4F6RD

Tubulin:stathmin-like domain complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
159
structure length
159
Chain Sequence
b'GSDLGKKLLEAARAGQDDEVRILMANGADVNAEDDSGKTPLHLAAIKGHLEIVEVLLKHGADVNAADKMGDTPLHLAALYGHLEIVEVLLKNGADVNATDTYGFTPLHLAADAGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Design and characterization of modular scaffolds for tubulin assembly.
pubmed doi rcsb
source organism Artificial gene
molecule tags Cell cycle
total genus 54
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4f6rD00
4OAUC 2XZTG 1IXVA 1YYHA 4G8KA 4RLYA 2DVWA 5AQ9A 4QQIA 5CEDB 5AQBA 3AJIA 5AQ7A 4DX7D 2J8SD 1K1BA 2XEHA 3JUEA 3Q9UC 4HRLA 3V2XA 4O60A 4CYMD 4U96D 5EN5D 5HRYA 1N11A 2DZOA 3TWVA 1IKND 4GMRA 1WDYA 4F1PA 3EHQA 1BI7B 3V31A 2AJAA 1K3ZD 1TR4A 4HLLA 2BKKB 5ENOD 3W9FA 4CZ2D 1SVXA 4C48B 3TWSA 4DX6D 1N0QA 3DEPA 4OAVB 1K1AA 1DCQA 2Y1LE 4LNUD 5AARA 5JA4D 1YMPA 2F8XK 3SO8A 1MX2A 5HS0A 1SW6A 2V4HC 3NOGD 1G3NB 5EILA 4HBDA 4DX1A 4DX2A 4DRXE 2L6BA 3ZU7B 1BI8B 5AN8A 4HRMB 3W9GA 2ETCA 2QC9A 1BU9A 1QYMA 3JXJA 1AP7A 3B95A 2KBXA 5EIBE 5ENSD 4HQDA 3TWXA 5EYLA 2VGEA 2A5EA 4HI9A 1OY3D 1OT8A 3V79K 3EU9A 2F37A 4UUCA 3UTMA 4J8YA 5EIDA 4G8LA 5KNHD 3D9HA 2JABA 3AAAC 2XEEA 5AQAA 5BXUA 4ATZD 2Y0BG 4LSZE 4TUMA 3UI2A 4BERA 4U8VD 3KEAA 4K5AB 1IHBA 2QYJA 3J5QB 3NBNB 5ENTD 2ZGGA 3F6QA 4JB8P 5AAOA 3B7BA 4K5BA 3ZNGA 3IXEA 4HRNA 3T9KA 4O1OA 4N5QA 4Z68A 5D66A 3TWQA 2ETAA 5KBAA 5CECB 2V5QC 4U8YD 3HG0D 4J7WA 1MX6A 4BESA 1BLXB 3JXIA 4B93B 3DEOA 4YDYA 1D9SA 2RFMA 3TWRA 3UXGA 4ZFHA 4ZHBA 4F6RD 5HKPA 1MYOA 3EHRA 4O1PA 3HRAA 4GPMA 2XENA 4DUIA 5BXOA 2B0OE 2FO1E 4K5CA 2MYOA 3V30A 2BKGA 2ETBA 5ENRD 1AWCB 2XZDG 5FIOA 1UOHA 3LJNA 4BETA 1A5EA 1N0RA 2DZNA 3Q9NC 4HI8A 3C5RA 4HB5A 4LG6A 2DWZA 5JMND 1BD8A 2KXPC 3NOCD 3T8KA 4BSZB 1NFIE 2HE0A 3TWUA 1MJ0A 4QFVA 4A63B 2ZGDA 3TWWA 1YCSB 5ENPD 3TWTA 5CEAA 5CERB 2F8YA 2RFAA 1WG0A 5KNGA 5EYPF 1MX4A 4HNAD 1DC2A 3ZUVB 4U95D 3J5PA 3V2OA 5FINA 5ENQD 5ITZF 1S70B 2P2CP 5CBOA 4NIKA 4DX5D 3ZKJA 4YDWA 2NYJA 5CBNA 2PNNA 4BEPA 5KWDA
chains in the Genus database with same CATH superfamily
1UJJA 4RLYA 5CEDB 2ZISA 3BQOA 4WNGA 4APFA 4AP2A 4CGVA 2MHKA 4U04A 2M63A 3PDNA 3APCA 3U4TA 4AJWA 2GRRB 4J8DA 3JQ1A 4B94A 2LSUA 1O5MA 4CGWA 3SFXA 3GZ1A 1FVHA 3PNLB 3CVQA 3CVVA 2BF0X 3SF4A 5BXUA 2C0LA 2WXHA 4FHJA 4FADA 2L0TB 4GTVA 5IY5E 1X5BA 4UWGA 5E75A 2Y3AA 2YQ8A 3CK8A 4BESA 4XKCA 3ULEG 4F6RD 3DSSA 3EHRA 3CSTA 5BXOA 5D0QD 5FTPA 1HX8A 3C5RA 1H0AA 2Y69E 2EILE 4K03A 3PS6A 3FH8A 4ANWA 2Q7FA 2XCCA 5E76A 2OOEA 4EZKA 1SA4A 2IY0C 2WXQA 5G55A 2IQCA 5ITZF 5ENQD 2L0IA 4U0UA 3SBTB 4PS8A 3TAXA 3BG1B 4AVXA 3VTYA 1UG3A 4HORA 1FT1A 4O60A 3ONKA 4UWFA 4L2LA 4UI9K 3FUIA 5D0OD 1TR4A 3KSLA 1TNYA 4C48B 2XRZA 2H6IA 4HS2A 4OAVB 3CQCB 1MX2A 3LPZA 2V5FA 3MKQB 4HBDA 2OEWA 5AN8A 5C2YA 3UKRG 1PC2A 1AP7A 2KBXA 3ZVVA 4EZLA 2VGEA 3ML9A 4L2YA 5AIJA 1OY3D 4GCOA 3GZSA 3AG3E 5CMWA 2UWJG 1RZ4A 2QYJA 2J09A 2PL2A 5EX0A 3ZGQA 2J08A 4JZYA 3IHVA 5HQ8A 2WXFA 4J0UA 3R7RA 1MX6A 3D9IA 3QK0A 4YNDA 4Y6WA 5BNWA 3B7UX 5HKPA 4J8FA 4K5CA 4GZDA 3IHYA 3KSQA 2DWZA 3IBEA 1BD8A 1OCCE 1HH8A 4GA2A 3MV2B 1KPSB 2LSVA 1V55E 5CEAA 5CCMA 1DC2A 3G2SA 3JQ0A 4J6IA 3OAWA 2P2CP 1INZA 4N2QA 4DX5D 4YDWA 2PNNA 3Q75A 4PS3A 4G8KA 3ASGA 5HRYA 5FQ7A 2X38A 1ELWA 2AJAA 3PZ2A 1S63A 3FTZA 2KZTA 2XGOA 4WNEA 4H7YA 4JD2G 2AWIA 5J90A 1TN6A 4UQXA 3CHRA 4APOA 3LVRE 4FULA 2MOWA 2V4HC 1JCRA 3U66A 4DI3A 4G24A 2JEKA 4UQYA 2XRYA 5ENSD 3EDTB 2IONA 3LYAA 1TNOA 3I3NA 4JHRA 3ZYLA 3ZFWA 1ZBPA 2Y0BG 4B8AA 3SY2A 2HM8A 3WG7E 4K5BA 3FUFA 3D9MA 3NZSA 3EIQC 2P9NG 3FTSA 3DPYA 1D9SA 1JWFA 4U0SA 2LXMA 2PM7A 3BUAA 4Y6CA 1N0RA 2XQ0A 1E7UA 1OCOE 4RSYA 3I5PA 3EUVA 1E7VA 3CVYA 2IF4A 2XEVA 5KNGA 1HG2A 4LEUA 4AM9A 5ANRA 1S70B 3RO3A 2ONDA 3ZKJA 3PEVB 4MLPA 3GW4A 3Q9UC 2XEHA 4I2ZA 1A17A 4ILIA 1MQSA 4K0RA 4GTQA 3Q49B 1E8YA 3G2WA 3BG0B 1JCSA 2VSYA 1IQRA 2R59A 3CIAA 4DX6D 5JA4D 1YMPA 2I1KA 3CKCA 4LRZA 5EILA 4U7EB 1BI8B 3PZDA 4HRMB 3W9GA 3PE4A 5JJ7A 5C1DA 4GYOA 1V54E 3ZEFA 3FULA 1BPOA 5FZRA 4L23A 2JABA 4LCTA 4XKBA 5T4YA 3B7RL 3FUJA 2LNIA 4JEHA 3NBNB 2OEVA 2J49A 3BEEA 4I6GA 1WAO1 2DCPA 2IFUA 1H6KA 3ZIMA 2V0PA 3CVUA 2ETAA 3SNXA 3FTYA 1NI1A 3KEZA 3PZ4A 5EDSA 1TNZA 1H2VC 3QAQA 1SZ9A 2PQNA 2XPZA 3PEUB 3SGHA 5JJ6A 4M3OA 4EQFA 1TEZA 4LNGA 1X81A 2VQ2A 4LG6A 3VLFA 3T8KA 2VYIA 4DJAA 4AOFA 4YVOA 1MJ0A 3ASHA 3T5VA 4HFGA 1ZB1A 4AXHA 4CRWA 3DSWA 1MX4A 3L17A 4HNAD 3Q78A 4GMLA 4WWNA 4BEPA 2J4BA 3ABKE 5AQ9A 2J8SD 1S64A 3CVLA 2R03A 3S7FA 3TWVA 1S0PA 3O4ZA 4U63A 3R9AB 4A1SA 2AXVA 4M7CA 5A6CA 4I6EA 3PRZA 1N0QA 2F8XK 2C2LA 3CQGB 3ENEA 3FH5A 1K8KG 2QC9A 4AEZC 3ASFA 2VGXB 5T8IA 5HI7A 3UT4A 2X6FA 3UT8A 4LSZE 4TUMA 3UINC 4ANXA 5FZSA 1VDYA 4AIFA 1HZ4A 5BW8C 3X2QE 4HXIA 3V30A 3RAUA 4GZCA 3LJNA 4BETA 2DZNA 1NP7A 4CCAA 1Q2ZA 3C3RA 2RG8A 3TG4A 3CVXA 3L08A 2L9BA 4G26A 4HOUA 3UMVA 4KYOB 4YDOA 2FEZA 3CV0A 4QQIA 1IQUA 3QB2A 4JPSA 3CR3A 3EHMA 3UX4A 5D2MC 3SHFA 2OCCE 3FH7A 1IKND 2WXJA 4OVUA 3DRAA 3APFA 3DXKG 3MYVA 1TNBA 3E4BA 2GRMA 2Y1LE 3S7DA 3DSVA 1UJKA 2JLBA 2XPIA 1Y6IA 3AU4A 1BU9A 2FBNA 4B89A 3TJPA 3EJNA 1O1SA 2A5EA 3QNKA 3FUDA 2WXLA 3TXMA 3CEQA 3ASOE 4CEMA 2BEDA 1IHBA 4G23A 4HVBA 4HLEA 2ZGGA 3QWPA 4A3TA 3GZ2A 4L1BA 3D9NA 4WAFA 2AXUA 3FTUA 4O1PA 3KS2A 2FO1E 2ZXWE 4MKTA 2V8SE 5AJLA 3ZPJA 1D8DA 2QZAA 3UT7A 3TL5A 2J07A 3ESLA 2RKKA 2Y4UA 5ANLA 4ILHB 4KT6B 5FINA 3NZUA 4BWRA 3HXCA 1NA3A 5CBOA 2GRLA 3LKUA 3URZA 3FU0A 4GTMA 3HHMA 5AQBA 4DX7D 2V4LA 2R5SA 5BT1A 5DIZA 2XCBA 3UM1A 4A3VA 1HU3A 4P29A 1DCQA 4HOTA 3IKOB 1E8ZA 3B13A 4RG6A 2WXMA 3DSUA 5ENNA 4A55A 2BUGA 2VSNA 3DSXA 3JXJA 3ABLE 4CT4A 4UUCA 4J8YA 2WXKA 2X3MA 4I17A 4EBAG 5ARFA 5BV1A 4J8EA 4KZ0A 3B7BA 3ZNGA 3Q7FA 4N3BA 4L7TA 1Z6TA 1O1RA 1P5QA 1HF8A 3CHPA 2V5QC 4J7WA 3DEOA 1LF8A 4XI9A 3CVPA 4PUCA 2XENA 2IU1A 3MX3A 4EBAA 2BKGA 4EHMA 2GGFA 3Q9NC 1UN8A 1N9AA 3NOCD 4HOSA 3D3MA 1H6PA 3HXBA 2R02A 4IN3B 3MJWA 4FLBA 3FU3A 2DIWA 2WMOA 4MS6A 4OAUC 2AXZA 2DVWA 2VSOE 4GZ5A 3JUEA 4GTOA 4BTAA 2VTBB 2EIME 1BI7B 5H7PA 3FUKA 2WXGA 3U64A 2R05A 3Q15A 5HS0A 4PS7A 3ULQA 4FC8A 4TXRA 3SI5A 3LDZA 2CHXA 2FF4A 3ZW3A 3ABME 4HI9A 3V79K 4E6HA 4JL0A 3D9HA 3FTWA 3D9OA 3UI2A 4KBQA 2KCKA 3QWVA 3MEKA 4G11A 1HXIA 4XIFA 2I9CA 5KBAA 4FP7A 3FUHA 4U8YD 3VLEA 3CK7A 3CVNA 1BLXB 3ISMC 4I43A 4R7LA 5CHEE 3C3QA 2VGYA 3TWRA 2WQHA 1JCQA 5A23A 4HI8A 1TNUA 4I2WA 2LO6A 4UI9C 2GROB 3TWTA 1ZU2A 3HVEB 5FZQA 5T3RA 2WQ7A 5LFAA 4U95D 3FEYA 4XX5A 4WWOA 2DYRE 3HXEA 1UN9A 3TGOA 3EHNA 3DSTA 2WM9A 1YYHA 3QKYA 1JPLA 1K1BA 1N11A 2RD0A 2OVBA 3EHQA 4ACKA 4CZ2D 4DLQA 1K1AA 2R17C 3LEWA 3MKQA 2VJ8A 5KJMA 4HOQA 3DBSA 2L6JA 2B6CA 4NQ0A 4N5CA 4B8CB 4UWKA 3B95A 5CCLA 3Q79A 1HS6A 5FJYA 2P9SG 3SBSA 3ZHEB 3EU9A 2EINE 3FHEA 1QZ2A 3I4RB 3CSFA 5AQAA 1LD8A 3ZN3A 1D8EA 4C0MA 3AS5A 4G2VA 4URKA 3D9PA 4NACA 4GAAA 3T9KA 3PZ1A 3LJ3A 2EQXA 3ML8A 4GB9A 3ZYMA 2WMNA 4N39A 2CHZA 3JUIA 3C3OA 5LOZA 3UIOC 2B0OE 1OWOA 4ME2A 1OWLA 1E8XA 1TYQG 3JCKC 1WM5A 3AG2E 3E37A 3FDHA 3IEGA 4D10C 5ARGA 1QQEA 4OVVA 4BSZB 2VTBA 2ZGDA 1YCSB 4IYPA 4JA9A 2F8YA 1U3CA 3UQ3A 1L5JA 2WPVA 3RRNB 4E85A 1HO8A 3CGHA 3SQVA 1DCEA 2XZTG 2BTDA 2A5UA 3T5XA 3AJIA 2X6JA 5LCWC 5LP0A 5EN5D 1NL4A 4GA1A 3UPVA 3DXMG 3RO2A 4IRUA 3DEPA 2OVFA 4F3VA 1HFAA 4BT9A 3SO8A 1G3NB 3MZLB 1LTXA 3FUMA 5G05C 4RG9A 3CKBA 4U07A 3OTNA 2YHCA 4XI0A 4MBGA 3HXDA 1OWNA 3EIJA 3RU0A 2X6IA 1UW4B 2IO2C 3L6AA 2KCVA 5EIDA 4PDXA 4G8LA 3FEXA 3VTXA 4GYWA 4WNFA 1H19A 3KEAA 3MGBA 1U3DA 5B3SE 4XE0A 3MA5A 3NAWA 3PNTB 5CECB 3HVEA 2WXOA 4ZFHA 4YDEA 3E30A 4DUIA 3LXUX 4C0EA 5LCWJ 4OYSA 3JYSA 2CG2A 3Q4AB 4L9PA 4I6JA 4W9RA 4F7AA 3B7TA 4QFVA 3S7BA 5CERB 4GPKA 3J5PA 3PREA 5G05J 4CDMA 1FVFA 1SZAA 3CLJA 4GA0A 2E2EA 2AW6A 3ZYQA 4GMRA 3RSEG 3ZHEA 1WY6A 4DLOA 4BX8A 1N4QA 2YNQA 1B89A 3ZRHA 5BV0A 1W3BA 4LNUD 2Y4TA 3L13A 4J8SA 3OXGA 3UM3A 4DX2A 3MV3B 3R9MA 1N95A 1QYMA 2XPYA 1EPUA 3TWXA 3QWWA 5DBKA 2DBAA 4Q94A 2WXPA 2IJGX 1RW2A 2X6HA 4KVOA 2WB2A 3RK6A 2P9IG 3D9KA 1QNFA 4K5AB 1EYHA 2YINA 3IXEA 3HXFA 4Z68A 2P9UG 3TWQA 3LVQE 2IOSA 2P9KG 1XNFA 4GPMA 2MYOA 2ETBA 5A7DB 3OXFA 1QBQA 4DPRA 4FA6A 5CRVA 1N4SA 4O6FA 5AJDA 3ZUVB 3V2OA 4GTSA 1N4RA 2P9LG 1EF1C 2PQRA 4WUYA 2WXRA 5KWDA 4GYYA 1IXVA 1IYGA 5FT9A 2KC7A 2XGMA 4N3AA 1H6OA 4U96D 4CT0A 4CDNA 4F1PA 5ENOD 2KZTB 1SVXA 4NURA 1KZPA 4XZ4A 2I2OA 1TJCA 3MKRA 1KT1A 2MRIA 2ETCA 3HIZA 3PZ3A 2VSXE 4HQDA 5CMYA 2VGXA 5FQ6A 1Z3XA 2J9QA 3AAAC 3G2VA 4CDRA 4ATZD 3AS4A 4U8VD 4LNBA 5CRUA 3VLDA 2IEJA 4JB8P 5ENTD 1H2TC 4F53A 4LERA 4GU5A 4ANVA 4N5QA 3S7JA 5KJLA 3PUKA 3G2TA 4GTPA 2XGSA 2FO7A 2RFMA 5EKQD 2H6GA 4RVBA 2FULA 1U2VG 1JUQA 4XEIG 3U3WA 3QARA 1UOHA 3LS8A 1TJFA 4ANUA 3S2AA 4I1OB 3TXNA 4JHKA 4GCNA 2KXPC 1O1TA 1N4PA 3PH0C 4JEUA 2NXPA 1SQMA 4U8HA 3HDXA 4JC8A 4LUNU 2WXIA 3QC1A 4WWPA 5FQ8A 5JHBA 3V2XA 3U9WA 1XGWA 5BUZA 4I9CA 2DZOA 5B1AE 3ULYA 1WDYA 1SA5A 1E90A 4HLLA 3PVLA 3GYZA 3D9LA 3EU5A 4V3IA 5AARA 3FTXA 4JW1A 5LX8A 2NC9A 3RRMB 2ZU6B 4MRUA 3ONLA 5EYLA 2A4ZA 4X8QA 5FQ4A 5M72A 1OT8A 4B0ZA 3ESKA 2F37A 4GTRA 3UTMA 2X6KA 4ILGA 1JWGA 4GTTA 5KNHD 2AVPA 4NRHB 3SFZA 3F6QA 5AAOA 3L22A 2CG3A 2DYSE 4HRNA 3LY9A 4U0ZA 5B1BE 5D66A 4ABNA 2WQ6A 4JVSA 1MYOA 1FT2A 3AG1E 1DVPA 5FIOA 1A5EA 4AY5A 1OUVA 4N3CA 2XHEA 3CHQA 5BPPA 2HE0A 3WXXA 2YHEA 4A63B 3R7QA 2P9PG 1E96B 5J08A 2RFAA 4BX9A 5EYPF 3PE3A 1OWMA 3E32A 4KMOA 4DK5A 3SFYA 5AQ7A 4HRLA 2GW1A 2I1JA 3CK9A 4JA7A 3CHMA 3RIBA 3NQPA 3NF1A 1OCZE 1KT0A 3IV0A 1DNPA 3LY7A 2J4DA 1OXJA 3W9FA 4YVQC 1NZNA 3TWSA 5G04C 2IO3C 4BT8A 4TV3A 3G2UA 3FUEA 1SW6A 4DX1A 3L54A 4BFRA 4KXKB 5JHAA 4Q96A 2HR2A 1Z5SC 4I9EA 4TXPA 3T8MA 5JJTA 5G2NA 4TXQA 2E0IA 2XEEA 4GMJA 2GRPB 2HO1A 1ELRA 2PZIA 4G25A 4TRQA 2FI7A 5FWQA 3SD5A 4EZJA 2KATA 2P58C 3HG0D 4F1SA 2C0MA 2QFCA 3JXIA 4C9BB 4YDYA 1TN7A 3FTVA 3UXGA 3L16A 4AV7A 3HRAA 3ZXSA 4ATGA 1AWCB 3UIPC 4UI9J 3QDNA 5KJNA 3CHSA 5G04J 5ENPD 3UM0A 1FCHA 3Q5MA 2CHWA 2HYZA 3LCAA 2NYJA 2ZIRA 2KM4A 4A1GA 1Z3YA 2UY1B 1H2UA 1KZOA 3FY4A 2IOLA 3V31A 1K3ZD 2H6HA 3Q7AA 3UUXA 4RQIA 3SZ7A 4IULA 2BKKB 3FWVA 1E8WA 4AY6A 2R2LA 5KCMA 2QY7A 3NOGD 1LD7A 4UWHA 2L6BA 3FFLA 3ZU7B 3HYMB 4FLHA 4BSXA 3KD7A 3E33A 2EIKE 3PUJA 5EIBE 3N71A 1OCRE 2WXNA 3LY8A 4FJZA 4JHJA 2GRNB 4EPZA 5KJKA 1N52A 2WVIA 3QOUA 4Q69A 3J5QB 1HG5A 3DPDA 1KLXA 4ACLA 3CVWA 3BU8A 2GRQB 4O1OA 2XS8A 3RKVA 3AG4E 1MHQA 4UWLA 2LUHA 3RRUA 4PH4B 2KCLA 3ZYKA 5ENRD 3C98A 1N54A 4HB5A 1HE8A 5JMND 3Q73A 4FU3A 3APDA 2NSZA 2LXLA 3FU6A 4BY6A 2ILRA 2QYUA 3O48A 4TUUA 4NIKA 1PY1A 3AU5A 1FPPA 2LAHA 1IHGA 1GW6A 2F0YA 3ASNE 1OWPA 4BTBA 4GZ6A 4CYMD 1MZCA 1EDUA 5AYWD 1YA0A 3TG5A 4WNDA 5EX3A 2PM6A 4EECA 2H6FA 1ELKA 3FP3A 4G1TA 3FU5A 4DRXE 3P1UA 3Q47B 5AENA 3P2BA 3AS8A 3QJZA 3D9JA 3I4GA 1Y8MA 2OV8A 2I6HA 3ZXPA 4BERA 3UM2A 3OXLA 3FUNA 3KAEA 3L82A 4GZ3A 4B93B 4I1MA 4ZHBA 2EIJE 4JXTA 2CFUA 3NB2A 3CHOA 4DI4A 2XZDG 3B7SA 4N2SA 1PAQA 2UY1A 3UKUG 2CFZA 3MCXA 4H7XA 3RJVA 2LAIA 4KVMA 1N94A 4KZCA 1NFIE 3TWUA 3DWLG 2XS1A 4I1AA 3C72A 3TWWA 3E34A 3L9TA 1WG0A 4FHKA 3K9IA 1TN8A 4UQZA 4FJYA 3ASDA 1NA0A 5CBNA
chains in the Genus database with same CATH topology
4OAUC 2XZTG 1IXVA 1YYHA 4G8KA 4RLYA 2DVWA 5AQ9A 4QQIA 5CEDB 5AQBA 3AJIA 5AQ7A 4DX7D 2J8SD 1K1BA 2XEHA 3JUEA 3Q9UC 4HRLA 3V2XA 4O60A 4CYMD 4U96D 5EN5D 5HRYA 1N11A 2DZOA 3TWVA 1IKND 4GMRA 1WDYA 4F1PA 3EHQA 1BI7B 3V31A 2AJAA 1K3ZD 1TR4A 4HLLA 2BKKB 5ENOD 3W9FA 4CZ2D 1SVXA 4C48B 3TWSA 4DX6D 1N0QA 3DEPA 4OAVB 1K1AA 1DCQA 2Y1LE 4LNUD 5AARA 5JA4D 1YMPA 2F8XK 3SO8A 1MX2A 5HS0A 1SW6A 2V4HC 3NOGD 1G3NB 5EILA 4HBDA 4DX1A 4DX2A 4DRXE 2L6BA 3ZU7B 1BI8B 5AN8A 4HRMB 3W9GA 2ETCA 2QC9A 1BU9A 1QYMA 3JXJA 1AP7A 3B95A 2KBXA 5EIBE 5ENSD 4HQDA 3TWXA 5EYLA 2VGEA 2A5EA 4HI9A 1OY3D 1OT8A 3V79K 3EU9A 2F37A 4UUCA 3UTMA 4J8YA 5EIDA 4G8LA 5KNHD 3D9HA 2JABA 3AAAC 2XEEA 5AQAA 5BXUA 4ATZD 2Y0BG 4LSZE 4TUMA 3UI2A 4BERA 4U8VD 3KEAA 4K5AB 1IHBA 2QYJA 3J5QB 3NBNB 5ENTD 2ZGGA 3F6QA 4JB8P 5AAOA 3B7BA 4K5BA 3ZNGA 3IXEA 4HRNA 3T9KA 4O1OA 4N5QA 4Z68A 5D66A 3TWQA 2ETAA 5KBAA 5CECB 2V5QC 4U8YD 3HG0D 4J7WA 1MX6A 4BESA 1BLXB 3JXIA 4B93B 3DEOA 4YDYA 1D9SA 2RFMA 3TWRA 3UXGA 4ZFHA 4ZHBA 4F6RD 5HKPA 1MYOA 3EHRA 4O1PA 3HRAA 4GPMA 2XENA 4DUIA 5BXOA 2B0OE 2FO1E 4K5CA 2MYOA 3V30A 2BKGA 2ETBA 5ENRD 1AWCB 2XZDG 5FIOA 1UOHA 3LJNA 4BETA 1A5EA 1N0RA 2DZNA 3Q9NC 4HI8A 3C5RA 4HB5A 4LG6A 2DWZA 5JMND 1BD8A 2KXPC 3NOCD 3T8KA 4BSZB 1NFIE 2HE0A 3TWUA 1MJ0A 4QFVA 4A63B 2ZGDA 3TWWA 1YCSB 5ENPD 3TWTA 5CEAA 5CERB 2F8YA 2RFAA 1WG0A 5KNGA 5EYPF 1MX4A 4HNAD 1DC2A 3ZUVB 4U95D 3J5PA 3V2OA 5FINA 5ENQD 5ITZF 1S70B 2P2CP 5CBOA 4NIKA 4DX5D 3ZKJA 4YDWA 2NYJA 5CBNA 2PNNA 4BEPA 5KWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAU C;  2XZT G;  1IXV A;  1YYH A;  4G8K A;  4RLY A;  2DVW A;  5AQ9 A;  4QQI A;  5CED B;  5AQB A;  3AJI A;  5AQ7 A;  4DX7 D;  2J8S D;  1K1B A;  2XEH A;  3JUE A;  3Q9U C;  4HRL A;  3V2X A;  4O60 A;  4CYM D;  4U96 D;  5EN5 D;  5HRY A;  1N11 A;  2DZO A;  3TWV A;  1IKN D;  4GMR A;  1WDY A;  4F1P A;  3EHQ A;  1BI7 B;  3V31 A;  2AJA A;  1K3Z D;  1TR4 A;  4HLL A;  2BKK B;  5ENO D;  3W9F A;  4CZ2 D;  1SVX A;  4C48 B;  3TWS A;  4DX6 D;  1N0Q A;  3DEP A;  4OAV B;  1K1A A;  1DCQ A;  2Y1L E;  4LNU D;  5AAR A;  5JA4 D;  1YMP A;  2F8X K;  3SO8 A;  1MX2 A;  5HS0 A;  1SW6 A;  2V4H C;  3NOG D;  1G3N B;  5EIL A;  4HBD A;  4DX1 A;  4DX2 A;  4DRX E;  2L6B A;  3ZU7 B;  1BI8 B;  5AN8 A;  4HRM B;  3W9G A;  2ETC A;  2QC9 A;  1BU9 A;  1QYM A;  3JXJ A;  1AP7 A;  3B95 A;  2KBX A;  5EIB E;  5ENS D;  4HQD A;  3TWX A;  5EYL A;  2VGE A;  2A5E A;  4HI9 A;  1OY3 D;  1OT8 A;  3V79 K;  3EU9 A;  2F37 A;  4UUC A;  3UTM A;  4J8Y A;  5EID A;  4G8L A;  5KNH D;  3D9H A;  2JAB A;  3AAA C;  2XEE A;  5AQA A;  5BXU A;  4ATZ D;  2Y0B G;  4LSZ E;  4TUM A;  3UI2 A;  4BER A;  4U8V D;  3KEA A;  4K5A B;  1IHB A;  2QYJ A;  3J5Q B;  3NBN B;  5ENT D;  2ZGG A;  3F6Q A;  4JB8 P;  5AAO A;  3B7B A;  4K5B A;  3ZNG A;  3IXE A;  4HRN A;  3T9K A;  4O1O A;  4N5Q A;  4Z68 A;  5D66 A;  3TWQ A;  2ETA A;  5KBA A;  5CEC B;  2V5Q C;  4U8Y D;  3HG0 D;  4J7W A;  1MX6 A;  4BES A;  1BLX B;  3JXI A;  4B93 B;  3DEO A;  4YDY A;  1D9S A;  2RFM A;  3TWR A;  3UXG A;  4ZFH A;  4ZHB A;  4F6R D;  5HKP A;  1MYO A;  3EHR A;  4O1P A;  3HRA A;  4GPM A;  2XEN A;  4DUI A;  5BXO A;  2B0O E;  2FO1 E;  4K5C A;  2MYO A;  3V30 A;  2BKG A;  2ETB A;  5ENR D;  1AWC B;  2XZD G;  5FIO A;  1UOH A;  3LJN A;  4BET A;  1A5E A;  1N0R A;  2DZN A;  3Q9N C;  4HI8 A;  3C5R A;  4HB5 A;  4LG6 A;  2DWZ A;  5JMN D;  1BD8 A;  2KXP C;  3NOC D;  3T8K A;  4BSZ B;  1NFI E;  2HE0 A;  3TWU A;  1MJ0 A;  4QFV A;  4A63 B;  2ZGD A;  3TWW A;  1YCS B;  5ENP D;  3TWT A;  5CEA A;  5CER B;  2F8Y A;  2RFA A;  1WG0 A;  5KNG A;  5EYP F;  1MX4 A;  4HNA D;  1DC2 A;  3ZUV B;  4U95 D;  3J5P A;  3V2O A;  5FIN A;  5ENQ D;  5ITZ F;  1S70 B;  2P2C P;  5CBO A;  4NIK A;  4DX5 D;  3ZKJ A;  4YDW A;  2NYJ A;  5CBN A;  2PNN A;  4BEP A;  5KWD A; 
#chains in the Genus database with same CATH topology
 1UJJ A;  4RLY A;  5CED B;  2ZIS A;  3BQO A;  4WNG A;  4APF A;  4AP2 A;  4CGV A;  2MHK A;  4U04 A;  2M63 A;  3PDN A;  3APC A;  3U4T A;  4AJW A;  2GRR B;  4J8D A;  3JQ1 A;  4B94 A;  2LSU A;  1O5M A;  4CGW A;  3SFX A;  3GZ1 A;  1FVH A;  3PNL B;  3CVQ A;  3CVV A;  2BF0 X;  3SF4 A;  5BXU A;  2C0L A;  2WXH A;  4FHJ A;  4FAD A;  2L0T B;  4GTV A;  5IY5 E;  1X5B A;  4UWG A;  5E75 A;  2Y3A A;  2YQ8 A;  3CK8 A;  4BES A;  4XKC A;  3ULE G;  4F6R D;  3DSS A;  3EHR A;  3CST A;  5BXO A;  5D0Q D;  5FTP A;  1HX8 A;  3C5R A;  1H0A A;  2Y69 E;  2EIL E;  4K03 A;  3PS6 A;  3FH8 A;  4ANW A;  2Q7F A;  2XCC A;  5E76 A;  2OOE A;  4EZK A;  1SA4 A;  2IY0 C;  2WXQ A;  5G55 A;  2IQC A;  5ITZ F;  5ENQ D;  2L0I A;  4U0U A;  3SBT B;  4PS8 A;  3TAX A;  3BG1 B;  4AVX A;  3VTY A;  1UG3 A;  4HOR A;  1FT1 A;  4O60 A;  3ONK A;  4UWF A;  4L2L A;  4UI9 K;  3FUI A;  5D0O D;  1TR4 A;  3KSL A;  1TNY A;  4C48 B;  2XRZ A;  2H6I A;  4HS2 A;  4OAV B;  3CQC B;  1MX2 A;  3LPZ A;  2V5F A;  3MKQ B;  4HBD A;  2OEW A;  5AN8 A;  5C2Y A;  3UKR G;  1PC2 A;  1AP7 A;  2KBX A;  3ZVV A;  4EZL A;  2VGE A;  3ML9 A;  4L2Y A;  5AIJ A;  1OY3 D;  4GCO A;  3GZS A;  3AG3 E;  5CMW A;  2UWJ G;  1RZ4 A;  2QYJ A;  2J09 A;  2PL2 A;  5EX0 A;  3ZGQ A;  2J08 A;  4JZY A;  3IHV A;  5HQ8 A;  2WXF A;  4J0U A;  3R7R A;  1MX6 A;  3D9I A;  3QK0 A;  4YND A;  4Y6W A;  5BNW A;  3B7U X;  5HKP A;  4J8F A;  4K5C A;  4GZD A;  3IHY A;  3KSQ A;  2DWZ A;  3IBE A;  1BD8 A;  1OCC E;  1HH8 A;  4GA2 A;  3MV2 B;  1KPS B;  2LSV A;  1V55 E;  5CEA A;  5CCM A;  1DC2 A;  3G2S A;  3JQ0 A;  4J6I A;  3OAW A;  2P2C P;  1INZ A;  4N2Q A;  4DX5 D;  4YDW A;  2PNN A;  3Q75 A;  4PS3 A;  4G8K A;  3ASG A;  5HRY A;  5FQ7 A;  2X38 A;  1ELW A;  2AJA A;  3PZ2 A;  1S63 A;  3FTZ A;  2KZT A;  2XGO A;  4WNE A;  4H7Y A;  4JD2 G;  2AWI A;  5J90 A;  1TN6 A;  4UQX A;  3CHR A;  4APO A;  3LVR E;  4FUL A;  2MOW A;  2V4H C;  1JCR A;  3U66 A;  4DI3 A;  4G24 A;  2JEK A;  4UQY A;  2XRY A;  5ENS D;  3EDT B;  2ION A;  3LYA A;  1TNO A;  3I3N A;  4JHR A;  3ZYL A;  3ZFW A;  1ZBP A;  2Y0B G;  4B8A A;  3SY2 A;  2HM8 A;  3WG7 E;  4K5B A;  3FUF A;  3D9M A;  3NZS A;  3EIQ C;  2P9N G;  3FTS A;  3DPY A;  1D9S A;  1JWF A;  4U0S A;  2LXM A;  2PM7 A;  3BUA A;  4Y6C A;  1N0R A;  2XQ0 A;  1E7U A;  1OCO E;  4RSY A;  3I5P A;  3EUV A;  1E7V A;  3CVY A;  2IF4 A;  2XEV A;  5KNG A;  1HG2 A;  4LEU A;  4AM9 A;  5ANR A;  1S70 B;  3RO3 A;  2OND A;  3ZKJ A;  3PEV B;  4MLP A;  3GW4 A;  3Q9U C;  2XEH A;  4I2Z A;  1A17 A;  4ILI A;  1MQS A;  4K0R A;  4GTQ A;  3Q49 B;  1E8Y A;  3G2W A;  3BG0 B;  1JCS A;  2VSY A;  1IQR A;  2R59 A;  3CIA A;  4DX6 D;  5JA4 D;  1YMP A;  2I1K A;  3CKC A;  4LRZ A;  5EIL A;  4U7E B;  1BI8 B;  3PZD A;  4HRM B;  3W9G A;  3PE4 A;  5JJ7 A;  5C1D A;  4GYO A;  1V54 E;  3ZEF A;  3FUL A;  1BPO A;  5FZR A;  4L23 A;  2JAB A;  4LCT A;  4XKB A;  5T4Y A;  3B7R L;  3FUJ A;  2LNI A;  4JEH A;  3NBN B;  2OEV A;  2J49 A;  3BEE A;  4I6G A;  1WAO 1;  2DCP A;  2IFU A;  1H6K A;  3ZIM A;  2V0P A;  3CVU A;  2ETA A;  3SNX A;  3FTY A;  1NI1 A;  3KEZ A;  3PZ4 A;  5EDS A;  1TNZ A;  1H2V C;  3QAQ A;  1SZ9 A;  2PQN A;  2XPZ A;  3PEU B;  3SGH A;  5JJ6 A;  4M3O A;  4EQF A;  1TEZ A;  4LNG A;  1X81 A;  2VQ2 A;  4LG6 A;  3VLF A;  3T8K A;  2VYI A;  4DJA A;  4AOF A;  4YVO A;  1MJ0 A;  3ASH A;  3T5V A;  4HFG A;  1ZB1 A;  4AXH A;  4CRW A;  3DSW A;  1MX4 A;  3L17 A;  4HNA D;  3Q78 A;  4GML A;  4WWN A;  4BEP A;  2J4B A;  3ABK E;  5AQ9 A;  2J8S D;  1S64 A;  3CVL A;  2R03 A;  3S7F A;  3TWV A;  1S0P A;  3O4Z A;  4U63 A;  3R9A B;  4A1S A;  2AXV A;  4M7C A;  5A6C A;  4I6E A;  3PRZ A;  1N0Q A;  2F8X K;  2C2L A;  3CQG B;  3ENE A;  3FH5 A;  1K8K G;  2QC9 A;  4AEZ C;  3ASF A;  2VGX B;  5T8I A;  5HI7 A;  3UT4 A;  2X6F A;  3UT8 A;  4LSZ E;  4TUM A;  3UIN C;  4ANX A;  5FZS A;  1VDY A;  4AIF A;  1HZ4 A;  5BW8 C;  3X2Q E;  4HXI A;  3V30 A;  3RAU A;  4GZC A;  3LJN A;  4BET A;  2DZN A;  1NP7 A;  4CCA A;  1Q2Z A;  3C3R A;  2RG8 A;  3TG4 A;  3CVX A;  3L08 A;  2L9B A;  4G26 A;  4HOU A;  3UMV A;  4KYO B;  4YDO A;  2FEZ A;  3CV0 A;  4QQI A;  1IQU A;  3QB2 A;  4JPS A;  3CR3 A;  3EHM A;  3UX4 A;  5D2M C;  3SHF A;  2OCC E;  3FH7 A;  1IKN D;  2WXJ A;  4OVU A;  3DRA A;  3APF A;  3DXK G;  3MYV A;  1TNB A;  3E4B A;  2GRM A;  2Y1L E;  3S7D A;  3DSV A;  1UJK A;  2JLB A;  2XPI A;  1Y6I A;  3AU4 A;  1BU9 A;  2FBN A;  4B89 A;  3TJP A;  3EJN A;  1O1S A;  2A5E A;  3QNK A;  3FUD A;  2WXL A;  3TXM A;  3CEQ A;  3ASO E;  4CEM A;  2BED A;  1IHB A;  4G23 A;  4HVB A;  4HLE A;  2ZGG A;  3QWP A;  4A3T A;  3GZ2 A;  4L1B A;  3D9N A;  4WAF A;  2AXU A;  3FTU A;  4O1P A;  3KS2 A;  2FO1 E;  2ZXW E;  4MKT A;  2V8S E;  5AJL A;  3ZPJ A;  1D8D A;  2QZA A;  3UT7 A;  3TL5 A;  2J07 A;  3ESL A;  2RKK A;  2Y4U A;  5ANL A;  4ILH B;  4KT6 B;  5FIN A;  3NZU A;  4BWR A;  3HXC A;  1NA3 A;  5CBO A;  2GRL A;  3LKU A;  3URZ A;  3FU0 A;  4GTM A;  3HHM A;  5AQB A;  4DX7 D;  2V4L A;  2R5S A;  5BT1 A;  5DIZ A;  2XCB A;  3UM1 A;  4A3V A;  1HU3 A;  4P29 A;  1DCQ A;  4HOT A;  3IKO B;  1E8Z A;  3B13 A;  4RG6 A;  2WXM A;  3DSU A;  5ENN A;  4A55 A;  2BUG A;  2VSN A;  3DSX A;  3JXJ A;  3ABL E;  4CT4 A;  4UUC A;  4J8Y A;  2WXK A;  2X3M A;  4I17 A;  4EBA G;  5ARF A;  5BV1 A;  4J8E A;  4KZ0 A;  3B7B A;  3ZNG A;  3Q7F A;  4N3B A;  4L7T A;  1Z6T A;  1O1R A;  1P5Q A;  1HF8 A;  3CHP A;  2V5Q C;  4J7W A;  3DEO A;  1LF8 A;  4XI9 A;  3CVP A;  4PUC A;  2XEN A;  2IU1 A;  3MX3 A;  4EBA A;  2BKG A;  4EHM A;  2GGF A;  3Q9N C;  1UN8 A;  1N9A A;  3NOC D;  4HOS A;  3D3M A;  1H6P A;  3HXB A;  2R02 A;  4IN3 B;  3MJW A;  4FLB A;  3FU3 A;  2DIW A;  2WMO A;  4MS6 A;  4OAU C;  2AXZ A;  2DVW A;  2VSO E;  4GZ5 A;  3JUE A;  4GTO A;  4BTA A;  2VTB B;  2EIM E;  1BI7 B;  5H7P A;  3FUK A;  2WXG A;  3U64 A;  2R05 A;  3Q15 A;  5HS0 A;  4PS7 A;  3ULQ A;  4FC8 A;  4TXR A;  3SI5 A;  3LDZ A;  2CHX A;  2FF4 A;  3ZW3 A;  3ABM E;  4HI9 A;  3V79 K;  4E6H A;  4JL0 A;  3D9H A;  3FTW A;  3D9O A;  3UI2 A;  4KBQ A;  2KCK A;  3QWV A;  3MEK A;  4G11 A;  1HXI A;  4XIF A;  2I9C A;  5KBA A;  4FP7 A;  3FUH A;  4U8Y D;  3VLE A;  3CK7 A;  3CVN A;  1BLX B;  3ISM C;  4I43 A;  4R7L A;  5CHE E;  3C3Q A;  2VGY A;  3TWR A;  2WQH A;  1JCQ A;  5A23 A;  4HI8 A;  1TNU A;  4I2W A;  2LO6 A;  4UI9 C;  2GRO B;  3TWT A;  1ZU2 A;  3HVE B;  5FZQ A;  5T3R A;  2WQ7 A;  5LFA A;  4U95 D;  3FEY A;  4XX5 A;  4WWO A;  2DYR E;  3HXE A;  1UN9 A;  3TGO A;  3EHN A;  3DST A;  2WM9 A;  1YYH A;  3QKY A;  1JPL A;  1K1B A;  1N11 A;  2RD0 A;  2OVB A;  3EHQ A;  4ACK A;  4CZ2 D;  4DLQ A;  1K1A A;  2R17 C;  3LEW A;  3MKQ A;  2VJ8 A;  5KJM A;  4HOQ A;  3DBS A;  2L6J A;  2B6C A;  4NQ0 A;  4N5C A;  4B8C B;  4UWK A;  3B95 A;  5CCL A;  3Q79 A;  1HS6 A;  5FJY A;  2P9S G;  3SBS A;  3ZHE B;  3EU9 A;  2EIN E;  3FHE A;  1QZ2 A;  3I4R B;  3CSF A;  5AQA A;  1LD8 A;  3ZN3 A;  1D8E A;  4C0M A;  3AS5 A;  4G2V A;  4URK A;  3D9P A;  4NAC A;  4GAA A;  3T9K A;  3PZ1 A;  3LJ3 A;  2EQX A;  3ML8 A;  4GB9 A;  3ZYM A;  2WMN A;  4N39 A;  2CHZ A;  3JUI A;  3C3O A;  5LOZ A;  3UIO C;  2B0O E;  1OWO A;  4ME2 A;  1OWL A;  1E8X A;  1TYQ G;  3JCK C;  1WM5 A;  3AG2 E;  3E37 A;  3FDH A;  3IEG A;  4D10 C;  5ARG A;  1QQE A;  4OVV A;  4BSZ B;  2VTB A;  2ZGD A;  1YCS B;  4IYP A;  4JA9 A;  2F8Y A;  1U3C A;  3UQ3 A;  1L5J A;  2WPV A;  3RRN B;  4E85 A;  1HO8 A;  3CGH A;  3SQV A;  1DCE A;  2XZT G;  2BTD A;  2A5U A;  3T5X A;  3AJI A;  2X6J A;  5LCW C;  5LP0 A;  5EN5 D;  1NL4 A;  4GA1 A;  3UPV A;  3DXM G;  3RO2 A;  4IRU A;  3DEP A;  2OVF A;  4F3V A;  1HFA A;  4BT9 A;  3SO8 A;  1G3N B;  3MZL B;  1LTX A;  3FUM A;  5G05 C;  4RG9 A;  3CKB A;  4U07 A;  3OTN A;  2YHC A;  4XI0 A;  4MBG A;  3HXD A;  1OWN A;  3EIJ A;  3RU0 A;  2X6I A;  1UW4 B;  2IO2 C;  3L6A A;  2KCV A;  5EID A;  4PDX A;  4G8L A;  3FEX A;  3VTX A;  4GYW A;  4WNF A;  1H19 A;  3KEA A;  3MGB A;  1U3D A;  5B3S E;  4XE0 A;  3MA5 A;  3NAW A;  3PNT B;  5CEC B;  3HVE A;  2WXO A;  4ZFH A;  4YDE A;  3E30 A;  4DUI A;  3LXU X;  4C0E A;  5LCW J;  4OYS A;  3JYS A;  2CG2 A;  3Q4A B;  4L9P A;  4I6J A;  4W9R A;  4F7A A;  3B7T A;  4QFV A;  3S7B A;  5CER B;  4GPK A;  3J5P A;  3PRE A;  5G05 J;  4CDM A;  1FVF A;  1SZA A;  3CLJ A;  4GA0 A;  2E2E A;  2AW6 A;  3ZYQ A;  4GMR A;  3RSE G;  3ZHE A;  1WY6 A;  4DLO A;  4BX8 A;  1N4Q A;  2YNQ A;  1B89 A;  3ZRH A;  5BV0 A;  1W3B A;  4LNU D;  2Y4T A;  3L13 A;  4J8S A;  3OXG A;  3UM3 A;  4DX2 A;  3MV3 B;  3R9M A;  1N95 A;  1QYM A;  2XPY A;  1EPU A;  3TWX A;  3QWW A;  5DBK A;  2DBA A;  4Q94 A;  2WXP A;  2IJG X;  1RW2 A;  2X6H A;  4KVO A;  2WB2 A;  3RK6 A;  2P9I G;  3D9K A;  1QNF A;  4K5A B;  1EYH A;  2YIN A;  3IXE A;  3HXF A;  4Z68 A;  2P9U G;  3TWQ A;  3LVQ E;  2IOS A;  2P9K G;  1XNF A;  4GPM A;  2MYO A;  2ETB A;  5A7D B;  3OXF A;  1QBQ A;  4DPR A;  4FA6 A;  5CRV A;  1N4S A;  4O6F A;  5AJD A;  3ZUV B;  3V2O A;  4GTS A;  1N4R A;  2P9L G;  1EF1 C;  2PQR A;  4WUY A;  2WXR A;  5KWD A;  4GYY A;  1IXV A;  1IYG A;  5FT9 A;  2KC7 A;  2XGM A;  4N3A A;  1H6O A;  4U96 D;  4CT0 A;  4CDN A;  4F1P A;  5ENO D;  2KZT B;  1SVX A;  4NUR A;  1KZP A;  4XZ4 A;  2I2O A;  1TJC A;  3MKR A;  1KT1 A;  2MRI A;  2ETC A;  3HIZ A;  3PZ3 A;  2VSX E;  4HQD A;  5CMY A;  2VGX A;  5FQ6 A;  1Z3X A;  2J9Q A;  3AAA C;  3G2V A;  4CDR A;  4ATZ D;  3AS4 A;  4U8V D;  4LNB A;  5CRU A;  3VLD A;  2IEJ A;  4JB8 P;  5ENT D;  1H2T C;  4F53 A;  4LER A;  4GU5 A;  4ANV A;  4N5Q A;  3S7J A;  5KJL A;  3PUK A;  3G2T A;  4GTP A;  2XGS A;  2FO7 A;  2RFM A;  5EKQ D;  2H6G A;  4RVB A;  2FUL A;  1U2V G;  1JUQ A;  4XEI G;  3U3W A;  3QAR A;  1UOH A;  3LS8 A;  1TJF A;  4ANU A;  3S2A A;  4I1O B;  3TXN A;  4JHK A;  4GCN A;  2KXP C;  1O1T A;  1N4P A;  3PH0 C;  4JEU A;  2NXP A;  1SQM A;  4U8H A;  3HDX A;  4JC8 A;  4LUN U;  2WXI A;  3QC1 A;  4WWP A;  5FQ8 A;  5JHB A;  3V2X A;  3U9W A;  1XGW A;  5BUZ A;  4I9C A;  2DZO A;  5B1A E;  3ULY A;  1WDY A;  1SA5 A;  1E90 A;  4HLL A;  3PVL A;  3GYZ A;  3D9L A;  3EU5 A;  4V3I A;  5AAR A;  3FTX A;  4JW1 A;  5LX8 A;  2NC9 A;  3RRM B;  2ZU6 B;  4MRU A;  3ONL A;  5EYL A;  2A4Z A;  4X8Q A;  5FQ4 A;  5M72 A;  1OT8 A;  4B0Z A;  3ESK A;  2F37 A;  4GTR A;  3UTM A;  2X6K A;  4ILG A;  1JWG A;  4GTT A;  5KNH D;  2AVP A;  4NRH B;  3SFZ A;  3F6Q A;  5AAO A;  3L22 A;  2CG3 A;  2DYS E;  4HRN A;  3LY9 A;  4U0Z A;  5B1B E;  5D66 A;  4ABN A;  2WQ6 A;  4JVS A;  1MYO A;  1FT2 A;  3AG1 E;  1DVP A;  5FIO A;  1A5E A;  4AY5 A;  1OUV A;  4N3C A;  2XHE A;  3CHQ A;  5BPP A;  2HE0 A;  3WXX A;  2YHE A;  4A63 B;  3R7Q A;  2P9P G;  1E96 B;  5J08 A;  2RFA A;  4BX9 A;  5EYP F;  3PE3 A;  1OWM A;  3E32 A;  4KMO A;  4DK5 A;  3SFY A;  5AQ7 A;  4HRL A;  2GW1 A;  2I1J A;  3CK9 A;  4JA7 A;  3CHM A;  3RIB A;  3NQP A;  3NF1 A;  1OCZ E;  1KT0 A;  3IV0 A;  1DNP A;  3LY7 A;  2J4D A;  1OXJ A;  3W9F A;  4YVQ C;  1NZN A;  3TWS A;  5G04 C;  2IO3 C;  4BT8 A;  4TV3 A;  3G2U A;  3FUE A;  1SW6 A;  4DX1 A;  3L54 A;  4BFR A;  4KXK B;  5JHA A;  4Q96 A;  2HR2 A;  1Z5S C;  4I9E A;  4TXP A;  3T8M A;  5JJT A;  5G2N A;  4TXQ A;  2E0I A;  2XEE A;  4GMJ A;  2GRP B;  2HO1 A;  1ELR A;  2PZI A;  4G25 A;  4TRQ A;  2FI7 A;  5FWQ A;  3SD5 A;  4EZJ A;  2KAT A;  2P58 C;  3HG0 D;  4F1S A;  2C0M A;  2QFC A;  3JXI A;  4C9B B;  4YDY A;  1TN7 A;  3FTV A;  3UXG A;  3L16 A;  4AV7 A;  3HRA A;  3ZXS A;  4ATG A;  1AWC B;  3UIP C;  4UI9 J;  3QDN A;  5KJN A;  3CHS A;  5G04 J;  5ENP D;  3UM0 A;  1FCH A;  3Q5M A;  2CHW A;  2HYZ A;  3LCA A;  2NYJ A;  2ZIR A;  2KM4 A;  4A1G A;  1Z3Y A;  2UY1 B;  1H2U A;  1KZO A;  3FY4 A;  2IOL A;  3V31 A;  1K3Z D;  2H6H A;  3Q7A A;  3UUX A;  4RQI A;  3SZ7 A;  4IUL A;  2BKK B;  3FWV A;  1E8W A;  4AY6 A;  2R2L A;  5KCM A;  2QY7 A;  3NOG D;  1LD7 A;  4UWH A;  2L6B A;  3FFL A;  3ZU7 B;  3HYM B;  4FLH A;  4BSX A;  3KD7 A;  3E33 A;  2EIK E;  3PUJ A;  5EIB E;  3N71 A;  1OCR E;  2WXN A;  3LY8 A;  4FJZ A;  4JHJ A;  2GRN B;  4EPZ A;  5KJK A;  1N52 A;  2WVI A;  3QOU A;  4Q69 A;  3J5Q B;  1HG5 A;  3DPD A;  1KLX A;  4ACL A;  3CVW A;  3BU8 A;  2GRQ B;  4O1O A;  2XS8 A;  3RKV A;  3AG4 E;  1MHQ A;  4UWL A;  2LUH A;  3RRU A;  4PH4 B;  2KCL A;  3ZYK A;  5ENR D;  3C98 A;  1N54 A;  4HB5 A;  1HE8 A;  5JMN D;  3Q73 A;  4FU3 A;  3APD A;  2NSZ A;  2LXL A;  3FU6 A;  4BY6 A;  2ILR A;  2QYU A;  3O48 A;  4TUU A;  4NIK A;  1PY1 A;  3AU5 A;  1FPP A;  2LAH A;  1IHG A;  1GW6 A;  2F0Y A;  3ASN E;  1OWP A;  4BTB A;  4GZ6 A;  4CYM D;  1MZC A;  1EDU A;  5AYW D;  1YA0 A;  3TG5 A;  4WND A;  5EX3 A;  2PM6 A;  4EEC A;  2H6F A;  1ELK A;  3FP3 A;  4G1T A;  3FU5 A;  4DRX E;  3P1U A;  3Q47 B;  5AEN A;  3P2B A;  3AS8 A;  3QJZ A;  3D9J A;  3I4G A;  1Y8M A;  2OV8 A;  2I6H A;  3ZXP A;  4BER A;  3UM2 A;  3OXL A;  3FUN A;  3KAE A;  3L82 A;  4GZ3 A;  4B93 B;  4I1M A;  4ZHB A;  2EIJ E;  4JXT A;  2CFU A;  3NB2 A;  3CHO A;  4DI4 A;  2XZD G;  3B7S A;  4N2S A;  1PAQ A;  2UY1 A;  3UKU G;  2CFZ A;  3MCX A;  4H7X A;  3RJV A;  2LAI A;  4KVM A;  1N94 A;  4KZC A;  1NFI E;  3TWU A;  3DWL G;  2XS1 A;  4I1A A;  3C72 A;  3TWW A;  3E34 A;  3L9T A;  1WG0 A;  4FHK A;  3K9I A;  1TN8 A;  4UQZ A;  4FJY A;  3ASD A;  1NA0 A;  5CBN A; 
#chains in the Genus database with same CATH homology
 4OAU C;  2XZT G;  1IXV A;  1YYH A;  4G8K A;  4RLY A;  2DVW A;  5AQ9 A;  4QQI A;  5CED B;  5AQB A;  3AJI A;  5AQ7 A;  4DX7 D;  2J8S D;  1K1B A;  2XEH A;  3JUE A;  3Q9U C;  4HRL A;  3V2X A;  4O60 A;  4CYM D;  4U96 D;  5EN5 D;  5HRY A;  1N11 A;  2DZO A;  3TWV A;  1IKN D;  4GMR A;  1WDY A;  4F1P A;  3EHQ A;  1BI7 B;  3V31 A;  2AJA A;  1K3Z D;  1TR4 A;  4HLL A;  2BKK B;  5ENO D;  3W9F A;  4CZ2 D;  1SVX A;  4C48 B;  3TWS A;  4DX6 D;  1N0Q A;  3DEP A;  4OAV B;  1K1A A;  1DCQ A;  2Y1L E;  4LNU D;  5AAR A;  5JA4 D;  1YMP A;  2F8X K;  3SO8 A;  1MX2 A;  5HS0 A;  1SW6 A;  2V4H C;  3NOG D;  1G3N B;  5EIL A;  4HBD A;  4DX1 A;  4DX2 A;  4DRX E;  2L6B A;  3ZU7 B;  1BI8 B;  5AN8 A;  4HRM B;  3W9G A;  2ETC A;  2QC9 A;  1BU9 A;  1QYM A;  3JXJ A;  1AP7 A;  3B95 A;  2KBX A;  5EIB E;  5ENS D;  4HQD A;  3TWX A;  5EYL A;  2VGE A;  2A5E A;  4HI9 A;  1OY3 D;  1OT8 A;  3V79 K;  3EU9 A;  2F37 A;  4UUC A;  3UTM A;  4J8Y A;  5EID A;  4G8L A;  5KNH D;  3D9H A;  2JAB A;  3AAA C;  2XEE A;  5AQA A;  5BXU A;  4ATZ D;  2Y0B G;  4LSZ E;  4TUM A;  3UI2 A;  4BER A;  4U8V D;  3KEA A;  4K5A B;  1IHB A;  2QYJ A;  3J5Q B;  3NBN B;  5ENT D;  2ZGG A;  3F6Q A;  4JB8 P;  5AAO A;  3B7B A;  4K5B A;  3ZNG A;  3IXE A;  4HRN A;  3T9K A;  4O1O A;  4N5Q A;  4Z68 A;  5D66 A;  3TWQ A;  2ETA A;  5KBA A;  5CEC B;  2V5Q C;  4U8Y D;  3HG0 D;  4J7W A;  1MX6 A;  4BES A;  1BLX B;  3JXI A;  4B93 B;  3DEO A;  4YDY A;  1D9S A;  2RFM A;  3TWR A;  3UXG A;  4ZFH A;  4ZHB A;  4F6R D;  5HKP A;  1MYO A;  3EHR A;  4O1P A;  3HRA A;  4GPM A;  2XEN A;  4DUI A;  5BXO A;  2B0O E;  2FO1 E;  4K5C A;  2MYO A;  3V30 A;  2BKG A;  2ETB A;  5ENR D;  1AWC B;  2XZD G;  5FIO A;  1UOH A;  3LJN A;  4BET A;  1A5E A;  1N0R A;  2DZN A;  3Q9N C;  4HI8 A;  3C5R A;  4HB5 A;  4LG6 A;  2DWZ A;  5JMN D;  1BD8 A;  2KXP C;  3NOC D;  3T8K A;  4BSZ B;  1NFI E;  2HE0 A;  3TWU A;  1MJ0 A;  4QFV A;  4A63 B;  2ZGD A;  3TWW A;  1YCS B;  5ENP D;  3TWT A;  5CEA A;  5CER B;  2F8Y A;  2RFA A;  1WG0 A;  5KNG A;  5EYP F;  1MX4 A;  4HNA D;  1DC2 A;  3ZUV B;  4U95 D;  3J5P A;  3V2O A;  5FIN A;  5ENQ D;  5ITZ F;  1S70 B;  2P2C P;  5CBO A;  4NIK A;  4DX5 D;  3ZKJ A;  4YDW A;  2NYJ A;  5CBN A;  2PNN A;  4BEP A;  5KWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...