4F6RD

Tubulin:stathmin-like domain complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
159
structure length
159
Chain Sequence
GSDLGKKLLEAARAGQDDEVRILMANGADVNAEDDSGKTPLHLAAIKGHLEIVEVLLKHGADVNAADKMGDTPLHLAALYGHLEIVEVLLKNGADVNATDTYGFTPLHLAADAGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Design and characterization of modular scaffolds for tubulin assembly.
pubmed doi rcsb
source organism Artificial gene
molecule tags Cell cycle
total genus 54
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4f6rD00
2A5EA 3V30A 1IXVA 2ETBA 4DX1A 1OY3D 2ETCA 5ENSD 5HRYA 4O1OA 5ENQD 3TWSA 2RFAA 4BEPA 3Q9UC 5KNHD 5HS0A 3ZKJA 3UXGA 4ZFHA 4U8VD 1DC2A 4QQIA 5ENRD 4HRMB 1YYHA 4U8YD 1BI8B 5CBOA 1N0RA 2V5QC 1BLXB 4HLLA 3Q9NC 5FINA 4K5BA 4GMRA 3EHQA 1QYMA 1BU9A 3AJIA 3TWWA 3C5RA 4HI8A 3V79K 4Z68A 1AP7A 2XZTG 1MX4A 2DVWA 4G8KA 4K5CA 4YDWA 4ATZD 3D9HA 2F8YA 3NOCD 3NOGD 3TWXA 2FO1E 3T8KA 1S70B 3JXJA 5AQ7A 3T9KA 5EIBE 4HQDA 4HB5A 5EILA 1TR4A 3UI2A 2NYJA 2XEHA 4ZHBA 2F37A 4JB8P 5ENPD 4HNAD 4LNUD 3V31A 4CZ2D 4OAUC 3EHRA 3ZNGA 3TWUA 3NBNB 5AQ9A 4HRLA 4O60A 1YMPA 1IKND 2AJAA 5BXUA 2F8XK 5FIOA 4F6RD 2QC9A 5CERB 2VGEA 1UOHA 3IXEA 3TWQA 1MX2A 4UUCA 2DZNA 3AAAC 4O1PA 1NFIE 2V4HC 5KBAA 2HE0A 4K5AB 2XENA 4QFVA 3V2OA 2ZGDA 1AWCB 2Y1LE 2BKGA 4LSZE 2QYJA 5EYPF 3J5PA 1SW6A 3F6QA 4J7WA 4U96D 4DUIA 2L6BA 5CECB 1BI7B 4DX6D 4HI9A 3ZU7B 1MYOA 4LG6A 4BESA 1WG0A 1K1BA 1YCSB 1MX6A 2PNNA 2XEEA 4A63B 5AQBA 4TUMA 4DX2A 4DX7D 5JMND 4BERA 4GPMA 3SO8A 4OAVB 2KBXA 3B7BA 3TWVA 4CYMD 5CEAA 4HRNA 4J8YA 1N11A 2ETAA 3ZUVB 5EN5D 5KWDA 3JUEA 1IHBA 2DWZA 4HBDA 5EIDA 4DRXE 3UTMA 5ENTD 2XZDG 3HG0D 4F1PA 4BETA 1OT8A 2Y0BG 1K3ZD 4G8LA 4B93B 3HRAA 1BD8A 5AQAA 5JA4D 2RFMA 1D9SA 5BXOA 4U95D 1SVXA 5CEDB 3TWRA 3J5QB 5CBNA 3KEAA 2JABA 3V2XA 5ITZF 3W9FA 2P2CP 5ENOD 2MYOA 4NIKA 3DEPA 2B0OE 4BSZB 4C48B 5HKPA 3B95A 4N5QA 3LJNA 5AAOA 1N0QA 2KXPC 1A5EA 5KNGA 3JXIA 4YDYA 3TWTA 1K1AA 3DEOA 3EU9A 2DZOA 5AARA 4DX5D 5EYLA 1MJ0A 5D66A 5AN8A 2ZGGA 2BKKB 1DCQA 4RLYA 3W9GA 1WDYA 1G3NB 2J8SD
chains in the Genus database with same CATH superfamily
2J09A 1N4SA 3TWSA 3CKCA 5HS0A 4ATGA 4FHJA 2KATA 4F7AA 2AW6A 4IRUA 5B1BE 4FHKA 2JLBA 4HI8A 3IBEA 5G05C 3GYZA 3QARA 3NOGD 2WXHA 3T8KA 4XKBA 5ANRA 4GTVA 4GPKA 1W3BA 4WNFA 4UI9K 1TYQG 4G23A 3NBNB 3S7BA 4GTQA 5FIOA 1Y8MA 3D9IA 2VGEA 5A7DB 1UW4B 4B0ZA 4K5AB 2XENA 3UINC 3ZYQA 4G11A 1MHQA 1UN8A 3FUFA 4TRQA 3ESKA 4GYOA 1KT1A 5CMWA 4A63B 3CVVA 3MX3A 2ZIRA 3ZXPA 3JUIA 1H2VC 1RW2A 4GMLA 1UG3A 3EIJA 1K3ZD 4ANVA 4CT4A 5JA4D 5AQAA 2IF4A 3LY7A 2X6IA 4I9EA 1OUVA 4IYPA 3DSXA 4GTOA 4N3BA 3SNXA 4MKTA 4DX5D 3L16A 2KZTB 3R9AB 4EECA 2LNIA 4ACLA 1WDYA 2C0MA 2P9LG 4BEPA 1Z3XA 1Z3YA 3ZGQA 3FTYA 5CRVA 4CCAA 2NXPA 1YA0A 3AJIA 3AS4A 3TWWA 4V3IA 1MX4A 5KCMA 1ZBPA 3B7TA 3C98A 1HS6A 2AXUA 1K8KG 4HB5A 3R9MA 4GTPA 2LXMA 4AEZC 3K9IA 3V31A 1O1SA 2CG2A 1JCRA 1KZPA 1TNOA 3FH8A 3AS8A 2WMOA 2HE0A 3QC1A 3R7RA 1UJJA 3Q75A 3OXLA 1UN9A 2KC7A 2PNNA 3G2SA 3CIAA 4G26A 4OVUA 1E8ZA 3D9OA 3SY2A 4NRHB 4BWRA 4EPZA 1D8EA 4OYSA 4C0EA 1HXIA 1O1TA 3KEAA 4JA9A 4WNGA 2KXPC 4PUCA 3MV2B 2WMNA 1NA0A 2DZOA 2KZTA 2V8SE 4K0RA 5LOZA 3NZUA 1G3NB 4LEUA 4LCTA 3E32A 1E7VA 3AS5A 1SQMA 3EHQA 2BUGA 1RZ4A 5JHBA 4K5CA 4ATZD 1OWMA 2EILE 4LNBA 3LKUA 3PE3A 3UM1A 4AY6A 4HNAD 1MZCA 1HG5A 3C3RA 1YMPA 1IKND 2XCBA 3SQVA 2WQHA 3APCA 3MV3B 4JC8A 1HG2A 3AG3E 2XRYA 4J7WA 3PNLB 3CHMA 1MYOA 4XIFA 2EIJE 2XGSA 3L54A 4GTRA 2I1KA 1UJKA 4CYMD 4F53A 3RKVA 3DXMG 4Q96A 1H6KA 3TGOA 3UTMA 4F1SA 2MHKA 1FPPA 5FQ8A 1OWNA 2RFMA 4ILGA 1SVXA 2EIKE 1N95A 3Q4AB 2FEZA 3J5QB 5FZRA 2P9NG 2CFZA 1Z5SC 3FH5A 4JEHA 2VQ2A 4U0SA 1E8XA 4JL0A 4LRZA 2V0PA 1A5EA 1E96B 4J6IA 3DEOA 1MJ0A 4UQYA 3W9GA 3FP3A 1Q2ZA 2QY7A 2P9SG 4FP7A 1BI8B 2H6IA 5CBOA 1N0RA 4G25A 4FJZA 2LAIA 4KT6B 4YDWA 4TV3A 4L9PA 5EKQD 3GZ1A 3OXFA 4LERA 2Y4TA 3ASGA 3FH7A 2VSNA 5D0QD 2OEWA 4OAUC 3QWWA 3BG0B 3PVLA 2FO7A 3TWQA 2DZNA 4BT9A 2A5UA 2Y1LE 3ZVVA 3FY4A 2IOLA 1WAO1 2WQ7A 1HZ4A 3UIPC 3Q78A 4GB9A 4JEUA 3FULA 4BERA 2XPIA 2LAHA 3RK6A 4HBDA 5EIDA 5LCWC 2VJ8A 2DYSE 2LO6A 5IY5E 4C9BB 5ANLA 4YVQC 2XGOA 5CEDB 4G2VA 4J8DA 3AU4A 5ENOD 2VGXB 4JPSA 3DBSA 1SA5A 1WY6A 3ULQA 5BV0A 2YINA 3DSUA 2HM8A 4KYOB 4AJWA 3LYAA 1OY3D 2XGMA 2RFAA 3Q9UC 3ZKJA 3CEQA 2H6GA 1YYHA 3FEXA 4UWLA 5FINA 4G1TA 4Y6CA 5BW8C 2XS1A 3V79K 4I1AA 3UT7A 4JW1A 3JQ1A 3KD7A 2QYUA 4HS2A 4GU5A 3BG1B 5A6CA 3SFXA 3C72A 5ENPD 5KJKA 3TWUA 4O60A 2AJAA 2QC9A 5CERB 4DLOA 3IKOB 3PUKA 3AAAC 5AYWD 5KBAA 3B7RL 2RG8A 2KCKA 3ABLE 4BTBA 4B8AA 2LSUA 2P9PG 3KSQA 4NACA 2I9CA 3E34A 4DX6D 3DSSA 1TJFA 5AQBA 3SF4A 4GPMA 3DSVA 3IHVA 4J8YA 3E37A 2GGFA 2CHXA 3HRAA 1BD8A 2VYIA 3CHPA 2WPVA 2P58C 4ME2A 4E6HA 1HO8A 5FQ4A 5G04C 3DPYA 5CMYA 3UKRG 3APDA 3S2AA 2B0OE 2XS8A 3QWVA 2DBAA 3AG2E 4WNEA 3VTXA 1IXVA 4DX1A 5ENSD 4ZFHA 1N9AA 3RRNB 3UT8A 3KEZA 4XKCA 4JZYA 3T5XA 3PZDA 4FLBA 4N2SA 5BNWA 1N4QA 5EX0A 4TUUA 5AJDA 4WWNA 3JXJA 3DRAA 3ML8A 2XCCA 3BUAA 1U3DA 2IO2C 2GRMA 1OWPA 1SZAA 1E8YA 4HLEA 2UY1A 2MOWA 3IXEA 1PC2A 4J8FA 3U3WA 2BKGA 5AJLA 1ELWA 3S7DA 3FU0A 4A3VA 1ZB1A 2VTBA 4AIFA 2IO3C 4U7EB 4GA1A 2WXIA 5E76A 4XEIG 1FT2A 1IHBA 4XX5A 5LX8A 1EYHA 2PZIA 4AP2A 1JUQA 4G8LA 3D9NA 3X2QE 4JXTA 4PS8A 4TXPA 5J08A 3TWRA 4I17A 2UWJG 4JHJA 5FZQA 1DCEA 4URKA 5ITZF 4HOQA 4WAFA 5FWQA 2WB2A 4O6FA 1ELRA 3BQOA 4BT8A 3PH0C 3P1UA 5KNGA 4AM9A 4YDYA 3CK7A 4DI3A 5ARFA 3FUNA 2HYZA 4RLYA 3MKRA 4O1OA 4KZCA 2GW1A 3PZ4A 1DC2A 2CG3A 2FULA 3RAUA 2XPZA 4BY6A 4U8YD 4AV7A 5E75A 4PDXA 2V5QC 5M72A 2QZAA 3S7JA 3HHMA 2PL2A 1D8DA 3D9KA 5KJMA 4P29A 3HYMB 4RVBA 4I6EA 3FTSA 1EDUA 3RRMB 3FU6A 3D3MA 1TNZA 3MJWA 4IULA 2BF0X 3LY9A 4F6RD 3DXKG 3PDNA 1LD8A 4K03A 4CDRA 5C1DA 4I1MA 2R03A 4IN3B 1PY1A 1YCSB 3UMVA 1NL4A 4KZ0A 2ETAA 2X6KA 1X5BA 3LJ3A 3KAEA 4GAAA 2J08A 3HG0D 3MA5A 2J4BA 1OT8A 4GA2A 4EZKA 4JHRA 3APFA 4M7CA 3EHMA 3NQPA 3RO2A 2FI7A 4L2LA 4UWGA 4XE0A 2IFUA 4C48B 2R05A 3D9MA 4CT0A 1H0AA 4J0UA 3HXDA 3DPDA 5AARA 3G2VA 2GRLA 1HF8A 2WXMA 4GTMA 2V5FA 1TNBA 3MGBA 2A5EA 3CQCB 5HRYA 3UXGA 5ENRD 3B13A 2X6FA 3GZSA 4B94A 5G2NA 3QB2A 2X3MA 2AVPA 5J90A 3TWXA 4GTSA 2NC9A 4X8QA 4HQDA 3T9KA 2EQXA 4A1SA 2RKKA 2ONDA 2F37A 4JB8P 3UT4A 5CCMA 3ASFA 4EBAA 2E0IA 3Q73A 3PRZA 1QQEA 5DBKA 2PM7A 4E85A 3IEGA 4YNDA 3I3NA 1MX2A 1MQSA 3FUJA 4O1PA 2V4HC 2ZGDA 1AWCB 3ML9A 3CVWA 4N39A 3ABKE 2L9BA 2J9QA 4BFRA 4DX2A 3LXUX 3AU5A 2WXJA 4YVOA 4EZLA 3CVXA 5ENTD 3R7QA 4B93B 4U95D 4RQIA 1N52A 3EHNA 4FADA 4I6JA 4L7TA 5B1AE 3L9TA 1TNUA 3MKQB 1K1AA 5EYLA 2Y4UA 2PM6A 3Q79A 2ETBA 4ANXA 3TG5A 3HXFA 1S63A 1LD7A 2YHEA 5D0OD 2V4LA 3ISMC 2I2OA 4BX9A 2OCCE 3CVLA 4G8KA 1O1RA 4HXIA 3EIQC 5AQ7A 4WWOA 4Q69A 5EILA 1TR4A 3CSTA 3FTXA 2FBNA 3U66A 3UKUG 4BTAA 4R7LA 3EJNA 2YQ8A 4NURA 3CQGB 2X38A 3TJPA 4U07A 3L08A 5BXUA 2ILRA 5LP0A 2JEKA 3LDZA 1U2VG 3HXCA 4UWKA 3J5PA 1JPLA 2WM9A 4NQ0A 1BI7B 2Q7FA 4FULA 3E33A 4BESA 5LCWJ 3OAWA 4DX7D 4UI9C 3SO8A 1N11A 1FT1A 2LUHA 3T5VA 3UPVA 3BU8A 4XI0A 2DIWA 2MRIA 2R59A 4GZ3A 3VLFA 4U8HA 3QJZA 4JD2G 3ASDA 4I2ZA 4PS7A 2XHEA 3KS2A 2FF4A 3G2TA 2PQRA 3ASNE 1QNFA 3MKQA 4N3AA 3EU9A 4M3OA 2CHWA 5D66A 1H19A 3IHYA 2FO1E 3SZ7A 2J8SD 5BXOA 4XI9A 3V30A 2R2LA 4GZCA 4Q94A 4JA7A 5KNHD 4G24A 4I9CA 4FU3A 4D10C 5CCLA 1BLXB 3Q9NC 1DVPA 4FJYA 1QYMA 1INZA 2KCVA 1NZNA 3D9HA 4CDNA 1H6PA 3FWVA 5DIZA 4MLPA 3FDHA 3D9PA 4GCOA 1NI1A 3GW4A 2XPYA 3SHFA 4N3CA 4CZ2D 4C0MA 3PZ3A 4GA0A 3EUVA 2F8XK 1UOHA 4APFA 2EIME 2VSXE 4UUCA 1NFIE 3ZN3A 3UQ3A 5JHAA 2C2LA 1TN7A 4LSZE 5EYPF 1Z6TA 2E2EA 3CVQA 4JHKA 4WUYA 2IONA 2H6HA 2WXQA 2IU1A 4ACKA 4RG6A 5EN5D 2UY1B 5G04J 5G55A 5T8IA 3E4BA 2KCLA 1D9SA 1HX8A 3LEWA 2KM4A 3VLDA 3QDNA 4CGVA 5FTPA 2VTBB 1LTXA 4UQZA 1OXJA 3GZ2A 2GRNB 3IV0A 2AXZA 3Q7FA 3RIBA 1QZ2A 2QFCA 4APOA 4EZJA 3CVYA 3VTYA 1VDYA 3ZYLA 3ZHEA 3FUHA 4GYWA 4HLLA 3ZIMA 3Q49B 4HVBA 1N54A 3CV0A 2I1JA 3DSTA 4L2YA 2LXLA 3FTWA 3PZ1A 3CR3A 4HFGA 1H2UA 2J49A 2Y3AA 3ONKA 3P2BA 2GROB 2CFUA 1KPSB 1PAQA 3RJVA 3V2OA 3UM0A 1V55E 5CECB 3Q47B 2R02A 3FTZA 5BUZA 1JWGA 3B7BA 3EDTB 3L22A 5CEAA 3ABME 5KWDA 2X6JA 3LVRE 4L23A 4DRXE 2RD0A 1E7UA 3ZW3A 4MBGA 4H7XA 4CDMA 1OCCE 2Y0BG 3U4TA 2DCPA 3HXEA 4GZ6A 1OWLA 3SFYA 2JABA 1KT0A 2F0YA 3SFZA 2MYOA 4HOSA 4HOUA 2VGYA 2AXVA 3C3QA 3FFLA 2C0LA 3ULYA 3JXIA 1IHGA 4RSYA 3CVUA 3L13A 2ETCA 3CHRA 1FVFA 4LUNU 3G2UA 3SD5A 4N2QA 4K5BA 1H2TC 2P9IG 1EPUA 5FT9A 3SI5A 4A3TA 3C5RA 3E30A 4Z68A 3FUEA 4I6GA 2F8YA 5FJYA 3NOCD 1FCHA 3JYSA 1S70B 4TXRA 2EINE 3Q7AA 3UI2A 3AG4E 2NYJA 4ZHBA 2WXRA 3FUDA 3Q15A 2XEVA 3ENEA 3ZNGA 4FA6A 3OXGA 3AG1E 3D9JA 4HRLA 3LY8A 2WXPA 2WXFA 2R5SA 3NAWA 1V54E 4QFVA 3D9LA 3TXMA 3CVPA 3CVNA 3RO3A 2QYJA 5KJNA 2GRPB 4U96D 4DUIA 3HDXA 4DPRA 4Y6WA 4DLQA 1TN6A 3TL5A 2VSOE 3I4RB 4AVXA 2GRRB 2DWZA 3NF1A 4CEMA 3PE4A 3L6AA 1HU3A 3ZPJA 3O48A 3URZA 4J8EA 1OWOA 5HQ8A 4PS3A 2WXKA 3JCKC 5BT1A 3ZRHA 3FUMA 2YNQA 2P2CP 3DEPA 3QAQA 1L5JA 3OTNA 5AN8A 2BKKB 4GZDA 1X81A 2L0TB 4GMRA 3L17A 4I1OB 3ESLA 3FHEA 2HR2A 4MS6A 3PZ2A 5JJ6A 5FZSA 3O4ZA 5FQ6A 3SBSA 1B89A 3ASOE 3QOUA 5HI7A 2P9UG 4UWHA 3MEKA 4ANWA 3ASHA 1HH8A 1OCOE 4EQFA 1DNPA 3ZYMA 4B8CB 4PH4B 4YDEA 4HI9A 4MRUA 1IQRA 1TN8A 4OVVA 2WXNA 4U63A 5JMND 4A1GA 2ZISA 4OAVB 3FEYA 5T4YA 1TEZA 2WVIA 5JJTA 3CSFA 3CHOA 2OEVA 3S7FA 3I5PA 2J07A 3PNTB 4NIKA 3UUXA 3QK0A 3C3OA 5HKPA 5AIJA 3B95A 5AAOA 4U0ZA 1N0QA 5CRUA 1WM5A 4I43A 4GYYA 3PUJA 4GCNA 3ZXSA 5ENQD 4I2WA 3SBTB 3ZYKA 4U8VD 1H6OA 4HRMB 3UM2A 3B7UX 5T3RA 1U3CA 1JWFA 1E90A 2OVFA 4GZ5A 1AP7A 3NB2A 5A23A 2L6JA 3ULEG 4ILIA 1SA4A 5EIBE 1KLXA 1NA3A 2XQ0A 2AWIA 4A55A 5B3SE 3ZFWA 2ZXWE 3EHRA 4HOTA 3HXBA 3VLEA 2ZU6B 4L1BA 2PQNA 4KVMA 3RRUA 4AY5A 4GTTA 1A17A 2I6HA 2IJGX 4N5CA 4UI9J 3F6QA 3LCAA 3MCXA 2L6BA 4CRWA 3ZU7B 4LG6A 2R17C 2OVBA 2M63A 2KBXA 2WXGA 4HRNA 4BX8A 3B7SA 5EX3A 3ZUVB 2YHCA 1EF1C 1XGWA 4ANUA 2L0IA 2A4ZA 4AXHA 4UWFA 3CHSA 3CHQA 3V2XA 1S64A 1TJCA 2IEJA 4U04A 3JQ0A 3L82A 3MZLB 4BSZB 3HVEB 3LJNA 5EDSA 4U0UA 3Q5MA 2HO1A 5AENA 3CLJA 1LF8A 1JCQA 2GRQB 4WNDA 3PREA 2B6CA 2CHZA 3U9WA 1HFAA 4JVSA 1OCZE 3T8MA 4TXQA 1S0PA 2X6HA 2XEHA 3DSWA 3ZEFA 3UIOC 4LNUD 4AOFA 1GW6A 4ABNA 1BPOA 3WG7E 3ZHEB 3G2WA 4UQXA 1SZ9A 3FUKA 2BEDA 3EU5A 4HORA 3RSEG 5LFAA 4H7YA 2OV8A 3MYVA 4EHMA 1FVHA 5JJ7A 3CGHA 3LS8A 1NP7A 4F3VA 1MX6A 4CGWA 2XEEA 4TUMA 1ELKA 1QBQA 3CK9A 1HE8A 1JCSA 5KJLA 3PEVB 5BPPA 3TWVA 2H6FA 4B89A 2WXOA 5D2MC 1N4RA 2Y69E 3DWLG 4DK5A 4F1PA 4BETA 2WXLA 3QKYA 5CHEE 3KSLA 3N71A 1OCRE 2BTDA 1TNYA 1IYGA 3CKBA 3HIZA 3BEEA 4KMOA 4LNGA 4XZ4A 4DJAA 4N5QA 3HVEA 3TXNA 4W9RA 2P9KG 4FC8A 3I4GA 5H7PA 3FTUA 2IOSA 1E8WA 4BSXA 3LPZA 5ARGA 2IQCA 2J4DA 2OOEA 4QQIA 4GMJA 4EBAG 1O5MA 3ONLA 2VSYA 5C2YA 2DYRE 1BU9A 3QWPA 3SGHA 2XZTG 2DVWA 3TAXA 4ILHB 3LVQE 3NZSA 4RG9A 2XRZA 5AQ9A 3FU5A 2IY0C 2LSVA 5ENNA 3QNKA 1N4PA 4KVOA 1SW6A 3WXXA 4YDOA 4FLHA 1WG0A 1K1BA 4KBQA 3PEUB 2VGXA 1Y6IA 2WQ6A 5BV1A 3U64A 3RU0A 1IQUA 3JUEA 2NSZA 5FQ7A 2XZDG 1N94A 4DI4A 4WWPA 1ZU2A 5CBNA 1P5QA 5G05J 3UM3A 3W9FA 3FUIA 3TG4A 3PS6A 4KXKB 1KZOA 3TWTA 3FTVA 4J8SA 3UX4A 2ZGGA 1DCQA 1XNFA 3CK8A 3FU3A
chains in the Genus database with same CATH topology
2A5EA 3V30A 1IXVA 2ETBA 4DX1A 1OY3D 2ETCA 5ENSD 5HRYA 4O1OA 5ENQD 3TWSA 2RFAA 4BEPA 3Q9UC 5KNHD 5HS0A 3ZKJA 3UXGA 4ZFHA 4U8VD 1DC2A 4QQIA 5ENRD 4HRMB 1YYHA 4U8YD 1BI8B 5CBOA 1N0RA 2V5QC 1BLXB 4HLLA 3Q9NC 5FINA 4K5BA 4GMRA 3EHQA 1QYMA 1BU9A 3AJIA 3TWWA 3C5RA 4HI8A 3V79K 4Z68A 1AP7A 2XZTG 1MX4A 2DVWA 4G8KA 4K5CA 4YDWA 4ATZD 3D9HA 2F8YA 3NOCD 3NOGD 3TWXA 2FO1E 3T8KA 1S70B 3JXJA 5AQ7A 3T9KA 5EIBE 4HQDA 4HB5A 5EILA 1TR4A 3UI2A 2NYJA 2XEHA 4ZHBA 2F37A 4JB8P 5ENPD 4HNAD 4LNUD 3V31A 4CZ2D 4OAUC 3EHRA 3ZNGA 3TWUA 3NBNB 5AQ9A 4HRLA 4O60A 1YMPA 1IKND 2AJAA 5BXUA 2F8XK 5FIOA 4F6RD 2QC9A 5CERB 2VGEA 1UOHA 3IXEA 3TWQA 1MX2A 4UUCA 2DZNA 3AAAC 4O1PA 1NFIE 2V4HC 5KBAA 2HE0A 4K5AB 2XENA 4QFVA 3V2OA 2ZGDA 1AWCB 2Y1LE 2BKGA 4LSZE 2QYJA 5EYPF 3J5PA 1SW6A 3F6QA 4J7WA 4U96D 4DUIA 2L6BA 5CECB 1BI7B 4DX6D 4HI9A 3ZU7B 1MYOA 4LG6A 4BESA 1WG0A 1K1BA 1YCSB 1MX6A 2PNNA 2XEEA 4A63B 5AQBA 4TUMA 4DX2A 4DX7D 5JMND 4BERA 4GPMA 3SO8A 4OAVB 2KBXA 3B7BA 3TWVA 4CYMD 5CEAA 4HRNA 4J8YA 1N11A 2ETAA 3ZUVB 5EN5D 5KWDA 3JUEA 1IHBA 2DWZA 4HBDA 5EIDA 4DRXE 3UTMA 5ENTD 2XZDG 3HG0D 4F1PA 4BETA 1OT8A 2Y0BG 1K3ZD 4G8LA 4B93B 3HRAA 1BD8A 5AQAA 5JA4D 2RFMA 1D9SA 5BXOA 4U95D 1SVXA 5CEDB 3TWRA 3J5QB 5CBNA 3KEAA 2JABA 3V2XA 5ITZF 3W9FA 2P2CP 5ENOD 2MYOA 4NIKA 3DEPA 2B0OE 4BSZB 4C48B 5HKPA 3B95A 4N5QA 3LJNA 5AAOA 1N0QA 2KXPC 1A5EA 5KNGA 3JXIA 4YDYA 3TWTA 1K1AA 3DEOA 3EU9A 2DZOA 5AARA 4DX5D 5EYLA 1MJ0A 5D66A 5AN8A 2ZGGA 2BKKB 1DCQA 4RLYA 3W9GA 1WDYA 1G3NB 2J8SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5E A;  3V30 A;  1IXV A;  2ETB A;  4DX1 A;  1OY3 D;  2ETC A;  5ENS D;  5HRY A;  4O1O A;  5ENQ D;  3TWS A;  2RFA A;  4BEP A;  3Q9U C;  5KNH D;  5HS0 A;  3ZKJ A;  3UXG A;  4ZFH A;  4U8V D;  1DC2 A;  4QQI A;  5ENR D;  4HRM B;  1YYH A;  4U8Y D;  1BI8 B;  5CBO A;  1N0R A;  2V5Q C;  1BLX B;  4HLL A;  3Q9N C;  5FIN A;  4K5B A;  4GMR A;  3EHQ A;  1QYM A;  1BU9 A;  3AJI A;  3TWW A;  3C5R A;  4HI8 A;  3V79 K;  4Z68 A;  1AP7 A;  2XZT G;  1MX4 A;  2DVW A;  4G8K A;  4K5C A;  4YDW A;  4ATZ D;  3D9H A;  2F8Y A;  3NOC D;  3NOG D;  3TWX A;  2FO1 E;  3T8K A;  1S70 B;  3JXJ A;  5AQ7 A;  3T9K A;  5EIB E;  4HQD A;  4HB5 A;  5EIL A;  1TR4 A;  3UI2 A;  2NYJ A;  2XEH A;  4ZHB A;  2F37 A;  4JB8 P;  5ENP D;  4HNA D;  4LNU D;  3V31 A;  4CZ2 D;  4OAU C;  3EHR A;  3ZNG A;  3TWU A;  3NBN B;  5AQ9 A;  4HRL A;  4O60 A;  1YMP A;  1IKN D;  2AJA A;  5BXU A;  2F8X K;  5FIO A;  4F6R D;  2QC9 A;  5CER B;  2VGE A;  1UOH A;  3IXE A;  3TWQ A;  1MX2 A;  4UUC A;  2DZN A;  3AAA C;  4O1P A;  1NFI E;  2V4H C;  5KBA A;  2HE0 A;  4K5A B;  2XEN A;  4QFV A;  3V2O A;  2ZGD A;  1AWC B;  2Y1L E;  2BKG A;  4LSZ E;  2QYJ A;  5EYP F;  3J5P A;  1SW6 A;  3F6Q A;  4J7W A;  4U96 D;  4DUI A;  2L6B A;  5CEC B;  1BI7 B;  4DX6 D;  4HI9 A;  3ZU7 B;  1MYO A;  4LG6 A;  4BES A;  1WG0 A;  1K1B A;  1YCS B;  1MX6 A;  2PNN A;  2XEE A;  4A63 B;  5AQB A;  4TUM A;  4DX2 A;  4DX7 D;  5JMN D;  4BER A;  4GPM A;  3SO8 A;  4OAV B;  2KBX A;  3B7B A;  3TWV A;  4CYM D;  5CEA A;  4HRN A;  4J8Y A;  1N11 A;  2ETA A;  3ZUV B;  5EN5 D;  5KWD A;  3JUE A;  1IHB A;  2DWZ A;  4HBD A;  5EID A;  4DRX E;  3UTM A;  5ENT D;  2XZD G;  3HG0 D;  4F1P A;  4BET A;  1OT8 A;  2Y0B G;  1K3Z D;  4G8L A;  4B93 B;  3HRA A;  1BD8 A;  5AQA A;  5JA4 D;  2RFM A;  1D9S A;  5BXO A;  4U95 D;  1SVX A;  5CED B;  3TWR A;  3J5Q B;  5CBN A;  3KEA A;  2JAB A;  3V2X A;  5ITZ F;  3W9F A;  2P2C P;  5ENO D;  2MYO A;  4NIK A;  3DEP A;  2B0O E;  4BSZ B;  4C48 B;  5HKP A;  3B95 A;  4N5Q A;  3LJN A;  5AAO A;  1N0Q A;  2KXP C;  1A5E A;  5KNG A;  3JXI A;  4YDY A;  3TWT A;  1K1A A;  3DEO A;  3EU9 A;  2DZO A;  5AAR A;  4DX5 D;  5EYL A;  1MJ0 A;  5D66 A;  5AN8 A;  2ZGG A;  2BKK B;  1DCQ A;  4RLY A;  3W9G A;  1WDY A;  1G3N B;  2J8S D; 
#chains in the Genus database with same CATH topology
 2J09 A;  1N4S A;  3TWS A;  3CKC A;  5HS0 A;  4ATG A;  4FHJ A;  2KAT A;  4F7A A;  2AW6 A;  4IRU A;  5B1B E;  4FHK A;  2JLB A;  4HI8 A;  3IBE A;  5G05 C;  3GYZ A;  3QAR A;  3NOG D;  2WXH A;  3T8K A;  4XKB A;  5ANR A;  4GTV A;  4GPK A;  1W3B A;  4WNF A;  4UI9 K;  1TYQ G;  4G23 A;  3NBN B;  3S7B A;  4GTQ A;  5FIO A;  1Y8M A;  3D9I A;  2VGE A;  5A7D B;  1UW4 B;  4B0Z A;  4K5A B;  2XEN A;  3UIN C;  3ZYQ A;  4G11 A;  1MHQ A;  1UN8 A;  3FUF A;  4TRQ A;  3ESK A;  4GYO A;  1KT1 A;  5CMW A;  4A63 B;  3CVV A;  3MX3 A;  2ZIR A;  3ZXP A;  3JUI A;  1H2V C;  1RW2 A;  4GML A;  1UG3 A;  3EIJ A;  1K3Z D;  4ANV A;  4CT4 A;  5JA4 D;  5AQA A;  2IF4 A;  3LY7 A;  2X6I A;  4I9E A;  1OUV A;  4IYP A;  3DSX A;  4GTO A;  4N3B A;  3SNX A;  4MKT A;  4DX5 D;  3L16 A;  2KZT B;  3R9A B;  4EEC A;  2LNI A;  4ACL A;  1WDY A;  2C0M A;  2P9L G;  4BEP A;  1Z3X A;  1Z3Y A;  3ZGQ A;  3FTY A;  5CRV A;  4CCA A;  2NXP A;  1YA0 A;  3AJI A;  3AS4 A;  3TWW A;  4V3I A;  1MX4 A;  5KCM A;  1ZBP A;  3B7T A;  3C98 A;  1HS6 A;  2AXU A;  1K8K G;  4HB5 A;  3R9M A;  4GTP A;  2LXM A;  4AEZ C;  3K9I A;  3V31 A;  1O1S A;  2CG2 A;  1JCR A;  1KZP A;  1TNO A;  3FH8 A;  3AS8 A;  2WMO A;  2HE0 A;  3QC1 A;  3R7R A;  1UJJ A;  3Q75 A;  3OXL A;  1UN9 A;  2KC7 A;  2PNN A;  3G2S A;  3CIA A;  4G26 A;  4OVU A;  1E8Z A;  3D9O A;  3SY2 A;  4NRH B;  4BWR A;  4EPZ A;  1D8E A;  4OYS A;  4C0E A;  1HXI A;  1O1T A;  3KEA A;  4JA9 A;  4WNG A;  2KXP C;  4PUC A;  3MV2 B;  2WMN A;  1NA0 A;  2DZO A;  2KZT A;  2V8S E;  4K0R A;  5LOZ A;  3NZU A;  1G3N B;  4LEU A;  4LCT A;  3E32 A;  1E7V A;  3AS5 A;  1SQM A;  3EHQ A;  2BUG A;  1RZ4 A;  5JHB A;  4K5C A;  4ATZ D;  1OWM A;  2EIL E;  4LNB A;  3LKU A;  3PE3 A;  3UM1 A;  4AY6 A;  4HNA D;  1MZC A;  1HG5 A;  3C3R A;  1YMP A;  1IKN D;  2XCB A;  3SQV A;  2WQH A;  3APC A;  3MV3 B;  4JC8 A;  1HG2 A;  3AG3 E;  2XRY A;  4J7W A;  3PNL B;  3CHM A;  1MYO A;  4XIF A;  2EIJ E;  2XGS A;  3L54 A;  4GTR A;  2I1K A;  1UJK A;  4CYM D;  4F53 A;  3RKV A;  3DXM G;  4Q96 A;  1H6K A;  3TGO A;  3UTM A;  4F1S A;  2MHK A;  1FPP A;  5FQ8 A;  1OWN A;  2RFM A;  4ILG A;  1SVX A;  2EIK E;  1N95 A;  3Q4A B;  2FEZ A;  3J5Q B;  5FZR A;  2P9N G;  2CFZ A;  1Z5S C;  3FH5 A;  4JEH A;  2VQ2 A;  4U0S A;  1E8X A;  4JL0 A;  4LRZ A;  2V0P A;  1A5E A;  1E96 B;  4J6I A;  3DEO A;  1MJ0 A;  4UQY A;  3W9G A;  3FP3 A;  1Q2Z A;  2QY7 A;  2P9S G;  4FP7 A;  1BI8 B;  2H6I A;  5CBO A;  1N0R A;  4G25 A;  4FJZ A;  2LAI A;  4KT6 B;  4YDW A;  4TV3 A;  4L9P A;  5EKQ D;  3GZ1 A;  3OXF A;  4LER A;  2Y4T A;  3ASG A;  3FH7 A;  2VSN A;  5D0Q D;  2OEW A;  4OAU C;  3QWW A;  3BG0 B;  3PVL A;  2FO7 A;  3TWQ A;  2DZN A;  4BT9 A;  2A5U A;  2Y1L E;  3ZVV A;  3FY4 A;  2IOL A;  1WAO 1;  2WQ7 A;  1HZ4 A;  3UIP C;  3Q78 A;  4GB9 A;  4JEU A;  3FUL A;  4BER A;  2XPI A;  2LAH A;  3RK6 A;  4HBD A;  5EID A;  5LCW C;  2VJ8 A;  2DYS E;  2LO6 A;  5IY5 E;  4C9B B;  5ANL A;  4YVQ C;  2XGO A;  5CED B;  4G2V A;  4J8D A;  3AU4 A;  5ENO D;  2VGX B;  4JPS A;  3DBS A;  1SA5 A;  1WY6 A;  3ULQ A;  5BV0 A;  2YIN A;  3DSU A;  2HM8 A;  4KYO B;  4AJW A;  3LYA A;  1OY3 D;  2XGM A;  2RFA A;  3Q9U C;  3ZKJ A;  3CEQ A;  2H6G A;  1YYH A;  3FEX A;  4UWL A;  5FIN A;  4G1T A;  4Y6C A;  5BW8 C;  2XS1 A;  3V79 K;  4I1A A;  3UT7 A;  4JW1 A;  3JQ1 A;  3KD7 A;  2QYU A;  4HS2 A;  4GU5 A;  3BG1 B;  5A6C A;  3SFX A;  3C72 A;  5ENP D;  5KJK A;  3TWU A;  4O60 A;  2AJA A;  2QC9 A;  5CER B;  4DLO A;  3IKO B;  3PUK A;  3AAA C;  5AYW D;  5KBA A;  3B7R L;  2RG8 A;  2KCK A;  3ABL E;  4BTB A;  4B8A A;  2LSU A;  2P9P G;  3KSQ A;  4NAC A;  2I9C A;  3E34 A;  4DX6 D;  3DSS A;  1TJF A;  5AQB A;  3SF4 A;  4GPM A;  3DSV A;  3IHV A;  4J8Y A;  3E37 A;  2GGF A;  2CHX A;  3HRA A;  1BD8 A;  2VYI A;  3CHP A;  2WPV A;  2P58 C;  4ME2 A;  4E6H A;  1HO8 A;  5FQ4 A;  5G04 C;  3DPY A;  5CMY A;  3UKR G;  3APD A;  3S2A A;  2B0O E;  2XS8 A;  3QWV A;  2DBA A;  3AG2 E;  4WNE A;  3VTX A;  1IXV A;  4DX1 A;  5ENS D;  4ZFH A;  1N9A A;  3RRN B;  3UT8 A;  3KEZ A;  4XKC A;  4JZY A;  3T5X A;  3PZD A;  4FLB A;  4N2S A;  5BNW A;  1N4Q A;  5EX0 A;  4TUU A;  5AJD A;  4WWN A;  3JXJ A;  3DRA A;  3ML8 A;  2XCC A;  3BUA A;  1U3D A;  2IO2 C;  2GRM A;  1OWP A;  1SZA A;  1E8Y A;  4HLE A;  2UY1 A;  2MOW A;  3IXE A;  1PC2 A;  4J8F A;  3U3W A;  2BKG A;  5AJL A;  1ELW A;  3S7D A;  3FU0 A;  4A3V A;  1ZB1 A;  2VTB A;  4AIF A;  2IO3 C;  4U7E B;  4GA1 A;  2WXI A;  5E76 A;  4XEI G;  1FT2 A;  1IHB A;  4XX5 A;  5LX8 A;  1EYH A;  2PZI A;  4AP2 A;  1JUQ A;  4G8L A;  3D9N A;  3X2Q E;  4JXT A;  4PS8 A;  4TXP A;  5J08 A;  3TWR A;  4I17 A;  2UWJ G;  4JHJ A;  5FZQ A;  1DCE A;  4URK A;  5ITZ F;  4HOQ A;  4WAF A;  5FWQ A;  2WB2 A;  4O6F A;  1ELR A;  3BQO A;  4BT8 A;  3PH0 C;  3P1U A;  5KNG A;  4AM9 A;  4YDY A;  3CK7 A;  4DI3 A;  5ARF A;  3FUN A;  2HYZ A;  4RLY A;  3MKR A;  4O1O A;  4KZC A;  2GW1 A;  3PZ4 A;  1DC2 A;  2CG3 A;  2FUL A;  3RAU A;  2XPZ A;  4BY6 A;  4U8Y D;  4AV7 A;  5E75 A;  4PDX A;  2V5Q C;  5M72 A;  2QZA A;  3S7J A;  3HHM A;  2PL2 A;  1D8D A;  3D9K A;  5KJM A;  4P29 A;  3HYM B;  4RVB A;  4I6E A;  3FTS A;  1EDU A;  3RRM B;  3FU6 A;  3D3M A;  1TNZ A;  3MJW A;  4IUL A;  2BF0 X;  3LY9 A;  4F6R D;  3DXK G;  3PDN A;  1LD8 A;  4K03 A;  4CDR A;  5C1D A;  4I1M A;  2R03 A;  4IN3 B;  1PY1 A;  1YCS B;  3UMV A;  1NL4 A;  4KZ0 A;  2ETA A;  2X6K A;  1X5B A;  3LJ3 A;  3KAE A;  4GAA A;  2J08 A;  3HG0 D;  3MA5 A;  2J4B A;  1OT8 A;  4GA2 A;  4EZK A;  4JHR A;  3APF A;  4M7C A;  3EHM A;  3NQP A;  3RO2 A;  2FI7 A;  4L2L A;  4UWG A;  4XE0 A;  2IFU A;  4C48 B;  2R05 A;  3D9M A;  4CT0 A;  1H0A A;  4J0U A;  3HXD A;  3DPD A;  5AAR A;  3G2V A;  2GRL A;  1HF8 A;  2WXM A;  4GTM A;  2V5F A;  1TNB A;  3MGB A;  2A5E A;  3CQC B;  5HRY A;  3UXG A;  5ENR D;  3B13 A;  2X6F A;  3GZS A;  4B94 A;  5G2N A;  3QB2 A;  2X3M A;  2AVP A;  5J90 A;  3TWX A;  4GTS A;  2NC9 A;  4X8Q A;  4HQD A;  3T9K A;  2EQX A;  4A1S A;  2RKK A;  2OND A;  2F37 A;  4JB8 P;  3UT4 A;  5CCM A;  3ASF A;  4EBA A;  2E0I A;  3Q73 A;  3PRZ A;  1QQE A;  5DBK A;  2PM7 A;  4E85 A;  3IEG A;  4YND A;  3I3N A;  1MX2 A;  1MQS A;  3FUJ A;  4O1P A;  2V4H C;  2ZGD A;  1AWC B;  3ML9 A;  3CVW A;  4N39 A;  3ABK E;  2L9B A;  2J9Q A;  4BFR A;  4DX2 A;  3LXU X;  3AU5 A;  2WXJ A;  4YVO A;  4EZL A;  3CVX A;  5ENT D;  3R7Q A;  4B93 B;  4U95 D;  4RQI A;  1N52 A;  3EHN A;  4FAD A;  4I6J A;  4L7T A;  5B1A E;  3L9T A;  1TNU A;  3MKQ B;  1K1A A;  5EYL A;  2Y4U A;  2PM6 A;  3Q79 A;  2ETB A;  4ANX A;  3TG5 A;  3HXF A;  1S63 A;  1LD7 A;  2YHE A;  5D0O D;  2V4L A;  3ISM C;  2I2O A;  4BX9 A;  2OCC E;  3CVL A;  4G8K A;  1O1R A;  4HXI A;  3EIQ C;  5AQ7 A;  4WWO A;  4Q69 A;  5EIL A;  1TR4 A;  3CST A;  3FTX A;  2FBN A;  3U66 A;  3UKU G;  4BTA A;  4R7L A;  3EJN A;  2YQ8 A;  4NUR A;  3CQG B;  2X38 A;  3TJP A;  4U07 A;  3L08 A;  5BXU A;  2ILR A;  5LP0 A;  2JEK A;  3LDZ A;  1U2V G;  3HXC A;  4UWK A;  3J5P A;  1JPL A;  2WM9 A;  4NQ0 A;  1BI7 B;  2Q7F A;  4FUL A;  3E33 A;  4BES A;  5LCW J;  3OAW A;  4DX7 D;  4UI9 C;  3SO8 A;  1N11 A;  1FT1 A;  2LUH A;  3T5V A;  3UPV A;  3BU8 A;  4XI0 A;  2DIW A;  2MRI A;  2R59 A;  4GZ3 A;  3VLF A;  4U8H A;  3QJZ A;  4JD2 G;  3ASD A;  4I2Z A;  4PS7 A;  2XHE A;  3KS2 A;  2FF4 A;  3G2T A;  2PQR A;  3ASN E;  1QNF A;  3MKQ A;  4N3A A;  3EU9 A;  4M3O A;  2CHW A;  5D66 A;  1H19 A;  3IHY A;  2FO1 E;  3SZ7 A;  2J8S D;  5BXO A;  4XI9 A;  3V30 A;  2R2L A;  4GZC A;  4Q94 A;  4JA7 A;  5KNH D;  4G24 A;  4I9C A;  4FU3 A;  4D10 C;  5CCL A;  1BLX B;  3Q9N C;  1DVP A;  4FJY A;  1QYM A;  1INZ A;  2KCV A;  1NZN A;  3D9H A;  4CDN A;  1H6P A;  3FWV A;  5DIZ A;  4MLP A;  3FDH A;  3D9P A;  4GCO A;  1NI1 A;  3GW4 A;  2XPY A;  3SHF A;  4N3C A;  4CZ2 D;  4C0M A;  3PZ3 A;  4GA0 A;  3EUV A;  2F8X K;  1UOH A;  4APF A;  2EIM E;  2VSX E;  4UUC A;  1NFI E;  3ZN3 A;  3UQ3 A;  5JHA A;  2C2L A;  1TN7 A;  4LSZ E;  5EYP F;  1Z6T A;  2E2E A;  3CVQ A;  4JHK A;  4WUY A;  2ION A;  2H6H A;  2WXQ A;  2IU1 A;  4ACK A;  4RG6 A;  5EN5 D;  2UY1 B;  5G04 J;  5G55 A;  5T8I A;  3E4B A;  2KCL A;  1D9S A;  1HX8 A;  3LEW A;  2KM4 A;  3VLD A;  3QDN A;  4CGV A;  5FTP A;  2VTB B;  1LTX A;  4UQZ A;  1OXJ A;  3GZ2 A;  2GRN B;  3IV0 A;  2AXZ A;  3Q7F A;  3RIB A;  1QZ2 A;  2QFC A;  4APO A;  4EZJ A;  3CVY A;  3VTY A;  1VDY A;  3ZYL A;  3ZHE A;  3FUH A;  4GYW A;  4HLL A;  3ZIM A;  3Q49 B;  4HVB A;  1N54 A;  3CV0 A;  2I1J A;  3DST A;  4L2Y A;  2LXL A;  3FTW A;  3PZ1 A;  3CR3 A;  4HFG A;  1H2U A;  2J49 A;  2Y3A A;  3ONK A;  3P2B A;  2GRO B;  2CFU A;  1KPS B;  1PAQ A;  3RJV A;  3V2O A;  3UM0 A;  1V55 E;  5CEC B;  3Q47 B;  2R02 A;  3FTZ A;  5BUZ A;  1JWG A;  3B7B A;  3EDT B;  3L22 A;  5CEA A;  3ABM E;  5KWD A;  2X6J A;  3LVR E;  4L23 A;  4DRX E;  2RD0 A;  1E7U A;  3ZW3 A;  4MBG A;  4H7X A;  4CDM A;  1OCC E;  2Y0B G;  3U4T A;  2DCP A;  3HXE A;  4GZ6 A;  1OWL A;  3SFY A;  2JAB A;  1KT0 A;  2F0Y A;  3SFZ A;  2MYO A;  4HOS A;  4HOU A;  2VGY A;  2AXV A;  3C3Q A;  3FFL A;  2C0L A;  3ULY A;  3JXI A;  1IHG A;  4RSY A;  3CVU A;  3L13 A;  2ETC A;  3CHR A;  1FVF A;  4LUN U;  3G2U A;  3SD5 A;  4N2Q A;  4K5B A;  1H2T C;  2P9I G;  1EPU A;  5FT9 A;  3SI5 A;  4A3T A;  3C5R A;  3E30 A;  4Z68 A;  3FUE A;  4I6G A;  2F8Y A;  5FJY A;  3NOC D;  1FCH A;  3JYS A;  1S70 B;  4TXR A;  2EIN E;  3Q7A A;  3UI2 A;  3AG4 E;  2NYJ A;  4ZHB A;  2WXR A;  3FUD A;  3Q15 A;  2XEV A;  3ENE A;  3ZNG A;  4FA6 A;  3OXG A;  3AG1 E;  3D9J A;  4HRL A;  3LY8 A;  2WXP A;  2WXF A;  2R5S A;  3NAW A;  1V54 E;  4QFV A;  3D9L A;  3TXM A;  3CVP A;  3CVN A;  3RO3 A;  2QYJ A;  5KJN A;  2GRP B;  4U96 D;  4DUI A;  3HDX A;  4DPR A;  4Y6W A;  4DLQ A;  1TN6 A;  3TL5 A;  2VSO E;  3I4R B;  4AVX A;  2GRR B;  2DWZ A;  3NF1 A;  4CEM A;  3PE4 A;  3L6A A;  1HU3 A;  3ZPJ A;  3O48 A;  3URZ A;  4J8E A;  1OWO A;  5HQ8 A;  4PS3 A;  2WXK A;  3JCK C;  5BT1 A;  3ZRH A;  3FUM A;  2YNQ A;  2P2C P;  3DEP A;  3QAQ A;  1L5J A;  3OTN A;  5AN8 A;  2BKK B;  4GZD A;  1X81 A;  2L0T B;  4GMR A;  3L17 A;  4I1O B;  3ESL A;  3FHE A;  2HR2 A;  4MS6 A;  3PZ2 A;  5JJ6 A;  5FZS A;  3O4Z A;  5FQ6 A;  3SBS A;  1B89 A;  3ASO E;  3QOU A;  5HI7 A;  2P9U G;  4UWH A;  3MEK A;  4ANW A;  3ASH A;  1HH8 A;  1OCO E;  4EQF A;  1DNP A;  3ZYM A;  4B8C B;  4PH4 B;  4YDE A;  4HI9 A;  4MRU A;  1IQR A;  1TN8 A;  4OVV A;  2WXN A;  4U63 A;  5JMN D;  4A1G A;  2ZIS A;  4OAV B;  3FEY A;  5T4Y A;  1TEZ A;  2WVI A;  5JJT A;  3CSF A;  3CHO A;  2OEV A;  3S7F A;  3I5P A;  2J07 A;  3PNT B;  4NIK A;  3UUX A;  3QK0 A;  3C3O A;  5HKP A;  5AIJ A;  3B95 A;  5AAO A;  4U0Z A;  1N0Q A;  5CRU A;  1WM5 A;  4I43 A;  4GYY A;  3PUJ A;  4GCN A;  3ZXS A;  5ENQ D;  4I2W A;  3SBT B;  3ZYK A;  4U8V D;  1H6O A;  4HRM B;  3UM2 A;  3B7U X;  5T3R A;  1U3C A;  1JWF A;  1E90 A;  2OVF A;  4GZ5 A;  1AP7 A;  3NB2 A;  5A23 A;  2L6J A;  3ULE G;  4ILI A;  1SA4 A;  5EIB E;  1KLX A;  1NA3 A;  2XQ0 A;  2AWI A;  4A55 A;  5B3S E;  3ZFW A;  2ZXW E;  3EHR A;  4HOT A;  3HXB A;  3VLE A;  2ZU6 B;  4L1B A;  2PQN A;  4KVM A;  3RRU A;  4AY5 A;  4GTT A;  1A17 A;  2I6H A;  2IJG X;  4N5C A;  4UI9 J;  3F6Q A;  3LCA A;  3MCX A;  2L6B A;  4CRW A;  3ZU7 B;  4LG6 A;  2R17 C;  2OVB A;  2M63 A;  2KBX A;  2WXG A;  4HRN A;  4BX8 A;  3B7S A;  5EX3 A;  3ZUV B;  2YHC A;  1EF1 C;  1XGW A;  4ANU A;  2L0I A;  2A4Z A;  4AXH A;  4UWF A;  3CHS A;  3CHQ A;  3V2X A;  1S64 A;  1TJC A;  2IEJ A;  4U04 A;  3JQ0 A;  3L82 A;  3MZL B;  4BSZ B;  3HVE B;  3LJN A;  5EDS A;  4U0U A;  3Q5M A;  2HO1 A;  5AEN A;  3CLJ A;  1LF8 A;  1JCQ A;  2GRQ B;  4WND A;  3PRE A;  2B6C A;  2CHZ A;  3U9W A;  1HFA A;  4JVS A;  1OCZ E;  3T8M A;  4TXQ A;  1S0P A;  2X6H A;  2XEH A;  3DSW A;  3ZEF A;  3UIO C;  4LNU D;  4AOF A;  1GW6 A;  4ABN A;  1BPO A;  3WG7 E;  3ZHE B;  3G2W A;  4UQX A;  1SZ9 A;  3FUK A;  2BED A;  3EU5 A;  4HOR A;  3RSE G;  5LFA A;  4H7Y A;  2OV8 A;  3MYV A;  4EHM A;  1FVH A;  5JJ7 A;  3CGH A;  3LS8 A;  1NP7 A;  4F3V A;  1MX6 A;  4CGW A;  2XEE A;  4TUM A;  1ELK A;  1QBQ A;  3CK9 A;  1HE8 A;  1JCS A;  5KJL A;  3PEV B;  5BPP A;  3TWV A;  2H6F A;  4B89 A;  2WXO A;  5D2M C;  1N4R A;  2Y69 E;  3DWL G;  4DK5 A;  4F1P A;  4BET A;  2WXL A;  3QKY A;  5CHE E;  3KSL A;  3N71 A;  1OCR E;  2BTD A;  1TNY A;  1IYG A;  3CKB A;  3HIZ A;  3BEE A;  4KMO A;  4LNG A;  4XZ4 A;  4DJA A;  4N5Q A;  3HVE A;  3TXN A;  4W9R A;  2P9K G;  4FC8 A;  3I4G A;  5H7P A;  3FTU A;  2IOS A;  1E8W A;  4BSX A;  3LPZ A;  5ARG A;  2IQC A;  2J4D A;  2OOE A;  4QQI A;  4GMJ A;  4EBA G;  1O5M A;  3ONL A;  2VSY A;  5C2Y A;  2DYR E;  1BU9 A;  3QWP A;  3SGH A;  2XZT G;  2DVW A;  3TAX A;  4ILH B;  3LVQ E;  3NZS A;  4RG9 A;  2XRZ A;  5AQ9 A;  3FU5 A;  2IY0 C;  2LSV A;  5ENN A;  3QNK A;  1N4P A;  4KVO A;  1SW6 A;  3WXX A;  4YDO A;  4FLH A;  1WG0 A;  1K1B A;  4KBQ A;  3PEU B;  2VGX A;  1Y6I A;  2WQ6 A;  5BV1 A;  3U64 A;  3RU0 A;  1IQU A;  3JUE A;  2NSZ A;  5FQ7 A;  2XZD G;  1N94 A;  4DI4 A;  4WWP A;  1ZU2 A;  5CBN A;  1P5Q A;  5G05 J;  3UM3 A;  3W9F A;  3FUI A;  3TG4 A;  3PS6 A;  4KXK B;  1KZO A;  3TWT A;  3FTV A;  4J8S A;  3UX4 A;  2ZGG A;  1DCQ A;  1XNF A;  3CK8 A;  3FU3 A; 
#chains in the Genus database with same CATH homology
 2A5E A;  3V30 A;  1IXV A;  2ETB A;  4DX1 A;  1OY3 D;  2ETC A;  5ENS D;  5HRY A;  4O1O A;  5ENQ D;  3TWS A;  2RFA A;  4BEP A;  3Q9U C;  5KNH D;  5HS0 A;  3ZKJ A;  3UXG A;  4ZFH A;  4U8V D;  1DC2 A;  4QQI A;  5ENR D;  4HRM B;  1YYH A;  4U8Y D;  1BI8 B;  5CBO A;  1N0R A;  2V5Q C;  1BLX B;  4HLL A;  3Q9N C;  5FIN A;  4K5B A;  4GMR A;  3EHQ A;  1QYM A;  1BU9 A;  3AJI A;  3TWW A;  3C5R A;  4HI8 A;  3V79 K;  4Z68 A;  1AP7 A;  2XZT G;  1MX4 A;  2DVW A;  4G8K A;  4K5C A;  4YDW A;  4ATZ D;  3D9H A;  2F8Y A;  3NOC D;  3NOG D;  3TWX A;  2FO1 E;  3T8K A;  1S70 B;  3JXJ A;  5AQ7 A;  3T9K A;  5EIB E;  4HQD A;  4HB5 A;  5EIL A;  1TR4 A;  3UI2 A;  2NYJ A;  2XEH A;  4ZHB A;  2F37 A;  4JB8 P;  5ENP D;  4HNA D;  4LNU D;  3V31 A;  4CZ2 D;  4OAU C;  3EHR A;  3ZNG A;  3TWU A;  3NBN B;  5AQ9 A;  4HRL A;  4O60 A;  1YMP A;  1IKN D;  2AJA A;  5BXU A;  2F8X K;  5FIO A;  4F6R D;  2QC9 A;  5CER B;  2VGE A;  1UOH A;  3IXE A;  3TWQ A;  1MX2 A;  4UUC A;  2DZN A;  3AAA C;  4O1P A;  1NFI E;  2V4H C;  5KBA A;  2HE0 A;  4K5A B;  2XEN A;  4QFV A;  3V2O A;  2ZGD A;  1AWC B;  2Y1L E;  2BKG A;  4LSZ E;  2QYJ A;  5EYP F;  3J5P A;  1SW6 A;  3F6Q A;  4J7W A;  4U96 D;  4DUI A;  2L6B A;  5CEC B;  1BI7 B;  4DX6 D;  4HI9 A;  3ZU7 B;  1MYO A;  4LG6 A;  4BES A;  1WG0 A;  1K1B A;  1YCS B;  1MX6 A;  2PNN A;  2XEE A;  4A63 B;  5AQB A;  4TUM A;  4DX2 A;  4DX7 D;  5JMN D;  4BER A;  4GPM A;  3SO8 A;  4OAV B;  2KBX A;  3B7B A;  3TWV A;  4CYM D;  5CEA A;  4HRN A;  4J8Y A;  1N11 A;  2ETA A;  3ZUV B;  5EN5 D;  5KWD A;  3JUE A;  1IHB A;  2DWZ A;  4HBD A;  5EID A;  4DRX E;  3UTM A;  5ENT D;  2XZD G;  3HG0 D;  4F1P A;  4BET A;  1OT8 A;  2Y0B G;  1K3Z D;  4G8L A;  4B93 B;  3HRA A;  1BD8 A;  5AQA A;  5JA4 D;  2RFM A;  1D9S A;  5BXO A;  4U95 D;  1SVX A;  5CED B;  3TWR A;  3J5Q B;  5CBN A;  3KEA A;  2JAB A;  3V2X A;  5ITZ F;  3W9F A;  2P2C P;  5ENO D;  2MYO A;  4NIK A;  3DEP A;  2B0O E;  4BSZ B;  4C48 B;  5HKP A;  3B95 A;  4N5Q A;  3LJN A;  5AAO A;  1N0Q A;  2KXP C;  1A5E A;  5KNG A;  3JXI A;  4YDY A;  3TWT A;  1K1A A;  3DEO A;  3EU9 A;  2DZO A;  5AAR A;  4DX5 D;  5EYL A;  1MJ0 A;  5D66 A;  5AN8 A;  2ZGG A;  2BKK B;  1DCQ A;  4RLY A;  3W9G A;  1WDY A;  1G3N B;  2J8S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...