4F6RD

Tubulin:stathmin-like domain complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
159
structure length
159
Chain Sequence
GSDLGKKLLEAARAGQDDEVRILMANGADVNAEDDSGKTPLHLAAIKGHLEIVEVLLKHGADVNAADKMGDTPLHLAALYGHLEIVEVLLKNGADVNATDTYGFTPLHLAADAGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title Design and characterization of modular scaffolds for tubulin assembly.
pubmed doi rcsb
source organism Artificial gene
total genus 54
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4f6rD00
1N0QA 3D9HA 2ETAA 2Y0BG 3F6QA 3UTMA 4DRXE 4DX6D 3T8KA 2HE0A 4J8YA 1IXVA 3V2OA 2F8XK 1D9SA 1MX2A 1S70B 2BKGA 3AAAC 5AQBA 3TWRA 4U96D 4K5AB 1OY3D 5ENSD 5HS0A 3SO8A 3TWWA 5AAOA 5EIBE 4JB8P 3UXGA 5EYLA 5FINA 3Q9UC 4ATZD 3DEPA 2BKKB 1BI8B 4O60A 2B0OE 2VGEA 4B93B 4BSZB 4DX7D 1K1AA 1WG0A 1IKND 4HRMB 4GPMA 2A5EA 1UOHA 2ETBA 3TWXA 1IHBA 4GMRA 2KXPC 2XEEA 4HRNA 5KNGA 3ZKJA 4ZHBA 2KBXA 1N0RA 2QC9A 5EIDA 3ZNGA 4HB5A 3NOGD 4F1PA 4DX2A 5HRYA 2DVWA 4QQIA 3ZU7B 2DWZA 3TWTA 2XZTG 4BETA 5AQ9A 2RFMA 1MX4A 4N5QA 5ITZF 5JA4D 3B95A 4K5BA 2FO1E 1G3NB 5D66A 3EHQA 4QFVA 4F6RD 5ENOD 2J8SD 5ENQD 5AQ7A 3NBNB 4BERA 1BU9A 4LG6A 4U8VD 2F8YA 4HI9A 1WDYA 4Z68A 3EU9A 1MX6A 3C5RA 4HLLA 4K5CA 1DC2A 1YCSB 4LSZE 2AJAA 2V4HC 3JXJA 3Q9NC 1AWCB 3V31A 3J5PA 2RFAA 5KWDA 5EYPF 2XZDG 3V79K 3DEOA 2L6BA 2DZNA 3J5QB 5KNHD 4CYMD 5BXUA 5CBOA 4CZ2D 4OAUC 3UI2A 4J7WA 5EILA 2ZGDA 4HNAD 4A63B 1OT8A 2MYOA 4DUIA 4OAVB 3NOCD 5EN5D 3TWUA 5KBAA 4UUCA 1YYHA 1K3ZD 4DX5D 5AN8A 4NIKA 3W9GA 3V2XA 2Y1LE 1SVXA 2P2CP 3TWQA 5BXOA 4U95D 1BI7B 4O1PA 5ENPD 1TR4A 2PNNA 3KEAA 3V30A 3AJIA 2XENA 5HKPA 3IXEA 4YDYA 3EHRA 5CECB 5JMND 5CEDB 5ENTD 2F37A 1QYMA 4BESA 5AQAA 4HRLA 3TWVA 4G8LA 1SW6A 5CBNA 3LJNA 4HBDA 4YDWA 4TUMA 1BLXB 4U8YD 4DX1A 4G8KA 3ZUVB 1AP7A 2JABA 2QYJA 1N11A 2NYJA 4O1OA 4BEPA 1A5EA 1MJ0A 1YMPA 2DZOA 5CERB 2ETCA 2ZGGA 3W9FA 3JUEA 3B7BA 3HRAA 3TWSA 4C48B 2XEHA 4ZFHA 5ENRD 4LNUD 1K1BA 3JXIA 4RLYA 3HG0D 4HI8A 1DCQA 1BD8A 1NFIE 4HQDA 3T9KA 5CEAA 5FIOA 1MYOA 2V5QC 5AARA
chains in the Genus database with same CATH superfamily
3Q15A 3AU4A 3QWVA 4V3IA 2GRLA 3RIBA 1HZ4A 3L9TA 5G2NA 5BV0A 1HX8A 3FH8A 4G24A 4XI9A 1SQMA 4K0RA 3JYSA 1H6KA 3U3WA 4YVQC 5CCMA 1NA0A 2ONDA 4Y6WA 4GA2A 1OXJA 2H6IA 2X6HA 1EPUA 2NC9A 2FO1E 3EU5A 4ACKA 2ILRA 1ELRA 5EKQD 4HVBA 3GW4A 4BERA 2A5UA 4ANWA 4U8VD 4HI9A 3D9NA 2R5SA 2LAIA 4HOQA 3E32A 2YQ8A 5EX0A 2M63A 5KWDA 4CT0A 3UMVA 3QARA 4CZ2D 2NSZA 1K8KG 3CK7A 4I17A 3MKQB 1UN8A 1DNPA 4CT4A 1JWGA 3R9MA 4AJWA 2ZU6B 2MOWA 3L16A 5G05J 2J9QA 3DXKG 3TGOA 2JLBA 5FWQA 4BWRA 4L1BA 4BT8A 4RLYA 1WM5A 3JQ1A 3T9KA 2DCPA 3G2UA 4DRXE 3CIAA 4J8YA 3V2OA 4LEUA 4C0EA 2WMOA 1S70B 1L5JA 4F53A 3ZYKA 4FA6A 2X6JA 1BI8B 2I6HA 2VGEA 4DX7D 3ZPJA 4AOFA 4AEZC 4LCTA 3SFZA 5BV1A 4WWOA 3FEXA 4BSXA 3CVWA 4TV3A 1IYGA 5CHEE 4AP2A 3O4ZA 2RG8A 2GRPB 2B6CA 1SA5A 1WDYA 4EZJA 4CDRA 5E76A 2OVFA 1OT8A 2MYOA 1N54A 4GCOA 4CRWA 2PQRA 4NACA 3DPDA 3IBEA 5D0OD 1QYMA 3FTVA 1E8XA 4G8KA 3DSSA 3FUKA 2LNIA 1BPOA 3LYAA 5CCLA 3T5VA 5CERB 2ETCA 3FUFA 4C48B 2WVIA 5A7DB 3B7TA 1DCQA 4I1MA 4BTAA 3C3RA 2P9PG 2H6GA 3TWRA 2YHEA 1OY3D 5KJNA 3Q78A 4GMLA 3AG1E 2KBXA 2UWJG 3ULQA 4Q96A 3ML8A 4EBAA 5AQ9A 2RFMA 1HE8A 4B94A 3APDA 4BX9A 4M7CA 5EX3A 2KM4A 3PEVB 3VTXA 1FVFA 4URKA 3Q7AA 5ENQD 3GZSA 3EU9A 5FQ4A 1MHQA 5BPPA 1YCSB 5FJYA 2X6KA 3O48A 1Z3XA 4DUIA 3APCA 3TWUA 1TNUA 1E8YA 4N2SA 2ZISA 1U3DA 1WAO1 4GTMA 3RRNB 2WPVA 4DJAA 3PDNA 3SY2A 5HKPA 2LUHA 4APFA 5E75A 4H7XA 3MX3A 4JEHA 2F37A 3PREA 4DLOA 2KCLA 1ZB1A 3GZ1A 4HRLA 2QY7A 4YDWA 4ME2A 4AY6A 3ONLA 3ZUVB 1N11A 4XX5A 3CK9A 3W9FA 1KPSB 4EHMA 4ZFHA 4HI8A 4N39A 4GTOA 3ZXSA 1OWLA 1WY6A 3R9AB 3BQOA 4P29A 1UJJA 3CR3A 3UXGA 3EUVA 3DEPA 4RG9A 4UQZA 4FJYA 5J08A 4XKBA 4HFGA 3DSWA 4KZ0A 3QJZA 1S63A 4BX8A 3ZKJA 1U2VG 5BNWA 3AS8A 3IHVA 4O6FA 4I6GA 1N52A 3C98A 4A3VA 3UM2A 1S0PA 3TWTA 3FU5A 3LVQE 1E8WA 4Y6CA 2GROB 1A17A 4F6RD 2WQ7A 2F8YA 3SD5A 3NF1A 4KT6B 4XZ4A 3Q9NC 3FUMA 3ZGQA 1D8DA 4A55A 2V8SE 1LD7A 4HOTA 4MS6A 1TEZA 3NOCD 4I1AA 3DXMG 4UQYA 2I1JA 4HORA 2XS8A 3CQCB 3TWQA 3QNKA 3DRAA 4EPZA 3BU8A 3OXGA 4O1PA 3EIQC 2RKKA 3FUNA 3CLJA 4GZ5A 2L0IA 4G23A 2KZTA 3HXFA 4HS2A 3RO3A 3LJNA 1EYHA 1JCSA 4TRQA 3T8MA 3FP3A 2CG3A 2FULA 4GTTA 2P9NG 3QWWA 3PRZA 5KJLA 1P5QA 4FC8A 3ZHEB 1FT2A 4GB9A 1N94A 2WQHA 2MRIA 3HDXA 1B89A 2WXRA 2XRYA 3S7JA 2V5QC 4DX6D 3D9HA 3ASOE 1QZ2A 3PNLB 4KYOB 2WXGA 2CG2A 3E4BA 4OVUA 3FUJA 5FINA 2X6FA 1TNBA 1TJCA 4JPSA 2IFUA 2B0OE 2V0PA 3QAQA 4ILHB 2IU1A 3R7RA 5EIDA 2J07A 3B13A 4XE0A 2DWZA 4FHKA 4KMOA 4CDMA 4FADA 4GZ3A 5D66A 4QFVA 2VSOE 4LG6A 2I1KA 3VLEA 1MX6A 4UQXA 1AWCB 4JZYA 4NURA 2WXIA 2BEDA 3RKVA 2GRQB 1XNFA 2XGMA 3UM1A 5ARFA 2Y4TA 2VYIA 4G26A 2VSXE 1H19A 2QYUA 1LF8A 5FQ7A 1JCRA 4LRZA 4AXHA 5CBNA 4DX1A 3KAEA 5T8IA 3HXEA 3SI5A 2XGSA 4WNFA 1EF1C 3SFYA 2WXKA 4PDXA 2OV8A 4W9RA 3UUXA 3EIJA 5CEAA 4DI3A 3CVVA 3UIOC 1PAQA 3X2QE 2HE0A 1NI1A 4LERA 4J8FA 4YDEA 5D2MC 1EDUA 5ENSD 5EIBE 5EYLA 4ATZD 4WNEA 4J8SA 5ANLA 4GMJA 1K1AA 1IHBA 4ZHBA 2YHCA 3RRUA 3APFA 2OVBA 1OCZE 4YNDA 2C0MA 4F1PA 4J8EA 2XZTG 3Q7FA 1OWPA 1OWOA 4FULA 4XEIG 4GAAA 3FTXA 5HQ8A 2J4DA 3L22A 4K5CA 2OCCE 4L9PA 1OWNA 3CHMA 2C0LA 2IY0C 4BT9A 4PS3A 4ATGA 1X5BA 3PE4A 5AENA 1D8EA 3DEOA 5KNHD 2GGFA 5FQ8A 2ZGDA 3ASHA 5CRUA 4FLBA 4U07A 1INZA 4UUCA 4E85A 4UWHA 3E33A 3V2XA 2X38A 3G2SA 3SHFA 5CECB 2VGYA 3UT4A 5CMWA 4BESA 4WNGA 3DPYA 3NQPA 2QYJA 4J6IA 3PZ4A 1XGWA 3MA5A 4GYOA 5ENNA 1N4RA 4YVOA 1HG2A 1VDYA 3HIZA 4N3CA 1MYOA 3F6QA 3ENEA 1ELKA 3ABKE 3VLFA 4AY5A 1JUQA 5FTPA 2BKKB 1E8ZA 3C3QA 3PZ2A 3L82A 3ISMC 1HO8A 3ULEG 2IONA 2XHEA 2J4BA 1N4QA 3OAWA 1TN6A 3SZ7A 1PC2A 1DVPA 2WXFA 3OTNA 3QC1A 3NBNB 2UY1A 3UIPC 3ASNE 1FPPA 1TN7A 4CYMD 2L6BA 2DZNA 3Q47B 4FLHA 1H2TC 1H2UA 4I9EA 3RO2A 3D9KA 2LXLA 3D9IA 5LFAA 4EBAG 3S7FA 2P2CP 4EZKA 2EIME 1H6OA 3CVXA 3KEAA 2IEJA 2R2LA 4HBDA 4U8YD 3RU0A 4CDNA 3Q79A 1HU3A 4BEPA 2XQ0A 3AG2E 1NZNA 3ZYLA 4ILGA 3HG0D 5AIJA 2KATA 3OXFA 2FF4A 2R02A 1KZPA 3CEQA 3V79K 4K5AB 4PS7A 4XKCA 3CHOA 2F0YA 2L9BA 1IKND 4GPMA 3DBSA 2MHKA 3URZA 3N71A 3EJNA 3KD7A 2X6IA 3LY7A 4J8DA 2DVWA 4E6HA 3NZUA 2IJGX 1H0AA 1HS6A 3KS2A 5JA4D 3ESKA 2XRZA 4K5BA 2AVPA 3RRMB 3ZXPA 2PL2A 2WXOA 3I4RB 4HLLA 1OUVA 2KCKA 3EHMA 3IEGA 3ASFA 4JA7A 4UI9C 3V31A 2XPYA 3MEKA 2LXMA 2WXQA 4NQ0A 3FEYA 4M3OA 4N3BA 1N9AA 1K3ZD 4HXIA 3W9GA 3AG3E 1SA4A 2XCBA 2XGOA 4F7AA 4MBGA 2Q7FA 4FHJA 3FULA 2BTDA 3IXEA 2EINE 2QFCA 2XPIA 3EHRA 4A1GA 3U4TA 4JHRA 1Z3YA 3B7UX 1FVHA 2V4LA 1FT1A 4I6EA 1KT0A 3QKYA 2KZTB 2OEWA 4ANXA 4CCAA 4MRUA 3FU6A 4GTSA 2KC7A 5G55A 4JW1A 1MX2A 3FTYA 2EQXA 5BW8C 3NZSA 1O1SA 1JWFA 5A23A 4EZLA 2EIKE 4DLQA 4HRNA 2XEEA 4L7TA 1N0RA 4TUUA 4ACLA 2P9IG 4HOSA 1TYQG 2LO6A 3PH0C 3I4GA 2R59A 1E7VA 3QDNA 5FT9A 4JHJA 3FTWA 3KSQA 2P9SG 3QK0A 1HXIA 3J5QB 3UX4A 3CHRA 4H7YA 4XI0A 3CHPA 1UN9A 3D9LA 4DX5D 4B8CB 1SVXA 3AJIA 4KBQA 4N5CA 2GW1A 4DI4A 4GU5A 1OCRE 3DWLG 2WB2A 3Q49B 3IHYA 2DYSE 5FZRA 1HG5A 1QBQA 2J08A 3L13A 3B7BA 2HM8A 2VSNA 3CQGB 2XEHA 3LKUA 2L6JA 2WXLA 1N0QA 4PH4B 2BKGA 2EILE 4B0ZA 3ZRHA 4AM9A 3SO8A 3TWWA 2AXUA 4GA1A 3UKRG 5G04C 2R05A 4B93B 3FH5A 2VSYA 1IQUA 3TAXA 3LS8A 4U0ZA 1H6PA 3ONKA 3EHNA 2WXHA 3D9MA 1TJFA 3E34A 5LOZA 2CHZA 4FU3A 3ULYA 4HLEA 4FP7A 3ZEFA 3EHQA 3HXDA 4EQFA 2ZIRA 1ZBPA 5AQ7A 3D9PA 4GCNA 2Y4UA 4UI9K 1OCCE 3L6AA 5ARGA 2X3MA 4LSZE 1JCQA 3J5PA 2RFAA 3FU3A 4UWGA 5AYWD 4C9BB 5CBOA 3UI2A 3TJPA 2KCVA 2Y1LE 3QB2A 4GTPA 4YDYA 2CHWA 3FUEA 2WMNA 3U64A 1OCOE 1Z5SC 4O1OA 2DYRE 3RAUA 3AS5A 2YNQA 3TWSA 1U3CA 5ENRD 2L0TB 4NRHB 3TXNA 4HQDA 2CFZA 3FH7A 3LY8A 3ZVVA 3AS4A 1TNZA 3MV3B 3CVYA 1ELWA 3TG4A 1Q2ZA 3FWVA 4R7LA 3NB2A 2E2EA 1O5MA 2AXVA 2AW6A 1UW4B 3PEUB 3ZNGA 2QZAA 2HYZA 4QQIA 5CMYA 5H7PA 3MV2B 3LDZA 3L08A 5LCWC 4N5QA 5ITZF 3B95A 3I5PA 2R17C 4K03A 4L2LA 2DBAA 2HR2A 4Z68A 3BG0B 1Z6TA 3C5RA 3CVPA 4APOA 4BTBA 4EECA 4A3TA 4F3VA 3JUIA 3U9WA 4HNAD 2UY1B 4CEMA 3TXMA 3OXLA 3NAWA 3I3NA 3BUAA 3HVEB 3BG1B 2IF4A 4GA0A 4U7EB 3MGBA 4FJZA 2J49A 2GRNB 5FQ6A 4Q69A 3MZLB 2C2LA 2WXNA 5G05C 4N2QA 3TWVA 3RSEG 1BLXB 2XEVA 3QOUA 3L54A 3G2WA 4JXTA 3PS6A 5T3RA 4ANUA 3ASGA 1RZ4A 3HYMB 3HRAA 1HFAA 5HI7A 2PM7A 3FY4A 5AARA 2WQ6A 3UTMA 3UM0A 2AXZA 4UWKA 1IXVA 3SNXA 2P9LG 4U96D 3UT8A 5C1DA 2PM6A 3S7DA 1FCHA 1Y6IA 5LCWJ 2I9CA 4L2YA 3AU5A 2E0IA 2A5EA 3TWXA 1PY1A 1DCEA 1S64A 4HB5A 3NOGD 3K9IA 3ZU7B 2FBNA 3VTYA 3FUIA 4I43A 2J8SD 1OWMA 3ABLE 3MKRA 5FZQA 2AJAA 3JXJA 4G2VA 3TL5A 5JJ6A 2VGXA 2GRMA 4J7WA 4JEUA 5ANRA 1MZCA 4GZDA 5JJ7A 4RG6A 3HHMA 4CGWA 3HXBA 5BXOA 4U95D 3UINC 1TR4A 4BFRA 1RW2A 3UM3A 1JPLA 2EIJE 5D0QD 3HVEA 3L17A 5ENTD 2LSVA 3U66A 2XS1A 1AP7A 4Q94A 2VTBB 1A5EA 2VQ2A 1V54E 2ZGGA 2H6FA 4KVMA 5DIZA 4U0SA 4LNUD 2FEZA 3PZ3A 3CSTA 4J0UA 5FIOA 4UWLA 2PQNA 2GRRB 3AAAC 5AQBA 3G2VA 3IKOB 1E96B 3EDTB 4G1TA 2OOEA 3PVLA 2KXPC 5KNGA 4DX2A 5HRYA 1KLXA 4BETA 5C2YA 2IOSA 4JD2G 1E7UA 3B7RL 3CK8A 3CKCA 3ZYMA 4D10C 4C0MA 4B89A 3ABME 4RVBA 3CHSA 4U0UA 2DIWA 2RD0A 4AVXA 2AWIA 2P9KG 1N4PA 3QWPA 3MKQA 5KCMA 4WWNA 4WNDA 5IY5E 3JCKC 2H6HA 3B7SA 3LCAA 3PUJA 5EN5D 3FDHA 2P58C 4NIKA 3WXXA 2J09A 3BEEA 5DBKA 2XENA 1N95A 3ZYQA 3WG7E 1V55E 4DK5A 4I2ZA 5CEDB 4LNBA 5AQAA 3JQ0A 3MCXA 5JHAA 3LVRE 4MLPA 2NYJA 5T4YA 2DZOA 4KZCA 4ABNA 5M72A 2VTBA 2ETAA 2Y0BG 1QQEA 3T8KA 2F8XK 3CHQA 3ZIMA 2I2OA 5AAOA 4JB8P 3Q9UC 3CV0A 4JA9A 3FTSA 4O60A 1KZOA 4BSZB 3ZN3A 2WXJA 4GMRA 1N4SA 3MJWA 3C3OA 5AJLA 4L23A 2LAHA 2Y69E 1MX4A 4HOUA 2VJ8A 4N3AA 3PZ1A 4IULA 5ENOD 4OYSA 3LJ3A 4AV7A 1Y8MA 1BU9A 1H2VC 3D3MA 4OVVA 4JVSA 1DC2A 4I2WA 2V4HC 4KXKB 2XZDG 3ML9A 3Q4AB 3CVUA 3RK6A 4A63B 4UI9J 2PZIA 2WXPA 4KVOA 1IHGA 2IO2C 2P9UG 5AN8A 4YDOA 1TNYA 1HF8A 4IN3B 4IYPA 3UKUG 5ENPD 3C72A 4GTQA 3R7QA 3UT7A 3CVQA 4PS8A 4WUYA 3P2BA 4JL0A 2JEKA 2NXPA 3ZFWA 3PE3A 2HO1A 3D9OA 4ANVA 5KJKA 1YMPA 3CVNA 3Q75A 3S7BA 3LPZA 1HH8A 1NL4A 3FUDA 1IQRA 4TXRA 3SQVA 2ZXWE 5BUZA 2WM9A 5B3SE 3SGHA 5FZSA 1NA3A 1TN8A 2FI7A 4BY6A 1WG0A 4HRMB 4X8QA 4LNGA 5BT1A 4PUCA 3VLDA 5LX8A 4B8AA 2QC9A 3KSLA 3E30A 2WXMA 5CRVA 1UJKA 4JHKA 3FHEA 1MQSA 1LD8A 3DSTA 3CVLA 1G3NB 4TXQA 2CHXA 5JJTA 2BUGA 3LY9A 4OAUC 5BXUA 3GYZA 1YA0A 3T5XA 1E90A 3ASDA 4MKTA 1KT1A 2IQCA 5B1BE 4RQIA 4WWPA 3P1UA 1NP7A 3V30A 2V5FA 3RJVA 3KEZA 2OEVA 5JMND 3ZW3A 3UPVA 4G11A 4G8LA 3DSVA 2JABA 4I6JA 3FTUA 1MJ0A 4I9CA 4RSYA 3GZ2A 4LUNU 3TG5A 4GZ6A 1K1BA 3JXIA 5B1AE 4UWFA 4WAFA 1NFIE 4GPKA 5J90A 3SBSA 2Y3AA 2CFUA 1D9SA 5HS0A 1QNFA 5EDSA 3CGHA 3G2TA 4GTVA 3LXUX 1UOHA 2ETBA 3S2AA 2FO7A 5G04J 3LEWA 2R03A 4IRUA 3SFXA 5KJMA 1SZAA 3FTZA 3FUHA 3AG4E 3PZDA 5AJDA 3UQ3A 4XIFA 2XPZA 3CSFA 5A6CA 4G25A 3HXCA 1ZU2A 3CKBA 4F1SA 3DSXA 3FU0A 3D9JA 1O1TA 4ILIA 5LP0A 4AIFA 2IO3C 4JC8A 4U04A 5EYPF 2BF0X 3SF4A 5EILA 2XCCA 1SZ9A 3MYVA 1X81A 4OAVB 5KBAA 1YYHA 2LSUA 3FFLA 3DSUA 4CGVA 1UG3A 3ESLA 2IOLA 2A4ZA 4I1OB 1TNOA 2VGXB 1BI7B 4TXPA 4A1SA 2PNNA 2YINA 3SBTB 1O1RA 4GYYA 1GW6A 3ZHEA 1SW6A 1W3BA 4TUMA 3Q73A 3PUKA 3E37A 3IV0A 3Q5MA 3JUEA 1LTXA 3PNTB 5JHBA 4U63A 4GZCA 4GTRA 1BD8A 4U8HA 4GYWA 4DPRA
chains in the Genus database with same CATH topology
1N0QA 3D9HA 2ETAA 2Y0BG 3F6QA 3UTMA 4DRXE 4DX6D 3T8KA 2HE0A 4J8YA 1IXVA 3V2OA 2F8XK 1D9SA 1MX2A 1S70B 2BKGA 3AAAC 5AQBA 3TWRA 4U96D 4K5AB 1OY3D 5ENSD 5HS0A 3SO8A 3TWWA 5AAOA 5EIBE 4JB8P 3UXGA 5EYLA 5FINA 3Q9UC 4ATZD 3DEPA 2BKKB 1BI8B 4O60A 2B0OE 2VGEA 4B93B 4BSZB 4DX7D 1K1AA 1WG0A 1IKND 4HRMB 4GPMA 2A5EA 1UOHA 2ETBA 3TWXA 1IHBA 4GMRA 2KXPC 2XEEA 4HRNA 5KNGA 3ZKJA 4ZHBA 2KBXA 1N0RA 2QC9A 5EIDA 3ZNGA 4HB5A 3NOGD 4F1PA 4DX2A 5HRYA 2DVWA 4QQIA 3ZU7B 2DWZA 3TWTA 2XZTG 4BETA 5AQ9A 2RFMA 1MX4A 4N5QA 5ITZF 5JA4D 3B95A 4K5BA 2FO1E 1G3NB 5D66A 3EHQA 4QFVA 4F6RD 5ENOD 2J8SD 5ENQD 5AQ7A 3NBNB 4BERA 1BU9A 4LG6A 4U8VD 2F8YA 4HI9A 1WDYA 4Z68A 3EU9A 1MX6A 3C5RA 4HLLA 4K5CA 1DC2A 1YCSB 4LSZE 2AJAA 2V4HC 3JXJA 3Q9NC 1AWCB 3V31A 3J5PA 2RFAA 5KWDA 5EYPF 2XZDG 3V79K 3DEOA 2L6BA 2DZNA 3J5QB 5KNHD 4CYMD 5BXUA 5CBOA 4CZ2D 4OAUC 3UI2A 4J7WA 5EILA 2ZGDA 4HNAD 4A63B 1OT8A 2MYOA 4DUIA 4OAVB 3NOCD 5EN5D 3TWUA 5KBAA 4UUCA 1YYHA 1K3ZD 4DX5D 5AN8A 4NIKA 3W9GA 3V2XA 2Y1LE 1SVXA 2P2CP 3TWQA 5BXOA 4U95D 1BI7B 4O1PA 5ENPD 1TR4A 2PNNA 3KEAA 3V30A 3AJIA 2XENA 5HKPA 3IXEA 4YDYA 3EHRA 5CECB 5JMND 5CEDB 5ENTD 2F37A 1QYMA 4BESA 5AQAA 4HRLA 3TWVA 4G8LA 1SW6A 5CBNA 3LJNA 4HBDA 4YDWA 4TUMA 1BLXB 4U8YD 4DX1A 4G8KA 3ZUVB 1AP7A 2JABA 2QYJA 1N11A 2NYJA 4O1OA 4BEPA 1A5EA 1MJ0A 1YMPA 2DZOA 5CERB 2ETCA 2ZGGA 3W9FA 3JUEA 3B7BA 3HRAA 3TWSA 4C48B 2XEHA 4ZFHA 5ENRD 4LNUD 1K1BA 3JXIA 4RLYA 3HG0D 4HI8A 1DCQA 1BD8A 1NFIE 4HQDA 3T9KA 5CEAA 5FIOA 1MYOA 2V5QC 5AARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0Q A;  3D9H A;  2ETA A;  2Y0B G;  3F6Q A;  3UTM A;  4DRX E;  4DX6 D;  3T8K A;  2HE0 A;  4J8Y A;  1IXV A;  3V2O A;  2F8X K;  1D9S A;  1MX2 A;  1S70 B;  2BKG A;  3AAA C;  5AQB A;  3TWR A;  4U96 D;  4K5A B;  1OY3 D;  5ENS D;  5HS0 A;  3SO8 A;  3TWW A;  5AAO A;  5EIB E;  4JB8 P;  3UXG A;  5EYL A;  5FIN A;  3Q9U C;  4ATZ D;  3DEP A;  2BKK B;  1BI8 B;  4O60 A;  2B0O E;  2VGE A;  4B93 B;  4BSZ B;  4DX7 D;  1K1A A;  1WG0 A;  1IKN D;  4HRM B;  4GPM A;  2A5E A;  1UOH A;  2ETB A;  3TWX A;  1IHB A;  4GMR A;  2KXP C;  2XEE A;  4HRN A;  5KNG A;  3ZKJ A;  4ZHB A;  2KBX A;  1N0R A;  2QC9 A;  5EID A;  3ZNG A;  4HB5 A;  3NOG D;  4F1P A;  4DX2 A;  5HRY A;  2DVW A;  4QQI A;  3ZU7 B;  2DWZ A;  3TWT A;  2XZT G;  4BET A;  5AQ9 A;  2RFM A;  1MX4 A;  4N5Q A;  5ITZ F;  5JA4 D;  3B95 A;  4K5B A;  2FO1 E;  1G3N B;  5D66 A;  3EHQ A;  4QFV A;  4F6R D;  5ENO D;  2J8S D;  5ENQ D;  5AQ7 A;  3NBN B;  4BER A;  1BU9 A;  4LG6 A;  4U8V D;  2F8Y A;  4HI9 A;  1WDY A;  4Z68 A;  3EU9 A;  1MX6 A;  3C5R A;  4HLL A;  4K5C A;  1DC2 A;  1YCS B;  4LSZ E;  2AJA A;  2V4H C;  3JXJ A;  3Q9N C;  1AWC B;  3V31 A;  3J5P A;  2RFA A;  5KWD A;  5EYP F;  2XZD G;  3V79 K;  3DEO A;  2L6B A;  2DZN A;  3J5Q B;  5KNH D;  4CYM D;  5BXU A;  5CBO A;  4CZ2 D;  4OAU C;  3UI2 A;  4J7W A;  5EIL A;  2ZGD A;  4HNA D;  4A63 B;  1OT8 A;  2MYO A;  4DUI A;  4OAV B;  3NOC D;  5EN5 D;  3TWU A;  5KBA A;  4UUC A;  1YYH A;  1K3Z D;  4DX5 D;  5AN8 A;  4NIK A;  3W9G A;  3V2X A;  2Y1L E;  1SVX A;  2P2C P;  3TWQ A;  5BXO A;  4U95 D;  1BI7 B;  4O1P A;  5ENP D;  1TR4 A;  2PNN A;  3KEA A;  3V30 A;  3AJI A;  2XEN A;  5HKP A;  3IXE A;  4YDY A;  3EHR A;  5CEC B;  5JMN D;  5CED B;  5ENT D;  2F37 A;  1QYM A;  4BES A;  5AQA A;  4HRL A;  3TWV A;  4G8L A;  1SW6 A;  5CBN A;  3LJN A;  4HBD A;  4YDW A;  4TUM A;  1BLX B;  4U8Y D;  4DX1 A;  4G8K A;  3ZUV B;  1AP7 A;  2JAB A;  2QYJ A;  1N11 A;  2NYJ A;  4O1O A;  4BEP A;  1A5E A;  1MJ0 A;  1YMP A;  2DZO A;  5CER B;  2ETC A;  2ZGG A;  3W9F A;  3JUE A;  3B7B A;  3HRA A;  3TWS A;  4C48 B;  2XEH A;  4ZFH A;  5ENR D;  4LNU D;  1K1B A;  3JXI A;  4RLY A;  3HG0 D;  4HI8 A;  1DCQ A;  1BD8 A;  1NFI E;  4HQD A;  3T9K A;  5CEA A;  5FIO A;  1MYO A;  2V5Q C;  5AAR A; 
#chains in the Genus database with same CATH topology
 3Q15 A;  3AU4 A;  3QWV A;  4V3I A;  2GRL A;  3RIB A;  1HZ4 A;  3L9T A;  5G2N A;  5BV0 A;  1HX8 A;  3FH8 A;  4G24 A;  4XI9 A;  1SQM A;  4K0R A;  3JYS A;  1H6K A;  3U3W A;  4YVQ C;  5CCM A;  1NA0 A;  2OND A;  4Y6W A;  4GA2 A;  1OXJ A;  2H6I A;  2X6H A;  1EPU A;  2NC9 A;  2FO1 E;  3EU5 A;  4ACK A;  2ILR A;  1ELR A;  5EKQ D;  4HVB A;  3GW4 A;  4BER A;  2A5U A;  4ANW A;  4U8V D;  4HI9 A;  3D9N A;  2R5S A;  2LAI A;  4HOQ A;  3E32 A;  2YQ8 A;  5EX0 A;  2M63 A;  5KWD A;  4CT0 A;  3UMV A;  3QAR A;  4CZ2 D;  2NSZ A;  1K8K G;  3CK7 A;  4I17 A;  3MKQ B;  1UN8 A;  1DNP A;  4CT4 A;  1JWG A;  3R9M A;  4AJW A;  2ZU6 B;  2MOW A;  3L16 A;  5G05 J;  2J9Q A;  3DXK G;  3TGO A;  2JLB A;  5FWQ A;  4BWR A;  4L1B A;  4BT8 A;  4RLY A;  1WM5 A;  3JQ1 A;  3T9K A;  2DCP A;  3G2U A;  4DRX E;  3CIA A;  4J8Y A;  3V2O A;  4LEU A;  4C0E A;  2WMO A;  1S70 B;  1L5J A;  4F53 A;  3ZYK A;  4FA6 A;  2X6J A;  1BI8 B;  2I6H A;  2VGE A;  4DX7 D;  3ZPJ A;  4AOF A;  4AEZ C;  4LCT A;  3SFZ A;  5BV1 A;  4WWO A;  3FEX A;  4BSX A;  3CVW A;  4TV3 A;  1IYG A;  5CHE E;  4AP2 A;  3O4Z A;  2RG8 A;  2GRP B;  2B6C A;  1SA5 A;  1WDY A;  4EZJ A;  4CDR A;  5E76 A;  2OVF A;  1OT8 A;  2MYO A;  1N54 A;  4GCO A;  4CRW A;  2PQR A;  4NAC A;  3DPD A;  3IBE A;  5D0O D;  1QYM A;  3FTV A;  1E8X A;  4G8K A;  3DSS A;  3FUK A;  2LNI A;  1BPO A;  3LYA A;  5CCL A;  3T5V A;  5CER B;  2ETC A;  3FUF A;  4C48 B;  2WVI A;  5A7D B;  3B7T A;  1DCQ A;  4I1M A;  4BTA A;  3C3R A;  2P9P G;  2H6G A;  3TWR A;  2YHE A;  1OY3 D;  5KJN A;  3Q78 A;  4GML A;  3AG1 E;  2KBX A;  2UWJ G;  3ULQ A;  4Q96 A;  3ML8 A;  4EBA A;  5AQ9 A;  2RFM A;  1HE8 A;  4B94 A;  3APD A;  4BX9 A;  4M7C A;  5EX3 A;  2KM4 A;  3PEV B;  3VTX A;  1FVF A;  4URK A;  3Q7A A;  5ENQ D;  3GZS A;  3EU9 A;  5FQ4 A;  1MHQ A;  5BPP A;  1YCS B;  5FJY A;  2X6K A;  3O48 A;  1Z3X A;  4DUI A;  3APC A;  3TWU A;  1TNU A;  1E8Y A;  4N2S A;  2ZIS A;  1U3D A;  1WAO 1;  4GTM A;  3RRN B;  2WPV A;  4DJA A;  3PDN A;  3SY2 A;  5HKP A;  2LUH A;  4APF A;  5E75 A;  4H7X A;  3MX3 A;  4JEH A;  2F37 A;  3PRE A;  4DLO A;  2KCL A;  1ZB1 A;  3GZ1 A;  4HRL A;  2QY7 A;  4YDW A;  4ME2 A;  4AY6 A;  3ONL A;  3ZUV B;  1N11 A;  4XX5 A;  3CK9 A;  3W9F A;  1KPS B;  4EHM A;  4ZFH A;  4HI8 A;  4N39 A;  4GTO A;  3ZXS A;  1OWL A;  1WY6 A;  3R9A B;  3BQO A;  4P29 A;  1UJJ A;  3CR3 A;  3UXG A;  3EUV A;  3DEP A;  4RG9 A;  4UQZ A;  4FJY A;  5J08 A;  4XKB A;  4HFG A;  3DSW A;  4KZ0 A;  3QJZ A;  1S63 A;  4BX8 A;  3ZKJ A;  1U2V G;  5BNW A;  3AS8 A;  3IHV A;  4O6F A;  4I6G A;  1N52 A;  3C98 A;  4A3V A;  3UM2 A;  1S0P A;  3TWT A;  3FU5 A;  3LVQ E;  1E8W A;  4Y6C A;  2GRO B;  1A17 A;  4F6R D;  2WQ7 A;  2F8Y A;  3SD5 A;  3NF1 A;  4KT6 B;  4XZ4 A;  3Q9N C;  3FUM A;  3ZGQ A;  1D8D A;  4A55 A;  2V8S E;  1LD7 A;  4HOT A;  4MS6 A;  1TEZ A;  3NOC D;  4I1A A;  3DXM G;  4UQY A;  2I1J A;  4HOR A;  2XS8 A;  3CQC B;  3TWQ A;  3QNK A;  3DRA A;  4EPZ A;  3BU8 A;  3OXG A;  4O1P A;  3EIQ C;  2RKK A;  3FUN A;  3CLJ A;  4GZ5 A;  2L0I A;  4G23 A;  2KZT A;  3HXF A;  4HS2 A;  3RO3 A;  3LJN A;  1EYH A;  1JCS A;  4TRQ A;  3T8M A;  3FP3 A;  2CG3 A;  2FUL A;  4GTT A;  2P9N G;  3QWW A;  3PRZ A;  5KJL A;  1P5Q A;  4FC8 A;  3ZHE B;  1FT2 A;  4GB9 A;  1N94 A;  2WQH A;  2MRI A;  3HDX A;  1B89 A;  2WXR A;  2XRY A;  3S7J A;  2V5Q C;  4DX6 D;  3D9H A;  3ASO E;  1QZ2 A;  3PNL B;  4KYO B;  2WXG A;  2CG2 A;  3E4B A;  4OVU A;  3FUJ A;  5FIN A;  2X6F A;  1TNB A;  1TJC A;  4JPS A;  2IFU A;  2B0O E;  2V0P A;  3QAQ A;  4ILH B;  2IU1 A;  3R7R A;  5EID A;  2J07 A;  3B13 A;  4XE0 A;  2DWZ A;  4FHK A;  4KMO A;  4CDM A;  4FAD A;  4GZ3 A;  5D66 A;  4QFV A;  2VSO E;  4LG6 A;  2I1K A;  3VLE A;  1MX6 A;  4UQX A;  1AWC B;  4JZY A;  4NUR A;  2WXI A;  2BED A;  3RKV A;  2GRQ B;  1XNF A;  2XGM A;  3UM1 A;  5ARF A;  2Y4T A;  2VYI A;  4G26 A;  2VSX E;  1H19 A;  2QYU A;  1LF8 A;  5FQ7 A;  1JCR A;  4LRZ A;  4AXH A;  5CBN A;  4DX1 A;  3KAE A;  5T8I A;  3HXE A;  3SI5 A;  2XGS A;  4WNF A;  1EF1 C;  3SFY A;  2WXK A;  4PDX A;  2OV8 A;  4W9R A;  3UUX A;  3EIJ A;  5CEA A;  4DI3 A;  3CVV A;  3UIO C;  1PAQ A;  3X2Q E;  2HE0 A;  1NI1 A;  4LER A;  4J8F A;  4YDE A;  5D2M C;  1EDU A;  5ENS D;  5EIB E;  5EYL A;  4ATZ D;  4WNE A;  4J8S A;  5ANL A;  4GMJ A;  1K1A A;  1IHB A;  4ZHB A;  2YHC A;  3RRU A;  3APF A;  2OVB A;  1OCZ E;  4YND A;  2C0M A;  4F1P A;  4J8E A;  2XZT G;  3Q7F A;  1OWP A;  1OWO A;  4FUL A;  4XEI G;  4GAA A;  3FTX A;  5HQ8 A;  2J4D A;  3L22 A;  4K5C A;  2OCC E;  4L9P A;  1OWN A;  3CHM A;  2C0L A;  2IY0 C;  4BT9 A;  4PS3 A;  4ATG A;  1X5B A;  3PE4 A;  5AEN A;  1D8E A;  3DEO A;  5KNH D;  2GGF A;  5FQ8 A;  2ZGD A;  3ASH A;  5CRU A;  4FLB A;  4U07 A;  1INZ A;  4UUC A;  4E85 A;  4UWH A;  3E33 A;  3V2X A;  2X38 A;  3G2S A;  3SHF A;  5CEC B;  2VGY A;  3UT4 A;  5CMW A;  4BES A;  4WNG A;  3DPY A;  3NQP A;  2QYJ A;  4J6I A;  3PZ4 A;  1XGW A;  3MA5 A;  4GYO A;  5ENN A;  1N4R A;  4YVO A;  1HG2 A;  1VDY A;  3HIZ A;  4N3C A;  1MYO A;  3F6Q A;  3ENE A;  1ELK A;  3ABK E;  3VLF A;  4AY5 A;  1JUQ A;  5FTP A;  2BKK B;  1E8Z A;  3C3Q A;  3PZ2 A;  3L82 A;  3ISM C;  1HO8 A;  3ULE G;  2ION A;  2XHE A;  2J4B A;  1N4Q A;  3OAW A;  1TN6 A;  3SZ7 A;  1PC2 A;  1DVP A;  2WXF A;  3OTN A;  3QC1 A;  3NBN B;  2UY1 A;  3UIP C;  3ASN E;  1FPP A;  1TN7 A;  4CYM D;  2L6B A;  2DZN A;  3Q47 B;  4FLH A;  1H2T C;  1H2U A;  4I9E A;  3RO2 A;  3D9K A;  2LXL A;  3D9I A;  5LFA A;  4EBA G;  3S7F A;  2P2C P;  4EZK A;  2EIM E;  1H6O A;  3CVX A;  3KEA A;  2IEJ A;  2R2L A;  4HBD A;  4U8Y D;  3RU0 A;  4CDN A;  3Q79 A;  1HU3 A;  4BEP A;  2XQ0 A;  3AG2 E;  1NZN A;  3ZYL A;  4ILG A;  3HG0 D;  5AIJ A;  2KAT A;  3OXF A;  2FF4 A;  2R02 A;  1KZP A;  3CEQ A;  3V79 K;  4K5A B;  4PS7 A;  4XKC A;  3CHO A;  2F0Y A;  2L9B A;  1IKN D;  4GPM A;  3DBS A;  2MHK A;  3URZ A;  3N71 A;  3EJN A;  3KD7 A;  2X6I A;  3LY7 A;  4J8D A;  2DVW A;  4E6H A;  3NZU A;  2IJG X;  1H0A A;  1HS6 A;  3KS2 A;  5JA4 D;  3ESK A;  2XRZ A;  4K5B A;  2AVP A;  3RRM B;  3ZXP A;  2PL2 A;  2WXO A;  3I4R B;  4HLL A;  1OUV A;  2KCK A;  3EHM A;  3IEG A;  3ASF A;  4JA7 A;  4UI9 C;  3V31 A;  2XPY A;  3MEK A;  2LXM A;  2WXQ A;  4NQ0 A;  3FEY A;  4M3O A;  4N3B A;  1N9A A;  1K3Z D;  4HXI A;  3W9G A;  3AG3 E;  1SA4 A;  2XCB A;  2XGO A;  4F7A A;  4MBG A;  2Q7F A;  4FHJ A;  3FUL A;  2BTD A;  3IXE A;  2EIN E;  2QFC A;  2XPI A;  3EHR A;  4A1G A;  3U4T A;  4JHR A;  1Z3Y A;  3B7U X;  1FVH A;  2V4L A;  1FT1 A;  4I6E A;  1KT0 A;  3QKY A;  2KZT B;  2OEW A;  4ANX A;  4CCA A;  4MRU A;  3FU6 A;  4GTS A;  2KC7 A;  5G55 A;  4JW1 A;  1MX2 A;  3FTY A;  2EQX A;  5BW8 C;  3NZS A;  1O1S A;  1JWF A;  5A23 A;  4EZL A;  2EIK E;  4DLQ A;  4HRN A;  2XEE A;  4L7T A;  1N0R A;  4TUU A;  4ACL A;  2P9I G;  4HOS A;  1TYQ G;  2LO6 A;  3PH0 C;  3I4G A;  2R59 A;  1E7V A;  3QDN A;  5FT9 A;  4JHJ A;  3FTW A;  3KSQ A;  2P9S G;  3QK0 A;  1HXI A;  3J5Q B;  3UX4 A;  3CHR A;  4H7Y A;  4XI0 A;  3CHP A;  1UN9 A;  3D9L A;  4DX5 D;  4B8C B;  1SVX A;  3AJI A;  4KBQ A;  4N5C A;  2GW1 A;  4DI4 A;  4GU5 A;  1OCR E;  3DWL G;  2WB2 A;  3Q49 B;  3IHY A;  2DYS E;  5FZR A;  1HG5 A;  1QBQ A;  2J08 A;  3L13 A;  3B7B A;  2HM8 A;  2VSN A;  3CQG B;  2XEH A;  3LKU A;  2L6J A;  2WXL A;  1N0Q A;  4PH4 B;  2BKG A;  2EIL E;  4B0Z A;  3ZRH A;  4AM9 A;  3SO8 A;  3TWW A;  2AXU A;  4GA1 A;  3UKR G;  5G04 C;  2R05 A;  4B93 B;  3FH5 A;  2VSY A;  1IQU A;  3TAX A;  3LS8 A;  4U0Z A;  1H6P A;  3ONK A;  3EHN A;  2WXH A;  3D9M A;  1TJF A;  3E34 A;  5LOZ A;  2CHZ A;  4FU3 A;  3ULY A;  4HLE A;  4FP7 A;  3ZEF A;  3EHQ A;  3HXD A;  4EQF A;  2ZIR A;  1ZBP A;  5AQ7 A;  3D9P A;  4GCN A;  2Y4U A;  4UI9 K;  1OCC E;  3L6A A;  5ARG A;  2X3M A;  4LSZ E;  1JCQ A;  3J5P A;  2RFA A;  3FU3 A;  4UWG A;  5AYW D;  4C9B B;  5CBO A;  3UI2 A;  3TJP A;  2KCV A;  2Y1L E;  3QB2 A;  4GTP A;  4YDY A;  2CHW A;  3FUE A;  2WMN A;  3U64 A;  1OCO E;  1Z5S C;  4O1O A;  2DYR E;  3RAU A;  3AS5 A;  2YNQ A;  3TWS A;  1U3C A;  5ENR D;  2L0T B;  4NRH B;  3TXN A;  4HQD A;  2CFZ A;  3FH7 A;  3LY8 A;  3ZVV A;  3AS4 A;  1TNZ A;  3MV3 B;  3CVY A;  1ELW A;  3TG4 A;  1Q2Z A;  3FWV A;  4R7L A;  3NB2 A;  2E2E A;  1O5M A;  2AXV A;  2AW6 A;  1UW4 B;  3PEU B;  3ZNG A;  2QZA A;  2HYZ A;  4QQI A;  5CMY A;  5H7P A;  3MV2 B;  3LDZ A;  3L08 A;  5LCW C;  4N5Q A;  5ITZ F;  3B95 A;  3I5P A;  2R17 C;  4K03 A;  4L2L A;  2DBA A;  2HR2 A;  4Z68 A;  3BG0 B;  1Z6T A;  3C5R A;  3CVP A;  4APO A;  4BTB A;  4EEC A;  4A3T A;  4F3V A;  3JUI A;  3U9W A;  4HNA D;  2UY1 B;  4CEM A;  3TXM A;  3OXL A;  3NAW A;  3I3N A;  3BUA A;  3HVE B;  3BG1 B;  2IF4 A;  4GA0 A;  4U7E B;  3MGB A;  4FJZ A;  2J49 A;  2GRN B;  5FQ6 A;  4Q69 A;  3MZL B;  2C2L A;  2WXN A;  5G05 C;  4N2Q A;  3TWV A;  3RSE G;  1BLX B;  2XEV A;  3QOU A;  3L54 A;  3G2W A;  4JXT A;  3PS6 A;  5T3R A;  4ANU A;  3ASG A;  1RZ4 A;  3HYM B;  3HRA A;  1HFA A;  5HI7 A;  2PM7 A;  3FY4 A;  5AAR A;  2WQ6 A;  3UTM A;  3UM0 A;  2AXZ A;  4UWK A;  1IXV A;  3SNX A;  2P9L G;  4U96 D;  3UT8 A;  5C1D A;  2PM6 A;  3S7D A;  1FCH A;  1Y6I A;  5LCW J;  2I9C A;  4L2Y A;  3AU5 A;  2E0I A;  2A5E A;  3TWX A;  1PY1 A;  1DCE A;  1S64 A;  4HB5 A;  3NOG D;  3K9I A;  3ZU7 B;  2FBN A;  3VTY A;  3FUI A;  4I43 A;  2J8S D;  1OWM A;  3ABL E;  3MKR A;  5FZQ A;  2AJA A;  3JXJ A;  4G2V A;  3TL5 A;  5JJ6 A;  2VGX A;  2GRM A;  4J7W A;  4JEU A;  5ANR A;  1MZC A;  4GZD A;  5JJ7 A;  4RG6 A;  3HHM A;  4CGW A;  3HXB A;  5BXO A;  4U95 D;  3UIN C;  1TR4 A;  4BFR A;  1RW2 A;  3UM3 A;  1JPL A;  2EIJ E;  5D0Q D;  3HVE A;  3L17 A;  5ENT D;  2LSV A;  3U66 A;  2XS1 A;  1AP7 A;  4Q94 A;  2VTB B;  1A5E A;  2VQ2 A;  1V54 E;  2ZGG A;  2H6F A;  4KVM A;  5DIZ A;  4U0S A;  4LNU D;  2FEZ A;  3PZ3 A;  3CST A;  4J0U A;  5FIO A;  4UWL A;  2PQN A;  2GRR B;  3AAA C;  5AQB A;  3G2V A;  3IKO B;  1E96 B;  3EDT B;  4G1T A;  2OOE A;  3PVL A;  2KXP C;  5KNG A;  4DX2 A;  5HRY A;  1KLX A;  4BET A;  5C2Y A;  2IOS A;  4JD2 G;  1E7U A;  3B7R L;  3CK8 A;  3CKC A;  3ZYM A;  4D10 C;  4C0M A;  4B89 A;  3ABM E;  4RVB A;  3CHS A;  4U0U A;  2DIW A;  2RD0 A;  4AVX A;  2AWI A;  2P9K G;  1N4P A;  3QWP A;  3MKQ A;  5KCM A;  4WWN A;  4WND A;  5IY5 E;  3JCK C;  2H6H A;  3B7S A;  3LCA A;  3PUJ A;  5EN5 D;  3FDH A;  2P58 C;  4NIK A;  3WXX A;  2J09 A;  3BEE A;  5DBK A;  2XEN A;  1N95 A;  3ZYQ A;  3WG7 E;  1V55 E;  4DK5 A;  4I2Z A;  5CED B;  4LNB A;  5AQA A;  3JQ0 A;  3MCX A;  5JHA A;  3LVR E;  4MLP A;  2NYJ A;  5T4Y A;  2DZO A;  4KZC A;  4ABN A;  5M72 A;  2VTB A;  2ETA A;  2Y0B G;  1QQE A;  3T8K A;  2F8X K;  3CHQ A;  3ZIM A;  2I2O A;  5AAO A;  4JB8 P;  3Q9U C;  3CV0 A;  4JA9 A;  3FTS A;  4O60 A;  1KZO A;  4BSZ B;  3ZN3 A;  2WXJ A;  4GMR A;  1N4S A;  3MJW A;  3C3O A;  5AJL A;  4L23 A;  2LAH A;  2Y69 E;  1MX4 A;  4HOU A;  2VJ8 A;  4N3A A;  3PZ1 A;  4IUL A;  5ENO D;  4OYS A;  3LJ3 A;  4AV7 A;  1Y8M A;  1BU9 A;  1H2V C;  3D3M A;  4OVV A;  4JVS A;  1DC2 A;  4I2W A;  2V4H C;  4KXK B;  2XZD G;  3ML9 A;  3Q4A B;  3CVU A;  3RK6 A;  4A63 B;  4UI9 J;  2PZI A;  2WXP A;  4KVO A;  1IHG A;  2IO2 C;  2P9U G;  5AN8 A;  4YDO A;  1TNY A;  1HF8 A;  4IN3 B;  4IYP A;  3UKU G;  5ENP D;  3C72 A;  4GTQ A;  3R7Q A;  3UT7 A;  3CVQ A;  4PS8 A;  4WUY A;  3P2B A;  4JL0 A;  2JEK A;  2NXP A;  3ZFW A;  3PE3 A;  2HO1 A;  3D9O A;  4ANV A;  5KJK A;  1YMP A;  3CVN A;  3Q75 A;  3S7B A;  3LPZ A;  1HH8 A;  1NL4 A;  3FUD A;  1IQR A;  4TXR A;  3SQV A;  2ZXW E;  5BUZ A;  2WM9 A;  5B3S E;  3SGH A;  5FZS A;  1NA3 A;  1TN8 A;  2FI7 A;  4BY6 A;  1WG0 A;  4HRM B;  4X8Q A;  4LNG A;  5BT1 A;  4PUC A;  3VLD A;  5LX8 A;  4B8A A;  2QC9 A;  3KSL A;  3E30 A;  2WXM A;  5CRV A;  1UJK A;  4JHK A;  3FHE A;  1MQS A;  1LD8 A;  3DST A;  3CVL A;  1G3N B;  4TXQ A;  2CHX A;  5JJT A;  2BUG A;  3LY9 A;  4OAU C;  5BXU A;  3GYZ A;  1YA0 A;  3T5X A;  1E90 A;  3ASD A;  4MKT A;  1KT1 A;  2IQC A;  5B1B E;  4RQI A;  4WWP A;  3P1U A;  1NP7 A;  3V30 A;  2V5F A;  3RJV A;  3KEZ A;  2OEV A;  5JMN D;  3ZW3 A;  3UPV A;  4G11 A;  4G8L A;  3DSV A;  2JAB A;  4I6J A;  3FTU A;  1MJ0 A;  4I9C A;  4RSY A;  3GZ2 A;  4LUN U;  3TG5 A;  4GZ6 A;  1K1B A;  3JXI A;  5B1A E;  4UWF A;  4WAF A;  1NFI E;  4GPK A;  5J90 A;  3SBS A;  2Y3A A;  2CFU A;  1D9S A;  5HS0 A;  1QNF A;  5EDS A;  3CGH A;  3G2T A;  4GTV A;  3LXU X;  1UOH A;  2ETB A;  3S2A A;  2FO7 A;  5G04 J;  3LEW A;  2R03 A;  4IRU A;  3SFX A;  5KJM A;  1SZA A;  3FTZ A;  3FUH A;  3AG4 E;  3PZD A;  5AJD A;  3UQ3 A;  4XIF A;  2XPZ A;  3CSF A;  5A6C A;  4G25 A;  3HXC A;  1ZU2 A;  3CKB A;  4F1S A;  3DSX A;  3FU0 A;  3D9J A;  1O1T A;  4ILI A;  5LP0 A;  4AIF A;  2IO3 C;  4JC8 A;  4U04 A;  5EYP F;  2BF0 X;  3SF4 A;  5EIL A;  2XCC A;  1SZ9 A;  3MYV A;  1X81 A;  4OAV B;  5KBA A;  1YYH A;  2LSU A;  3FFL A;  3DSU A;  4CGV A;  1UG3 A;  3ESL A;  2IOL A;  2A4Z A;  4I1O B;  1TNO A;  2VGX B;  1BI7 B;  4TXP A;  4A1S A;  2PNN A;  2YIN A;  3SBT B;  1O1R A;  4GYY A;  1GW6 A;  3ZHE A;  1SW6 A;  1W3B A;  4TUM A;  3Q73 A;  3PUK A;  3E37 A;  3IV0 A;  3Q5M A;  3JUE A;  1LTX A;  3PNT B;  5JHB A;  4U63 A;  4GZC A;  4GTR A;  1BD8 A;  4U8H A;  4GYW A;  4DPR A; 
#chains in the Genus database with same CATH homology
 1N0Q A;  3D9H A;  2ETA A;  2Y0B G;  3F6Q A;  3UTM A;  4DRX E;  4DX6 D;  3T8K A;  2HE0 A;  4J8Y A;  1IXV A;  3V2O A;  2F8X K;  1D9S A;  1MX2 A;  1S70 B;  2BKG A;  3AAA C;  5AQB A;  3TWR A;  4U96 D;  4K5A B;  1OY3 D;  5ENS D;  5HS0 A;  3SO8 A;  3TWW A;  5AAO A;  5EIB E;  4JB8 P;  3UXG A;  5EYL A;  5FIN A;  3Q9U C;  4ATZ D;  3DEP A;  2BKK B;  1BI8 B;  4O60 A;  2B0O E;  2VGE A;  4B93 B;  4BSZ B;  4DX7 D;  1K1A A;  1WG0 A;  1IKN D;  4HRM B;  4GPM A;  2A5E A;  1UOH A;  2ETB A;  3TWX A;  1IHB A;  4GMR A;  2KXP C;  2XEE A;  4HRN A;  5KNG A;  3ZKJ A;  4ZHB A;  2KBX A;  1N0R A;  2QC9 A;  5EID A;  3ZNG A;  4HB5 A;  3NOG D;  4F1P A;  4DX2 A;  5HRY A;  2DVW A;  4QQI A;  3ZU7 B;  2DWZ A;  3TWT A;  2XZT G;  4BET A;  5AQ9 A;  2RFM A;  1MX4 A;  4N5Q A;  5ITZ F;  5JA4 D;  3B95 A;  4K5B A;  2FO1 E;  1G3N B;  5D66 A;  3EHQ A;  4QFV A;  4F6R D;  5ENO D;  2J8S D;  5ENQ D;  5AQ7 A;  3NBN B;  4BER A;  1BU9 A;  4LG6 A;  4U8V D;  2F8Y A;  4HI9 A;  1WDY A;  4Z68 A;  3EU9 A;  1MX6 A;  3C5R A;  4HLL A;  4K5C A;  1DC2 A;  1YCS B;  4LSZ E;  2AJA A;  2V4H C;  3JXJ A;  3Q9N C;  1AWC B;  3V31 A;  3J5P A;  2RFA A;  5KWD A;  5EYP F;  2XZD G;  3V79 K;  3DEO A;  2L6B A;  2DZN A;  3J5Q B;  5KNH D;  4CYM D;  5BXU A;  5CBO A;  4CZ2 D;  4OAU C;  3UI2 A;  4J7W A;  5EIL A;  2ZGD A;  4HNA D;  4A63 B;  1OT8 A;  2MYO A;  4DUI A;  4OAV B;  3NOC D;  5EN5 D;  3TWU A;  5KBA A;  4UUC A;  1YYH A;  1K3Z D;  4DX5 D;  5AN8 A;  4NIK A;  3W9G A;  3V2X A;  2Y1L E;  1SVX A;  2P2C P;  3TWQ A;  5BXO A;  4U95 D;  1BI7 B;  4O1P A;  5ENP D;  1TR4 A;  2PNN A;  3KEA A;  3V30 A;  3AJI A;  2XEN A;  5HKP A;  3IXE A;  4YDY A;  3EHR A;  5CEC B;  5JMN D;  5CED B;  5ENT D;  2F37 A;  1QYM A;  4BES A;  5AQA A;  4HRL A;  3TWV A;  4G8L A;  1SW6 A;  5CBN A;  3LJN A;  4HBD A;  4YDW A;  4TUM A;  1BLX B;  4U8Y D;  4DX1 A;  4G8K A;  3ZUV B;  1AP7 A;  2JAB A;  2QYJ A;  1N11 A;  2NYJ A;  4O1O A;  4BEP A;  1A5E A;  1MJ0 A;  1YMP A;  2DZO A;  5CER B;  2ETC A;  2ZGG A;  3W9F A;  3JUE A;  3B7B A;  3HRA A;  3TWS A;  4C48 B;  2XEH A;  4ZFH A;  5ENR D;  4LNU D;  1K1B A;  3JXI A;  4RLY A;  3HG0 D;  4HI8 A;  1DCQ A;  1BD8 A;  1NFI E;  4HQD A;  3T9K A;  5CEA A;  5FIO A;  1MYO A;  2V5Q C;  5AAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...