3SO8A

Crystal structure of ankra
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
NSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ankyrin repeat family A protein 2
total genus 49
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3so8A00
5EYPF 3IXEA 3Q9UC 2F8XK 5HS0A 1D9SA 3TWSA 4JB8P 2F8YA 5EN5D 3T9KA 3AAAC 3TWQA 3JXIA 4BEPA 4F6RD 2XZDG 5EIBE 2ZGDA 4QQIA 1OY3D 2FO1E 2V4HC 2XEHA 3HG0D 4BERA 4O60A 4A63B 4HBDA 2P2CP 4J7WA 1BLXB 1MX2A 2KBXA 1DC2A 1A5EA 2RFAA 5FINA 3V79K 3AJIA 4LNUD 3NOGD 4HLLA 3TWWA 4N5QA 4ATZD 5ENRD 4U8YD 4GMRA 5FIOA 1SVXA 4HRLA 3F6QA 3V30A 5EYLA 5HRYA 4DX2A 3TWRA 3UTMA 1WG0A 1K1BA 2AJAA 3EU9A 5ITZF 4K5AB 5EIDA 1IHBA 2ETBA 4HRMB 2V5QC 4GPMA 4ZFHA 1SW6A 4G8KA 4HB5A 1TR4A 1UOHA 1IKND 2KXPC 4TUMA 3ZU7B 1AP7A 2MYOA 4DX5D 5CECB 4U95D 4CYMD 3V31A 4C48B 3B95A 5JA4D 2DWZA 3B7BA 5KNHD 3HRAA 4BETA 5CEDB 4U8VD 4G8LA 3SO8A 5HKPA 4HNAD 1BI8B 3W9FA 2PNNA 1YMPA 2BKKB 3V2XA 3ZUVB 2ETAA 4DX7D 1IXVA 1BI7B 5ENPD 3UXGA 3ZKJA 4HI8A 2Y0BG 3LJNA 5BXOA 3DEOA 4HRNA 4UUCA 5AQAA 5AAOA 5AARA 5AN8A 4U96D 2BKGA 5AQ9A 1NFIE 3EHRA 1G3NB 5AQ7A 2Y1LE 4CZ2D 5CEAA 4OAVB 2QC9A 5D66A 4O1PA 1N0RA 4DRXE 5ENQD 1MX4A 3J5QB 4J8YA 1MJ0A 4LSZE 3KEAA 3W9GA 1WDYA 2B0OE 4NIKA 2VGEA 5JMND 1OT8A 1MYOA 4YDYA 3JUEA 4LG6A 5ENTD 3C5RA 4HQDA 3TWUA 4OAUC 2XENA 3JXJA 4B93B 4ZHBA 1MX6A 2ZGGA 4YDWA 5ENSD 2DZNA 4HI9A 4BSZB 3Q9NC 1S70B 2JABA 1BD8A 1YCSB 3J5PA 3UI2A 5KWDA 1AWCB 1BU9A 2XZTG 4RLYA 1QYMA 2XEEA 5CBOA 4DUIA 1K3ZD 3NBNB 4QFVA 1YYHA 4F1PA 3T8KA 2QYJA 4DX6D 5CBNA 4K5CA 1DCQA 2L6BA 5CERB 2A5EA 3TWTA 2ETCA 1N0QA 5ENOD 5KNGA 4K5BA 4O1OA 3V2OA 5BXUA 1K1AA 2F37A 5EILA 2J8SD 2DVWA 5KBAA 2HE0A 2RFMA 3DEPA 4BESA 3D9HA 2NYJA 3TWVA 3ZNGA 5AQBA 4DX1A 4Z68A 2DZOA 3NOCD 3EHQA 3TWXA 1N11A
chains in the Genus database with same CATH superfamily
3KSLA 3LY7A 2MRIA 4A3TA 3KEZA 3TWQA 1NA3A 3EUVA 4TV3A 4ACKA 4H7XA 1DNPA 1N9AA 2FEZA 4GTSA 3IHYA 4N5QA 3FH7A 5FQ4A 3V30A 4J8FA 2C0MA 2VGXB 4EZKA 2MYOA 2H6IA 4U95D 4CYMD 4I2ZA 3U66A 3UM2A 3Q7FA 2GW1A 4F3VA 4HNAD 2CG2A 2BKKB 3CIAA 3V2XA 3E32A 3CHQA 3ZKJA 2LUHA 3AS8A 3SFYA 3C3OA 4CT0A 4N5CA 3FTWA 2ZU6B 1U3CA 1NFIE 1G3NB 2JLBA 4XIFA 3ZXPA 2I9CA 2VSXE 2VSNA 1EF1C 2EILE 3ZYKA 2B0OE 3APFA 3RRUA 3Q79A 3CK7A 3JXJA 1E90A 2ZGGA 3DRAA 4TXQA 2OEVA 4A3VA 3QB2A 4FU3A 2ZIRA 3D9PA 3T8KA 4APOA 4UQXA 1H2UA 2ETCA 4ILHB 5AYWD 4HS2A 4Y6WA 3CHMA 4DLQA 5B1BE 4LCTA 4H7YA 1UW4B 2WXFA 3QWPA 4EQFA 3IXEA 3S7JA 2J08A 3IKOB 3T9KA 3B7UX 3TXMA 2WMNA 5T3RA 3BQOA 2ZGDA 1FCHA 4GTMA 3SD5A 2FO1E 4BERA 3FEYA 4A63B 2OEWA 3PZ3A 2RKKA 4F7AA 4I17A 3Q49B 1Z6TA 1V55E 4JPSA 2EQXA 1IHBA 1TNYA 3AG2E 2BUGA 4J8EA 4N3AA 3ZU7B 5CECB 2NSZA 2P9LG 3CK8A 3NZUA 5T4YA 5BUZA 3L6AA 5HKPA 4DX7D 3FTSA 3R7RA 3FWVA 3SBTB 3E30A 4I1AA 1N0RA 1MJ0A 4CGWA 4L7TA 4NIKA 4B93B 3FUHA 4OVVA 3UI2A 4XX5A 2CHZA 4GMJA 5CBNA 4AY6A 4PDXA 1OUVA 2F0YA 3LS8A 3IEGA 3IBEA 4HLEA 5EX0A 3FEXA 3NOCD 4GZDA 4RQIA 4UI9J 3GW4A 4WWPA 3S7DA 3QAQA 1JWFA 1HG2A 1E8WA 2XGSA 4GU5A 5FZSA 2IQCA 1H0AA 3HIZA 2AXUA 3PEUB 5ITZF 5T8IA 4BT9A 5CRUA 2V5QC 2B6CA 1QNFA 4DPRA 3Q4AB 4JL0A 2EIKE 1Q2ZA 5CEDB 4G11A 4V3IA 1S63A 2LXMA 5AQAA 3PUKA 2R05A 5E75A 4ABNA 4U96D 2C2LA 5FJYA 5CEAA 3GZSA 4M3OA 3FP3A 2WXHA 3MKQA 4HQDA 3FUDA 4XI9A 2XRZA 1YCSB 2I6HA 3L17A 2WXRA 4Q96A 3CQGB 4CEMA 3FUMA 3KD7A 2OV8A 4GAAA 4URKA 2R5SA 3OTNA 4WNEA 4GB9A 5ENOD 3DXMG 3PH0C 2DVWA 5CHEE 3D9HA 2IONA 2X38A 4UWKA 4U0UA 2OOEA 3Q9UC 5HS0A 3QARA 3AAAC 2LNIA 2V8SE 1OCRE 1TYQG 2X6KA 5FQ8A 2H6GA 4G2VA 2QFCA 1JUQA 4W9RA 1H2TC 3FU6A 1BLXB 1MX2A 1OWMA 4GTTA 2P9KG 2RFAA 5FINA 3V79K 4B0ZA 3FTVA 4U8YD 3Q7AA 4GMRA 5FIOA 3VLEA 4FHJA 2XQ0A 1UN9A 2PQNA 3CVXA 3L9TA 3CR3A 3PS6A 1SW6A 3FY4A 4GTPA 4WNGA 3RK6A 1ELRA 3SFXA 4XE0A 4HORA 5G55A 4L23A 3C3RA 3ZRHA 2JEKA 1BI8B 4UI9C 3LDZA 3KS2A 1KZPA 5FT9A 1OCOE 3UXGA 1O1RA 2UY1A 3CVPA 2PM6A 4UWGA 3U64A 3FU0A 1V54E 4AIFA 3JQ0A 3KEAA 3APCA 3HVEB 5CCMA 3BG0B 1X81A 5LX8A 5ENTD 3LY9A 2Q7FA 2DYSE 2XEVA 2WQ6A 4P29A 1SZ9A 1H6OA 1MX6A 5EKQD 4ZHBA 4HI9A 2LO6A 1TN6A 2CG3A 2J9QA 4JW1A 1BU9A 4RLYA 2QYUA 3D9JA 4Q69A 3CKCA 4F1PA 3PE3A 1S64A 2KCKA 4BX9A 4UWLA 4MKTA 2P9IG 1IYGA 4JA9A 5ARFA 2IEJA 2H6HA 4G26A 5EN5D 4FC8A 4F6RD 3Q5MA 3C98A 5A23A 3UKRG 3PDNA 3HHMA 5FQ6A 4U07A 3R9AB 3CGHA 3U3WA 3RKVA 4ATZD 5ENRD 2LSVA 3RO2A 2BF0X 5EYLA 2PQRA 4DX2A 5EIDA 2AVPA 4G24A 1IKND 1WAO1 3LY8A 4L9PA 2CFZA 2VGXA 3W9FA 3S7FA 2WXJA 2WXKA 3BG1B 1FT1A 2IFUA 5AQ9A 3PZ2A 1OCCE 5H7PA 4N3BA 5ENQD 1JCRA 1WDYA 2EIME 3LYAA 4A1SA 1HXIA 2IJGX 3J5PA 4Q94A 2HYZA 3HDXA 4B89A 4EPZA 3CVUA 3ZFWA 2L6BA 3ZEFA 2CHXA 2ZXWE 2LXLA 2MHKA 5B3SE 4GZ5A 3L08A 5ARGA 4ANUA 3CHSA 3TL5A 2NYJA 3PEVB 4EZJA 4A55A 1QBQA 3JXIA 4BTAA 4C9BB 3ULQA 2J49A 4GMLA 4AEZC 2YHEA 2LAHA 3FH8A 2ILRA 3LEWA 2WM9A 3TWRA 4GYWA 3UTMA 1K1BA 3AS4A 5AJDA 1JPLA 4HRMB 3FU5A 1B89A 2KXPC 2E2EA 1H6KA 4BETA 5FQ7A 4MBGA 4G1TA 4UQYA 3ZYQA 4BSXA 3BUAA 3KSQA 4ILIA 2Y0BG 4I43A 3ZN3A 4HRNA 4GPKA 5KJMA 5FZQA 3SNXA 3EHMA 2VSOE 5DIZA 3SI5A 3UM0A 3L22A 1MX4A 5JJTA 3SHFA 3ZYLA 4WNFA 2YINA 4LG6A 3MZLB 3C5RA 1NA0A 3ML9A 2DZNA 2QY7A 3L16A 5J90A 4QFVA 4A1GA 4DX6D 2FF4A 3HXDA 2M63A 3TJPA 4DJAA 4O1OA 1ZBPA 4JHJA 2R59A 3PZ1A 2RFMA 3TWVA 3CHPA 4XEIG 3AU5A 1W3BA 3EIJA 2F8YA 2GRMA 2R2LA 4HOUA 3T5XA 3URZA 1ELKA 3MKRA 2P2CP 4JD2G 2KBXA 1KLXA 3AJIA 1U3DA 4XZ4A 3TWWA 5D0OD 4HRLA 3QC1A 3Q73A 2J4DA 2J4BA 3R9MA 4IN3B 1TR4A 1UOHA 3I4RB 2H6FA 4KBQA 3ENEA 3CHRA 3ULEG 4G8LA 3RRNB 2C0LA 4I6GA 5AAOA 2ZISA 4U04A 2L6JA 2DCPA 3AU4A 3EHRA 2AWIA 2PL2A 4J8YA 2R03A 3C72A 1NL4A 3ASOE 3W9GA 1ELWA 3MX3A 1OT8A 4I2WA 1MYOA 4PS7A 4U7EB 2YNQA 3QKYA 4OAUC 2VYIA 3ASGA 3Q9NC 4MLPA 2VGYA 4NRHB 4N3CA 4JA7A 2HO1A 3ONKA 1IHGA 2XCCA 2HR2A 2KCLA 2I2OA 1NI1A 4RG9A 3LPZA 3SFZA 4B94A 3U4TA 4PUCA 2P9PG 4ACLA 4DX1A 5KJLA 2KM4A 3UIOC 3JQ1A 2NXPA 3FUKA 3U9WA 4EBAG 2GRPB 4QQIA 5CMYA 2XEHA 2WXNA 2Y3AA 4GTOA 3ABME 5HRYA 2RD0A 2GRQB 3E37A 4K5AB 2WXGA 3FH5A 4AOFA 4LNGA 3PNTB 3HXFA 3B7BA 5KNHD 2UY1B 3UPVA 4F53A 3SY2A 1XGWA 3B7TA 1HE8A 1KT1A 2IOSA 4GZ3A 4RSYA 2KZTB 2X3MA 3ONLA 3EJNA 2DBAA 4LSZE 1N4PA 3NZSA 2GRNB 3S2AA 3PVLA 4N2SA 2PM7A 3ESLA 2XZTG 4C0MA 5A6CA 3DXKG 4K0RA 1U2VG 4DI4A 4U0SA 5AJLA 3C3QA 2V5FA 5BXUA 1OWLA 2J07A 3NAWA 4IRUA 2R17C 3IV0A 4GZCA 3JUIA 1KPSB 1D9SA 4JB8P 4IYPA 1HF8A 1E7VA 4WWNA 3VTYA 4JVSA 4O60A 4JHKA 4HBDA 3JCKC 2OVBA 3FHEA 4N2QA 2P9SG 1WG0A 4FA6A 2IOLA 4DI3A 4FJZA 4HB5A 3SZ7A 3Q15A 3E33A 3D3MA 5ENNA 4GZ6A 4I1OB 1P5QA 4J0UA 3MGBA 1YMPA 4ANVA 3UT4A 5BXOA 3HYMB 3WXXA 2Y1LE 2QC9A 4KVOA 4O1PA 1QQEA 1JCQA 3NB2A 3O48A 2VGEA 2CFUA 1ZU2A 2IU1A 4EECA 3ULYA 1N4RA 1DCEA 3RRMB 5G2NA 1UJJA 2XGOA 5KWDA 2VTBA 2YQ8A 3HXBA 1OWNA 1DCQA 1UG3A 4G25A 2X6FA 1E8XA 3ZIMA 4N39A 1E7UA 3ZVVA 2WQ7A 3RU0A 3DEPA 3SQVA 4L2LA 3O4ZA 5EYPF 4YDOA 4GTRA 4WUYA 3CLJA 2A5UA 4E6HA 4UWHA 4GTVA 3Q47B 1O1TA 5BNWA 1A5EA 2WMOA 4ATGA 5LCWC 3ABLE 5ANRA 1TNBA 3FTXA 3UM3A 4K03A 2WXLA 1SQMA 1SZAA 1TNOA 1A17A 2WXMA 5JA4D 3MYVA 2L0IA 3ZHEB 2I1KA 4I1MA 2PNNA 4FLHA 3D9MA 3UKUG 3CSTA 3LJNA 4TXPA 3QOUA 3CEQA 4PS3A 4AJWA 1IQRA 1E8YA 5AQ7A 1HG5A 4DRXE 4GTQA 1UN8A 4CRWA 3TWUA 4TRQA 4LEUA 4YDWA 3FUIA 2XRYA 4F1SA 4GYOA 2GGFA 2XGMA 3CVNA 4HOQA 4X8QA 4WNDA 5CMWA 5EX3A 3CVVA 3MKQB 1WM5A 4L2YA 2F37A 1H6PA 5EILA 3BEEA 3CVLA 2HE0A 4CDNA 3AS5A 2V0PA 5D2MC 4BESA 3ABKE 1MHQA 2DZOA 3EHQA 3TWXA 1N11A 3RSEG 3NF1A 1N4SA 4UI9K 4BX8A 2L0TB 1TN8A 2DYRE 1OY3D 3RO3A 4AY5A 5D0QD 1LF8A 5JJ7A 2KZTA 4LNUD 2HM8A 4G8KA 5JHBA 3N71A 4TUMA 1AP7A 4ME2A 4BT8A 3LCAA 4I6EA 4C48B 3BU8A 3HRAA 3WG7E 3FUEA 5IY5E 3CVYA 1JCSA 3MEKA 1K8KG 4FULA 2WB2A 4TXRA 3K9IA 3GYZA 2XPZA 2J09A 3AG1E 4MS6A 3TGOA 3ASDA 3FU3A 5CCLA 5JMND 3I5PA 5FZRA 3JUEA 4HVBA 3DSUA 5HI7A 1S70B 1BD8A 3X2QE 2FI7A 4K5CA 2WVIA 4CT4A 2XS1A 4HXIA 2BTDA 3ISMC 3PE4A 4Y6CA 2GRRB 4I6JA 3RJVA 4KZCA 1HX8A 2XPIA 1SA5A 4PS8A 4L1BA 3DSSA 5BPPA 1WY6A 2FBNA 2I1JA 1TNUA 3AG3E 1NZNA 1PY1A 2OCCE 4U8HA 4OVUA 3D9OA 4HLLA 3ASNE 1OWOA 4ZFHA 2KCVA 3B7SA 5BV1A 1E96B 2AXZA 3TG4A 3V31A 3PZDA 2WXPA 3UMVA 3SO8A 3SGHA 3CHOA 3QK0A 5J08A 1S0PA 4ANWA 3DSXA 3FUFA 3ZPJA 3FFLA 5KJNA 1L5JA 1TJCA 4FHKA 2QZAA 4HFGA 5BT1A 4ANXA 3IHVA 3I3NA 3QDNA 2XENA 1KZOA 5G04J 1Y6IA 3DSTA 5CBOA 5G05J 1IQUA 2VJ8A 3CQCB 3ZXSA 5ANLA 5CERB 3VLFA 3DBSA 4KYOB 4E85A 2XPYA 1FVHA 1XNFA 2P9UG 4EZLA 3FULA 3D9KA 4YNDA 2KC7A 4NQ0A 3ZHEA 4BEPA 2XZDG 5EIBE 3HXCA 4J7WA 4CCAA 4NACA 4RVBA 1N95A 3RIBA 4ILGA 3CVQA 1TN7A 1OWPA 4EBAA 3CSFA 4BTBA 3LJ3A 2ETBA 1LD7A 2XS8A 3G2VA 3OXGA 2UWJG 3LXUX 3B95A 2DWZA 2X6JA 1EPUA 4O6FA 5LCWJ 1INZA 3T8MA 4AVXA 1TJFA 3HVEA 3FTUA 3UX4A 4PH4B 1HFAA 4B8CB 3P1UA 1IXVA 1BI7B 3EHNA 5M72A 3DEOA 4YVQC 3MA5A 2BEDA 5AARA 4U63A 5AN8A 4LUNU 3I4GA 2AW6A 5JJ6A 3LVQE 3J5QB 4HOTA 1E8ZA 1TEZA 2VQ2A 2IF4A 4WAFA 4JEUA 4KZ0A 5FWQA 3FUNA 2X6IA 4XI0A 2JABA 5AIJA 2WQHA 2FO7A 1FPPA 4FJYA 4D10C 1K3ZD 3NBNB 1HH8A 4KVMA 2WXIA 2WXOA 3DPYA 5AENA 1N0QA 5HQ8A 5KNGA 3QNKA 4K5BA 1K1AA 3G2SA 3FTYA 3HXEA 3EIQC 1YYHA 2KATA 2F8XK 3TWSA 2OVFA 4UQZA 2V4HC 4KMOA 1HZ4A 3OAWA 5BW8C 3PNLB 3UINC 3OXFA 5LOZA 2RG8A 3CV0A 2FULA 4JHRA 3EU5A 1SVXA 1NP7A 4FADA 4AP2A 4GPMA 5G04C 3MJWA 4I9EA 1D8DA 2GRLA 5KCMA 4J8SA 3FTZA 1DVPA 4G23A 2WXQA 3S7BA 3ZUVB 5EDSA 5ENPD 2GROB 3VTXA 1HU3A 3DPDA 4IULA 3L54A 4UWFA 5LP0A 1O1SA 1Z5SC 4CZ2D 2NC9A 2E0IA 1X5BA 4CDRA 2A4ZA 4J6IA 4APFA 3DSVA 3G2WA 1FVFA 3VLDA 2WPVA 3NQPA 1N94A 3B13A 4U0ZA 3OXLA 2XEEA 3L82A 4BY6A 3QWWA 5E76A 2QYJA 2DIWA 5FTPA 2A5EA 3TAXA 3ASFA 3ZW3A 3SBSA 4YVOA 3FUJA 4AV7A 3P2BA 3SF4A 3V2OA 1D8EA 3ASHA 4BFRA 3AG4E 3E4BA 1KT0A 3TG5A 4DK5A 2V4LA 3HG0D 1H19A 2EIJE 1DC2A 2Y4UA 3MV2B 4KXKB 4YDEA 1JWGA 2EINE 3TXNA 3GZ1A 1N54A 4MRUA 4FP7A 2P9NG 4FLBA 1TNZA 1RZ4A 3MV3B 1O5MA 2VTBB 4M7CA 4I9CA 1OXJA 4GYYA 3RAUA 4UUCA 1Z3XA 3PUJA 3R7QA 3UM1A 2BKGA 1Z3YA 1RW2A 3KAEA 2YHCA 3ML8A 4OAVB 2ONDA 5D66A 3CKBA 3D9NA 1N52A 5CRVA 1MZCA 1HO8A 4YDYA 3JYSA 3LKUA 4CDMA 2LAIA 1LTXA 4GA1A 5ENSD 4BSZB 3L13A 3D9LA 3DSWA 1GW6A 2IO2C 4J8DA 4DLOA 2VSYA 4DUIA 4CGVA 1H2VC 1BPOA 3MCXA 1FT2A 1VDYA 4BWRA 3CK9A 5KBAA 2R02A 3G2UA 3ZGQA 5AQBA 4Z68A 4GA2A 5LFAA 5G05C 3E34A 2PZIA 2L9BA 4AM9A 5JHAA 4TUUA 3UIPC 3PRZA 2XCBA 4JZYA 4WWOA 4AXHA 3NOGD 2IO3C 5C1DA 3F6QA 4GCOA 2AJAA 3CVWA 3EU9A 3G2TA 1EDUA 4GCNA 3LVRE 2Y4TA 2AXVA 4DX5D 1EYHA 1PC2A 2LSUA 3QWVA 4NURA 1QZ2A 4U8VD 5KJKA 3PREA 3UUXA 4RG6A 2P58C 2IY0C 2ETAA 3GZ2A 3UT7A 4OYSA 1YA0A 4HI8A 2Y69E 4LERA 1OCZE 1Y8MA 3DWLG 4JEHA 4EHMA 1UJKA 2X6HA 4JXTA 4LNBA 3QJZA 5A7DB 3FDHA 4XKBA 3PZ4A 3Q78A 1ZB1A 3Q75A 1MQSA 1AWCB 3D9IA 3B7RL 2CHWA 1QYMA 3ESKA 1SA4A 4LRZA 5B1AE 4JC8A 4KT6B 3UQ3A 3UT8A 4HOSA 4R7LA 5C2YA 3APDA 3TWTA 4XKCA 2XHEA 2MOWA 1N4QA 4C0EA 4B8AA 1LD8A 3EDTB 2J8SD 3T5VA 3ZYMA 3ZNGA 1HS6A 1PAQA 4GA0A 5DBKA 5BV0A
chains in the Genus database with same CATH topology
5EYPF 3IXEA 3Q9UC 2F8XK 5HS0A 1D9SA 3TWSA 4JB8P 2F8YA 5EN5D 3T9KA 3AAAC 3TWQA 3JXIA 4BEPA 4F6RD 2XZDG 5EIBE 2ZGDA 4QQIA 1OY3D 2FO1E 2V4HC 2XEHA 3HG0D 4BERA 4O60A 4A63B 4HBDA 2P2CP 4J7WA 1BLXB 1MX2A 2KBXA 1DC2A 1A5EA 2RFAA 5FINA 3V79K 3AJIA 4LNUD 3NOGD 4HLLA 3TWWA 4N5QA 4ATZD 5ENRD 4U8YD 4GMRA 5FIOA 1SVXA 4HRLA 3F6QA 3V30A 5EYLA 5HRYA 4DX2A 3TWRA 3UTMA 1WG0A 1K1BA 2AJAA 3EU9A 5ITZF 4K5AB 5EIDA 1IHBA 2ETBA 4HRMB 2V5QC 4GPMA 4ZFHA 1SW6A 4G8KA 4HB5A 1TR4A 1UOHA 1IKND 2KXPC 4TUMA 3ZU7B 1AP7A 2MYOA 4DX5D 5CECB 4U95D 4CYMD 3V31A 4C48B 3B95A 5JA4D 2DWZA 3B7BA 5KNHD 3HRAA 4BETA 5CEDB 4U8VD 4G8LA 3SO8A 5HKPA 4HNAD 1BI8B 3W9FA 2PNNA 1YMPA 2BKKB 3V2XA 3ZUVB 2ETAA 4DX7D 1IXVA 1BI7B 5ENPD 3UXGA 3ZKJA 4HI8A 2Y0BG 3LJNA 5BXOA 3DEOA 4HRNA 4UUCA 5AQAA 5AAOA 5AARA 5AN8A 4U96D 2BKGA 5AQ9A 1NFIE 3EHRA 1G3NB 5AQ7A 2Y1LE 4CZ2D 5CEAA 4OAVB 2QC9A 5D66A 4O1PA 1N0RA 4DRXE 5ENQD 1MX4A 3J5QB 4J8YA 1MJ0A 4LSZE 3KEAA 3W9GA 1WDYA 2B0OE 4NIKA 2VGEA 5JMND 1OT8A 1MYOA 4YDYA 3JUEA 4LG6A 5ENTD 3C5RA 4HQDA 3TWUA 4OAUC 2XENA 3JXJA 4B93B 4ZHBA 1MX6A 2ZGGA 4YDWA 5ENSD 2DZNA 4HI9A 4BSZB 3Q9NC 1S70B 2JABA 1BD8A 1YCSB 3J5PA 3UI2A 5KWDA 1AWCB 1BU9A 2XZTG 4RLYA 1QYMA 2XEEA 5CBOA 4DUIA 1K3ZD 3NBNB 4QFVA 1YYHA 4F1PA 3T8KA 2QYJA 4DX6D 5CBNA 4K5CA 1DCQA 2L6BA 5CERB 2A5EA 3TWTA 2ETCA 1N0QA 5ENOD 5KNGA 4K5BA 4O1OA 3V2OA 5BXUA 1K1AA 2F37A 5EILA 2J8SD 2DVWA 5KBAA 2HE0A 2RFMA 3DEPA 4BESA 3D9HA 2NYJA 3TWVA 3ZNGA 5AQBA 4DX1A 4Z68A 2DZOA 3NOCD 3EHQA 3TWXA 1N11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EYP F;  3IXE A;  3Q9U C;  2F8X K;  5HS0 A;  1D9S A;  3TWS A;  4JB8 P;  2F8Y A;  5EN5 D;  3T9K A;  3AAA C;  3TWQ A;  3JXI A;  4BEP A;  4F6R D;  2XZD G;  5EIB E;  2ZGD A;  4QQI A;  1OY3 D;  2FO1 E;  2V4H C;  2XEH A;  3HG0 D;  4BER A;  4O60 A;  4A63 B;  4HBD A;  2P2C P;  4J7W A;  1BLX B;  1MX2 A;  2KBX A;  1DC2 A;  1A5E A;  2RFA A;  5FIN A;  3V79 K;  3AJI A;  4LNU D;  3NOG D;  4HLL A;  3TWW A;  4N5Q A;  4ATZ D;  5ENR D;  4U8Y D;  4GMR A;  5FIO A;  1SVX A;  4HRL A;  3F6Q A;  3V30 A;  5EYL A;  5HRY A;  4DX2 A;  3TWR A;  3UTM A;  1WG0 A;  1K1B A;  2AJA A;  3EU9 A;  5ITZ F;  4K5A B;  5EID A;  1IHB A;  2ETB A;  4HRM B;  2V5Q C;  4GPM A;  4ZFH A;  1SW6 A;  4G8K A;  4HB5 A;  1TR4 A;  1UOH A;  1IKN D;  2KXP C;  4TUM A;  3ZU7 B;  1AP7 A;  2MYO A;  4DX5 D;  5CEC B;  4U95 D;  4CYM D;  3V31 A;  4C48 B;  3B95 A;  5JA4 D;  2DWZ A;  3B7B A;  5KNH D;  3HRA A;  4BET A;  5CED B;  4U8V D;  4G8L A;  3SO8 A;  5HKP A;  4HNA D;  1BI8 B;  3W9F A;  2PNN A;  1YMP A;  2BKK B;  3V2X A;  3ZUV B;  2ETA A;  4DX7 D;  1IXV A;  1BI7 B;  5ENP D;  3UXG A;  3ZKJ A;  4HI8 A;  2Y0B G;  3LJN A;  5BXO A;  3DEO A;  4HRN A;  4UUC A;  5AQA A;  5AAO A;  5AAR A;  5AN8 A;  4U96 D;  2BKG A;  5AQ9 A;  1NFI E;  3EHR A;  1G3N B;  5AQ7 A;  2Y1L E;  4CZ2 D;  5CEA A;  4OAV B;  2QC9 A;  5D66 A;  4O1P A;  1N0R A;  4DRX E;  5ENQ D;  1MX4 A;  3J5Q B;  4J8Y A;  1MJ0 A;  4LSZ E;  3KEA A;  3W9G A;  1WDY A;  2B0O E;  4NIK A;  2VGE A;  5JMN D;  1OT8 A;  1MYO A;  4YDY A;  3JUE A;  4LG6 A;  5ENT D;  3C5R A;  4HQD A;  3TWU A;  4OAU C;  2XEN A;  3JXJ A;  4B93 B;  4ZHB A;  1MX6 A;  2ZGG A;  4YDW A;  5ENS D;  2DZN A;  4HI9 A;  4BSZ B;  3Q9N C;  1S70 B;  2JAB A;  1BD8 A;  1YCS B;  3J5P A;  3UI2 A;  5KWD A;  1AWC B;  1BU9 A;  2XZT G;  4RLY A;  1QYM A;  2XEE A;  5CBO A;  4DUI A;  1K3Z D;  3NBN B;  4QFV A;  1YYH A;  4F1P A;  3T8K A;  2QYJ A;  4DX6 D;  5CBN A;  4K5C A;  1DCQ A;  2L6B A;  5CER B;  2A5E A;  3TWT A;  2ETC A;  1N0Q A;  5ENO D;  5KNG A;  4K5B A;  4O1O A;  3V2O A;  5BXU A;  1K1A A;  2F37 A;  5EIL A;  2J8S D;  2DVW A;  5KBA A;  2HE0 A;  2RFM A;  3DEP A;  4BES A;  3D9H A;  2NYJ A;  3TWV A;  3ZNG A;  5AQB A;  4DX1 A;  4Z68 A;  2DZO A;  3NOC D;  3EHQ A;  3TWX A;  1N11 A; 
#chains in the Genus database with same CATH topology
 3KSL A;  3LY7 A;  2MRI A;  4A3T A;  3KEZ A;  3TWQ A;  1NA3 A;  3EUV A;  4TV3 A;  4ACK A;  4H7X A;  1DNP A;  1N9A A;  2FEZ A;  4GTS A;  3IHY A;  4N5Q A;  3FH7 A;  5FQ4 A;  3V30 A;  4J8F A;  2C0M A;  2VGX B;  4EZK A;  2MYO A;  2H6I A;  4U95 D;  4CYM D;  4I2Z A;  3U66 A;  3UM2 A;  3Q7F A;  2GW1 A;  4F3V A;  4HNA D;  2CG2 A;  2BKK B;  3CIA A;  3V2X A;  3E32 A;  3CHQ A;  3ZKJ A;  2LUH A;  3AS8 A;  3SFY A;  3C3O A;  4CT0 A;  4N5C A;  3FTW A;  2ZU6 B;  1U3C A;  1NFI E;  1G3N B;  2JLB A;  4XIF A;  3ZXP A;  2I9C A;  2VSX E;  2VSN A;  1EF1 C;  2EIL E;  3ZYK A;  2B0O E;  3APF A;  3RRU A;  3Q79 A;  3CK7 A;  3JXJ A;  1E90 A;  2ZGG A;  3DRA A;  4TXQ A;  2OEV A;  4A3V A;  3QB2 A;  4FU3 A;  2ZIR A;  3D9P A;  3T8K A;  4APO A;  4UQX A;  1H2U A;  2ETC A;  4ILH B;  5AYW D;  4HS2 A;  4Y6W A;  3CHM A;  4DLQ A;  5B1B E;  4LCT A;  4H7Y A;  1UW4 B;  2WXF A;  3QWP A;  4EQF A;  3IXE A;  3S7J A;  2J08 A;  3IKO B;  3T9K A;  3B7U X;  3TXM A;  2WMN A;  5T3R A;  3BQO A;  2ZGD A;  1FCH A;  4GTM A;  3SD5 A;  2FO1 E;  4BER A;  3FEY A;  4A63 B;  2OEW A;  3PZ3 A;  2RKK A;  4F7A A;  4I17 A;  3Q49 B;  1Z6T A;  1V55 E;  4JPS A;  2EQX A;  1IHB A;  1TNY A;  3AG2 E;  2BUG A;  4J8E A;  4N3A A;  3ZU7 B;  5CEC B;  2NSZ A;  2P9L G;  3CK8 A;  3NZU A;  5T4Y A;  5BUZ A;  3L6A A;  5HKP A;  4DX7 D;  3FTS A;  3R7R A;  3FWV A;  3SBT B;  3E30 A;  4I1A A;  1N0R A;  1MJ0 A;  4CGW A;  4L7T A;  4NIK A;  4B93 B;  3FUH A;  4OVV A;  3UI2 A;  4XX5 A;  2CHZ A;  4GMJ A;  5CBN A;  4AY6 A;  4PDX A;  1OUV A;  2F0Y A;  3LS8 A;  3IEG A;  3IBE A;  4HLE A;  5EX0 A;  3FEX A;  3NOC D;  4GZD A;  4RQI A;  4UI9 J;  3GW4 A;  4WWP A;  3S7D A;  3QAQ A;  1JWF A;  1HG2 A;  1E8W A;  2XGS A;  4GU5 A;  5FZS A;  2IQC A;  1H0A A;  3HIZ A;  2AXU A;  3PEU B;  5ITZ F;  5T8I A;  4BT9 A;  5CRU A;  2V5Q C;  2B6C A;  1QNF A;  4DPR A;  3Q4A B;  4JL0 A;  2EIK E;  1Q2Z A;  5CED B;  4G11 A;  4V3I A;  1S63 A;  2LXM A;  5AQA A;  3PUK A;  2R05 A;  5E75 A;  4ABN A;  4U96 D;  2C2L A;  5FJY A;  5CEA A;  3GZS A;  4M3O A;  3FP3 A;  2WXH A;  3MKQ A;  4HQD A;  3FUD A;  4XI9 A;  2XRZ A;  1YCS B;  2I6H A;  3L17 A;  2WXR A;  4Q96 A;  3CQG B;  4CEM A;  3FUM A;  3KD7 A;  2OV8 A;  4GAA A;  4URK A;  2R5S A;  3OTN A;  4WNE A;  4GB9 A;  5ENO D;  3DXM G;  3PH0 C;  2DVW A;  5CHE E;  3D9H A;  2ION A;  2X38 A;  4UWK A;  4U0U A;  2OOE A;  3Q9U C;  5HS0 A;  3QAR A;  3AAA C;  2LNI A;  2V8S E;  1OCR E;  1TYQ G;  2X6K A;  5FQ8 A;  2H6G A;  4G2V A;  2QFC A;  1JUQ A;  4W9R A;  1H2T C;  3FU6 A;  1BLX B;  1MX2 A;  1OWM A;  4GTT A;  2P9K G;  2RFA A;  5FIN A;  3V79 K;  4B0Z A;  3FTV A;  4U8Y D;  3Q7A A;  4GMR A;  5FIO A;  3VLE A;  4FHJ A;  2XQ0 A;  1UN9 A;  2PQN A;  3CVX A;  3L9T A;  3CR3 A;  3PS6 A;  1SW6 A;  3FY4 A;  4GTP A;  4WNG A;  3RK6 A;  1ELR A;  3SFX A;  4XE0 A;  4HOR A;  5G55 A;  4L23 A;  3C3R A;  3ZRH A;  2JEK A;  1BI8 B;  4UI9 C;  3LDZ A;  3KS2 A;  1KZP A;  5FT9 A;  1OCO E;  3UXG A;  1O1R A;  2UY1 A;  3CVP A;  2PM6 A;  4UWG A;  3U64 A;  3FU0 A;  1V54 E;  4AIF A;  3JQ0 A;  3KEA A;  3APC A;  3HVE B;  5CCM A;  3BG0 B;  1X81 A;  5LX8 A;  5ENT D;  3LY9 A;  2Q7F A;  2DYS E;  2XEV A;  2WQ6 A;  4P29 A;  1SZ9 A;  1H6O A;  1MX6 A;  5EKQ D;  4ZHB A;  4HI9 A;  2LO6 A;  1TN6 A;  2CG3 A;  2J9Q A;  4JW1 A;  1BU9 A;  4RLY A;  2QYU A;  3D9J A;  4Q69 A;  3CKC A;  4F1P A;  3PE3 A;  1S64 A;  2KCK A;  4BX9 A;  4UWL A;  4MKT A;  2P9I G;  1IYG A;  4JA9 A;  5ARF A;  2IEJ A;  2H6H A;  4G26 A;  5EN5 D;  4FC8 A;  4F6R D;  3Q5M A;  3C98 A;  5A23 A;  3UKR G;  3PDN A;  3HHM A;  5FQ6 A;  4U07 A;  3R9A B;  3CGH A;  3U3W A;  3RKV A;  4ATZ D;  5ENR D;  2LSV A;  3RO2 A;  2BF0 X;  5EYL A;  2PQR A;  4DX2 A;  5EID A;  2AVP A;  4G24 A;  1IKN D;  1WAO 1;  3LY8 A;  4L9P A;  2CFZ A;  2VGX A;  3W9F A;  3S7F A;  2WXJ A;  2WXK A;  3BG1 B;  1FT1 A;  2IFU A;  5AQ9 A;  3PZ2 A;  1OCC E;  5H7P A;  4N3B A;  5ENQ D;  1JCR A;  1WDY A;  2EIM E;  3LYA A;  4A1S A;  1HXI A;  2IJG X;  3J5P A;  4Q94 A;  2HYZ A;  3HDX A;  4B89 A;  4EPZ A;  3CVU A;  3ZFW A;  2L6B A;  3ZEF A;  2CHX A;  2ZXW E;  2LXL A;  2MHK A;  5B3S E;  4GZ5 A;  3L08 A;  5ARG A;  4ANU A;  3CHS A;  3TL5 A;  2NYJ A;  3PEV B;  4EZJ A;  4A55 A;  1QBQ A;  3JXI A;  4BTA A;  4C9B B;  3ULQ A;  2J49 A;  4GML A;  4AEZ C;  2YHE A;  2LAH A;  3FH8 A;  2ILR A;  3LEW A;  2WM9 A;  3TWR A;  4GYW A;  3UTM A;  1K1B A;  3AS4 A;  5AJD A;  1JPL A;  4HRM B;  3FU5 A;  1B89 A;  2KXP C;  2E2E A;  1H6K A;  4BET A;  5FQ7 A;  4MBG A;  4G1T A;  4UQY A;  3ZYQ A;  4BSX A;  3BUA A;  3KSQ A;  4ILI A;  2Y0B G;  4I43 A;  3ZN3 A;  4HRN A;  4GPK A;  5KJM A;  5FZQ A;  3SNX A;  3EHM A;  2VSO E;  5DIZ A;  3SI5 A;  3UM0 A;  3L22 A;  1MX4 A;  5JJT A;  3SHF A;  3ZYL A;  4WNF A;  2YIN A;  4LG6 A;  3MZL B;  3C5R A;  1NA0 A;  3ML9 A;  2DZN A;  2QY7 A;  3L16 A;  5J90 A;  4QFV A;  4A1G A;  4DX6 D;  2FF4 A;  3HXD A;  2M63 A;  3TJP A;  4DJA A;  4O1O A;  1ZBP A;  4JHJ A;  2R59 A;  3PZ1 A;  2RFM A;  3TWV A;  3CHP A;  4XEI G;  3AU5 A;  1W3B A;  3EIJ A;  2F8Y A;  2GRM A;  2R2L A;  4HOU A;  3T5X A;  3URZ A;  1ELK A;  3MKR A;  2P2C P;  4JD2 G;  2KBX A;  1KLX A;  3AJI A;  1U3D A;  4XZ4 A;  3TWW A;  5D0O D;  4HRL A;  3QC1 A;  3Q73 A;  2J4D A;  2J4B A;  3R9M A;  4IN3 B;  1TR4 A;  1UOH A;  3I4R B;  2H6F A;  4KBQ A;  3ENE A;  3CHR A;  3ULE G;  4G8L A;  3RRN B;  2C0L A;  4I6G A;  5AAO A;  2ZIS A;  4U04 A;  2L6J A;  2DCP A;  3AU4 A;  3EHR A;  2AWI A;  2PL2 A;  4J8Y A;  2R03 A;  3C72 A;  1NL4 A;  3ASO E;  3W9G A;  1ELW A;  3MX3 A;  1OT8 A;  4I2W A;  1MYO A;  4PS7 A;  4U7E B;  2YNQ A;  3QKY A;  4OAU C;  2VYI A;  3ASG A;  3Q9N C;  4MLP A;  2VGY A;  4NRH B;  4N3C A;  4JA7 A;  2HO1 A;  3ONK A;  1IHG A;  2XCC A;  2HR2 A;  2KCL A;  2I2O A;  1NI1 A;  4RG9 A;  3LPZ A;  3SFZ A;  4B94 A;  3U4T A;  4PUC A;  2P9P G;  4ACL A;  4DX1 A;  5KJL A;  2KM4 A;  3UIO C;  3JQ1 A;  2NXP A;  3FUK A;  3U9W A;  4EBA G;  2GRP B;  4QQI A;  5CMY A;  2XEH A;  2WXN A;  2Y3A A;  4GTO A;  3ABM E;  5HRY A;  2RD0 A;  2GRQ B;  3E37 A;  4K5A B;  2WXG A;  3FH5 A;  4AOF A;  4LNG A;  3PNT B;  3HXF A;  3B7B A;  5KNH D;  2UY1 B;  3UPV A;  4F53 A;  3SY2 A;  1XGW A;  3B7T A;  1HE8 A;  1KT1 A;  2IOS A;  4GZ3 A;  4RSY A;  2KZT B;  2X3M A;  3ONL A;  3EJN A;  2DBA A;  4LSZ E;  1N4P A;  3NZS A;  2GRN B;  3S2A A;  3PVL A;  4N2S A;  2PM7 A;  3ESL A;  2XZT G;  4C0M A;  5A6C A;  3DXK G;  4K0R A;  1U2V G;  4DI4 A;  4U0S A;  5AJL A;  3C3Q A;  2V5F A;  5BXU A;  1OWL A;  2J07 A;  3NAW A;  4IRU A;  2R17 C;  3IV0 A;  4GZC A;  3JUI A;  1KPS B;  1D9S A;  4JB8 P;  4IYP A;  1HF8 A;  1E7V A;  4WWN A;  3VTY A;  4JVS A;  4O60 A;  4JHK A;  4HBD A;  3JCK C;  2OVB A;  3FHE A;  4N2Q A;  2P9S G;  1WG0 A;  4FA6 A;  2IOL A;  4DI3 A;  4FJZ A;  4HB5 A;  3SZ7 A;  3Q15 A;  3E33 A;  3D3M A;  5ENN A;  4GZ6 A;  4I1O B;  1P5Q A;  4J0U A;  3MGB A;  1YMP A;  4ANV A;  3UT4 A;  5BXO A;  3HYM B;  3WXX A;  2Y1L E;  2QC9 A;  4KVO A;  4O1P A;  1QQE A;  1JCQ A;  3NB2 A;  3O48 A;  2VGE A;  2CFU A;  1ZU2 A;  2IU1 A;  4EEC A;  3ULY A;  1N4R A;  1DCE A;  3RRM B;  5G2N A;  1UJJ A;  2XGO A;  5KWD A;  2VTB A;  2YQ8 A;  3HXB A;  1OWN A;  1DCQ A;  1UG3 A;  4G25 A;  2X6F A;  1E8X A;  3ZIM A;  4N39 A;  1E7U A;  3ZVV A;  2WQ7 A;  3RU0 A;  3DEP A;  3SQV A;  4L2L A;  3O4Z A;  5EYP F;  4YDO A;  4GTR A;  4WUY A;  3CLJ A;  2A5U A;  4E6H A;  4UWH A;  4GTV A;  3Q47 B;  1O1T A;  5BNW A;  1A5E A;  2WMO A;  4ATG A;  5LCW C;  3ABL E;  5ANR A;  1TNB A;  3FTX A;  3UM3 A;  4K03 A;  2WXL A;  1SQM A;  1SZA A;  1TNO A;  1A17 A;  2WXM A;  5JA4 D;  3MYV A;  2L0I A;  3ZHE B;  2I1K A;  4I1M A;  2PNN A;  4FLH A;  3D9M A;  3UKU G;  3CST A;  3LJN A;  4TXP A;  3QOU A;  3CEQ A;  4PS3 A;  4AJW A;  1IQR A;  1E8Y A;  5AQ7 A;  1HG5 A;  4DRX E;  4GTQ A;  1UN8 A;  4CRW A;  3TWU A;  4TRQ A;  4LEU A;  4YDW A;  3FUI A;  2XRY A;  4F1S A;  4GYO A;  2GGF A;  2XGM A;  3CVN A;  4HOQ A;  4X8Q A;  4WND A;  5CMW A;  5EX3 A;  3CVV A;  3MKQ B;  1WM5 A;  4L2Y A;  2F37 A;  1H6P A;  5EIL A;  3BEE A;  3CVL A;  2HE0 A;  4CDN A;  3AS5 A;  2V0P A;  5D2M C;  4BES A;  3ABK E;  1MHQ A;  2DZO A;  3EHQ A;  3TWX A;  1N11 A;  3RSE G;  3NF1 A;  1N4S A;  4UI9 K;  4BX8 A;  2L0T B;  1TN8 A;  2DYR E;  1OY3 D;  3RO3 A;  4AY5 A;  5D0Q D;  1LF8 A;  5JJ7 A;  2KZT A;  4LNU D;  2HM8 A;  4G8K A;  5JHB A;  3N71 A;  4TUM A;  1AP7 A;  4ME2 A;  4BT8 A;  3LCA A;  4I6E A;  4C48 B;  3BU8 A;  3HRA A;  3WG7 E;  3FUE A;  5IY5 E;  3CVY A;  1JCS A;  3MEK A;  1K8K G;  4FUL A;  2WB2 A;  4TXR A;  3K9I A;  3GYZ A;  2XPZ A;  2J09 A;  3AG1 E;  4MS6 A;  3TGO A;  3ASD A;  3FU3 A;  5CCL A;  5JMN D;  3I5P A;  5FZR A;  3JUE A;  4HVB A;  3DSU A;  5HI7 A;  1S70 B;  1BD8 A;  3X2Q E;  2FI7 A;  4K5C A;  2WVI A;  4CT4 A;  2XS1 A;  4HXI A;  2BTD A;  3ISM C;  3PE4 A;  4Y6C A;  2GRR B;  4I6J A;  3RJV A;  4KZC A;  1HX8 A;  2XPI A;  1SA5 A;  4PS8 A;  4L1B A;  3DSS A;  5BPP A;  1WY6 A;  2FBN A;  2I1J A;  1TNU A;  3AG3 E;  1NZN A;  1PY1 A;  2OCC E;  4U8H A;  4OVU A;  3D9O A;  4HLL A;  3ASN E;  1OWO A;  4ZFH A;  2KCV A;  3B7S A;  5BV1 A;  1E96 B;  2AXZ A;  3TG4 A;  3V31 A;  3PZD A;  2WXP A;  3UMV A;  3SO8 A;  3SGH A;  3CHO A;  3QK0 A;  5J08 A;  1S0P A;  4ANW A;  3DSX A;  3FUF A;  3ZPJ A;  3FFL A;  5KJN A;  1L5J A;  1TJC A;  4FHK A;  2QZA A;  4HFG A;  5BT1 A;  4ANX A;  3IHV A;  3I3N A;  3QDN A;  2XEN A;  1KZO A;  5G04 J;  1Y6I A;  3DST A;  5CBO A;  5G05 J;  1IQU A;  2VJ8 A;  3CQC B;  3ZXS A;  5ANL A;  5CER B;  3VLF A;  3DBS A;  4KYO B;  4E85 A;  2XPY A;  1FVH A;  1XNF A;  2P9U G;  4EZL A;  3FUL A;  3D9K A;  4YND A;  2KC7 A;  4NQ0 A;  3ZHE A;  4BEP A;  2XZD G;  5EIB E;  3HXC A;  4J7W A;  4CCA A;  4NAC A;  4RVB A;  1N95 A;  3RIB A;  4ILG A;  3CVQ A;  1TN7 A;  1OWP A;  4EBA A;  3CSF A;  4BTB A;  3LJ3 A;  2ETB A;  1LD7 A;  2XS8 A;  3G2V A;  3OXG A;  2UWJ G;  3LXU X;  3B95 A;  2DWZ A;  2X6J A;  1EPU A;  4O6F A;  5LCW J;  1INZ A;  3T8M A;  4AVX A;  1TJF A;  3HVE A;  3FTU A;  3UX4 A;  4PH4 B;  1HFA A;  4B8C B;  3P1U A;  1IXV A;  1BI7 B;  3EHN A;  5M72 A;  3DEO A;  4YVQ C;  3MA5 A;  2BED A;  5AAR A;  4U63 A;  5AN8 A;  4LUN U;  3I4G A;  2AW6 A;  5JJ6 A;  3LVQ E;  3J5Q B;  4HOT A;  1E8Z A;  1TEZ A;  2VQ2 A;  2IF4 A;  4WAF A;  4JEU A;  4KZ0 A;  5FWQ A;  3FUN A;  2X6I A;  4XI0 A;  2JAB A;  5AIJ A;  2WQH A;  2FO7 A;  1FPP A;  4FJY A;  4D10 C;  1K3Z D;  3NBN B;  1HH8 A;  4KVM A;  2WXI A;  2WXO A;  3DPY A;  5AEN A;  1N0Q A;  5HQ8 A;  5KNG A;  3QNK A;  4K5B A;  1K1A A;  3G2S A;  3FTY A;  3HXE A;  3EIQ C;  1YYH A;  2KAT A;  2F8X K;  3TWS A;  2OVF A;  4UQZ A;  2V4H C;  4KMO A;  1HZ4 A;  3OAW A;  5BW8 C;  3PNL B;  3UIN C;  3OXF A;  5LOZ A;  2RG8 A;  3CV0 A;  2FUL A;  4JHR A;  3EU5 A;  1SVX A;  1NP7 A;  4FAD A;  4AP2 A;  4GPM A;  5G04 C;  3MJW A;  4I9E A;  1D8D A;  2GRL A;  5KCM A;  4J8S A;  3FTZ A;  1DVP A;  4G23 A;  2WXQ A;  3S7B A;  3ZUV B;  5EDS A;  5ENP D;  2GRO B;  3VTX A;  1HU3 A;  3DPD A;  4IUL A;  3L54 A;  4UWF A;  5LP0 A;  1O1S A;  1Z5S C;  4CZ2 D;  2NC9 A;  2E0I A;  1X5B A;  4CDR A;  2A4Z A;  4J6I A;  4APF A;  3DSV A;  3G2W A;  1FVF A;  3VLD A;  2WPV A;  3NQP A;  1N94 A;  3B13 A;  4U0Z A;  3OXL A;  2XEE A;  3L82 A;  4BY6 A;  3QWW A;  5E76 A;  2QYJ A;  2DIW A;  5FTP A;  2A5E A;  3TAX A;  3ASF A;  3ZW3 A;  3SBS A;  4YVO A;  3FUJ A;  4AV7 A;  3P2B A;  3SF4 A;  3V2O A;  1D8E A;  3ASH A;  4BFR A;  3AG4 E;  3E4B A;  1KT0 A;  3TG5 A;  4DK5 A;  2V4L A;  3HG0 D;  1H19 A;  2EIJ E;  1DC2 A;  2Y4U A;  3MV2 B;  4KXK B;  4YDE A;  1JWG A;  2EIN E;  3TXN A;  3GZ1 A;  1N54 A;  4MRU A;  4FP7 A;  2P9N G;  4FLB A;  1TNZ A;  1RZ4 A;  3MV3 B;  1O5M A;  2VTB B;  4M7C A;  4I9C A;  1OXJ A;  4GYY A;  3RAU A;  4UUC A;  1Z3X A;  3PUJ A;  3R7Q A;  3UM1 A;  2BKG A;  1Z3Y A;  1RW2 A;  3KAE A;  2YHC A;  3ML8 A;  4OAV B;  2OND A;  5D66 A;  3CKB A;  3D9N A;  1N52 A;  5CRV A;  1MZC A;  1HO8 A;  4YDY A;  3JYS A;  3LKU A;  4CDM A;  2LAI A;  1LTX A;  4GA1 A;  5ENS D;  4BSZ B;  3L13 A;  3D9L A;  3DSW A;  1GW6 A;  2IO2 C;  4J8D A;  4DLO A;  2VSY A;  4DUI A;  4CGV A;  1H2V C;  1BPO A;  3MCX A;  1FT2 A;  1VDY A;  4BWR A;  3CK9 A;  5KBA A;  2R02 A;  3G2U A;  3ZGQ A;  5AQB A;  4Z68 A;  4GA2 A;  5LFA A;  5G05 C;  3E34 A;  2PZI A;  2L9B A;  4AM9 A;  5JHA A;  4TUU A;  3UIP C;  3PRZ A;  2XCB A;  4JZY A;  4WWO A;  4AXH A;  3NOG D;  2IO3 C;  5C1D A;  3F6Q A;  4GCO A;  2AJA A;  3CVW A;  3EU9 A;  3G2T A;  1EDU A;  4GCN A;  3LVR E;  2Y4T A;  2AXV A;  4DX5 D;  1EYH A;  1PC2 A;  2LSU A;  3QWV A;  4NUR A;  1QZ2 A;  4U8V D;  5KJK A;  3PRE A;  3UUX A;  4RG6 A;  2P58 C;  2IY0 C;  2ETA A;  3GZ2 A;  3UT7 A;  4OYS A;  1YA0 A;  4HI8 A;  2Y69 E;  4LER A;  1OCZ E;  1Y8M A;  3DWL G;  4JEH A;  4EHM A;  1UJK A;  2X6H A;  4JXT A;  4LNB A;  3QJZ A;  5A7D B;  3FDH A;  4XKB A;  3PZ4 A;  3Q78 A;  1ZB1 A;  3Q75 A;  1MQS A;  1AWC B;  3D9I A;  3B7R L;  2CHW A;  1QYM A;  3ESK A;  1SA4 A;  4LRZ A;  5B1A E;  4JC8 A;  4KT6 B;  3UQ3 A;  3UT8 A;  4HOS A;  4R7L A;  5C2Y A;  3APD A;  3TWT A;  4XKC A;  2XHE A;  2MOW A;  1N4Q A;  4C0E A;  4B8A A;  1LD8 A;  3EDT B;  2J8S D;  3T5V A;  3ZYM A;  3ZNG A;  1HS6 A;  1PAQ A;  4GA0 A;  5DBK A;  5BV0 A; 
#chains in the Genus database with same CATH homology
 5EYP F;  3IXE A;  3Q9U C;  2F8X K;  5HS0 A;  1D9S A;  3TWS A;  4JB8 P;  2F8Y A;  5EN5 D;  3T9K A;  3AAA C;  3TWQ A;  3JXI A;  4BEP A;  4F6R D;  2XZD G;  5EIB E;  2ZGD A;  4QQI A;  1OY3 D;  2FO1 E;  2V4H C;  2XEH A;  3HG0 D;  4BER A;  4O60 A;  4A63 B;  4HBD A;  2P2C P;  4J7W A;  1BLX B;  1MX2 A;  2KBX A;  1DC2 A;  1A5E A;  2RFA A;  5FIN A;  3V79 K;  3AJI A;  4LNU D;  3NOG D;  4HLL A;  3TWW A;  4N5Q A;  4ATZ D;  5ENR D;  4U8Y D;  4GMR A;  5FIO A;  1SVX A;  4HRL A;  3F6Q A;  3V30 A;  5EYL A;  5HRY A;  4DX2 A;  3TWR A;  3UTM A;  1WG0 A;  1K1B A;  2AJA A;  3EU9 A;  5ITZ F;  4K5A B;  5EID A;  1IHB A;  2ETB A;  4HRM B;  2V5Q C;  4GPM A;  4ZFH A;  1SW6 A;  4G8K A;  4HB5 A;  1TR4 A;  1UOH A;  1IKN D;  2KXP C;  4TUM A;  3ZU7 B;  1AP7 A;  2MYO A;  4DX5 D;  5CEC B;  4U95 D;  4CYM D;  3V31 A;  4C48 B;  3B95 A;  5JA4 D;  2DWZ A;  3B7B A;  5KNH D;  3HRA A;  4BET A;  5CED B;  4U8V D;  4G8L A;  3SO8 A;  5HKP A;  4HNA D;  1BI8 B;  3W9F A;  2PNN A;  1YMP A;  2BKK B;  3V2X A;  3ZUV B;  2ETA A;  4DX7 D;  1IXV A;  1BI7 B;  5ENP D;  3UXG A;  3ZKJ A;  4HI8 A;  2Y0B G;  3LJN A;  5BXO A;  3DEO A;  4HRN A;  4UUC A;  5AQA A;  5AAO A;  5AAR A;  5AN8 A;  4U96 D;  2BKG A;  5AQ9 A;  1NFI E;  3EHR A;  1G3N B;  5AQ7 A;  2Y1L E;  4CZ2 D;  5CEA A;  4OAV B;  2QC9 A;  5D66 A;  4O1P A;  1N0R A;  4DRX E;  5ENQ D;  1MX4 A;  3J5Q B;  4J8Y A;  1MJ0 A;  4LSZ E;  3KEA A;  3W9G A;  1WDY A;  2B0O E;  4NIK A;  2VGE A;  5JMN D;  1OT8 A;  1MYO A;  4YDY A;  3JUE A;  4LG6 A;  5ENT D;  3C5R A;  4HQD A;  3TWU A;  4OAU C;  2XEN A;  3JXJ A;  4B93 B;  4ZHB A;  1MX6 A;  2ZGG A;  4YDW A;  5ENS D;  2DZN A;  4HI9 A;  4BSZ B;  3Q9N C;  1S70 B;  2JAB A;  1BD8 A;  1YCS B;  3J5P A;  3UI2 A;  5KWD A;  1AWC B;  1BU9 A;  2XZT G;  4RLY A;  1QYM A;  2XEE A;  5CBO A;  4DUI A;  1K3Z D;  3NBN B;  4QFV A;  1YYH A;  4F1P A;  3T8K A;  2QYJ A;  4DX6 D;  5CBN A;  4K5C A;  1DCQ A;  2L6B A;  5CER B;  2A5E A;  3TWT A;  2ETC A;  1N0Q A;  5ENO D;  5KNG A;  4K5B A;  4O1O A;  3V2O A;  5BXU A;  1K1A A;  2F37 A;  5EIL A;  2J8S D;  2DVW A;  5KBA A;  2HE0 A;  2RFM A;  3DEP A;  4BES A;  3D9H A;  2NYJ A;  3TWV A;  3ZNG A;  5AQB A;  4DX1 A;  4Z68 A;  2DZO A;  3NOC D;  3EHQ A;  3TWX A;  1N11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...