2NSZA

1.15 angstrom crystal structure of the ma3 domain of pdcd4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
129
structure length
129
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for inhibition of translation by the tumor suppressor Pdcd4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antitumor protein
molecule keywords Programmed cell death protein 4
total genus 54
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nszA00
3L6AA 1H2UA 3FEYA 4B89A 1UW4B 4C9BB 2RG8A 1PAQA 2IOLA 5ANRA 4JHKA 2VSXE 2ZU6B 3D3MA 3EIJA 2IU1A 2GGFA 4JHJA 4B8CB 1H2VC 1N52A 1H6KA 4LUNU 2IOSA 1N54A 4CEMA 2VSOE 4IULA 3EIQC 4GMJA 2KZTB 2I2OA 4GMLA 1H2TC 4CT4A 3FEXA 2KZTA 2FULA 4CRWA 3JUIA 1UG3A 2NSZA 2IONA 1HU3A 3RK6A 4B8AA 2HM8A
chains in the Genus database with same CATH superfamily
1ZBPA 4DI4A 2X6HA 3Q78A 1Y6IA 3DWLG 4ACLA 3FHEA 1H6OA 4A63B 2OV8A 4G8KA 1JPLA 5CBOA 3I5PA 2PQNA 2V8SE 3ZHEA 3OTNA 2XENA 2VGYA 2Y69E 1OY3D 4HB5A 4ANVA 3QK0A 5BXOA 3ZPJA 3UM1A 4EZJA 1N4PA 4N3AA 4GTSA 4EECA 4ANWA 3QWVA 4DLOA 3L22A 4APFA 2VYIA 5LFAA 3CHOA 3LJNA 2VTBB 4XIFA 4BESA 4CGVA 1W3BA 5CECB 3RRMB 3MA5A 4ANUA 3IBEA 2XGMA 2FBNA 2KBXA 4FHJA 5CEAA 2PM7A 1BI7B 4J8EA 1UG3A 3UI2A 1S64A 4XEIG 4BX8A 4YVQC 4A3VA 3EHNA 2XEEA 3ML9A 5EIDA 2XPZA 1N4QA 2IU1A 2WXHA 4HI9A 5G05J 3QJZA 1TYQG 1FCHA 3RO2A 3AG4E 2P9KG 5CHEE 1NA0A 5EKQD 1UOHA 2YINA 3LDZA 3T8KA 4U07A 4DRXE 3CLJA 3FTSA 4U8HA 4KZCA 3TWWA 4U7EB 2WXMA 2KZTB 2PNNA 4YDWA 1D9SA 3HDXA 2ETCA 5CCLA 1E7UA 4TRQA 2Y4UA 3DSSA 1JUQA 2WQ7A 4ABNA 2CG3A 3LVRE 3URZA 5KNHD 5ENRD 1JCQA 4O1OA 3AU5A 1Z5SC 4KZ0A 2H6FA 2V4LA 5G55A 2OEWA 2R03A 2QFCA 3D9OA 4RG9A 3ZNGA 3VLEA 3E37A 3Q4AB 3SHFA 1UN9A 3LJ3A 4PH4B 3TWUA 3TXMA 2C2LA 4ZFHA 4YNDA 1OXJA 3HXBA 3EHRA 1Z3YA 3V30A 2YNQA 4AJWA 2A5EA 1JWFA 3JUEA 3PNTB 5EIBE 2OEVA 4JEHA 5G04C 3S7DA 3U66A 4N5CA 1GW6A 2XHEA 3OAWA 3BUAA 2EIKE 4YDEA 1TN7A 2PZIA 1Y8MA 2NXPA 4CYMD 4E6HA 4ATGA 1N4RA 4BSZB 3MKQA 3HXFA 4HOQA 4U8YD 5AJDA 2KC7A 3CK7A 3D9HA 4JXTA 5ANRA 3T5VA 3SBTB 3I4RB 4KBQA 2WXGA 3UT4A 2DIWA 3FU0A 4FU3A 2F0YA 5CBNA 4DX2A 4HNAD 1ELRA 4NURA 5AJLA 2ZISA 3FWVA 3CGHA 3E4BA 3CHSA 3CKBA 1UW4B 4L7TA 4WNGA 1O1RA 4EQFA 3R9AB 3RO3A 4WNEA 2KATA 2AVPA 2DBAA 3BG0B 4N3BA 5EYLA 1SA5A 1MQSA 3FUHA 3UT7A 2UWJG 4BWRA 5CRVA 2F8XK 3P1UA 3ULEG 2VSXE 3PNLB 5J90A 4AY5A 4BETA 1E8YA 4A3TA 4HFGA 3KSQA 3S7FA 2VGXB 2RFMA 4BT9A 1O1SA 3MKRA 4WNFA 3FY4A 5CCMA 5AAOA 1NZNA 5B1AE 4HVBA 3ASDA 4K0RA 3AS8A 3SFZA 3DBSA 4K5CA 4G23A 3F6QA 2R02A 4I17A 3IEGA 3U4TA 4ILHB 5BW8C 3DSUA 3ISMC 4UI9J 5BUZA 2AXVA 4B93B 1XGWA 4HRMB 2CHXA 3RRUA 1KZPA 4MS6A 4LUNU 4HS2A 1O5MA 4KMOA 4Z68A 4OAUC 4J8FA 1S63A 1OCOE 3E32A 2EINE 2CHZA 1SA4A 3U9WA 4HXIA 3RAUA 3TGOA 5D2MC 2WXIA 3Q15A 4LG6A 5DIZA 1H2VC 4TXQA 3MX3A 4URKA 2Y1LE 3NOCD 5CEDB 4G24A 3LYAA 3FTUA 4WWPA 3EDTB 3J5PA 4GAAA 1OWOA 1MX2A 3FULA 4JPSA 4HOSA 1QQEA 4GZDA 3R7QA 1WDYA 2OCCE 2GRPB 3WG7E 2YHEA 2I2OA 3HG0D 4FHKA 4AY6A 4QQIA 3CVPA 1ELKA 1RW2A 3GZ2A 5JMND 3TWTA 3D3MA 3EUVA 4JA7A 4TUMA 3SFYA 3FU3A 3NBNB 2LO6A 3WXXA 2GROB 2WXFA 2IONA 4DI3A 4NRHB 4LCTA 4UWGA 4C0EA 3JYSA 4GTRA 4HRNA 1OWNA 4I1AA 2F37A 3MCXA 3N71A 2WXQA 3ZXSA 2ETAA 4DUIA 5FTPA 1Q2ZA 2ZU6B 3SI5A 1U3DA 2XEHA 3ENEA 1N54A 2LNIA 3D9LA 3HVEA 3JUIA 2X6IA 4NQ0A 1A17A 2OVBA 3CVXA 3AJIA 2WXKA 1YA0A 4UUCA 4DX6D 4HLEA 1N11A 2V0PA 2VQ2A 2Q7FA 2VSNA 4R7LA 5B1BE 4C9BB 1Z3XA 3Q73A 2HE0A 3SNXA 5JJTA 4EPZA 2YQ8A 3DSVA 1OWMA 5LCWC 4AVXA 4AIFA 2XGSA 1KLXA 4I1OB 5EYPF 3Q5MA 3RSEG 3ZGQA 3EHQA 1LD7A 2ZGDA 3CSTA 5HRYA 4JA9A 5A6CA 5J08A 2I6HA 2V5FA 5AQAA 1OCZE 2ETBA 2WXRA 4RG6A 1TNZA 2R05A 2BKKB 3GZ1A 4AM9A 3IKOB 1MZCA 5HKPA 4GZ5A 4RSYA 3CQCB 3ASFA 3CSFA 2R17C 5G04J 3UMVA 3ZW3A 3G2VA 2P9IG 4PS7A 1H19A 3PZ3A 1YMPA 3TWSA 1X81A 5FJYA 3APDA 3CHRA 5FZRA 5LP0A 3PREA 2VGEA 1TNYA 2DYSE 3CVQA 1TJFA 3EU5A 3C3OA 5CMYA 4JB8P 2DVWA 1TEZA 4L23A 1INZA 3RKVA 4N2SA 1HXIA 4K5AB 5D0OD 4LNBA 5LX8A 1TN6A 1RZ4A 5A23A 3GW4A 1IXVA 4TXRA 1K1BA 4JHRA 2I9CA 3DSTA 4A55A 3PS6A 1SQMA 2P9NG 3UKUG 3FTXA 4MBGA 4EZLA 1S0PA 4OVUA 4GTTA 2VSOE 2X6JA 3D9NA 1H2TC 3PVLA 4FP7A 4UQXA 1ZB1A 2ILRA 3ML8A 1SVXA 3IXEA 5A7DB 5ENNA 3APFA 1BPOA 3AS5A 4KT6B 3NF1A 4LSZE 2RG8A 4H7XA 5DBKA 3LVQE 2AW6A 5FQ8A 3VLDA 3ABLE 5EILA 2I1KA 3B7BA 4BT8A 3IHVA 4TUUA 3HHMA 4J6IA 4C48B 4PUCA 3FUIA 4CDRA 4GMRA 2FO7A 3E30A 4MLPA 4Q96A 2X3MA 5BV1A 3QARA 3RRNB 5CERB 3V31A 4C0MA 4DK5A 2X38A 4APOA 5KJMA 1KT1A 1OUVA 1EF1C 1U2VG 4AP2A 2XPYA 5FIOA 4LEUA 2RD0A 2B6CA 2LXMA 4B94A 3FH5A 5M72A 4AXHA 1KZOA 2AXUA 5ENQD 4DX5D 4LNUD 3FUJA 2VGXA 3RK6A 4KVMA 4RLYA 4J8YA 2DCPA 4BSXA 3FFLA 3BU8A 4O1PA 4L1BA 1HO8A 1MYOA 3PEVB 5JHAA 1EYHA 1WAO1 3ABKE 4YVOA 2P9LG 4U8VD 4TXPA 1IQRA 2WB2A 4JHKA 4CCAA 4J8SA 3ASOE 4WUYA 4G11A 1L5JA 3K9IA 5FQ7A 3L16A 3KEAA 3CK8A 1QZ2A 3FTZA 1EDUA 2HO1A 1E7VA 3D9KA 1EPUA 3V2OA 3L08A 4I2ZA 2IOLA 2L9BA 1LTXA 3TWQA 3IV0A 2KCLA 1G3NB 4GZ6A 2P9PG 4FJZA 4ILGA 3U64A 3ZXPA 4F6RD 3W9GA 2DWZA 2L0TB 2OOEA 4ME2A 1MX4A 2OVFA 4IN3B 4M7CA 2GRRB 3LXUX 1K1AA 2A5UA 1XNFA 3QB2A 2GRMA 2L6BA 3SBSA 3UKRG 2JABA 5AIJA 3MJWA 1P5QA 3UIPC 4OVVA 2YHCA 3VLFA 4JC8A 4K5BA 1AP7A 2JEKA 4G8LA 4UWFA 4N5QA 4XKBA 3APCA 3QWPA 3CHPA 1MJ0A 4B8AA 4UWLA 4ILIA 3EJNA 3FUKA 3FU6A 4JEUA 2DYRE 3HYMB 3CHQA 5H7PA 3DPYA 2L6JA 2WXJA 1O1TA 3UT8A 2Y4TA 5FT9A 4GTQA 2JLBA 3BEEA 3UM3A 2CFZA 1H6PA 1BLXB 3UM0A 4ANXA 3Q49B 3ESLA 3CR3A 4I6EA 4ACKA 4N3CA 4F1SA 4Q69A 2ZXWE 4Y6WA 3OXFA 3HXCA 1UJKA 3LPZA 4DPRA 3LCAA 3W9FA 2WXNA 1BU9A 5B3SE 2FI7A 1DVPA 5HI7A 3HIZA 3LS8A 5AQBA 4BFRA 3VTYA 3TAXA 2EIJE 4U04A 5BPPA 3CK9A 5LOZA 4GZCA 3TG5A 5EDSA 2V4HC 3ULYA 3FUFA 2ZGGA 2DZOA 3QOUA 3RIBA 5HQ8A 5D0QD 3B13A 3R9MA 3QKYA 3PUJA 2XZDG 2GGFA 1OCCE 5KBAA 2Y0BG 2LUHA 5KJLA 2QC9A 2WVIA 1LF8A 4HQDA 4BERA 2MOWA 4O60A 2KCKA 2J08A 3EU9A 2QYUA 3ZYMA 4OYSA 1NA3A 3Q7FA 5EX3A 4ATZD 4L2YA 2PQRA 2QZAA 3KSLA 3Q79A 3UIOC 4XKCA 3FP3A 1Z6TA 1PC2A 3FTVA 4FJYA 1N95A 2KCVA 2WM9A 3E33A 2XS1A 1TNBA 3MGBA 5T3RA 1SZAA 5JJ7A 4AOFA 2WQHA 2P9SG 4IULA 1H0AA 3CVUA 4FADA 3HRAA 3ABME 3PZ2A 3C5RA 4FA6A 5ANLA 4Y6CA 2IEJA 3X2QE 3FTYA 1HG5A 3G2UA 4E85A 4UI9C 1YCSB 3ONLA 4G1TA 3LEWA 1QYMA 2NSZA 4NACA 5JHBA 3DSWA 4DJAA 2WMNA 4G26A 2FO1E 1K3ZD 2XRZA 3OXGA 2IJGX 3G2WA 3FUMA 4UQZA 2A4ZA 4MRUA 4IYPA 3B7RL 5ENPD 3FH7A 3AAAC 2GRNB 4HBDA 3NZUA 2P9UG 2WXLA 1H2UA 5T8IA 3DSXA 2AWIA 3C98A 3ZU7B 4JD2G 3BG1B 4M3OA 3L17A 3ZYKA 3CQGB 4RVBA 5AYWD 1N0RA 3SO8A 2EILE 5ENOD 4U0SA 2V5QC 1HU3A 3MV2B 1E8WA 5KCMA 3G2TA 1QNFA 3ZYQA 2PL2A 2J09A 3DEPA 2LSVA 5FZQA 3TXNA 2IY0C 1IHGA 4HORA 2WQ6A 3ZEFA 3PH0C 5KJNA 5FZSA 3FDHA 1D8DA 3PE3A 4GCOA 3DRAA 1IKND 2E2EA 5AN8A 2H6IA 4ZHBA 1LD8A 4K03A 5C2YA 3DXMG 4UQYA 3FU5A 4AV7A 1N9AA 3CKCA 3ESKA 5AARA 4XI0A 3NZSA 5KNGA 2MYOA 2J9QA 1WY6A 4HI8A 4I2WA 2E0IA 3QWWA 5ARFA 2NYJA 3MEKA 5FQ6A 4XI9A 3U3WA 3CHMA 4F7AA 1PY1A 3P2BA 5FINA 2KXPC 2X6FA 3S7BA 5G2NA 2R59A 1D8EA 4UI9K 4FLHA 4F53A 1DC2A 1FVFA 2QYJA 4GA2A 4RQIA 3PZ4A 5ENTD 3Q47B 4GZ3A 1U3CA 3DEOA 4CEMA 2XRYA 2XEVA 3Q7AA 4FC8A 4QFVA 3TWXA 2X6KA 3CVYA 2WMOA 4U95D 2UY1B 1HZ4A 3B7UX 3EIJA 3ZUVB 5KWDA 4OAVB 3NQPA 3UX4A 1HH8A 1UN8A 3MKQB 2EQXA 2CG2A 4PS3A 1ELWA 4XE0A 3SD5A 2HYZA 4GYYA 3RU0A 3TG4A 4HLLA 3PEUB 4UWHA 3ZVVA 1V54E 4EHMA 3FEXA 5KJKA 2FULA 2DZNA 4TV3A 4N2QA 2BUGA 3UXGA 4W9RA 4G25A 3FEYA 4B0ZA 3JQ1A 3KEZA 3NOGD 2J07A 4U0ZA 3HXDA 1NL4A 1NI1A 3S2AA 4EZKA 3JXIA 1HS6A 4GA0A 4I1MA 5BT1A 1OT8A 1UJJA 3BQOA 3V2XA 3FUEA 5HS0A 4KXKB 4CDMA 3AS4A 4EBAA 3T8MA 1A5EA 4JZYA 5T4YA 3ASNE 4B89A 3OXLA 1TNOA 4P29A 2LAHA 5BXUA 4LERA 4GU5A 3CVWA 1E8ZA 3AG3E 1SW6A 2XQ0A 4HRLA 3Q9NC 2H6GA 2WXOA 3L6AA 4HOTA 3CVLA 1ZU2A 3PZ1A 1WM5A 3L82A 2EIME 3O48A 3D9IA 3O4ZA 3D9JA 4J8DA 1WG0A 4YDYA 5ITZF 3KS2A 2FF4A 4KYOB 4AEZC 1K8KG 4DX7D 1MHQA 4BTAA 1DCQA 2QY7A 5CRUA 4CGWA 2UY1A 2LAIA 4U63A 1FPPA 2XPIA 2GRLA 4HOUA 2XZTG 4F1PA 4GYWA 1KT0A 1IQUA 3RJVA 2BKGA 5AQ7A 1YYHA 5LCWJ 2I1JA 3ZFWA 4J7WA 1HX8A 4L2LA 5BNWA 1V55E 4JHJA 4WAFA 2IOSA 3MYVA 1OCRE 3NB2A 4JVSA 3PUKA 4GMLA 3AG2E 4GPMA 4FULA 4I43A 4CDNA 2P58C 3T5XA 1JCRA 2IO2C 2NC9A 1KPSB 3L54A 3VTXA 3PZDA 1NFIE 4WWOA 4DX1A 3TJPA 4XX5A 4DLQA 4JL0A 5ARGA 4A1GA 4CZ2D 1H6KA 3JCKC 3PE4A 1DCEA 3L13A 4EBAG 3UPVA 3R7RA 4GCNA 1SZ9A 1N0QA 3LY8A 5EX0A 4I6GA 1TR4A 4V3IA 3C3RA 3NAWA 3QC1A 3TL5A 5E76A 2IO3C 1BD8A 2J4DA 2R2LA 4BX9A 1QBQA 5G05C 3CEQA 4JW1A 5C1DA 2J4BA 4LNGA 4PDXA 2XCCA 3QDNA 2ZIRA 3ASGA 3LY7A 2GRQB 3B7SA 3B7TA 1HG2A 1E90A 3Q75A 3CVNA 3IHYA 2J49A 4BEPA 3ASHA 4WWNA 4X8QA 2F8YA 2WPVA 3ZHEB 2J8SD 4F3VA 2XCBA 2L0IA 3TWRA 2BF0X 2XS8A 4GA1A 1MX6A 1PAQA 2VSYA 1FT2A 4CT0A 1JCSA 4GTMA 4B8CB 4U96D 3JXJA 4H7YA 2WXPA 3ZRHA 3SY2A 3I3NA 3TWVA 4BY6A 1X5BA 1OWPA 2MRIA 1FVHA 3E34A 3LKUA 3G2SA 3B95A 5ENSD 2RKKA 3PDNA 3I4GA 2XGOA 5JA4D 5E75A 4YDOA 4LRZA 1OWLA 3UUXA 3DPDA 3SQVA 3L9TA 2C0LA 1N94A 3SF4A 3SZ7A 3CVVA 3HXEA 4GYOA 3MV3B 4L9PA 3GYZA 4UWKA 3FTWA 4FLBA 3PRZA 2IF4A 2M63A 3GZSA 4MKTA 4KVOA 2AXZA 2BEDA 3UINC 3CIAA 5BV0A 3S7JA 3D9PA 3D9MA 4GTPA 1JWGA 4A1SA 3ONKA 4I9CA 2B0OE 2CHWA 4G2VA 3T9KA 2MHKA 1BI8B 2HM8A 2PM6A 2GW1A 2ONDA 4GB9A 5JJ6A 4D10C 4GTOA 2VJ8A 5EN5D 3Q9UC 2HR2A 3DXKG 3UTMA 3JQ0A 5IY5E 2LSUA 3KD7A 3J5QB 3EIQC 1TNUA 4N39A 2LXLA 4U0UA 2BTDA 1NP7A 1IHBA 5FQ4A 4IRUA 5D66A 3FUDA 3AU4A 1HE8A 1B89A 3SFXA 1TN8A 3UQ3A 3QNKA 3UM2A 4J0UA 1E8XA 4XZ4A 3FUNA 3SGHA 3CV0A 4O6FA 3HVEB 4NIKA 1VDYA 3ZKJA 2IQCA 3V79K 1N52A 1IYGA 4I6JA 2AJAA 5AQ9A 4GMJA 1HF8A 2P2CP 4CRWA 4PS8A 1FT1A 2H6HA 1AWCB 2CFUA 4GTVA 2IFUA 2RFAA 1DNPA 4Q94A 3EHMA 3LY9A 3QAQA 3C72A 1TJCA 4WNDA 2FEZA 3C3QA 3MZLB 5CMWA 3ZN3A 5AENA 3ZYLA 1S70B 4GPKA 4I9EA 5FWQA 3ZIMA 1HFAA 3FH8A 3AG1E 2VTBA 1N4SA 4BTBA 1E96B 2Y3AA 4CT4A 2KZTA 3KAEA 2KM4A 2R5SA 2C0MA 3ULQA
chains in the Genus database with same CATH topology
4I6EA 4ACKA 4UWGA 3T8MA 4EBAA 1ZBPA 4JZYA 3JYSA 4N3CA 4C0EA 5T4YA 4F1SA 1OWNA 4B89A 4DI4A 3OXLA 4I1AA 2X6HA 3MCXA 4Q69A 3N71A 2WXQA 3ZXSA 1Y6IA 4ACLA 4Y6WA 4P29A 2LAHA 3FHEA 5FTPA 4LERA 3OXFA 2ZU6B 4GU5A 3SI5A 1UJKA 1U3DA 3LPZA 4DPRA 3CVWA 1E8ZA 2OV8A 3ENEA 3LCAA 1N54A 2WXNA 2LNIA 3D9LA 3HVEA 1JPLA 2FI7A 1DVPA 3I5PA 2PQNA 2V8SE 3ZHEA 3JUIA 2X6IA 5HI7A 2XQ0A 3HIZA 3OTNA 3LS8A 4NQ0A 1A17A 2OVBA 2VGYA 4BFRA 3CVXA 2WXOA 3L6AA 4HOTA 3VTYA 4ANVA 3QK0A 3CVLA 3TAXA 3ZPJA 1ZU2A 4U04A 2WXKA 4EZJA 5BPPA 3CK9A 5LOZA 1WM5A 4GZCA 4N3AA 1YA0A 4EECA 3TG5A 4ANWA 3O4ZA 3O48A 3QWVA 3D9IA 3L22A 4APFA 4DLOA 3D9JA 4J8DA 5EDSA 2VYIA 5LFAA 3CHOA 2VTBB 3KS2A 2FF4A 4KYOB 4HLEA 4AEZC 4XIFA 3FUFA 2V0PA 4CGVA 1W3BA 3QOUA 3RIBA 5HQ8A 2VQ2A 2Q7FA 1MHQA 3RRMB 4BTAA 2VSNA 2QY7A 5D0QD 4R7LA 3B13A 4C9BB 3QKYA 3MA5A 4CGWA 2UY1A 1Z3XA 4ANUA 3IBEA 2LAIA 2XGMA 3PUJA 2FBNA 4FHJA 2GGFA 4U63A 2XPIA 2GRLA 4HOUA 3SNXA 5JJTA 5KJLA 4GYWA 4EPZA 2YQ8A 2PM7A 1KT0A 2WVIA 1IQUA 1OWMA 1LF8A 3RJVA 4J8EA 1UG3A 5LCWC 2MOWA 3Q49B 2KCKA 4BX8A 4YVQC 2J08A 4A3VA 4AVXA 4AIFA 2XGSA 3EHNA 1KLXA 5LCWJ 4I1OB 3ZYMA 4OYSA 2I1JA 3ZFWA 1NA3A 5EX3A 3ML9A 3Q5MA 3ZGQA 1HX8A 2XPZA 2PQRA 4L2LA 4L2YA 5BNWA 2IU1A 4JHJA 4WAFA 3CSTA 4JA9A 5A6CA 2WXHA 5J08A 2IOSA 5G05J 2I6HA 2V5FA 3MYVA 4XKCA 3QJZA 4JVSA 3PUKA 4GMLA 3FP3A 1FCHA 1Z6TA 3RO2A 2WXRA 4RG6A 1PC2A 3FTVA 4FULA 5CHEE 1NA0A 5EKQD 4FJYA 4I43A 4CDNA 2P58C 2YINA 3GZ1A 3T5XA 3LDZA 3L54A 4AM9A 2NC9A 3IKOB 2KCVA 2WM9A 4GZ5A 4RSYA 3CQCB 4U07A 3VTXA 3PZDA 3ASFA 4WWOA 3CLJA 3MGBA 3TJPA 3CSFA 3FTSA 4XX5A 5T3RA 2R17C 5G04J 3UMVA 3ZW3A 4DLQA 4JL0A 1SZAA 5ARGA 3G2VA 4A1GA 1H6KA 4PS7A 1H19A 4U8HA 4KZCA 4AOFA 3JCKC 5JJ7A 2WQHA 2WXMA 3PE4A 4IULA 1H0AA 3CVUA 5FJYA 2KZTB 4FADA 3APDA 3CHRA 3HDXA 3L13A 5FZRA 5LP0A 5CCLA 3PREA 4EBAG 4FA6A 1E7UA 5ANLA 4Y6CA 3R7RA 3UPVA 4GCNA 1SZ9A 4TRQA 3CVQA 2Y4UA 3FTYA 1JUQA 1HG5A 1TJFA 2WQ7A 3LY8A 4ABNA 5CMYA 5EX0A 2CG3A 1TEZA 4L23A 3LVRE 3G2UA 3URZA 4I6GA 4E85A 1INZA 4UI9C 4V3IA 3RKVA 4N2SA 1HXIA 3AU5A 4KZ0A 3QC1A 3TL5A 3ONLA 4G1TA 3LEWA 5D0OD 5E76A 5LX8A 2V4LA 5G55A 2J4DA 5A23A 3GW4A 2NSZA 4BX9A 4JHRA 4NACA 2I9CA 2QFCA 5G05C 4A55A 5JHBA 3CEQA 3D9OA 4RG9A 4JW1A 4DJAA 3PS6A 5C1DA 2WMNA 2J4BA 3VLEA 1SQMA 4PDXA 2XCCA 4G26A 3Q4AB 3FTXA 3SHFA 3QDNA 3LY7A 3ASGA 2XRZA 4EZLA 1S0PA 3OXGA 3B7SA 4OVUA 3B7TA 1UN9A 1HG2A 3LJ3A 2IJGX 1E90A 4PH4B 3CVNA 3IHYA 3TXMA 2C2LA 3G2WA 2J49A 3FUMA 2VSOE 4ANXA 4YNDA 3D9NA 2X6JA 3ASHA 4WWNA 4UQZA 1H2TC 3PVLA 2WPVA 2A4ZA 4FP7A 4MRUA 4UQXA 3ZHEB 4IYPA 4F3VA 2ILRA 3ML8A 3B7RL 1Z3YA 3FH7A 5A7DB 5ENNA 3APFA 2XCBA 3NZUA 2L0IA 1BPOA 2WXLA 2YNQA 1H2UA 3AS5A 2BF0X 5T8IA 4AJWA 1JWFA 4KT6B 3NF1A 4GA1A 3PNTB 2RG8A 4H7XA 1PAQA 2VSYA 2AWIA 3C98A 4CT0A 5DBKA 4JEHA 3LVQE 5G04C 3S7DA 3U66A 2AW6A 4N5CA 1GW6A 2XHEA 3OAWA 3BG1B 4M3OA 3L17A 5FQ8A 4B8CB 3VLDA 4H7YA 2PZIA 2WXPA 1Y8MA 3CQGB 3ZRHA 4RVBA 2NXPA 3I3NA 5AYWD 3ZYKA 4BY6A 1X5BA 2I1KA 4U0SA 4BT8A 1HU3A 3IHVA 3MV2B 4E6HA 1E8WA 4ATGA 5KCMA 4TUUA 3G2TA 3MKQA 1OWPA 3HHMA 1QNFA 2MRIA 4J6IA 1FVHA 3ZYQA 4HOQA 2PL2A 2J09A 3LKUA 2LSVA 5FZQA 3TXNA 5AJDA 2KC7A 3G2SA 4PUCA 3CK7A 3FUIA 4JXTA 5ANRA 4CDRA 3T5VA 3SBTB 3I4RB 4KBQA 1IHGA 2WXGA 3UT4A 2FO7A 4MLPA 4Q96A 3PDNA 2DIWA 4HORA 3FU0A 3I4GA 2X3MA 4FU3A 5BV1A 3QARA 2WQ6A 3RRNB 3ZEFA 1ELRA 4NURA 5AJLA 4C0MA 3PH0C 4DK5A 2X38A 3FWVA 3CGHA 3E4BA 4APOA 5KJMA 3CHSA 5KJNA 2XGOA 5FZSA 3FDHA 1KT1A 3PE3A 5E75A 1OUVA 3CKBA 1UW4B 4GCOA 1EF1C 1OWLA 4L7TA 4LRZA 3UUXA 3DPDA 4WNGA 4AP2A 2XPYA 2E2EA 4EQFA 2C0LA 3SF4A 3SZ7A 4LEUA 3CVVA 2RD0A 4B94A 3R9AB 3FH5A 4GYOA 4AXHA 4K03A 5M72A 3RO3A 2AXUA 4WNEA 5C2YA 3MV3B 4UQYA 2KATA 3GYZA 2AVPA 4UWKA 3FTWA 2DBAA 4FLBA 3FUJA 3PRZA 2VGXA 2IF4A 2M63A 3BG0B 3GZSA 4MKTA 3FU5A 4KVMA 4N3BA 3RK6A 2DCPA 4KVOA 4AV7A 1MQSA 3ULQA 2AXZA 3FUHA 4BSXA 3FFLA 3CIAA 3UT7A 2UWJG 5BV0A 3CKCA 3ESKA 4BWRA 4L1BA 3S7JA 3D9PA 3D9MA 3P1UA 4XI0A 1HO8A 1JWGA 3NZSA 2VSXE 4A1SA 3PEVB 3PNLB 5JHAA 3ONKA 1EYHA 4I9CA 2J9QA 4AY5A 5J90A 1WY6A 1E8YA 1WAO1 4A3TA 4HFGA 3S7FA 2CHWA 2VGXB 4YVOA 4G2VA 4I2WA 2E0IA 4BT9A 3QWWA 2MHKA 5ARFA 2PM6A 2HM8A 4GB9A 2GW1A 2ONDA 5JJ6A 4D10C 3MKRA 4WNFA 2VJ8A 3FY4A 5CCMA 2HR2A 1IQRA 3JQ0A 3MEKA 5FQ6A 4XI9A 4JHKA 2WB2A 3U3WA 1NZNA 4CCAA 2LSUA 3CHMA 3KD7A 4J8SA 4HVBA 3ASDA 4WUYA 4F7AA 1PY1A 4G11A 4K0RA 1L5JA 3K9IA 3P2BA 3AS8A 3EIQC 5FQ7A 3L16A 2X6FA 4N39A 3CK8A 3SFZA 3S7BA 3DBSA 5G2NA 2R59A 4U0UA 4G23A 4UI9K 4FLHA 1QZ2A 4I17A 3U4TA 3FTZA 1EDUA 3IEGA 2BTDA 4ILHB 5BW8C 4F53A 2HO1A 1NP7A 4UI9J 1E7VA 1FVFA 3D9KA 4GA2A 1EPUA 5FQ4A 3L08A 4IRUA 4I2ZA 2IOLA 5BUZA 3FUDA 3AU4A 2AXVA 3Q47B 1HE8A 1XGWA 1B89A 4GZ3A 1U3CA 2L9BA 2CHXA 3RRUA 4MS6A 3IV0A 4LUNU 3UQ3A 3QNKA 4HS2A 4CEMA 2XRYA 4KMOA 2XEVA 4J8FA 2KCLA 4J0UA 1E8XA 4FC8A 4GZ6A 4QFVA 4FJZA 2CHZA 3ESLA 4XZ4A 4ILGA 3U9WA 3FUNA 3U64A 4HXIA 3SGHA 3CV0A 4O6FA 2L0TB 2X6KA 2OOEA 3HVEB 2WXIA 3TGOA 3CVYA 1VDYA 2WMOA 4ME2A 2OVFA 2UY1B 4IN3B 2IQCA 1HZ4A 3B7UX 3Q15A 5DIZA 3LXUX 3EIJA 2A5UA 1H2VC 1N52A 1IYGA 4I6JA 1XNFA 3QB2A 3NQPA 4GMJA 3UX4A 1HF8A 1HH8A 1UN8A 3MX3A 2GRMA 4CRWA 3MKQB 4URKA 3SBSA 4PS8A 2EQXA 4G24A 5AIJA 3LYAA 3FTUA 2CG2A 2CFUA 4PS3A 1ELWA 3MJWA 1P5QA 4WWPA 4XE0A 3SD5A 2HYZA 2IFUA 3EDTB 4GYYA 4OVVA 4GAAA 1OWOA 1DNPA 3FULA 4Q94A 2YHCA 3VLFA 4JPSA 3RU0A 4HOSA 4JC8A 3TG4A 3EHMA 1QQEA 3PEUB 3LY9A 4GZDA 3QAQA 4UWHA 3R7QA 3ZVVA 1TJCA 2JEKA 4UWFA 2YHEA 2I2OA 4WNDA 2FEZA 4XKBA 3MZLB 3APCA 3FEXA 4FHKA 5KJKA 2FULA 3QWPA 4TV3A 4N2QA 2BUGA 5CMWA 3CHPA 3ZN3A 4B8AA 4AY6A 4W9RA 4UWLA 5AENA 4G25A 3CVPA 4ILIA 3EJNA 3FEYA 3FUKA 3ZYLA 3FU6A 4GPKA 4I9EA 5FWQA 4B0ZA 3ZIMA 3JQ1A 1HFAA 3FH8A 3KEZA 4JEUA 2VTBA 3HYMB 1ELKA 3CHQA 2J07A 3GZ2A 4BTBA 2L6JA 2WXJA 4U0ZA 3D3MA 1E96B 4JA7A 2Y4TA 5FT9A 3UT8A 2Y3AA 3FU3A 2JLBA 2LO6A 3S2AA 4EZKA 3BEEA 1HS6A 2CFZA 4GA0A 3WXXA 4I1MA 4CT4A 2KZTA 2WXFA 5BT1A 1UJJA 2IONA 3KAEA 3FUEA 4DI3A 2KM4A 4NRHB 4LCTA 4KXKB 4CDMA 3AS4A 2R5SA 2C0MA 3CR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L6A A;  1H2U A;  3FEY A;  4B89 A;  1UW4 B;  4C9B B;  2RG8 A;  1PAQ A;  2IOL A;  5ANR A;  4JHK A;  2VSX E;  2ZU6 B;  3D3M A;  3EIJ A;  2IU1 A;  2GGF A;  4JHJ A;  4B8C B;  1H2V C;  1N52 A;  1H6K A;  4LUN U;  2IOS A;  1N54 A;  4CEM A;  2VSO E;  4IUL A;  3EIQ C;  4GMJ A;  2KZT B;  2I2O A;  4GML A;  1H2T C;  4CT4 A;  3FEX A;  2KZT A;  2FUL A;  4CRW A;  3JUI A;  1UG3 A;  2NSZ A;  2ION A;  1HU3 A;  3RK6 A;  4B8A A;  2HM8 A; 
#chains in the Genus database with same CATH topology
 1ZBP A;  4DI4 A;  2X6H A;  3Q78 A;  1Y6I A;  3DWL G;  4ACL A;  3FHE A;  1H6O A;  4A63 B;  2OV8 A;  4G8K A;  1JPL A;  5CBO A;  3I5P A;  2PQN A;  2V8S E;  3ZHE A;  3OTN A;  2XEN A;  2VGY A;  2Y69 E;  1OY3 D;  4HB5 A;  4ANV A;  3QK0 A;  5BXO A;  3ZPJ A;  3UM1 A;  4EZJ A;  1N4P A;  4N3A A;  4GTS A;  4EEC A;  4ANW A;  3QWV A;  4DLO A;  3L22 A;  4APF A;  2VYI A;  5LFA A;  3CHO A;  3LJN A;  2VTB B;  4XIF A;  4BES A;  4CGV A;  1W3B A;  5CEC B;  3RRM B;  3MA5 A;  4ANU A;  3IBE A;  2XGM A;  2FBN A;  2KBX A;  4FHJ A;  5CEA A;  2PM7 A;  1BI7 B;  4J8E A;  1UG3 A;  3UI2 A;  1S64 A;  4XEI G;  4BX8 A;  4YVQ C;  4A3V A;  3EHN A;  2XEE A;  3ML9 A;  5EID A;  2XPZ A;  1N4Q A;  2IU1 A;  2WXH A;  4HI9 A;  5G05 J;  3QJZ A;  1TYQ G;  1FCH A;  3RO2 A;  3AG4 E;  2P9K G;  5CHE E;  1NA0 A;  5EKQ D;  1UOH A;  2YIN A;  3LDZ A;  3T8K A;  4U07 A;  4DRX E;  3CLJ A;  3FTS A;  4U8H A;  4KZC A;  3TWW A;  4U7E B;  2WXM A;  2KZT B;  2PNN A;  4YDW A;  1D9S A;  3HDX A;  2ETC A;  5CCL A;  1E7U A;  4TRQ A;  2Y4U A;  3DSS A;  1JUQ A;  2WQ7 A;  4ABN A;  2CG3 A;  3LVR E;  3URZ A;  5KNH D;  5ENR D;  1JCQ A;  4O1O A;  3AU5 A;  1Z5S C;  4KZ0 A;  2H6F A;  2V4L A;  5G55 A;  2OEW A;  2R03 A;  2QFC A;  3D9O A;  4RG9 A;  3ZNG A;  3VLE A;  3E37 A;  3Q4A B;  3SHF A;  1UN9 A;  3LJ3 A;  4PH4 B;  3TWU A;  3TXM A;  2C2L A;  4ZFH A;  4YND A;  1OXJ A;  3HXB A;  3EHR A;  1Z3Y A;  3V30 A;  2YNQ A;  4AJW A;  2A5E A;  1JWF A;  3JUE A;  3PNT B;  5EIB E;  2OEV A;  4JEH A;  5G04 C;  3S7D A;  3U66 A;  4N5C A;  1GW6 A;  2XHE A;  3OAW A;  3BUA A;  2EIK E;  4YDE A;  1TN7 A;  2PZI A;  1Y8M A;  2NXP A;  4CYM D;  4E6H A;  4ATG A;  1N4R A;  4BSZ B;  3MKQ A;  3HXF A;  4HOQ A;  4U8Y D;  5AJD A;  2KC7 A;  3CK7 A;  3D9H A;  4JXT A;  5ANR A;  3T5V A;  3SBT B;  3I4R B;  4KBQ A;  2WXG A;  3UT4 A;  2DIW A;  3FU0 A;  4FU3 A;  2F0Y A;  5CBN A;  4DX2 A;  4HNA D;  1ELR A;  4NUR A;  5AJL A;  2ZIS A;  3FWV A;  3CGH A;  3E4B A;  3CHS A;  3CKB A;  1UW4 B;  4L7T A;  4WNG A;  1O1R A;  4EQF A;  3R9A B;  3RO3 A;  4WNE A;  2KAT A;  2AVP A;  2DBA A;  3BG0 B;  4N3B A;  5EYL A;  1SA5 A;  1MQS A;  3FUH A;  3UT7 A;  2UWJ G;  4BWR A;  5CRV A;  2F8X K;  3P1U A;  3ULE G;  2VSX E;  3PNL B;  5J90 A;  4AY5 A;  4BET A;  1E8Y A;  4A3T A;  4HFG A;  3KSQ A;  3S7F A;  2VGX B;  2RFM A;  4BT9 A;  1O1S A;  3MKR A;  4WNF A;  3FY4 A;  5CCM A;  5AAO A;  1NZN A;  5B1A E;  4HVB A;  3ASD A;  4K0R A;  3AS8 A;  3SFZ A;  3DBS A;  4K5C A;  4G23 A;  3F6Q A;  2R02 A;  4I17 A;  3IEG A;  3U4T A;  4ILH B;  5BW8 C;  3DSU A;  3ISM C;  4UI9 J;  5BUZ A;  2AXV A;  4B93 B;  1XGW A;  4HRM B;  2CHX A;  3RRU A;  1KZP A;  4MS6 A;  4LUN U;  4HS2 A;  1O5M A;  4KMO A;  4Z68 A;  4OAU C;  4J8F A;  1S63 A;  1OCO E;  3E32 A;  2EIN E;  2CHZ A;  1SA4 A;  3U9W A;  4HXI A;  3RAU A;  3TGO A;  5D2M C;  2WXI A;  3Q15 A;  4LG6 A;  5DIZ A;  1H2V C;  4TXQ A;  3MX3 A;  4URK A;  2Y1L E;  3NOC D;  5CED B;  4G24 A;  3LYA A;  3FTU A;  4WWP A;  3EDT B;  3J5P A;  4GAA A;  1OWO A;  1MX2 A;  3FUL A;  4JPS A;  4HOS A;  1QQE A;  4GZD A;  3R7Q A;  1WDY A;  2OCC E;  2GRP B;  3WG7 E;  2YHE A;  2I2O A;  3HG0 D;  4FHK A;  4AY6 A;  4QQI A;  3CVP A;  1ELK A;  1RW2 A;  3GZ2 A;  5JMN D;  3TWT A;  3D3M A;  3EUV A;  4JA7 A;  4TUM A;  3SFY A;  3FU3 A;  3NBN B;  2LO6 A;  3WXX A;  2GRO B;  2WXF A;  2ION A;  4DI3 A;  4NRH B;  4LCT A;  4UWG A;  4C0E A;  3JYS A;  4GTR A;  4HRN A;  1OWN A;  4I1A A;  2F37 A;  3MCX A;  3N71 A;  2WXQ A;  3ZXS A;  2ETA A;  4DUI A;  5FTP A;  1Q2Z A;  2ZU6 B;  3SI5 A;  1U3D A;  2XEH A;  3ENE A;  1N54 A;  2LNI A;  3D9L A;  3HVE A;  3JUI A;  2X6I A;  4NQ0 A;  1A17 A;  2OVB A;  3CVX A;  3AJI A;  2WXK A;  1YA0 A;  4UUC A;  4DX6 D;  4HLE A;  1N11 A;  2V0P A;  2VQ2 A;  2Q7F A;  2VSN A;  4R7L A;  5B1B E;  4C9B B;  1Z3X A;  3Q73 A;  2HE0 A;  3SNX A;  5JJT A;  4EPZ A;  2YQ8 A;  3DSV A;  1OWM A;  5LCW C;  4AVX A;  4AIF A;  2XGS A;  1KLX A;  4I1O B;  5EYP F;  3Q5M A;  3RSE G;  3ZGQ A;  3EHQ A;  1LD7 A;  2ZGD A;  3CST A;  5HRY A;  4JA9 A;  5A6C A;  5J08 A;  2I6H A;  2V5F A;  5AQA A;  1OCZ E;  2ETB A;  2WXR A;  4RG6 A;  1TNZ A;  2R05 A;  2BKK B;  3GZ1 A;  4AM9 A;  3IKO B;  1MZC A;  5HKP A;  4GZ5 A;  4RSY A;  3CQC B;  3ASF A;  3CSF A;  2R17 C;  5G04 J;  3UMV A;  3ZW3 A;  3G2V A;  2P9I G;  4PS7 A;  1H19 A;  3PZ3 A;  1YMP A;  3TWS A;  1X81 A;  5FJY A;  3APD A;  3CHR A;  5FZR A;  5LP0 A;  3PRE A;  2VGE A;  1TNY A;  2DYS E;  3CVQ A;  1TJF A;  3EU5 A;  3C3O A;  5CMY A;  4JB8 P;  2DVW A;  1TEZ A;  4L23 A;  1INZ A;  3RKV A;  4N2S A;  1HXI A;  4K5A B;  5D0O D;  4LNB A;  5LX8 A;  1TN6 A;  1RZ4 A;  5A23 A;  3GW4 A;  1IXV A;  4TXR A;  1K1B A;  4JHR A;  2I9C A;  3DST A;  4A55 A;  3PS6 A;  1SQM A;  2P9N G;  3UKU G;  3FTX A;  4MBG A;  4EZL A;  1S0P A;  4OVU A;  4GTT A;  2VSO E;  2X6J A;  3D9N A;  1H2T C;  3PVL A;  4FP7 A;  4UQX A;  1ZB1 A;  2ILR A;  3ML8 A;  1SVX A;  3IXE A;  5A7D B;  5ENN A;  3APF A;  1BPO A;  3AS5 A;  4KT6 B;  3NF1 A;  4LSZ E;  2RG8 A;  4H7X A;  5DBK A;  3LVQ E;  2AW6 A;  5FQ8 A;  3VLD A;  3ABL E;  5EIL A;  2I1K A;  3B7B A;  4BT8 A;  3IHV A;  4TUU A;  3HHM A;  4J6I A;  4C48 B;  4PUC A;  3FUI A;  4CDR A;  4GMR A;  2FO7 A;  3E30 A;  4MLP A;  4Q96 A;  2X3M A;  5BV1 A;  3QAR A;  3RRN B;  5CER B;  3V31 A;  4C0M A;  4DK5 A;  2X38 A;  4APO A;  5KJM A;  1KT1 A;  1OUV A;  1EF1 C;  1U2V G;  4AP2 A;  2XPY A;  5FIO A;  4LEU A;  2RD0 A;  2B6C A;  2LXM A;  4B94 A;  3FH5 A;  5M72 A;  4AXH A;  1KZO A;  2AXU A;  5ENQ D;  4DX5 D;  4LNU D;  3FUJ A;  2VGX A;  3RK6 A;  4KVM A;  4RLY A;  4J8Y A;  2DCP A;  4BSX A;  3FFL A;  3BU8 A;  4O1P A;  4L1B A;  1HO8 A;  1MYO A;  3PEV B;  5JHA A;  1EYH A;  1WAO 1;  3ABK E;  4YVO A;  2P9L G;  4U8V D;  4TXP A;  1IQR A;  2WB2 A;  4JHK A;  4CCA A;  4J8S A;  3ASO E;  4WUY A;  4G11 A;  1L5J A;  3K9I A;  5FQ7 A;  3L16 A;  3KEA A;  3CK8 A;  1QZ2 A;  3FTZ A;  1EDU A;  2HO1 A;  1E7V A;  3D9K A;  1EPU A;  3V2O A;  3L08 A;  4I2Z A;  2IOL A;  2L9B A;  1LTX A;  3TWQ A;  3IV0 A;  2KCL A;  1G3N B;  4GZ6 A;  2P9P G;  4FJZ A;  4ILG A;  3U64 A;  3ZXP A;  4F6R D;  3W9G A;  2DWZ A;  2L0T B;  2OOE A;  4ME2 A;  1MX4 A;  2OVF A;  4IN3 B;  4M7C A;  2GRR B;  3LXU X;  1K1A A;  2A5U A;  1XNF A;  3QB2 A;  2GRM A;  2L6B A;  3SBS A;  3UKR G;  2JAB A;  5AIJ A;  3MJW A;  1P5Q A;  3UIP C;  4OVV A;  2YHC A;  3VLF A;  4JC8 A;  4K5B A;  1AP7 A;  2JEK A;  4G8L A;  4UWF A;  4N5Q A;  4XKB A;  3APC A;  3QWP A;  3CHP A;  1MJ0 A;  4B8A A;  4UWL A;  4ILI A;  3EJN A;  3FUK A;  3FU6 A;  4JEU A;  2DYR E;  3HYM B;  3CHQ A;  5H7P A;  3DPY A;  2L6J A;  2WXJ A;  1O1T A;  3UT8 A;  2Y4T A;  5FT9 A;  4GTQ A;  2JLB A;  3BEE A;  3UM3 A;  2CFZ A;  1H6P A;  1BLX B;  3UM0 A;  4ANX A;  3Q49 B;  3ESL A;  3CR3 A;  4I6E A;  4ACK A;  4N3C A;  4F1S A;  4Q69 A;  2ZXW E;  4Y6W A;  3OXF A;  3HXC A;  1UJK A;  3LPZ A;  4DPR A;  3LCA A;  3W9F A;  2WXN A;  1BU9 A;  5B3S E;  2FI7 A;  1DVP A;  5HI7 A;  3HIZ A;  3LS8 A;  5AQB A;  4BFR A;  3VTY A;  3TAX A;  2EIJ E;  4U04 A;  5BPP A;  3CK9 A;  5LOZ A;  4GZC A;  3TG5 A;  5EDS A;  2V4H C;  3ULY A;  3FUF A;  2ZGG A;  2DZO A;  3QOU A;  3RIB A;  5HQ8 A;  5D0Q D;  3B13 A;  3R9M A;  3QKY A;  3PUJ A;  2XZD G;  2GGF A;  1OCC E;  5KBA A;  2Y0B G;  2LUH A;  5KJL A;  2QC9 A;  2WVI A;  1LF8 A;  4HQD A;  4BER A;  2MOW A;  4O60 A;  2KCK A;  2J08 A;  3EU9 A;  2QYU A;  3ZYM A;  4OYS A;  1NA3 A;  3Q7F A;  5EX3 A;  4ATZ D;  4L2Y A;  2PQR A;  2QZA A;  3KSL A;  3Q79 A;  3UIO C;  4XKC A;  3FP3 A;  1Z6T A;  1PC2 A;  3FTV A;  4FJY A;  1N95 A;  2KCV A;  2WM9 A;  3E33 A;  2XS1 A;  1TNB A;  3MGB A;  5T3R A;  1SZA A;  5JJ7 A;  4AOF A;  2WQH A;  2P9S G;  4IUL A;  1H0A A;  3CVU A;  4FAD A;  3HRA A;  3ABM E;  3PZ2 A;  3C5R A;  4FA6 A;  5ANL A;  4Y6C A;  2IEJ A;  3X2Q E;  3FTY A;  1HG5 A;  3G2U A;  4E85 A;  4UI9 C;  1YCS B;  3ONL A;  4G1T A;  3LEW A;  1QYM A;  2NSZ A;  4NAC A;  5JHB A;  3DSW A;  4DJA A;  2WMN A;  4G26 A;  2FO1 E;  1K3Z D;  2XRZ A;  3OXG A;  2IJG X;  3G2W A;  3FUM A;  4UQZ A;  2A4Z A;  4MRU A;  4IYP A;  3B7R L;  5ENP D;  3FH7 A;  3AAA C;  2GRN B;  4HBD A;  3NZU A;  2P9U G;  2WXL A;  1H2U A;  5T8I A;  3DSX A;  2AWI A;  3C98 A;  3ZU7 B;  4JD2 G;  3BG1 B;  4M3O A;  3L17 A;  3ZYK A;  3CQG B;  4RVB A;  5AYW D;  1N0R A;  3SO8 A;  2EIL E;  5ENO D;  4U0S A;  2V5Q C;  1HU3 A;  3MV2 B;  1E8W A;  5KCM A;  3G2T A;  1QNF A;  3ZYQ A;  2PL2 A;  2J09 A;  3DEP A;  2LSV A;  5FZQ A;  3TXN A;  2IY0 C;  1IHG A;  4HOR A;  2WQ6 A;  3ZEF A;  3PH0 C;  5KJN A;  5FZS A;  3FDH A;  1D8D A;  3PE3 A;  4GCO A;  3DRA A;  1IKN D;  2E2E A;  5AN8 A;  2H6I A;  4ZHB A;  1LD8 A;  4K03 A;  5C2Y A;  3DXM G;  4UQY A;  3FU5 A;  4AV7 A;  1N9A A;  3CKC A;  3ESK A;  5AAR A;  4XI0 A;  3NZS A;  5KNG A;  2MYO A;  2J9Q A;  1WY6 A;  4HI8 A;  4I2W A;  2E0I A;  3QWW A;  5ARF A;  2NYJ A;  3MEK A;  5FQ6 A;  4XI9 A;  3U3W A;  3CHM A;  4F7A A;  1PY1 A;  3P2B A;  5FIN A;  2KXP C;  2X6F A;  3S7B A;  5G2N A;  2R59 A;  1D8E A;  4UI9 K;  4FLH A;  4F53 A;  1DC2 A;  1FVF A;  2QYJ A;  4GA2 A;  4RQI A;  3PZ4 A;  5ENT D;  3Q47 B;  4GZ3 A;  1U3C A;  3DEO A;  4CEM A;  2XRY A;  2XEV A;  3Q7A A;  4FC8 A;  4QFV A;  3TWX A;  2X6K A;  3CVY A;  2WMO A;  4U95 D;  2UY1 B;  1HZ4 A;  3B7U X;  3EIJ A;  3ZUV B;  5KWD A;  4OAV B;  3NQP A;  3UX4 A;  1HH8 A;  1UN8 A;  3MKQ B;  2EQX A;  2CG2 A;  4PS3 A;  1ELW A;  4XE0 A;  3SD5 A;  2HYZ A;  4GYY A;  3RU0 A;  3TG4 A;  4HLL A;  3PEU B;  4UWH A;  3ZVV A;  1V54 E;  4EHM A;  3FEX A;  5KJK A;  2FUL A;  2DZN A;  4TV3 A;  4N2Q A;  2BUG A;  3UXG A;  4W9R A;  4G25 A;  3FEY A;  4B0Z A;  3JQ1 A;  3KEZ A;  3NOG D;  2J07 A;  4U0Z A;  3HXD A;  1NL4 A;  1NI1 A;  3S2A A;  4EZK A;  3JXI A;  1HS6 A;  4GA0 A;  4I1M A;  5BT1 A;  1OT8 A;  1UJJ A;  3BQO A;  3V2X A;  3FUE A;  5HS0 A;  4KXK B;  4CDM A;  3AS4 A;  4EBA A;  3T8M A;  1A5E A;  4JZY A;  5T4Y A;  3ASN E;  4B89 A;  3OXL A;  1TNO A;  4P29 A;  2LAH A;  5BXU A;  4LER A;  4GU5 A;  3CVW A;  1E8Z A;  3AG3 E;  1SW6 A;  2XQ0 A;  4HRL A;  3Q9N C;  2H6G A;  2WXO A;  3L6A A;  4HOT A;  3CVL A;  1ZU2 A;  3PZ1 A;  1WM5 A;  3L82 A;  2EIM E;  3O48 A;  3D9I A;  3O4Z A;  3D9J A;  4J8D A;  1WG0 A;  4YDY A;  5ITZ F;  3KS2 A;  2FF4 A;  4KYO B;  4AEZ C;  1K8K G;  4DX7 D;  1MHQ A;  4BTA A;  1DCQ A;  2QY7 A;  5CRU A;  4CGW A;  2UY1 A;  2LAI A;  4U63 A;  1FPP A;  2XPI A;  2GRL A;  4HOU A;  2XZT G;  4F1P A;  4GYW A;  1KT0 A;  1IQU A;  3RJV A;  2BKG A;  5AQ7 A;  1YYH A;  5LCW J;  2I1J A;  3ZFW A;  4J7W A;  1HX8 A;  4L2L A;  5BNW A;  1V55 E;  4JHJ A;  4WAF A;  2IOS A;  3MYV A;  1OCR E;  3NB2 A;  4JVS A;  3PUK A;  4GML A;  3AG2 E;  4GPM A;  4FUL A;  4I43 A;  4CDN A;  2P58 C;  3T5X A;  1JCR A;  2IO2 C;  2NC9 A;  1KPS B;  3L54 A;  3VTX A;  3PZD A;  1NFI E;  4WWO A;  4DX1 A;  3TJP A;  4XX5 A;  4DLQ A;  4JL0 A;  5ARG A;  4A1G A;  4CZ2 D;  1H6K A;  3JCK C;  3PE4 A;  1DCE A;  3L13 A;  4EBA G;  3UPV A;  3R7R A;  4GCN A;  1SZ9 A;  1N0Q A;  3LY8 A;  5EX0 A;  4I6G A;  1TR4 A;  4V3I A;  3C3R A;  3NAW A;  3QC1 A;  3TL5 A;  5E76 A;  2IO3 C;  1BD8 A;  2J4D A;  2R2L A;  4BX9 A;  1QBQ A;  5G05 C;  3CEQ A;  4JW1 A;  5C1D A;  2J4B A;  4LNG A;  4PDX A;  2XCC A;  3QDN A;  2ZIR A;  3ASG A;  3LY7 A;  2GRQ B;  3B7S A;  3B7T A;  1HG2 A;  1E90 A;  3Q75 A;  3CVN A;  3IHY A;  2J49 A;  4BEP A;  3ASH A;  4WWN A;  4X8Q A;  2F8Y A;  2WPV A;  3ZHE B;  2J8S D;  4F3V A;  2XCB A;  2L0I A;  3TWR A;  2BF0 X;  2XS8 A;  4GA1 A;  1MX6 A;  1PAQ A;  2VSY A;  1FT2 A;  4CT0 A;  1JCS A;  4GTM A;  4B8C B;  4U96 D;  3JXJ A;  4H7Y A;  2WXP A;  3ZRH A;  3SY2 A;  3I3N A;  3TWV A;  4BY6 A;  1X5B A;  1OWP A;  2MRI A;  1FVH A;  3E34 A;  3LKU A;  3G2S A;  3B95 A;  5ENS D;  2RKK A;  3PDN A;  3I4G A;  2XGO A;  5JA4 D;  5E75 A;  4YDO A;  4LRZ A;  1OWL A;  3UUX A;  3DPD A;  3SQV A;  3L9T A;  2C0L A;  1N94 A;  3SF4 A;  3SZ7 A;  3CVV A;  3HXE A;  4GYO A;  3MV3 B;  4L9P A;  3GYZ A;  4UWK A;  3FTW A;  4FLB A;  3PRZ A;  2IF4 A;  2M63 A;  3GZS A;  4MKT A;  4KVO A;  2AXZ A;  2BED A;  3UIN C;  3CIA A;  5BV0 A;  3S7J A;  3D9P A;  3D9M A;  4GTP A;  1JWG A;  4A1S A;  3ONK A;  4I9C A;  2B0O E;  2CHW A;  4G2V A;  3T9K A;  2MHK A;  1BI8 B;  2HM8 A;  2PM6 A;  2GW1 A;  2OND A;  4GB9 A;  5JJ6 A;  4D10 C;  4GTO A;  2VJ8 A;  5EN5 D;  3Q9U C;  2HR2 A;  3DXK G;  3UTM A;  3JQ0 A;  5IY5 E;  2LSU A;  3KD7 A;  3J5Q B;  3EIQ C;  1TNU A;  4N39 A;  2LXL A;  4U0U A;  2BTD A;  1NP7 A;  1IHB A;  5FQ4 A;  4IRU A;  5D66 A;  3FUD A;  3AU4 A;  1HE8 A;  1B89 A;  3SFX A;  1TN8 A;  3UQ3 A;  3QNK A;  3UM2 A;  4J0U A;  1E8X A;  4XZ4 A;  3FUN A;  3SGH A;  3CV0 A;  4O6F A;  3HVE B;  4NIK A;  1VDY A;  3ZKJ A;  2IQC A;  3V79 K;  1N52 A;  1IYG A;  4I6J A;  2AJA A;  5AQ9 A;  4GMJ A;  1HF8 A;  2P2C P;  4CRW A;  4PS8 A;  1FT1 A;  2H6H A;  1AWC B;  2CFU A;  4GTV A;  2IFU A;  2RFA A;  1DNP A;  4Q94 A;  3EHM A;  3LY9 A;  3QAQ A;  3C72 A;  1TJC A;  4WND A;  2FEZ A;  3C3Q A;  3MZL B;  5CMW A;  3ZN3 A;  5AEN A;  3ZYL A;  1S70 B;  4GPK A;  4I9E A;  5FWQ A;  3ZIM A;  1HFA A;  3FH8 A;  3AG1 E;  2VTB A;  1N4S A;  4BTB A;  1E96 B;  2Y3A A;  4CT4 A;  2KZT A;  3KAE A;  2KM4 A;  2R5S A;  2C0M A;  3ULQ A; 
#chains in the Genus database with same CATH homology
 4I6E A;  4ACK A;  4UWG A;  3T8M A;  4EBA A;  1ZBP A;  4JZY A;  3JYS A;  4N3C A;  4C0E A;  5T4Y A;  4F1S A;  1OWN A;  4B89 A;  4DI4 A;  3OXL A;  4I1A A;  2X6H A;  3MCX A;  4Q69 A;  3N71 A;  2WXQ A;  3ZXS A;  1Y6I A;  4ACL A;  4Y6W A;  4P29 A;  2LAH A;  3FHE A;  5FTP A;  4LER A;  3OXF A;  2ZU6 B;  4GU5 A;  3SI5 A;  1UJK A;  1U3D A;  3LPZ A;  4DPR A;  3CVW A;  1E8Z A;  2OV8 A;  3ENE A;  3LCA A;  1N54 A;  2WXN A;  2LNI A;  3D9L A;  3HVE A;  1JPL A;  2FI7 A;  1DVP A;  3I5P A;  2PQN A;  2V8S E;  3ZHE A;  3JUI A;  2X6I A;  5HI7 A;  2XQ0 A;  3HIZ A;  3OTN A;  3LS8 A;  4NQ0 A;  1A17 A;  2OVB A;  2VGY A;  4BFR A;  3CVX A;  2WXO A;  3L6A A;  4HOT A;  3VTY A;  4ANV A;  3QK0 A;  3CVL A;  3TAX A;  3ZPJ A;  1ZU2 A;  4U04 A;  2WXK A;  4EZJ A;  5BPP A;  3CK9 A;  5LOZ A;  1WM5 A;  4GZC A;  4N3A A;  1YA0 A;  4EEC A;  3TG5 A;  4ANW A;  3O4Z A;  3O48 A;  3QWV A;  3D9I A;  3L22 A;  4APF A;  4DLO A;  3D9J A;  4J8D A;  5EDS A;  2VYI A;  5LFA A;  3CHO A;  2VTB B;  3KS2 A;  2FF4 A;  4KYO B;  4HLE A;  4AEZ C;  4XIF A;  3FUF A;  2V0P A;  4CGV A;  1W3B A;  3QOU A;  3RIB A;  5HQ8 A;  2VQ2 A;  2Q7F A;  1MHQ A;  3RRM B;  4BTA A;  2VSN A;  2QY7 A;  5D0Q D;  4R7L A;  3B13 A;  4C9B B;  3QKY A;  3MA5 A;  4CGW A;  2UY1 A;  1Z3X A;  4ANU A;  3IBE A;  2LAI A;  2XGM A;  3PUJ A;  2FBN A;  4FHJ A;  2GGF A;  4U63 A;  2XPI A;  2GRL A;  4HOU A;  3SNX A;  5JJT A;  5KJL A;  4GYW A;  4EPZ A;  2YQ8 A;  2PM7 A;  1KT0 A;  2WVI A;  1IQU A;  1OWM A;  1LF8 A;  3RJV A;  4J8E A;  1UG3 A;  5LCW C;  2MOW A;  3Q49 B;  2KCK A;  4BX8 A;  4YVQ C;  2J08 A;  4A3V A;  4AVX A;  4AIF A;  2XGS A;  3EHN A;  1KLX A;  5LCW J;  4I1O B;  3ZYM A;  4OYS A;  2I1J A;  3ZFW A;  1NA3 A;  5EX3 A;  3ML9 A;  3Q5M A;  3ZGQ A;  1HX8 A;  2XPZ A;  2PQR A;  4L2L A;  4L2Y A;  5BNW A;  2IU1 A;  4JHJ A;  4WAF A;  3CST A;  4JA9 A;  5A6C A;  2WXH A;  5J08 A;  2IOS A;  5G05 J;  2I6H A;  2V5F A;  3MYV A;  4XKC A;  3QJZ A;  4JVS A;  3PUK A;  4GML A;  3FP3 A;  1FCH A;  1Z6T A;  3RO2 A;  2WXR A;  4RG6 A;  1PC2 A;  3FTV A;  4FUL A;  5CHE E;  1NA0 A;  5EKQ D;  4FJY A;  4I43 A;  4CDN A;  2P58 C;  2YIN A;  3GZ1 A;  3T5X A;  3LDZ A;  3L54 A;  4AM9 A;  2NC9 A;  3IKO B;  2KCV A;  2WM9 A;  4GZ5 A;  4RSY A;  3CQC B;  4U07 A;  3VTX A;  3PZD A;  3ASF A;  4WWO A;  3CLJ A;  3MGB A;  3TJP A;  3CSF A;  3FTS A;  4XX5 A;  5T3R A;  2R17 C;  5G04 J;  3UMV A;  3ZW3 A;  4DLQ A;  4JL0 A;  1SZA A;  5ARG A;  3G2V A;  4A1G A;  1H6K A;  4PS7 A;  1H19 A;  4U8H A;  4KZC A;  4AOF A;  3JCK C;  5JJ7 A;  2WQH A;  2WXM A;  3PE4 A;  4IUL A;  1H0A A;  3CVU A;  5FJY A;  2KZT B;  4FAD A;  3APD A;  3CHR A;  3HDX A;  3L13 A;  5FZR A;  5LP0 A;  5CCL A;  3PRE A;  4EBA G;  4FA6 A;  1E7U A;  5ANL A;  4Y6C A;  3R7R A;  3UPV A;  4GCN A;  1SZ9 A;  4TRQ A;  3CVQ A;  2Y4U A;  3FTY A;  1JUQ A;  1HG5 A;  1TJF A;  2WQ7 A;  3LY8 A;  4ABN A;  5CMY A;  5EX0 A;  2CG3 A;  1TEZ A;  4L23 A;  3LVR E;  3G2U A;  3URZ A;  4I6G A;  4E85 A;  1INZ A;  4UI9 C;  4V3I A;  3RKV A;  4N2S A;  1HXI A;  3AU5 A;  4KZ0 A;  3QC1 A;  3TL5 A;  3ONL A;  4G1T A;  3LEW A;  5D0O D;  5E76 A;  5LX8 A;  2V4L A;  5G55 A;  2J4D A;  5A23 A;  3GW4 A;  2NSZ A;  4BX9 A;  4JHR A;  4NAC A;  2I9C A;  2QFC A;  5G05 C;  4A55 A;  5JHB A;  3CEQ A;  3D9O A;  4RG9 A;  4JW1 A;  4DJA A;  3PS6 A;  5C1D A;  2WMN A;  2J4B A;  3VLE A;  1SQM A;  4PDX A;  2XCC A;  4G26 A;  3Q4A B;  3FTX A;  3SHF A;  3QDN A;  3LY7 A;  3ASG A;  2XRZ A;  4EZL A;  1S0P A;  3OXG A;  3B7S A;  4OVU A;  3B7T A;  1UN9 A;  1HG2 A;  3LJ3 A;  2IJG X;  1E90 A;  4PH4 B;  3CVN A;  3IHY A;  3TXM A;  2C2L A;  3G2W A;  2J49 A;  3FUM A;  2VSO E;  4ANX A;  4YND A;  3D9N A;  2X6J A;  3ASH A;  4WWN A;  4UQZ A;  1H2T C;  3PVL A;  2WPV A;  2A4Z A;  4FP7 A;  4MRU A;  4UQX A;  3ZHE B;  4IYP A;  4F3V A;  2ILR A;  3ML8 A;  3B7R L;  1Z3Y A;  3FH7 A;  5A7D B;  5ENN A;  3APF A;  2XCB A;  3NZU A;  2L0I A;  1BPO A;  2WXL A;  2YNQ A;  1H2U A;  3AS5 A;  2BF0 X;  5T8I A;  4AJW A;  1JWF A;  4KT6 B;  3NF1 A;  4GA1 A;  3PNT B;  2RG8 A;  4H7X A;  1PAQ A;  2VSY A;  2AWI A;  3C98 A;  4CT0 A;  5DBK A;  4JEH A;  3LVQ E;  5G04 C;  3S7D A;  3U66 A;  2AW6 A;  4N5C A;  1GW6 A;  2XHE A;  3OAW A;  3BG1 B;  4M3O A;  3L17 A;  5FQ8 A;  4B8C B;  3VLD A;  4H7Y A;  2PZI A;  2WXP A;  1Y8M A;  3CQG B;  3ZRH A;  4RVB A;  2NXP A;  3I3N A;  5AYW D;  3ZYK A;  4BY6 A;  1X5B A;  2I1K A;  4U0S A;  4BT8 A;  1HU3 A;  3IHV A;  3MV2 B;  4E6H A;  1E8W A;  4ATG A;  5KCM A;  4TUU A;  3G2T A;  3MKQ A;  1OWP A;  3HHM A;  1QNF A;  2MRI A;  4J6I A;  1FVH A;  3ZYQ A;  4HOQ A;  2PL2 A;  2J09 A;  3LKU A;  2LSV A;  5FZQ A;  3TXN A;  5AJD A;  2KC7 A;  3G2S A;  4PUC A;  3CK7 A;  3FUI A;  4JXT A;  5ANR A;  4CDR A;  3T5V A;  3SBT B;  3I4R B;  4KBQ A;  1IHG A;  2WXG A;  3UT4 A;  2FO7 A;  4MLP A;  4Q96 A;  3PDN A;  2DIW A;  4HOR A;  3FU0 A;  3I4G A;  2X3M A;  4FU3 A;  5BV1 A;  3QAR A;  2WQ6 A;  3RRN B;  3ZEF A;  1ELR A;  4NUR A;  5AJL A;  4C0M A;  3PH0 C;  4DK5 A;  2X38 A;  3FWV A;  3CGH A;  3E4B A;  4APO A;  5KJM A;  3CHS A;  5KJN A;  2XGO A;  5FZS A;  3FDH A;  1KT1 A;  3PE3 A;  5E75 A;  1OUV A;  3CKB A;  1UW4 B;  4GCO A;  1EF1 C;  1OWL A;  4L7T A;  4LRZ A;  3UUX A;  3DPD A;  4WNG A;  4AP2 A;  2XPY A;  2E2E A;  4EQF A;  2C0L A;  3SF4 A;  3SZ7 A;  4LEU A;  3CVV A;  2RD0 A;  4B94 A;  3R9A B;  3FH5 A;  4GYO A;  4AXH A;  4K03 A;  5M72 A;  3RO3 A;  2AXU A;  4WNE A;  5C2Y A;  3MV3 B;  4UQY A;  2KAT A;  3GYZ A;  2AVP A;  4UWK A;  3FTW A;  2DBA A;  4FLB A;  3FUJ A;  3PRZ A;  2VGX A;  2IF4 A;  2M63 A;  3BG0 B;  3GZS A;  4MKT A;  3FU5 A;  4KVM A;  4N3B A;  3RK6 A;  2DCP A;  4KVO A;  4AV7 A;  1MQS A;  3ULQ A;  2AXZ A;  3FUH A;  4BSX A;  3FFL A;  3CIA A;  3UT7 A;  2UWJ G;  5BV0 A;  3CKC A;  3ESK A;  4BWR A;  4L1B A;  3S7J A;  3D9P A;  3D9M A;  3P1U A;  4XI0 A;  1HO8 A;  1JWG A;  3NZS A;  2VSX E;  4A1S A;  3PEV B;  3PNL B;  5JHA A;  3ONK A;  1EYH A;  4I9C A;  2J9Q A;  4AY5 A;  5J90 A;  1WY6 A;  1E8Y A;  1WAO 1;  4A3T A;  4HFG A;  3S7F A;  2CHW A;  2VGX B;  4YVO A;  4G2V A;  4I2W A;  2E0I A;  4BT9 A;  3QWW A;  2MHK A;  5ARF A;  2PM6 A;  2HM8 A;  4GB9 A;  2GW1 A;  2OND A;  5JJ6 A;  4D10 C;  3MKR A;  4WNF A;  2VJ8 A;  3FY4 A;  5CCM A;  2HR2 A;  1IQR A;  3JQ0 A;  3MEK A;  5FQ6 A;  4XI9 A;  4JHK A;  2WB2 A;  3U3W A;  1NZN A;  4CCA A;  2LSU A;  3CHM A;  3KD7 A;  4J8S A;  4HVB A;  3ASD A;  4WUY A;  4F7A A;  1PY1 A;  4G11 A;  4K0R A;  1L5J A;  3K9I A;  3P2B A;  3AS8 A;  3EIQ C;  5FQ7 A;  3L16 A;  2X6F A;  4N39 A;  3CK8 A;  3SFZ A;  3S7B A;  3DBS A;  5G2N A;  2R59 A;  4U0U A;  4G23 A;  4UI9 K;  4FLH A;  1QZ2 A;  4I17 A;  3U4T A;  3FTZ A;  1EDU A;  3IEG A;  2BTD A;  4ILH B;  5BW8 C;  4F53 A;  2HO1 A;  1NP7 A;  4UI9 J;  1E7V A;  1FVF A;  3D9K A;  4GA2 A;  1EPU A;  5FQ4 A;  3L08 A;  4IRU A;  4I2Z A;  2IOL A;  5BUZ A;  3FUD A;  3AU4 A;  2AXV A;  3Q47 B;  1HE8 A;  1XGW A;  1B89 A;  4GZ3 A;  1U3C A;  2L9B A;  2CHX A;  3RRU A;  4MS6 A;  3IV0 A;  4LUN U;  3UQ3 A;  3QNK A;  4HS2 A;  4CEM A;  2XRY A;  4KMO A;  2XEV A;  4J8F A;  2KCL A;  4J0U A;  1E8X A;  4FC8 A;  4GZ6 A;  4QFV A;  4FJZ A;  2CHZ A;  3ESL A;  4XZ4 A;  4ILG A;  3U9W A;  3FUN A;  3U64 A;  4HXI A;  3SGH A;  3CV0 A;  4O6F A;  2L0T B;  2X6K A;  2OOE A;  3HVE B;  2WXI A;  3TGO A;  3CVY A;  1VDY A;  2WMO A;  4ME2 A;  2OVF A;  2UY1 B;  4IN3 B;  2IQC A;  1HZ4 A;  3B7U X;  3Q15 A;  5DIZ A;  3LXU X;  3EIJ A;  2A5U A;  1H2V C;  1N52 A;  1IYG A;  4I6J A;  1XNF A;  3QB2 A;  3NQP A;  4GMJ A;  3UX4 A;  1HF8 A;  1HH8 A;  1UN8 A;  3MX3 A;  2GRM A;  4CRW A;  3MKQ B;  4URK A;  3SBS A;  4PS8 A;  2EQX A;  4G24 A;  5AIJ A;  3LYA A;  3FTU A;  2CG2 A;  2CFU A;  4PS3 A;  1ELW A;  3MJW A;  1P5Q A;  4WWP A;  4XE0 A;  3SD5 A;  2HYZ A;  2IFU A;  3EDT B;  4GYY A;  4OVV A;  4GAA A;  1OWO A;  1DNP A;  3FUL A;  4Q94 A;  2YHC A;  3VLF A;  4JPS A;  3RU0 A;  4HOS A;  4JC8 A;  3TG4 A;  3EHM A;  1QQE A;  3PEU B;  3LY9 A;  4GZD A;  3QAQ A;  4UWH A;  3R7Q A;  3ZVV A;  1TJC A;  2JEK A;  4UWF A;  2YHE A;  2I2O A;  4WND A;  2FEZ A;  4XKB A;  3MZL B;  3APC A;  3FEX A;  4FHK A;  5KJK A;  2FUL A;  3QWP A;  4TV3 A;  4N2Q A;  2BUG A;  5CMW A;  3CHP A;  3ZN3 A;  4B8A A;  4AY6 A;  4W9R A;  4UWL A;  5AEN A;  4G25 A;  3CVP A;  4ILI A;  3EJN A;  3FEY A;  3FUK A;  3ZYL A;  3FU6 A;  4GPK A;  4I9E A;  5FWQ A;  4B0Z A;  3ZIM A;  3JQ1 A;  1HFA A;  3FH8 A;  3KEZ A;  4JEU A;  2VTB A;  3HYM B;  1ELK A;  3CHQ A;  2J07 A;  3GZ2 A;  4BTB A;  2L6J A;  2WXJ A;  4U0Z A;  3D3M A;  1E96 B;  4JA7 A;  2Y4T A;  5FT9 A;  3UT8 A;  2Y3A A;  3FU3 A;  2JLB A;  2LO6 A;  3S2A A;  4EZK A;  3BEE A;  1HS6 A;  2CFZ A;  4GA0 A;  3WXX A;  4I1M A;  4CT4 A;  2KZT A;  2WXF A;  5BT1 A;  1UJJ A;  2ION A;  3KAE A;  3FUE A;  4DI3 A;  2KM4 A;  4NRH B;  4LCT A;  4KXK B;  4CDM A;  3AS4 A;  2R5S A;  2C0M A;  3CR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...