2UWJG

Structure of the heterotrimeric complex which regulates type iii secretion needle formation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
DTSLIRELAELALAGSGQHCHEEALCIAEWLERLGQDEAARLIRISSLANQGRYQEALAFAHGNPWPALEPWFALCEWHLGLGAALDRRLAGLGGSSDPALADFAAGMRAQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords TYPE III EXPORT PROTEIN PSCE
publication title Structure of the heterotrimeric complex that regulates type III secretion needle formation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 44
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF09477 Type_III_YscG Bacterial type II secretion system chaperone protein (type_III_yscG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2uwjG00
4J0UA 2V5FA 5LCWC 3RIBA 3Q4AB 4N39A 4BWRA 1KT0A 4UI9C 3R9AB 4I2ZA 3QKYA 3ZN3A 5FZSA 4RG9A 3K9IA 4G1TA 1KT1A 4G2VA 3CVPA 4BTBA 1WAO1 3MV2B 3ZFWA 2KC7A 3UPVA 4U0ZA 2WPVA 3CVLA 3S7DA 1IYGA 5JJ7A 2FF4A 3UUXA 1XNFA 4AM9A 3Q5MA 3GW4A 4N3AA 4AY5A 1B89A 3CVNA 3WXXA 3ULQA 3U4TA 1ZBPA 1E96B 2UY1A 5CCMA 1NA0A 4WNFA 2FI7A 4N2SA 5BNWA 4GCOA 3URZA 3SZ7A 2IF4A 4U04A 3Q49B 4N2QA 5D0OD 1HH8A 3RKVA 3O48A 2XGOA 3OXFA 5FZRA 5JJ6A 5G04J 1PC2A 3VTXA 2OOEA 2DBAA 3E4BA 2VGXB 3LYAA 4W9RA 4A1SA 4UQXA 3ZPJA 4F3VA 4JHRA 3TG5A 2GW1A 3RO3A 4LEUA 5C1DA 4HOQA 1YA0A 4JL0A 3CK8A 2Y4TA 4JA7A 3GYZA 5DIZA 2PL2A 3CV0A 3IEGA 5HQ8A 2KCVA 2E2EA 4WUYA 2UWJG 5BT1A 4N5CA 2XGMA 3LPZA 4GYWA 5A7DB 2NC9A 3BEEA 3CKCA 5HI7A 4KXKB 3MV3B 1WM5A 5DBKA 4I9CA 3VTYA 2C2LA 4WNGA 3LY8A 3MKRA 4BT9A 3S7FA 3MA5A 5G05J 3AS4A 1QZ2A 4GCNA 3JYSA 5EX3A 5FZQA 5FT9A 3CK9A 3ASHA 1ZU2A 1Y8MA 3TGOA 4GZ3A 3QWPA 3S7JA 5KJLA 5KJMA 2FEZA 1ELWA 1QQEA 4UI9K 5A6CA 2PQRA 4J8DA 3ZHEB 5AYWD 1NA3A 2R5SA 4XI0A 3ASFA 4J8FA 4G23A 3TG4A 3LKUA 4I1AA 4WNDA 2IFUA 1HZ4A 4B94A 3OXLA 4BT8A 5ARGA 3KD7A 4HOUA 3SF4A 4KBQA 3AS8A 4EQFA 5LCWJ 3ASDA 5KJNA 3CEQA 3GZ1A 4IN3B 2J9QA 4Y6WA 4UI9J 5FJYA 3UQ3A 3LY9A 1NZNA 4N3BA 5EX0A 4GZ5A 3GZ2A 3FFLA 3QDNA 4JA9A 1A17A 2AVPA 5BW8C 4G24A 3RU0A 1FCHA 3CK7A 2L6JA 4O6FA 4BTAA 2UY1B 4KYOB 4G26A 3RO2A 3QWVA 5EKQD 2VSNA 3PDNA 3PE3A 2WQHA 3KAEA 2YQ8A 2I6HA 4NQ0A 2HR2A 2XEVA 2VGYA 3TAXA 2LNIA 4HOTA 2C0LA 2ONDA 4I17A 4GA2A 1IHGA 4GYYA 4HORA 3CVQA 4YVQC 2Y4UA 3CKBA 3LCAA 3ZHEA 5ARFA 2MHKA 4CGWA 5G04C 4YNDA 2FBNA 3KS2A 2QFCA 4ABNA 2XCBA 3HYMB 2LSVA 4H7XA 4UQZA 4G25A 5JJTA 1W3BA 4I9EA 4GYOA 4CDRA 3FP3A 4GPKA 4I2WA 2FO7A 4NRHB 4XI9A 1TJCA 4U0SA 2VGXA 2JLBA 3OXGA 4UQYA 3ASGA 3ZGQA 4WNEA 2P58C 2BUGA 3FWVA 3S7BA 2HYZA 4N3CA 4GA1A 4APOA 4CGVA 4ME2A 2C0MA 2PZIA 2XCCA 4GA0A 5KJKA 1HXIA 1OUVA 2KATA 4U07A 3RJVA 1P5QA 3NF1A 5CHEE 2VQ2A 3Q15A 2VYIA 4AIFA 4H7YA 4U0UA 4J8EA 3QOUA 5G05C 2YHCA 4AY6A 4Y6CA 4HOSA 4XIFA 1ELRA 3U3WA 2KCLA 2KCKA 2LSUA 2XGSA 4GZ6A 2PQNA 1KLXA 3PE4A 3AS5A 3N71A 3QWWA 4YVOA 2XPIA 5CCLA 4RG6A 3ESKA 2VSYA 3LY7A 3EDTB 2Q7FA 3Q47B 3MEKA 5FTPA 2HO1A 5D0QD 5M72A
chains in the Genus database with same CATH superfamily
3TWSA 4GTQA 2I1KA 3UIPC 2B0OE 3PRZA 3ML8A 5LCWC 3ZYQA 2IU1A 2LXLA 4DX1A 4ZHBA 4XE0A 3R9MA 3R9AB 4CT4A 1TN7A 4BFRA 2EILE 4RG9A 4G1TA 4D10C 2F8XK 2IOSA 2P9IG 2AXUA 2WXKA 3ZFWA 3AJIA 3L17A 2ILRA 2VTBA 3DBSA 3FH5A 5JJ7A 2FF4A 4ATZD 5BXUA 3L54A 2F37A 1FVFA 2IONA 1XNFA 4EBAA 4AM9A 2DCPA 4FHKA 3PEUB 5LFAA 4N3AA 1ZBPA 1E8ZA 5CEAA 3J5QB 2DZOA 3HXCA 2EQXA 2FI7A 4KVOA 3C3RA 3T5VA 3PUKA 2R2LA 4HB5A 3HVEA 2J08A 4BX8A 5FZRA 4YDEA 4I6GA 3VTXA 1NP7A 5AQAA 2FULA 1FVHA 3SI5A 2X6IA 3ZPJA 5FQ4A 3B7SA 3ZW3A 4JHRA 2GW1A 2XEEA 5FQ6A 4C48B 3D9IA 5EILA 2P9PG 1TN8A 2LXMA 5KNHD 2LO6A 2PL2A 3Q7FA 3CGHA 3ZXPA 3APDA 2R02A 3LEWA 3I4RB 2UWJG 2Y3AA 4F7AA 3FTSA 3B7TA 4I1OB 3IV0A 4G8LA 2LAIA 1MJ0A 3CSFA 4GYWA 4U63A 3BEEA 3CKCA 1JPLA 3NAWA 3FUJA 5AN8A 3PZ1A 3LY8A 4PS7A 3S7FA 3MA5A 1WG0A 4FLBA 1QZ2A 4Q69A 4K5BA 3AAAC 4ILHB 2WXIA 2WXOA 3DSUA 3UX4A 4BEPA 4AV7A 4GMJA 1NL4A 5EX3A 5FZQA 3R7QA 3UM0A 3SNXA 3D9HA 3D3MA 5G2NA 2M63A 2A4ZA 4A1GA 1KZOA 3B95A 3C3OA 5ENOD 4BERA 3IBEA 3S7JA 5KJLA 3LJ3A 4UWGA 1ELWA 2F0YA 5A6CA 4J8DA 2QY7A 3UINC 1OWOA 3ASFA 4J8FA 2EIME 3DEPA 5EIDA 3TG4A 2WXRA 3LKUA 5H7PA 2RKKA 3ZYLA 3L13A 1OY3D 1OWLA 4B0ZA 3FEXA 3CEQA 3GZ1A 2GRNB 3SFZA 3FUFA 3HIZA 5FJYA 3L16A 2X6HA 4RSYA 3FFLA 5FQ8A 2XZTG 3T5XA 4JA9A 2WXHA 4B93B 5AAOA 2I2OA 4OYSA 2BF0X 4ACKA 3NOGD 4DUIA 3AG4E 2UY1B 3RO2A 3CHSA 3JXJA 4OAUC 4L23A 1TYQG 4J6IA 4U95D 2AXZA 4CEMA 2CFUA 1MHQA 3I5PA 1DC2A 5AJDA 5ENTD 5B1AE 3FU6A 4DX5D 2LNIA 4NIKA 2OVBA 2C0LA 2ONDA 5BXOA 4GA2A 4DX7D 4GYYA 5JA4D 5KWDA 3ZXSA 2WQ6A 3UM3A 4HRLA 1IQUA 4FULA 2XENA 2J09A 3FUKA 1TNZA 2MHKA 2DVWA 2V4LA 2I9CA 3QAQA 3FUNA 3C5RA 1PY1A 3T9KA 2QFCA 4ABNA 2VSOE 3AG1E 2WXPA 3QK0A 2P9UG 4HVBA 2LSVA 4LG6A 4H7XA 3L08A 1G3NB 2P9NG 2WM9A 3MCXA 1D8EA 4Z68A 2FO7A 5JHBA 2JLBA 4E6HA 3D9PA 5ENSD 4L9PA 1K1AA 2B6CA 2BUGA 3FWVA 3EHRA 3RRNB 4CGVA 4GA1A 2XCCA 2PZIA 3V2OA 4CDMA 3ISMC 4PDXA 4UWFA 3CSTA 1LD7A 1P5QA 2J4DA 3IHYA 4U8HA 3Q15A 1TNBA 2VYIA 3QB2A 4U0UA 5G05C 4PUCA 4K5AB 1BD8A 4ILIA 1BI8B 3ZEFA 4AY6A 1YMPA 2KZTA 2KM4A 3FY4A 4IRUA 5KBAA 1HG5A 2LSUA 2XGSA 4KMOA 4TRQA 4R7LA 2PQNA 3PE4A 1Z5SC 3N71A 4XX5A 2GRMA 4RG6A 3DXKG 2VSYA 3MX3A 3JQ1A 4Q94A 3BUAA 3Q79A 4AXHA 1K3ZD 3TJPA 3Q47B 5HKPA 3MEKA 5FTPA 2HO1A 3VLEA 5D0QD 2OCCE 2GRLA 1LF8A 2WXFA 2ETCA 3UT8A 1OWNA 4GMLA 4DJAA 5D66A 3Q4AB 1BPOA 4IYPA 3CLJA 4UI9C 2WMOA 3QKYA 4FC8A 2IEJA 2VSXE 4JHKA 3K9IA 3L9TA 2DIWA 2WMNA 1HU3A 1KT1A 4HFGA 3CVPA 4G8KA 1U3CA 3E37A 3G2VA 3RAUA 2KC7A 2WB2A 1E7UA 4U0ZA 1Y6IA 4QFVA 3S7DA 2QC9A 2XPYA 1IXVA 1SA5A 1XGWA 1OCZE 1INZA 2IO2C 3Q75A 4L7TA 3APFA 3GW4A 4K0RA 2IO3C 1B89A 3U4TA 1E96B 3PEVB 1MX4A 5CCMA 1NA0A 4CDNA 3CHRA 2ZISA 1YCSB 3URZA 3SZ7A 4U04A 3Q49B 3SBTB 4HNAD 3RKVA 2R17C 2XGOA 5JJ6A 3DSVA 5EYPF 2OOEA 2JEKA 2VGXB 4A1SA 4UQXA 1Z3YA 5ENNA 2H6FA 3TWRA 1QBQA 5E76A 1DVPA 4LEUA 1N4QA 5C1DA 5CBNA 5CEDB 4HOQA 4EZKA 1OCRE 1GW6A 4JA7A 5DIZA 4B89A 4GAAA 2CFZA 3CV0A 2J07A 2A5UA 3EHNA 4BESA 2KCVA 4WUYA 1TNUA 1D9SA 3EU5A 2XRZA 4FADA 3BQOA 4EHMA 3MKQB 3E33A 2BEDA 3MGBA 5FWQA 3CVUA 1Q2ZA 5A7DB 4KXKB 2CHWA 3VTYA 5B1BE 1JWGA 4ANUA 4Q96A 4I43A 1N9AA 1X5BA 3JYSA 2GGFA 3ONLA 1H2UA 2VGEA 4TUUA 3W9FA 3U66A 5FT9A 2AJAA 3CK9A 5LX8A 4HI8A 3FTZA 5AQ9A 1FT2A 1NFIE 4A55A 3ZRHA 2V5QC 4TXPA 5FINA 5KJMA 2GRPB 5T3RA 4C0EA 2FEZA 3LXUX 3CVYA 1EYHA 3ZHEB 4DX6D 3PUJA 2R5SA 4XI0A 3PZ3A 4P29A 2IFUA 3SBSA 3SFXA 3KD7A 3KEZA 1SZ9A 3AS8A 2AXVA 3C72A 3BG1B 2J9QA 3RRUA 4NURA 3HXEA 3LY9A 1NZNA 4KZ0A 4OAVB 1HFAA 4GZ5A 3GZ2A 3I3NA 3JCKC 3FUMA 4U8YD 4KT6B 3QDNA 2GRRB 3ABME 3ASOE 4C0MA 3FDHA 4G24A 1SZAA 1WDYA 4HQDA 2A5EA 3FHEA 1H2TC 4AOFA 2P9SG 3EHQA 3BG0B 3HDXA 3VLFA 3FUDA 3PDNA 2IJGX 2J49A 3ML9A 3T8MA 5JHAA 3KAEA 1JWFA 1KPSB 2LAHA 3DPYA 3UI2A 3CHQA 4WAFA 4JEUA 2HR2A 3U64A 4O1OA 1JCQA 1ELKA 3TAXA 4MS6A 1SW6A 5CBOA 2WQ7A 4I17A 3DWLG 3UT7A 3L22A 3CVQA 2WXJA 3OAWA 3APCA 3ZHEA 4XEIG 4GMRA 3OTNA 4BSXA 4CGWA 5EYLA 4LUNU 3VLDA 2WXLA 3HYMB 3NB2A 3PZDA 4DPRA 4EZJA 3P1UA 3RK6A 4I9EA 3UKRG 3ENEA 3ZYMA 4GYOA 4A3TA 3EUVA 3FP3A 2KBXA 3Q9UC 4UUCA 2L0IA 1N95A 3OXGA 2BKKB 4LERA 1OCOE 4YDWA 3HXBA 4FA6A 2HYZA 4N3CA 4BY6A 1YYHA 3NQPA 1K8KG 3U9WA 3HHMA 2DYRE 1HXIA 1OUVA 3NZSA 1WY6A 3V31A 2XPZA 3SD5A 1X81A 3J5PA 3NF1A 4KZCA 2GRQB 2Y1LE 3D9LA 3NZUA 3PZ2A 4AIFA 5BV0A 4O1PA 4X8QA 4Y6CA 4HXIA 1OT8A 3ZU7B 4XIFA 3U3WA 3G2UA 1UG3A 2ZGDA 1N52A 4FHJA 4UWKA 3AS5A 1OXJA 4BX9A 4LNGA 2XPIA 3UIOC 3ESKA 1Z3XA 2P9LG 4GTRA 4GTSA 5D2MC 1BU9A 2ZU6B 1FT1A 1EPUA 1N4SA 3SY2A 4M7CA 3NBNB 4TV3A 4GU5A 3PZ4A 2V8SE 2E0IA 4GTOA 3UKUG 2R05A 4ANXA 4N39A 1KT0A 4I2ZA 5BUZA 1N4PA 2DZNA 3ESLA 3FU0A 2X3MA 4RLYA 4BTBA 3D9MA 3MV2B 3Q78A 3CHPA 3FTWA 3IKOB 1KZPA 1N0RA 3CHOA 1TN6A 3UUXA 4JD2G 3JUIA 1E7VA 4JC8A 4AY5A 3L6AA 5T8IA 3ULQA 3TWUA 4OVVA 1TEZA 2UY1A 3O4ZA 4PS3A 2RFAA 4WNFA 1DCQA 2H6GA 3JQ0A 3D9OA 2J8SD 5BNWA 4DLOA 4GCOA 2MRIA 3C3QA 5J08A 4HI9A 4GPMA 2IF4A 5ENQD 5D0OD 4DX2A 5CMWA 2Y0BG 3OXFA 3PNLB 1PC2A 5G04J 5CMYA 2DBAA 3TWXA 5FQ7A 3SQVA 3TL5A 4W9RA 4J8YA 4JPSA 1NI1A 2H6HA 3EJNA 4L2YA 5C2YA 3FU5A 2XZDG 4GTTA 3RO3A 1E8WA 1OCCE 2R59A 3CK8A 3LVRE 5CRUA 1S70B 3PNTB 4B8AA 2VJ8A 1HO8A 1HS6A 4QQIA 2GROB 3FTYA 1N0QA 2E2EA 1D8DA 1MQSA 3CHMA 2X6JA 2XGMA 2FO1E 4WWPA 3FEYA 2ZGGA 4F1SA 2NC9A 1WM5A 5DBKA 1UW4B 4BT9A 2AWIA 3AS4A 1E90A 4PH4B 2CHZA 4HLEA 3FTUA 3FUEA 4RQIA 4ILGA 4EZLA 3PS6A 4ZFHA 3UTMA 3CQCB 3G2TA 4JZYA 1ZU2A 2MOWA 4I6EA 3RRMB 1SVXA 1AWCB 3E32A 4GZ3A 1E8XA 2DYSE 1QQEA 2PQRA 2XS8A 1NA3A 5AYWD 2OV8A 4HRMB 5CERB 5JMND 1HZ4A 2V0PA 4B94A 3EIQC 3ONKA 3OXLA 4UWHA 2ZXWE 1O1TA 1H2VC 5LCWJ 3ASDA 5KJNA 1AP7A 4IN3B 4Y6WA 4L2LA 2IY0C 2WXNA 2VTBB 1LTXA 5EX0A 4TUMA 3WG7E 3SHFA 1VDYA 1BI7B 4GTPA 4NACA 3CVVA 3ABLE 1TNOA 1O1RA 3SGHA 3HG0D 5BW8C 3CK7A 3CVWA 2EIJE 3B7BA 3ZVVA 4KYOB 4G26A 3TXNA 5ENPD 2PM6A 1N94A 1RZ4A 4AEZC 2VSNA 5G55A 3PE3A 5EN5D 4HLLA 2QZAA 5AQ7A 2I6HA 3D9KA 4WWOA 3HVEB 4NQ0A 4MBGA 5ANLA 4N5QA 2XEVA 5LP0A 2VGYA 2AW6A 4HOTA 2X38A 1IHGA 3I4GA 4HORA 4ANWA 4JXTA 4XZ4A 2NYJA 2L0TB 1QYMA 3QC1A 4YVQC 3CKBA 3LCAA 5ARFA 4ATGA 1HF8A 5T4YA 3FULA 2FBNA 3B13A 5ANRA 3TWTA 1V55E 3UT4A 3ZNGA 4G25A 5JJTA 3TWVA 2ETBA 2DWZA 2ETAA 3EU9A 4E85A 3LVQE 4CDRA 1S0PA 2X6FA 4I2WA 2J4BA 4KVMA 2XS1A 4U0SA 2VGXA 5ITZF 3ZGQA 4I1MA 2LUHA 3E30A 2QYJA 3S7BA 2WXQA 2IQCA 2C0MA 4GA0A 4JB8P 1OWMA 3Q9NC 4GZCA 2CG2A 4U7EB 5IY5E 4GTVA 5CHEE 4M3OA 3HRAA 3RSEG 3MKQA 3CIAA 2YHEA 4URKA 3UM1A 4MKTA 1ELRA 2KCLA 2ZIRA 4GZ6A 4JEHA 2BTDA 3FTXA 4A3VA 1KLXA 3V30A 2YINA 3QWWA 5CCLA 4XKBA 4MLPA 1EDUA 3LDZA 4GB9A 3DRAA 4LNUD 4CT0A 4RVBA 1H19A 3EDTB 2Q7FA 4B8CB 3FH8A 4GZDA 4UWLA 4JW1A 3IXEA 4FJYA 3MJWA 4APFA 2XEHA 2V4HC 4J0UA 5AARA 4OVUA 2V5FA 1JUQA 3NOCD 3RIBA 3QJZA 5EIBE 4BWRA 4JVSA 2I1JA 3ZN3A 5FZSA 4HBDA 3BU8A 3HXFA 3ZUVB 3DPDA 4G2VA 2X6KA 1WAO1 3UPVA 3E34A 1HG2A 5EDSA 1HX8A 3FUIA 2WPVA 3CVLA 2PM7A 1IYGA 1V54E 1Z6TA 4AJWA 3KSQA 3B7UX 4K5CA 3KSLA 3Q5MA 3DEOA 3C98A 1L5JA 5ENRD 3CVNA 3WXXA 5E75A 1MYOA 2WVIA 3S2AA 3ZIMA 3QNKA 3KEAA 2YNQA 1BLXB 4N2SA 5B3SE 3AG2E 1U2VG 4N2QA 1E8YA 1HH8A 3O48A 4DLQA 3SFYA 3MZLB 3TWQA 3E4BA 3JXIA 3LYAA 1QNFA 1IKND 4F3VA 3TG5A 4FLHA 3R7RA 1N11A 5BV1A 1O1SA 3ZYKA 4MRUA 1N4RA 1YA0A 2BKGA 2QYUA 3DSWA 4JL0A 2Y4TA 1UN8A 3GYZA 4IULA 1IHBA 3ASNE 3TXMA 3IEGA 5HQ8A 1S63A 2HE0A 5AQBA 2XQ0A 3PREA 1MZCA 5CRVA 5BT1A 3IHVA 4N5CA 3G2SA 3LPZA 4HRNA 4DI4A 1FPPA 1K1BA 5KNGA 1DCEA 5HI7A 4DI3A 3MV3B 2KZTB 4I9CA 2C2LA 2RFMA 4WNGA 3D9JA 1MX2A 3MKRA 3AG3E 1DNPA 1PAQA 5G05J 4CRWA 4GCNA 4TXQA 5LOZA 5AJLA 5KCMA 3EIJA 3DSSA 5BPPA 2P9KG 4F53A 4L1BA 2XHEA 4LNBA 3ASHA 2HM8A 3X2QE 3ULYA 4CYMD 1Y8MA 4FU3A 3TGOA 1N54A 3QWPA 4K03A 3SO8A 4UI9K 5AIJA 4BETA 4GTMA 4A63B 4G23A 2OEVA 4I1AA 4WNDA 2NSZA 5ARGA 4BT8A 4HOUA 3SF4A 4KBQA 4EQFA 3ABKE 2RG8A 2IOLA 4UI9J 3HXDA 3UQ3A 5AENA 2H6IA 3UM2A 3EHMA 4N3BA 1TNYA 1O5MA 1S64A 1JCSA 1A17A 2AVPA 3DXMG 2P2CP 3V2XA 5J90A 3PVLA 3RU0A 2XRYA 1FCHA 3GZSA 3UMVA 5A23A 5HRYA 2L6JA 4O6FA 4BTAA 3AU4A 4HS2A 1UN9A 3L82A 4V3IA 3ULEG 2OVFA 4U96D 3QWVA 4LSZE 4DK5A 3JUEA 5EKQD 3LJNA 2WQHA 1JCRA 2KXPC 2YQ8A 3TWWA 4J8SA 3FH7A 3MYVA 3B7RL 2L9BA 3FU3A 3LS8A 1SA4A 3FTVA 2F8YA 1UOHA 1LD8A 4LCTA 4U8VD 5CECB 1ZB1A 2Y4UA 4EPZA 2CG3A 3AU5A 4BSZB 4CZ2D 5G04C 3Q7AA 4YNDA 4C9BB 3CQGB 3KS2A 3T8KA 1EF1C 2XCBA 4DRXE 1U3DA 1H6PA 1OWPA 4UQZA 4EBAG 4AVXA 2RD0A 1W3BA 3ZKJA 4FJZA 4CCAA 1H0AA 2OEWA 4GPKA 4NRHB 4XI9A 3W9GA 1TJCA 4UQYA 4J7WA 4YDOA 3ASGA 3DSTA 4WNEA 2P58C 3CR3A 2JABA 3Q73A 4APOA 4ME2A 3P2BA 5KJKA 2EINE 2WXGA 4EECA 1IQRA 2KATA 1UJKA 1A5EA 4U07A 4F1PA 1RW2A 4YDYA 1TJFA 2Y69E 4AP2A 3RJVA 3UXGA 1H6KA 2VQ2A 2R03A 4F6RD 3DSXA 2MYOA 4WWNA 5FIOA 2PNNA 5HS0A 2WXMA 4H7YA 4J8EA 3QOUA 2YHCA 3FUHA 4JHJA 4PS8A 2L6BA 3V79K 4XKCA 4HOSA 4FP7A 4ANVA 2KCKA 1TR4A 4LRZA 3D9NA 4YVOA 1SQMA 1H6OA 1MX6A 3PH0C 4G11A 1HE8A 3F6QA 3LY7A 3CVXA 4TXRA 2CHXA 2EIKE 4I6JA 3QARA 4O60A 4ACLA 1UJJA 2NXPA 5M72A 3G2WA
chains in the Genus database with same CATH topology
4TV3A 4J0UA 3UT8A 2I1KA 1OWNA 4GMLA 4OVUA 4DJAA 4GU5A 2V5FA 3PRZA 3ML8A 1JUQA 5LCWC 2V8SE 3ZYQA 2E0IA 2IU1A 3RIBA 3Q4AB 3QJZA 1BPOA 4IYPA 4XE0A 4ANXA 4N39A 4BWRA 1KT0A 3CLJA 4JVSA 2WMOA 4UI9C 4I2ZA 3R9AB 2I1JA 4CT4A 3QKYA 4FC8A 3ZN3A 4BFRA 2VSXE 5FZSA 4JHKA 4RG9A 5BUZA 3K9IA 4G1TA 4D10C 2DIWA 3DPDA 2WMNA 1HU3A 1KT1A 3ESLA 3FU0A 4HFGA 4G2VA 2IOSA 2X3MA 2X6KA 3CVPA 4BTBA 1WAO1 3D9MA 1U3CA 3G2VA 3MV2B 2AXUA 2KC7A 2WXKA 3ZFWA 3CHPA 3UPVA 2WB2A 1E7UA 4U0ZA 1HG2A 5EDSA 3FTWA 3IKOB 1HX8A 2ILRA 3L17A 3FUIA 2WPVA 1Y6IA 3CVLA 2VTBA 3DBSA 4QFVA 3S7DA 3CHOA 2PM7A 1IYGA 3FH5A 5JJ7A 2FF4A 1Z6TA 2XPYA 3L54A 4AJWA 1FVFA 3UUXA 1XGWA 3B7UX 2IONA 1XNFA 4EBAA 4AM9A 2DCPA 1INZA 3JUIA 3Q5MA 1E7VA 4JC8A 4FHKA 3C98A 4L7TA 3PEUB 5LFAA 3APFA 3GW4A 4K0RA 4N3AA 4AY5A 1L5JA 3L6AA 5T8IA 1B89A 3CVNA 3WXXA 3ULQA 5E75A 3U4TA 2WVIA 1ZBPA 1E8ZA 1E96B 4OVVA 1TEZA 2UY1A 3PEVB 3S2AA 3ZIMA 3QNKA 2EQXA 5CCMA 3O4ZA 4PS3A 1NA0A 4WNFA 2FI7A 3JQ0A 4CDNA 3D9OA 4KVOA 2YNQA 3CHRA 4N2SA 5BNWA 3T5VA 4DLOA 3PUKA 4GCOA 2MRIA 5J08A 3URZA 3SZ7A 2IF4A 4U04A 3Q49B 3SBTB 4N2QA 3HVEA 1E8YA 5D0OD 1HH8A 3RKVA 2J08A 2R17C 3O48A 4BX8A 5CMWA 2XGOA 3OXFA 5FZRA 5JJ6A 3PNLB 1PC2A 5G04J 4DLQA 4I6GA 5CMYA 3VTXA 1NP7A 2OOEA 2JEKA 2DBAA 3MZLB 5FQ7A 2FULA 1FVHA 3SI5A 3TL5A 3E4BA 2VGXB 3LYAA 4W9RA 4JPSA 1QNFA 4A1SA 2X6IA 4UQXA 3ZPJA 5FQ4A 3EJNA 3B7SA 1Z3YA 4L2YA 5C2YA 5ENNA 3FU5A 3ZW3A 4F3VA 4JHRA 3TG5A 4FLHA 2GW1A 3R7RA 5FQ6A 5BV1A 5E76A 3ZYKA 4MRUA 1DVPA 3D9IA 4LEUA 3RO3A 1E8WA 5C1DA 4HOQA 4EZKA 2R59A 1YA0A 1GW6A 4JL0A 3CK8A 3LVRE 2Y4TA 2LO6A 4JA7A 1UN8A 3GYZA 3PNTB 4B8AA 5DIZA 4IULA 4B89A 2PL2A 2VJ8A 4GAAA 1HO8A 1HS6A 2CFZA 3CGHA 3TXMA 3CV0A 2J07A 3FTYA 3IEGA 5HQ8A 2A5UA 3EHNA 3APDA 2KCVA 2E2EA 3LEWA 4WUYA 1MQSA 3I4RB 2XQ0A 2UWJG 3PREA 2Y3AA 4F7AA 5BT1A 3FTSA 3CHMA 2X6JA 3IHVA 2XRZA 4N5CA 4FADA 3B7TA 3G2SA 4I1OB 3IV0A 2XGMA 3MKQB 3LPZA 2LAIA 4WWPA 3MGBA 5FWQA 3CSFA 4GYWA 4DI4A 3FEYA 3CVUA 5A7DB 4F1SA 2NC9A 4U63A 3BEEA 3CKCA 5HI7A 1JPLA 4KXKB 4DI3A 3MV3B 1WM5A 2CHWA 5DBKA 2KZTB 1UW4B 3FUJA 4I9CA 3VTYA 2C2LA 4WNGA 3D9JA 3LY8A 1JWGA 4ANUA 3MKRA 4PS7A 4BT9A 2AWIA 4Q96A 3S7FA 1DNPA 3MA5A 1PAQA 3AS4A 5G05J 4I43A 1E90A 4CRWA 4PH4B 4FLBA 1QZ2A 4Q69A 1X5BA 2CHZA 4ILHB 4GCNA 4HLEA 2WXIA 2WXOA 3FTUA 5LOZA 5AJLA 3FUEA 3UX4A 3JYSA 4AV7A 4GMJA 5EX3A 5KCMA 3EIJA 2GGFA 5FZQA 3ONLA 1H2UA 3R7QA 4ILGA 3SNXA 4TUUA 3U66A 3D3MA 5FT9A 5BPPA 4EZLA 4F53A 3PS6A 3CK9A 4L1BA 2XHEA 3CQCB 5G2NA 5LX8A 2M63A 2A4ZA 3FTZA 3G2TA 3ASHA 2HM8A 4A1GA 4JZYA 1ZU2A 2MOWA 4I6EA 3RRMB 1Y8MA 4A55A 3ZRHA 4FU3A 3TGOA 3IBEA 4GZ3A 1N54A 1E8XA 3QWPA 4K03A 3S7JA 5KJLA 5KJMA 3LJ3A 4UWGA 5T3RA 4C0EA 2FEZA 3LXUX 1ELWA 1QQEA 1EYHA 4UI9K 5AIJA 5A6CA 2PQRA 3CVYA 4J8DA 3ZHEB 3PUJA 1NA3A 2R5SA 5AYWD 2QY7A 2OV8A 4XI0A 1OWOA 3ASFA 4J8FA 4P29A 4G23A 3TG4A 2WXRA 3LKUA 4I1AA 4WNDA 2IFUA 1HZ4A 2NSZA 3ZYLA 2V0PA 3SBSA 4B94A 3L13A 3EIQC 3ONKA 3OXLA 3KD7A 5ARGA 3KEZA 4BT8A 1OWLA 4HOUA 4KBQA 4UWHA 1SZ9A 3AS8A 3SF4A 4B0ZA 2AXVA 1H2VC 4EQFA 3FEXA 5LCWJ 3ASDA 5KJNA 3CEQA 3GZ1A 4IN3B 3BG1B 2J9QA 4Y6WA 3SFZA 3FUFA 4L2LA 2RG8A 3RRUA 2IOLA 4UI9J 3HIZA 5FJYA 3L16A 2WXNA 4NURA 3UQ3A 5AENA 2VTBB 3LY9A 1NZNA 3EHMA 4KZ0A 4N3BA 5EX0A 2X6HA 1HFAA 4GZ5A 3GZ2A 4RSYA 3SHFA 1VDYA 3FFLA 3I3NA 4NACA 3JCKC 3FUMA 5FQ8A 4KT6B 3QDNA 3T5XA 4JA9A 3CVVA 1A17A 2WXHA 4C0MA 2AVPA 3SGHA 2I2OA 4OYSA 5BW8C 2BF0X 3FDHA 4G24A 5J90A 3PVLA 3RU0A 2XRYA 4ACKA 1SZAA 1FCHA 3CK7A 3GZSA 3UMVA 5A23A 3CVWA 2L6JA 4O6FA 4BTAA 3AU4A 4HS2A 1UN9A 4V3IA 3FHEA 1H2TC 4AOFA 2UY1B 2OVFA 3ZVVA 4KYOB 4G26A 3RO2A 3CHSA 3QWVA 3TXNA 3BG0B 2PM6A 4L23A 4DK5A 3HDXA 3VLFA 5EKQD 4AEZC 4J6IA 2VSNA 3FUDA 3PDNA 5G55A 2IJGX 2J49A 3PE3A 2WQHA 3ML9A 3T8MA 5JHAA 3KAEA 2AXZA 2YQ8A 1JWFA 4J8SA 4CEMA 3FH7A 2CFUA 1MHQA 2LAHA 3I5PA 3MYVA 2I6HA 3B7RL 3D9KA 4WWOA 2L9BA 3HVEB 4NQ0A 3CHQA 4WAFA 5AJDA 4JEUA 2HR2A 5ANLA 2XEVA 3U64A 5LP0A 2VGYA 3FU6A 1ELKA 3FU3A 2AW6A 3TAXA 2LNIA 3LS8A 4HOTA 4MS6A 3FTVA 2OVBA 2C0LA 2ONDA 4I17A 2WQ7A 4GA2A 2X38A 1IHGA 4GYYA 3I4GA 4HORA 4ANWA 4JXTA 4LCTA 4XZ4A 3UT7A 3L22A 3ZXSA 2WQ6A 3CVQA 2L0TB 2WXJA 1IQUA 3QC1A 3OAWA 4FULA 4YVQC 2Y4UA 3APCA 3CKBA 3LCAA 3ZHEA 5ARFA 4EPZA 2CG3A 2J09A 4ATGA 3FUKA 3AU5A 3OTNA 1HF8A 4BSXA 2MHKA 2V4LA 5T4YA 4CGWA 3FULA 5G04C 2I9CA 3QAQA 3FUNA 4YNDA 4C9BB 1PY1A 3B13A 2FBNA 2QFCA 3CQGB 3KS2A 4LUNU 5ANRA 3VLDA 2VSOE 4ABNA 2WXLA 1EF1C 2XCBA 2WXPA 3QK0A 3HYMB 1U3DA 2LSVA 4HVBA 4H7XA 3PZDA 3UT4A 4DPRA 1OWPA 4UQZA 4EBAG 4EZJA 4AVXA 3P1UA 2RD0A 4G25A 3L08A 3RK6A 5JJTA 1W3BA 4I9EA 3ENEA 4E85A 3ZYMA 4GYOA 3LVQE 4CDRA 4FJZA 2WM9A 4A3TA 3MCXA 4CCAA 1S0PA 1H0AA 3FP3A 2X6FA 4GPKA 2L0IA 4I2WA 2FO7A 2J4BA 4KVMA 4NRHB 4XI9A 5JHBA 1TJCA 4U0SA 2VGXA 2JLBA 3OXGA 4UQYA 4E6HA 3D9PA 3ASGA 4LERA 3ZGQA 4WNEA 4I1MA 2P58C 3CR3A 2BUGA 3FWVA 4FA6A 3S7BA 2HYZA 4N3CA 2WXQA 4GA1A 3RRNB 4APOA 3NQPA 4BY6A 4CGVA 4ME2A 2IQCA 2C0MA 2PZIA 2XCCA 3P2BA 3U9WA 4GA0A 4CDMA 3HHMA 5KJKA 1HXIA 1OWMA 1OUVA 2WXGA 4EECA 1IQRA 2KATA 4GZCA 3NZSA 4PDXA 1UJKA 4UWFA 1WY6A 4U07A 3CSTA 2CG2A 2XPZA 3SD5A 1TJFA 4AP2A 2J4DA 1P5QA 3RJVA 3NF1A 3IHYA 1H6KA 5CHEE 2VQ2A 4KZCA 4U8HA 3Q15A 3D9LA 3NZUA 4WWNA 2VYIA 4AIFA 2WXMA 3QB2A 4H7YA 5BV0A 4U0UA 4M3OA 4J8EA 3QOUA 3MKQA 5G05C 4PUCA 3CIAA 2YHCA 2YHEA 4URKA 3FUHA 4ILIA 3ZEFA 4JHJA 4PS8A 4AY6A 4MKTA 4XKCA 4Y6CA 4HXIA 4HOSA 4XIFA 2KZTA 2KM4A 1ELRA 3FY4A 3U3WA 2KCLA 4IRUA 3G2UA 1UG3A 4FP7A 4ANVA 1HG5A 2KCKA 2LSUA 2XGSA 4KMOA 1N52A 4GZ6A 4JEHA 4LRZA 4TRQA 2BTDA 3FTXA 4R7LA 3D9NA 2PQNA 4A3VA 4FHJA 1KLXA 3PE4A 3AS5A 4UWKA 2YINA 3N71A 4XX5A 3QWWA 4BX9A 4YVOA 2XPIA 2GRMA 5CCLA 1SQMA 4RG6A 3ESKA 2VSYA 3MX3A 4XKBA 4MLPA 3JQ1A 1Z3XA 4Q94A 3PH0C 1EDUA 4G11A 3LDZA 4GB9A 1HE8A 3LY7A 4CT0A 3CVXA 4AXHA 4RVBA 1H19A 3EDTB 2Q7FA 2CHXA 4I6JA 3TJPA 3Q47B 4B8CB 3MEKA 2ZU6B 3FH8A 5FTPA 1EPUA 2HO1A 4GZDA 4UWLA 3QARA 4JW1A 4ACLA 1UJJA 2NXPA 3VLEA 4FJYA 5D0QD 3MJWA 3G2WA 5M72A 2GRLA 4APFA 1LF8A 2WXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0U A;  2V5F A;  5LCW C;  3RIB A;  3Q4A B;  4N39 A;  4BWR A;  1KT0 A;  4UI9 C;  3R9A B;  4I2Z A;  3QKY A;  3ZN3 A;  5FZS A;  4RG9 A;  3K9I A;  4G1T A;  1KT1 A;  4G2V A;  3CVP A;  4BTB A;  1WAO 1;  3MV2 B;  3ZFW A;  2KC7 A;  3UPV A;  4U0Z A;  2WPV A;  3CVL A;  3S7D A;  1IYG A;  5JJ7 A;  2FF4 A;  3UUX A;  1XNF A;  4AM9 A;  3Q5M A;  3GW4 A;  4N3A A;  4AY5 A;  1B89 A;  3CVN A;  3WXX A;  3ULQ A;  3U4T A;  1ZBP A;  1E96 B;  2UY1 A;  5CCM A;  1NA0 A;  4WNF A;  2FI7 A;  4N2S A;  5BNW A;  4GCO A;  3URZ A;  3SZ7 A;  2IF4 A;  4U04 A;  3Q49 B;  4N2Q A;  5D0O D;  1HH8 A;  3RKV A;  3O48 A;  2XGO A;  3OXF A;  5FZR A;  5JJ6 A;  5G04 J;  1PC2 A;  3VTX A;  2OOE A;  2DBA A;  3E4B A;  2VGX B;  3LYA A;  4W9R A;  4A1S A;  4UQX A;  3ZPJ A;  4F3V A;  4JHR A;  3TG5 A;  2GW1 A;  3RO3 A;  4LEU A;  5C1D A;  4HOQ A;  1YA0 A;  4JL0 A;  3CK8 A;  2Y4T A;  4JA7 A;  3GYZ A;  5DIZ A;  2PL2 A;  3CV0 A;  3IEG A;  5HQ8 A;  2KCV A;  2E2E A;  4WUY A;  2UWJ G;  5BT1 A;  4N5C A;  2XGM A;  3LPZ A;  4GYW A;  5A7D B;  2NC9 A;  3BEE A;  3CKC A;  5HI7 A;  4KXK B;  3MV3 B;  1WM5 A;  5DBK A;  4I9C A;  3VTY A;  2C2L A;  4WNG A;  3LY8 A;  3MKR A;  4BT9 A;  3S7F A;  3MA5 A;  5G05 J;  3AS4 A;  1QZ2 A;  4GCN A;  3JYS A;  5EX3 A;  5FZQ A;  5FT9 A;  3CK9 A;  3ASH A;  1ZU2 A;  1Y8M A;  3TGO A;  4GZ3 A;  3QWP A;  3S7J A;  5KJL A;  5KJM A;  2FEZ A;  1ELW A;  1QQE A;  4UI9 K;  5A6C A;  2PQR A;  4J8D A;  3ZHE B;  5AYW D;  1NA3 A;  2R5S A;  4XI0 A;  3ASF A;  4J8F A;  4G23 A;  3TG4 A;  3LKU A;  4I1A A;  4WND A;  2IFU A;  1HZ4 A;  4B94 A;  3OXL A;  4BT8 A;  5ARG A;  3KD7 A;  4HOU A;  3SF4 A;  4KBQ A;  3AS8 A;  4EQF A;  5LCW J;  3ASD A;  5KJN A;  3CEQ A;  3GZ1 A;  4IN3 B;  2J9Q A;  4Y6W A;  4UI9 J;  5FJY A;  3UQ3 A;  3LY9 A;  1NZN A;  4N3B A;  5EX0 A;  4GZ5 A;  3GZ2 A;  3FFL A;  3QDN A;  4JA9 A;  1A17 A;  2AVP A;  5BW8 C;  4G24 A;  3RU0 A;  1FCH A;  3CK7 A;  2L6J A;  4O6F A;  4BTA A;  2UY1 B;  4KYO B;  4G26 A;  3RO2 A;  3QWV A;  5EKQ D;  2VSN A;  3PDN A;  3PE3 A;  2WQH A;  3KAE A;  2YQ8 A;  2I6H A;  4NQ0 A;  2HR2 A;  2XEV A;  2VGY A;  3TAX A;  2LNI A;  4HOT A;  2C0L A;  2OND A;  4I17 A;  4GA2 A;  1IHG A;  4GYY A;  4HOR A;  3CVQ A;  4YVQ C;  2Y4U A;  3CKB A;  3LCA A;  3ZHE A;  5ARF A;  2MHK A;  4CGW A;  5G04 C;  4YND A;  2FBN A;  3KS2 A;  2QFC A;  4ABN A;  2XCB A;  3HYM B;  2LSV A;  4H7X A;  4UQZ A;  4G25 A;  5JJT A;  1W3B A;  4I9E A;  4GYO A;  4CDR A;  3FP3 A;  4GPK A;  4I2W A;  2FO7 A;  4NRH B;  4XI9 A;  1TJC A;  4U0S A;  2VGX A;  2JLB A;  3OXG A;  4UQY A;  3ASG A;  3ZGQ A;  4WNE A;  2P58 C;  2BUG A;  3FWV A;  3S7B A;  2HYZ A;  4N3C A;  4GA1 A;  4APO A;  4CGV A;  4ME2 A;  2C0M A;  2PZI A;  2XCC A;  4GA0 A;  5KJK A;  1HXI A;  1OUV A;  2KAT A;  4U07 A;  3RJV A;  1P5Q A;  3NF1 A;  5CHE E;  2VQ2 A;  3Q15 A;  2VYI A;  4AIF A;  4H7Y A;  4U0U A;  4J8E A;  3QOU A;  5G05 C;  2YHC A;  4AY6 A;  4Y6C A;  4HOS A;  4XIF A;  1ELR A;  3U3W A;  2KCL A;  2KCK A;  2LSU A;  2XGS A;  4GZ6 A;  2PQN A;  1KLX A;  3PE4 A;  3AS5 A;  3N71 A;  3QWW A;  4YVO A;  2XPI A;  5CCL A;  4RG6 A;  3ESK A;  2VSY A;  3LY7 A;  3EDT B;  2Q7F A;  3Q47 B;  3MEK A;  5FTP A;  2HO1 A;  5D0Q D;  5M72 A; 
#chains in the Genus database with same CATH topology
 3TWS A;  4GTQ A;  2I1K A;  3UIP C;  2B0O E;  3PRZ A;  3ML8 A;  5LCW C;  3ZYQ A;  2IU1 A;  2LXL A;  4DX1 A;  4ZHB A;  4XE0 A;  3R9M A;  3R9A B;  4CT4 A;  1TN7 A;  4BFR A;  2EIL E;  4RG9 A;  4G1T A;  4D10 C;  2F8X K;  2IOS A;  2P9I G;  2AXU A;  2WXK A;  3ZFW A;  3AJI A;  3L17 A;  2ILR A;  2VTB A;  3DBS A;  3FH5 A;  5JJ7 A;  2FF4 A;  4ATZ D;  5BXU A;  3L54 A;  2F37 A;  1FVF A;  2ION A;  1XNF A;  4EBA A;  4AM9 A;  2DCP A;  4FHK A;  3PEU B;  5LFA A;  4N3A A;  1ZBP A;  1E8Z A;  5CEA A;  3J5Q B;  2DZO A;  3HXC A;  2EQX A;  2FI7 A;  4KVO A;  3C3R A;  3T5V A;  3PUK A;  2R2L A;  4HB5 A;  3HVE A;  2J08 A;  4BX8 A;  5FZR A;  4YDE A;  4I6G A;  3VTX A;  1NP7 A;  5AQA A;  2FUL A;  1FVH A;  3SI5 A;  2X6I A;  3ZPJ A;  5FQ4 A;  3B7S A;  3ZW3 A;  4JHR A;  2GW1 A;  2XEE A;  5FQ6 A;  4C48 B;  3D9I A;  5EIL A;  2P9P G;  1TN8 A;  2LXM A;  5KNH D;  2LO6 A;  2PL2 A;  3Q7F A;  3CGH A;  3ZXP A;  3APD A;  2R02 A;  3LEW A;  3I4R B;  2UWJ G;  2Y3A A;  4F7A A;  3FTS A;  3B7T A;  4I1O B;  3IV0 A;  4G8L A;  2LAI A;  1MJ0 A;  3CSF A;  4GYW A;  4U63 A;  3BEE A;  3CKC A;  1JPL A;  3NAW A;  3FUJ A;  5AN8 A;  3PZ1 A;  3LY8 A;  4PS7 A;  3S7F A;  3MA5 A;  1WG0 A;  4FLB A;  1QZ2 A;  4Q69 A;  4K5B A;  3AAA C;  4ILH B;  2WXI A;  2WXO A;  3DSU A;  3UX4 A;  4BEP A;  4AV7 A;  4GMJ A;  1NL4 A;  5EX3 A;  5FZQ A;  3R7Q A;  3UM0 A;  3SNX A;  3D9H A;  3D3M A;  5G2N A;  2M63 A;  2A4Z A;  4A1G A;  1KZO A;  3B95 A;  3C3O A;  5ENO D;  4BER A;  3IBE A;  3S7J A;  5KJL A;  3LJ3 A;  4UWG A;  1ELW A;  2F0Y A;  5A6C A;  4J8D A;  2QY7 A;  3UIN C;  1OWO A;  3ASF A;  4J8F A;  2EIM E;  3DEP A;  5EID A;  3TG4 A;  2WXR A;  3LKU A;  5H7P A;  2RKK A;  3ZYL A;  3L13 A;  1OY3 D;  1OWL A;  4B0Z A;  3FEX A;  3CEQ A;  3GZ1 A;  2GRN B;  3SFZ A;  3FUF A;  3HIZ A;  5FJY A;  3L16 A;  2X6H A;  4RSY A;  3FFL A;  5FQ8 A;  2XZT G;  3T5X A;  4JA9 A;  2WXH A;  4B93 B;  5AAO A;  2I2O A;  4OYS A;  2BF0 X;  4ACK A;  3NOG D;  4DUI A;  3AG4 E;  2UY1 B;  3RO2 A;  3CHS A;  3JXJ A;  4OAU C;  4L23 A;  1TYQ G;  4J6I A;  4U95 D;  2AXZ A;  4CEM A;  2CFU A;  1MHQ A;  3I5P A;  1DC2 A;  5AJD A;  5ENT D;  5B1A E;  3FU6 A;  4DX5 D;  2LNI A;  4NIK A;  2OVB A;  2C0L A;  2OND A;  5BXO A;  4GA2 A;  4DX7 D;  4GYY A;  5JA4 D;  5KWD A;  3ZXS A;  2WQ6 A;  3UM3 A;  4HRL A;  1IQU A;  4FUL A;  2XEN A;  2J09 A;  3FUK A;  1TNZ A;  2MHK A;  2DVW A;  2V4L A;  2I9C A;  3QAQ A;  3FUN A;  3C5R A;  1PY1 A;  3T9K A;  2QFC A;  4ABN A;  2VSO E;  3AG1 E;  2WXP A;  3QK0 A;  2P9U G;  4HVB A;  2LSV A;  4LG6 A;  4H7X A;  3L08 A;  1G3N B;  2P9N G;  2WM9 A;  3MCX A;  1D8E A;  4Z68 A;  2FO7 A;  5JHB A;  2JLB A;  4E6H A;  3D9P A;  5ENS D;  4L9P A;  1K1A A;  2B6C A;  2BUG A;  3FWV A;  3EHR A;  3RRN B;  4CGV A;  4GA1 A;  2XCC A;  2PZI A;  3V2O A;  4CDM A;  3ISM C;  4PDX A;  4UWF A;  3CST A;  1LD7 A;  1P5Q A;  2J4D A;  3IHY A;  4U8H A;  3Q15 A;  1TNB A;  2VYI A;  3QB2 A;  4U0U A;  5G05 C;  4PUC A;  4K5A B;  1BD8 A;  4ILI A;  1BI8 B;  3ZEF A;  4AY6 A;  1YMP A;  2KZT A;  2KM4 A;  3FY4 A;  4IRU A;  5KBA A;  1HG5 A;  2LSU A;  2XGS A;  4KMO A;  4TRQ A;  4R7L A;  2PQN A;  3PE4 A;  1Z5S C;  3N71 A;  4XX5 A;  2GRM A;  4RG6 A;  3DXK G;  2VSY A;  3MX3 A;  3JQ1 A;  4Q94 A;  3BUA A;  3Q79 A;  4AXH A;  1K3Z D;  3TJP A;  3Q47 B;  5HKP A;  3MEK A;  5FTP A;  2HO1 A;  3VLE A;  5D0Q D;  2OCC E;  2GRL A;  1LF8 A;  2WXF A;  2ETC A;  3UT8 A;  1OWN A;  4GML A;  4DJA A;  5D66 A;  3Q4A B;  1BPO A;  4IYP A;  3CLJ A;  4UI9 C;  2WMO A;  3QKY A;  4FC8 A;  2IEJ A;  2VSX E;  4JHK A;  3K9I A;  3L9T A;  2DIW A;  2WMN A;  1HU3 A;  1KT1 A;  4HFG A;  3CVP A;  4G8K A;  1U3C A;  3E37 A;  3G2V A;  3RAU A;  2KC7 A;  2WB2 A;  1E7U A;  4U0Z A;  1Y6I A;  4QFV A;  3S7D A;  2QC9 A;  2XPY A;  1IXV A;  1SA5 A;  1XGW A;  1OCZ E;  1INZ A;  2IO2 C;  3Q75 A;  4L7T A;  3APF A;  3GW4 A;  4K0R A;  2IO3 C;  1B89 A;  3U4T A;  1E96 B;  3PEV B;  1MX4 A;  5CCM A;  1NA0 A;  4CDN A;  3CHR A;  2ZIS A;  1YCS B;  3URZ A;  3SZ7 A;  4U04 A;  3Q49 B;  3SBT B;  4HNA D;  3RKV A;  2R17 C;  2XGO A;  5JJ6 A;  3DSV A;  5EYP F;  2OOE A;  2JEK A;  2VGX B;  4A1S A;  4UQX A;  1Z3Y A;  5ENN A;  2H6F A;  3TWR A;  1QBQ A;  5E76 A;  1DVP A;  4LEU A;  1N4Q A;  5C1D A;  5CBN A;  5CED B;  4HOQ A;  4EZK A;  1OCR E;  1GW6 A;  4JA7 A;  5DIZ A;  4B89 A;  4GAA A;  2CFZ A;  3CV0 A;  2J07 A;  2A5U A;  3EHN A;  4BES A;  2KCV A;  4WUY A;  1TNU A;  1D9S A;  3EU5 A;  2XRZ A;  4FAD A;  3BQO A;  4EHM A;  3MKQ B;  3E33 A;  2BED A;  3MGB A;  5FWQ A;  3CVU A;  1Q2Z A;  5A7D B;  4KXK B;  2CHW A;  3VTY A;  5B1B E;  1JWG A;  4ANU A;  4Q96 A;  4I43 A;  1N9A A;  1X5B A;  3JYS A;  2GGF A;  3ONL A;  1H2U A;  2VGE A;  4TUU A;  3W9F A;  3U66 A;  5FT9 A;  2AJA A;  3CK9 A;  5LX8 A;  4HI8 A;  3FTZ A;  5AQ9 A;  1FT2 A;  1NFI E;  4A55 A;  3ZRH A;  2V5Q C;  4TXP A;  5FIN A;  5KJM A;  2GRP B;  5T3R A;  4C0E A;  2FEZ A;  3LXU X;  3CVY A;  1EYH A;  3ZHE B;  4DX6 D;  3PUJ A;  2R5S A;  4XI0 A;  3PZ3 A;  4P29 A;  2IFU A;  3SBS A;  3SFX A;  3KD7 A;  3KEZ A;  1SZ9 A;  3AS8 A;  2AXV A;  3C72 A;  3BG1 B;  2J9Q A;  3RRU A;  4NUR A;  3HXE A;  3LY9 A;  1NZN A;  4KZ0 A;  4OAV B;  1HFA A;  4GZ5 A;  3GZ2 A;  3I3N A;  3JCK C;  3FUM A;  4U8Y D;  4KT6 B;  3QDN A;  2GRR B;  3ABM E;  3ASO E;  4C0M A;  3FDH A;  4G24 A;  1SZA A;  1WDY A;  4HQD A;  2A5E A;  3FHE A;  1H2T C;  4AOF A;  2P9S G;  3EHQ A;  3BG0 B;  3HDX A;  3VLF A;  3FUD A;  3PDN A;  2IJG X;  2J49 A;  3ML9 A;  3T8M A;  5JHA A;  3KAE A;  1JWF A;  1KPS B;  2LAH A;  3DPY A;  3UI2 A;  3CHQ A;  4WAF A;  4JEU A;  2HR2 A;  3U64 A;  4O1O A;  1JCQ A;  1ELK A;  3TAX A;  4MS6 A;  1SW6 A;  5CBO A;  2WQ7 A;  4I17 A;  3DWL G;  3UT7 A;  3L22 A;  3CVQ A;  2WXJ A;  3OAW A;  3APC A;  3ZHE A;  4XEI G;  4GMR A;  3OTN A;  4BSX A;  4CGW A;  5EYL A;  4LUN U;  3VLD A;  2WXL A;  3HYM B;  3NB2 A;  3PZD A;  4DPR A;  4EZJ A;  3P1U A;  3RK6 A;  4I9E A;  3UKR G;  3ENE A;  3ZYM A;  4GYO A;  4A3T A;  3EUV A;  3FP3 A;  2KBX A;  3Q9U C;  4UUC A;  2L0I A;  1N95 A;  3OXG A;  2BKK B;  4LER A;  1OCO E;  4YDW A;  3HXB A;  4FA6 A;  2HYZ A;  4N3C A;  4BY6 A;  1YYH A;  3NQP A;  1K8K G;  3U9W A;  3HHM A;  2DYR E;  1HXI A;  1OUV A;  3NZS A;  1WY6 A;  3V31 A;  2XPZ A;  3SD5 A;  1X81 A;  3J5P A;  3NF1 A;  4KZC A;  2GRQ B;  2Y1L E;  3D9L A;  3NZU A;  3PZ2 A;  4AIF A;  5BV0 A;  4O1P A;  4X8Q A;  4Y6C A;  4HXI A;  1OT8 A;  3ZU7 B;  4XIF A;  3U3W A;  3G2U A;  1UG3 A;  2ZGD A;  1N52 A;  4FHJ A;  4UWK A;  3AS5 A;  1OXJ A;  4BX9 A;  4LNG A;  2XPI A;  3UIO C;  3ESK A;  1Z3X A;  2P9L G;  4GTR A;  4GTS A;  5D2M C;  1BU9 A;  2ZU6 B;  1FT1 A;  1EPU A;  1N4S A;  3SY2 A;  4M7C A;  3NBN B;  4TV3 A;  4GU5 A;  3PZ4 A;  2V8S E;  2E0I A;  4GTO A;  3UKU G;  2R05 A;  4ANX A;  4N39 A;  1KT0 A;  4I2Z A;  5BUZ A;  1N4P A;  2DZN A;  3ESL A;  3FU0 A;  2X3M A;  4RLY A;  4BTB A;  3D9M A;  3MV2 B;  3Q78 A;  3CHP A;  3FTW A;  3IKO B;  1KZP A;  1N0R A;  3CHO A;  1TN6 A;  3UUX A;  4JD2 G;  3JUI A;  1E7V A;  4JC8 A;  4AY5 A;  3L6A A;  5T8I A;  3ULQ A;  3TWU A;  4OVV A;  1TEZ A;  2UY1 A;  3O4Z A;  4PS3 A;  2RFA A;  4WNF A;  1DCQ A;  2H6G A;  3JQ0 A;  3D9O A;  2J8S D;  5BNW A;  4DLO A;  4GCO A;  2MRI A;  3C3Q A;  5J08 A;  4HI9 A;  4GPM A;  2IF4 A;  5ENQ D;  5D0O D;  4DX2 A;  5CMW A;  2Y0B G;  3OXF A;  3PNL B;  1PC2 A;  5G04 J;  5CMY A;  2DBA A;  3TWX A;  5FQ7 A;  3SQV A;  3TL5 A;  4W9R A;  4J8Y A;  4JPS A;  1NI1 A;  2H6H A;  3EJN A;  4L2Y A;  5C2Y A;  3FU5 A;  2XZD G;  4GTT A;  3RO3 A;  1E8W A;  1OCC E;  2R59 A;  3CK8 A;  3LVR E;  5CRU A;  1S70 B;  3PNT B;  4B8A A;  2VJ8 A;  1HO8 A;  1HS6 A;  4QQI A;  2GRO B;  3FTY A;  1N0Q A;  2E2E A;  1D8D A;  1MQS A;  3CHM A;  2X6J A;  2XGM A;  2FO1 E;  4WWP A;  3FEY A;  2ZGG A;  4F1S A;  2NC9 A;  1WM5 A;  5DBK A;  1UW4 B;  4BT9 A;  2AWI A;  3AS4 A;  1E90 A;  4PH4 B;  2CHZ A;  4HLE A;  3FTU A;  3FUE A;  4RQI A;  4ILG A;  4EZL A;  3PS6 A;  4ZFH A;  3UTM A;  3CQC B;  3G2T A;  4JZY A;  1ZU2 A;  2MOW A;  4I6E A;  3RRM B;  1SVX A;  1AWC B;  3E32 A;  4GZ3 A;  1E8X A;  2DYS E;  1QQE A;  2PQR A;  2XS8 A;  1NA3 A;  5AYW D;  2OV8 A;  4HRM B;  5CER B;  5JMN D;  1HZ4 A;  2V0P A;  4B94 A;  3EIQ C;  3ONK A;  3OXL A;  4UWH A;  2ZXW E;  1O1T A;  1H2V C;  5LCW J;  3ASD A;  5KJN A;  1AP7 A;  4IN3 B;  4Y6W A;  4L2L A;  2IY0 C;  2WXN A;  2VTB B;  1LTX A;  5EX0 A;  4TUM A;  3WG7 E;  3SHF A;  1VDY A;  1BI7 B;  4GTP A;  4NAC A;  3CVV A;  3ABL E;  1TNO A;  1O1R A;  3SGH A;  3HG0 D;  5BW8 C;  3CK7 A;  3CVW A;  2EIJ E;  3B7B A;  3ZVV A;  4KYO B;  4G26 A;  3TXN A;  5ENP D;  2PM6 A;  1N94 A;  1RZ4 A;  4AEZ C;  2VSN A;  5G55 A;  3PE3 A;  5EN5 D;  4HLL A;  2QZA A;  5AQ7 A;  2I6H A;  3D9K A;  4WWO A;  3HVE B;  4NQ0 A;  4MBG A;  5ANL A;  4N5Q A;  2XEV A;  5LP0 A;  2VGY A;  2AW6 A;  4HOT A;  2X38 A;  1IHG A;  3I4G A;  4HOR A;  4ANW A;  4JXT A;  4XZ4 A;  2NYJ A;  2L0T B;  1QYM A;  3QC1 A;  4YVQ C;  3CKB A;  3LCA A;  5ARF A;  4ATG A;  1HF8 A;  5T4Y A;  3FUL A;  2FBN A;  3B13 A;  5ANR A;  3TWT A;  1V55 E;  3UT4 A;  3ZNG A;  4G25 A;  5JJT A;  3TWV A;  2ETB A;  2DWZ A;  2ETA A;  3EU9 A;  4E85 A;  3LVQ E;  4CDR A;  1S0P A;  2X6F A;  4I2W A;  2J4B A;  4KVM A;  2XS1 A;  4U0S A;  2VGX A;  5ITZ F;  3ZGQ A;  4I1M A;  2LUH A;  3E30 A;  2QYJ A;  3S7B A;  2WXQ A;  2IQC A;  2C0M A;  4GA0 A;  4JB8 P;  1OWM A;  3Q9N C;  4GZC A;  2CG2 A;  4U7E B;  5IY5 E;  4GTV A;  5CHE E;  4M3O A;  3HRA A;  3RSE G;  3MKQ A;  3CIA A;  2YHE A;  4URK A;  3UM1 A;  4MKT A;  1ELR A;  2KCL A;  2ZIR A;  4GZ6 A;  4JEH A;  2BTD A;  3FTX A;  4A3V A;  1KLX A;  3V30 A;  2YIN A;  3QWW A;  5CCL A;  4XKB A;  4MLP A;  1EDU A;  3LDZ A;  4GB9 A;  3DRA A;  4LNU D;  4CT0 A;  4RVB A;  1H19 A;  3EDT B;  2Q7F A;  4B8C B;  3FH8 A;  4GZD A;  4UWL A;  4JW1 A;  3IXE A;  4FJY A;  3MJW A;  4APF A;  2XEH A;  2V4H C;  4J0U A;  5AAR A;  4OVU A;  2V5F A;  1JUQ A;  3NOC D;  3RIB A;  3QJZ A;  5EIB E;  4BWR A;  4JVS A;  2I1J A;  3ZN3 A;  5FZS A;  4HBD A;  3BU8 A;  3HXF A;  3ZUV B;  3DPD A;  4G2V A;  2X6K A;  1WAO 1;  3UPV A;  3E34 A;  1HG2 A;  5EDS A;  1HX8 A;  3FUI A;  2WPV A;  3CVL A;  2PM7 A;  1IYG A;  1V54 E;  1Z6T A;  4AJW A;  3KSQ A;  3B7U X;  4K5C A;  3KSL A;  3Q5M A;  3DEO A;  3C98 A;  1L5J A;  5ENR D;  3CVN A;  3WXX A;  5E75 A;  1MYO A;  2WVI A;  3S2A A;  3ZIM A;  3QNK A;  3KEA A;  2YNQ A;  1BLX B;  4N2S A;  5B3S E;  3AG2 E;  1U2V G;  4N2Q A;  1E8Y A;  1HH8 A;  3O48 A;  4DLQ A;  3SFY A;  3MZL B;  3TWQ A;  3E4B A;  3JXI A;  3LYA A;  1QNF A;  1IKN D;  4F3V A;  3TG5 A;  4FLH A;  3R7R A;  1N11 A;  5BV1 A;  1O1S A;  3ZYK A;  4MRU A;  1N4R A;  1YA0 A;  2BKG A;  2QYU A;  3DSW A;  4JL0 A;  2Y4T A;  1UN8 A;  3GYZ A;  4IUL A;  1IHB A;  3ASN E;  3TXM A;  3IEG A;  5HQ8 A;  1S63 A;  2HE0 A;  5AQB A;  2XQ0 A;  3PRE A;  1MZC A;  5CRV A;  5BT1 A;  3IHV A;  4N5C A;  3G2S A;  3LPZ A;  4HRN A;  4DI4 A;  1FPP A;  1K1B A;  5KNG A;  1DCE A;  5HI7 A;  4DI3 A;  3MV3 B;  2KZT B;  4I9C A;  2C2L A;  2RFM A;  4WNG A;  3D9J A;  1MX2 A;  3MKR A;  3AG3 E;  1DNP A;  1PAQ A;  5G05 J;  4CRW A;  4GCN A;  4TXQ A;  5LOZ A;  5AJL A;  5KCM A;  3EIJ A;  3DSS A;  5BPP A;  2P9K G;  4F53 A;  4L1B A;  2XHE A;  4LNB A;  3ASH A;  2HM8 A;  3X2Q E;  3ULY A;  4CYM D;  1Y8M A;  4FU3 A;  3TGO A;  1N54 A;  3QWP A;  4K03 A;  3SO8 A;  4UI9 K;  5AIJ A;  4BET A;  4GTM A;  4A63 B;  4G23 A;  2OEV A;  4I1A A;  4WND A;  2NSZ A;  5ARG A;  4BT8 A;  4HOU A;  3SF4 A;  4KBQ A;  4EQF A;  3ABK E;  2RG8 A;  2IOL A;  4UI9 J;  3HXD A;  3UQ3 A;  5AEN A;  2H6I A;  3UM2 A;  3EHM A;  4N3B A;  1TNY A;  1O5M A;  1S64 A;  1JCS A;  1A17 A;  2AVP A;  3DXM G;  2P2C P;  3V2X A;  5J90 A;  3PVL A;  3RU0 A;  2XRY A;  1FCH A;  3GZS A;  3UMV A;  5A23 A;  5HRY A;  2L6J A;  4O6F A;  4BTA A;  3AU4 A;  4HS2 A;  1UN9 A;  3L82 A;  4V3I A;  3ULE G;  2OVF A;  4U96 D;  3QWV A;  4LSZ E;  4DK5 A;  3JUE A;  5EKQ D;  3LJN A;  2WQH A;  1JCR A;  2KXP C;  2YQ8 A;  3TWW A;  4J8S A;  3FH7 A;  3MYV A;  3B7R L;  2L9B A;  3FU3 A;  3LS8 A;  1SA4 A;  3FTV A;  2F8Y A;  1UOH A;  1LD8 A;  4LCT A;  4U8V D;  5CEC B;  1ZB1 A;  2Y4U A;  4EPZ A;  2CG3 A;  3AU5 A;  4BSZ B;  4CZ2 D;  5G04 C;  3Q7A A;  4YND A;  4C9B B;  3CQG B;  3KS2 A;  3T8K A;  1EF1 C;  2XCB A;  4DRX E;  1U3D A;  1H6P A;  1OWP A;  4UQZ A;  4EBA G;  4AVX A;  2RD0 A;  1W3B A;  3ZKJ A;  4FJZ A;  4CCA A;  1H0A A;  2OEW A;  4GPK A;  4NRH B;  4XI9 A;  3W9G A;  1TJC A;  4UQY A;  4J7W A;  4YDO A;  3ASG A;  3DST A;  4WNE A;  2P58 C;  3CR3 A;  2JAB A;  3Q73 A;  4APO A;  4ME2 A;  3P2B A;  5KJK A;  2EIN E;  2WXG A;  4EEC A;  1IQR A;  2KAT A;  1UJK A;  1A5E A;  4U07 A;  4F1P A;  1RW2 A;  4YDY A;  1TJF A;  2Y69 E;  4AP2 A;  3RJV A;  3UXG A;  1H6K A;  2VQ2 A;  2R03 A;  4F6R D;  3DSX A;  2MYO A;  4WWN A;  5FIO A;  2PNN A;  5HS0 A;  2WXM A;  4H7Y A;  4J8E A;  3QOU A;  2YHC A;  3FUH A;  4JHJ A;  4PS8 A;  2L6B A;  3V79 K;  4XKC A;  4HOS A;  4FP7 A;  4ANV A;  2KCK A;  1TR4 A;  4LRZ A;  3D9N A;  4YVO A;  1SQM A;  1H6O A;  1MX6 A;  3PH0 C;  4G11 A;  1HE8 A;  3F6Q A;  3LY7 A;  3CVX A;  4TXR A;  2CHX A;  2EIK E;  4I6J A;  3QAR A;  4O60 A;  4ACL A;  1UJJ A;  2NXP A;  5M72 A;  3G2W A; 
#chains in the Genus database with same CATH homology
 4TV3 A;  4J0U A;  3UT8 A;  2I1K A;  1OWN A;  4GML A;  4OVU A;  4DJA A;  4GU5 A;  2V5F A;  3PRZ A;  3ML8 A;  1JUQ A;  5LCW C;  2V8S E;  3ZYQ A;  2E0I A;  2IU1 A;  3RIB A;  3Q4A B;  3QJZ A;  1BPO A;  4IYP A;  4XE0 A;  4ANX A;  4N39 A;  4BWR A;  1KT0 A;  3CLJ A;  4JVS A;  2WMO A;  4UI9 C;  4I2Z A;  3R9A B;  2I1J A;  4CT4 A;  3QKY A;  4FC8 A;  3ZN3 A;  4BFR A;  2VSX E;  5FZS A;  4JHK A;  4RG9 A;  5BUZ A;  3K9I A;  4G1T A;  4D10 C;  2DIW A;  3DPD A;  2WMN A;  1HU3 A;  1KT1 A;  3ESL A;  3FU0 A;  4HFG A;  4G2V A;  2IOS A;  2X3M A;  2X6K A;  3CVP A;  4BTB A;  1WAO 1;  3D9M A;  1U3C A;  3G2V A;  3MV2 B;  2AXU A;  2KC7 A;  2WXK A;  3ZFW A;  3CHP A;  3UPV A;  2WB2 A;  1E7U A;  4U0Z A;  1HG2 A;  5EDS A;  3FTW A;  3IKO B;  1HX8 A;  2ILR A;  3L17 A;  3FUI A;  2WPV A;  1Y6I A;  3CVL A;  2VTB A;  3DBS A;  4QFV A;  3S7D A;  3CHO A;  2PM7 A;  1IYG A;  3FH5 A;  5JJ7 A;  2FF4 A;  1Z6T A;  2XPY A;  3L54 A;  4AJW A;  1FVF A;  3UUX A;  1XGW A;  3B7U X;  2ION A;  1XNF A;  4EBA A;  4AM9 A;  2DCP A;  1INZ A;  3JUI A;  3Q5M A;  1E7V A;  4JC8 A;  4FHK A;  3C98 A;  4L7T A;  3PEU B;  5LFA A;  3APF A;  3GW4 A;  4K0R A;  4N3A A;  4AY5 A;  1L5J A;  3L6A A;  5T8I A;  1B89 A;  3CVN A;  3WXX A;  3ULQ A;  5E75 A;  3U4T A;  2WVI A;  1ZBP A;  1E8Z A;  1E96 B;  4OVV A;  1TEZ A;  2UY1 A;  3PEV B;  3S2A A;  3ZIM A;  3QNK A;  2EQX A;  5CCM A;  3O4Z A;  4PS3 A;  1NA0 A;  4WNF A;  2FI7 A;  3JQ0 A;  4CDN A;  3D9O A;  4KVO A;  2YNQ A;  3CHR A;  4N2S A;  5BNW A;  3T5V A;  4DLO A;  3PUK A;  4GCO A;  2MRI A;  5J08 A;  3URZ A;  3SZ7 A;  2IF4 A;  4U04 A;  3Q49 B;  3SBT B;  4N2Q A;  3HVE A;  1E8Y A;  5D0O D;  1HH8 A;  3RKV A;  2J08 A;  2R17 C;  3O48 A;  4BX8 A;  5CMW A;  2XGO A;  3OXF A;  5FZR A;  5JJ6 A;  3PNL B;  1PC2 A;  5G04 J;  4DLQ A;  4I6G A;  5CMY A;  3VTX A;  1NP7 A;  2OOE A;  2JEK A;  2DBA A;  3MZL B;  5FQ7 A;  2FUL A;  1FVH A;  3SI5 A;  3TL5 A;  3E4B A;  2VGX B;  3LYA A;  4W9R A;  4JPS A;  1QNF A;  4A1S A;  2X6I A;  4UQX A;  3ZPJ A;  5FQ4 A;  3EJN A;  3B7S A;  1Z3Y A;  4L2Y A;  5C2Y A;  5ENN A;  3FU5 A;  3ZW3 A;  4F3V A;  4JHR A;  3TG5 A;  4FLH A;  2GW1 A;  3R7R A;  5FQ6 A;  5BV1 A;  5E76 A;  3ZYK A;  4MRU A;  1DVP A;  3D9I A;  4LEU A;  3RO3 A;  1E8W A;  5C1D A;  4HOQ A;  4EZK A;  2R59 A;  1YA0 A;  1GW6 A;  4JL0 A;  3CK8 A;  3LVR E;  2Y4T A;  2LO6 A;  4JA7 A;  1UN8 A;  3GYZ A;  3PNT B;  4B8A A;  5DIZ A;  4IUL A;  4B89 A;  2PL2 A;  2VJ8 A;  4GAA A;  1HO8 A;  1HS6 A;  2CFZ A;  3CGH A;  3TXM A;  3CV0 A;  2J07 A;  3FTY A;  3IEG A;  5HQ8 A;  2A5U A;  3EHN A;  3APD A;  2KCV A;  2E2E A;  3LEW A;  4WUY A;  1MQS A;  3I4R B;  2XQ0 A;  2UWJ G;  3PRE A;  2Y3A A;  4F7A A;  5BT1 A;  3FTS A;  3CHM A;  2X6J A;  3IHV A;  2XRZ A;  4N5C A;  4FAD A;  3B7T A;  3G2S A;  4I1O B;  3IV0 A;  2XGM A;  3MKQ B;  3LPZ A;  2LAI A;  4WWP A;  3MGB A;  5FWQ A;  3CSF A;  4GYW A;  4DI4 A;  3FEY A;  3CVU A;  5A7D B;  4F1S A;  2NC9 A;  4U63 A;  3BEE A;  3CKC A;  5HI7 A;  1JPL A;  4KXK B;  4DI3 A;  3MV3 B;  1WM5 A;  2CHW A;  5DBK A;  2KZT B;  1UW4 B;  3FUJ A;  4I9C A;  3VTY A;  2C2L A;  4WNG A;  3D9J A;  3LY8 A;  1JWG A;  4ANU A;  3MKR A;  4PS7 A;  4BT9 A;  2AWI A;  4Q96 A;  3S7F A;  1DNP A;  3MA5 A;  1PAQ A;  3AS4 A;  5G05 J;  4I43 A;  1E90 A;  4CRW A;  4PH4 B;  4FLB A;  1QZ2 A;  4Q69 A;  1X5B A;  2CHZ A;  4ILH B;  4GCN A;  4HLE A;  2WXI A;  2WXO A;  3FTU A;  5LOZ A;  5AJL A;  3FUE A;  3UX4 A;  3JYS A;  4AV7 A;  4GMJ A;  5EX3 A;  5KCM A;  3EIJ A;  2GGF A;  5FZQ A;  3ONL A;  1H2U A;  3R7Q A;  4ILG A;  3SNX A;  4TUU A;  3U66 A;  3D3M A;  5FT9 A;  5BPP A;  4EZL A;  4F53 A;  3PS6 A;  3CK9 A;  4L1B A;  2XHE A;  3CQC B;  5G2N A;  5LX8 A;  2M63 A;  2A4Z A;  3FTZ A;  3G2T A;  3ASH A;  2HM8 A;  4A1G A;  4JZY A;  1ZU2 A;  2MOW A;  4I6E A;  3RRM B;  1Y8M A;  4A55 A;  3ZRH A;  4FU3 A;  3TGO A;  3IBE A;  4GZ3 A;  1N54 A;  1E8X A;  3QWP A;  4K03 A;  3S7J A;  5KJL A;  5KJM A;  3LJ3 A;  4UWG A;  5T3R A;  4C0E A;  2FEZ A;  3LXU X;  1ELW A;  1QQE A;  1EYH A;  4UI9 K;  5AIJ A;  5A6C A;  2PQR A;  3CVY A;  4J8D A;  3ZHE B;  3PUJ A;  1NA3 A;  2R5S A;  5AYW D;  2QY7 A;  2OV8 A;  4XI0 A;  1OWO A;  3ASF A;  4J8F A;  4P29 A;  4G23 A;  3TG4 A;  2WXR A;  3LKU A;  4I1A A;  4WND A;  2IFU A;  1HZ4 A;  2NSZ A;  3ZYL A;  2V0P A;  3SBS A;  4B94 A;  3L13 A;  3EIQ C;  3ONK A;  3OXL A;  3KD7 A;  5ARG A;  3KEZ A;  4BT8 A;  1OWL A;  4HOU A;  4KBQ A;  4UWH A;  1SZ9 A;  3AS8 A;  3SF4 A;  4B0Z A;  2AXV A;  1H2V C;  4EQF A;  3FEX A;  5LCW J;  3ASD A;  5KJN A;  3CEQ A;  3GZ1 A;  4IN3 B;  3BG1 B;  2J9Q A;  4Y6W A;  3SFZ A;  3FUF A;  4L2L A;  2RG8 A;  3RRU A;  2IOL A;  4UI9 J;  3HIZ A;  5FJY A;  3L16 A;  2WXN A;  4NUR A;  3UQ3 A;  5AEN A;  2VTB B;  3LY9 A;  1NZN A;  3EHM A;  4KZ0 A;  4N3B A;  5EX0 A;  2X6H A;  1HFA A;  4GZ5 A;  3GZ2 A;  4RSY A;  3SHF A;  1VDY A;  3FFL A;  3I3N A;  4NAC A;  3JCK C;  3FUM A;  5FQ8 A;  4KT6 B;  3QDN A;  3T5X A;  4JA9 A;  3CVV A;  1A17 A;  2WXH A;  4C0M A;  2AVP A;  3SGH A;  2I2O A;  4OYS A;  5BW8 C;  2BF0 X;  3FDH A;  4G24 A;  5J90 A;  3PVL A;  3RU0 A;  2XRY A;  4ACK A;  1SZA A;  1FCH A;  3CK7 A;  3GZS A;  3UMV A;  5A23 A;  3CVW A;  2L6J A;  4O6F A;  4BTA A;  3AU4 A;  4HS2 A;  1UN9 A;  4V3I A;  3FHE A;  1H2T C;  4AOF A;  2UY1 B;  2OVF A;  3ZVV A;  4KYO B;  4G26 A;  3RO2 A;  3CHS A;  3QWV A;  3TXN A;  3BG0 B;  2PM6 A;  4L23 A;  4DK5 A;  3HDX A;  3VLF A;  5EKQ D;  4AEZ C;  4J6I A;  2VSN A;  3FUD A;  3PDN A;  5G55 A;  2IJG X;  2J49 A;  3PE3 A;  2WQH A;  3ML9 A;  3T8M A;  5JHA A;  3KAE A;  2AXZ A;  2YQ8 A;  1JWF A;  4J8S A;  4CEM A;  3FH7 A;  2CFU A;  1MHQ A;  2LAH A;  3I5P A;  3MYV A;  2I6H A;  3B7R L;  3D9K A;  4WWO A;  2L9B A;  3HVE B;  4NQ0 A;  3CHQ A;  4WAF A;  5AJD A;  4JEU A;  2HR2 A;  5ANL A;  2XEV A;  3U64 A;  5LP0 A;  2VGY A;  3FU6 A;  1ELK A;  3FU3 A;  2AW6 A;  3TAX A;  2LNI A;  3LS8 A;  4HOT A;  4MS6 A;  3FTV A;  2OVB A;  2C0L A;  2OND A;  4I17 A;  2WQ7 A;  4GA2 A;  2X38 A;  1IHG A;  4GYY A;  3I4G A;  4HOR A;  4ANW A;  4JXT A;  4LCT A;  4XZ4 A;  3UT7 A;  3L22 A;  3ZXS A;  2WQ6 A;  3CVQ A;  2L0T B;  2WXJ A;  1IQU A;  3QC1 A;  3OAW A;  4FUL A;  4YVQ C;  2Y4U A;  3APC A;  3CKB A;  3LCA A;  3ZHE A;  5ARF A;  4EPZ A;  2CG3 A;  2J09 A;  4ATG A;  3FUK A;  3AU5 A;  3OTN A;  1HF8 A;  4BSX A;  2MHK A;  2V4L A;  5T4Y A;  4CGW A;  3FUL A;  5G04 C;  2I9C A;  3QAQ A;  3FUN A;  4YND A;  4C9B B;  1PY1 A;  3B13 A;  2FBN A;  2QFC A;  3CQG B;  3KS2 A;  4LUN U;  5ANR A;  3VLD A;  2VSO E;  4ABN A;  2WXL A;  1EF1 C;  2XCB A;  2WXP A;  3QK0 A;  3HYM B;  1U3D A;  2LSV A;  4HVB A;  4H7X A;  3PZD A;  3UT4 A;  4DPR A;  1OWP A;  4UQZ A;  4EBA G;  4EZJ A;  4AVX A;  3P1U A;  2RD0 A;  4G25 A;  3L08 A;  3RK6 A;  5JJT A;  1W3B A;  4I9E A;  3ENE A;  4E85 A;  3ZYM A;  4GYO A;  3LVQ E;  4CDR A;  4FJZ A;  2WM9 A;  4A3T A;  3MCX A;  4CCA A;  1S0P A;  1H0A A;  3FP3 A;  2X6F A;  4GPK A;  2L0I A;  4I2W A;  2FO7 A;  2J4B A;  4KVM A;  4NRH B;  4XI9 A;  5JHB A;  1TJC A;  4U0S A;  2VGX A;  2JLB A;  3OXG A;  4UQY A;  4E6H A;  3D9P A;  3ASG A;  4LER A;  3ZGQ A;  4WNE A;  4I1M A;  2P58 C;  3CR3 A;  2BUG A;  3FWV A;  4FA6 A;  3S7B A;  2HYZ A;  4N3C A;  2WXQ A;  4GA1 A;  3RRN B;  4APO A;  3NQP A;  4BY6 A;  4CGV A;  4ME2 A;  2IQC A;  2C0M A;  2PZI A;  2XCC A;  3P2B A;  3U9W A;  4GA0 A;  4CDM A;  3HHM A;  5KJK A;  1HXI A;  1OWM A;  1OUV A;  2WXG A;  4EEC A;  1IQR A;  2KAT A;  4GZC A;  3NZS A;  4PDX A;  1UJK A;  4UWF A;  1WY6 A;  4U07 A;  3CST A;  2CG2 A;  2XPZ A;  3SD5 A;  1TJF A;  4AP2 A;  2J4D A;  1P5Q A;  3RJV A;  3NF1 A;  3IHY A;  1H6K A;  5CHE E;  2VQ2 A;  4KZC A;  4U8H A;  3Q15 A;  3D9L A;  3NZU A;  4WWN A;  2VYI A;  4AIF A;  2WXM A;  3QB2 A;  4H7Y A;  5BV0 A;  4U0U A;  4M3O A;  4J8E A;  3QOU A;  3MKQ A;  5G05 C;  4PUC A;  3CIA A;  2YHC A;  2YHE A;  4URK A;  3FUH A;  4ILI A;  3ZEF A;  4JHJ A;  4PS8 A;  4AY6 A;  4MKT A;  4XKC A;  4Y6C A;  4HXI A;  4HOS A;  4XIF A;  2KZT A;  2KM4 A;  1ELR A;  3FY4 A;  3U3W A;  2KCL A;  4IRU A;  3G2U A;  1UG3 A;  4FP7 A;  4ANV A;  1HG5 A;  2KCK A;  2LSU A;  2XGS A;  4KMO A;  1N52 A;  4GZ6 A;  4JEH A;  4LRZ A;  4TRQ A;  2BTD A;  3FTX A;  4R7L A;  3D9N A;  2PQN A;  4A3V A;  4FHJ A;  1KLX A;  3PE4 A;  3AS5 A;  4UWK A;  2YIN A;  3N71 A;  4XX5 A;  3QWW A;  4BX9 A;  4YVO A;  2XPI A;  2GRM A;  5CCL A;  1SQM A;  4RG6 A;  3ESK A;  2VSY A;  3MX3 A;  4XKB A;  4MLP A;  3JQ1 A;  1Z3X A;  4Q94 A;  3PH0 C;  1EDU A;  4G11 A;  3LDZ A;  4GB9 A;  1HE8 A;  3LY7 A;  4CT0 A;  3CVX A;  4AXH A;  4RVB A;  1H19 A;  3EDT B;  2Q7F A;  2CHX A;  4I6J A;  3TJP A;  3Q47 B;  4B8C B;  3MEK A;  2ZU6 B;  3FH8 A;  5FTP A;  1EPU A;  2HO1 A;  4GZD A;  4UWL A;  3QAR A;  4JW1 A;  4ACL A;  1UJJ A;  2NXP A;  3VLE A;  4FJY A;  5D0Q D;  3MJW A;  3G2W A;  5M72 A;  2GRL A;  4APF A;  1LF8 A;  2WXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...