3SO8A

Crystal structure of ankra
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
NSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ankyrin repeat family A protein 2
publication title Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3so8A00
1MX4A 2A5EA 3TWRA 3NOCD 3C5RA 2ETAA 3Q9NC 1OT8A 3HRAA 4O1OA 4JB8P 2KXPC 4K5AB 4HB5A 1IXVA 2L6BA 4QQIA 1D9SA 4HRNA 4NIKA 1MYOA 1UOHA 5EIBE 5AQ9A 2KBXA 4J8YA 5CBOA 2HE0A 1WG0A 3W9GA 4F6RD 2J8SD 4BETA 4F1PA 5BXUA 3LJNA 5ENSD 1A5EA 4LSZE 2XENA 5FINA 5KNHD 4RLYA 4GPMA 4HRLA 3B95A 4Z68A 2DVWA 1K1BA 3UTMA 5KWDA 2FO1E 5EIDA 2DWZA 5D66A 3ZUVB 4BEPA 2DZNA 1YCSB 5FIOA 3EU9A 1MX2A 2P2CP 2XEHA 3Q9UC 2RFMA 4DX7D 2ZGGA 4U8YD 1YYHA 3TWUA 3V2OA 4A63B 2DZOA 2VGEA 3IXEA 4YDWA 5AQBA 1SVXA 3JXIA 4QFVA 2NYJA 1BI7B 1N11A 1BD8A 2XZDG 5AARA 5BXOA 4BSZB 5AQ7A 5CERB 3NBNB 4DUIA 1N0RA 1G3NB 1K1AA 4HBDA 4UUCA 5HKPA 3SO8A 2Y0BG 3TWSA 1YMPA 2QC9A 1DCQA 5EILA 5ENRD 3V30A 5CECB 5CEDB 5EYPF 4G8LA 5CEAA 2F8YA 1N0QA 1AWCB 1BU9A 2ZGDA 4HI9A 4DX5D 5AAOA 1WDYA 2ETBA 4J7WA 5ENQD 5HS0A 4CZ2D 1MX6A 5ITZF 3V79K 1TR4A 2QYJA 5AN8A 3T9KA 1MJ0A 5KNGA 1S70B 4DRXE 4HLLA 4B93B 3DEPA 3V31A 1SW6A 4C48B 3J5QB 5ENPD 4GMRA 4LG6A 5JMND 3NOGD 2Y1LE 3TWVA 4HRMB 5AQAA 4O1PA 5ENTD 4BERA 3JXJA 5JA4D 4CYMD 3J5PA 2BKGA 4K5BA 1IKND 2MYOA 3TWTA 2PNNA 1IHBA 4ZHBA 5CBNA 4DX2A 5KBAA 3ZKJA 3B7BA 4ATZD 3EHQA 4OAVB 1AP7A 2XEEA 5ENOD 3DEOA 3UI2A 3KEAA 4U8VD 4ZFHA 5HRYA 2BKKB 2AJAA 3D9HA 4OAUC 4U95D 4O60A 4YDYA 4HQDA 4N5QA 3ZNGA 3AAAC 3TWWA 3HG0D 3T8KA 2F8XK 1DC2A 4DX1A 4G8KA 2XZTG 3AJIA 1BLXB 4HNAD 1OY3D 1QYMA 2ETCA 4DX6D 3TWQA 3F6QA 4BESA 3UXGA 3V2XA 4HI8A 2B0OE 1BI8B 4LNUD 4U96D 5EN5D 1NFIE 5EYLA 1K3ZD 2F37A 4TUMA 3EHRA 2V5QC 4K5CA 2JABA 3TWXA 3W9FA 2V4HC 3ZU7B 3JUEA 2RFAA
chains in the Genus database with same CATH superfamily
2I1KA 4PS7A 5B1BE 1HZ4A 3U66A 3S7DA 1WY6A 5E76A 4HB5A 4TXRA 4YNDA 4HRNA 5EIBE 2P9IG 3E33A 2EINE 1LTXA 3D9OA 3LJNA 4LSZE 4CGWA 3G2VA 5DIZA 1JWFA 3EIQC 3ZUVB 3UKRG 3ZHEB 3AS5A 4QFVA 4JEUA 3ZW3A 3OXFA 2IO2C 2OOEA 5J90A 2QC9A 3V30A 2JLBA 5CEAA 2P9KG 1IQRA 4LEUA 3V79K 2R59A 3ULQA 4HOUA 2I9CA 3MKQA 1FT1A 1S0PA 3ABKE 5JMND 3CVXA 2Y1LE 4I6EA 3ASHA 3JXJA 4CYMD 3UIPC 1IHBA 2XS1A 4RG6A 4W9RA 5BV1A 4K0RA 5D0OD 5AJDA 4C0MA 4BY6A 4HXIA 1K3ZD 1NZNA 4U0UA 2PM7A 4CRWA 4A3VA 1SZAA 2WXOA 3DSTA 2CFUA 5C1DA 4GTRA 3FTVA 5FQ7A 2CG2A 5FZRA 3S2AA 5A6CA 2R03A 3W9GA 1ZB1A 4A1GA 3SBSA 4UQZA 1A5EA 4N2SA 2XENA 2YQ8A 3FU0A 4KZCA 1E90A 3MKRA 2DVWA 3CHRA 1K1BA 3UTMA 2FO1E 3ZPJA 5FIOA 1UN9A 3LY8A 4A1SA 2VJ8A 3HXFA 4D10C 1K1AA 5HKPA 3SO8A 3LY7A 3FTSA 5CMWA 4AOFA 3DRAA 2WMOA 4HI9A 5ARFA 1JWGA 2IQCA 3ASGA 2P9NG 2VYIA 4HVBA 3DEPA 3L16A 5T3RA 3MJWA 4LG6A 1D8EA 1TJCA 2VTBA 3J5PA 4I1AA 2PNNA 4IRUA 3FTWA 3UI2A 4GZCA 1H6PA 5CRUA 1N4SA 2WXQA 4GYWA 4U95D 4O60A 1H2VC 3RKVA 2HM8A 1BLXB 3L13A 2R05A 2Y69E 3TAXA 4LNGA 2YINA 4BESA 5FT9A 3V2XA 4LNUD 4AXHA 2XPYA 5EN5D 4TUMA 3RO3A 2I1JA 3KSQA 2V4HC 5KJKA 5BT1A 2H6IA 4RVBA 1OT8A 3APDA 3MZLB 3U9WA 3HDXA 2L6BA 5AQ9A 5BW8C 2FBNA 1E8YA 2UWJG 3B7TA 2J8SD 3AU5A 5FZSA 2PL2A 3LEWA 4EZJA 3HYMB 4RLYA 3CVPA 3SD5A 3UUXA 2YNQA 1OWMA 3C72A 5A23A 3Q9UC 5JJ6A 1N95A 2VSOE 1YYHA 5FQ6A 3SGHA 2AVPA 5IY5E 3JXIA 4Q96A 4LUNU 2V8SE 5FQ4A 3UX4A 3TWSA 1DCQA 5ENRD 3DXKG 2BF0X 4UI9K 1E8ZA 4J7WA 5ITZF 1QQEA 1HH8A 3FP3A 3V31A 1Z3XA 3O4ZA 4DK5A 3PZ1A 3HIZA 3X2QE 1FPPA 2X3MA 4I1OB 2DBAA 4ANXA 3MKQB 2MYOA 4UQXA 5KBAA 3JQ0A 4GTQA 2FEZA 3CVYA 3FY4A 3DXMG 3CKCA 3KEAA 1IHGA 3CGHA 3ZNGA 2Y4TA 1A17A 3PRZA 1Q2ZA 3T8KA 4WUYA 2XZTG 2DYSE 3QAQA 2X6IA 4U96D 3AS8A 2FULA 4TXQA 3ABME 3TGOA 3Q7FA 4PDXA 5J08A 1EDUA 1D8DA 2P58C 4U07A 3QWVA 3ULYA 1IXVA 4LCTA 3TJPA 3VLDA 4GZDA 4G25A 1H6OA 4F1PA 2WPVA 2CG3A 2WXMA 3AG3E 4HRLA 4JXTA 3UKUG 2PM6A 1O1TA 3JYSA 3CV0A 2YHCA 3HXBA 1SVXA 3UM1A 2RG8A 4HORA 3CHPA 4EQFA 1U2VG 5AQ7A 2XPZA 1FT2A 5EYPF 1TN8A 1QBQA 4G8LA 4B94A 3ZHEA 1QZ2A 3AG1E 5CMYA 1MJ0A 1N94A 2WXGA 3MYVA 3L22A 1LD8A 4C48B 2WXHA 4ANVA 4AIFA 3R9AB 3SNXA 2VTBB 4EZKA 3CK9A 4BWRA 4B89A 3AAAC 4JD2G 4GTVA 3ENEA 2ETCA 1E8XA 3RK6A 5G04C 3FH8A 3Q78A 4UWKA 4GA1A 5H7PA 4J0UA 2B6CA 3D3MA 4C9BB 3SFYA 3ZU7B 1N54A 2A5EA 3FUKA 1O1SA 3P1UA 4K03A 4O6FA 1MQSA 3LS8A 4CCAA 4I6GA 1TEZA 4GYOA 1UOHA 2V0PA 2GW1A 2HE0A 3FU5A 4GAAA 5D0QD 1E7UA 3CKBA 2WVIA 3QJZA 2E2EA 4WWPA 4G1TA 4FULA 2LAHA 1PC2A 4FLBA 4ABNA 4BT9A 3OXLA 3BQOA 3GZ2A 4JHRA 2IJGX 4BSXA 1TN6A 3B7SA 3SF4A 2JEKA 4UWFA 3T9KA 3D9JA 1S70B 4HLLA 2VGXB 2HR2A 3TWVA 3FH7A 4APFA 3NQPA 4J8SA 3PH0C 2XRYA 3EHQA 3FDHA 3ESKA 4H7YA 1Y8MA 3OXGA 3PUKA 3UIOC 2XPIA 4CDMA 5KCMA 3TWQA 4HI8A 1TYQG 4PS8A 5AJLA 1TN7A 1E7VA 3JUEA 3IBEA 5ENNA 3L9TA 1MZCA 3NOCD 3CQGB 3CVLA 4K5AB 4BX9A 3RU0A 4XI9A 3K9IA 4OVUA 3UMVA 3QDNA 3RRNB 4XKCA 5FINA 2WB2A 1H2TC 3DSVA 4GPMA 4U0ZA 5G04J 1KZPA 3FULA 5EIDA 2Y3AA 1YCSB 4N2QA 2HO1A 1OXJA 4I17A 3C3QA 5CERB 1OCRE 3UM0A 1Z6TA 2Y0BG 4TUUA 2XCBA 5CECB 2ONDA 2R17C 4F1SA 5AYWD 1IQUA 2GRLA 4DX5D 3DSSA 5HS0A 1H0AA 4HOTA 3ZYLA 4JZYA 3J5QB 1WAO1 3CLJA 1OWNA 5ENTD 4PUCA 2AW6A 4FADA 3CVQA 3PVLA 5ENOD 2X6HA 3QARA 2XQ0A 2J08A 3CVVA 4NACA 4XZ4A 4L1BA 2AJAA 3D9HA 4HQDA 3PREA 3L08A 4AVXA 4DX1A 5JJTA 5A7DB 4DI3A 2IY0C 5ANLA 3BUAA 4RQIA 3VTYA 3EHRA 1IYGA 4NQ0A 4Q69A 4XI0A 2OCCE 4O1OA 2WQ7A 4F7AA 1TNOA 1ZU2A 3CHMA 3TG5A 5FZQA 1D9SA 3C98A 1WG0A 3E37A 5B3SE 1ELRA 3EJNA 4UWGA 1FCHA 2LAIA 4CEMA 4G23A 3U3WA 1HO8A 3V2OA 3ZN3A 4ACKA 1K8KG 1LD7A 4AY5A 1S64A 1TR4A 1UJKA 1DNPA 2VSNA 4FJZA 3CHSA 3HXDA 3BG0B 4J6IA 3WG7E 3D9NA 4GMJA 1NP7A 4GPKA 4ILIA 2NSZA 5D2MC 2WQHA 5CBNA 1EF1C 2MRIA 4FJYA 5FQ8A 3DEOA 4B0ZA 4IULA 3DPDA 2Y4UA 2P9UG 1HS6A 4JVSA 3LYAA 3PUJA 4GZ3A 3FTUA 2LSVA 3LXUX 3ASOE 1TNYA 3LCAA 1BI8B 2NXPA 1FVHA 2GRMA 3Q73A 3G2TA 1N4QA 3QNKA 1HX8A 3I5PA 4WWOA 3SI5A 5E75A 3R7QA 4G11A 3ASFA 5FTPA 3VLEA 4NIKA 3CK7A 2ZXWE 4FHKA 2X38A 3TL5A 5ENSD 3FUNA 2FI7A 3LDZA 4FC8A 1NI1A 5JHBA 4WNEA 5KWDA 3ASNE 5ANRA 2LSUA 3OTNA 2R2LA 5HQ8A 2ZGGA 4E6HA 1PAQA 2IU1A 3SFXA 1BI7B 5AARA 5AIJA 3PZ3A 3T8MA 3B7UX 1JCRA 3TG4A 4BX8A 2LUHA 2F8YA 1BU9A 2H6HA 3C3RA 2ZGDA 3JUIA 4NURA 1WDYA 3EDTB 4MKTA 3UQ3A 3Q75A 2L0IA 2R5SA 2CHWA 5ENPD 4HRMB 2KCVA 1H6KA 5EDSA 3B7RL 3HXEA 4K5BA 3TWTA 4DLOA 2QZAA 3ZKJA 2VSYA 2VGXA 3I4GA 5HRYA 4ILGA 1QNFA 3KEZA 1P5QA 2ZISA 1DC2A 1MHQA 4G8KA 3B13A 1QYMA 3L54A 4U63A 4B8CB 3UT7A 3DSWA 3E30A 3UPVA 3APFA 5BUZA 3L17A 4J8FA 2ETAA 4L23A 3RO2A 4GCOA 2UY1B 4ATGA 3R9MA 4M3OA 4QQIA 2J4DA 2KC7A 3ZGQA 4EECA 4AY6A 4BETA 4J8EA 3CSTA 3PNTB 3SQVA 4WWNA 1Z5SC 3EU9A 1MX2A 2IOSA 1DVPA 3ULEG 3KAEA 2H6FA 2XZDG 3FEYA 4HFGA 4DUIA 5KJNA 4ME2A 2XHEA 1OCOE 2XEVA 4G2VA 1HF8A 1KPSB 2XS8A 4DLQA 2H6GA 2XCCA 4RSYA 4KBQA 5LOZA 1V55E 3FUFA 5KNGA 1H19A 1TNZA 2IOLA 1E96B 1OUVA 2WMNA 2IFUA 5JA4D 4R7LA 1ELKA 1ELWA 4I9EA 4OAVB 4DX2A 1NA3A 1HXIA 3IKOB 4RG9A 3LVRE 3MGBA 3MV2B 4ZFHA 3FEXA 4GTPA 4G24A 2A5UA 4XE0A 4TXPA 4CDNA 2L9BA 5G55A 2PZIA 4E85A 3HXCA 4DJAA 5M72A 4XKBA 2V5QC 2JABA 2DCPA 5CCLA 3CVUA 2CHZA 1DCEA 4GYYA 4IYPA 4L2YA 4BTAA 4N39A 3FWVA 2XGOA 3FU6A 2GROB 3FUJA 3ZYKA 2FO7A 4AP2A 5LCWC 3FUMA 5D66A 3AS4A 2GRQB 2OVBA 4EPZA 2RFMA 5AQBA 3DWLG 3AG4E 4L7TA 3ABLE 4BTBA 1KT1A 1HFAA 4TV3A 1N0RA 1G3NB 4FHJA 5G2NA 1GW6A 5CEDB 2C0LA 1N52A 4MRUA 4BFRA 4C0EA 3CIAA 4KMOA 1OWLA 4A3TA 4ANWA 3UT8A 3RRMB 4BERA 3UM3A 1X81A 2CHXA 3T5VA 1TNBA 4XIFA 2GRNB 3Q7AA 3FU3A 3CEQA 4U8VD 3ZFWA 3BU8A 4JW1A 1RW2A 3PEUB 1SA4A 3G2UA 4JPSA 1VDYA 2XRZA 1KZOA 2PQRA 4JC8A 1HU3A 2RFAA 2WQ6A 1Z3YA 3ASDA 3TWRA 3NF1A 3OAWA 3SHFA 5C2YA 3I3NA 4N3CA 3E32A 1H2UA 1MYOA 4JEHA 4U0SA 4MBGA 5EKQD 3AG2E 4URKA 1XNFA 3MX3A 3GYZA 4EBAA 2AXVA 3FUDA 2V4LA 2WXNA 4LNBA 4HOSA 1BD8A 2LO6A 4GZ6A 4UWLA 4BSZB 3NBNB 4PH4B 2ZIRA 1OCCE 2BTDA 3PE3A 1MX6A 4B93B 3ZVVA 2X6JA 3ML9A 3NOGD 3KD7A 2OEVA 4AJWA 5AQAA 3PEVB 4X8QA 5LCWJ 1XGWA 2XGMA 5BV0A 5T4YA 5KJMA 2LXLA 3SY2A 4FLHA 4GA2A 3N71A 4J8DA 4N5QA 2MOWA 3QKYA 3SZ7A 2WXJA 2L0TB 4GTOA 1INZA 1PY1A 3MV3B 3W9FA 4WAFA 4I43A 4L9PA 3C5RA 2RKKA 4KXKB 3P2BA 3LY9A 2ZU6B 4UWHA 4YDOA 4XEIG 2A4ZA 1BPOA 3NB2A 2LXMA 2VQ2A 1JUQA 3B95A 2EQXA 2PQNA 2UY1A 2P9PG 3QK0A 2DWZA 1OWPA 3ZEFA 3WXXA 3NZSA 2DYRE 3QB2A 5CHEE 3CR3A 2NYJA 2NC9A 2IF4A 3DBSA 5CCMA 1HG2A 3JCKC 1WM5A 5EILA 4F3VA 3EU5A 3CHOA 4L2LA 4I2ZA 4EBAG 2OVFA 3U4TA 2WXKA 4UQYA 4YDEA 3UT4A 2CFZA 3HVEA 4JA7A 4HS2A 4O1PA 4CGVA 4B8AA 3PNLB 5ARGA 4IN3B 3B7BA 1AP7A 3R7RA 3MCXA 3U64A 4GMLA 2KATA 3HG0D 2J07A 3IEGA 2EIME 5LX8A 3FFLA 4WNDA 4DX6D 1NL4A 3S7FA 3DSXA 3ZRHA 3GW4A 3G2SA 4WNFA 4GCNA 3D9IA 3ML8A 4HOQA 2KM4A 3ZYQA 5JJ7A 4FP7A 2WXPA 1N4RA 4JB8P 3S7JA 1JCQA 3UINC 3O48A 4F53A 4J8YA 5CRVA 4F6RD 3DSUA 4Q94A 4EZLA 5BXUA 3LJ3A 1HE8A 5LP0A 3E34A 1O1RA 2BEDA 4MS6A 2L6JA 3Q79A 1N4PA 3MEKA 4DX7D 1OWOA 1HG5A 5FWQA 3IXEA 3KSLA 2J4BA 3AU4A 3QC1A 5BXOA 1UN8A 5BPPA 1YMPA 1LF8A 4ANUA 2VGYA 3PZ4A 3BG1B 3EHNA 4CZ2D 5ENQD 3LKUA 1U3DA 3ZXSA 4DI4A 4AM9A 4TRQA 3L82A 2I6HA 2XEEA 2AWIA 4OYSA 5G05C 2EILE 2GGFA 4GTSA 2BKKB 1JPLA 3FHEA 3EHMA 3VTXA 3LPZA 3TWWA 1OCZE 3Q49B 2AXZA 3AJIA 4Y6CA 3ONKA 4HLEA 3TXMA 4P29A 4U8HA 2F37A 1NA0A 1FVFA 2J49A 2GRRB 2X6FA 2QFCA 3QWWA 3TWXA 4CT4A 2YHEA 1MX4A 3LVQE 3TXNA 1W3BA 4EHMA 3T5XA 3HRAA 4KZ0A 4GB9A 1L5JA 4LRZA 2KXPC 4GA0A 4KVMA 3FUIA 3MA5A 3E4BA 2KCLA 4I1MA 4V3IA 5KNHD 3RIBA 1N9AA 3RAUA 4AEZC 4Z68A 1JCSA 3ESLA 1EYHA 2DZNA 2XEHA 3RJVA 3TWUA 2VGEA 4YDWA 1S63A 2R02A 1N11A 3D9LA 5AENA 4I9CA 3APCA 3IHYA 3Q4AB 3DPYA 1UW4B 2Q7FA 5AAOA 2J09A 3G2WA 3FTZA 5AN8A 2VSXE 4DRXE 1X5BA 3URZA 1ZBPA 3PS6A 5JHAA 4GMRA 2HYZA 3D9KA 2BKGA 5FJYA 3HVEB 4JHJA 3NZUA 2QY7A 1O5MA 3PZDA 4PS3A 1EPUA 1UG3A 4OAUC 4KVOA 4YDYA 3CSFA 1KLXA 4JL0A 2F8XK 4HNAD 2RD0A 4ILHB 2KZTA 3QWPA 1YA0A 3UXGA 4U7EB 3FTYA 2M63A 3ZYMA 3ZXPA 2B0OE 3CHQA 3ISMC 3Q9NC 4FU3A 3FH5A 3KS2A 5BNWA 1SZ9A 4MLPA 5G05J 4N3AA 2KBXA 5CBOA 2DIWA 2FF4A 4I2WA 4CT0A 4JHKA 2IONA 4AV7A 3GZ1A 4WNGA 1UJJA 2P9SG 3EUVA 2OEWA 4U8YD 4A63B 2DZOA 3NAWA 4I6JA 4G26A 3UM2A 5LFAA 3GZSA 4N5CA 3SFZA 5T8IA 1AWCB 2IEJA 2QYUA 4DPRA 3CQCB 3Q47B 2GRPB 4UI9C 1SW6A 4N3BA 3IHVA 2E0IA 2LNIA 2EIKE 3CVNA 4GZ5A 2ILRA 5EX3A 3VLFA 2C0MA 1SQMA 2XGSA 2J9QA 4APOA 3IV0A 3ZIMA 3I4RB 3RSEG 2WXIA 4H7XA 3PZ2A 3PDNA 1KT0A 1NFIE 3CVWA 3D9MA 4ACLA 3D9PA 4K5CA 3QOUA 4KYOB 3JQ1A 4FA6A 2MHKA 3BEEA 1RZ4A 2I2OA 3C3OA 2WXLA 4M7CA 2OV8A 4BT8A 1V54E 3Q5MA 3RRUA 3SBTB 4BEPA 2P9LG 3FUHA 2P2CP 5KJLA 1E8WA 1Y6IA 4OVVA 3S7BA 1B89A 4GTTA 1TNUA 4A55A 4HBDA 4UUCA 4KT6B 5HI7A 1SA5A 3EIJA 3ONLA 1N0QA 3Q15A 4GU5A 2WXFA 2IO3C 4GTMA 2ETBA 3HHMA 2X6KA 2QYJA 2AXUA 5B1AE 3PE4A 4XX5A 2V5FA 2WXRA 2F0YA 5DBKA 1IKND 4ZHBA 1TJFA 4YVQC 4ATZD 4JA9A 3FTXA 4YVOA 2BUGA 3FUEA 4NRHB 3CK8A 4CDRA 3L6AA 2EIJE 4Y6WA 2WM9A 1OY3D 3F6QA 2KCKA 4U04A 4LERA 2C2LA 5EYLA 4UI9J 5EX0A 2KZTB 1U3CA
chains in the Genus database with same CATH topology
1MX4A 2A5EA 3TWRA 3NOCD 3C5RA 2ETAA 3Q9NC 1OT8A 3HRAA 4O1OA 4JB8P 2KXPC 4K5AB 4HB5A 1IXVA 2L6BA 4QQIA 1D9SA 4HRNA 4NIKA 1MYOA 1UOHA 5EIBE 5AQ9A 2KBXA 4J8YA 5CBOA 2HE0A 1WG0A 3W9GA 4F6RD 2J8SD 4BETA 4F1PA 5BXUA 3LJNA 5ENSD 1A5EA 4LSZE 2XENA 5FINA 5KNHD 4RLYA 4GPMA 4HRLA 3B95A 4Z68A 2DVWA 1K1BA 3UTMA 5KWDA 2FO1E 5EIDA 2DWZA 5D66A 3ZUVB 4BEPA 2DZNA 1YCSB 5FIOA 3EU9A 1MX2A 2P2CP 2XEHA 3Q9UC 2RFMA 4DX7D 2ZGGA 4U8YD 1YYHA 3TWUA 3V2OA 4A63B 2DZOA 2VGEA 3IXEA 4YDWA 5AQBA 1SVXA 3JXIA 4QFVA 2NYJA 1BI7B 1N11A 1BD8A 2XZDG 5AARA 5BXOA 4BSZB 5AQ7A 5CERB 3NBNB 4DUIA 1N0RA 1G3NB 1K1AA 4HBDA 4UUCA 5HKPA 3SO8A 2Y0BG 3TWSA 1YMPA 2QC9A 1DCQA 5EILA 5ENRD 3V30A 5CECB 5CEDB 5EYPF 4G8LA 5CEAA 2F8YA 1N0QA 1AWCB 1BU9A 2ZGDA 4HI9A 4DX5D 5AAOA 1WDYA 2ETBA 4J7WA 5ENQD 5HS0A 4CZ2D 1MX6A 5ITZF 3V79K 1TR4A 2QYJA 5AN8A 3T9KA 1MJ0A 5KNGA 1S70B 4DRXE 4HLLA 4B93B 3DEPA 3V31A 1SW6A 4C48B 3J5QB 5ENPD 4GMRA 4LG6A 5JMND 3NOGD 2Y1LE 3TWVA 4HRMB 5AQAA 4O1PA 5ENTD 4BERA 3JXJA 5JA4D 4CYMD 3J5PA 2BKGA 4K5BA 1IKND 2MYOA 3TWTA 2PNNA 1IHBA 4ZHBA 5CBNA 4DX2A 5KBAA 3ZKJA 3B7BA 4ATZD 3EHQA 4OAVB 1AP7A 2XEEA 5ENOD 3DEOA 3UI2A 3KEAA 4U8VD 4ZFHA 5HRYA 2BKKB 2AJAA 3D9HA 4OAUC 4U95D 4O60A 4YDYA 4HQDA 4N5QA 3ZNGA 3AAAC 3TWWA 3HG0D 3T8KA 2F8XK 1DC2A 4DX1A 4G8KA 2XZTG 3AJIA 1BLXB 4HNAD 1OY3D 1QYMA 2ETCA 4DX6D 3TWQA 3F6QA 4BESA 3UXGA 3V2XA 4HI8A 2B0OE 1BI8B 4LNUD 4U96D 5EN5D 1NFIE 5EYLA 1K3ZD 2F37A 4TUMA 3EHRA 2V5QC 4K5CA 2JABA 3TWXA 3W9FA 2V4HC 3ZU7B 3JUEA 2RFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX4 A;  2A5E A;  3TWR A;  3NOC D;  3C5R A;  2ETA A;  3Q9N C;  1OT8 A;  3HRA A;  4O1O A;  4JB8 P;  2KXP C;  4K5A B;  4HB5 A;  1IXV A;  2L6B A;  4QQI A;  1D9S A;  4HRN A;  4NIK A;  1MYO A;  1UOH A;  5EIB E;  5AQ9 A;  2KBX A;  4J8Y A;  5CBO A;  2HE0 A;  1WG0 A;  3W9G A;  4F6R D;  2J8S D;  4BET A;  4F1P A;  5BXU A;  3LJN A;  5ENS D;  1A5E A;  4LSZ E;  2XEN A;  5FIN A;  5KNH D;  4RLY A;  4GPM A;  4HRL A;  3B95 A;  4Z68 A;  2DVW A;  1K1B A;  3UTM A;  5KWD A;  2FO1 E;  5EID A;  2DWZ A;  5D66 A;  3ZUV B;  4BEP A;  2DZN A;  1YCS B;  5FIO A;  3EU9 A;  1MX2 A;  2P2C P;  2XEH A;  3Q9U C;  2RFM A;  4DX7 D;  2ZGG A;  4U8Y D;  1YYH A;  3TWU A;  3V2O A;  4A63 B;  2DZO A;  2VGE A;  3IXE A;  4YDW A;  5AQB A;  1SVX A;  3JXI A;  4QFV A;  2NYJ A;  1BI7 B;  1N11 A;  1BD8 A;  2XZD G;  5AAR A;  5BXO A;  4BSZ B;  5AQ7 A;  5CER B;  3NBN B;  4DUI A;  1N0R A;  1G3N B;  1K1A A;  4HBD A;  4UUC A;  5HKP A;  3SO8 A;  2Y0B G;  3TWS A;  1YMP A;  2QC9 A;  1DCQ A;  5EIL A;  5ENR D;  3V30 A;  5CEC B;  5CED B;  5EYP F;  4G8L A;  5CEA A;  2F8Y A;  1N0Q A;  1AWC B;  1BU9 A;  2ZGD A;  4HI9 A;  4DX5 D;  5AAO A;  1WDY A;  2ETB A;  4J7W A;  5ENQ D;  5HS0 A;  4CZ2 D;  1MX6 A;  5ITZ F;  3V79 K;  1TR4 A;  2QYJ A;  5AN8 A;  3T9K A;  1MJ0 A;  5KNG A;  1S70 B;  4DRX E;  4HLL A;  4B93 B;  3DEP A;  3V31 A;  1SW6 A;  4C48 B;  3J5Q B;  5ENP D;  4GMR A;  4LG6 A;  5JMN D;  3NOG D;  2Y1L E;  3TWV A;  4HRM B;  5AQA A;  4O1P A;  5ENT D;  4BER A;  3JXJ A;  5JA4 D;  4CYM D;  3J5P A;  2BKG A;  4K5B A;  1IKN D;  2MYO A;  3TWT A;  2PNN A;  1IHB A;  4ZHB A;  5CBN A;  4DX2 A;  5KBA A;  3ZKJ A;  3B7B A;  4ATZ D;  3EHQ A;  4OAV B;  1AP7 A;  2XEE A;  5ENO D;  3DEO A;  3UI2 A;  3KEA A;  4U8V D;  4ZFH A;  5HRY A;  2BKK B;  2AJA A;  3D9H A;  4OAU C;  4U95 D;  4O60 A;  4YDY A;  4HQD A;  4N5Q A;  3ZNG A;  3AAA C;  3TWW A;  3HG0 D;  3T8K A;  2F8X K;  1DC2 A;  4DX1 A;  4G8K A;  2XZT G;  3AJI A;  1BLX B;  4HNA D;  1OY3 D;  1QYM A;  2ETC A;  4DX6 D;  3TWQ A;  3F6Q A;  4BES A;  3UXG A;  3V2X A;  4HI8 A;  2B0O E;  1BI8 B;  4LNU D;  4U96 D;  5EN5 D;  1NFI E;  5EYL A;  1K3Z D;  2F37 A;  4TUM A;  3EHR A;  2V5Q C;  4K5C A;  2JAB A;  3TWX A;  3W9F A;  2V4H C;  3ZU7 B;  3JUE A;  2RFA A; 
#chains in the Genus database with same CATH topology
 2I1K A;  4PS7 A;  5B1B E;  1HZ4 A;  3U66 A;  3S7D A;  1WY6 A;  5E76 A;  4HB5 A;  4TXR A;  4YND A;  4HRN A;  5EIB E;  2P9I G;  3E33 A;  2EIN E;  1LTX A;  3D9O A;  3LJN A;  4LSZ E;  4CGW A;  3G2V A;  5DIZ A;  1JWF A;  3EIQ C;  3ZUV B;  3UKR G;  3ZHE B;  3AS5 A;  4QFV A;  4JEU A;  3ZW3 A;  3OXF A;  2IO2 C;  2OOE A;  5J90 A;  2QC9 A;  3V30 A;  2JLB A;  5CEA A;  2P9K G;  1IQR A;  4LEU A;  3V79 K;  2R59 A;  3ULQ A;  4HOU A;  2I9C A;  3MKQ A;  1FT1 A;  1S0P A;  3ABK E;  5JMN D;  3CVX A;  2Y1L E;  4I6E A;  3ASH A;  3JXJ A;  4CYM D;  3UIP C;  1IHB A;  2XS1 A;  4RG6 A;  4W9R A;  5BV1 A;  4K0R A;  5D0O D;  5AJD A;  4C0M A;  4BY6 A;  4HXI A;  1K3Z D;  1NZN A;  4U0U A;  2PM7 A;  4CRW A;  4A3V A;  1SZA A;  2WXO A;  3DST A;  2CFU A;  5C1D A;  4GTR A;  3FTV A;  5FQ7 A;  2CG2 A;  5FZR A;  3S2A A;  5A6C A;  2R03 A;  3W9G A;  1ZB1 A;  4A1G A;  3SBS A;  4UQZ A;  1A5E A;  4N2S A;  2XEN A;  2YQ8 A;  3FU0 A;  4KZC A;  1E90 A;  3MKR A;  2DVW A;  3CHR A;  1K1B A;  3UTM A;  2FO1 E;  3ZPJ A;  5FIO A;  1UN9 A;  3LY8 A;  4A1S A;  2VJ8 A;  3HXF A;  4D10 C;  1K1A A;  5HKP A;  3SO8 A;  3LY7 A;  3FTS A;  5CMW A;  4AOF A;  3DRA A;  2WMO A;  4HI9 A;  5ARF A;  1JWG A;  2IQC A;  3ASG A;  2P9N G;  2VYI A;  4HVB A;  3DEP A;  3L16 A;  5T3R A;  3MJW A;  4LG6 A;  1D8E A;  1TJC A;  2VTB A;  3J5P A;  4I1A A;  2PNN A;  4IRU A;  3FTW A;  3UI2 A;  4GZC A;  1H6P A;  5CRU A;  1N4S A;  2WXQ A;  4GYW A;  4U95 D;  4O60 A;  1H2V C;  3RKV A;  2HM8 A;  1BLX B;  3L13 A;  2R05 A;  2Y69 E;  3TAX A;  4LNG A;  2YIN A;  4BES A;  5FT9 A;  3V2X A;  4LNU D;  4AXH A;  2XPY A;  5EN5 D;  4TUM A;  3RO3 A;  2I1J A;  3KSQ A;  2V4H C;  5KJK A;  5BT1 A;  2H6I A;  4RVB A;  1OT8 A;  3APD A;  3MZL B;  3U9W A;  3HDX A;  2L6B A;  5AQ9 A;  5BW8 C;  2FBN A;  1E8Y A;  2UWJ G;  3B7T A;  2J8S D;  3AU5 A;  5FZS A;  2PL2 A;  3LEW A;  4EZJ A;  3HYM B;  4RLY A;  3CVP A;  3SD5 A;  3UUX A;  2YNQ A;  1OWM A;  3C72 A;  5A23 A;  3Q9U C;  5JJ6 A;  1N95 A;  2VSO E;  1YYH A;  5FQ6 A;  3SGH A;  2AVP A;  5IY5 E;  3JXI A;  4Q96 A;  4LUN U;  2V8S E;  5FQ4 A;  3UX4 A;  3TWS A;  1DCQ A;  5ENR D;  3DXK G;  2BF0 X;  4UI9 K;  1E8Z A;  4J7W A;  5ITZ F;  1QQE A;  1HH8 A;  3FP3 A;  3V31 A;  1Z3X A;  3O4Z A;  4DK5 A;  3PZ1 A;  3HIZ A;  3X2Q E;  1FPP A;  2X3M A;  4I1O B;  2DBA A;  4ANX A;  3MKQ B;  2MYO A;  4UQX A;  5KBA A;  3JQ0 A;  4GTQ A;  2FEZ A;  3CVY A;  3FY4 A;  3DXM G;  3CKC A;  3KEA A;  1IHG A;  3CGH A;  3ZNG A;  2Y4T A;  1A17 A;  3PRZ A;  1Q2Z A;  3T8K A;  4WUY A;  2XZT G;  2DYS E;  3QAQ A;  2X6I A;  4U96 D;  3AS8 A;  2FUL A;  4TXQ A;  3ABM E;  3TGO A;  3Q7F A;  4PDX A;  5J08 A;  1EDU A;  1D8D A;  2P58 C;  4U07 A;  3QWV A;  3ULY A;  1IXV A;  4LCT A;  3TJP A;  3VLD A;  4GZD A;  4G25 A;  1H6O A;  4F1P A;  2WPV A;  2CG3 A;  2WXM A;  3AG3 E;  4HRL A;  4JXT A;  3UKU G;  2PM6 A;  1O1T A;  3JYS A;  3CV0 A;  2YHC A;  3HXB A;  1SVX A;  3UM1 A;  2RG8 A;  4HOR A;  3CHP A;  4EQF A;  1U2V G;  5AQ7 A;  2XPZ A;  1FT2 A;  5EYP F;  1TN8 A;  1QBQ A;  4G8L A;  4B94 A;  3ZHE A;  1QZ2 A;  3AG1 E;  5CMY A;  1MJ0 A;  1N94 A;  2WXG A;  3MYV A;  3L22 A;  1LD8 A;  4C48 B;  2WXH A;  4ANV A;  4AIF A;  3R9A B;  3SNX A;  2VTB B;  4EZK A;  3CK9 A;  4BWR A;  4B89 A;  3AAA C;  4JD2 G;  4GTV A;  3ENE A;  2ETC A;  1E8X A;  3RK6 A;  5G04 C;  3FH8 A;  3Q78 A;  4UWK A;  4GA1 A;  5H7P A;  4J0U A;  2B6C A;  3D3M A;  4C9B B;  3SFY A;  3ZU7 B;  1N54 A;  2A5E A;  3FUK A;  1O1S A;  3P1U A;  4K03 A;  4O6F A;  1MQS A;  3LS8 A;  4CCA A;  4I6G A;  1TEZ A;  4GYO A;  1UOH A;  2V0P A;  2GW1 A;  2HE0 A;  3FU5 A;  4GAA A;  5D0Q D;  1E7U A;  3CKB A;  2WVI A;  3QJZ A;  2E2E A;  4WWP A;  4G1T A;  4FUL A;  2LAH A;  1PC2 A;  4FLB A;  4ABN A;  4BT9 A;  3OXL A;  3BQO A;  3GZ2 A;  4JHR A;  2IJG X;  4BSX A;  1TN6 A;  3B7S A;  3SF4 A;  2JEK A;  4UWF A;  3T9K A;  3D9J A;  1S70 B;  4HLL A;  2VGX B;  2HR2 A;  3TWV A;  3FH7 A;  4APF A;  3NQP A;  4J8S A;  3PH0 C;  2XRY A;  3EHQ A;  3FDH A;  3ESK A;  4H7Y A;  1Y8M A;  3OXG A;  3PUK A;  3UIO C;  2XPI A;  4CDM A;  5KCM A;  3TWQ A;  4HI8 A;  1TYQ G;  4PS8 A;  5AJL A;  1TN7 A;  1E7V A;  3JUE A;  3IBE A;  5ENN A;  3L9T A;  1MZC A;  3NOC D;  3CQG B;  3CVL A;  4K5A B;  4BX9 A;  3RU0 A;  4XI9 A;  3K9I A;  4OVU A;  3UMV A;  3QDN A;  3RRN B;  4XKC A;  5FIN A;  2WB2 A;  1H2T C;  3DSV A;  4GPM A;  4U0Z A;  5G04 J;  1KZP A;  3FUL A;  5EID A;  2Y3A A;  1YCS B;  4N2Q A;  2HO1 A;  1OXJ A;  4I17 A;  3C3Q A;  5CER B;  1OCR E;  3UM0 A;  1Z6T A;  2Y0B G;  4TUU A;  2XCB A;  5CEC B;  2OND A;  2R17 C;  4F1S A;  5AYW D;  1IQU A;  2GRL A;  4DX5 D;  3DSS A;  5HS0 A;  1H0A A;  4HOT A;  3ZYL A;  4JZY A;  3J5Q B;  1WAO 1;  3CLJ A;  1OWN A;  5ENT D;  4PUC A;  2AW6 A;  4FAD A;  3CVQ A;  3PVL A;  5ENO D;  2X6H A;  3QAR A;  2XQ0 A;  2J08 A;  3CVV A;  4NAC A;  4XZ4 A;  4L1B A;  2AJA A;  3D9H A;  4HQD A;  3PRE A;  3L08 A;  4AVX A;  4DX1 A;  5JJT A;  5A7D B;  4DI3 A;  2IY0 C;  5ANL A;  3BUA A;  4RQI A;  3VTY A;  3EHR A;  1IYG A;  4NQ0 A;  4Q69 A;  4XI0 A;  2OCC E;  4O1O A;  2WQ7 A;  4F7A A;  1TNO A;  1ZU2 A;  3CHM A;  3TG5 A;  5FZQ A;  1D9S A;  3C98 A;  1WG0 A;  3E37 A;  5B3S E;  1ELR A;  3EJN A;  4UWG A;  1FCH A;  2LAI A;  4CEM A;  4G23 A;  3U3W A;  1HO8 A;  3V2O A;  3ZN3 A;  4ACK A;  1K8K G;  1LD7 A;  4AY5 A;  1S64 A;  1TR4 A;  1UJK A;  1DNP A;  2VSN A;  4FJZ A;  3CHS A;  3HXD A;  3BG0 B;  4J6I A;  3WG7 E;  3D9N A;  4GMJ A;  1NP7 A;  4GPK A;  4ILI A;  2NSZ A;  5D2M C;  2WQH A;  5CBN A;  1EF1 C;  2MRI A;  4FJY A;  5FQ8 A;  3DEO A;  4B0Z A;  4IUL A;  3DPD A;  2Y4U A;  2P9U G;  1HS6 A;  4JVS A;  3LYA A;  3PUJ A;  4GZ3 A;  3FTU A;  2LSV A;  3LXU X;  3ASO E;  1TNY A;  3LCA A;  1BI8 B;  2NXP A;  1FVH A;  2GRM A;  3Q73 A;  3G2T A;  1N4Q A;  3QNK A;  1HX8 A;  3I5P A;  4WWO A;  3SI5 A;  5E75 A;  3R7Q A;  4G11 A;  3ASF A;  5FTP A;  3VLE A;  4NIK A;  3CK7 A;  2ZXW E;  4FHK A;  2X38 A;  3TL5 A;  5ENS D;  3FUN A;  2FI7 A;  3LDZ A;  4FC8 A;  1NI1 A;  5JHB A;  4WNE A;  5KWD A;  3ASN E;  5ANR A;  2LSU A;  3OTN A;  2R2L A;  5HQ8 A;  2ZGG A;  4E6H A;  1PAQ A;  2IU1 A;  3SFX A;  1BI7 B;  5AAR A;  5AIJ A;  3PZ3 A;  3T8M A;  3B7U X;  1JCR A;  3TG4 A;  4BX8 A;  2LUH A;  2F8Y A;  1BU9 A;  2H6H A;  3C3R A;  2ZGD A;  3JUI A;  4NUR A;  1WDY A;  3EDT B;  4MKT A;  3UQ3 A;  3Q75 A;  2L0I A;  2R5S A;  2CHW A;  5ENP D;  4HRM B;  2KCV A;  1H6K A;  5EDS A;  3B7R L;  3HXE A;  4K5B A;  3TWT A;  4DLO A;  2QZA A;  3ZKJ A;  2VSY A;  2VGX A;  3I4G A;  5HRY A;  4ILG A;  1QNF A;  3KEZ A;  1P5Q A;  2ZIS A;  1DC2 A;  1MHQ A;  4G8K A;  3B13 A;  1QYM A;  3L54 A;  4U63 A;  4B8C B;  3UT7 A;  3DSW A;  3E30 A;  3UPV A;  3APF A;  5BUZ A;  3L17 A;  4J8F A;  2ETA A;  4L23 A;  3RO2 A;  4GCO A;  2UY1 B;  4ATG A;  3R9M A;  4M3O A;  4QQI A;  2J4D A;  2KC7 A;  3ZGQ A;  4EEC A;  4AY6 A;  4BET A;  4J8E A;  3CST A;  3PNT B;  3SQV A;  4WWN A;  1Z5S C;  3EU9 A;  1MX2 A;  2IOS A;  1DVP A;  3ULE G;  3KAE A;  2H6F A;  2XZD G;  3FEY A;  4HFG A;  4DUI A;  5KJN A;  4ME2 A;  2XHE A;  1OCO E;  2XEV A;  4G2V A;  1HF8 A;  1KPS B;  2XS8 A;  4DLQ A;  2H6G A;  2XCC A;  4RSY A;  4KBQ A;  5LOZ A;  1V55 E;  3FUF A;  5KNG A;  1H19 A;  1TNZ A;  2IOL A;  1E96 B;  1OUV A;  2WMN A;  2IFU A;  5JA4 D;  4R7L A;  1ELK A;  1ELW A;  4I9E A;  4OAV B;  4DX2 A;  1NA3 A;  1HXI A;  3IKO B;  4RG9 A;  3LVR E;  3MGB A;  3MV2 B;  4ZFH A;  3FEX A;  4GTP A;  4G24 A;  2A5U A;  4XE0 A;  4TXP A;  4CDN A;  2L9B A;  5G55 A;  2PZI A;  4E85 A;  3HXC A;  4DJA A;  5M72 A;  4XKB A;  2V5Q C;  2JAB A;  2DCP A;  5CCL A;  3CVU A;  2CHZ A;  1DCE A;  4GYY A;  4IYP A;  4L2Y A;  4BTA A;  4N39 A;  3FWV A;  2XGO A;  3FU6 A;  2GRO B;  3FUJ A;  3ZYK A;  2FO7 A;  4AP2 A;  5LCW C;  3FUM A;  5D66 A;  3AS4 A;  2GRQ B;  2OVB A;  4EPZ A;  2RFM A;  5AQB A;  3DWL G;  3AG4 E;  4L7T A;  3ABL E;  4BTB A;  1KT1 A;  1HFA A;  4TV3 A;  1N0R A;  1G3N B;  4FHJ A;  5G2N A;  1GW6 A;  5CED B;  2C0L A;  1N52 A;  4MRU A;  4BFR A;  4C0E A;  3CIA A;  4KMO A;  1OWL A;  4A3T A;  4ANW A;  3UT8 A;  3RRM B;  4BER A;  3UM3 A;  1X81 A;  2CHX A;  3T5V A;  1TNB A;  4XIF A;  2GRN B;  3Q7A A;  3FU3 A;  3CEQ A;  4U8V D;  3ZFW A;  3BU8 A;  4JW1 A;  1RW2 A;  3PEU B;  1SA4 A;  3G2U A;  4JPS A;  1VDY A;  2XRZ A;  1KZO A;  2PQR A;  4JC8 A;  1HU3 A;  2RFA A;  2WQ6 A;  1Z3Y A;  3ASD A;  3TWR A;  3NF1 A;  3OAW A;  3SHF A;  5C2Y A;  3I3N A;  4N3C A;  3E32 A;  1H2U A;  1MYO A;  4JEH A;  4U0S A;  4MBG A;  5EKQ D;  3AG2 E;  4URK A;  1XNF A;  3MX3 A;  3GYZ A;  4EBA A;  2AXV A;  3FUD A;  2V4L A;  2WXN A;  4LNB A;  4HOS A;  1BD8 A;  2LO6 A;  4GZ6 A;  4UWL A;  4BSZ B;  3NBN B;  4PH4 B;  2ZIR A;  1OCC E;  2BTD A;  3PE3 A;  1MX6 A;  4B93 B;  3ZVV A;  2X6J A;  3ML9 A;  3NOG D;  3KD7 A;  2OEV A;  4AJW A;  5AQA A;  3PEV B;  4X8Q A;  5LCW J;  1XGW A;  2XGM A;  5BV0 A;  5T4Y A;  5KJM A;  2LXL A;  3SY2 A;  4FLH A;  4GA2 A;  3N71 A;  4J8D A;  4N5Q A;  2MOW A;  3QKY A;  3SZ7 A;  2WXJ A;  2L0T B;  4GTO A;  1INZ A;  1PY1 A;  3MV3 B;  3W9F A;  4WAF A;  4I43 A;  4L9P A;  3C5R A;  2RKK A;  4KXK B;  3P2B A;  3LY9 A;  2ZU6 B;  4UWH A;  4YDO A;  4XEI G;  2A4Z A;  1BPO A;  3NB2 A;  2LXM A;  2VQ2 A;  1JUQ A;  3B95 A;  2EQX A;  2PQN A;  2UY1 A;  2P9P G;  3QK0 A;  2DWZ A;  1OWP A;  3ZEF A;  3WXX A;  3NZS A;  2DYR E;  3QB2 A;  5CHE E;  3CR3 A;  2NYJ A;  2NC9 A;  2IF4 A;  3DBS A;  5CCM A;  1HG2 A;  3JCK C;  1WM5 A;  5EIL A;  4F3V A;  3EU5 A;  3CHO A;  4L2L A;  4I2Z A;  4EBA G;  2OVF A;  3U4T A;  2WXK A;  4UQY A;  4YDE A;  3UT4 A;  2CFZ A;  3HVE A;  4JA7 A;  4HS2 A;  4O1P A;  4CGV A;  4B8A A;  3PNL B;  5ARG A;  4IN3 B;  3B7B A;  1AP7 A;  3R7R A;  3MCX A;  3U64 A;  4GML A;  2KAT A;  3HG0 D;  2J07 A;  3IEG A;  2EIM E;  5LX8 A;  3FFL A;  4WND A;  4DX6 D;  1NL4 A;  3S7F A;  3DSX A;  3ZRH A;  3GW4 A;  3G2S A;  4WNF A;  4GCN A;  3D9I A;  3ML8 A;  4HOQ A;  2KM4 A;  3ZYQ A;  5JJ7 A;  4FP7 A;  2WXP A;  1N4R A;  4JB8 P;  3S7J A;  1JCQ A;  3UIN C;  3O48 A;  4F53 A;  4J8Y A;  5CRV A;  4F6R D;  3DSU A;  4Q94 A;  4EZL A;  5BXU A;  3LJ3 A;  1HE8 A;  5LP0 A;  3E34 A;  1O1R A;  2BED A;  4MS6 A;  2L6J A;  3Q79 A;  1N4P A;  3MEK A;  4DX7 D;  1OWO A;  1HG5 A;  5FWQ A;  3IXE A;  3KSL A;  2J4B A;  3AU4 A;  3QC1 A;  5BXO A;  1UN8 A;  5BPP A;  1YMP A;  1LF8 A;  4ANU A;  2VGY A;  3PZ4 A;  3BG1 B;  3EHN A;  4CZ2 D;  5ENQ D;  3LKU A;  1U3D A;  3ZXS A;  4DI4 A;  4AM9 A;  4TRQ A;  3L82 A;  2I6H A;  2XEE A;  2AWI A;  4OYS A;  5G05 C;  2EIL E;  2GGF A;  4GTS A;  2BKK B;  1JPL A;  3FHE A;  3EHM A;  3VTX A;  3LPZ A;  3TWW A;  1OCZ E;  3Q49 B;  2AXZ A;  3AJI A;  4Y6C A;  3ONK A;  4HLE A;  3TXM A;  4P29 A;  4U8H A;  2F37 A;  1NA0 A;  1FVF A;  2J49 A;  2GRR B;  2X6F A;  2QFC A;  3QWW A;  3TWX A;  4CT4 A;  2YHE A;  1MX4 A;  3LVQ E;  3TXN A;  1W3B A;  4EHM A;  3T5X A;  3HRA A;  4KZ0 A;  4GB9 A;  1L5J A;  4LRZ A;  2KXP C;  4GA0 A;  4KVM A;  3FUI A;  3MA5 A;  3E4B A;  2KCL A;  4I1M A;  4V3I A;  5KNH D;  3RIB A;  1N9A A;  3RAU A;  4AEZ C;  4Z68 A;  1JCS A;  3ESL A;  1EYH A;  2DZN A;  2XEH A;  3RJV A;  3TWU A;  2VGE A;  4YDW A;  1S63 A;  2R02 A;  1N11 A;  3D9L A;  5AEN A;  4I9C A;  3APC A;  3IHY A;  3Q4A B;  3DPY A;  1UW4 B;  2Q7F A;  5AAO A;  2J09 A;  3G2W A;  3FTZ A;  5AN8 A;  2VSX E;  4DRX E;  1X5B A;  3URZ A;  1ZBP A;  3PS6 A;  5JHA A;  4GMR A;  2HYZ A;  3D9K A;  2BKG A;  5FJY A;  3HVE B;  4JHJ A;  3NZU A;  2QY7 A;  1O5M A;  3PZD A;  4PS3 A;  1EPU A;  1UG3 A;  4OAU C;  4KVO A;  4YDY A;  3CSF A;  1KLX A;  4JL0 A;  2F8X K;  4HNA D;  2RD0 A;  4ILH B;  2KZT A;  3QWP A;  1YA0 A;  3UXG A;  4U7E B;  3FTY A;  2M63 A;  3ZYM A;  3ZXP A;  2B0O E;  3CHQ A;  3ISM C;  3Q9N C;  4FU3 A;  3FH5 A;  3KS2 A;  5BNW A;  1SZ9 A;  4MLP A;  5G05 J;  4N3A A;  2KBX A;  5CBO A;  2DIW A;  2FF4 A;  4I2W A;  4CT0 A;  4JHK A;  2ION A;  4AV7 A;  3GZ1 A;  4WNG A;  1UJJ A;  2P9S G;  3EUV A;  2OEW A;  4U8Y D;  4A63 B;  2DZO A;  3NAW A;  4I6J A;  4G26 A;  3UM2 A;  5LFA A;  3GZS A;  4N5C A;  3SFZ A;  5T8I A;  1AWC B;  2IEJ A;  2QYU A;  4DPR A;  3CQC B;  3Q47 B;  2GRP B;  4UI9 C;  1SW6 A;  4N3B A;  3IHV A;  2E0I A;  2LNI A;  2EIK E;  3CVN A;  4GZ5 A;  2ILR A;  5EX3 A;  3VLF A;  2C0M A;  1SQM A;  2XGS A;  2J9Q A;  4APO A;  3IV0 A;  3ZIM A;  3I4R B;  3RSE G;  2WXI A;  4H7X A;  3PZ2 A;  3PDN A;  1KT0 A;  1NFI E;  3CVW A;  3D9M A;  4ACL A;  3D9P A;  4K5C A;  3QOU A;  4KYO B;  3JQ1 A;  4FA6 A;  2MHK A;  3BEE A;  1RZ4 A;  2I2O A;  3C3O A;  2WXL A;  4M7C A;  2OV8 A;  4BT8 A;  1V54 E;  3Q5M A;  3RRU A;  3SBT B;  4BEP A;  2P9L G;  3FUH A;  2P2C P;  5KJL A;  1E8W A;  1Y6I A;  4OVV A;  3S7B A;  1B89 A;  4GTT A;  1TNU A;  4A55 A;  4HBD A;  4UUC A;  4KT6 B;  5HI7 A;  1SA5 A;  3EIJ A;  3ONL A;  1N0Q A;  3Q15 A;  4GU5 A;  2WXF A;  2IO3 C;  4GTM A;  2ETB A;  3HHM A;  2X6K A;  2QYJ A;  2AXU A;  5B1A E;  3PE4 A;  4XX5 A;  2V5F A;  2WXR A;  2F0Y A;  5DBK A;  1IKN D;  4ZHB A;  1TJF A;  4YVQ C;  4ATZ D;  4JA9 A;  3FTX A;  4YVO A;  2BUG A;  3FUE A;  4NRH B;  3CK8 A;  4CDR A;  3L6A A;  2EIJ E;  4Y6W A;  2WM9 A;  1OY3 D;  3F6Q A;  2KCK A;  4U04 A;  4LER A;  2C2L A;  5EYL A;  4UI9 J;  5EX0 A;  2KZT B;  1U3C A; 
#chains in the Genus database with same CATH homology
 1MX4 A;  2A5E A;  3TWR A;  3NOC D;  3C5R A;  2ETA A;  3Q9N C;  1OT8 A;  3HRA A;  4O1O A;  4JB8 P;  2KXP C;  4K5A B;  4HB5 A;  1IXV A;  2L6B A;  4QQI A;  1D9S A;  4HRN A;  4NIK A;  1MYO A;  1UOH A;  5EIB E;  5AQ9 A;  2KBX A;  4J8Y A;  5CBO A;  2HE0 A;  1WG0 A;  3W9G A;  4F6R D;  2J8S D;  4BET A;  4F1P A;  5BXU A;  3LJN A;  5ENS D;  1A5E A;  4LSZ E;  2XEN A;  5FIN A;  5KNH D;  4RLY A;  4GPM A;  4HRL A;  3B95 A;  4Z68 A;  2DVW A;  1K1B A;  3UTM A;  5KWD A;  2FO1 E;  5EID A;  2DWZ A;  5D66 A;  3ZUV B;  4BEP A;  2DZN A;  1YCS B;  5FIO A;  3EU9 A;  1MX2 A;  2P2C P;  2XEH A;  3Q9U C;  2RFM A;  4DX7 D;  2ZGG A;  4U8Y D;  1YYH A;  3TWU A;  3V2O A;  4A63 B;  2DZO A;  2VGE A;  3IXE A;  4YDW A;  5AQB A;  1SVX A;  3JXI A;  4QFV A;  2NYJ A;  1BI7 B;  1N11 A;  1BD8 A;  2XZD G;  5AAR A;  5BXO A;  4BSZ B;  5AQ7 A;  5CER B;  3NBN B;  4DUI A;  1N0R A;  1G3N B;  1K1A A;  4HBD A;  4UUC A;  5HKP A;  3SO8 A;  2Y0B G;  3TWS A;  1YMP A;  2QC9 A;  1DCQ A;  5EIL A;  5ENR D;  3V30 A;  5CEC B;  5CED B;  5EYP F;  4G8L A;  5CEA A;  2F8Y A;  1N0Q A;  1AWC B;  1BU9 A;  2ZGD A;  4HI9 A;  4DX5 D;  5AAO A;  1WDY A;  2ETB A;  4J7W A;  5ENQ D;  5HS0 A;  4CZ2 D;  1MX6 A;  5ITZ F;  3V79 K;  1TR4 A;  2QYJ A;  5AN8 A;  3T9K A;  1MJ0 A;  5KNG A;  1S70 B;  4DRX E;  4HLL A;  4B93 B;  3DEP A;  3V31 A;  1SW6 A;  4C48 B;  3J5Q B;  5ENP D;  4GMR A;  4LG6 A;  5JMN D;  3NOG D;  2Y1L E;  3TWV A;  4HRM B;  5AQA A;  4O1P A;  5ENT D;  4BER A;  3JXJ A;  5JA4 D;  4CYM D;  3J5P A;  2BKG A;  4K5B A;  1IKN D;  2MYO A;  3TWT A;  2PNN A;  1IHB A;  4ZHB A;  5CBN A;  4DX2 A;  5KBA A;  3ZKJ A;  3B7B A;  4ATZ D;  3EHQ A;  4OAV B;  1AP7 A;  2XEE A;  5ENO D;  3DEO A;  3UI2 A;  3KEA A;  4U8V D;  4ZFH A;  5HRY A;  2BKK B;  2AJA A;  3D9H A;  4OAU C;  4U95 D;  4O60 A;  4YDY A;  4HQD A;  4N5Q A;  3ZNG A;  3AAA C;  3TWW A;  3HG0 D;  3T8K A;  2F8X K;  1DC2 A;  4DX1 A;  4G8K A;  2XZT G;  3AJI A;  1BLX B;  4HNA D;  1OY3 D;  1QYM A;  2ETC A;  4DX6 D;  3TWQ A;  3F6Q A;  4BES A;  3UXG A;  3V2X A;  4HI8 A;  2B0O E;  1BI8 B;  4LNU D;  4U96 D;  5EN5 D;  1NFI E;  5EYL A;  1K3Z D;  2F37 A;  4TUM A;  3EHR A;  2V5Q C;  4K5C A;  2JAB A;  3TWX A;  3W9F A;  2V4H C;  3ZU7 B;  3JUE A;  2RFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...