2UWJG

Structure of the heterotrimeric complex which regulates type iii secretion needle formation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
DTSLIRELAELALAGSGQHCHEEALCIAEWLERLGQDEAARLIRISSLANQGRYQEALAFAHGNPWPALEPWFALCEWHLGLGAALDRRLAGLGGSSDPALADFAAGMRAQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III EXPORT PROTEIN PSCE
publication title Structure of the heterotrimeric complex that regulates type III secretion needle formation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF09477 Type_III_YscG Bacterial type II secretion system chaperone protein (type_III_yscG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2uwjG00
4N39A 4UI9C 3ULQA 5JJTA 5BT1A 2PZIA 3CK9A 4W9RA 2IF4A 5JJ6A 2FO7A 2HR2A 3U4TA 2R5SA 4GA2A 1P5QA 4EQFA 3QOUA 3PE4A 1FCHA 3MA5A 1HZ4A 4GZ3A 2HO1A 5C1DA 3ASHA 2AVPA 4G26A 4H7XA 3RU0A 3MKRA 3U3WA 3CKCA 4WNEA 2KCKA 4XIFA 3Q4AB 3FWVA 4APOA 2C0LA 3CVNA 4UQZA 3N71A 3ESKA 3RO2A 3ZHEA 1KLXA 2LSUA 3K9IA 3ZPJA 3CV0A 4HOUA 1TJCA 2FI7A 3RJVA 2KATA 3S7JA 3BEEA 4YVQC 4N3AA 1ZU2A 2XCBA 4AY6A 2LNIA 5KJNA 3LY8A 2PQNA 2KCVA 5EKQD 4BTAA 2YQ8A 5CCLA 3MV2B 2FEZA 1KT1A 5FTPA 3R9AB 4GYYA 3KS2A 3PE3A 2PQRA 3AS5A 3CKBA 3S7DA 3SF4A 4AY5A 3CEQA 4U07A 5EX0A 3TAXA 1WM5A 2VSNA 4HOTA 5KJLA 4I2ZA 4UI9J 5LCWC 2UY1B 3PDNA 3QWVA 2KCLA 2VGXB 4BWRA 3RO3A 3WXXA 2XGMA 3HYMB 4HOSA 5ARFA 3MEKA 4U0SA 1ELRA 4IN3B 3E4BA 3MV3B 2LSVA 2BUGA 4BT9A 5G04C 4G24A 3UPVA 3Q49B 3O48A 5BNWA 5M72A 1WAO1 2C2LA 3Q47B 3CK8A 3ASGA 5FJYA 4UQYA 3LY7A 3LPZA 4ABNA 2FF4A 4I17A 3OXLA 1NA0A 1NA3A 4I1AA 4GCNA 4I9EA 3Q5MA 3Q15A 4WNGA 3QKYA 5BW8C 4JA9A 2Y4UA 4YVOA 3QWPA 1IYGA 4H7YA 2MHKA 4UI9K 3JYSA 3LKUA 1B89A 2L6JA 2WQHA 1ZBPA 4J8FA 3LYAA 3CVQA 3ASFA 2FBNA 2Q7FA 3CK7A 2DBAA 5A7DB 2VYIA 4RG9A 4JA7A 2HYZA 2XPIA 2VGYA 2UY1A 3ZFWA 3FFLA 4GYOA 5A6CA 2VGXA 3KD7A 5HI7A 4N3CA 4AIFA 3OXFA 4CGWA 4N2SA 5D0OD 3GZ2A 4GZ5A 2WPVA 4YNDA 4O6FA 5G05C 2OOEA 3TG4A 5LCWJ 3KAEA 4WUYA 4BT8A 1ELWA 2KC7A 3QWWA 4CGVA 3AS4A 1E96B 5FZSA 4UQXA 4G25A 1KT0A 5DIZA 4J8EA 4Y6CA 5DBKA 5G04J 2E2EA 3ZGQA 3ZN3A 3RKVA 4JHRA 3UUXA 5D0QD 4J8DA 4GA0A 4N2QA 1QQEA 2XGOA 5FT9A 4NQ0A 2VSYA 2C0MA 5KJKA 1NZNA 3VTXA 4KBQA 4GPKA 4HOQA 5HQ8A 1XNFA 4KXKB 3EDTB 4XI0A 4B94A 4BTBA 4N3BA 2IFUA 2P58C 4U0UA 2Y4TA 2GW1A 5FZQA 4N5CA 4G23A 3LY9A 1HH8A 3FP3A 3SZ7A 2YHCA 5JJ7A 1OUVA 3UQ3A 1A17A 4GYWA 2J9QA 1QZ2A 4GZ6A 3RIBA 1IHGA 1W3BA 4WNFA 4GA1A 3NF1A 2PL2A 4F3VA 4NRHB 3TG5A 2UWJG 1Y8MA 4KYOB 3CVPA 3QDNA 3LCAA 1HXIA 3GZ1A 4A1SA 1PC2A 3ZHEB 5G05J 3OXGA 2JLBA 5CHEE 1YA0A 5EX3A 2I6HA 4RG6A 2XEVA 4WNDA 3GW4A 4I9CA 4LEUA 3VTYA 2ONDA 4GCOA 4U04A 3ASDA 3S7FA 3IEGA 4G1TA 4AM9A 5CCMA 2QFCA 5AYWD 4JL0A 4I2WA 5ARGA 5KJMA 4XI9A 3S7BA 4U0ZA 4HORA 3GYZA 4ME2A 4J0UA 2VQ2A 5FZRA 2NC9A 3TGOA 4Y6WA 4CDRA 3CVLA 2V5FA 2XCCA 2XGSA 4G2VA 3URZA 3AS8A
chains in the Genus database with same CATH superfamily
1SVXA 4N39A 3IBEA 3ULQA 5JJTA 4BSXA 3D9MA 3C3RA 5AIJA 1BLXB 3W9GA 3R7RA 3FTSA 3AG2E 3TXMA 2J08A 1H0AA 3U4TA 4EQFA 1QYMA 4A63B 2HO1A 5ANRA 2AVPA 1WY6A 4G26A 3DSSA 3PEVB 4WNEA 3EIQC 4XIFA 3Q4AB 3D9OA 3C3QA 2C0LA 4QFVA 2WXKA 1HS6A 1JUQA 3D9NA 3N71A 5J90A 4PS3A 3ZHEA 1HG2A 1KLXA 3CSTA 2I1KA 5HKPA 2P9UG 1EF1C 2FI7A 1K1BA 3HXDA 3ASNE 3TWWA 5FINA 4CCAA 4PS7A 3BEEA 2PNNA 1E7UA 4LRZA 1IKND 4Q96A 4EPZA 3DSXA 2XCBA 3HG0D 4AY6A 3PNTB 1TN8A 3LY8A 3VLDA 3ZYLA 5EKQD 4F6RD 1OWNA 3MV2B 3UI2A 4GYYA 1UN8A 4RLYA 4JC8A 3RAUA 1OXJA 3S7DA 3HVEA 2V8SE 4AY5A 2P9KG 4OAVB 4TUUA 1X5BA 5D2MC 1O5MA 3Q7AA 3LXUX 2R03A 4UI9J 4YDOA 4UWFA 2KCLA 4BWRA 4C0MA 3AG1E 4Q94A 3CQGB 4HNAD 3AAAC 3CGHA 3L13A 4HB5A 4BY6A 5KCMA 3U64A 3UM1A 2EIME 4BT9A 3ABME 4G24A 3UPVA 3B7RL 4DRXE 5BNWA 4E85A 3V30A 4JB8P 3CHPA 5FJYA 1TNBA 2A5EA 4UQYA 2ILRA 3L54A 4ABNA 4KMOA 1NA0A 3TWXA 1UW4B 4I1AA 4I9EA 3ZXSA 3PREA 4U96D 3QKYA 3Q9NC 1TR4A 2KBXA 3FUMA 4TXRA 4H7YA 5EIDA 1B89A 2WQHA 2XPZA 4DK5A 3U9WA 4C9BB 1ZBPA 2F0YA 3LYAA 3UT4A 1SW6A 3ABLE 4RSYA 5CEDB 3CVQA 4A3VA 1HF8A 2FBNA 3CK7A 2MYOA 2GRRB 3C72A 1Z5SC 3QJZA 1OWLA 5A7DB 3LVRE 3LVQE 4GTTA 3FFLA 4J7WA 5EYLA 4U8HA 5LX8A 1WG0A 2CFUA 5ENOD 3GZ2A 4GZ5A 4LNBA 1E8YA 3EHQA 3KSLA 3KAEA 1ELWA 2Y69E 2OVBA 5ENNA 2E0IA 3QWWA 1HG5A 2P9PG 4PH4B 4FHJA 4I6JA 1N4PA 3EHNA 2GRMA 4OVVA 1G3NB 5FZSA 4TXQA 4UQXA 4J8EA 2QYJA 2AXUA 4Y6CA 3EU5A 3ZU7B 5KBAA 4U63A 3RKVA 3J5PA 2EILE 4IYPA 3IHVA 3PUJA 2XGOA 1N52A 2WXIA 3DWLG 4DX7D 3B7UX 2AJAA 3NZUA 3MZLB 1SZ9A 1XNFA 3EDTB 2IFUA 1TNUA 1N4SA 3DSUA 1UJKA 5BUZA 3E34A 3ML9A 2Y4TA 5CRVA 4BERA 3C3OA 5IY5E 4G23A 4DPRA 3LY9A 4AEZC 1UOHA 1NL4A 2VJ8A 1LTXA 2X38A 5LP0A 3PS6A 4UWLA 1OY3D 4HI9A 3NB2A 5ENSD 5CEAA 5JA4D 3Q7FA 1A17A 4Q69A 4GYWA 4GZCA 4AV7A 4GB9A 3TG5A 1S64A 2UWJG 3LCAA 4GTQA 2NXPA 4MS6A 4TUMA 1XGWA 4BFRA 3C98A 5G05J 2OEVA 3OXGA 4EZLA 2V4HC 1GW6A 3GW4A 1FT2A 2OEWA 4M3OA 4U04A 3S7FA 3TL5A 4G1TA 3FY4A 3FTXA 1TNOA 3TWRA 5ANLA 2P9IG 4JL0A 4I2WA 1SZAA 4JD2G 2WMOA 4FJZA 4U8VD 2VQ2A 3TGOA 3Q73A 2H6IA 3CVLA 2WXFA 3PZ4A 1BI8B 1S0PA 3D9KA 3DPYA 4UI9C 4JEUA 2YNQA 3JXIA 3UKUG 5BT1A 2PZIA 2GRPB 4K0RA 2A4ZA 4CDNA 2IF4A 3FUNA 2QC9A 1O1TA 4UUCA 4GA2A 1HO8A 1U3DA 4UWHA 4KZCA 4GZ3A 5C1DA 1FT1A 4H7XA 5HS0A 1SQMA 2KCKA 3PVLA 4APOA 1DC2A 3UM0A 3CVNA 4DLOA 5ENTD 3CVUA 1AWCB 2LSUA 2WXGA 3D9JA 3ZPJA 3FU0A 3CV0A 2WXRA 4ANUA 3ENEA 1S70B 3V79K 2QZAA 3RJVA 4FHKA 2KATA 5AARA 4ILGA 5CMWA 3FEXA 1LF8A 2Y1LE 1ZU2A 1OWMA 3MKQB 4WAFA 4YDYA 4BESA 2LNIA 4ZFHA 3DPDA 5KJNA 2PQNA 2KCVA 4BTAA 2YQ8A 5CCLA 4FU3A 3IV0A 1KT1A 3R9AB 2QYUA 3SGHA 1DVPA 4CEMA 5ENRD 3JQ1A 3AS5A 3CKBA 3SF4A 3ABKE 2XHEA 5G55A 3LJ3A 2JABA 3Q75A 4U07A 3ZW3A 3TAXA 2J09A 2VSNA 5EIBE 1OCCE 5J08A 4I2ZA 5ENPD 2UY1B 3QWVA 1A5EA 2VGXB 1PY1A 3RO3A 3WXXA 3PUKA 5ARFA 5KNHD 5CBOA 4FADA 1MX6A 4G11A 1E7VA 3CHMA 1WDYA 5AQBA 3EHRA 3MV3B 3WG7E 2CHWA 3Q49B 2J4DA 1PAQA 3FTUA 3ULYA 2FO1E 2EIJE 2C2LA 2ZU6B 2H6HA 4U7EB 2XENA 3DSWA 4YDWA 2LXLA 4GTSA 5T3RA 3LPZA 1K3ZD 3OTNA 1VDYA 2LO6A 2KM4A 3PRZA 4F1SA 1NA3A 3CSFA 4GCNA 3BUAA 3Q5MA 4JW1A 3Q15A 4WNGA 1S63A 2P9NG 4DLQA 1H6KA 4Z68A 4AVXA 2CHXA 2Y4UA 4B93B 3IHYA 3AG3E 1IYGA 4I1MA 5A23A 3U66A 1V55E 1FPPA 1IQUA 1BU9A 4HRMB 3Q78A 1N54A 4HLLA 2DVWA 4KZ0A 3ZKJA 3R9MA 3E30A 3ZYKA 1MX4A 3FUDA 4F1PA 4HQDA 2HYZA 3UX4A 1ZB1A 2RFMA 3CVWA 2VGYA 3ZFWA 2R17C 1LD8A 2RFAA 4AIFA 2WQ6A 4N2SA 1HFAA 5D0OD 3TWVA 2L0TB 2WXPA 1U3CA 5G05C 2OOEA 3TG4A 3FTVA 3ISMC 1NFIE 3KEAA 2WM9A 2B6CA 2BKKB 2RKKA 1E96B 2ZIRA 4JHKA 1KT0A 1TEZA 1TYQG 2BEDA 4BETA 5DBKA 3ZGQA 3ONLA 3J5QB 4GTVA 2EQXA 1MJ0A 3UUXA 3CHQA 2XS8A 4N2QA 1L5JA 4KVMA 2C0MA 5KJKA 3D9PA 2AW6A 4R7LA 3RSEG 4U8YD 4DJAA 4GPKA 1N95A 2ZXWE 4HOQA 3BG0B 2NYJA 2Y3AA 4XI0A 1Y6IA 2R2LA 5B1BE 4N3BA 1LD7A 1RW2A 4L7TA 3I3NA 4U0UA 4AXHA 2GW1A 3UIPC 4IULA 1OCRE 5FZQA 1Z3YA 3TWQA 3QAQA 4N5CA 3E32A 3TWTA 4DI4A 3ESLA 3UINC 3V31A 3FP3A 3SZ7A 2CG3A 4NURA 5EDSA 3UQ3A 2VTBB 4I43A 2J9QA 1QZ2A 4GZ6A 2WVIA 3RIBA 1IHGA 4WNFA 3NF1A 4F3VA 5B3SE 1TJFA 1OCOE 1N4QA 3G2UA 4CZ2D 4KT6B 4A1SA 2DYRE 1PC2A 4DX5D 5LFAA 4UWKA 5CHEE 3JCKC 1TNZA 4AJWA 4L2YA 3DXMG 2I6HA 1H6OA 2PM7A 3PZ3A 3ZUVB 3ZRHA 4I9CA 3T8KA 5AAOA 3L6AA 3VTYA 3JUIA 3L22A 3IEGA 4JVSA 1IHBA 4GAAA 4G8LA 3EUVA 1MHQA 2RD0A 3UM2A 4BX8A 1JWFA 5AYWD 5KJMA 4V3IA 3GYZA 2NC9A 2EINE 4HS2A 3ZIMA 4Y6WA 2R02A 3JXJA 1Q2ZA 2XGSA 5EN5D 1AP7A 2MOWA 3JQ0A 3TWUA 2HE0A 3AS8A 3V2XA 3OAWA 3P1UA 3FTZA 4BSZB 2RG8A 2DCPA 3APCA 3G2TA 3CK9A 4JEHA 4XEIG 3T8MA 1DCEA 4GMLA 4EHMA 2HR2A 2R5SA 1P5QA 3PE4A 2L6BA 1HZ4A 4ANWA 4EZJA 3RU0A 1H6PA 1EYHA 3U3WA 4LNUD 1MQSA 3CKCA 3AU5A 2J49A 4HFGA 4ZHBA 3FWVA 1FVFA 3SHFA 1NI1A 2LUHA 3ESKA 1U2VG 3RO2A 1X81A 4K5CA 2XZTG 3K9IA 4ILIA 4O60A 1OT8A 4HOUA 2CHZA 2BTDA 2KZTA 4GTPA 2IQCA 2ETAA 2GGFA 3FUJA 3D9HA 4AP2A 4YVQC 5T8IA 3CVXA 3SFXA 4GMJA 3X2QE 4C48B 2I9CA 2A5UA 2I1JA 2M63A 5JMND 4FULA 3FUKA 2KZTB 2FEZA 4J6IA 5FQ7A 1KZOA 5FTPA 3UT7A 2NSZA 1N0RA 3ZXPA 5BV0A 4B8CB 3KS2A 5KWDA 3PE3A 3RK6A 3T5XA 4MLPA 4J8SA 2QY7A 1Z6TA 3CHOA 2XZDG 3CEQA 5EYPF 3PNLB 1HU3A 1INZA 4HOTA 3FU5A 3BQOA 1N4RA 2BKGA 3IKOB 3VLEA 5BXOA 1OWOA 3T9KA 4I1OB 1H2VC 1UG3A 1JWGA 1N0QA 3I5PA 5FQ8A 3SQVA 3MEKA 4U0SA 1ELRA 1MX2A 4O1OA 5B1AE 3E4BA 2XS1A 2ZGGA 4FA6A 2LSVA 5AQ7A 4DI3A 4P29A 5M72A 3FUIA 4KVOA 4F53A 4E6HA 3HDXA 4G8KA 4ILHB 1HE8A 4ACLA 3FHEA 3CK8A 3ASGA 3FU6A 3JUEA 2J4BA 1N9AA 3PZDA 4PS8A 4N5QA 2IO2C 2H6FA 4I17A 3OXLA 2XEHA 2GROB 3RRMB 3L08A 3ONKA 3CLJA 4L9PA 3SFYA 3MKQA 4HVBA 1JPLA 2Y0BG 4JA9A 4YVOA 1N94A 1DNPA 4JPSA 3E33A 2J07A 2MHKA 2ZGDA 3W9FA 3FEYA 3UKRG 4J8FA 2F37A 4LERA 2Q7FA 4WWNA 4NIKA 4X8QA 2YHEA 5CERB 3B7BA 5EILA 2VYIA 4RG9A 4JA7A 3UIOC 3UTMA 2XPIA 3PH0C 2V5QC 2UY1A 1JCQA 4GYOA 3TXNA 2JEKA 5A6CA 2VGXA 3KD7A 3L17A 4CYMD 3OXFA 4M7CA 4RQIA 2HM8A 4CGWA 2WPVA 4YNDA 1O1SA 3HXBA 4O6FA 3EJNA 3FUEA 3MGBA 5LCWJ 3RRNB 2ZISA 4BT8A 2V4LA 4JZYA 2KC7A 3L9TA 2GRLA 4CGVA 4DX6D 5BV1A 3LEWA 5DIZA 1YMPA 4GPMA 4DX2A 5G04J 3CVVA 4OAUC 3CIAA 5AQ9A 1EDUA 5FQ4A 1H2TC 4GA0A 1H19A 3APDA 3UXGA 2X6FA 5FT9A 3L16A 4NQ0A 2VSYA 4OVUA 2YINA 3DEOA 3VTXA 1YCSB 4KBQA 4XZ4A 2DWZA 3NQPA 1N11A 4KXKB 4EBAG 5ITZF 3ULEG 4XE0A 1K8KG 3FU3A 2F8XK 2LAIA 3ZEFA 2IEJA 3SBTB 3ZYQA 4NACA 4HI8A 1HH8A 3DSVA 2IU1A 3L82A 5JJ7A 4AOFA 5CRUA 4K5BA 3NZSA 2IOSA 3HXFA 1BPOA 5E76A 1RZ4A 3FTWA 1W3BA 2R59A 2WXMA 4GA1A 5FQ6A 2PL2A 2WXLA 4LUNU 2WXOA 4NRHB 2EIKE 5AQAA 3CVPA 1OCZE 1QBQA 3D3MA 3ZNGA 3GZ1A 2I2OA 4XX5A 3ZHEB 4A1GA 5CMYA 4RG6A 2DZOA 3NOGD 2X6HA 4WNDA 2PM6A 4LEUA 4MKTA 2BF0X 3D9LA 2ONDA 3ASDA 3PZ2A 1SA5A 5ENQD 4AM9A 4EZKA 5CCMA 1BD8A 4FJYA 3LDZA 4C0EA 1BI7B 4LNGA 4LSZE 4XI9A 3ASOE 3B13A 3DRAA 3CHRA 5AENA 1D8EA 4TXPA 5FZRA 1JCRA 4I6GA 2X3MA 3C5RA 2V5FA 3LS8A 3ML8A 3EU9A 1YYHA 3GZSA 3DBSA 3FUHA 3IXEA 2LXMA 2WQ7A 1D8DA 2FULA 3HVEB 1MYOA 2KXPC 3AG4E 3DSTA 3APFA 4GZDA 3FTYA 3RRUA 4W9RA 4URKA 4TV3A 5JJ6A 2FO7A 2VTBA 3QOUA 4MBGA 1FCHA 3MA5A 4GU5A 3ASHA 4D10C 1IQRA 4LG6A 4CDMA 3MKRA 3FUFA 4DX1A 3BU8A 4HXIA 4UQZA 1OWPA 3HHMA 3PZ1A 3SBSA 5JHAA 1V54E 3B7SA 4FLBA 5AJLA 2IJGX 1D9SA 2P9LG 3SNXA 1TJCA 4HBDA 2B0OE 4LCTA 3HRAA 3O4ZA 3EHMA 3S7JA 5AJDA 3FH8A 4N3AA 2X6KA 1TNYA 1E90A 3AU4A 3AJIA 4MRUA 3B7TA 4JXTA 2VGEA 5BXUA 4J8YA 3T5VA 2PQRA 3FDHA 1O1RA 1UN9A 3CHSA 4HRNA 3MCXA 1E8XA 5EX0A 1WM5A 1QNFA 3I4GA 4XKBA 2IOLA 2OVFA 2V0PA 5KJLA 4O1PA 5LCWC 3PDNA 1KPSB 5HRYA 4RVBA 5LOZA 3MYVA 2ETBA 5KNGA 4ANVA 4L2LA 2VSXE 2CG2A 3DEPA 4YDEA 2XGMA 3ZYMA 2XPYA 3HYMB 4HOSA 4IN3B 4PUCA 5FIOA 2BUGA 2XRYA 3G2VA 5CECB 5G04C 3O48A 3MX3A 3NOCD 1FVHA 3D9IA 2WB2A 1WAO1 3SD5A 3QC1A 3Q47B 3LY7A 4ANXA 4ATZD 3LJNA 3TWSA 2FF4A 1SA4A 2X6JA 3HXEA 1H2UA 1MZCA 5FWQA 4ATGA 1TN6A 3BG1B 3NBNB 5BW8C 1HX8A 2ETCA 3VLFA 3QWPA 4A55A 5T4YA 1KZPA 4UI9K 4B8AA 3JYSA 3LKUA 3UMVA 2L6JA 4XKCA 2OCCE 2CFZA 4PDXA 4UWGA 4EBAA 2DZNA 1K1AA 3ASFA 3G2SA 3QARA 3PEUB 3I4RB 1Z3XA 5JHBA 2DBAA 1UJJA 2XRZA 3Q79A 5H7PA 2R05A 3FH5A 1NP7A 3S2AA 4HRLA 3QNKA 2WXJA 3KEZA 2OV8A 3FULA 5HI7A 4B89A 2XQ0A 4N3CA 2GRNB 2L0IA 1DCQA 4GMRA 2XEEA 3HXCA 4I6EA 2VSOE 2WMNA 3HIZA 3F6QA 4WUYA 2LAHA 3QB2A 2AXVA 2P9SG 2H6GA 3AS4A 4K5AB 2P2CP 4CT0A 1E8WA 3CR3A 4JHJA 4G25A 5E75A 3UT8A 4APFA 2E2EA 2AXZA 3ZN3A 4CRWA 2MRIA 4JHRA 2AWIA 4CT4A 2GRQB 3R7QA 5D0QD 3QK0A 3FH7A 4J8DA 2J8SD 1QQEA 3NAWA 2IO3C 3CQCB 1NZNA 4F7AA 2IONA 4GTRA 3P2BA 2X6IA 4L23A 2DYSE 5CBNA 1E8ZA 4GTOA 5G2NA 5HQ8A 4K03A 4B94A 4BTBA 4BEPA 2WXNA 2P58C 4A3TA 1ELKA 3ZVVA 4HLEA 4TRQA 4WWOA 5AN8A 3SFZA 4WWPA 3B95A 5D66A 3SY2A 2YHCA 1OUVA 3TJPA 1EPUA 4GTMA 3SI5A 3Q9UC 4EECA 4ACKA 3MJWA 1Y8MA 4KYOB 4BX9A 5BPPA 3QDNA 2L9BA 1HXIA 4B0ZA 2IY0C 4U95D 3V2OA 4FP7A 3EIJA 2JLBA 4FC8A 4OYSA 4DUIA 1TN7A 1IXVA 1YA0A 5EX3A 4QQIA 4FLHA 3E37A 3KSQA 2F8YA 3G2WA 2XEVA 3SO8A 4GCOA 3CVYA 2DIWA 3DXKG 5C2YA 3UM3A 2QFCA 2WXHA 5ARGA 2WXQA 3S7BA 4U0ZA 1JCSA 4HORA 4ME2A 4J0UA 4IRUA 4L1BA 4CDRA 2XCCA 4G2VA 3URZA
chains in the Genus database with same CATH topology
1S0PA 3D9KA 4N39A 4UI9C 3IBEA 4JEUA 2YNQA 3OAWA 2WQ7A 3P1UA 3FTZA 2FULA 3ULQA 5JJTA 4BSXA 3HVEB 5BT1A 3D9MA 2RG8A 2DCPA 3APCA 5AIJA 2PZIA 3G2TA 3CK9A 4JEHA 3R7RA 3FTSA 4K0RA 3T8MA 2A4ZA 3TXMA 3APFA 4GZDA 2J08A 3FTYA 3RRUA 4W9RA 4CDNA 1H0AA 4URKA 2IF4A 3FUNA 4TV3A 5JJ6A 4GMLA 2FO7A 2HR2A 3U4TA 2R5SA 4GA2A 1HO8A 2VTBA 1P5QA 4EQFA 3QOUA 3PE4A 1U3DA 4UWHA 4KZCA 1FCHA 3MA5A 4GU5A 1HZ4A 4GZ3A 2HO1A 5C1DA 3ASHA 5ANRA 4D10C 1IQRA 4ANWA 2AVPA 1WY6A 4G26A 4EZJA 4H7XA 3RU0A 4CDMA 3MKRA 3FUFA 3PEVB 1EYHA 3U3WA 1MQSA 3CKCA 1SQMA 3AU5A 4WNEA 4HXIA 2J49A 2KCKA 3EIQC 4XIFA 3Q4AB 3PVLA 3D9OA 4HFGA 3FWVA 4APOA 1FVFA 3SHFA 2C0LA 3CVNA 4QFVA 2WXKA 1HS6A 4UQZA 1OWPA 1JUQA 3D9NA 3N71A 3HHMA 4DLOA 5J90A 3ESKA 3SBSA 3RO2A 5JHAA 4PS3A 3ZHEA 3CVUA 1HG2A 1KLXA 2LSUA 2WXGA 2I1KA 3B7SA 3CSTA 3D9JA 3K9IA 4FLBA 5AJLA 3ZPJA 2IJGX 4ILIA 3FU0A 3CV0A 2WXRA 4ANUA 3SNXA 4HOUA 1TJCA 3ENEA 2CHZA 4LCTA 2BTDA 1EF1C 2FI7A 2KZTA 3O4ZA 3EHMA 3RJVA 4FHKA 2IQCA 2GGFA 3FUJA 4AP2A 2KATA 4ILGA 4CCAA 4PS7A 5CMWA 3S7JA 3FEXA 3BEEA 5AJDA 4YVQC 5T8IA 1E7UA 1LF8A 3CVXA 4LRZA 3FH8A 4Q96A 4GMJA 4EPZA 4N3AA 1ZU2A 1OWMA 3MKQB 2XCBA 4WAFA 2X6KA 4AY6A 2I9CA 3PNTB 2A5UA 2I1JA 2LNIA 5KJNA 3DPDA 3LY8A 1E90A 2PQNA 3VLDA 2KCVA 3AU4A 3ZYLA 5EKQD 4BTAA 2YQ8A 1OWNA 5CCLA 4FU3A 2M63A 3MV2B 4FULA 3FUKA 4MRUA 3B7TA 2KZTB 2FEZA 4J6IA 5FQ7A 3IV0A 1KT1A 4JXTA 5FTPA 3R9AB 3UT7A 2NSZA 4GYYA 3SGHA 1DVPA 4CEMA 1UN8A 5BV0A 4B8CB 3KS2A 3JQ1A 4JC8A 3T5VA 3PE3A 3RK6A 2PQRA 3AS5A 3CKBA 3FDHA 3S7DA 3SF4A 3T5XA 1UN9A 4MLPA 3HVEA 4J8SA 2XHEA 2QY7A 2V8SE 3CHSA 4AY5A 1Z6TA 3CHOA 5G55A 3MCXA 3CEQA 3LJ3A 4TUUA 4U07A 1E8XA 1X5BA 5EX0A 3ZW3A 3TAXA 1WM5A 1QNFA 3I4GA 1HU3A 3PNLB 2J09A 2VSNA 1INZA 4XKBA 4HOTA 5J08A 2IOLA 2OVFA 2V0PA 3FU5A 3LXUX 4I2ZA 4UI9J 5KJLA 5LCWC 2UY1B 3PDNA 3IKOB 3QWVA 3VLEA 4RVBA 4UWFA 2KCLA 2VGXB 5LOZA 4BWRA 1OWOA 3MYVA 4ANVA 1PY1A 4I1OB 3RO3A 4C0MA 1H2VC 4Q94A 3WXXA 4L2LA 2VSXE 3PUKA 1UG3A 1JWGA 2CG2A 2XGMA 3ZYMA 3CQGB 2XPYA 3HYMB 3I5PA 5FQ8A 3CGHA 3L13A 5ARFA 4HOSA 4BY6A 3MEKA 4FADA 4U0SA 5KCMA 4G11A 1E7VA 3CHMA 1ELRA 4IN3B 3U64A 3E4BA 3MV3B 4PUCA 4FA6A 2LSVA 2BUGA 2XRYA 3G2VA 4BT9A 5G04C 4G24A 2CHWA 3UPVA 3Q49B 3O48A 2J4DA 3B7RL 3MX3A 4DI3A 5BNWA 1FVHA 4P29A 5M72A 1PAQA 3D9IA 3FTUA 3FUIA 2WB2A 4KVOA 1WAO1 3SD5A 4F53A 4E6HA 3HDXA 4E85A 4ILHB 3QC1A 2C2LA 2ZU6B 1HE8A 3Q47B 4ACLA 3FHEA 3CK8A 3CHPA 3ASGA 3FU6A 5FJYA 4UQYA 3LY7A 4ANXA 2J4BA 5T3RA 2ILRA 3LPZA 3PZDA 4PS8A 3L54A 4ABNA 2FF4A 3OTNA 4I17A 4KMOA 3OXLA 2X6JA 1VDYA 1NA0A 2LO6A 2KM4A 3PRZA 4F1SA 1NA3A 1UW4B 3CSFA 4GCNA 1H2UA 4I1AA 4I9EA 3Q5MA 3RRMB 3L08A 4JW1A 5FWQA 3Q15A 3ONKA 4WNGA 3CLJA 4ATGA 4DLQA 3BG1B 3MKQA 1H6KA 3ZXSA 4HVBA 3PREA 3QKYA 1JPLA 5BW8C 1HX8A 4AVXA 2CHXA 4JA9A 2Y4UA 4YVOA 3VLFA 1DNPA 3QWPA 4JPSA 4A55A 3IHYA 5T4YA 3FUMA 1IYGA 4H7YA 2J07A 2MHKA 4UI9K 4B8AA 4I1MA 5A23A 3JYSA 3LKUA 3U66A 1B89A 3UMVA 2L6JA 2WQHA 4XKCA 2XPZA 4DK5A 3FEYA 3U9WA 4C9BB 1ZBPA 2CFZA 4J8FA 3LYAA 1IQUA 4PDXA 4UWGA 3UT4A 4RSYA 3CVQA 4EBAA 4A3VA 1HF8A 3ASFA 1N54A 2FBNA 2Q7FA 3CK7A 3G2SA 4LERA 4WWNA 3QARA 3PEUB 2YHEA 3I4RB 1Z3XA 4KZ0A 5JHBA 3QJZA 2DBAA 1UJJA 1OWLA 3ZYKA 2XRZA 5A7DB 3LVRE 3LVQE 3FUDA 2VYIA 4RG9A 4JA7A 2HYZA 3UX4A 2XPIA 3PH0C 3CVWA 3FH5A 1NP7A 2UY1A 2VGYA 3S2AA 3FFLA 4GYOA 3TXNA 2JEKA 3ZFWA 2VGXA 5A6CA 3KD7A 3QNKA 2WXJA 3KEZA 2OV8A 3FULA 2R17C 5HI7A 4B89A 4U8HA 2XQ0A 4N3CA 3L17A 4AIFA 5LX8A 2WQ6A 3OXFA 2CFUA 2HM8A 4CGWA 4N2SA 1HFAA 2L0IA 3GZ2A 4GZ5A 5D0OD 2WPVA 4YNDA 4O6FA 2L0TB 2WXPA 3EJNA 2VSOE 1E8YA 2WMNA 4I6EA 1U3CA 5G05C 3FUEA 3MGBA 2OOEA 3TG4A 5LCWJ 3HIZA 3FTVA 3KAEA 3RRNB 4WUYA 4BT8A 1ELWA 2V4LA 4JZYA 2KC7A 2LAHA 3QB2A 2AXVA 2OVBA 5ENNA 2E0IA 3QWWA 1HG5A 2GRLA 4CGVA 3AS4A 4PH4B 5BV1A 4FHJA 2WM9A 4I6JA 4CT0A 1E8WA 3EHNA 2GRMA 3CR3A 3LEWA 1E96B 4OVVA 5FZSA 4JHJA 4UQXA 4G25A 1KT0A 4JHKA 1TEZA 5DIZA 4J8EA 5E75A 2AXUA 4Y6CA 3UT8A 5DBKA 5G04J 2E2EA 3ZGQA 2AXZA 4APFA 3CVVA 3ZN3A 4U63A 3ONLA 3CIAA 3RKVA 4CRWA 2EQXA 2MRIA 4JHRA 2AWIA 3UUXA 1EDUA 4CT4A 4IYPA 3R7QA 5FQ4A 1H2TC 3CHQA 5D0QD 3QK0A 3FH7A 4J8DA 3IHVA 4GA0A 1H19A 3APDA 3PUJA 4N2QA 1QQEA 1L5JA 2X6FA 2XGOA 1N52A 3L16A 5FT9A 2WXIA 4NQ0A 2VSYA 4OVUA 2YINA 4KVMA 2C0MA 3CQCB 5KJKA 1NZNA 3VTXA 3D9PA 4F7AA 2IONA 2AW6A 4KBQA 4XZ4A 4R7LA 3P2BA 4DJAA 4GPKA 2X6IA 4L23A 4HOQA 1E8ZA 3B7UX 3BG0B 3NQPA 3NZUA 5G2NA 3MZLB 5HQ8A 1SZ9A 1XNFA 2Y3AA 3EDTB 4K03A 4KXKB 4XI0A 1Y6IA 4EBAG 4B94A 4BTBA 4N3BA 2WXNA 4L7TA 2IFUA 2P58C 4A3TA 1UJKA 4XE0A 5BUZA 3I3NA 4U0UA 3ML9A 2Y4TA 1ELKA 4AXHA 2GW1A 3ZVVA 3FU3A 4IULA 4TRQA 4WWOA 1Z3YA 5FZQA 3SFZA 4HLEA 2LAIA 4WWPA 3QAQA 3ZEFA 4N5CA 4G23A 4DPRA 3LY9A 4AEZC 2VJ8A 3SBTB 4DI4A 3ESLA 2X38A 3ZYQA 4NACA 5LP0A 1HH8A 3FP3A 3SZ7A 2CG3A 2IU1A 3PS6A 4NURA 2YHCA 5EDSA 4UWLA 5JJ7A 1OUVA 3UQ3A 3TJPA 4AOFA 1EPUA 2VTBB 3NZSA 4I43A 2IOSA 1A17A 3SI5A 4Q69A 1BPOA 4GYWA 5E76A 2J9QA 1QZ2A 4GZ6A 4EECA 2WVIA 4GZCA 3FTWA 3RIBA 1IHGA 1W3BA 4WNFA 2R59A 2WXMA 4AV7A 4GA1A 3NF1A 2PL2A 5FQ6A 4ACKA 2WXLA 3MJWA 4GB9A 4F3VA 4LUNU 2WXOA 4NRHB 3TG5A 2UWJG 1Y8MA 4KYOB 1TJFA 4BX9A 5BPPA 3CVPA 3QDNA 3LCAA 2L9BA 1HXIA 4B0ZA 2NXPA 3D3MA 3G2UA 3GZ1A 4MS6A 1XGWA 4BFRA 2I2OA 4KT6B 3C98A 4A1SA 4XX5A 4FP7A 1PC2A 3ZHEB 5G05J 3EIJA 4A1GA 3OXGA 2JLBA 5LFAA 4UWKA 5CHEE 5CMYA 3JCKC 4FC8A 4AJWA 4OYSA 1YA0A 4L2YA 5EX3A 4EZLA 2I6HA 2PM7A 4FLHA 4RG6A 1GW6A 3G2WA 2XEVA 2X6HA 4WNDA 3GW4A 3ZRHA 2PM6A 4I9CA 4LEUA 3L6AA 4MKTA 3VTYA 2BF0X 4M3OA 3D9LA 2ONDA 4GCOA 4U04A 3ASDA 3JUIA 3L22A 3S7FA 3TL5A 3IEGA 4JVSA 4GAAA 3CVYA 4G1TA 3FY4A 2DIWA 5C2YA 1MHQA 3FTXA 4AM9A 2RD0A 4EZKA 5CCMA 4BX8A 5ANLA 1JWFA 2QFCA 2WXHA 5AYWD 4FJYA 4JL0A 4I2WA 5ARGA 3LDZA 2WXQA 4C0EA 5KJMA 4XI9A 1SZAA 3B13A 4V3IA 3S7BA 4U0ZA 3CHRA 5AENA 4HORA 2WMOA 3GYZA 4FJZA 4J0UA 4ME2A 3FUHA 2VQ2A 5FZRA 2NC9A 4HS2A 4IRUA 3ZIMA 4I6GA 4Y6WA 3TGOA 4L1BA 4CDRA 2X3MA 3CVLA 2WXFA 2V5FA 2XCCA 3LS8A 3ML8A 2XGSA 2MOWA 3GZSA 3JQ0A 4G2VA 3URZA 3AS8A 3DBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N39 A;  4UI9 C;  3ULQ A;  5JJT A;  5BT1 A;  2PZI A;  3CK9 A;  4W9R A;  2IF4 A;  5JJ6 A;  2FO7 A;  2HR2 A;  3U4T A;  2R5S A;  4GA2 A;  1P5Q A;  4EQF A;  3QOU A;  3PE4 A;  1FCH A;  3MA5 A;  1HZ4 A;  4GZ3 A;  2HO1 A;  5C1D A;  3ASH A;  2AVP A;  4G26 A;  4H7X A;  3RU0 A;  3MKR A;  3U3W A;  3CKC A;  4WNE A;  2KCK A;  4XIF A;  3Q4A B;  3FWV A;  4APO A;  2C0L A;  3CVN A;  4UQZ A;  3N71 A;  3ESK A;  3RO2 A;  3ZHE A;  1KLX A;  2LSU A;  3K9I A;  3ZPJ A;  3CV0 A;  4HOU A;  1TJC A;  2FI7 A;  3RJV A;  2KAT A;  3S7J A;  3BEE A;  4YVQ C;  4N3A A;  1ZU2 A;  2XCB A;  4AY6 A;  2LNI A;  5KJN A;  3LY8 A;  2PQN A;  2KCV A;  5EKQ D;  4BTA A;  2YQ8 A;  5CCL A;  3MV2 B;  2FEZ A;  1KT1 A;  5FTP A;  3R9A B;  4GYY A;  3KS2 A;  3PE3 A;  2PQR A;  3AS5 A;  3CKB A;  3S7D A;  3SF4 A;  4AY5 A;  3CEQ A;  4U07 A;  5EX0 A;  3TAX A;  1WM5 A;  2VSN A;  4HOT A;  5KJL A;  4I2Z A;  4UI9 J;  5LCW C;  2UY1 B;  3PDN A;  3QWV A;  2KCL A;  2VGX B;  4BWR A;  3RO3 A;  3WXX A;  2XGM A;  3HYM B;  4HOS A;  5ARF A;  3MEK A;  4U0S A;  1ELR A;  4IN3 B;  3E4B A;  3MV3 B;  2LSV A;  2BUG A;  4BT9 A;  5G04 C;  4G24 A;  3UPV A;  3Q49 B;  3O48 A;  5BNW A;  5M72 A;  1WAO 1;  2C2L A;  3Q47 B;  3CK8 A;  3ASG A;  5FJY A;  4UQY A;  3LY7 A;  3LPZ A;  4ABN A;  2FF4 A;  4I17 A;  3OXL A;  1NA0 A;  1NA3 A;  4I1A A;  4GCN A;  4I9E A;  3Q5M A;  3Q15 A;  4WNG A;  3QKY A;  5BW8 C;  4JA9 A;  2Y4U A;  4YVO A;  3QWP A;  1IYG A;  4H7Y A;  2MHK A;  4UI9 K;  3JYS A;  3LKU A;  1B89 A;  2L6J A;  2WQH A;  1ZBP A;  4J8F A;  3LYA A;  3CVQ A;  3ASF A;  2FBN A;  2Q7F A;  3CK7 A;  2DBA A;  5A7D B;  2VYI A;  4RG9 A;  4JA7 A;  2HYZ A;  2XPI A;  2VGY A;  2UY1 A;  3ZFW A;  3FFL A;  4GYO A;  5A6C A;  2VGX A;  3KD7 A;  5HI7 A;  4N3C A;  4AIF A;  3OXF A;  4CGW A;  4N2S A;  5D0O D;  3GZ2 A;  4GZ5 A;  2WPV A;  4YND A;  4O6F A;  5G05 C;  2OOE A;  3TG4 A;  5LCW J;  3KAE A;  4WUY A;  4BT8 A;  1ELW A;  2KC7 A;  3QWW A;  4CGV A;  3AS4 A;  1E96 B;  5FZS A;  4UQX A;  4G25 A;  1KT0 A;  5DIZ A;  4J8E A;  4Y6C A;  5DBK A;  5G04 J;  2E2E A;  3ZGQ A;  3ZN3 A;  3RKV A;  4JHR A;  3UUX A;  5D0Q D;  4J8D A;  4GA0 A;  4N2Q A;  1QQE A;  2XGO A;  5FT9 A;  4NQ0 A;  2VSY A;  2C0M A;  5KJK A;  1NZN A;  3VTX A;  4KBQ A;  4GPK A;  4HOQ A;  5HQ8 A;  1XNF A;  4KXK B;  3EDT B;  4XI0 A;  4B94 A;  4BTB A;  4N3B A;  2IFU A;  2P58 C;  4U0U A;  2Y4T A;  2GW1 A;  5FZQ A;  4N5C A;  4G23 A;  3LY9 A;  1HH8 A;  3FP3 A;  3SZ7 A;  2YHC A;  5JJ7 A;  1OUV A;  3UQ3 A;  1A17 A;  4GYW A;  2J9Q A;  1QZ2 A;  4GZ6 A;  3RIB A;  1IHG A;  1W3B A;  4WNF A;  4GA1 A;  3NF1 A;  2PL2 A;  4F3V A;  4NRH B;  3TG5 A;  2UWJ G;  1Y8M A;  4KYO B;  3CVP A;  3QDN A;  3LCA A;  1HXI A;  3GZ1 A;  4A1S A;  1PC2 A;  3ZHE B;  5G05 J;  3OXG A;  2JLB A;  5CHE E;  1YA0 A;  5EX3 A;  2I6H A;  4RG6 A;  2XEV A;  4WND A;  3GW4 A;  4I9C A;  4LEU A;  3VTY A;  2OND A;  4GCO A;  4U04 A;  3ASD A;  3S7F A;  3IEG A;  4G1T A;  4AM9 A;  5CCM A;  2QFC A;  5AYW D;  4JL0 A;  4I2W A;  5ARG A;  5KJM A;  4XI9 A;  3S7B A;  4U0Z A;  4HOR A;  3GYZ A;  4ME2 A;  4J0U A;  2VQ2 A;  5FZR A;  2NC9 A;  3TGO A;  4Y6W A;  4CDR A;  3CVL A;  2V5F A;  2XCC A;  2XGS A;  4G2V A;  3URZ A;  3AS8 A; 
#chains in the Genus database with same CATH topology
 1SVX A;  4N39 A;  3IBE A;  3ULQ A;  5JJT A;  4BSX A;  3D9M A;  3C3R A;  5AIJ A;  1BLX B;  3W9G A;  3R7R A;  3FTS A;  3AG2 E;  3TXM A;  2J08 A;  1H0A A;  3U4T A;  4EQF A;  1QYM A;  4A63 B;  2HO1 A;  5ANR A;  2AVP A;  1WY6 A;  4G26 A;  3DSS A;  3PEV B;  4WNE A;  3EIQ C;  4XIF A;  3Q4A B;  3D9O A;  3C3Q A;  2C0L A;  4QFV A;  2WXK A;  1HS6 A;  1JUQ A;  3D9N A;  3N71 A;  5J90 A;  4PS3 A;  3ZHE A;  1HG2 A;  1KLX A;  3CST A;  2I1K A;  5HKP A;  2P9U G;  1EF1 C;  2FI7 A;  1K1B A;  3HXD A;  3ASN E;  3TWW A;  5FIN A;  4CCA A;  4PS7 A;  3BEE A;  2PNN A;  1E7U A;  4LRZ A;  1IKN D;  4Q96 A;  4EPZ A;  3DSX A;  2XCB A;  3HG0 D;  4AY6 A;  3PNT B;  1TN8 A;  3LY8 A;  3VLD A;  3ZYL A;  5EKQ D;  4F6R D;  1OWN A;  3MV2 B;  3UI2 A;  4GYY A;  1UN8 A;  4RLY A;  4JC8 A;  3RAU A;  1OXJ A;  3S7D A;  3HVE A;  2V8S E;  4AY5 A;  2P9K G;  4OAV B;  4TUU A;  1X5B A;  5D2M C;  1O5M A;  3Q7A A;  3LXU X;  2R03 A;  4UI9 J;  4YDO A;  4UWF A;  2KCL A;  4BWR A;  4C0M A;  3AG1 E;  4Q94 A;  3CQG B;  4HNA D;  3AAA C;  3CGH A;  3L13 A;  4HB5 A;  4BY6 A;  5KCM A;  3U64 A;  3UM1 A;  2EIM E;  4BT9 A;  3ABM E;  4G24 A;  3UPV A;  3B7R L;  4DRX E;  5BNW A;  4E85 A;  3V30 A;  4JB8 P;  3CHP A;  5FJY A;  1TNB A;  2A5E A;  4UQY A;  2ILR A;  3L54 A;  4ABN A;  4KMO A;  1NA0 A;  3TWX A;  1UW4 B;  4I1A A;  4I9E A;  3ZXS A;  3PRE A;  4U96 D;  3QKY A;  3Q9N C;  1TR4 A;  2KBX A;  3FUM A;  4TXR A;  4H7Y A;  5EID A;  1B89 A;  2WQH A;  2XPZ A;  4DK5 A;  3U9W A;  4C9B B;  1ZBP A;  2F0Y A;  3LYA A;  3UT4 A;  1SW6 A;  3ABL E;  4RSY A;  5CED B;  3CVQ A;  4A3V A;  1HF8 A;  2FBN A;  3CK7 A;  2MYO A;  2GRR B;  3C72 A;  1Z5S C;  3QJZ A;  1OWL A;  5A7D B;  3LVR E;  3LVQ E;  4GTT A;  3FFL A;  4J7W A;  5EYL A;  4U8H A;  5LX8 A;  1WG0 A;  2CFU A;  5ENO D;  3GZ2 A;  4GZ5 A;  4LNB A;  1E8Y A;  3EHQ A;  3KSL A;  3KAE A;  1ELW A;  2Y69 E;  2OVB A;  5ENN A;  2E0I A;  3QWW A;  1HG5 A;  2P9P G;  4PH4 B;  4FHJ A;  4I6J A;  1N4P A;  3EHN A;  2GRM A;  4OVV A;  1G3N B;  5FZS A;  4TXQ A;  4UQX A;  4J8E A;  2QYJ A;  2AXU A;  4Y6C A;  3EU5 A;  3ZU7 B;  5KBA A;  4U63 A;  3RKV A;  3J5P A;  2EIL E;  4IYP A;  3IHV A;  3PUJ A;  2XGO A;  1N52 A;  2WXI A;  3DWL G;  4DX7 D;  3B7U X;  2AJA A;  3NZU A;  3MZL B;  1SZ9 A;  1XNF A;  3EDT B;  2IFU A;  1TNU A;  1N4S A;  3DSU A;  1UJK A;  5BUZ A;  3E34 A;  3ML9 A;  2Y4T A;  5CRV A;  4BER A;  3C3O A;  5IY5 E;  4G23 A;  4DPR A;  3LY9 A;  4AEZ C;  1UOH A;  1NL4 A;  2VJ8 A;  1LTX A;  2X38 A;  5LP0 A;  3PS6 A;  4UWL A;  1OY3 D;  4HI9 A;  3NB2 A;  5ENS D;  5CEA A;  5JA4 D;  3Q7F A;  1A17 A;  4Q69 A;  4GYW A;  4GZC A;  4AV7 A;  4GB9 A;  3TG5 A;  1S64 A;  2UWJ G;  3LCA A;  4GTQ A;  2NXP A;  4MS6 A;  4TUM A;  1XGW A;  4BFR A;  3C98 A;  5G05 J;  2OEV A;  3OXG A;  4EZL A;  2V4H C;  1GW6 A;  3GW4 A;  1FT2 A;  2OEW A;  4M3O A;  4U04 A;  3S7F A;  3TL5 A;  4G1T A;  3FY4 A;  3FTX A;  1TNO A;  3TWR A;  5ANL A;  2P9I G;  4JL0 A;  4I2W A;  1SZA A;  4JD2 G;  2WMO A;  4FJZ A;  4U8V D;  2VQ2 A;  3TGO A;  3Q73 A;  2H6I A;  3CVL A;  2WXF A;  3PZ4 A;  1BI8 B;  1S0P A;  3D9K A;  3DPY A;  4UI9 C;  4JEU A;  2YNQ A;  3JXI A;  3UKU G;  5BT1 A;  2PZI A;  2GRP B;  4K0R A;  2A4Z A;  4CDN A;  2IF4 A;  3FUN A;  2QC9 A;  1O1T A;  4UUC A;  4GA2 A;  1HO8 A;  1U3D A;  4UWH A;  4KZC A;  4GZ3 A;  5C1D A;  1FT1 A;  4H7X A;  5HS0 A;  1SQM A;  2KCK A;  3PVL A;  4APO A;  1DC2 A;  3UM0 A;  3CVN A;  4DLO A;  5ENT D;  3CVU A;  1AWC B;  2LSU A;  2WXG A;  3D9J A;  3ZPJ A;  3FU0 A;  3CV0 A;  2WXR A;  4ANU A;  3ENE A;  1S70 B;  3V79 K;  2QZA A;  3RJV A;  4FHK A;  2KAT A;  5AAR A;  4ILG A;  5CMW A;  3FEX A;  1LF8 A;  2Y1L E;  1ZU2 A;  1OWM A;  3MKQ B;  4WAF A;  4YDY A;  4BES A;  2LNI A;  4ZFH A;  3DPD A;  5KJN A;  2PQN A;  2KCV A;  4BTA A;  2YQ8 A;  5CCL A;  4FU3 A;  3IV0 A;  1KT1 A;  3R9A B;  2QYU A;  3SGH A;  1DVP A;  4CEM A;  5ENR D;  3JQ1 A;  3AS5 A;  3CKB A;  3SF4 A;  3ABK E;  2XHE A;  5G55 A;  3LJ3 A;  2JAB A;  3Q75 A;  4U07 A;  3ZW3 A;  3TAX A;  2J09 A;  2VSN A;  5EIB E;  1OCC E;  5J08 A;  4I2Z A;  5ENP D;  2UY1 B;  3QWV A;  1A5E A;  2VGX B;  1PY1 A;  3RO3 A;  3WXX A;  3PUK A;  5ARF A;  5KNH D;  5CBO A;  4FAD A;  1MX6 A;  4G11 A;  1E7V A;  3CHM A;  1WDY A;  5AQB A;  3EHR A;  3MV3 B;  3WG7 E;  2CHW A;  3Q49 B;  2J4D A;  1PAQ A;  3FTU A;  3ULY A;  2FO1 E;  2EIJ E;  2C2L A;  2ZU6 B;  2H6H A;  4U7E B;  2XEN A;  3DSW A;  4YDW A;  2LXL A;  4GTS A;  5T3R A;  3LPZ A;  1K3Z D;  3OTN A;  1VDY A;  2LO6 A;  2KM4 A;  3PRZ A;  4F1S A;  1NA3 A;  3CSF A;  4GCN A;  3BUA A;  3Q5M A;  4JW1 A;  3Q15 A;  4WNG A;  1S63 A;  2P9N G;  4DLQ A;  1H6K A;  4Z68 A;  4AVX A;  2CHX A;  2Y4U A;  4B93 B;  3IHY A;  3AG3 E;  1IYG A;  4I1M A;  5A23 A;  3U66 A;  1V55 E;  1FPP A;  1IQU A;  1BU9 A;  4HRM B;  3Q78 A;  1N54 A;  4HLL A;  2DVW A;  4KZ0 A;  3ZKJ A;  3R9M A;  3E30 A;  3ZYK A;  1MX4 A;  3FUD A;  4F1P A;  4HQD A;  2HYZ A;  3UX4 A;  1ZB1 A;  2RFM A;  3CVW A;  2VGY A;  3ZFW A;  2R17 C;  1LD8 A;  2RFA A;  4AIF A;  2WQ6 A;  4N2S A;  1HFA A;  5D0O D;  3TWV A;  2L0T B;  2WXP A;  1U3C A;  5G05 C;  2OOE A;  3TG4 A;  3FTV A;  3ISM C;  1NFI E;  3KEA A;  2WM9 A;  2B6C A;  2BKK B;  2RKK A;  1E96 B;  2ZIR A;  4JHK A;  1KT0 A;  1TEZ A;  1TYQ G;  2BED A;  4BET A;  5DBK A;  3ZGQ A;  3ONL A;  3J5Q B;  4GTV A;  2EQX A;  1MJ0 A;  3UUX A;  3CHQ A;  2XS8 A;  4N2Q A;  1L5J A;  4KVM A;  2C0M A;  5KJK A;  3D9P A;  2AW6 A;  4R7L A;  3RSE G;  4U8Y D;  4DJA A;  4GPK A;  1N95 A;  2ZXW E;  4HOQ A;  3BG0 B;  2NYJ A;  2Y3A A;  4XI0 A;  1Y6I A;  2R2L A;  5B1B E;  4N3B A;  1LD7 A;  1RW2 A;  4L7T A;  3I3N A;  4U0U A;  4AXH A;  2GW1 A;  3UIP C;  4IUL A;  1OCR E;  5FZQ A;  1Z3Y A;  3TWQ A;  3QAQ A;  4N5C A;  3E32 A;  3TWT A;  4DI4 A;  3ESL A;  3UIN C;  3V31 A;  3FP3 A;  3SZ7 A;  2CG3 A;  4NUR A;  5EDS A;  3UQ3 A;  2VTB B;  4I43 A;  2J9Q A;  1QZ2 A;  4GZ6 A;  2WVI A;  3RIB A;  1IHG A;  4WNF A;  3NF1 A;  4F3V A;  5B3S E;  1TJF A;  1OCO E;  1N4Q A;  3G2U A;  4CZ2 D;  4KT6 B;  4A1S A;  2DYR E;  1PC2 A;  4DX5 D;  5LFA A;  4UWK A;  5CHE E;  3JCK C;  1TNZ A;  4AJW A;  4L2Y A;  3DXM G;  2I6H A;  1H6O A;  2PM7 A;  3PZ3 A;  3ZUV B;  3ZRH A;  4I9C A;  3T8K A;  5AAO A;  3L6A A;  3VTY A;  3JUI A;  3L22 A;  3IEG A;  4JVS A;  1IHB A;  4GAA A;  4G8L A;  3EUV A;  1MHQ A;  2RD0 A;  3UM2 A;  4BX8 A;  1JWF A;  5AYW D;  5KJM A;  4V3I A;  3GYZ A;  2NC9 A;  2EIN E;  4HS2 A;  3ZIM A;  4Y6W A;  2R02 A;  3JXJ A;  1Q2Z A;  2XGS A;  5EN5 D;  1AP7 A;  2MOW A;  3JQ0 A;  3TWU A;  2HE0 A;  3AS8 A;  3V2X A;  3OAW A;  3P1U A;  3FTZ A;  4BSZ B;  2RG8 A;  2DCP A;  3APC A;  3G2T A;  3CK9 A;  4JEH A;  4XEI G;  3T8M A;  1DCE A;  4GML A;  4EHM A;  2HR2 A;  2R5S A;  1P5Q A;  3PE4 A;  2L6B A;  1HZ4 A;  4ANW A;  4EZJ A;  3RU0 A;  1H6P A;  1EYH A;  3U3W A;  4LNU D;  1MQS A;  3CKC A;  3AU5 A;  2J49 A;  4HFG A;  4ZHB A;  3FWV A;  1FVF A;  3SHF A;  1NI1 A;  2LUH A;  3ESK A;  1U2V G;  3RO2 A;  1X81 A;  4K5C A;  2XZT G;  3K9I A;  4ILI A;  4O60 A;  1OT8 A;  4HOU A;  2CHZ A;  2BTD A;  2KZT A;  4GTP A;  2IQC A;  2ETA A;  2GGF A;  3FUJ A;  3D9H A;  4AP2 A;  4YVQ C;  5T8I A;  3CVX A;  3SFX A;  4GMJ A;  3X2Q E;  4C48 B;  2I9C A;  2A5U A;  2I1J A;  2M63 A;  5JMN D;  4FUL A;  3FUK A;  2KZT B;  2FEZ A;  4J6I A;  5FQ7 A;  1KZO A;  5FTP A;  3UT7 A;  2NSZ A;  1N0R A;  3ZXP A;  5BV0 A;  4B8C B;  3KS2 A;  5KWD A;  3PE3 A;  3RK6 A;  3T5X A;  4MLP A;  4J8S A;  2QY7 A;  1Z6T A;  3CHO A;  2XZD G;  3CEQ A;  5EYP F;  3PNL B;  1HU3 A;  1INZ A;  4HOT A;  3FU5 A;  3BQO A;  1N4R A;  2BKG A;  3IKO B;  3VLE A;  5BXO A;  1OWO A;  3T9K A;  4I1O B;  1H2V C;  1UG3 A;  1JWG A;  1N0Q A;  3I5P A;  5FQ8 A;  3SQV A;  3MEK A;  4U0S A;  1ELR A;  1MX2 A;  4O1O A;  5B1A E;  3E4B A;  2XS1 A;  2ZGG A;  4FA6 A;  2LSV A;  5AQ7 A;  4DI3 A;  4P29 A;  5M72 A;  3FUI A;  4KVO A;  4F53 A;  4E6H A;  3HDX A;  4G8K A;  4ILH B;  1HE8 A;  4ACL A;  3FHE A;  3CK8 A;  3ASG A;  3FU6 A;  3JUE A;  2J4B A;  1N9A A;  3PZD A;  4PS8 A;  4N5Q A;  2IO2 C;  2H6F A;  4I17 A;  3OXL A;  2XEH A;  2GRO B;  3RRM B;  3L08 A;  3ONK A;  3CLJ A;  4L9P A;  3SFY A;  3MKQ A;  4HVB A;  1JPL A;  2Y0B G;  4JA9 A;  4YVO A;  1N94 A;  1DNP A;  4JPS A;  3E33 A;  2J07 A;  2MHK A;  2ZGD A;  3W9F A;  3FEY A;  3UKR G;  4J8F A;  2F37 A;  4LER A;  2Q7F A;  4WWN A;  4NIK A;  4X8Q A;  2YHE A;  5CER B;  3B7B A;  5EIL A;  2VYI A;  4RG9 A;  4JA7 A;  3UIO C;  3UTM A;  2XPI A;  3PH0 C;  2V5Q C;  2UY1 A;  1JCQ A;  4GYO A;  3TXN A;  2JEK A;  5A6C A;  2VGX A;  3KD7 A;  3L17 A;  4CYM D;  3OXF A;  4M7C A;  4RQI A;  2HM8 A;  4CGW A;  2WPV A;  4YND A;  1O1S A;  3HXB A;  4O6F A;  3EJN A;  3FUE A;  3MGB A;  5LCW J;  3RRN B;  2ZIS A;  4BT8 A;  2V4L A;  4JZY A;  2KC7 A;  3L9T A;  2GRL A;  4CGV A;  4DX6 D;  5BV1 A;  3LEW A;  5DIZ A;  1YMP A;  4GPM A;  4DX2 A;  5G04 J;  3CVV A;  4OAU C;  3CIA A;  5AQ9 A;  1EDU A;  5FQ4 A;  1H2T C;  4GA0 A;  1H19 A;  3APD A;  3UXG A;  2X6F A;  5FT9 A;  3L16 A;  4NQ0 A;  2VSY A;  4OVU A;  2YIN A;  3DEO A;  3VTX A;  1YCS B;  4KBQ A;  4XZ4 A;  2DWZ A;  3NQP A;  1N11 A;  4KXK B;  4EBA G;  5ITZ F;  3ULE G;  4XE0 A;  1K8K G;  3FU3 A;  2F8X K;  2LAI A;  3ZEF A;  2IEJ A;  3SBT B;  3ZYQ A;  4NAC A;  4HI8 A;  1HH8 A;  3DSV A;  2IU1 A;  3L82 A;  5JJ7 A;  4AOF A;  5CRU A;  4K5B A;  3NZS A;  2IOS A;  3HXF A;  1BPO A;  5E76 A;  1RZ4 A;  3FTW A;  1W3B A;  2R59 A;  2WXM A;  4GA1 A;  5FQ6 A;  2PL2 A;  2WXL A;  4LUN U;  2WXO A;  4NRH B;  2EIK E;  5AQA A;  3CVP A;  1OCZ E;  1QBQ A;  3D3M A;  3ZNG A;  3GZ1 A;  2I2O A;  4XX5 A;  3ZHE B;  4A1G A;  5CMY A;  4RG6 A;  2DZO A;  3NOG D;  2X6H A;  4WND A;  2PM6 A;  4LEU A;  4MKT A;  2BF0 X;  3D9L A;  2OND A;  3ASD A;  3PZ2 A;  1SA5 A;  5ENQ D;  4AM9 A;  4EZK A;  5CCM A;  1BD8 A;  4FJY A;  3LDZ A;  4C0E A;  1BI7 B;  4LNG A;  4LSZ E;  4XI9 A;  3ASO E;  3B13 A;  3DRA A;  3CHR A;  5AEN A;  1D8E A;  4TXP A;  5FZR A;  1JCR A;  4I6G A;  2X3M A;  3C5R A;  2V5F A;  3LS8 A;  3ML8 A;  3EU9 A;  1YYH A;  3GZS A;  3DBS A;  3FUH A;  3IXE A;  2LXM A;  2WQ7 A;  1D8D A;  2FUL A;  3HVE B;  1MYO A;  2KXP C;  3AG4 E;  3DST A;  3APF A;  4GZD A;  3FTY A;  3RRU A;  4W9R A;  4URK A;  4TV3 A;  5JJ6 A;  2FO7 A;  2VTB A;  3QOU A;  4MBG A;  1FCH A;  3MA5 A;  4GU5 A;  3ASH A;  4D10 C;  1IQR A;  4LG6 A;  4CDM A;  3MKR A;  3FUF A;  4DX1 A;  3BU8 A;  4HXI A;  4UQZ A;  1OWP A;  3HHM A;  3PZ1 A;  3SBS A;  5JHA A;  1V54 E;  3B7S A;  4FLB A;  5AJL A;  2IJG X;  1D9S A;  2P9L G;  3SNX A;  1TJC A;  4HBD A;  2B0O E;  4LCT A;  3HRA A;  3O4Z A;  3EHM A;  3S7J A;  5AJD A;  3FH8 A;  4N3A A;  2X6K A;  1TNY A;  1E90 A;  3AU4 A;  3AJI A;  4MRU A;  3B7T A;  4JXT A;  2VGE A;  5BXU A;  4J8Y A;  3T5V A;  2PQR A;  3FDH A;  1O1R A;  1UN9 A;  3CHS A;  4HRN A;  3MCX A;  1E8X A;  5EX0 A;  1WM5 A;  1QNF A;  3I4G A;  4XKB A;  2IOL A;  2OVF A;  2V0P A;  5KJL A;  4O1P A;  5LCW C;  3PDN A;  1KPS B;  5HRY A;  4RVB A;  5LOZ A;  3MYV A;  2ETB A;  5KNG A;  4ANV A;  4L2L A;  2VSX E;  2CG2 A;  3DEP A;  4YDE A;  2XGM A;  3ZYM A;  2XPY A;  3HYM B;  4HOS A;  4IN3 B;  4PUC A;  5FIO A;  2BUG A;  2XRY A;  3G2V A;  5CEC B;  5G04 C;  3O48 A;  3MX3 A;  3NOC D;  1FVH A;  3D9I A;  2WB2 A;  1WAO 1;  3SD5 A;  3QC1 A;  3Q47 B;  3LY7 A;  4ANX A;  4ATZ D;  3LJN A;  3TWS A;  2FF4 A;  1SA4 A;  2X6J A;  3HXE A;  1H2U A;  1MZC A;  5FWQ A;  4ATG A;  1TN6 A;  3BG1 B;  3NBN B;  5BW8 C;  1HX8 A;  2ETC A;  3VLF A;  3QWP A;  4A55 A;  5T4Y A;  1KZP A;  4UI9 K;  4B8A A;  3JYS A;  3LKU A;  3UMV A;  2L6J A;  4XKC A;  2OCC E;  2CFZ A;  4PDX A;  4UWG A;  4EBA A;  2DZN A;  1K1A A;  3ASF A;  3G2S A;  3QAR A;  3PEU B;  3I4R B;  1Z3X A;  5JHB A;  2DBA A;  1UJJ A;  2XRZ A;  3Q79 A;  5H7P A;  2R05 A;  3FH5 A;  1NP7 A;  3S2A A;  4HRL A;  3QNK A;  2WXJ A;  3KEZ A;  2OV8 A;  3FUL A;  5HI7 A;  4B89 A;  2XQ0 A;  4N3C A;  2GRN B;  2L0I A;  1DCQ A;  4GMR A;  2XEE A;  3HXC A;  4I6E A;  2VSO E;  2WMN A;  3HIZ A;  3F6Q A;  4WUY A;  2LAH A;  3QB2 A;  2AXV A;  2P9S G;  2H6G A;  3AS4 A;  4K5A B;  2P2C P;  4CT0 A;  1E8W A;  3CR3 A;  4JHJ A;  4G25 A;  5E75 A;  3UT8 A;  4APF A;  2E2E A;  2AXZ A;  3ZN3 A;  4CRW A;  2MRI A;  4JHR A;  2AWI A;  4CT4 A;  2GRQ B;  3R7Q A;  5D0Q D;  3QK0 A;  3FH7 A;  4J8D A;  2J8S D;  1QQE A;  3NAW A;  2IO3 C;  3CQC B;  1NZN A;  4F7A A;  2ION A;  4GTR A;  3P2B A;  2X6I A;  4L23 A;  2DYS E;  5CBN A;  1E8Z A;  4GTO A;  5G2N A;  5HQ8 A;  4K03 A;  4B94 A;  4BTB A;  4BEP A;  2WXN A;  2P58 C;  4A3T A;  1ELK A;  3ZVV A;  4HLE A;  4TRQ A;  4WWO A;  5AN8 A;  3SFZ A;  4WWP A;  3B95 A;  5D66 A;  3SY2 A;  2YHC A;  1OUV A;  3TJP A;  1EPU A;  4GTM A;  3SI5 A;  3Q9U C;  4EEC A;  4ACK A;  3MJW A;  1Y8M A;  4KYO B;  4BX9 A;  5BPP A;  3QDN A;  2L9B A;  1HXI A;  4B0Z A;  2IY0 C;  4U95 D;  3V2O A;  4FP7 A;  3EIJ A;  2JLB A;  4FC8 A;  4OYS A;  4DUI A;  1TN7 A;  1IXV A;  1YA0 A;  5EX3 A;  4QQI A;  4FLH A;  3E37 A;  3KSQ A;  2F8Y A;  3G2W A;  2XEV A;  3SO8 A;  4GCO A;  3CVY A;  2DIW A;  3DXK G;  5C2Y A;  3UM3 A;  2QFC A;  2WXH A;  5ARG A;  2WXQ A;  3S7B A;  4U0Z A;  1JCS A;  4HOR A;  4ME2 A;  4J0U A;  4IRU A;  4L1B A;  4CDR A;  2XCC A;  4G2V A;  3URZ A; 
#chains in the Genus database with same CATH homology
 1S0P A;  3D9K A;  4N39 A;  4UI9 C;  3IBE A;  4JEU A;  2YNQ A;  3OAW A;  2WQ7 A;  3P1U A;  3FTZ A;  2FUL A;  3ULQ A;  5JJT A;  4BSX A;  3HVE B;  5BT1 A;  3D9M A;  2RG8 A;  2DCP A;  3APC A;  5AIJ A;  2PZI A;  3G2T A;  3CK9 A;  4JEH A;  3R7R A;  3FTS A;  4K0R A;  3T8M A;  2A4Z A;  3TXM A;  3APF A;  4GZD A;  2J08 A;  3FTY A;  3RRU A;  4W9R A;  4CDN A;  1H0A A;  4URK A;  2IF4 A;  3FUN A;  4TV3 A;  5JJ6 A;  4GML A;  2FO7 A;  2HR2 A;  3U4T A;  2R5S A;  4GA2 A;  1HO8 A;  2VTB A;  1P5Q A;  4EQF A;  3QOU A;  3PE4 A;  1U3D A;  4UWH A;  4KZC A;  1FCH A;  3MA5 A;  4GU5 A;  1HZ4 A;  4GZ3 A;  2HO1 A;  5C1D A;  3ASH A;  5ANR A;  4D10 C;  1IQR A;  4ANW A;  2AVP A;  1WY6 A;  4G26 A;  4EZJ A;  4H7X A;  3RU0 A;  4CDM A;  3MKR A;  3FUF A;  3PEV B;  1EYH A;  3U3W A;  1MQS A;  3CKC A;  1SQM A;  3AU5 A;  4WNE A;  4HXI A;  2J49 A;  2KCK A;  3EIQ C;  4XIF A;  3Q4A B;  3PVL A;  3D9O A;  4HFG A;  3FWV A;  4APO A;  1FVF A;  3SHF A;  2C0L A;  3CVN A;  4QFV A;  2WXK A;  1HS6 A;  4UQZ A;  1OWP A;  1JUQ A;  3D9N A;  3N71 A;  3HHM A;  4DLO A;  5J90 A;  3ESK A;  3SBS A;  3RO2 A;  5JHA A;  4PS3 A;  3ZHE A;  3CVU A;  1HG2 A;  1KLX A;  2LSU A;  2WXG A;  2I1K A;  3B7S A;  3CST A;  3D9J A;  3K9I A;  4FLB A;  5AJL A;  3ZPJ A;  2IJG X;  4ILI A;  3FU0 A;  3CV0 A;  2WXR A;  4ANU A;  3SNX A;  4HOU A;  1TJC A;  3ENE A;  2CHZ A;  4LCT A;  2BTD A;  1EF1 C;  2FI7 A;  2KZT A;  3O4Z A;  3EHM A;  3RJV A;  4FHK A;  2IQC A;  2GGF A;  3FUJ A;  4AP2 A;  2KAT A;  4ILG A;  4CCA A;  4PS7 A;  5CMW A;  3S7J A;  3FEX A;  3BEE A;  5AJD A;  4YVQ C;  5T8I A;  1E7U A;  1LF8 A;  3CVX A;  4LRZ A;  3FH8 A;  4Q96 A;  4GMJ A;  4EPZ A;  4N3A A;  1ZU2 A;  1OWM A;  3MKQ B;  2XCB A;  4WAF A;  2X6K A;  4AY6 A;  2I9C A;  3PNT B;  2A5U A;  2I1J A;  2LNI A;  5KJN A;  3DPD A;  3LY8 A;  1E90 A;  2PQN A;  3VLD A;  2KCV A;  3AU4 A;  3ZYL A;  5EKQ D;  4BTA A;  2YQ8 A;  1OWN A;  5CCL A;  4FU3 A;  2M63 A;  3MV2 B;  4FUL A;  3FUK A;  4MRU A;  3B7T A;  2KZT B;  2FEZ A;  4J6I A;  5FQ7 A;  3IV0 A;  1KT1 A;  4JXT A;  5FTP A;  3R9A B;  3UT7 A;  2NSZ A;  4GYY A;  3SGH A;  1DVP A;  4CEM A;  1UN8 A;  5BV0 A;  4B8C B;  3KS2 A;  3JQ1 A;  4JC8 A;  3T5V A;  3PE3 A;  3RK6 A;  2PQR A;  3AS5 A;  3CKB A;  3FDH A;  3S7D A;  3SF4 A;  3T5X A;  1UN9 A;  4MLP A;  3HVE A;  4J8S A;  2XHE A;  2QY7 A;  2V8S E;  3CHS A;  4AY5 A;  1Z6T A;  3CHO A;  5G55 A;  3MCX A;  3CEQ A;  3LJ3 A;  4TUU A;  4U07 A;  1E8X A;  1X5B A;  5EX0 A;  3ZW3 A;  3TAX A;  1WM5 A;  1QNF A;  3I4G A;  1HU3 A;  3PNL B;  2J09 A;  2VSN A;  1INZ A;  4XKB A;  4HOT A;  5J08 A;  2IOL A;  2OVF A;  2V0P A;  3FU5 A;  3LXU X;  4I2Z A;  4UI9 J;  5KJL A;  5LCW C;  2UY1 B;  3PDN A;  3IKO B;  3QWV A;  3VLE A;  4RVB A;  4UWF A;  2KCL A;  2VGX B;  5LOZ A;  4BWR A;  1OWO A;  3MYV A;  4ANV A;  1PY1 A;  4I1O B;  3RO3 A;  4C0M A;  1H2V C;  4Q94 A;  3WXX A;  4L2L A;  2VSX E;  3PUK A;  1UG3 A;  1JWG A;  2CG2 A;  2XGM A;  3ZYM A;  3CQG B;  2XPY A;  3HYM B;  3I5P A;  5FQ8 A;  3CGH A;  3L13 A;  5ARF A;  4HOS A;  4BY6 A;  3MEK A;  4FAD A;  4U0S A;  5KCM A;  4G11 A;  1E7V A;  3CHM A;  1ELR A;  4IN3 B;  3U64 A;  3E4B A;  3MV3 B;  4PUC A;  4FA6 A;  2LSV A;  2BUG A;  2XRY A;  3G2V A;  4BT9 A;  5G04 C;  4G24 A;  2CHW A;  3UPV A;  3Q49 B;  3O48 A;  2J4D A;  3B7R L;  3MX3 A;  4DI3 A;  5BNW A;  1FVH A;  4P29 A;  5M72 A;  1PAQ A;  3D9I A;  3FTU A;  3FUI A;  2WB2 A;  4KVO A;  1WAO 1;  3SD5 A;  4F53 A;  4E6H A;  3HDX A;  4E85 A;  4ILH B;  3QC1 A;  2C2L A;  2ZU6 B;  1HE8 A;  3Q47 B;  4ACL A;  3FHE A;  3CK8 A;  3CHP A;  3ASG A;  3FU6 A;  5FJY A;  4UQY A;  3LY7 A;  4ANX A;  2J4B A;  5T3R A;  2ILR A;  3LPZ A;  3PZD A;  4PS8 A;  3L54 A;  4ABN A;  2FF4 A;  3OTN A;  4I17 A;  4KMO A;  3OXL A;  2X6J A;  1VDY A;  1NA0 A;  2LO6 A;  2KM4 A;  3PRZ A;  4F1S A;  1NA3 A;  1UW4 B;  3CSF A;  4GCN A;  1H2U A;  4I1A A;  4I9E A;  3Q5M A;  3RRM B;  3L08 A;  4JW1 A;  5FWQ A;  3Q15 A;  3ONK A;  4WNG A;  3CLJ A;  4ATG A;  4DLQ A;  3BG1 B;  3MKQ A;  1H6K A;  3ZXS A;  4HVB A;  3PRE A;  3QKY A;  1JPL A;  5BW8 C;  1HX8 A;  4AVX A;  2CHX A;  4JA9 A;  2Y4U A;  4YVO A;  3VLF A;  1DNP A;  3QWP A;  4JPS A;  4A55 A;  3IHY A;  5T4Y A;  3FUM A;  1IYG A;  4H7Y A;  2J07 A;  2MHK A;  4UI9 K;  4B8A A;  4I1M A;  5A23 A;  3JYS A;  3LKU A;  3U66 A;  1B89 A;  3UMV A;  2L6J A;  2WQH A;  4XKC A;  2XPZ A;  4DK5 A;  3FEY A;  3U9W A;  4C9B B;  1ZBP A;  2CFZ A;  4J8F A;  3LYA A;  1IQU A;  4PDX A;  4UWG A;  3UT4 A;  4RSY A;  3CVQ A;  4EBA A;  4A3V A;  1HF8 A;  3ASF A;  1N54 A;  2FBN A;  2Q7F A;  3CK7 A;  3G2S A;  4LER A;  4WWN A;  3QAR A;  3PEU B;  2YHE A;  3I4R B;  1Z3X A;  4KZ0 A;  5JHB A;  3QJZ A;  2DBA A;  1UJJ A;  1OWL A;  3ZYK A;  2XRZ A;  5A7D B;  3LVR E;  3LVQ E;  3FUD A;  2VYI A;  4RG9 A;  4JA7 A;  2HYZ A;  3UX4 A;  2XPI A;  3PH0 C;  3CVW A;  3FH5 A;  1NP7 A;  2UY1 A;  2VGY A;  3S2A A;  3FFL A;  4GYO A;  3TXN A;  2JEK A;  3ZFW A;  2VGX A;  5A6C A;  3KD7 A;  3QNK A;  2WXJ A;  3KEZ A;  2OV8 A;  3FUL A;  2R17 C;  5HI7 A;  4B89 A;  4U8H A;  2XQ0 A;  4N3C A;  3L17 A;  4AIF A;  5LX8 A;  2WQ6 A;  3OXF A;  2CFU A;  2HM8 A;  4CGW A;  4N2S A;  1HFA A;  2L0I A;  3GZ2 A;  4GZ5 A;  5D0O D;  2WPV A;  4YND A;  4O6F A;  2L0T B;  2WXP A;  3EJN A;  2VSO E;  1E8Y A;  2WMN A;  4I6E A;  1U3C A;  5G05 C;  3FUE A;  3MGB A;  2OOE A;  3TG4 A;  5LCW J;  3HIZ A;  3FTV A;  3KAE A;  3RRN B;  4WUY A;  4BT8 A;  1ELW A;  2V4L A;  4JZY A;  2KC7 A;  2LAH A;  3QB2 A;  2AXV A;  2OVB A;  5ENN A;  2E0I A;  3QWW A;  1HG5 A;  2GRL A;  4CGV A;  3AS4 A;  4PH4 B;  5BV1 A;  4FHJ A;  2WM9 A;  4I6J A;  4CT0 A;  1E8W A;  3EHN A;  2GRM A;  3CR3 A;  3LEW A;  1E96 B;  4OVV A;  5FZS A;  4JHJ A;  4UQX A;  4G25 A;  1KT0 A;  4JHK A;  1TEZ A;  5DIZ A;  4J8E A;  5E75 A;  2AXU A;  4Y6C A;  3UT8 A;  5DBK A;  5G04 J;  2E2E A;  3ZGQ A;  2AXZ A;  4APF A;  3CVV A;  3ZN3 A;  4U63 A;  3ONL A;  3CIA A;  3RKV A;  4CRW A;  2EQX A;  2MRI A;  4JHR A;  2AWI A;  3UUX A;  1EDU A;  4CT4 A;  4IYP A;  3R7Q A;  5FQ4 A;  1H2T C;  3CHQ A;  5D0Q D;  3QK0 A;  3FH7 A;  4J8D A;  3IHV A;  4GA0 A;  1H19 A;  3APD A;  3PUJ A;  4N2Q A;  1QQE A;  1L5J A;  2X6F A;  2XGO A;  1N52 A;  3L16 A;  5FT9 A;  2WXI A;  4NQ0 A;  2VSY A;  4OVU A;  2YIN A;  4KVM A;  2C0M A;  3CQC B;  5KJK A;  1NZN A;  3VTX A;  3D9P A;  4F7A A;  2ION A;  2AW6 A;  4KBQ A;  4XZ4 A;  4R7L A;  3P2B A;  4DJA A;  4GPK A;  2X6I A;  4L23 A;  4HOQ A;  1E8Z A;  3B7U X;  3BG0 B;  3NQP A;  3NZU A;  5G2N A;  3MZL B;  5HQ8 A;  1SZ9 A;  1XNF A;  2Y3A A;  3EDT B;  4K03 A;  4KXK B;  4XI0 A;  1Y6I A;  4EBA G;  4B94 A;  4BTB A;  4N3B A;  2WXN A;  4L7T A;  2IFU A;  2P58 C;  4A3T A;  1UJK A;  4XE0 A;  5BUZ A;  3I3N A;  4U0U A;  3ML9 A;  2Y4T A;  1ELK A;  4AXH A;  2GW1 A;  3ZVV A;  3FU3 A;  4IUL A;  4TRQ A;  4WWO A;  1Z3Y A;  5FZQ A;  3SFZ A;  4HLE A;  2LAI A;  4WWP A;  3QAQ A;  3ZEF A;  4N5C A;  4G23 A;  4DPR A;  3LY9 A;  4AEZ C;  2VJ8 A;  3SBT B;  4DI4 A;  3ESL A;  2X38 A;  3ZYQ A;  4NAC A;  5LP0 A;  1HH8 A;  3FP3 A;  3SZ7 A;  2CG3 A;  2IU1 A;  3PS6 A;  4NUR A;  2YHC A;  5EDS A;  4UWL A;  5JJ7 A;  1OUV A;  3UQ3 A;  3TJP A;  4AOF A;  1EPU A;  2VTB B;  3NZS A;  4I43 A;  2IOS A;  1A17 A;  3SI5 A;  4Q69 A;  1BPO A;  4GYW A;  5E76 A;  2J9Q A;  1QZ2 A;  4GZ6 A;  4EEC A;  2WVI A;  4GZC A;  3FTW A;  3RIB A;  1IHG A;  1W3B A;  4WNF A;  2R59 A;  2WXM A;  4AV7 A;  4GA1 A;  3NF1 A;  2PL2 A;  5FQ6 A;  4ACK A;  2WXL A;  3MJW A;  4GB9 A;  4F3V A;  4LUN U;  2WXO A;  4NRH B;  3TG5 A;  2UWJ G;  1Y8M A;  4KYO B;  1TJF A;  4BX9 A;  5BPP A;  3CVP A;  3QDN A;  3LCA A;  2L9B A;  1HXI A;  4B0Z A;  2NXP A;  3D3M A;  3G2U A;  3GZ1 A;  4MS6 A;  1XGW A;  4BFR A;  2I2O A;  4KT6 B;  3C98 A;  4A1S A;  4XX5 A;  4FP7 A;  1PC2 A;  3ZHE B;  5G05 J;  3EIJ A;  4A1G A;  3OXG A;  2JLB A;  5LFA A;  4UWK A;  5CHE E;  5CMY A;  3JCK C;  4FC8 A;  4AJW A;  4OYS A;  1YA0 A;  4L2Y A;  5EX3 A;  4EZL A;  2I6H A;  2PM7 A;  4FLH A;  4RG6 A;  1GW6 A;  3G2W A;  2XEV A;  2X6H A;  4WND A;  3GW4 A;  3ZRH A;  2PM6 A;  4I9C A;  4LEU A;  3L6A A;  4MKT A;  3VTY A;  2BF0 X;  4M3O A;  3D9L A;  2OND A;  4GCO A;  4U04 A;  3ASD A;  3JUI A;  3L22 A;  3S7F A;  3TL5 A;  3IEG A;  4JVS A;  4GAA A;  3CVY A;  4G1T A;  3FY4 A;  2DIW A;  5C2Y A;  1MHQ A;  3FTX A;  4AM9 A;  2RD0 A;  4EZK A;  5CCM A;  4BX8 A;  5ANL A;  1JWF A;  2QFC A;  2WXH A;  5AYW D;  4FJY A;  4JL0 A;  4I2W A;  5ARG A;  3LDZ A;  2WXQ A;  4C0E A;  5KJM A;  4XI9 A;  1SZA A;  3B13 A;  4V3I A;  3S7B A;  4U0Z A;  3CHR A;  5AEN A;  4HOR A;  2WMO A;  3GYZ A;  4FJZ A;  4J0U A;  4ME2 A;  3FUH A;  2VQ2 A;  5FZR A;  2NC9 A;  4HS2 A;  4IRU A;  3ZIM A;  4I6G A;  4Y6W A;  3TGO A;  4L1B A;  4CDR A;  2X3M A;  3CVL A;  2WXF A;  2V5F A;  2XCC A;  3LS8 A;  3ML8 A;  2XGS A;  2MOW A;  3GZS A;  3JQ0 A;  4G2V A;  3URZ A;  3AS8 A;  3DBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...