Q96 A;  4J8F A;  3EJN A;  4DRX E;  4I9C A;  4QFV A;  1ZU2 A;  4PDX A;  2C2L A;  4AV7 A;  4EZL A;  4AY5 A;  1FT2 A;  2OVF A;  2GRR B;  4EPZ A;  3L16 A;  1HZ4 A;  3E32 A;  5ENT D;  3CV0 A;  4TRQ A;  4O1P A;  4RVB A;  3TXM A;  4HS2 A;  1GW6 A;  2J4D A;  4F7A A;  3UT7 A;  1TNY A;  3LXU X;  4JZY A;  5BW8 C;  2J08 A;  3EU5 A;  3UXG A;  4GCO A;  3QNK A;  5FZS A;  3G2W A;  2YHE A;  2GRM A;  4NAC A;  3VLE A;  2IO3 C;  2OV8 A;  3WXX A;  2JLB A;  3GZ1 A;  2R17 C;  3NBN B;  1OCO E;  4A1G A;  3B7B A;  3RAU A;  3CVU A;  4Q94 A;  3NZS A;  3PEV B;  4N2Q A;  4YND A;  2Y0B G;  4DX2 A;  3HHM A;  1G3N B;  2ION A;  3ULE G;  5EDS A;  3ASO E;  3PUK A;  3NOC D;  4RSY A;  5ANR A;  4XE0 A;  4JPS A;  1BI8 B;  4APF A;  4JHK A;  4UWK A;  1TNZ A;  4U8H A;  5DIZ A;  4AJW A;  4ANU A;  3OXL A;  4U0S A;  2Y3A A;  3ULQ A;  3ZNG A;  2L6J A;  4G2V A;  4HRM B;  2FO7 A;  3LPZ A;  2Y69 E;  3SD5 A;  2OEW A;  1E8Z A;  3TGO A;  2PQR A;  3D9M A;  1BLX B;  3B95 A;  2XS1 A;  3UT8 A;  2AJA A;  5T3R A;  4A3V A;  1P5Q A;  4AXH A;  3CQG B;  1UN9 A;  1X5B A;  1EDU A;  2IU1 A;  2V5F A;  1JCS A;  1LTX A;  1JPL A;  4Q69 A;  4GA0 A;  3GW4 A;  3FUK A;  3CHS A;  3G2V A;  4OVV A;  2WXH A;  3IBE A;  2VSN A;  3CK9 A;  2PM6 A;  3ZFW A;  1Z5S C;  2DYR E;  1LD7 A;  3ESK A;  2PL2 A;  1HH8 A;  3PEU B;  3UUX A;  4CT4 A;  1UG3 A;  1TR4 A;  4CGV A;  4DLO A;  3DXK G;  3ONL A;  4GTP A;  4U04 A;  2PM7 A;  3CLJ A;  2XPY A;  5CMY A;  3Q47 B;  4TUM A;  4I17 A;  2DVW A;  1YCS B;  4FLH A;  4HRN A;  3CHR A;  4J0U A;  5FQ7 A;  3MKR A;  2KXP C;  1QNF A;  1KLX A;  3I5P A;  2J07 A;  2A5E A;  4XI9 A;  1RW2 A;  3PH0 C;  4LNB A;  3AS5 A;  4C0E A;  3SBT B;  1BPO A;  2QZA A;  1JWG A;  3MKQ A;  1U2V G;  2H6H A;  4MLP A;  3EHR A;  4N5Q A;  2YNQ A;  2XCC A;  3B7R L;  3FUL A;  2P9N G;  4JC8 A;  5JHB A;  4CDN A;  5KNH D;  4HNA D;  2WXM A;  2BKK B;  4EBA A;  2GRP B;  4F1P A;  3D9I A;  3MGB A;  1WY6 A;  2DIW A;  2BTD A;  2WQ6 A;  2OVB A;  4GYO A;  4J6I A;  4FJZ A;  1E8X A;  5HKP A;  2QYJ A;  2QFC A;  4DX7 D;  1AWC B;  3DSW A;  1ELW A;  3L9T A;  3SFY A;  2I2O A;  2AXV A;  2F0Y A;  2J09 A;  3RKV A;  1XGW A;  3ZN3 A;  3GZ2 A;  4AM9 A;  2ETA A;  2NXP A;  3D3M A;  1W3B A;  2IY0 C;  4KVM A;  2CHZ A;  4YDO A;  3C3O A;  3CST A;  3FU6 A;  3P1U A;  1BD8 A;  2XEH A;  2RFM A;  2X6I A;  3E33 A;  4XI0 A;  5D0O D;  3JQ1 A;  3TL5 A;  2E0I A;  3S7J A;  3D9O A;  4CGW A;  1SVX A;  1H2V C;  5AJD A;  1E7V A;  3ASN E;  3LEW A;  4N39 A;  3FHE A;  3IEG A;  1ZB1 A;  3RRU A;  2KBX A;  1WDY A;  1DCQ A;  2XHE A;  2RFA A;  2EQX A;  2EIN E;  3QAR A;  2LSV A;  1NP7 A;  5CEA A;  3QKY A;  3IHV A;  2ZIR A;  5AIJ A;  2WMO A;  2Y1L E;  1N4P A;  1N4R A;  5CRU A;  5EYL A;  4URK A;  1INZ A;  2WXP A;  3ASF A;  2RD0 A;  2R03 A;  4PUC A;  3QDN A;  2X6J A;  4PS7 A;  4FU3 A;  4BFR A;  2XZT G;  3ASH A;  2P9S G;  2L0T B;  4F3V A;  2HE0 A;  1YA0 A;  3CHP A;  4GTR A;  4HB5 A;  3L82 A;  3NOG D;  4NRH B;  4MRU A;  3V79 K;  5FZQ A;  5KBA A;  1PAQ A;  1WAO 1;  1E96 B;  4LG6 A;  2P9K G;  4I43 A;  3Q78 A;  3MEK A;  2AW6 A;  2FI7 A;  4EQF A;  4HI8 A;  3FTS A;  4BWR A;  4KXK B;  3TG4 A;  4DX1 A;  3V2O A;  5FZR A;  2H6G A;  3C5R A;  1LD8 A;  1S64 A;  3LCA A;  4ACK A;  3ABM E;  4HOT A;  3NAW A;  4LUN U;  4KZ0 A;  3DSX A;  4LEU A;  4WWN A;  2MHK A;  1EPU A;  5AQ9 A;  3B7T A;  1H2U A;  4ACL A;  1V55 E;  3G2T A;  3LY8 A;  4CZ2 D;  4ABN A;  1NZN A;  3TWT A;  4OVU A;  3ASG A;  3LKU A;  1PC2 A;  2P9I G;  3V31 A;  2F8X K;  3TWQ A;  3G2U A;  4U07 A;  1E90 A;  4WWP A;  1FPP A;  3FWV A;  4GZD A;  1MJ0 A;  5LOZ A;  2XGO A;  4BX9 A;  1N0R A;  2WVI A;  3TAX A;  3LYA A;  3VTX A;  2AXU A;  3UIO C;  1N94 A;  4UWF A;  3LVR E;  2C0L A;  4GTT A;  5HQ8 A;  3CR3 A;  3HXE A;  2WXQ A;  5CEC B;  3T5X A;  4E85 A;  1H19 A;  3C3Q A;  2Y4T A;  4Z68 A;  4TXQ A;  1JUQ A;  5FQ6 A;  1TN6 A;  3G2S A;  1Q2Z A;  1TJC A;  1MX4 A;  2QYU A;  3UM0 A;  1L5J A;  5A7D B;  1N95 A;  3APD A;  4G26 A;  1TJF A;  3UKR G;  3PS6 A;  4LNG A;  3T8K A;  3SHF A;  3ASD A;  5IY5 E;  3RIB A;  4WND A;  5LCW J;  2XQ0 A;  4EZJ A;  4FP7 A;  5JMN D;  1UJK A;  3QOU A;  5KJM A;  3DEO A;  4WAF A;  1DNP A;  4K5B A;  4CEM A;  3JXJ A;  2MOW A;  4BER A;  4U63 A;  3QWV A;  3FU3 A;  1DC2 A;  5CBN A;  2IJG X;  4UQZ A;  2YQ8 A;  2ZIS A;  1V54 E;  5CCM A;  2CG2 A;  3PVL A;  4PS3 A;  2CHW A;  3HVE A;  1IQU A;  3NB2 A;  5JJ6 A;  4JHJ A;  1KT0 A;  3AJI A;  3EIJ A;  4HOQ A;  2LUH A;  1WG0 A;  3DEP A;  1ZBP A;  2LXL A;  2XEV A;  4DUI A;  5ENO D;  2OEV A;  2GRL A;  3BU8 A;  4BT9 A;  3DBS A;  4BSZ B;  3U4T A;  4AEZ C;  3VTY A;  3URZ A;  3LVQ E;  4F6R D;  3BG1 B;  2CG3 A;  1MZC A;  3HYM B;  3PRZ A;  3PZ1 A;  1MHQ A;  4JD2 G;  5FJY A;  3CHO A;  4BET A;  4MBG A;  3D9N A;  4DI4 A;  1D8D A;  3J5Q B;  5EKQ D;  3LY9 A;  3NZU A;  4ZHB A;  2KM4 A;  4I2Z A;  1TN7 A;  4YDE A;  2EIJ E;  4U96 D;  3MKQ B;  4ZFH A;  3MJW A;  3FUM A;  3ZYL A;  3DXM G;  1H6K A;  3FTU A;  2FUL A;  5J08 A;  3S2A A;  4CDR A;  3Q7A A;  1OXJ A;  1O1T A;  3ABL E;  3KEZ A;  3UIN C;  3PDN A;  2JAB A;  1QYM A;  4K03 A;  2WXN A;  2PNN A;  4D10 C;  3E34 A;  5E76 A;  2V5Q C;  1FVH A;  2DZN A;  3KS2 A;  2DCP A;  4B0Z A;  5AQA A;  2KCK A;  4M7C A;  2XRZ A;  4JB8 P;  2WM9 A;  4LSZ E;  4APO A;  4GMJ A;  3Q4A B;  3JYS A;  2BUG A;  3S7F A;  4U0Z A;  3RRM B;  4XIF A;  1SA5 A;  2WMN A;  4PH4 B;  4BSX A;  5JHA A;  4WNF A;  4I1M A;  3I3N A;  1U3D A;  4GTS A;  4GPK A;  4GZ3 A;  2ZXW E;  2GRN B;  4ILG A;  2X6F A;  3SFZ A;  1N52 A;  3EUV A;  5B3S E;  4LER A;  3QB2 A;  3I4R B;  1N4S A;  4UWH A;  2AXZ A;  3TXN A;  2IOL A;  1UN8 A;  4XKB A;  2VGX A;  3R7R A;  1NL4 A;  2V4L A;  2FEZ A;  1OWP A;  2XEN A;  1ELR A;  4X8Q A;  3ZXS A;  4FA6 A;  4GZC A;  3NQP A;  2XRY A;  3RO2 A;  5KCM A;  5KNG A;  3V2X A;  2P9U G;  3Q79 A;  1VDY A;  3SGH A;  2R05 A;  4A3T A;  3O4Z A;  5CMW A;  2HO1 A;  4ANX A;  3APC A;  4J8Y A;  3JUE A;  3P2B A;  3RSE G;  1O1R A;  3CK8 A;  2EIK E;  3SZ7 A;  2P58 C;  3QAQ A;  4G23 A;  4EEC A;  2H6F A;  4I1O B;  3APF A;  2ETB A;  2KAT A;  5BUZ A;  2V4H C;  2H6I A;  1D8E A;  5FIO A;  2L0I A;  1H2T C;  3D9J A;  3IV0 A;  5ENN A;  3EHM A;  4GU5 A;  1E7U A;  1HS6 A;  2VGY A;  2IFU A;  1JCQ A;  3S7B A;  3C72 A;  1JCR A;  4JW1 A;  1IHB A;  4NIK A;  5ENP D;  3FUE A;  4GMR A;  1OCR E;  3UM3 A;  2IF4 A;  4ATG A;  4BTA A;  3CEQ A;  4GA2 A;  4WWO A;  1E8W A;  3SFX A;  4I9E A;  4BY6 A;  2GGF A;  1FVF A;  1UW4 B;  5BXU A;  4HXI A;  3JCK C;  2R5S A;  1SA4 A;  3UI2 A;  3K9I A;  5D2M C;  2EIL E;  2J4B A;  2WXF A;  3UPV A;  4GCN A;  2XGM A;  2VJ8 A;  3E37 A;  3FP3 A;  3R9M A;  3RU0 A;  4R7L A;  3J5P A;  2DBA A;  3FH5 A;  3MYV A;  2LO6 A;  1MX6 A;  2HM8 A;  3T8M A;  4K5C A;  4A63 B;  5J90 A;  3FH8 A;  4XEI G;  3SNX A;  4I6G A;  1IHG A;  4QQI A;  3T9K A;  4FUL A;  3CSF A;  2P9L G;  3ML9 A;  3PNL B;  5D66 A;  3AG1 E;  3L08 A;  3TWU A;  4N3B A;  4IYP A;  4CRW A;  1E8Y A;  3UIP C;  1UJJ A;  5EID A;  3LJN A;  4HRL A;  3UM2 A;  3VLD A;  2XZD G;  3FUH A;  5FWQ A;  3CVN A;  1QQE A;  3ZKJ A;  2GRO B;  2XPZ A;  5T4Y A;  3RK6 A;  2LNI A;  1YYH A;  3IXE A;  1OCC E;  3RRN B;  3AS4 A;  3ZYQ A;  5EN5 D;  5KJN A;  2ZGD A;  4XKC A;  4WNE A;  3ZIM A;  4L7T A;  3Q9N C;  4O60 A;  1N11 A;  3W9G A;  2WXO A;  4U0U A;  1A5E A;  1K8K G;  1SQM A;  5LP0 A;  5KJK A;  3B7S A;  3D9P A;  1NFI E;  4V3I A;  1S63 A;  3TWS A;  2L6B A;  4MS6 A;  5FQ8 A;  5EIL A;  3HVE B;  3DSU A;  3UM1 A;  5ITZ F;  5HS0 A;  2OOE A;  1ELK A;  4LRZ A;  3FUF A;  5LCW C;  1RZ4 A;  5G2N A;  2QY7 A;  4B93 B;  3Q75 A;  3KSQ A;  3EU9 A;  4F1S A;  4KYO B;  5EIB E;  3OTN A;  3VLF A;  4BEP A;  4M3O A;  3ZGQ A;  3FDH A;  5AQ7 A;  3AS8 A;  4L2Y A;  3L54 A;  4N3C A;  2BED A;  1IXV A;  2WB2 A;  2IEJ A;  3FU5 A;  1SZ9 A;  1KZP A;  4N5C A;  3UTM A;  3U9W A;  2CHX A;  3TWX A;  3BG0 B;  3TG5 A;  1TNO A;  3FY4 A;  4NUR A;  5B1A E;  2UY1 A;  1OT8 A;  4CYM D;  3HXB A;  5EX3 A;  4AOF A;  3TWW A;  1X81 A;  5CBO A;  5EX0 A;  3ZUV B;  2VTB A;  3FTX A;  2I1K A;  5JJ7 A;  1QZ2 A;  1XNF A;  2HR2 A;  1N4Q A;  2B0O E;  1Z6T A;  4LCT A;  2KZT A;  4EHM A;  3V30 A;  3ESL A;  4KT6 B;  5C1D A;  4MKT A;  3DPD A;  3PZ2 A;  4UWL A;  3RO3 A;  2VSX E;  3L13 A;  3FTY A;  4AVX A;  3CKB A;  4I1A A;  3BQO A;  3UT4 A;  5DBK A;  2ETC A;  3PNT B;  5H7P A;  4KBQ A;  2LSU A;  1D9S A;  5ARF A;  1EYH A;  2LAH A;  5BXO A;  4U8Y D;  4AIF A;  5CED B;  2P2C P;  2IOS A;  3Q73 A;  3PRE A;  3TWR A;  3Q5M A;  3ENE A;  4JXT A;  4YDW A;  2LAI A;  3UKU G;  3O48 A;  2C0M A;  1OY3 D;  2X6H A;  4P29 A;  3ZYM A;  1KT1 A;  2A4Z A;  4UQY A;  2QC9 A;  4ILI A;  3DSS A;  4B8A A;  3E30 A;  4KVO A;  4GPM A;  1K1B A;  1NA0 A;  2ILR A;  3PZ4 A;  3QC1 A;  4HOU A;  3PZ3 A;  4U8V D;  3DPY A;  3CVX A;  2CFU A;  2VGX B;  5KWD A;  3F6Q A;  4U95 D;  2JEK A;  2F37 A;  1NA3 A;  1OUV A;  4GYY A;  4L1B A;  3AG4 E;  3AG2 E;  3CVL A;  2WPV A;  4HI9 A;  5G05 J;  3L6A A;  3ULY A;  1IKN D;  2DYS E;  4JL0 A;  4I2W A;  4AY6 A;  3DWL G;  1S0P A;  3PZD A;  4HFG A;  4ANW A;  1N9A A;  4YDY A;  3FFL A;  4J7W A;  5ENR D;  5G55 A;  3JXI A;  3MZL B;  2NYJ A;  1MX2 A;  3FEY A;  3GYZ A;  4U7E B;  1K1A A;  3U64 A;  1FT1 A;  3ONK A;  5CCL A;  3QK0 A;  4UWG A;  5E75 A;  3PUJ A;  3ZPJ A;  4KZC A;  3ZHE A;  2NSZ A;  3KEA A;  2PQN A;  4YVQ C;  4ATZ D;  1OWN A;  2J49 A;  2V8S E;  3U66 A;  1KPS B;  3FUN A;  2BKG A;  4KMO A;  1YMP A;  4UI9 J;  1DVP A;  3DSV A;  3MA5 A;  4XZ4 A;  1O5M A;  4L2L A;  4FLB A;  4ANV A;  3FUJ A;  4BTB A;  5AJL A;  2XGS A;  3TJP A;  3OXG A;  3Q49 B;  3EDT B;  3WG7 E;  2KCV A;  3HRA A;  3CVP A;  2VSY A;  3X2Q E;  4C9B B;  4DX6 D;  5AQB A;  4HVB A;  3QJZ A;  2R59 A;  3ABK E;  2WXK A;  3EHQ A;  5AAO A;  5ENS D;  2V0P A;  1Z3X A;  2WXI A;  4CDM A;  4XX5 A;  1TN8 A;  2DWZ A;  1Y8M A;  4F53 A;  3LS8 A;  4IUL A;  4NQ0 A;  3N71 A;  5KJL A;  3ZEF A;  3CVY A;  2J9Q A;  4J8E A;  5T8I A;  4C0M A;  3FH7 A;  2WQH A;  3HDX A;  5G04 J;  4G8K A;  1JWF A;  4TXP A;  3ISM C;  3Q9U C;  1HFA A;  3MV3 B;  5FT9 A;  5M72 A;  4JEU A;  4A55 A;  4RLY A;  3ML8 A;  1HE8 A;  4L23 A;  2GRQ B;  1QBQ A;  2DZO A;  3UX4 A;  1N0Q A;  3E4B A;  5D0Q D;  5FIN A;  1MYO A;  4JA9 A;  2P9P G;  2A5U A;  5ANL A;  3CIA A;  3FUD A;  1TNB A;  2XS8 A;  5BV0 A;  3DRA A;  3U3W A;  3OXF A;  4I6E A;  4WNG A;  3ZW3 A;  1SZA A;  4TV3 A;  3JQ0 A;  2R02 A;  3CGH A;  3CKC A;  2IO2 C;  3FU0 A;  4N2S A;  1H6O A;  5A23 A;  5AEN A;  1HG5 A;  2WXR A;  2WQ7 A;  3EHN A;  2VGE A;  3KD7 A;  3C98 A;  4ME2 A;  2YIN A;  5ARG A;  2XCB A;  4G24 A;  4GAA A;  4CCA A;  4DI3 A;  1OWM A;  4OAU C;  3D9K A;  2RG8 A;  2KCL A;  3HXF A;  5FTP A;  3IKO B;  5HRY A;  3ZXP A;  2OCC E;  3SO8 A;  4GML A;  3C3R A;  3D9L A;  1HO8 A;  4W9R A;  2MYO A;  2WXJ A;  5BV1 A;  5AN8 A;  3MX3 A;  3CVV A;  3B7U X;  3FUI A;  2AWI A;  1OWO A;  1LF8 A;  3L22 A;  1IYG A;  4HLL A;  1SW6 A;  3PE4 A;  5AAR A;  4G11 A;  2R2L A;  4UI9 K;  2XEE A;  3NF1 A;  4DX5 D;  2E2E A;  3ZYK A;  5AYW D;  2WXG A;  3CK7 A;  4N3A A;  3LY7 A;  1AP7 A;  4GTV A;  1UOH A;  3SI5 A;  3SF4 A;  3AAA C;  3R9A B;  4FHJ A;  2UY1 B;  4GB9 A;  1B89 A;  1BU9 A;  4E6H A;  4DLQ A;  2VTB B;  1IQR A;  2YHC A;  2Y4U A;  2X3M A;  4HOS A;  3AU4 A;  4G25 A;  4FJY A;  1A17 A;  4JEH A;  3ZRH A;  4HLE A;  2KZT B;  4J8D A;  3FTZ A;  5BT1 A;  2IQC A;  3QWP A;  4UUC A;  1OWL A;  4JHR A;  4DK5 A;  1HXI A;  2AVP A;  4JA7 A;  4AP2 A;  2VSO E;  1TEZ A;  1MQS A;  1PY1 A;  4H7Y A;  1K3Z D;  1DCE A;  3AU5 A;  5JJT A;  1WM5 A;  5CHE E;  2Q7F A;  1HU3 A;  4TUU A;  3Q15 A;  3CHQ A;  1HG2 A;  2B6C A;  3CQC B;  3D9H A;  5HI7 A;  2ZU6 B;  1U3C A;  4A1S A;  2GW1 A;  4G8L A;  4FAD A;  5A6C A;  3MV2 B;  1H6P A;  4RQI A;  3B13 A;  3SY2 A;  2ZGG A;  2UWJ G;  3W9F A;  3FEX A;  4G1T A;  3SBS A;  3HXC A;  3LJ3 A;  4L9P A;  1N54 A;  4CT0 A;  2XPI A;  4TXR A;  2MRI A;  3JUI A;  2RKK A;  3R7Q A;  4RG6 A;  1Z3Y A;  5B1B E;  3AG3 E;  3TWV A;  2I6H A;  4J8S A;  3CVW A;  1S70 B;  1TYQ G;  4K0R A;  3L17 A;  3UMV A;  3KAE A;  5LFA A;  2F8Y A;  2VQ2 A;  1BI7 B;  4DPR A;  4BT8 A;  1KZO A;  4B89 A;  4GTO A;  4ILH B;  4BX8 A;  3S7D A;  4K5A B;  2CFZ A;  4FHK A;  5FQ4 A;  1O1S A;  2I1J A;  5LX8 A;  3ZHE B;  3BUA A;  5G05 C;  3HG0 D;  3Q7F A;  2FBN A;  3CHM A;  5CER B;  4B94 A;  2X38 A;  4I6J A;  1NI1 A;  4B8C B;  3HXD A;  3RJV A;  1OCZ E;  3T5V A;  5JA4 D;  2PZI A;  2WXL A;  2EIM E;  2KC7 A;  4DJA A;  3FTW A;  3PE3 A;  4FC8 A;  4H7X A;  1HX8 A;  3SQV A;  5C2Y A;  3I4G A;  3GZS A;  5ENQ D;  5EYP F;  3ZVV A;  4PS8 A;  5BNW A;  4GTM A;  4O6F A;  3CVQ A;  4IN3 B;  3HIZ A;  4GZ6 A;  4UI9 C;  1Y6I A; 
#chains in the Genus database with same CATH homology
 2KAT A;  4RG9 A;  5BUZ A;  2OND A;  2XGS A;  3QDN A;  3TJP A;  3OXG A;  3Q49 B;  4Y6C A;  3EDT B;  2L0I A;  2KCV A;  2X6J A;  1H2T C;  4PS7 A;  3CVP A;  4FU3 A;  3D9J A;  2BF0 X;  3IV0 A;  1EF1 C;  2VSY A;  3EHM A;  5ENN A;  4BFR A;  4JVS A;  4C9B B;  3ASH A;  4WUY A;  2I9C A;  2L0T B;  4F3V A;  1H0A A;  4GU5 A;  1YA0 A;  4HVB A;  3CHP A;  1E7U A;  2FF4 A;  3QJZ A;  2R59 A;  2WXK A;  3OAW A;  4UQX A;  1HS6 A;  3LDZ A;  4NRH B;  4MRU A;  5BPP A;  2VGY A;  2L9B A;  5FZQ A;  2V0P A;  2IFU A;  1Z3X A;  1HF8 A;  2WXI A;  4CDM A;  4XX5 A;  1PAQ A;  3S7B A;  3MCX A;  1WAO 1;  1E96 B;  1Y8M A;  2X6K A;  4F53 A;  3LS8 A;  4IUL A;  4HOR A;  3QWW A;  4I43 A;  3BEE A;  4JW1 A;  3MEK A;  4NQ0 A;  2AW6 A;  4IRU A;  2FI7 A;  3N71 A;  5KJL A;  3ZEF A;  3CVY A;  2J9Q A;  3FUE A;  4J8E A;  5T8I A;  3IHY A;  4C0M A;  4EQF A;  2IF4 A;  3FTS A;  4BWR A;  4KXK B;  3TG4 A;  3FH7 A;  4GA1 A;  4ATG A;  5FZR A;  3EIQ C;  2WQH A;  2M63 A;  3UQ3 A;  3CEQ A;  1FCH A;  3HDX A;  4BTA A;  4YVO A;  4GA2 A;  5G04 J;  4EBA G;  1JWF A;  4EZK A;  4WWO A;  2HYZ A;  1E8W A;  3LCA A;  1HFA A;  3FTV A;  4I9E A;  4OYS A;  3MV3 B;  5FT9 A;  4BY6 A;  4Y6W A;  5M72 A;  4ACK A;  4JEU A;  4A55 A;  2NC9 A;  2GGF A;  3ML8 A;  4HOT A;  1HE8 A;  4LUN U;  2VYI A;  1FVF A;  4GYW A;  4KZ0 A;  4L23 A;  4LEU A;  1UW4 B;  5G04 C;  4WWN A;  4GZ5 A;  4HXI A;  3JCK C;  4Q96 A;  2R5S A;  2MHK A;  1EPU A;  3UX4 A;  4J8F A;  3B7T A;  5D0Q D;  3E4B A;  3K9I A;  1H2U A;  4JA9 A;  4ACL A;  3EJN A;  2J4B A;  2WXF A;  3G2T A;  4I9C A;  3UPV A;  4GCN A;  2XGM A;  3LY8 A;  2VJ8 A;  4QFV A;  1ZU2 A;  4PDX A;  4ABN A;  3FP3 A;  1NZN A;  2A5U A;  2C2L A;  4OVU A;  3RU0 A;  3ASG A;  4AV7 A;  3LKU A;  4EZL A;  4R7L A;  1PC2 A;  2DBA A;  3FH5 A;  3MYV A;  5ANL A;  4AY5 A;  2OVF A;  2LO6 A;  3CIA A;  4EPZ A;  2HM8 A;  3FUD A;  3G2U A;  5BV0 A;  3T8M A;  4U07 A;  1E90 A;  4WWP A;  5J90 A;  3FH8 A;  3FWV A;  3L16 A;  3SNX A;  4GZD A;  3U3W A;  3OXF A;  4I6E A;  4I6G A;  4WNG A;  1IHG A;  3ZW3 A;  1HZ4 A;  1SZA A;  4FUL A;  4TV3 A;  3JQ0 A;  5LOZ A;  3CSF A;  3ML9 A;  3PNL B;  3CV0 A;  3CGH A;  4TRQ A;  4RVB A;  2XGO A;  3CKC A;  3TXM A;  3FU0 A;  4N2S A;  4HS2 A;  1GW6 A;  3L08 A;  2J4D A;  4BX9 A;  4F7A A;  3UT7 A;  2WVI A;  3TAX A;  5A23 A;  4N3B A;  5AEN A;  4IYP A;  4CRW A;  1HG5 A;  3LYA A;  1E8Y A;  3LXU X;  4JZY A;  2WXR A;  1UJJ A;  3VTX A;  5BW8 C;  2WQ7 A;  3EHN A;  2J08 A;  2AXU A;  3KD7 A;  3C98 A;  4ME2 A;  3VLD A;  4GCO A;  3QNK A;  3FUH A;  4UWF A;  3LVR E;  2C0L A;  2YIN A;  5ARG A;  5FZS A;  5FWQ A;  3CVN A;  5HQ8 A;  2XCB A;  3G2W A;  4G24 A;  1QQE A;  2YHE A;  2GRM A;  3CR3 A;  4NAC A;  4GAA A;  3VLE A;  4CCA A;  2WXQ A;  2OV8 A;  3WXX A;  2XPZ A;  4DI3 A;  1OWM A;  2JLB A;  3GZ1 A;  3D9K A;  2R17 C;  2LNI A;  5T4Y A;  2RG8 A;  3RK6 A;  3T5X A;  4E85 A;  1H19 A;  2KCL A;  3RRN B;  3AS4 A;  4A1G A;  2Y4T A;  3CVU A;  4Q94 A;  3NZS A;  5AJL A;  5FTP A;  1JUQ A;  3IKO B;  3PEV B;  3ZYQ A;  4N2Q A;  4YND A;  5FQ6 A;  5KJN A;  3HHM A;  2ION A;  4XKC A;  4WNE A;  4GML A;  3ZIM A;  4L7T A;  5EDS A;  3G2S A;  3PUK A;  3D9L A;  4RSY A;  1TJC A;  5ANR A;  1HO8 A;  2WXO A;  4U0U A;  4XE0 A;  4W9R A;  1L5J A;  5A7D B;  4JPS A;  1SQM A;  5LP0 A;  2WXJ A;  3APD A;  5KJK A;  3B7S A;  5BV1 A;  4G26 A;  3D9P A;  1TJF A;  3MX3 A;  3PS6 A;  3CVV A;  3B7U X;  4APF A;  4V3I A;  3SHF A;  4JHK A;  3FUI A;  2AWI A;  1OWO A;  4UWK A;  3ASD A;  3RIB A;  4MS6 A;  1LF8 A;  4U8H A;  4WND A;  5DIZ A;  3L22 A;  5FQ8 A;  5LCW J;  2XQ0 A;  4EZJ A;  3HVE B;  4FP7 A;  4PUC A;  4AJW A;  1IYG A;  1UJK A;  3QOU A;  5KJM A;  3PE4 A;  4G11 A;  4ANU A;  3OXL A;  4U0S A;  2Y3A A;  3ULQ A;  4WAF A;  2OOE A;  1DNP A;  4UI9 K;  4CEM A;  3NF1 A;  2E2E A;  2L6J A;  2MOW A;  4G2V A;  3ZYK A;  5AYW D;  4U63 A;  1ELK A;  3QWV A;  4LRZ A;  2WXG A;  3FUF A;  5LCW C;  3FU3 A;  2FO7 A;  3LPZ A;  5G2N A;  2QY7 A;  3CK7 A;  4N3A A;  2IJG X;  3SD5 A;  4UQZ A;  3LY7 A;  2YQ8 A;  1E8Z A;  3TGO A;  4F1S A;  4KYO B;  2PQR A;  3OTN A;  5CCM A;  3SI5 A;  2CG2 A;  3VLF A;  3PVL A;  4M3O A;  3R9A B;  3SF4 A;  4PS3 A;  4FHJ A;  2UY1 B;  2CHW A;  3D9M A;  3HVE A;  3FDH A;  4GB9 A;  1IQU A;  3ZGQ A;  1B89 A;  5JJ6 A;  3AS8 A;  4JHJ A;  1KT0 A;  4L2Y A;  3UT8 A;  3L54 A;  3EIJ A;  4N3C A;  4HOQ A;  4E6H A;  4DLQ A;  2VTB B;  5T3R A;  1IQR A;  2WB2 A;  4A3V A;  1P5Q A;  4AXH A;  3CQG B;  1ZBP A;  2XEV A;  2YHC A;  1UN9 A;  1X5B A;  1SZ9 A;  3FU5 A;  1EDU A;  2Y4U A;  2X3M A;  2IU1 A;  4HOS A;  3AU4 A;  2V5F A;  4G25 A;  4FJY A;  1A17 A;  4JEH A;  3ZRH A;  4N5C A;  3U9W A;  2CHX A;  2GRL A;  3BG0 B;  3TG5 A;  4HLE A;  2KZT B;  1JPL A;  3FY4 A;  4J8D A;  3FTZ A;  4BT9 A;  3DBS A;  4NUR A;  4Q69 A;  5BT1 A;  4GA0 A;  2UY1 A;  3GW4 A;  3U4T A;  4AEZ C;  3FUK A;  3CHS A;  3G2V A;  4OVV A;  5EX3 A;  3VTY A;  4AOF A;  2WXH A;  3URZ A;  2IQC A;  3IBE A;  2VSN A;  3CK9 A;  3QWP A;  2PM6 A;  3LVQ E;  3ZFW A;  1OWL A;  3BG1 B;  5EX0 A;  2VTB A;  2CG3 A;  4JHR A;  3ESK A;  2PL2 A;  3HYM B;  3FTX A;  2I1K A;  4DK5 A;  3PRZ A;  1HXI A;  1HH8 A;  5JJ7 A;  3PEU B;  1QZ2 A;  1XNF A;  2AVP A;  2HR2 A;  4JA7 A;  4AP2 A;  3UUX A;  1MHQ A;  4CT4 A;  2VSO E;  5FJY A;  1UG3 A;  1TEZ A;  1MQS A;  3CHO A;  1PY1 A;  1Z6T A;  4CGV A;  4LCT A;  4H7Y A;  4DLO A;  2KZT A;  3ONL A;  3D9N A;  3ESL A;  4U04 A;  4DI4 A;  2PM7 A;  3CLJ A;  3AU5 A;  4KT6 B;  5EKQ D;  5C1D A;  2XPY A;  5JJT A;  1WM5 A;  3LY9 A;  4MKT A;  5CMY A;  3DPD A;  3NZU A;  3Q47 B;  5CHE E;  2Q7F A;  1HU3 A;  4I17 A;  4TUU A;  2KM4 A;  4I2Z A;  4FLH A;  3Q15 A;  4UWL A;  3CHQ A;  3RO3 A;  2VSX E;  1HG2 A;  3CHR A;  3CQC B;  3L13 A;  3FTY A;  4J0U A;  5FQ7 A;  3MKQ B;  5HI7 A;  4AVX A;  3MKR A;  2ZU6 B;  1U3C A;  3CKB A;  4I1A A;  4A1S A;  2GW1 A;  1QNF A;  3MJW A;  3UT4 A;  5DBK A;  4FAD A;  5A6C A;  3PNT B;  3MV2 B;  3FUM A;  3ZYL A;  1H6K A;  3B13 A;  4KBQ A;  3FTU A;  1KLX A;  3I5P A;  2FUL A;  2LSU A;  5J08 A;  2J07 A;  3S2A A;  4XI9 A;  3PH0 C;  4CDR A;  5ARF A;  1EYH A;  2UWJ G;  3AS5 A;  2LAH A;  3FEX A;  4C0E A;  4G1T A;  3SBT B;  1BPO A;  4AIF A;  3KEZ A;  3SBS A;  3PDN A;  3LJ3 A;  1JWG A;  3MKQ A;  4K03 A;  2WXN A;  4D10 C;  2IOS A;  4MLP A;  3PRE A;  5E76 A;  1N54 A;  2YNQ A;  4CT0 A;  2XCC A;  2XPI A;  3Q5M A;  2MRI A;  3ENE A;  1FVH A;  3B7R L;  3JUI A;  3R7Q A;  4JXT A;  3FUL A;  2LAI A;  4RG6 A;  1Z3Y A;  3KS2 A;  2DCP A;  4JC8 A;  3O48 A;  5JHB A;  2C0M A;  4B0Z A;  4CDN A;  2KCK A;  2X6H A;  2I6H A;  4J8S A;  3CVW A;  2XRZ A;  4P29 A;  3ZYM A;  1KT1 A;  4K0R A;  2A4Z A;  2WXM A;  4UQY A;  4ILI A;  3L17 A;  4EBA A;  3UMV A;  4B8A A;  2WM9 A;  3KAE A;  4APO A;  4GMJ A;  4KVO A;  3Q4A B;  5LFA A;  3JYS A;  2BUG A;  3D9I A;  3MGB A;  3S7F A;  1NA0 A;  1WY6 A;  2ILR A;  2DIW A;  2BTD A;  2VQ2 A;  4U0Z A;  3RRM B;  2WQ6 A;  3QC1 A;  4DPR A;  2OVB A;  4GYO A;  4HOU A;  4J6I A;  4FJZ A;  4XIF A;  1E8X A;  4BT8 A;  3CVX A;  2CFU A;  2VGX B;  2WMN A;  4PH4 B;  4BSX A;  2QFC A;  4B89 A;  2JEK A;  5JHA A;  1NA3 A;  4WNF A;  1OUV A;  4I1M A;  4ILH B;  4BX8 A;  4GYY A;  4L1B A;  3I3N A;  1U3D A;  3S7D A;  1ELW A;  4GPK A;  2I2O A;  4GZ3 A;  2AXV A;  3CVL A;  2J09 A;  3RKV A;  2WPV A;  1XGW A;  3ZN3 A;  3GZ2 A;  2CFZ A;  4AM9 A;  5G05 J;  3L6A A;  2NXP A;  4FHK A;  4ILG A;  2X6F A;  3D3M A;  3SFZ A;  1N52 A;  1W3B A;  4LER A;  3QB2 A;  3I4R B;  4KVM A;  2CHZ A;  4UWH A;  3CST A;  2AXZ A;  4JL0 A;  3TXN A;  2IOL A;  3FU6 A;  3P1U A;  2I1J A;  4I2W A;  5FQ4 A;  1S0P A;  4AY6 A;  1UN8 A;  3PZD A;  2X6I A;  4XKB A;  4HFG A;  3ZHE B;  4ANW A;  5LX8 A;  3FFL A;  2VGX A;  5G55 A;  5G05 C;  3R7R A;  2V4L A;  4XI0 A;  2FEZ A;  5D0O D;  2FBN A;  3JQ1 A;  3MZL B;  1OWP A;  3TL5 A;  2E0I A;  1ELR A;  3CHM A;  3S7J A;  3D9O A;  3FEY A;  3ZXS A;  3GYZ A;  4B94 A;  2X38 A;  4CGW A;  4I6J A;  1H2V C;  5AJD A;  1E7V A;  4GZC A;  3U64 A;  4FA6 A;  3NQP A;  3LEW A;  4N39 A;  3FHE A;  2XRY A;  3IEG A;  3RO2 A;  3RRU A;  4B8C B;  5KCM A;  3ONK A;  3RJV A;  5CCL A;  3QK0 A;  4UWG A;  3T5V A;  4I1O B;  2PZI A;  3PUJ A;  2XHE A;  5E75 A;  1VDY A;  3ZPJ A;  2WXL A;  4KZC A;  3ZHE A;  2EQX A;  2KC7 A;  2NSZ A;  4DJA A;  3SGH A;  2PQN A;  4YVQ C;  3FTW A;  1OWN A;  2J49 A;  3O4Z A;  2V8S E;  3PE3 A;  4A3T A;  4FC8 A;  4H7X A;  3U66 A;  1HX8 A;  3FUN A;  3QAR A;  5C2Y A;  2LSV A;  1NP7 A;  4KMO A;  3I4G A;  5CMW A;  3GZS A;  3QKY A;  4UI9 J;  3IHV A;  5AIJ A;  1DVP A;  2WMO A;  2HO1 A;  3ZVV A;  4ANX A;  3APC A;  3MA5 A;  4PS8 A;  3P2B A;  5BNW A;  4O6F A;  3CVQ A;  4IN3 B;  4XZ4 A;  3HIZ A;  3CK8 A;  4L2L A;  3SZ7 A;  4URK A;  4FLB A;  2P58 C;  2WXP A;  1INZ A;  3ASF A;  4ANV A;  3QAQ A;  2RD0 A;  4G23 A;  4EEC A;  3FUJ A;  4GZ6 A;  4BTB A;  4UI9 C;  3APF A;  1Y6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...