3SO8A

Crystal structure of ankra
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
NSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat family A protein 2
publication title Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 49
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3so8A00
1SW6A 4J7WA 3IXEA 4K5BA 3LJNA 1MX6A 4C48B 4YDYA 4HB5A 2AJAA 4K5AB 4BEPA 5ITZF 2XZTG 4QQIA 2L6BA 4LNUD 5FINA 1YMPA 4LSZE 1S70B 2XEHA 5ENPD 3HRAA 4CYMD 1OT8A 3NOGD 1NFIE 4OAVB 3DEPA 3AJIA 2DVWA 2PNNA 2F37A 5AQBA 2J8SD 5KNHD 3AAAC 3Q9NC 4ATZD 4F1PA 4HNAD 4ZFHA 4BERA 3J5QB 4JB8P 4HRNA 3SO8A 2VGEA 1N0QA 1AWCB 1BI8B 5CEDB 1DC2A 5EILA 4RLYA 5CEAA 4B93B 4BETA 4DX1A 5ENRD 3F6QA 4UUCA 2Y1LE 1WG0A 2DWZA 2NYJA 5HRYA 1DCQA 4QFVA 4DX6D 5CERB 3T9KA 5EYPF 2ETBA 1A5EA 1IXVA 2QC9A 2V4HC 4HLLA 2BKKB 4K5CA 4U95D 4G8KA 4U96D 4A63B 2BKGA 3ZU7B 3JXJA 4O60A 2B0OE 4NIKA 2A5EA 3TWQA 3UXGA 5AQ7A 5EIDA 3UTMA 4O1PA 3JUEA 4HBDA 3TWTA 2XEEA 3DEOA 5ENQD 5BXUA 4BESA 4BSZB 1G3NB 3UI2A 4HRLA 2RFMA 4LG6A 4HRMB 5CBOA 2ETCA 3T8KA 4Z68A 3TWRA 2JABA 3W9FA 5ENTD 1YYHA 3TWUA 4HQDA 2MYOA 5JMND 3C5RA 4HI9A 4U8VD 3TWXA 2P2CP 3KEAA 3ZUVB 4G8LA 4DRXE 1MJ0A 3W9GA 5ENSD 3V2OA 2DZNA 2XENA 3TWSA 3TWWA 3V2XA 3NOCD 5CBNA 4TUMA 5CECB 2KBXA 3EU9A 3ZKJA 3V30A 3EHQA 1IKND 1K1AA 2DZOA 5AAOA 2QYJA 2XZDG 5KWDA 3B95A 1UOHA 3Q9UC 1K3ZD 4O1OA 1K1BA 4U8YD 5JA4D 5AQ9A 5AARA 3D9HA 5FIOA 1MYOA 1N0RA 2KXPC 5KBAA 5AN8A 2RFAA 3NBNB 1BLXB 3V79K 4F6RD 4OAUC 1SVXA 1BD8A 5KNGA 2FO1E 1MX4A 3ZNGA 2Y0BG 1AP7A 5EYLA 1WDYA 2ETAA 3EHRA 4DX2A 4YDWA 4J8YA 3V31A 2HE0A 2V5QC 3HG0D 4CZ2D 1YCSB 5BXOA 1D9SA 3TWVA 5EIBE 1MX2A 1OY3D 2ZGDA 3J5PA 4DUIA 4DX5D 1BU9A 4GMRA 4ZHBA 5EN5D 4DX7D 4HI8A 5HKPA 2F8XK 2ZGGA 1QYMA 5HS0A 1TR4A 1BI7B 1IHBA 1N11A 2F8YA 5D66A 5ENOD 4N5QA 3B7BA 5AQAA 3JXIA 4GPMA
chains in the Genus database with same CATH superfamily
2OVBA 3DPYA 3CKBA 1MX6A 3T8MA 3CHRA 4CRWA 1Q2ZA 3FH5A 1N52A 2PM7A 1B89A 4EBAG 4LRZA 1H6KA 1WG0A 3O48A 3T9KA 3FUJA 4CT0A 1H6PA 2J08A 3Q7FA 3VTYA 3U3WA 1HH8A 5BUZA 1Z6TA 4M7CA 3TG4A 4YNDA 4FADA 3ZIMA 5G05J 4LEUA 4YDEA 4H7XA 5IY5E 4GAAA 2I2OA 3CIAA 4H7YA 3CVPA 5KWDA 3B95A 1K1BA 2KC7A 3C3QA 3HHMA 1FT1A 3RU0A 3ASFA 3ASHA 3NBNB 3V79K 4JHKA 2KCVA 3CVVA 3HXBA 4GTOA 3E37A 4L2YA 5KJMA 1MX2A 2CG2A 1JCQA 4I1OB 3FWVA 5D66A 5ENOD 4N5QA 4N5CA 1TEZA 3CHOA 4K5BA 3LJNA 4XZ4A 1ZU2A 3CHMA 3B7UX 3PH0C 4J6IA 4TUUA 4CYMD 2XGSA 5EX3A 3ZYLA 4N39A 2UWJG 3AAAC 3NB2A 2X6HA 4I43A 3ML9A 4DX1A 4BSXA 3U64A 3ZRHA 4EZKA 2UY1A 4I6EA 1YA0A 4G8KA 4JD2G 3FH8A 3I5PA 4BX9A 4P29A 5KCMA 2IO3C 1KLXA 3SHFA 5BXUA 4HS2A 2P58C 3SBTB 1OWLA 3PE3A 3SY2A 3ZUVB 2C0MA 4IN3B 3RO2A 1K1AA 2BUGA 2QYJA 4UWKA 3APCA 5JHAA 3B7RL 3UM3A 3BEEA 1ZBPA 4I6JA 4TXQA 1MYOA 4UWGA 4PDXA 4RSYA 4OAUC 1BD8A 4C9BB 4G26A 1W3BA 2NXPA 3MKQA 2ETAA 4BY6A 2DYRE 3IEGA 3QOUA 2P9UG 2PZIA 3SQVA 4G2VA 1TR4A 3UX4A 3PVLA 4WWOA 3ZXSA 4GZCA 3JQ0A 4WNEA 4KMOA 3Q78A 4C48B 1U2VG 4L23A 4N2SA 1V55E 3SBSA 2HYZA 1V54E 4DI4A 2XEVA 5ENPD 3ZN3A 1OT8A 2L6JA 1NFIE 1FVFA 1N4RA 4HVBA 2KATA 3MX3A 4FHJA 4WUYA 2FF4A 1DCEA 2IFUA 4R7LA 4CGWA 4JL0A 3EUVA 4XI0A 3CVUA 2X6KA 2DCPA 3R7QA 4XKCA 4J8FA 1TJCA 3C98A 1WM5A 5HRYA 4KT6B 2R59A 4GZ6A 3VLEA 2QC9A 2R17C 4K5CA 3CQGB 3DSXA 1HZ4A 5HI7A 1X81A 3RIBA 4U8HA 3BUAA 3G2UA 4CGVA 4UWFA 1NZNA 1RZ4A 3DEOA 5ENQD 3RAUA 5LP0A 3FTYA 3UI2A 4GU5A 3T8KA 4B89A 1Z5SC 2CHWA 3BU8A 4HOTA 3ULEG 2EIJE 3CQCB 3UUXA 2QFCA 3QARA 5CECB 4APFA 3APFA 3LEWA 5DIZA 4IRUA 3ZXPA 4LCTA 2X38A 5T8IA 3CK7A 3AU5A 2CHXA 3J5PA 3CVXA 3WXXA 2P9IG 4BTAA 4L7TA 4MS6A 3AS8A 3AS5A 2WMNA 3HXEA 1TNZA 3L82A 2FI7A 3JQ1A 1HE8A 4LNUD 3JYSA 5A7DB 4UQYA 4KBQA 3HXFA 2ZIRA 2LUHA 3QB2A 4L9PA 3FTZA 2DVWA 2LO6A 3Q9NC 4ZFHA 5G05C 2J49A 1E8WA 1HF8A 4HOUA 2VGEA 1JWFA 3ONKA 5EILA 4B93B 4HLEA 2H6IA 4UUCA 3RRMB 4WWPA 2VTBB 4UWLA 3SFZA 2LAHA 4B0ZA 4HOQA 3D9NA 2WVIA 4G24A 3ZVVA 2I1JA 3ESLA 4BSZB 2EIME 3ISMC 4LG6A 1OWOA 1N9AA 3ABLE 3C5RA 2DZNA 1ELRA 2YQ8A 5JJ6A 2DZOA 1OCRE 3L54A 4FP7A 2WXQA 3E4BA 2QY7A 1ELWA 1IHGA 4U04A 3QWVA 5EYLA 2VQ2A 2WPVA 3EHRA 3ASOE 4J8YA 2EINE 2WMOA 1YCSB 5BXOA 4KVOA 3GZ1A 1N11A 4GPMA 3FTUA 3BG0B 5HQ8A 3IXEA 5CCLA 3QNKA 3FY4A 4YDYA 2XZTG 2PQNA 4PS7A 4FLHA 3HRAA 2F0YA 4X8QA 2C2LA 2RG8A 1SZ9A 4ATZD 2ILRA 4JHJA 3ULYA 1E8YA 1H19A 1DC2A 4Y6WA 2IQCA 3LY7A 4F1SA 4BWRA 5E76A 5AJDA 3AS4A 1IXVA 3RRUA 3PZ3A 2P9NG 2FO7A 3PNLB 3LY8A 4NIKA 2MHKA 2Y4TA 2A5EA 2LSVA 4AVXA 4HBDA 1TNOA 4LUNU 4TXPA 4ATGA 4EZJA 3OXFA 3PEUB 3IV0A 4G25A 2OOEA 3UM0A 5ENSD 4D10C 5KJLA 1QNFA 3SD5A 3ZKJA 5D0QD 3EHQA 2XZDG 5FQ7A 1N4SA 5JJ7A 5ARFA 3APDA 2VSNA 3GZSA 1UN8A 2VSXE 3E34A 4MKTA 4J8SA 3GW4A 3S7FA 2IEJA 4LNBA 4OVVA 1UG3A 5BV1A 5B1BE 2CFUA 3B7BA 3CVNA 2UY1B 2FBNA 4E6HA 3FUKA 4FC8A 2VGXA 4RVBA 5T3RA 1QZ2A 3D9KA 2L6BA 4OAVB 3PEVB 3RRNB 3D3MA 3FDHA 4HNAD 3PREA 3UMVA 1NP7A 3Q79A 1E8ZA 1S63A 2GRPB 2Y1LE 4GTSA 4QFVA 3Q5MA 5KJNA 4B94A 1KZOA 1IYGA 3ENEA 3G2VA 4JXTA 3K9IA 3ZW3A 5BW8C 2X6JA 3MEKA 3MKQB 1H2VC 5BT1A 3QKYA 3CVWA 5G04J 4A3TA 4C0MA 3FUEA 3EU9A 3FUFA 5CMYA 1H2UA 4HORA 5JJTA 3I3NA 3L22A 3EIJA 4O1OA 4FA6A 3UT8A 4ILGA 5LOZA 2GROB 3ZNGA 2HE0A 5EIBE 1OY3D 1IHBA 2IU1A 3PE4A 1Y6IA 3UIOC 1PY1A 2ZISA 2LAIA 1DNPA 5ITZF 2J09A 2P9SG 3LJ3A 4GZ5A 1YMPA 3Q75A 3DXKG 3P2BA 2R05A 1N4PA 2H6GA 4OVUA 3UINC 4U0UA 2J8SD 2J07A 3ZPJA 4GZ3A 4I2WA 4JB8P 2WQHA 4JA7A 5ENRD 4J8DA 2R5SA 3TL5A 1A5EA 3FEYA 3X2QE 1E7VA 3JXJA 2WQ7A 3CEQA 1L5JA 2B0OE 3DSSA 2L9BA 3VLFA 1H0AA 2LSUA 3CVLA 5LCWC 4I9EA 1FCHA 4Q69A 3W9GA 3DWLG 4K0RA 2LXMA 3FUDA 3HYMB 3S7JA 5FQ8A 5BPPA 1H6OA 4YVQC 2IONA 4L2LA 1OWMA 3OTNA 3QJZA 2J9QA 2A5UA 4ILHB 4EPZA 5KBAA 1TJFA 4WAFA 4AY5A 2FO1E 2WXLA 4AY6A 1SQMA 3QWPA 4EZLA 4GTQA 3FU5A 3LKUA 2MRIA 4LERA 1FVHA 1KT1A 3URZA 5AIJA 2MOWA 2B6CA 4KXKB 4LSZE 4GZDA 3DSUA 5ANLA 3AJIA 2L0IA 5KNHD 3TG5A 4GTVA 3UIPC 4XEIG 1BI8B 3FUNA 3FTSA 1QQEA 5CMWA 4UI9K 4DX6D 3CK8A 2CFZA 1OXJA 3DSWA 3KS2A 1O5MA 4GCNA 2IF4A 5G2NA 3MKRA 4CT4A 1Y8MA 2ZU6B 4CDNA 3ABME 2LNIA 5FZRA 1N4QA 5A6CA 3FULA 3ZHEB 2XPYA 2KZTB 5FJYA 2OEWA 3LY9A 4YDOA 3EHNA 5CBOA 4I2ZA 1Z3YA 1WAO1 5KJKA 5FZSA 4O6FA 1X5BA 3EIQC 4KZ0A 2JLBA 2P2CP 2V4LA 4URKA 2J4DA 5CBNA 2CG3A 4KZCA 1OCZE 1IKND 4IYPA 2C0LA 3ESKA 3T5VA 1UOHA 3MCXA 3SF4A 3GZ2A 1EPUA 2WXNA 3KEZA 3ULQA 5KNGA 3R9AB 4DLQA 3RK6A 5CHEE 2E2EA 5HS0A 2AVPA 2P9PG 5AQAA 3D9IA 4U0SA 3QC1A 2NC9A 2KCKA 2BEDA 3OAWA 2WB2A 1OWNA 4HB5A 1O1SA 1Z3XA 5FTPA 3ABKE 5EKQD 4GYWA 4F1PA 3CV0A 4BERA 4A1GA 4U63A 4F7AA 5G04C 4ME2A 2JEKA 3PZ4A 1OUVA 1JCRA 3FU0A 3DBSA 4TXRA 3Q4AB 1HXIA 3FTVA 3ASNE 4U96D 1UW4B 2XPZA 3Q15A 3TJPA 1TN6A 3CSFA 4YVOA 4AM9A 4TV3A 4EHMA 2WXHA 2XCBA 4XE0A 2ETCA 4Z68A 3WG7E 2MYOA 5JMND 2Y69E 2WXKA 3E32A 3MGBA 2FEZA 3DSVA 3NZUA 2VGXB 3Q9UC 3TXNA 4PH4B 3D9HA 2R2LA 2GRNB 3HXCA 4Q94A 1GW6A 3SFYA 4JW1A 4HXIA 2WXFA 4ANUA 2X6IA 2RKKA 3PS6A 4ZHBA 4MRUA 3R7RA 2WXGA 3IBEA 4TRQA 2J4BA 2ZXWE 3D9MA 3ZHEA 2KZTA 4PS8A 1S70B 5ANRA 4AV7A 3NOGD 3ZFWA 3MV2B 1ELKA 3KD7A 4I1MA 4FHKA 3ASDA 2WXJA 3DRAA 3JCKC 4HOSA 3RKVA 2WXRA 5CERB 2M63A 4GB9A 5FT9A 3I4GA 4KYOB 3TWQA 5EIDA 3D9OA 3FU6A 3GYZA 3NQPA 3LYAA 3ZYMA 3W9FA 3IKOB 5FQ6A 4CDRA 3QDNA 3TWXA 2IOSA 4DRXE 4GTRA 3V2OA 2XENA 3TWSA 5CRUA 3TWWA 3V2XA 3V30A 2XPIA 3CHPA 4U07A 3B7TA 1LD8A 2I1KA 1HS6A 3EHMA 1BLXB 4EBAA 4GCOA 1MX4A 4BFRA 2WXIA 1RW2A 3DXMG 2I6HA 4G23A 2GRMA 4GA1A 1LD7A 3CSTA 3CVYA 4GA0A 5FZQA 1ZB1A 2R02A 5EX0A 3BG1B 3ZYQA 4ANWA 3UM1A 2IJGX 2P9LG 4GTPA 3IHYA 3NAWA 2AXUA 5B1AE 1KT0A 3DEPA 2H6HA 3Q7AA 2L0TB 5AQBA 4M3OA 2AXVA 4I17A 2CHZA 2XGMA 3U9WA 3PUKA 3HDXA 3L17A 4BETA 2NYJA 1EDUA 3ONLA 1NA3A 2H6FA 3B7SA 3SFXA 2BKGA 3ZU7B 3SNXA 2XRZA 1D8DA 1O1RA 5AQ7A 4LNGA 3PZ2A 2VSYA 5FQ4A 3VTXA 1JWGA 1U3CA 2XEEA 1E8XA 2V8SE 3C3RA 3R9MA 5BV0A 3LS8A 4EECA 3ZGQA 4U8VD 2AW6A 1MJ0A 1TNYA 1SA5A 4UQZA 4GMJA 3LXUX 3HVEB 2KCLA 4DK5A 2V5FA 5FIOA 3NF1A 2X6FA 3S7DA 2GRLA 2KXPC 2RFAA 1OCOE 4DLOA 1AP7A 1IQUA 3DSTA 4BT9A 1TN7A 4GMRA 2EQXA 2F8YA 3PUJA 3SI5A 4J7WA 3MV3B 1A17A 1H2TC 4GTMA 1BPOA 3QK0A 4HFGA 1UN9A 4UI9J 2PNNA 2F37A 1O1TA 4FU3A 4AJWA 2WQ6A 4HRNA 3SO8A 3OXLA 5G55A 1VDYA 3HIZA 1E90A 3C3OA 3F6QA 3FUIA 3L6AA 2I9CA 3PZ1A 3O4ZA 4F53A 3PNTB 5ENNA 3BQOA 2V4HC 5D0OD 5CCMA 3AG1E 3FTWA 2Y3AA 3UXGA 2AXZA 1NA0A 4AP2A 2XQ0A 3JUEA 3UKUG 4ANXA 3P1UA 2KM4A 4RQIA 4BESA 3Q49B 3RJVA 1SZAA 3AU4A 1MQSA 4AXHA 4G8LA 3G2WA 3NOCD 4TUMA 3QAQA 3FEXA 2XRYA 5CRVA 3E30A 4U8YD 2DYSE 1N0RA 3PRZA 1E96B 3SZ7A 3PZDA 3L16A 5C2YA 2Y0BG 4JHRA 3FTXA 4N3CA 1D9SA 3MJWA 4I6GA 3I4RB 5HKPA 4U0ZA 2YNQA 2RD0A 4MLPA 2HM8A 4N3AA 3N71A 2PQRA 4K5AB 4BEPA 5J08A 1N54A 1MHQA 4UWHA 2DIWA 5A23A 1JUQA 1TNBA 4FJYA 4A55A 2VSOE 3ML8A 5CEAA 2A4ZA 4XX5A 1HO8A 1WY6A 2ETBA 3HVEA 1XNFA 2P9KG 3FUMA 3VLDA 2BKKB 3RSEG 2ONDA 4GYOA 4G1TA 2QYUA 3CGHA 4GA2A 4JPSA 4NACA 1G3NB 4HRLA 4HRMB 5FWQA 3JUIA 1YYHA 3TWUA 4B8CB 4HI9A 3DPDA 2AWIA 5T4YA 5E75A 3NZSA 2YINA 1UJKA 2V0PA 2XS1A 3U4TA 4WNFA 4DJAA 1K3ZD 2EIKE 1KZPA 5AARA 4APOA 3FHEA 3KSLA 2HR2A 4F6RD 4NRHB 4A3VA 1P5QA 2XGOA 4WNGA 4ABNA 2VJ8A 3CVQA 4A1SA 4WNDA 4DUIA 4DX5D 2PM6A 4L1BA 4JVSA 3FH7A 4XIFA 1FT2A 4G11A 4N3BA 3JXIA 1PC2A 4AEZC 5DBKA 1SW6A 4B8AA 3B13A 2NSZA 2GGFA 2GW1A 5C1DA 3U66A 2XEHA 5EDSA 2WXPA 3Q47B 3KSQA 3J5QB 1S64A 1N0QA 4C0EA 5D2MC 2XCCA 2YHEA 2HO1A 1QBQA 4FJZA 3UM2A 5BNWA 4IULA 4GYYA 3OXGA 1TYQG 4HLLA 4CCAA 5LX8A 3CHQA 5AJLA 4OYSA 1HG2A 3G2SA 3LVQE 3RO3A 4ILIA 4UQXA 3UTMA 1NL4A 3L9TA 1OCCE 2OEVA 1UJJA 5LFAA 2WXOA 3FP3A 4CEMA 2JABA 4HQDA 3KAEA 5H7PA 4J0UA 5B3SE 3T5XA 2BTDA 2XS8A 2XHEA 4AIFA 4GMLA 5JA4D 4JC8A 1SVXA 3IHVA 4JEHA 4UI9C 3D9LA 4YDWA 4CZ2D 3TWVA 3E33A 2ZGDA 3L13A 3Q73A 4E85A 2VGYA 1DVPA 3G2TA 4DI3A 4Y6CA 4RG9A 3MZLB 5JHBA 3CHSA 2VYIA 2WXMA 4XKBA 2AJAA 2X3MA 4K03A 4GPKA 1HU3A 1HFAA 4BX8A 1LF8A 4BTBA 3EDTB 4KVMA 4FULA 3EJNA 1SA4A 4U7EB 5CEDB 1PAQA 3UT7A 2E0IA 3S2AA 3D9PA 1DCQA 1D8EA 5EYPF 2Y4UA 3LPZA 1LTXA 4PS3A 3MYVA 3LCAA 2R03A 4U95D 1MZCA 4A63B 3CK9A 1EF1C 2YHCA 2BF0X 4O60A 3L08A 1KPSB 3FUHA 1U3DA 4RG6A 3TWTA 2LXLA 4BT8A 4V3IA 3TWRA 3FU3A 3HXDA 4DPRA 5LCWJ 4Q96A 1JPLA 5ARGA 4ACLA 5AAOA 4MBGA 1TNUA 2IY0C 5AN8A 3CLJA 1TN8A 2QZAA 1FPPA 3AG2E 1WDYA 3TGOA 2V5QC 2IOLA 3HG0D 4ACKA 5EN5D 2ZGGA 1JCSA 3D9JA 3CKCA 4XI9A 3SGHA 1E7UA 5M72A 3ASGA 3AG4E 3C72A 3FFLA 4ANVA 5AENA 3PDNA 1K8KG 2DBAA 4QQIA 3EU5A 3UQ3A 3AG3E 5FINA 3CR3A 1S0PA 3UKRG 1N95A 1NI1A 4FLBA 1INZA 2OVFA 4I1AA 3TAXA 2GRRB 4I9CA 1AWCB 4JZYA 4RLYA 4F3VA 2Q7FA 2DWZA 3UPVA 4NURA 2EILE 2WM9A 3S7BA 3QWWA 1N94A 1IQRA 4JA9A 3MA5A 2PL2A 3LVRE 2IO2C 4GTTA 2GRQB 1EYHA 4O1PA 4CDMA 4N2QA 1XGWA 1HX8A 1OWPA 3TXMA 2RFMA 3ZYKA 4PUCA 5ENTD 2OCCE 4NQ0A 3KEAA 2VTBA 2FULA 2KBXA 4AOFA 5AQ9A 4J8EA 4W9RA 4EQFA 4DX2A 3V31A 3LDZA 5AYWD 3ZEFA 1BU9A 4WWNA 4JEUA 3UT4A 5J90A 4DX7D 4HI8A 2F8XK 1QYMA 1BI7B 1HG5A 2OV8A
chains in the Genus database with same CATH topology
1SW6A 4J7WA 3IXEA 4K5BA 3LJNA 1MX6A 4C48B 4YDYA 4HB5A 2AJAA 4K5AB 4BEPA 5ITZF 2XZTG 4QQIA 2L6BA 4LNUD 5FINA 1YMPA 4LSZE 1S70B 2XEHA 5ENPD 3HRAA 4CYMD 1OT8A 3NOGD 1NFIE 4OAVB 3DEPA 3AJIA 2DVWA 2PNNA 2F37A 5AQBA 2J8SD 5KNHD 3AAAC 3Q9NC 4ATZD 4F1PA 4HNAD 4ZFHA 4BERA 3J5QB 4JB8P 4HRNA 3SO8A 2VGEA 1N0QA 1AWCB 1BI8B 5CEDB 1DC2A 5EILA 4RLYA 5CEAA 4B93B 4BETA 4DX1A 5ENRD 3F6QA 4UUCA 2Y1LE 1WG0A 2DWZA 2NYJA 5HRYA 1DCQA 4QFVA 4DX6D 5CERB 3T9KA 5EYPF 2ETBA 1A5EA 1IXVA 2QC9A 2V4HC 4HLLA 2BKKB 4K5CA 4U95D 4G8KA 4U96D 4A63B 2BKGA 3ZU7B 3JXJA 4O60A 2B0OE 4NIKA 2A5EA 3TWQA 3UXGA 5AQ7A 5EIDA 3UTMA 4O1PA 3JUEA 4HBDA 3TWTA 2XEEA 3DEOA 5ENQD 5BXUA 4BESA 4BSZB 1G3NB 3UI2A 4HRLA 2RFMA 4LG6A 4HRMB 5CBOA 2ETCA 3T8KA 4Z68A 3TWRA 2JABA 3W9FA 5ENTD 1YYHA 3TWUA 4HQDA 2MYOA 5JMND 3C5RA 4HI9A 4U8VD 3TWXA 2P2CP 3KEAA 3ZUVB 4G8LA 4DRXE 1MJ0A 3W9GA 5ENSD 3V2OA 2DZNA 2XENA 3TWSA 3TWWA 3V2XA 3NOCD 5CBNA 4TUMA 5CECB 2KBXA 3EU9A 3ZKJA 3V30A 3EHQA 1IKND 1K1AA 2DZOA 5AAOA 2QYJA 2XZDG 5KWDA 3B95A 1UOHA 3Q9UC 1K3ZD 4O1OA 1K1BA 4U8YD 5JA4D 5AQ9A 5AARA 3D9HA 5FIOA 1MYOA 1N0RA 2KXPC 5KBAA 5AN8A 2RFAA 3NBNB 1BLXB 3V79K 4F6RD 4OAUC 1SVXA 1BD8A 5KNGA 2FO1E 1MX4A 3ZNGA 2Y0BG 1AP7A 5EYLA 1WDYA 2ETAA 3EHRA 4DX2A 4YDWA 4J8YA 3V31A 2HE0A 2V5QC 3HG0D 4CZ2D 1YCSB 5BXOA 1D9SA 3TWVA 5EIBE 1MX2A 1OY3D 2ZGDA 3J5PA 4DUIA 4DX5D 1BU9A 4GMRA 4ZHBA 5EN5D 4DX7D 4HI8A 5HKPA 2F8XK 2ZGGA 1QYMA 5HS0A 1TR4A 1BI7B 1IHBA 1N11A 2F8YA 5D66A 5ENOD 4N5QA 3B7BA 5AQAA 3JXIA 4GPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW6 A;  4J7W A;  3IXE A;  4K5B A;  3LJN A;  1MX6 A;  4C48 B;  4YDY A;  4HB5 A;  2AJA A;  4K5A B;  4BEP A;  5ITZ F;  2XZT G;  4QQI A;  2L6B A;  4LNU D;  5FIN A;  1YMP A;  4LSZ E;  1S70 B;  2XEH A;  5ENP D;  3HRA A;  4CYM D;  1OT8 A;  3NOG D;  1NFI E;  4OAV B;  3DEP A;  3AJI A;  2DVW A;  2PNN A;  2F37 A;  5AQB A;  2J8S D;  5KNH D;  3AAA C;  3Q9N C;  4ATZ D;  4F1P A;  4HNA D;  4ZFH A;  4BER A;  3J5Q B;  4JB8 P;  4HRN A;  3SO8 A;  2VGE A;  1N0Q A;  1AWC B;  1BI8 B;  5CED B;  1DC2 A;  5EIL A;  4RLY A;  5CEA A;  4B93 B;  4BET A;  4DX1 A;  5ENR D;  3F6Q A;  4UUC A;  2Y1L E;  1WG0 A;  2DWZ A;  2NYJ A;  5HRY A;  1DCQ A;  4QFV A;  4DX6 D;  5CER B;  3T9K A;  5EYP F;  2ETB A;  1A5E A;  1IXV A;  2QC9 A;  2V4H C;  4HLL A;  2BKK B;  4K5C A;  4U95 D;  4G8K A;  4U96 D;  4A63 B;  2BKG A;  3ZU7 B;  3JXJ A;  4O60 A;  2B0O E;  4NIK A;  2A5E A;  3TWQ A;  3UXG A;  5AQ7 A;  5EID A;  3UTM A;  4O1P A;  3JUE A;  4HBD A;  3TWT A;  2XEE A;  3DEO A;  5ENQ D;  5BXU A;  4BES A;  4BSZ B;  1G3N B;  3UI2 A;  4HRL A;  2RFM A;  4LG6 A;  4HRM B;  5CBO A;  2ETC A;  3T8K A;  4Z68 A;  3TWR A;  2JAB A;  3W9F A;  5ENT D;  1YYH A;  3TWU A;  4HQD A;  2MYO A;  5JMN D;  3C5R A;  4HI9 A;  4U8V D;  3TWX A;  2P2C P;  3KEA A;  3ZUV B;  4G8L A;  4DRX E;  1MJ0 A;  3W9G A;  5ENS D;  3V2O A;  2DZN A;  2XEN A;  3TWS A;  3TWW A;  3V2X A;  3NOC D;  5CBN A;  4TUM A;  5CEC B;  2KBX A;  3EU9 A;  3ZKJ A;  3V30 A;  3EHQ A;  1IKN D;  1K1A A;  2DZO A;  5AAO A;  2QYJ A;  2XZD G;  5KWD A;  3B95 A;  1UOH A;  3Q9U C;  1K3Z D;  4O1O A;  1K1B A;  4U8Y D;  5JA4 D;  5AQ9 A;  5AAR A;  3D9H A;  5FIO A;  1MYO A;  1N0R A;  2KXP C;  5KBA A;  5AN8 A;  2RFA A;  3NBN B;  1BLX B;  3V79 K;  4F6R D;  4OAU C;  1SVX A;  1BD8 A;  5KNG A;  2FO1 E;  1MX4 A;  3ZNG A;  2Y0B G;  1AP7 A;  5EYL A;  1WDY A;  2ETA A;  3EHR A;  4DX2 A;  4YDW A;  4J8Y A;  3V31 A;  2HE0 A;  2V5Q C;  3HG0 D;  4CZ2 D;  1YCS B;  5BXO A;  1D9S A;  3TWV A;  5EIB E;  1MX2 A;  1OY3 D;  2ZGD A;  3J5P A;  4DUI A;  4DX5 D;  1BU9 A;  4GMR A;  4ZHB A;  5EN5 D;  4DX7 D;  4HI8 A;  5HKP A;  2F8X K;  2ZGG A;  1QYM A;  5HS0 A;  1TR4 A;  1BI7 B;  1IHB A;  1N11 A;  2F8Y A;  5D66 A;  5ENO D;  4N5Q A;  3B7B A;  5AQA A;  3JXI A;  4GPM A; 
#chains in the Genus database with same CATH topology
 2OVB A;  3DPY A;  3CKB A;  1MX6 A;  3T8M A;  3CHR A;  4CRW A;  1Q2Z A;  3FH5 A;  1N52 A;  2PM7 A;  1B89 A;  4EBA G;  4LRZ A;  1H6K A;  1WG0 A;  3O48 A;  3T9K A;  3FUJ A;  4CT0 A;  1H6P A;  2J08 A;  3Q7F A;  3VTY A;  3U3W A;  1HH8 A;  5BUZ A;  1Z6T A;  4M7C A;  3TG4 A;  4YND A;  4FAD A;  3ZIM A;  5G05 J;  4LEU A;  4YDE A;  4H7X A;  5IY5 E;  4GAA A;  2I2O A;  3CIA A;  4H7Y A;  3CVP A;  5KWD A;  3B95 A;  1K1B A;  2KC7 A;  3C3Q A;  3HHM A;  1FT1 A;  3RU0 A;  3ASF A;  3ASH A;  3NBN B;  3V79 K;  4JHK A;  2KCV A;  3CVV A;  3HXB A;  4GTO A;  3E37 A;  4L2Y A;  5KJM A;  1MX2 A;  2CG2 A;  1JCQ A;  4I1O B;  3FWV A;  5D66 A;  5ENO D;  4N5Q A;  4N5C A;  1TEZ A;  3CHO A;  4K5B A;  3LJN A;  4XZ4 A;  1ZU2 A;  3CHM A;  3B7U X;  3PH0 C;  4J6I A;  4TUU A;  4CYM D;  2XGS A;  5EX3 A;  3ZYL A;  4N39 A;  2UWJ G;  3AAA C;  3NB2 A;  2X6H A;  4I43 A;  3ML9 A;  4DX1 A;  4BSX A;  3U64 A;  3ZRH A;  4EZK A;  2UY1 A;  4I6E A;  1YA0 A;  4G8K A;  4JD2 G;  3FH8 A;  3I5P A;  4BX9 A;  4P29 A;  5KCM A;  2IO3 C;  1KLX A;  3SHF A;  5BXU A;  4HS2 A;  2P58 C;  3SBT B;  1OWL A;  3PE3 A;  3SY2 A;  3ZUV B;  2C0M A;  4IN3 B;  3RO2 A;  1K1A A;  2BUG A;  2QYJ A;  4UWK A;  3APC A;  5JHA A;  3B7R L;  3UM3 A;  3BEE A;  1ZBP A;  4I6J A;  4TXQ A;  1MYO A;  4UWG A;  4PDX A;  4RSY A;  4OAU C;  1BD8 A;  4C9B B;  4G26 A;  1W3B A;  2NXP A;  3MKQ A;  2ETA A;  4BY6 A;  2DYR E;  3IEG A;  3QOU A;  2P9U G;  2PZI A;  3SQV A;  4G2V A;  1TR4 A;  3UX4 A;  3PVL A;  4WWO A;  3ZXS A;  4GZC A;  3JQ0 A;  4WNE A;  4KMO A;  3Q78 A;  4C48 B;  1U2V G;  4L23 A;  4N2S A;  1V55 E;  3SBS A;  2HYZ A;  1V54 E;  4DI4 A;  2XEV A;  5ENP D;  3ZN3 A;  1OT8 A;  2L6J A;  1NFI E;  1FVF A;  1N4R A;  4HVB A;  2KAT A;  3MX3 A;  4FHJ A;  4WUY A;  2FF4 A;  1DCE A;  2IFU A;  4R7L A;  4CGW A;  4JL0 A;  3EUV A;  4XI0 A;  3CVU A;  2X6K A;  2DCP A;  3R7Q A;  4XKC A;  4J8F A;  1TJC A;  3C98 A;  1WM5 A;  5HRY A;  4KT6 B;  2R59 A;  4GZ6 A;  3VLE A;  2QC9 A;  2R17 C;  4K5C A;  3CQG B;  3DSX A;  1HZ4 A;  5HI7 A;  1X81 A;  3RIB A;  4U8H A;  3BUA A;  3G2U A;  4CGV A;  4UWF A;  1NZN A;  1RZ4 A;  3DEO A;  5ENQ D;  3RAU A;  5LP0 A;  3FTY A;  3UI2 A;  4GU5 A;  3T8K A;  4B89 A;  1Z5S C;  2CHW A;  3BU8 A;  4HOT A;  3ULE G;  2EIJ E;  3CQC B;  3UUX A;  2QFC A;  3QAR A;  5CEC B;  4APF A;  3APF A;  3LEW A;  5DIZ A;  4IRU A;  3ZXP A;  4LCT A;  2X38 A;  5T8I A;  3CK7 A;  3AU5 A;  2CHX A;  3J5P A;  3CVX A;  3WXX A;  2P9I G;  4BTA A;  4L7T A;  4MS6 A;  3AS8 A;  3AS5 A;  2WMN A;  3HXE A;  1TNZ A;  3L82 A;  2FI7 A;  3JQ1 A;  1HE8 A;  4LNU D;  3JYS A;  5A7D B;  4UQY A;  4KBQ A;  3HXF A;  2ZIR A;  2LUH A;  3QB2 A;  4L9P A;  3FTZ A;  2DVW A;  2LO6 A;  3Q9N C;  4ZFH A;  5G05 C;  2J49 A;  1E8W A;  1HF8 A;  4HOU A;  2VGE A;  1JWF A;  3ONK A;  5EIL A;  4B93 B;  4HLE A;  2H6I A;  4UUC A;  3RRM B;  4WWP A;  2VTB B;  4UWL A;  3SFZ A;  2LAH A;  4B0Z A;  4HOQ A;  3D9N A;  2WVI A;  4G24 A;  3ZVV A;  2I1J A;  3ESL A;  4BSZ B;  2EIM E;  3ISM C;  4LG6 A;  1OWO A;  1N9A A;  3ABL E;  3C5R A;  2DZN A;  1ELR A;  2YQ8 A;  5JJ6 A;  2DZO A;  1OCR E;  3L54 A;  4FP7 A;  2WXQ A;  3E4B A;  2QY7 A;  1ELW A;  1IHG A;  4U04 A;  3QWV A;  5EYL A;  2VQ2 A;  2WPV A;  3EHR A;  3ASO E;  4J8Y A;  2EIN E;  2WMO A;  1YCS B;  5BXO A;  4KVO A;  3GZ1 A;  1N11 A;  4GPM A;  3FTU A;  3BG0 B;  5HQ8 A;  3IXE A;  5CCL A;  3QNK A;  3FY4 A;  4YDY A;  2XZT G;  2PQN A;  4PS7 A;  4FLH A;  3HRA A;  2F0Y A;  4X8Q A;  2C2L A;  2RG8 A;  1SZ9 A;  4ATZ D;  2ILR A;  4JHJ A;  3ULY A;  1E8Y A;  1H19 A;  1DC2 A;  4Y6W A;  2IQC A;  3LY7 A;  4F1S A;  4BWR A;  5E76 A;  5AJD A;  3AS4 A;  1IXV A;  3RRU A;  3PZ3 A;  2P9N G;  2FO7 A;  3PNL B;  3LY8 A;  4NIK A;  2MHK A;  2Y4T A;  2A5E A;  2LSV A;  4AVX A;  4HBD A;  1TNO A;  4LUN U;  4TXP A;  4ATG A;  4EZJ A;  3OXF A;  3PEU B;  3IV0 A;  4G25 A;  2OOE A;  3UM0 A;  5ENS D;  4D10 C;  5KJL A;  1QNF A;  3SD5 A;  3ZKJ A;  5D0Q D;  3EHQ A;  2XZD G;  5FQ7 A;  1N4S A;  5JJ7 A;  5ARF A;  3APD A;  2VSN A;  3GZS A;  1UN8 A;  2VSX E;  3E34 A;  4MKT A;  4J8S A;  3GW4 A;  3S7F A;  2IEJ A;  4LNB A;  4OVV A;  1UG3 A;  5BV1 A;  5B1B E;  2CFU A;  3B7B A;  3CVN A;  2UY1 B;  2FBN A;  4E6H A;  3FUK A;  4FC8 A;  2VGX A;  4RVB A;  5T3R A;  1QZ2 A;  3D9K A;  2L6B A;  4OAV B;  3PEV B;  3RRN B;  3D3M A;  3FDH A;  4HNA D;  3PRE A;  3UMV A;  1NP7 A;  3Q79 A;  1E8Z A;  1S63 A;  2GRP B;  2Y1L E;  4GTS A;  4QFV A;  3Q5M A;  5KJN A;  4B94 A;  1KZO A;  1IYG A;  3ENE A;  3G2V A;  4JXT A;  3K9I A;  3ZW3 A;  5BW8 C;  2X6J A;  3MEK A;  3MKQ B;  1H2V C;  5BT1 A;  3QKY A;  3CVW A;  5G04 J;  4A3T A;  4C0M A;  3FUE A;  3EU9 A;  3FUF A;  5CMY A;  1H2U A;  4HOR A;  5JJT A;  3I3N A;  3L22 A;  3EIJ A;  4O1O A;  4FA6 A;  3UT8 A;  4ILG A;  5LOZ A;  2GRO B;  3ZNG A;  2HE0 A;  5EIB E;  1OY3 D;  1IHB A;  2IU1 A;  3PE4 A;  1Y6I A;  3UIO C;  1PY1 A;  2ZIS A;  2LAI A;  1DNP A;  5ITZ F;  2J09 A;  2P9S G;  3LJ3 A;  4GZ5 A;  1YMP A;  3Q75 A;  3DXK G;  3P2B A;  2R05 A;  1N4P A;  2H6G A;  4OVU A;  3UIN C;  4U0U A;  2J8S D;  2J07 A;  3ZPJ A;  4GZ3 A;  4I2W A;  4JB8 P;  2WQH A;  4JA7 A;  5ENR D;  4J8D A;  2R5S A;  3TL5 A;  1A5E A;  3FEY A;  3X2Q E;  1E7V A;  3JXJ A;  2WQ7 A;  3CEQ A;  1L5J A;  2B0O E;  3DSS A;  2L9B A;  3VLF A;  1H0A A;  2LSU A;  3CVL A;  5LCW C;  4I9E A;  1FCH A;  4Q69 A;  3W9G A;  3DWL G;  4K0R A;  2LXM A;  3FUD A;  3HYM B;  3S7J A;  5FQ8 A;  5BPP A;  1H6O A;  4YVQ C;  2ION A;  4L2L A;  1OWM A;  3OTN A;  3QJZ A;  2J9Q A;  2A5U A;  4ILH B;  4EPZ A;  5KBA A;  1TJF A;  4WAF A;  4AY5 A;  2FO1 E;  2WXL A;  4AY6 A;  1SQM A;  3QWP A;  4EZL A;  4GTQ A;  3FU5 A;  3LKU A;  2MRI A;  4LER A;  1FVH A;  1KT1 A;  3URZ A;  5AIJ A;  2MOW A;  2B6C A;  4KXK B;  4LSZ E;  4GZD A;  3DSU A;  5ANL A;  3AJI A;  2L0I A;  5KNH D;  3TG5 A;  4GTV A;  3UIP C;  4XEI G;  1BI8 B;  3FUN A;  3FTS A;  1QQE A;  5CMW A;  4UI9 K;  4DX6 D;  3CK8 A;  2CFZ A;  1OXJ A;  3DSW A;  3KS2 A;  1O5M A;  4GCN A;  2IF4 A;  5G2N A;  3MKR A;  4CT4 A;  1Y8M A;  2ZU6 B;  4CDN A;  3ABM E;  2LNI A;  5FZR A;  1N4Q A;  5A6C A;  3FUL A;  3ZHE B;  2XPY A;  2KZT B;  5FJY A;  2OEW A;  3LY9 A;  4YDO A;  3EHN A;  5CBO A;  4I2Z A;  1Z3Y A;  1WAO 1;  5KJK A;  5FZS A;  4O6F A;  1X5B A;  3EIQ C;  4KZ0 A;  2JLB A;  2P2C P;  2V4L A;  4URK A;  2J4D A;  5CBN A;  2CG3 A;  4KZC A;  1OCZ E;  1IKN D;  4IYP A;  2C0L A;  3ESK A;  3T5V A;  1UOH A;  3MCX A;  3SF4 A;  3GZ2 A;  1EPU A;  2WXN A;  3KEZ A;  3ULQ A;  5KNG A;  3R9A B;  4DLQ A;  3RK6 A;  5CHE E;  2E2E A;  5HS0 A;  2AVP A;  2P9P G;  5AQA A;  3D9I A;  4U0S A;  3QC1 A;  2NC9 A;  2KCK A;  2BED A;  3OAW A;  2WB2 A;  1OWN A;  4HB5 A;  1O1S A;  1Z3X A;  5FTP A;  3ABK E;  5EKQ D;  4GYW A;  4F1P A;  3CV0 A;  4BER A;  4A1G A;  4U63 A;  4F7A A;  5G04 C;  4ME2 A;  2JEK A;  3PZ4 A;  1OUV A;  1JCR A;  3FU0 A;  3DBS A;  4TXR A;  3Q4A B;  1HXI A;  3FTV A;  3ASN E;  4U96 D;  1UW4 B;  2XPZ A;  3Q15 A;  3TJP A;  1TN6 A;  3CSF A;  4YVO A;  4AM9 A;  4TV3 A;  4EHM A;  2WXH A;  2XCB A;  4XE0 A;  2ETC A;  4Z68 A;  3WG7 E;  2MYO A;  5JMN D;  2Y69 E;  2WXK A;  3E32 A;  3MGB A;  2FEZ A;  3DSV A;  3NZU A;  2VGX B;  3Q9U C;  3TXN A;  4PH4 B;  3D9H A;  2R2L A;  2GRN B;  3HXC A;  4Q94 A;  1GW6 A;  3SFY A;  4JW1 A;  4HXI A;  2WXF A;  4ANU A;  2X6I A;  2RKK A;  3PS6 A;  4ZHB A;  4MRU A;  3R7R A;  2WXG A;  3IBE A;  4TRQ A;  2J4B A;  2ZXW E;  3D9M A;  3ZHE A;  2KZT A;  4PS8 A;  1S70 B;  5ANR A;  4AV7 A;  3NOG D;  3ZFW A;  3MV2 B;  1ELK A;  3KD7 A;  4I1M A;  4FHK A;  3ASD A;  2WXJ A;  3DRA A;  3JCK C;  4HOS A;  3RKV A;  2WXR A;  5CER B;  2M63 A;  4GB9 A;  5FT9 A;  3I4G A;  4KYO B;  3TWQ A;  5EID A;  3D9O A;  3FU6 A;  3GYZ A;  3NQP A;  3LYA A;  3ZYM A;  3W9F A;  3IKO B;  5FQ6 A;  4CDR A;  3QDN A;  3TWX A;  2IOS A;  4DRX E;  4GTR A;  3V2O A;  2XEN A;  3TWS A;  5CRU A;  3TWW A;  3V2X A;  3V30 A;  2XPI A;  3CHP A;  4U07 A;  3B7T A;  1LD8 A;  2I1K A;  1HS6 A;  3EHM A;  1BLX B;  4EBA A;  4GCO A;  1MX4 A;  4BFR A;  2WXI A;  1RW2 A;  3DXM G;  2I6H A;  4G23 A;  2GRM A;  4GA1 A;  1LD7 A;  3CST A;  3CVY A;  4GA0 A;  5FZQ A;  1ZB1 A;  2R02 A;  5EX0 A;  3BG1 B;  3ZYQ A;  4ANW A;  3UM1 A;  2IJG X;  2P9L G;  4GTP A;  3IHY A;  3NAW A;  2AXU A;  5B1A E;  1KT0 A;  3DEP A;  2H6H A;  3Q7A A;  2L0T B;  5AQB A;  4M3O A;  2AXV A;  4I17 A;  2CHZ A;  2XGM A;  3U9W A;  3PUK A;  3HDX A;  3L17 A;  4BET A;  2NYJ A;  1EDU A;  3ONL A;  1NA3 A;  2H6F A;  3B7S A;  3SFX A;  2BKG A;  3ZU7 B;  3SNX A;  2XRZ A;  1D8D A;  1O1R A;  5AQ7 A;  4LNG A;  3PZ2 A;  2VSY A;  5FQ4 A;  3VTX A;  1JWG A;  1U3C A;  2XEE A;  1E8X A;  2V8S E;  3C3R A;  3R9M A;  5BV0 A;  3LS8 A;  4EEC A;  3ZGQ A;  4U8V D;  2AW6 A;  1MJ0 A;  1TNY A;  1SA5 A;  4UQZ A;  4GMJ A;  3LXU X;  3HVE B;  2KCL A;  4DK5 A;  2V5F A;  5FIO A;  3NF1 A;  2X6F A;  3S7D A;  2GRL A;  2KXP C;  2RFA A;  1OCO E;  4DLO A;  1AP7 A;  1IQU A;  3DST A;  4BT9 A;  1TN7 A;  4GMR A;  2EQX A;  2F8Y A;  3PUJ A;  3SI5 A;  4J7W A;  3MV3 B;  1A17 A;  1H2T C;  4GTM A;  1BPO A;  3QK0 A;  4HFG A;  1UN9 A;  4UI9 J;  2PNN A;  2F37 A;  1O1T A;  4FU3 A;  4AJW A;  2WQ6 A;  4HRN A;  3SO8 A;  3OXL A;  5G55 A;  1VDY A;  3HIZ A;  1E90 A;  3C3O A;  3F6Q A;  3FUI A;  3L6A A;  2I9C A;  3PZ1 A;  3O4Z A;  4F53 A;  3PNT B;  5ENN A;  3BQO A;  2V4H C;  5D0O D;  5CCM A;  3AG1 E;  3FTW A;  2Y3A A;  3UXG A;  2AXZ A;  1NA0 A;  4AP2 A;  2XQ0 A;  3JUE A;  3UKU G;  4ANX A;  3P1U A;  2KM4 A;  4RQI A;  4BES A;  3Q49 B;  3RJV A;  1SZA A;  3AU4 A;  1MQS A;  4AXH A;  4G8L A;  3G2W A;  3NOC D;  4TUM A;  3QAQ A;  3FEX A;  2XRY A;  5CRV A;  3E30 A;  4U8Y D;  2DYS E;  1N0R A;  3PRZ A;  1E96 B;  3SZ7 A;  3PZD A;  3L16 A;  5C2Y A;  2Y0B G;  4JHR A;  3FTX A;  4N3C A;  1D9S A;  3MJW A;  4I6G A;  3I4R B;  5HKP A;  4U0Z A;  2YNQ A;  2RD0 A;  4MLP A;  2HM8 A;  4N3A A;  3N71 A;  2PQR A;  4K5A B;  4BEP A;  5J08 A;  1N54 A;  1MHQ A;  4UWH A;  2DIW A;  5A23 A;  1JUQ A;  1TNB A;  4FJY A;  4A55 A;  2VSO E;  3ML8 A;  5CEA A;  2A4Z A;  4XX5 A;  1HO8 A;  1WY6 A;  2ETB A;  3HVE A;  1XNF A;  2P9K G;  3FUM A;  3VLD A;  2BKK B;  3RSE G;  2OND A;  4GYO A;  4G1T A;  2QYU A;  3CGH A;  4GA2 A;  4JPS A;  4NAC A;  1G3N B;  4HRL A;  4HRM B;  5FWQ A;  3JUI A;  1YYH A;  3TWU A;  4B8C B;  4HI9 A;  3DPD A;  2AWI A;  5T4Y A;  5E75 A;  3NZS A;  2YIN A;  1UJK A;  2V0P A;  2XS1 A;  3U4T A;  4WNF A;  4DJA A;  1K3Z D;  2EIK E;  1KZP A;  5AAR A;  4APO A;  3FHE A;  3KSL A;  2HR2 A;  4F6R D;  4NRH B;  4A3V A;  1P5Q A;  2XGO A;  4WNG A;  4ABN A;  2VJ8 A;  3CVQ A;  4A1S A;  4WND A;  4DUI A;  4DX5 D;  2PM6 A;  4L1B A;  4JVS A;  3FH7 A;  4XIF A;  1FT2 A;  4G11 A;  4N3B A;  3JXI A;  1PC2 A;  4AEZ C;  5DBK A;  1SW6 A;  4B8A A;  3B13 A;  2NSZ A;  2GGF A;  2GW1 A;  5C1D A;  3U66 A;  2XEH A;  5EDS A;  2WXP A;  3Q47 B;  3KSQ A;  3J5Q B;  1S64 A;  1N0Q A;  4C0E A;  5D2M C;  2XCC A;  2YHE A;  2HO1 A;  1QBQ A;  4FJZ A;  3UM2 A;  5BNW A;  4IUL A;  4GYY A;  3OXG A;  1TYQ G;  4HLL A;  4CCA A;  5LX8 A;  3CHQ A;  5AJL A;  4OYS A;  1HG2 A;  3G2S A;  3LVQ E;  3RO3 A;  4ILI A;  4UQX A;  3UTM A;  1NL4 A;  3L9T A;  1OCC E;  2OEV A;  1UJJ A;  5LFA A;  2WXO A;  3FP3 A;  4CEM A;  2JAB A;  4HQD A;  3KAE A;  5H7P A;  4J0U A;  5B3S E;  3T5X A;  2BTD A;  2XS8 A;  2XHE A;  4AIF A;  4GML A;  5JA4 D;  4JC8 A;  1SVX A;  3IHV A;  4JEH A;  4UI9 C;  3D9L A;  4YDW A;  4CZ2 D;  3TWV A;  3E33 A;  2ZGD A;  3L13 A;  3Q73 A;  4E85 A;  2VGY A;  1DVP A;  3G2T A;  4DI3 A;  4Y6C A;  4RG9 A;  3MZL B;  5JHB A;  3CHS A;  2VYI A;  2WXM A;  4XKB A;  2AJA A;  2X3M A;  4K03 A;  4GPK A;  1HU3 A;  1HFA A;  4BX8 A;  1LF8 A;  4BTB A;  3EDT B;  4KVM A;  4FUL A;  3EJN A;  1SA4 A;  4U7E B;  5CED B;  1PAQ A;  3UT7 A;  2E0I A;  3S2A A;  3D9P A;  1DCQ A;  1D8E A;  5EYP F;  2Y4U A;  3LPZ A;  1LTX A;  4PS3 A;  3MYV A;  3LCA A;  2R03 A;  4U95 D;  1MZC A;  4A63 B;  3CK9 A;  1EF1 C;  2YHC A;  2BF0 X;  4O60 A;  3L08 A;  1KPS B;  3FUH A;  1U3D A;  4RG6 A;  3TWT A;  2LXL A;  4BT8 A;  4V3I A;  3TWR A;  3FU3 A;  3HXD A;  4DPR A;  5LCW J;  4Q96 A;  1JPL A;  5ARG A;  4ACL A;  5AAO A;  4MBG A;  1TNU A;  2IY0 C;  5AN8 A;  3CLJ A;  1TN8 A;  2QZA A;  1FPP A;  3AG2 E;  1WDY A;  3TGO A;  2V5Q C;  2IOL A;  3HG0 D;  4ACK A;  5EN5 D;  2ZGG A;  1JCS A;  3D9J A;  3CKC A;  4XI9 A;  3SGH A;  1E7U A;  5M72 A;  3ASG A;  3AG4 E;  3C72 A;  3FFL A;  4ANV A;  5AEN A;  3PDN A;  1K8K G;  2DBA A;  4QQI A;  3EU5 A;  3UQ3 A;  3AG3 E;  5FIN A;  3CR3 A;  1S0P A;  3UKR G;  1N95 A;  1NI1 A;  4FLB A;  1INZ A;  2OVF A;  4I1A A;  3TAX A;  2GRR B;  4I9C A;  1AWC B;  4JZY A;  4RLY A;  4F3V A;  2Q7F A;  2DWZ A;  3UPV A;  4NUR A;  2EIL E;  2WM9 A;  3S7B A;  3QWW A;  1N94 A;  1IQR A;  4JA9 A;  3MA5 A;  2PL2 A;  3LVR E;  2IO2 C;  4GTT A;  2GRQ B;  1EYH A;  4O1P A;  4CDM A;  4N2Q A;  1XGW A;  1HX8 A;  1OWP A;  3TXM A;  2RFM A;  3ZYK A;  4PUC A;  5ENT D;  2OCC E;  4NQ0 A;  3KEA A;  2VTB A;  2FUL A;  2KBX A;  4AOF A;  5AQ9 A;  4J8E A;  4W9R A;  4EQF A;  4DX2 A;  3V31 A;  3LDZ A;  5AYW D;  3ZEF A;  1BU9 A;  4WWN A;  4JEU A;  3UT4 A;  5J90 A;  4DX7 D;  4HI8 A;  2F8X K;  1QYM A;  1BI7 B;  1HG5 A;  2OV8 A; 
#chains in the Genus database with same CATH homology
 1SW6 A;  4J7W A;  3IXE A;  4K5B A;  3LJN A;  1MX6 A;  4C48 B;  4YDY A;  4HB5 A;  2AJA A;  4K5A B;  4BEP A;  5ITZ F;  2XZT G;  4QQI A;  2L6B A;  4LNU D;  5FIN A;  1YMP A;  4LSZ E;  1S70 B;  2XEH A;  5ENP D;  3HRA A;  4CYM D;  1OT8 A;  3NOG D;  1NFI E;  4OAV B;  3DEP A;  3AJI A;  2DVW A;  2PNN A;  2F37 A;  5AQB A;  2J8S D;  5KNH D;  3AAA C;  3Q9N C;  4ATZ D;  4F1P A;  4HNA D;  4ZFH A;  4BER A;  3J5Q B;  4JB8 P;  4HRN A;  3SO8 A;  2VGE A;  1N0Q A;  1AWC B;  1BI8 B;  5CED B;  1DC2 A;  5EIL A;  4RLY A;  5CEA A;  4B93 B;  4BET A;  4DX1 A;  5ENR D;  3F6Q A;  4UUC A;  2Y1L E;  1WG0 A;  2DWZ A;  2NYJ A;  5HRY A;  1DCQ A;  4QFV A;  4DX6 D;  5CER B;  3T9K A;  5EYP F;  2ETB A;  1A5E A;  1IXV A;  2QC9 A;  2V4H C;  4HLL A;  2BKK B;  4K5C A;  4U95 D;  4G8K A;  4U96 D;  4A63 B;  2BKG A;  3ZU7 B;  3JXJ A;  4O60 A;  2B0O E;  4NIK A;  2A5E A;  3TWQ A;  3UXG A;  5AQ7 A;  5EID A;  3UTM A;  4O1P A;  3JUE A;  4HBD A;  3TWT A;  2XEE A;  3DEO A;  5ENQ D;  5BXU A;  4BES A;  4BSZ B;  1G3N B;  3UI2 A;  4HRL A;  2RFM A;  4LG6 A;  4HRM B;  5CBO A;  2ETC A;  3T8K A;  4Z68 A;  3TWR A;  2JAB A;  3W9F A;  5ENT D;  1YYH A;  3TWU A;  4HQD A;  2MYO A;  5JMN D;  3C5R A;  4HI9 A;  4U8V D;  3TWX A;  2P2C P;  3KEA A;  3ZUV B;  4G8L A;  4DRX E;  1MJ0 A;  3W9G A;  5ENS D;  3V2O A;  2DZN A;  2XEN A;  3TWS A;  3TWW A;  3V2X A;  3NOC D;  5CBN A;  4TUM A;  5CEC B;  2KBX A;  3EU9 A;  3ZKJ A;  3V30 A;  3EHQ A;  1IKN D;  1K1A A;  2DZO A;  5AAO A;  2QYJ A;  2XZD G;  5KWD A;  3B95 A;  1UOH A;  3Q9U C;  1K3Z D;  4O1O A;  1K1B A;  4U8Y D;  5JA4 D;  5AQ9 A;  5AAR A;  3D9H A;  5FIO A;  1MYO A;  1N0R A;  2KXP C;  5KBA A;  5AN8 A;  2RFA A;  3NBN B;  1BLX B;  3V79 K;  4F6R D;  4OAU C;  1SVX A;  1BD8 A;  5KNG A;  2FO1 E;  1MX4 A;  3ZNG A;  2Y0B G;  1AP7 A;  5EYL A;  1WDY A;  2ETA A;  3EHR A;  4DX2 A;  4YDW A;  4J8Y A;  3V31 A;  2HE0 A;  2V5Q C;  3HG0 D;  4CZ2 D;  1YCS B;  5BXO A;  1D9S A;  3TWV A;  5EIB E;  1MX2 A;  1OY3 D;  2ZGD A;  3J5P A;  4DUI A;  4DX5 D;  1BU9 A;  4GMR A;  4ZHB A;  5EN5 D;  4DX7 D;  4HI8 A;  5HKP A;  2F8X K;  2ZGG A;  1QYM A;  5HS0 A;  1TR4 A;  1BI7 B;  1IHB A;  1N11 A;  2F8Y A;  5D66 A;  5ENO D;  4N5Q A;  3B7B A;  5AQA A;  3JXI A;  4GPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...