3SO8A

Crystal structure of ankra
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
162
structure length
162
Chain Sequence
NSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ankyrin repeat family A protein 2
total genus 49
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3so8A00
1BI7B 5ENSD 4K5AB 2MYOA 3NOCD 5AAOA 4DX2A 5CEDB 4LG6A 1TR4A 3NOGD 1G3NB 3LJNA 3V2XA 3TWTA 4OAUC 5CERB 2P2CP 2QYJA 4UUCA 4CZ2D 2BKGA 1S70B 2KBXA 3AJIA 4GPMA 5EN5D 5KNGA 3JXIA 1AP7A 2F8XK 4HB5A 3AAAC 2VGEA 3C5RA 3EU9A 3J5PA 4BETA 1BU9A 4OAVB 4BERA 2XEHA 4C48B 3DEPA 1MYOA 1BD8A 4ATZD 2HE0A 3TWRA 3TWVA 1IXVA 3T9KA 2ETAA 3J5QB 5FINA 4A63B 4LSZE 3Q9NC 1YCSB 1DCQA 2AJAA 3UXGA 1AWCB 4JB8P 5AARA 3ZNGA 4CYMD 4HRNA 4HRMB 1WG0A 4HI9A 4K5BA 3V31A 4N5QA 2XENA 3IXEA 5ENOD 5JMND 4YDYA 5CBOA 4HNAD 3SO8A 1OY3D 4O60A 2ETCA 4ZHBA 3DEOA 5EYPF 3B7BA 3D9HA 2BKKB 3TWQA 3Q9UC 2ZGGA 4QQIA 2XZDG 4HI8A 5KNHD 3V79K 3W9GA 4DRXE 3TWUA 4O1PA 4DUIA 4G8KA 5CECB 5AQBA 5KWDA 2KXPC 3JUEA 5AQAA 4ZFHA 3JXJA 4U96D 5ENRD 1D9SA 4HBDA 4J8YA 5ITZF 5HRYA 5AN8A 5EILA 5EIDA 3ZKJA 3B95A 5HKPA 5EYLA 3V2OA 1IHBA 3TWXA 4BEPA 1MJ0A 3HG0D 4B93B 4U8VD 4TUMA 3HRAA 2DZNA 5BXUA 1DC2A 1N0QA 2NYJA 3TWSA 3W9FA 2V5QC 4DX5D 2PNNA 5KBAA 2F37A 4HLLA 2J8SD 1SW6A 3ZU7B 2B0OE 1IKND 3NBNB 1WDYA 3F6QA 4F6RD 4G8LA 4U8YD 2A5EA 4BESA 1SVXA 1NFIE 1MX2A 4GMRA 2XZTG 5HS0A 2ZGDA 5AQ7A 4QFVA 5ENQD 4RLYA 4K5CA 4DX7D 4J7WA 1K1BA 1BI8B 4U95D 5CEAA 2F8YA 1MX4A 5AQ9A 1N11A 4O1OA 2V4HC 2ETBA 3ZUVB 2FO1E 1A5EA 3UI2A 4DX6D 3T8KA 5FIOA 1OT8A 5D66A 3EHRA 4BSZB 2DVWA 3KEAA 2RFMA 4NIKA 1MX6A 5ENPD 1QYMA 4DX1A 4Z68A 2Y1LE 4F1PA 4YDWA 4LNUD 2JABA 5EIBE 2XEEA 3V30A 4HRLA 2Y0BG 5BXOA 5ENTD 2DWZA 1YYHA 1K1AA 3UTMA 1UOHA 5CBNA 2RFAA 1YMPA 4HQDA 2QC9A 1BLXB 1K3ZD 5JA4D 2L6BA 1N0RA 3EHQA 2DZOA 3TWWA
chains in the Genus database with same CATH superfamily
4J0UA 4GZ5A 4YDOA 3QWVA 2VGYA 1NA0A 5G05J 2ZXWE 3CLJA 2Y4UA 3PH0C 4RG9A 3R7QA 2F8XK 3FUIA 2E2EA 3J5PA 4C48B 4AOFA 4A63B 4LSZE 4OVVA 2BTDA 3Q78A 3CVWA 4KZ0A 3V31A 4ILHB 1GW6A 2BKKB 4DRXE 2C0LA 5AIJA 4O6FA 1N4PA 4WWOA 1TNZA 2XPIA 3DSTA 5ITZF 3B7RL 2ILRA 2WMOA 4BEPA 1MJ0A 1HXIA 4I2ZA 5FQ4A 3SFZA 4TUMA 2H6IA 1TNUA 4HS2A 1ZB1A 2OOEA 5KBAA 2DIWA 2IY0C 5A23A 5HS0A 2IO3C 4A3TA 2EIKE 1N4RA 3QOUA 1KT0A 3G2UA 4G24A 3LY7A 2WXKA 2IOLA 3EIQC 1E90A 2WXFA 4B89A 4G23A 3BQOA 3UX4A 1QYMA 2Y0BG 4UI9C 4CT4A 5JHBA 3CVVA 2XGMA 4HQDA 3APCA 2DZOA 3O48A 5EX3A 2X6HA 2WXQA 2BKGA 3AJIA 4PUCA 4KBQA 3U3WA 3MKQA 4YVOA 4I1OB 4NACA 3B7TA 5AARA 5J08A 4PS8A 4HRNA 2UWJG 4HRMB 3BU8A 3DSWA 1D9SA 1ELRA 3NF1A 3CHSA 3FU6A 5ARGA 5LOZA 2ZGGA 1DVPA 4F7AA 4JA7A 3TWUA 3C98A 2WQHA 4G8KA 3URZA 5T4YA 3ASDA 3E30A 4KZCA 2WM9A 4AY6A 1TN7A 2HYZA 1S64A 5HRYA 3LJ3A 4APFA 3QK0A 3ZRHA 3RO2A 2Y69E 4N39A 3ONLA 5BUZA 3RU0A 5CMWA 4TRQA 4FU3A 1HS6A 2B0OE 1FT2A 2IOSA 3CR3A 2WXJA 3CVYA 3ULQA 3B7SA 4ME2A 4MLPA 3UM2A 4FLHA 1H6PA 3ZUVB 3U4TA 1PAQA 2J07A 4F1PA 4OVUA 2E0IA 5ENNA 3V30A 1TJFA 1U3CA 1NI1A 5H7PA 2R2LA 2QC9A 1E7UA 3AU5A 3BUAA 3JCKC 4OAUC 4GA2A 1Y8MA 4UUCA 4DI3A 2KBXA 4HB5A 4RVBA 1BD8A 1N52A 3FTSA 2KCKA 2VYIA 3T5XA 4HI9A 3D9OA 5KJNA 4UWKA 3RKVA 3TG5A 2RKKA 4BTBA 2QY7A 5EYPF 1IQRA 3B7BA 3W9GA 3E34A 3CQGB 2KXPC 3CHRA 5ENRD 4UQYA 4KXKB 1OWNA 2GROB 2L0TB 1KZOA 4N3CA 3B95A 3RK6A 2VTBA 4G26A 3ESLA 2ZIRA 3D9MA 5FJYA 1HO8A 4BY6A 4ILIA 4E85A 5T8IA 2VSYA 2CFUA 4U8YD 1SVXA 2XZTG 3MKRA 4MBGA 5AQ7A 3Q73A 4B0ZA 1MZCA 4JEHA 2GRPB 5M72A 2I1KA 4Q94A 4JL0A 4IN3B 3NQPA 4GTSA 3EHRA 4XX5A 2JLBA 4NIKA 4WWNA 4I2WA 1JCSA 4I1MA 2XEEA 4LCTA 3UTMA 3CEQA 3CK8A 3PE3A 1HZ4A 3ZXPA 1BLXB 1NA3A 3TWWA 3P1UA 2BUGA 4LG6A 4J8FA 2DBAA 2X6IA 1RZ4A 2EILE 1S70B 2PM6A 4GPMA 3CHOA 4XKBA 2P9NG 1BU9A 5ARFA 5G04J 3AG1E 3HXBA 3OXLA 1MYOA 4ATZD 4X8QA 5ANLA 3LVQE 1ZU2A 4U0ZA 1DCQA 3PZ3A 4GTPA 4GZCA 2VTBB 1INZA 4I6JA 3AG3E 4JHJA 3AS4A 4OYSA 2GRQB 4U04A 2UY1A 3EUVA 4Q69A 4GYYA 1KPSB 5EDSA 3AG2E 1TJCA 5KJMA 3KSLA 3O4ZA 2ZU6B 2M63A 3AS8A 1UG3A 2GGFA 4CCAA 3ZYKA 3HG0D 4U8HA 2CG3A 1OUVA 3DBSA 5BXUA 1P5QA 3FWVA 3HVEB 3UINC 3KSQA 4FA6A 2OV8A 1OWPA 3ZU7B 3JQ1A 4ABNA 3GZSA 4PDXA 4RLYA 3EHMA 3CHPA 1LD7A 4Y6CA 4IRUA 3FUFA 1A5EA 1HFAA 3OTNA 3S7FA 4DI4A 2LUHA 1UJJA 3ULYA 3PE4A 3EU5A 5EX0A 5EIBE 4HLEA 1OXJA 1UN8A 4NRHB 1E96B 3S2AA 2QFCA 2NYJA 2V4LA 4K5AB 2NXPA 3FUMA 4AIFA 3JXIA 2R05A 3MCXA 4J6IA 5FQ8A 3TWRA 4JXTA 3E33A 4GMJA 1QZ2A 3U9WA 3LCAA 1AWCB 2YHEA 4WAFA 1NZNA 4N2SA 3NZSA 3IXEA 5JMND 3ZW3A 4A3VA 3FULA 2NC9A 5JJTA 4ANUA 5AQAA 3JXJA 3C72A 1JCRA 5FWQA 1PY1A 2J9QA 4IYPA 3FU0A 5EYLA 5DIZA 2YQ8A 1N94A 4HVBA 3WG7E 2V5QC 1Z3XA 2CHWA 2IONA 5JJ6A 1IKND 2C2LA 1WDYA 3L17A 3NAWA 1NFIE 3D9JA 3CVQA 4MS6A 4K5CA 1EF1C 5LCWJ 3HXDA 1W3BA 1N11A 1KZPA 2FO1E 3OAWA 1TNYA 4GTVA 1E8YA 4I1AA 4I9CA 5JJ7A 5D66A 4A1SA 2Y1LE 2KM4A 1QBQA 4CEMA 3S7DA 2L0IA 3MGBA 1YMPA 4FP7A 4JZYA 5AJLA 3LPZA 3HXFA 3SHFA 3SF4A 3NOGD 5CRVA 5KCMA 3AAAC 3C5RA 2PQRA 4B8CB 1HG2A 3DEPA 3CHQA 3SFXA 5AJDA 4JB8P 4CYMD 4EZKA 1BPOA 3QDNA 4F1SA 1LF8A 1SA4A 4U07A 5DBKA 3UKRG 3KS2A 3AU4A 4GYWA 4BWRA 3APFA 5FZSA 3N71A 3G2VA 2R02A 2F0YA 1HG5A 4F3VA 4WWPA 4JPSA 4HOTA 2GRLA 2XS8A 1XNFA 2MRIA 3SBTB 5HQ8A 5D0OD 4BSXA 1MX2A 2J4DA 2OVBA 2XGSA 1FVHA 2DYRE 2X38A 3SFYA 2WXRA 3X2QE 4O1OA 4DJAA 4HOQA 4KVMA 2DVWA 3MJWA 1N54A 4LNUD 1OCOE 2CG2A 4Q96A 4TXRA 5CBNA 3UIPC 4TUUA 3IV0A 4PH4B 2VGXA 3SGHA 2P2CP 3LS8A 3FP3A 3I4RB 4BERA 3FH7A 1IXVA 4I6GA 4PS7A 4RQIA 3UM0A 3QWPA 1IYGA 5HI7A 3VTYA 4DLQA 3D9HA 3CVUA 2HR2A 2XPZA 3FUJA 4LUNU 3ZN3A 4FLBA 3QKYA 4CGVA 3AS5A 3ZKJA 2IQCA 3PEVB 4RSYA 4GTTA 2F37A 3CK9A 2J8SD 3CKBA 4H7XA 2XQ0A 4N2QA 2R03A 2XPYA 3TL5A 3L13A 4B8AA 4EBAA 1PC2A 4CDRA 4ANXA 4JHKA 1MX4A 2LO6A 1FVFA 1X81A 2FBNA 4I6EA 4BSZB 2RFMA 2WXOA 4U63A 1ELWA 4GA1A 4J8SA 4GCNA 3EHNA 3L82A 4GCOA 4KMOA 1OWMA 3ML9A 3EHQA 3DRAA 4DX2A 3E32A 3PUJA 2YNQA 4GZ6A 4UQXA 5CERB 3CVXA 2NSZA 3FTZA 3DSSA 1IQUA 3PREA 1L5JA 3CHMA 3J5QB 4KYOB 1KLXA 3B13A 3UXGA 5CRUA 3R9MA 4WNDA 4AY5A 4K5BA 4DLOA 1Z5SC 3LY8A 2I6HA 3ASGA 2P58C 3FHEA 2IU1A 3UKUG 1HE8A 3ZYMA 4L1BA 2KZTB 4HOUA 3Q4AB 3FTVA 4CDMA 2IF4A 3ESKA 3CVLA 4JHRA 4GU5A 1SA5A 4J8YA 1E8WA 3FUDA 3ONKA 1Z3YA 2WXHA 2PM7A 4GAAA 3RRMB 3MV3B 4MRUA 1DC2A 3TWSA 4ANVA 3MKQB 1OCZE 5JHAA 3U64A 2ZGDA 4DX7D 3ZGQA 3WXXA 1OCCE 3ASNE 1E8XA 4JD2G 1YA0A 1OT8A 4ACKA 3D3MA 4LNGA 1A17A 3MV2B 2WXNA 3ASFA 5G2NA 3L08A 1OCRE 2RFAA 3SNXA 5D2MC 4N3BA 4UWLA 1N9AA 5CEAA 4UWFA 4EZLA 2AXZA 3U66A 3G2WA 1TYQG 4AP2A 2P9IG 3CVPA 3FH5A 2X6JA 2LAHA 1RW2A 2KZTA 1OWOA 3I3NA 5EKQD 2WQ6A 4LNBA 3ZNGA 3KD7A 3GZ1A 3ASHA 3VLEA 1OY3D 2Y4TA 4AJWA 3D9LA 2R59A 3EIJA 2XEVA 2XZDG 5BW8C 2ZISA 1FPPA 2WXIA 2J09A 4BTAA 2GRMA 4FC8A 4PS3A 4U96D 4BT8A 4ILGA 4HBDA 1H6OA 3TAXA 4AV7A 3T5VA 4L7TA 4U8VD 1UJKA 3VTXA 3I4GA 4HOSA 4K0RA 3PVLA 4I17A 3D9NA 4J7WA 3SI5A 2OVFA 4XE0A 5AQ9A 3PS6A 4URKA 3Q47B 1HF8A 5BV0A 3EDTB 3PZ1A 4DX1A 3FFLA 4I9EA 4YDWA 4FJYA 2VSOE 4J8EA 4HRLA 4R7LA 2BEDA 2XGOA 3DXKG 4WUYA 3MYVA 2WPVA 3L22A 3DPDA 2L6BA 2OCCE 2MYOA 2IO2C 2DYSE 5G05C 2WB2A 3D9KA 1G3NB 1NL4A 5KJLA 2QYJA 4CZ2D 3KAEA 5KNGA 4TXPA 3TG4A 2PQNA 3VLFA 4GTRA 3C3RA 1OWLA 5FINA 3HXCA 2KCLA 1SZ9A 3HDXA 3IHYA 3UIOC 4EBAG 2CHXA 2LNIA 4B94A 4O60A 2LAIA 3Q7FA 4JEUA 4JC8A 4H7YA 3CSTA 4WNGA 2WXPA 2EQXA 3OXFA 5C2YA 1WAO1 2MHKA 3FUKA 3FTXA 5EIDA 3ZVVA 4XI0A 2HO1A 1XGWA 2LXLA 3MA5A 3G2SA 4NURA 3IHVA 3FDHA 3GZ2A 1JWGA 3UPVA 4U95D 1SZAA 4BX8A 2F8YA 1JPLA 2V4HC 3S7BA 3R9AB 5FIOA 4GZ3A 5B3SE 2EIJE 1H2VC 3GW4A 1Q2ZA 3ISMC 5ENTD 1UOHA 5LCWC 3C3QA 5E76A 2J08A 2WVIA 4YNDA 3RJVA 2KCVA 3FH8A 1V54E 1AP7A 1VDYA 4HFGA 3TWVA 4BT9A 5BV1A 4BX9A 3SZ7A 4C9BB 3UM3A 4HXIA 1N4QA 1H0AA 4N5QA 3ZHEA 1X5BA 2VSXE 3L6AA 1TNBA 5B1AE 4YDEA 5A7DB 1N95A 3I5PA 3MEKA 5FQ6A 4TV3A 4G11A 4U0UA 4O1PA 2R5SA 3UUXA 3ABME 2VSNA 3NZUA 1Y6IA 2KC7A 2ONDA 4W9RA 5LX8A 2L9BA 4G25A 3PRZA 1N0QA 1TEZA 1SW6A 4F6RD 4BESA 4GMRA 2LSUA 3BEEA 3BG0B 5A6CA 5ENQD 2QYUA 2XRYA 3SY2A 4AVXA 2XS1A 2AW6A 4XKCA 1E8ZA 4DX6D 3ML8A 5BPPA 4JW1A 1O1RA 3Q5MA 1MX6A 4G2VA 3TXNA 2DCPA 1FCHA 1JUQA 3P2BA 2I2OA 2AWIA 2YINA 1K1AA 3EJNA 3DPYA 3NOCD 5AAOA 2A4ZA 2P9KG 2V5FA 3TWTA 2B6CA 2GRRB 3ABKE 2PL2A 1H6KA 4BETA 4EQFA 2VJ8A 1Z6TA 3JQ0A 3LEWA 4OAVB 3QAQA 2HE0A 3D9IA 4DK5A 3PEUB 4HORA 3L16A 1ZBPA 2FEZA 4EPZA 2R17C 3HHMA 2X6KA 4ZHBA 3FTYA 1S0PA 3JUIA 3TWQA 4EHMA 5KNHD 4HI8A 3V79K 3IBEA 5FZRA 4YVQC 2JEKA 3TJPA 1QQEA 5CCLA 3CV0A 2XHEA 4XEIG 3HYMB 4IULA 4UQZA 4XZ4A 1K8KG 2XCBA 2V0PA 3RSEG 3Q49B 2DZNA 3PDNA 5J90A 3APDA 3NBNB 1MQSA 3CKCA 4GZDA 3FTWA 3HIZA 3UT7A 4M3OA 1UW4B 3LXUX 4K03A 2P9SG 2WQ7A 1NP7A 4NQ0A 2PZIA 3GYZA 3IEGA 4AEZC 2KATA 4TXQA 4MKTA 4XI9A 3MX3A 2VGXB 3CIAA 3RRNB 3MZLB 1N0RA 3CGHA 5ENSD 3R7RA 3FEYA 4I43A 3LY9A 3NB2A 4A1GA 4JVSA 4N3AA 2BF0X 5BT1A 3T9KA 3CVNA 3LKUA 2XCCA 4M7CA 1TNOA 3L9TA 1WG0A 3DSUA 1D8EA 1EYHA 1H2TC 5ENOD 3LVRE 1DCEA 3DEOA 2WMNA 3HXEA 3K9IA 4QQIA 3DSXA 2IJGX 3ZFWA 5CECB 4F53A 2I9CA 4APOA 3D9PA 1UN9A 1D8DA 4N5CA 5T3RA 4UWHA 4GPKA 1TN6A 2AXVA 3TGOA 3HRAA 4GB9A 3FUEA 4L2YA 3JYSA 4GTOA 1U3DA 2WXMA 1K1BA 4GMLA 3UMVA 3ZYLA 4GTMA 2FI7A 4A55A 4LRZA 3ZEFA 3SD5A 4XIFA 1WM5A 1FT1A 4UI9K 1YYHA 4V3IA 1K3ZD 1BI7B 3DSVA 3ASOE 4KVOA 4EECA 1WY6A 4D10C 1TR4A 3AG4E 3UQ3A 3ENEA 2Q7FA 3QJZA 2ETAA 1YCSB 5FT9A 5IY5E 4AM9A 4C0EA 3RO3A 3SO8A 3ZIMA 2P9UG 3QB2A 2ETCA 1EDUA 3CQCB 5D0QD 5G55A 4L23A 1H19A 3Q9UC 2AVPA 1LD8A 2IFUA 1O1SA 3Q79A 3JUEA 1H2UA 4WNFA 4E6HA 1E7VA 1QNFA 5EILA 4ANWA 2X3MA 3TWXA 3FEXA 4EZJA 3CK7A 3FU5A 3W9FA 2PNNA 4U0SA 3FU3A 2A5EA 3QARA 4FULA 1LTXA 2QZAA 1HU3A 2FO7A 2J49A 1DNPA 4UI9J 1O1TA 4CGWA 2FULA 3KEAA 3FTUA 2J4BA 1HH8A 3KEZA 4GTQA 4FHKA 3PZDA 5JA4D 3RRUA 3QWWA 2A5UA 1KT1A 3QC1A 4DPRA 1JCQA 3V2XA 5FZQA 3LYAA 5CHEE 3ABLE 3ZYQA 3EU9A 4ATGA 2OEWA 1V55E 1ELKA 2EINE 4WNEA 3SQVA 3Q9NC 4ACLA 3ULEG 5CBOA 2CHZA 4P29A 4Y6WA 3PUKA 2C0MA 4BFRA 1HX8A 4GA0A 2I1JA 3RIBA 3Q15A 5AQBA 2GW1A 3RAUA 1U2VG 4CT0A 3ZHEB 5LFAA 5HKPA 3V2OA 1IHBA 1N4SA 4FADA 4B93B 4L9PA 3UT8A 1SQMA 3FUHA 4FJZA 3UM1A 4DX5D 3ZXSA 1MHQA 4LEUA 4G8LA 2H6GA 5AYWD 2RG8A 4QFVA 4KT6B 1BI8B 2Y3AA 4GYOA 3G2TA 2HM8A 1IHGA 2H6HA 2WXLA 2GRNB 5E75A 3OXGA 3PZ2A 2L6JA 2DWZA 5LP0A 2V8SE 3DXMG 3Q75A 4UWGA 2AXUA 4G1TA 3Q7AA 5CEDB 2WXGA 3LJNA 3PNTB 5KJKA 3CSFA 3ZPJA 1JWFA 5EN5D 3PNLB 5FTPA 2VGEA 3BG1B 3DWLG 3L54A 5ANRA 2P9PG 3T8MA 3S7JA 2XEHA 4L2LA 5G04C 3IKOB 2FF4A 3B7UX 2VQ2A 3FUNA 2AJAA 2OEVA 4AXHA 2MOWA 4Z68A 4C0MA 2XENA 3E4BA 2X6FA 4YDYA 4HNAD 3PZ4A 3VLDA 5AENA 2RD0A 2YHCA 2CFZA 3UT4A 4DUIA 4RG6A 5KWDA 4ZFHA 2IEJA 1TN8A 5CCMA 1O5MA 4J8DA 4CDNA 5AN8A 3FY4A 2LSVA 1EPUA 4LERA 5B1BE 4CRWA 3C3OA 5BNWA 1B89A 1S63A 2LXMA 2P9LG 4HLLA 2XRZA 3F6QA 3LDZA 3QNKA 4FHJA 5FQ7A 3TXMA 3HVEA 2ETBA 3E37A 3UI2A 3T8KA 4JA9A 5CMYA 5ENPD 2H6FA 4U7EB 2JABA 3SBSA 2EIME 5BXOA 2UY1B 5C1DA
chains in the Genus database with same CATH topology
1BI7B 5ENSD 4K5AB 2MYOA 3NOCD 5AAOA 4DX2A 5CEDB 4LG6A 1TR4A 3NOGD 1G3NB 3LJNA 3V2XA 3TWTA 4OAUC 5CERB 2P2CP 2QYJA 4UUCA 4CZ2D 2BKGA 1S70B 2KBXA 3AJIA 4GPMA 5EN5D 5KNGA 3JXIA 1AP7A 2F8XK 4HB5A 3AAAC 2VGEA 3C5RA 3EU9A 3J5PA 4BETA 1BU9A 4OAVB 4BERA 2XEHA 4C48B 3DEPA 1MYOA 1BD8A 4ATZD 2HE0A 3TWRA 3TWVA 1IXVA 3T9KA 2ETAA 3J5QB 5FINA 4A63B 4LSZE 3Q9NC 1YCSB 1DCQA 2AJAA 3UXGA 1AWCB 4JB8P 5AARA 3ZNGA 4CYMD 4HRNA 4HRMB 1WG0A 4HI9A 4K5BA 3V31A 4N5QA 2XENA 3IXEA 5ENOD 5JMND 4YDYA 5CBOA 4HNAD 3SO8A 1OY3D 4O60A 2ETCA 4ZHBA 3DEOA 5EYPF 3B7BA 3D9HA 2BKKB 3TWQA 3Q9UC 2ZGGA 4QQIA 2XZDG 4HI8A 5KNHD 3V79K 3W9GA 4DRXE 3TWUA 4O1PA 4DUIA 4G8KA 5CECB 5AQBA 5KWDA 2KXPC 3JUEA 5AQAA 4ZFHA 3JXJA 4U96D 5ENRD 1D9SA 4HBDA 4J8YA 5ITZF 5HRYA 5AN8A 5EILA 5EIDA 3ZKJA 3B95A 5HKPA 5EYLA 3V2OA 1IHBA 3TWXA 4BEPA 1MJ0A 3HG0D 4B93B 4U8VD 4TUMA 3HRAA 2DZNA 5BXUA 1DC2A 1N0QA 2NYJA 3TWSA 3W9FA 2V5QC 4DX5D 2PNNA 5KBAA 2F37A 4HLLA 2J8SD 1SW6A 3ZU7B 2B0OE 1IKND 3NBNB 1WDYA 3F6QA 4F6RD 4G8LA 4U8YD 2A5EA 4BESA 1SVXA 1NFIE 1MX2A 4GMRA 2XZTG 5HS0A 2ZGDA 5AQ7A 4QFVA 5ENQD 4RLYA 4K5CA 4DX7D 4J7WA 1K1BA 1BI8B 4U95D 5CEAA 2F8YA 1MX4A 5AQ9A 1N11A 4O1OA 2V4HC 2ETBA 3ZUVB 2FO1E 1A5EA 3UI2A 4DX6D 3T8KA 5FIOA 1OT8A 5D66A 3EHRA 4BSZB 2DVWA 3KEAA 2RFMA 4NIKA 1MX6A 5ENPD 1QYMA 4DX1A 4Z68A 2Y1LE 4F1PA 4YDWA 4LNUD 2JABA 5EIBE 2XEEA 3V30A 4HRLA 2Y0BG 5BXOA 5ENTD 2DWZA 1YYHA 1K1AA 3UTMA 1UOHA 5CBNA 2RFAA 1YMPA 4HQDA 2QC9A 1BLXB 1K3ZD 5JA4D 2L6BA 1N0RA 3EHQA 2DZOA 3TWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI7 B;  5ENS D;  4K5A B;  2MYO A;  3NOC D;  5AAO A;  4DX2 A;  5CED B;  4LG6 A;  1TR4 A;  3NOG D;  1G3N B;  3LJN A;  3V2X A;  3TWT A;  4OAU C;  5CER B;  2P2C P;  2QYJ A;  4UUC A;  4CZ2 D;  2BKG A;  1S70 B;  2KBX A;  3AJI A;  4GPM A;  5EN5 D;  5KNG A;  3JXI A;  1AP7 A;  2F8X K;  4HB5 A;  3AAA C;  2VGE A;  3C5R A;  3EU9 A;  3J5P A;  4BET A;  1BU9 A;  4OAV B;  4BER A;  2XEH A;  4C48 B;  3DEP A;  1MYO A;  1BD8 A;  4ATZ D;  2HE0 A;  3TWR A;  3TWV A;  1IXV A;  3T9K A;  2ETA A;  3J5Q B;  5FIN A;  4A63 B;  4LSZ E;  3Q9N C;  1YCS B;  1DCQ A;  2AJA A;  3UXG A;  1AWC B;  4JB8 P;  5AAR A;  3ZNG A;  4CYM D;  4HRN A;  4HRM B;  1WG0 A;  4HI9 A;  4K5B A;  3V31 A;  4N5Q A;  2XEN A;  3IXE A;  5ENO D;  5JMN D;  4YDY A;  5CBO A;  4HNA D;  3SO8 A;  1OY3 D;  4O60 A;  2ETC A;  4ZHB A;  3DEO A;  5EYP F;  3B7B A;  3D9H A;  2BKK B;  3TWQ A;  3Q9U C;  2ZGG A;  4QQI A;  2XZD G;  4HI8 A;  5KNH D;  3V79 K;  3W9G A;  4DRX E;  3TWU A;  4O1P A;  4DUI A;  4G8K A;  5CEC B;  5AQB A;  5KWD A;  2KXP C;  3JUE A;  5AQA A;  4ZFH A;  3JXJ A;  4U96 D;  5ENR D;  1D9S A;  4HBD A;  4J8Y A;  5ITZ F;  5HRY A;  5AN8 A;  5EIL A;  5EID A;  3ZKJ A;  3B95 A;  5HKP A;  5EYL A;  3V2O A;  1IHB A;  3TWX A;  4BEP A;  1MJ0 A;  3HG0 D;  4B93 B;  4U8V D;  4TUM A;  3HRA A;  2DZN A;  5BXU A;  1DC2 A;  1N0Q A;  2NYJ A;  3TWS A;  3W9F A;  2V5Q C;  4DX5 D;  2PNN A;  5KBA A;  2F37 A;  4HLL A;  2J8S D;  1SW6 A;  3ZU7 B;  2B0O E;  1IKN D;  3NBN B;  1WDY A;  3F6Q A;  4F6R D;  4G8L A;  4U8Y D;  2A5E A;  4BES A;  1SVX A;  1NFI E;  1MX2 A;  4GMR A;  2XZT G;  5HS0 A;  2ZGD A;  5AQ7 A;  4QFV A;  5ENQ D;  4RLY A;  4K5C A;  4DX7 D;  4J7W A;  1K1B A;  1BI8 B;  4U95 D;  5CEA A;  2F8Y A;  1MX4 A;  5AQ9 A;  1N11 A;  4O1O A;  2V4H C;  2ETB A;  3ZUV B;  2FO1 E;  1A5E A;  3UI2 A;  4DX6 D;  3T8K A;  5FIO A;  1OT8 A;  5D66 A;  3EHR A;  4BSZ B;  2DVW A;  3KEA A;  2RFM A;  4NIK A;  1MX6 A;  5ENP D;  1QYM A;  4DX1 A;  4Z68 A;  2Y1L E;  4F1P A;  4YDW A;  4LNU D;  2JAB A;  5EIB E;  2XEE A;  3V30 A;  4HRL A;  2Y0B G;  5BXO A;  5ENT D;  2DWZ A;  1YYH A;  1K1A A;  3UTM A;  1UOH A;  5CBN A;  2RFA A;  1YMP A;  4HQD A;  2QC9 A;  1BLX B;  1K3Z D;  5JA4 D;  2L6B A;  1N0R A;  3EHQ A;  2DZO A;  3TWW A; 
#chains in the Genus database with same CATH topology
 4J0U A;  4GZ5 A;  4YDO A;  3QWV A;  2VGY A;  1NA0 A;  5G05 J;  2ZXW E;  3CLJ A;  2Y4U A;  3PH0 C;  4RG9 A;  3R7Q A;  2F8X K;  3FUI A;  2E2E A;  3J5P A;  4C48 B;  4AOF A;  4A63 B;  4LSZ E;  4OVV A;  2BTD A;  3Q78 A;  3CVW A;  4KZ0 A;  3V31 A;  4ILH B;  1GW6 A;  2BKK B;  4DRX E;  2C0L A;  5AIJ A;  4O6F A;  1N4P A;  4WWO A;  1TNZ A;  2XPI A;  3DST A;  5ITZ F;  3B7R L;  2ILR A;  2WMO A;  4BEP A;  1MJ0 A;  1HXI A;  4I2Z A;  5FQ4 A;  3SFZ A;  4TUM A;  2H6I A;  1TNU A;  4HS2 A;  1ZB1 A;  2OOE A;  5KBA A;  2DIW A;  2IY0 C;  5A23 A;  5HS0 A;  2IO3 C;  4A3T A;  2EIK E;  1N4R A;  3QOU A;  1KT0 A;  3G2U A;  4G24 A;  3LY7 A;  2WXK A;  2IOL A;  3EIQ C;  1E90 A;  2WXF A;  4B89 A;  4G23 A;  3BQO A;  3UX4 A;  1QYM A;  2Y0B G;  4UI9 C;  4CT4 A;  5JHB A;  3CVV A;  2XGM A;  4HQD A;  3APC A;  2DZO A;  3O48 A;  5EX3 A;  2X6H A;  2WXQ A;  2BKG A;  3AJI A;  4PUC A;  4KBQ A;  3U3W A;  3MKQ A;  4YVO A;  4I1O B;  4NAC A;  3B7T A;  5AAR A;  5J08 A;  4PS8 A;  4HRN A;  2UWJ G;  4HRM B;  3BU8 A;  3DSW A;  1D9S A;  1ELR A;  3NF1 A;  3CHS A;  3FU6 A;  5ARG A;  5LOZ A;  2ZGG A;  1DVP A;  4F7A A;  4JA7 A;  3TWU A;  3C98 A;  2WQH A;  4G8K A;  3URZ A;  5T4Y A;  3ASD A;  3E30 A;  4KZC A;  2WM9 A;  4AY6 A;  1TN7 A;  2HYZ A;  1S64 A;  5HRY A;  3LJ3 A;  4APF A;  3QK0 A;  3ZRH A;  3RO2 A;  2Y69 E;  4N39 A;  3ONL A;  5BUZ A;  3RU0 A;  5CMW A;  4TRQ A;  4FU3 A;  1HS6 A;  2B0O E;  1FT2 A;  2IOS A;  3CR3 A;  2WXJ A;  3CVY A;  3ULQ A;  3B7S A;  4ME2 A;  4MLP A;  3UM2 A;  4FLH A;  1H6P A;  3ZUV B;  3U4T A;  1PAQ A;  2J07 A;  4F1P A;  4OVU A;  2E0I A;  5ENN A;  3V30 A;  1TJF A;  1U3C A;  1NI1 A;  5H7P A;  2R2L A;  2QC9 A;  1E7U A;  3AU5 A;  3BUA A;  3JCK C;  4OAU C;  4GA2 A;  1Y8M A;  4UUC A;  4DI3 A;  2KBX A;  4HB5 A;  4RVB A;  1BD8 A;  1N52 A;  3FTS A;  2KCK A;  2VYI A;  3T5X A;  4HI9 A;  3D9O A;  5KJN A;  4UWK A;  3RKV A;  3TG5 A;  2RKK A;  4BTB A;  2QY7 A;  5EYP F;  1IQR A;  3B7B A;  3W9G A;  3E34 A;  3CQG B;  2KXP C;  3CHR A;  5ENR D;  4UQY A;  4KXK B;  1OWN A;  2GRO B;  2L0T B;  1KZO A;  4N3C A;  3B95 A;  3RK6 A;  2VTB A;  4G26 A;  3ESL A;  2ZIR A;  3D9M A;  5FJY A;  1HO8 A;  4BY6 A;  4ILI A;  4E85 A;  5T8I A;  2VSY A;  2CFU A;  4U8Y D;  1SVX A;  2XZT G;  3MKR A;  4MBG A;  5AQ7 A;  3Q73 A;  4B0Z A;  1MZC A;  4JEH A;  2GRP B;  5M72 A;  2I1K A;  4Q94 A;  4JL0 A;  4IN3 B;  3NQP A;  4GTS A;  3EHR A;  4XX5 A;  2JLB A;  4NIK A;  4WWN A;  4I2W A;  1JCS A;  4I1M A;  2XEE A;  4LCT A;  3UTM A;  3CEQ A;  3CK8 A;  3PE3 A;  1HZ4 A;  3ZXP A;  1BLX B;  1NA3 A;  3TWW A;  3P1U A;  2BUG A;  4LG6 A;  4J8F A;  2DBA A;  2X6I A;  1RZ4 A;  2EIL E;  1S70 B;  2PM6 A;  4GPM A;  3CHO A;  4XKB A;  2P9N G;  1BU9 A;  5ARF A;  5G04 J;  3AG1 E;  3HXB A;  3OXL A;  1MYO A;  4ATZ D;  4X8Q A;  5ANL A;  3LVQ E;  1ZU2 A;  4U0Z A;  1DCQ A;  3PZ3 A;  4GTP A;  4GZC A;  2VTB B;  1INZ A;  4I6J A;  3AG3 E;  4JHJ A;  3AS4 A;  4OYS A;  2GRQ B;  4U04 A;  2UY1 A;  3EUV A;  4Q69 A;  4GYY A;  1KPS B;  5EDS A;  3AG2 E;  1TJC A;  5KJM A;  3KSL A;  3O4Z A;  2ZU6 B;  2M63 A;  3AS8 A;  1UG3 A;  2GGF A;  4CCA A;  3ZYK A;  3HG0 D;  4U8H A;  2CG3 A;  1OUV A;  3DBS A;  5BXU A;  1P5Q A;  3FWV A;  3HVE B;  3UIN C;  3KSQ A;  4FA6 A;  2OV8 A;  1OWP A;  3ZU7 B;  3JQ1 A;  4ABN A;  3GZS A;  4PDX A;  4RLY A;  3EHM A;  3CHP A;  1LD7 A;  4Y6C A;  4IRU A;  3FUF A;  1A5E A;  1HFA A;  3OTN A;  3S7F A;  4DI4 A;  2LUH A;  1UJJ A;  3ULY A;  3PE4 A;  3EU5 A;  5EX0 A;  5EIB E;  4HLE A;  1OXJ A;  1UN8 A;  4NRH B;  1E96 B;  3S2A A;  2QFC A;  2NYJ A;  2V4L A;  4K5A B;  2NXP A;  3FUM A;  4AIF A;  3JXI A;  2R05 A;  3MCX A;  4J6I A;  5FQ8 A;  3TWR A;  4JXT A;  3E33 A;  4GMJ A;  1QZ2 A;  3U9W A;  3LCA A;  1AWC B;  2YHE A;  4WAF A;  1NZN A;  4N2S A;  3NZS A;  3IXE A;  5JMN D;  3ZW3 A;  4A3V A;  3FUL A;  2NC9 A;  5JJT A;  4ANU A;  5AQA A;  3JXJ A;  3C72 A;  1JCR A;  5FWQ A;  1PY1 A;  2J9Q A;  4IYP A;  3FU0 A;  5EYL A;  5DIZ A;  2YQ8 A;  1N94 A;  4HVB A;  3WG7 E;  2V5Q C;  1Z3X A;  2CHW A;  2ION A;  5JJ6 A;  1IKN D;  2C2L A;  1WDY A;  3L17 A;  3NAW A;  1NFI E;  3D9J A;  3CVQ A;  4MS6 A;  4K5C A;  1EF1 C;  5LCW J;  3HXD A;  1W3B A;  1N11 A;  1KZP A;  2FO1 E;  3OAW A;  1TNY A;  4GTV A;  1E8Y A;  4I1A A;  4I9C A;  5JJ7 A;  5D66 A;  4A1S A;  2Y1L E;  2KM4 A;  1QBQ A;  4CEM A;  3S7D A;  2L0I A;  3MGB A;  1YMP A;  4FP7 A;  4JZY A;  5AJL A;  3LPZ A;  3HXF A;  3SHF A;  3SF4 A;  3NOG D;  5CRV A;  5KCM A;  3AAA C;  3C5R A;  2PQR A;  4B8C B;  1HG2 A;  3DEP A;  3CHQ A;  3SFX A;  5AJD A;  4JB8 P;  4CYM D;  4EZK A;  1BPO A;  3QDN A;  4F1S A;  1LF8 A;  1SA4 A;  4U07 A;  5DBK A;  3UKR G;  3KS2 A;  3AU4 A;  4GYW A;  4BWR A;  3APF A;  5FZS A;  3N71 A;  3G2V A;  2R02 A;  2F0Y A;  1HG5 A;  4F3V A;  4WWP A;  4JPS A;  4HOT A;  2GRL A;  2XS8 A;  1XNF A;  2MRI A;  3SBT B;  5HQ8 A;  5D0O D;  4BSX A;  1MX2 A;  2J4D A;  2OVB A;  2XGS A;  1FVH A;  2DYR E;  2X38 A;  3SFY A;  2WXR A;  3X2Q E;  4O1O A;  4DJA A;  4HOQ A;  4KVM A;  2DVW A;  3MJW A;  1N54 A;  4LNU D;  1OCO E;  2CG2 A;  4Q96 A;  4TXR A;  5CBN A;  3UIP C;  4TUU A;  3IV0 A;  4PH4 B;  2VGX A;  3SGH A;  2P2C P;  3LS8 A;  3FP3 A;  3I4R B;  4BER A;  3FH7 A;  1IXV A;  4I6G A;  4PS7 A;  4RQI A;  3UM0 A;  3QWP A;  1IYG A;  5HI7 A;  3VTY A;  4DLQ A;  3D9H A;  3CVU A;  2HR2 A;  2XPZ A;  3FUJ A;  4LUN U;  3ZN3 A;  4FLB A;  3QKY A;  4CGV A;  3AS5 A;  3ZKJ A;  2IQC A;  3PEV B;  4RSY A;  4GTT A;  2F37 A;  3CK9 A;  2J8S D;  3CKB A;  4H7X A;  2XQ0 A;  4N2Q A;  2R03 A;  2XPY A;  3TL5 A;  3L13 A;  4B8A A;  4EBA A;  1PC2 A;  4CDR A;  4ANX A;  4JHK A;  1MX4 A;  2LO6 A;  1FVF A;  1X81 A;  2FBN A;  4I6E A;  4BSZ B;  2RFM A;  2WXO A;  4U63 A;  1ELW A;  4GA1 A;  4J8S A;  4GCN A;  3EHN A;  3L82 A;  4GCO A;  4KMO A;  1OWM A;  3ML9 A;  3EHQ A;  3DRA A;  4DX2 A;  3E32 A;  3PUJ A;  2YNQ A;  4GZ6 A;  4UQX A;  5CER B;  3CVX A;  2NSZ A;  3FTZ A;  3DSS A;  1IQU A;  3PRE A;  1L5J A;  3CHM A;  3J5Q B;  4KYO B;  1KLX A;  3B13 A;  3UXG A;  5CRU A;  3R9M A;  4WND A;  4AY5 A;  4K5B A;  4DLO A;  1Z5S C;  3LY8 A;  2I6H A;  3ASG A;  2P58 C;  3FHE A;  2IU1 A;  3UKU G;  1HE8 A;  3ZYM A;  4L1B A;  2KZT B;  4HOU A;  3Q4A B;  3FTV A;  4CDM A;  2IF4 A;  3ESK A;  3CVL A;  4JHR A;  4GU5 A;  1SA5 A;  4J8Y A;  1E8W A;  3FUD A;  3ONK A;  1Z3Y A;  2WXH A;  2PM7 A;  4GAA A;  3RRM B;  3MV3 B;  4MRU A;  1DC2 A;  3TWS A;  4ANV A;  3MKQ B;  1OCZ E;  5JHA A;  3U64 A;  2ZGD A;  4DX7 D;  3ZGQ A;  3WXX A;  1OCC E;  3ASN E;  1E8X A;  4JD2 G;  1YA0 A;  1OT8 A;  4ACK A;  3D3M A;  4LNG A;  1A17 A;  3MV2 B;  2WXN A;  3ASF A;  5G2N A;  3L08 A;  1OCR E;  2RFA A;  3SNX A;  5D2M C;  4N3B A;  4UWL A;  1N9A A;  5CEA A;  4UWF A;  4EZL A;  2AXZ A;  3U66 A;  3G2W A;  1TYQ G;  4AP2 A;  2P9I G;  3CVP A;  3FH5 A;  2X6J A;  2LAH A;  1RW2 A;  2KZT A;  1OWO A;  3I3N A;  5EKQ D;  2WQ6 A;  4LNB A;  3ZNG A;  3KD7 A;  3GZ1 A;  3ASH A;  3VLE A;  1OY3 D;  2Y4T A;  4AJW A;  3D9L A;  2R59 A;  3EIJ A;  2XEV A;  2XZD G;  5BW8 C;  2ZIS A;  1FPP A;  2WXI A;  2J09 A;  4BTA A;  2GRM A;  4FC8 A;  4PS3 A;  4U96 D;  4BT8 A;  4ILG A;  4HBD A;  1H6O A;  3TAX A;  4AV7 A;  3T5V A;  4L7T A;  4U8V D;  1UJK A;  3VTX A;  3I4G A;  4HOS A;  4K0R A;  3PVL A;  4I17 A;  3D9N A;  4J7W A;  3SI5 A;  2OVF A;  4XE0 A;  5AQ9 A;  3PS6 A;  4URK A;  3Q47 B;  1HF8 A;  5BV0 A;  3EDT B;  3PZ1 A;  4DX1 A;  3FFL A;  4I9E A;  4YDW A;  4FJY A;  2VSO E;  4J8E A;  4HRL A;  4R7L A;  2BED A;  2XGO A;  3DXK G;  4WUY A;  3MYV A;  2WPV A;  3L22 A;  3DPD A;  2L6B A;  2OCC E;  2MYO A;  2IO2 C;  2DYS E;  5G05 C;  2WB2 A;  3D9K A;  1G3N B;  1NL4 A;  5KJL A;  2QYJ A;  4CZ2 D;  3KAE A;  5KNG A;  4TXP A;  3TG4 A;  2PQN A;  3VLF A;  4GTR A;  3C3R A;  1OWL A;  5FIN A;  3HXC A;  2KCL A;  1SZ9 A;  3HDX A;  3IHY A;  3UIO C;  4EBA G;  2CHX A;  2LNI A;  4B94 A;  4O60 A;  2LAI A;  3Q7F A;  4JEU A;  4JC8 A;  4H7Y A;  3CST A;  4WNG A;  2WXP A;  2EQX A;  3OXF A;  5C2Y A;  1WAO 1;  2MHK A;  3FUK A;  3FTX A;  5EID A;  3ZVV A;  4XI0 A;  2HO1 A;  1XGW A;  2LXL A;  3MA5 A;  3G2S A;  4NUR A;  3IHV A;  3FDH A;  3GZ2 A;  1JWG A;  3UPV A;  4U95 D;  1SZA A;  4BX8 A;  2F8Y A;  1JPL A;  2V4H C;  3S7B A;  3R9A B;  5FIO A;  4GZ3 A;  5B3S E;  2EIJ E;  1H2V C;  3GW4 A;  1Q2Z A;  3ISM C;  5ENT D;  1UOH A;  5LCW C;  3C3Q A;  5E76 A;  2J08 A;  2WVI A;  4YND A;  3RJV A;  2KCV A;  3FH8 A;  1V54 E;  1AP7 A;  1VDY A;  4HFG A;  3TWV A;  4BT9 A;  5BV1 A;  4BX9 A;  3SZ7 A;  4C9B B;  3UM3 A;  4HXI A;  1N4Q A;  1H0A A;  4N5Q A;  3ZHE A;  1X5B A;  2VSX E;  3L6A A;  1TNB A;  5B1A E;  4YDE A;  5A7D B;  1N95 A;  3I5P A;  3MEK A;  5FQ6 A;  4TV3 A;  4G11 A;  4U0U A;  4O1P A;  2R5S A;  3UUX A;  3ABM E;  2VSN A;  3NZU A;  1Y6I A;  2KC7 A;  2OND A;  4W9R A;  5LX8 A;  2L9B A;  4G25 A;  3PRZ A;  1N0Q A;  1TEZ A;  1SW6 A;  4F6R D;  4BES A;  4GMR A;  2LSU A;  3BEE A;  3BG0 B;  5A6C A;  5ENQ D;  2QYU A;  2XRY A;  3SY2 A;  4AVX A;  2XS1 A;  2AW6 A;  4XKC A;  1E8Z A;  4DX6 D;  3ML8 A;  5BPP A;  4JW1 A;  1O1R A;  3Q5M A;  1MX6 A;  4G2V A;  3TXN A;  2DCP A;  1FCH A;  1JUQ A;  3P2B A;  2I2O A;  2AWI A;  2YIN A;  1K1A A;  3EJN A;  3DPY A;  3NOC D;  5AAO A;  2A4Z A;  2P9K G;  2V5F A;  3TWT A;  2B6C A;  2GRR B;  3ABK E;  2PL2 A;  1H6K A;  4BET A;  4EQF A;  2VJ8 A;  1Z6T A;  3JQ0 A;  3LEW A;  4OAV B;  3QAQ A;  2HE0 A;  3D9I A;  4DK5 A;  3PEU B;  4HOR A;  3L16 A;  1ZBP A;  2FEZ A;  4EPZ A;  2R17 C;  3HHM A;  2X6K A;  4ZHB A;  3FTY A;  1S0P A;  3JUI A;  3TWQ A;  4EHM A;  5KNH D;  4HI8 A;  3V79 K;  3IBE A;  5FZR A;  4YVQ C;  2JEK A;  3TJP A;  1QQE A;  5CCL A;  3CV0 A;  2XHE A;  4XEI G;  3HYM B;  4IUL A;  4UQZ A;  4XZ4 A;  1K8K G;  2XCB A;  2V0P A;  3RSE G;  3Q49 B;  2DZN A;  3PDN A;  5J90 A;  3APD A;  3NBN B;  1MQS A;  3CKC A;  4GZD A;  3FTW A;  3HIZ A;  3UT7 A;  4M3O A;  1UW4 B;  3LXU X;  4K03 A;  2P9S G;  2WQ7 A;  1NP7 A;  4NQ0 A;  2PZI A;  3GYZ A;  3IEG A;  4AEZ C;  2KAT A;  4TXQ A;  4MKT A;  4XI9 A;  3MX3 A;  2VGX B;  3CIA A;  3RRN B;  3MZL B;  1N0R A;  3CGH A;  5ENS D;  3R7R A;  3FEY A;  4I43 A;  3LY9 A;  3NB2 A;  4A1G A;  4JVS A;  4N3A A;  2BF0 X;  5BT1 A;  3T9K A;  3CVN A;  3LKU A;  2XCC A;  4M7C A;  1TNO A;  3L9T A;  1WG0 A;  3DSU A;  1D8E A;  1EYH A;  1H2T C;  5ENO D;  3LVR E;  1DCE A;  3DEO A;  2WMN A;  3HXE A;  3K9I A;  4QQI A;  3DSX A;  2IJG X;  3ZFW A;  5CEC B;  4F53 A;  2I9C A;  4APO A;  3D9P A;  1UN9 A;  1D8D A;  4N5C A;  5T3R A;  4UWH A;  4GPK A;  1TN6 A;  2AXV A;  3TGO A;  3HRA A;  4GB9 A;  3FUE A;  4L2Y A;  3JYS A;  4GTO A;  1U3D A;  2WXM A;  1K1B A;  4GML A;  3UMV A;  3ZYL A;  4GTM A;  2FI7 A;  4A55 A;  4LRZ A;  3ZEF A;  3SD5 A;  4XIF A;  1WM5 A;  1FT1 A;  4UI9 K;  1YYH A;  4V3I A;  1K3Z D;  1BI7 B;  3DSV A;  3ASO E;  4KVO A;  4EEC A;  1WY6 A;  4D10 C;  1TR4 A;  3AG4 E;  3UQ3 A;  3ENE A;  2Q7F A;  3QJZ A;  2ETA A;  1YCS B;  5FT9 A;  5IY5 E;  4AM9 A;  4C0E A;  3RO3 A;  3SO8 A;  3ZIM A;  2P9U G;  3QB2 A;  2ETC A;  1EDU A;  3CQC B;  5D0Q D;  5G55 A;  4L23 A;  1H19 A;  3Q9U C;  2AVP A;  1LD8 A;  2IFU A;  1O1S A;  3Q79 A;  3JUE A;  1H2U A;  4WNF A;  4E6H A;  1E7V A;  1QNF A;  5EIL A;  4ANW A;  2X3M A;  3TWX A;  3FEX A;  4EZJ A;  3CK7 A;  3FU5 A;  3W9F A;  2PNN A;  4U0S A;  3FU3 A;  2A5E A;  3QAR A;  4FUL A;  1LTX A;  2QZA A;  1HU3 A;  2FO7 A;  2J49 A;  1DNP A;  4UI9 J;  1O1T A;  4CGW A;  2FUL A;  3KEA A;  3FTU A;  2J4B A;  1HH8 A;  3KEZ A;  4GTQ A;  4FHK A;  3PZD A;  5JA4 D;  3RRU A;  3QWW A;  2A5U A;  1KT1 A;  3QC1 A;  4DPR A;  1JCQ A;  3V2X A;  5FZQ A;  3LYA A;  5CHE E;  3ABL E;  3ZYQ A;  3EU9 A;  4ATG A;  2OEW A;  1V55 E;  1ELK A;  2EIN E;  4WNE A;  3SQV A;  3Q9N C;  4ACL A;  3ULE G;  5CBO A;  2CHZ A;  4P29 A;  4Y6W A;  3PUK A;  2C0M A;  4BFR A;  1HX8 A;  4GA0 A;  2I1J A;  3RIB A;  3Q15 A;  5AQB A;  2GW1 A;  3RAU A;  1U2V G;  4CT0 A;  3ZHE B;  5LFA A;  5HKP A;  3V2O A;  1IHB A;  1N4S A;  4FAD A;  4B93 B;  4L9P A;  3UT8 A;  1SQM A;  3FUH A;  4FJZ A;  3UM1 A;  4DX5 D;  3ZXS A;  1MHQ A;  4LEU A;  4G8L A;  2H6G A;  5AYW D;  2RG8 A;  4QFV A;  4KT6 B;  1BI8 B;  2Y3A A;  4GYO A;  3G2T A;  2HM8 A;  1IHG A;  2H6H A;  2WXL A;  2GRN B;  5E75 A;  3OXG A;  3PZ2 A;  2L6J A;  2DWZ A;  5LP0 A;  2V8S E;  3DXM G;  3Q75 A;  4UWG A;  2AXU A;  4G1T A;  3Q7A A;  5CED B;  2WXG A;  3LJN A;  3PNT B;  5KJK A;  3CSF A;  3ZPJ A;  1JWF A;  5EN5 D;  3PNL B;  5FTP A;  2VGE A;  3BG1 B;  3DWL G;  3L54 A;  5ANR A;  2P9P G;  3T8M A;  3S7J A;  2XEH A;  4L2L A;  5G04 C;  3IKO B;  2FF4 A;  3B7U X;  2VQ2 A;  3FUN A;  2AJA A;  2OEV A;  4AXH A;  2MOW A;  4Z68 A;  4C0M A;  2XEN A;  3E4B A;  2X6F A;  4YDY A;  4HNA D;  3PZ4 A;  3VLD A;  5AEN A;  2RD0 A;  2YHC A;  2CFZ A;  3UT4 A;  4DUI A;  4RG6 A;  5KWD A;  4ZFH A;  2IEJ A;  1TN8 A;  5CCM A;  1O5M A;  4J8D A;  4CDN A;  5AN8 A;  3FY4 A;  2LSV A;  1EPU A;  4LER A;  5B1B E;  4CRW A;  3C3O A;  5BNW A;  1B89 A;  1S63 A;  2LXM A;  2P9L G;  4HLL A;  2XRZ A;  3F6Q A;  3LDZ A;  3QNK A;  4FHJ A;  5FQ7 A;  3TXM A;  3HVE A;  2ETB A;  3E37 A;  3UI2 A;  3T8K A;  4JA9 A;  5CMY A;  5ENP D;  2H6F A;  4U7E B;  2JAB A;  3SBS A;  2EIM E;  5BXO A;  2UY1 B;  5C1D A; 
#chains in the Genus database with same CATH homology
 1BI7 B;  5ENS D;  4K5A B;  2MYO A;  3NOC D;  5AAO A;  4DX2 A;  5CED B;  4LG6 A;  1TR4 A;  3NOG D;  1G3N B;  3LJN A;  3V2X A;  3TWT A;  4OAU C;  5CER B;  2P2C P;  2QYJ A;  4UUC A;  4CZ2 D;  2BKG A;  1S70 B;  2KBX A;  3AJI A;  4GPM A;  5EN5 D;  5KNG A;  3JXI A;  1AP7 A;  2F8X K;  4HB5 A;  3AAA C;  2VGE A;  3C5R A;  3EU9 A;  3J5P A;  4BET A;  1BU9 A;  4OAV B;  4BER A;  2XEH A;  4C48 B;  3DEP A;  1MYO A;  1BD8 A;  4ATZ D;  2HE0 A;  3TWR A;  3TWV A;  1IXV A;  3T9K A;  2ETA A;  3J5Q B;  5FIN A;  4A63 B;  4LSZ E;  3Q9N C;  1YCS B;  1DCQ A;  2AJA A;  3UXG A;  1AWC B;  4JB8 P;  5AAR A;  3ZNG A;  4CYM D;  4HRN A;  4HRM B;  1WG0 A;  4HI9 A;  4K5B A;  3V31 A;  4N5Q A;  2XEN A;  3IXE A;  5ENO D;  5JMN D;  4YDY A;  5CBO A;  4HNA D;  3SO8 A;  1OY3 D;  4O60 A;  2ETC A;  4ZHB A;  3DEO A;  5EYP F;  3B7B A;  3D9H A;  2BKK B;  3TWQ A;  3Q9U C;  2ZGG A;  4QQI A;  2XZD G;  4HI8 A;  5KNH D;  3V79 K;  3W9G A;  4DRX E;  3TWU A;  4O1P A;  4DUI A;  4G8K A;  5CEC B;  5AQB A;  5KWD A;  2KXP C;  3JUE A;  5AQA A;  4ZFH A;  3JXJ A;  4U96 D;  5ENR D;  1D9S A;  4HBD A;  4J8Y A;  5ITZ F;  5HRY A;  5AN8 A;  5EIL A;  5EID A;  3ZKJ A;  3B95 A;  5HKP A;  5EYL A;  3V2O A;  1IHB A;  3TWX A;  4BEP A;  1MJ0 A;  3HG0 D;  4B93 B;  4U8V D;  4TUM A;  3HRA A;  2DZN A;  5BXU A;  1DC2 A;  1N0Q A;  2NYJ A;  3TWS A;  3W9F A;  2V5Q C;  4DX5 D;  2PNN A;  5KBA A;  2F37 A;  4HLL A;  2J8S D;  1SW6 A;  3ZU7 B;  2B0O E;  1IKN D;  3NBN B;  1WDY A;  3F6Q A;  4F6R D;  4G8L A;  4U8Y D;  2A5E A;  4BES A;  1SVX A;  1NFI E;  1MX2 A;  4GMR A;  2XZT G;  5HS0 A;  2ZGD A;  5AQ7 A;  4QFV A;  5ENQ D;  4RLY A;  4K5C A;  4DX7 D;  4J7W A;  1K1B A;  1BI8 B;  4U95 D;  5CEA A;  2F8Y A;  1MX4 A;  5AQ9 A;  1N11 A;  4O1O A;  2V4H C;  2ETB A;  3ZUV B;  2FO1 E;  1A5E A;  3UI2 A;  4DX6 D;  3T8K A;  5FIO A;  1OT8 A;  5D66 A;  3EHR A;  4BSZ B;  2DVW A;  3KEA A;  2RFM A;  4NIK A;  1MX6 A;  5ENP D;  1QYM A;  4DX1 A;  4Z68 A;  2Y1L E;  4F1P A;  4YDW A;  4LNU D;  2JAB A;  5EIB E;  2XEE A;  3V30 A;  4HRL A;  2Y0B G;  5BXO A;  5ENT D;  2DWZ A;  1YYH A;  1K1A A;  3UTM A;  1UOH A;  5CBN A;  2RFA A;  1YMP A;  4HQD A;  2QC9 A;  1BLX B;  1K3Z D;  5JA4 D;  2L6B A;  1N0R A;  3EHQ A;  2DZO A;  3TWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...