2UWJG

Structure of the heterotrimeric complex which regulates type iii secretion needle formation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
b'DTSLIRELAELALAGSGQHCHEEALCIAEWLERLGQDEAARLIRISSLANQGRYQEALAFAHGNPWPALEPWFALCEWHLGLGAALDRRLAGLGGSSDPALADFAAGMRAQVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III EXPORT PROTEIN PSCE
publication title Structure of the heterotrimeric complex that regulates type III secretion needle formation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF09477 Type_III_YscG Bacterial type II secretion system chaperone protein (type_III_yscG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2uwjG00
2VYIA 3CK8A 1IYGA 3GYZA 2KCVA 4HOQA 3LKUA 3LYAA 4N3AA 5KJLA 3TGOA 2BUGA 2FI7A 2Y4TA 2J9QA 4GCNA 5AYWD 5JJ7A 3UQ3A 5JJ6A 1B89A 1XNFA 5KJNA 1KLXA 4CGVA 2Q7FA 5FZRA 4AY6A 2XCBA 4N3BA 2HO1A 3ASDA 2MHKA 4I9EA 2DBAA 2WPVA 5G05J 3VTXA 3CK7A 4O6FA 4N5CA 2KCLA 4YNDA 1W3BA 3KS2A 4J8DA 3CVLA 4GZ3A 4HOUA 5A6CA 4HORA 4UI9K 4U0ZA 2LSVA 2XGOA 3CVQA 4LEUA 1OUVA 4I9CA 3S7BA 5HI7A 2FO7A 3HYMB 1WM5A 4I2ZA 3GZ1A 3MV3B 4WUYA 4GYWA 2VSYA 4BWRA 4GYYA 3S7FA 3CK9A 2C0MA 3WXXA 1ZBPA 4RG9A 2XGMA 3URZA 2IF4A 1YA0A 1A17A 4U0UA 4GPKA 5D0OD 4UQXA 3QWWA 5ARFA 4I17A 3MKRA 4GA2A 5C1DA 5EX3A 2L6JA 3JYSA 2VQ2A 2AVPA 2JLBA 3RIBA 5FZQA 4I2WA 2VGXB 3QOUA 3CKCA 3FP3A 3TG5A 3PE3A 1HXIA 5BNWA 2GW1A 2XCCA 3ASHA 2YQ8A 4N3CA 3FFLA 3AS8A 4B94A 3E4BA 3Q47B 5KJKA 1KT1A 3CKBA 1ZU2A 5G04C 4G26A 3CVPA 3SF4A 3SZ7A 3LY8A 4GA1A 4AY5A 1E96B 4N2SA 3AS4A 3PE4A 5CHEE 4J8FA 3CVNA 4G25A 4GCOA 5BW8C 4BT9A 5FT9A 3Q5MA 2NC9A 2C2LA 3ZFWA 2LSUA 1WAO1 3OXFA 1KT0A 4KYOB 3KD7A 5LCWJ 4I1AA 1NA3A 4YVOA 3OXLA 4H7XA 5A7DB 5LCWC 4HOSA 4H7YA 2VGXA 1ELWA 5M72A 4AIFA 5EKQD 3RU0A 5D0QD 5CCLA 4JA9A 3PDNA 4A1SA 2YHCA 3LPZA 2WQHA 3Q49B 4Y6CA 4WNFA 2KCKA 3CV0A 4AM9A 1NZNA 1ELRA 3ASFA 4NQ0A 4G24A 4ABNA 4KXKB 5BT1A 1PC2A 1Y8MA 3ZPJA 4U04A 4U07A 4CGWA 3QWPA 3U3WA 4GZ5A 4BTBA 4XI9A 3QWVA 2FBNA 3OXGA 5DIZA 5DBKA 1HZ4A 2ONDA 3S7DA 2PZIA 4Y6WA 4WNGA 3QDNA 3TAXA 3FWVA 2V5FA 3LY7A 4GZ6A 3IEGA 3RJVA 2LNIA 3ZHEB 3RKVA 3MA5A 4G1TA 2FEZA 5G04J 2XEVA 2UWJG 4UQYA 4F3VA 4WNDA 3K9IA 4BTAA 4KBQA 2HYZA 4U0SA 2OOEA 3RO2A 3ZGQA 2HR2A 1QZ2A 2C0LA 5FZSA 3GW4A 2VSNA 3ULQA 4GA0A 4XIFA 3GZ2A 4XI0A 1HH8A 3RO3A 4CDRA 3ASGA 2R5SA 4G2VA 4JL0A 3VTYA 4N2QA 2P58C 1IHGA 4YVQC 4RG6A 2KC7A 1NA0A 4J8EA 3ZHEA 5JJTA 3Q4AB 3LCAA 4UQZA 4NRHB 5FJYA 3Q15A 1P5QA 2UY1A 3MEKA 5HQ8A 5KJMA 4UI9J 3S7JA 5G05C 2I6HA 5EX0A 3NF1A 4BT8A 3R9AB 2E2EA 4UI9C 2PL2A 4APOA 4ME2A 5FTPA 4IN3B 2XPIA 2IFUA 4HOTA 2PQNA 2XGSA 2FF4A 4G23A 3O48A 3UPVA 2PQRA 3MV2B 4EQFA 4JHRA 3ESKA 1QQEA 3KAEA 3CEQA 3EDTB 2KATA 3LY9A 4GYOA 3U4TA 2VGYA 3BEEA 1TJCA 3N71A 5CCMA 5ARGA 3UUXA 2UY1B 3TG4A 2QFCA 3QKYA 4J0UA 4WNEA 1FCHA 3ZN3A 4N39A 3AS5A 4JA7A 2Y4UA 4W9RA
chains in the Genus database with same CATH superfamily
3UM2A 3D9JA 2OEVA 2KCVA 4ANUA 2EINE 1DVPA 3ABME 1OWNA 5KJLA 3HXFA 3TGOA 2Y4TA 3UI2A 4WAFA 4L2LA 1N52A 3MKQB 1MX6A 4U96D 2NSZA 3TWVA 4WWPA 3UIPC 1B89A 5KJNA 2ZGGA 3ZRHA 3CVUA 2XCBA 4N3BA 2HO1A 1HO8A 2DBAA 4FJYA 5G05J 4EPZA 3CQCB 4AV7A 3UM3A 4O6FA 3ZYQA 4K5AB 2BKGA 3FTXA 4LUNU 4J8DA 2GROB 3ASNE 4EECA 2DZOA 4C9BB 3DPDA 4HORA 5JMND 4UI9K 1MQSA 2CHXA 2XZTG 4UWLA 4GMJA 2RKKA 2X6IA 1H2UA 3Q7AA 3S7BA 3PEVB 4HLEA 1TYQG 4GTVA 3Q75A 4WUYA 2V4LA 4IULA 4GYWA 4MS6A 5EYPF 3KSQA 5CBNA 4GYYA 2P9KG 1N0QA 4DX5D 4A55A 4B89A 2IF4A 4PS7A 1YA0A 3QARA 2KXPC 3I4GA 4GPKA 4HI8A 4IRUA 5JHBA 4EZLA 4CDMA 4GU5A 1JWGA 1Q2ZA 4LSZE 3D9LA 3JYSA 2EILE 2VQ2A 3FUMA 2AVPA 3RIBA 4JXTA 4I2WA 3ZVVA 1N4PA 3NB2A 1HXIA 5BNWA 2XCCA 3D9HA 5KCMA 2DIWA 2XEHA 5FIOA 2L6BA 5LX8A 4KVMA 3Q7FA 3E4BA 1ZU2A 4G26A 3CVPA 4JHJA 4U8YD 3Q73A 4AEZC 3QAQA 3AS4A 3PE4A 3EIJA 1JCSA 3PZ1A 1SZAA 4JHKA 3L9TA 3PZ3A 4G25A 3HVEA 3B7TA 4EZJA 1SA4A 4G11A 1U2VG 2XHEA 1FT2A 2WXGA 3VLEA 1N95A 5CBOA 2DVWA 5A7DB 1MX2A 3FULA 5EYLA 3SFZA 2IU1A 4KZ0A 2VGXA 4Q96A 3E34A 3ULEG 4K0RA 5D0QD 2ILRA 2YINA 3PS6A 1K3ZD 3AU4A 1V54E 2LO6A 5CCLA 4JA9A 3W9FA 2QYJA 3TWWA 1JCRA 4UWKA 1NZNA 1ELRA 3CHRA 4G24A 3SFYA 3PZ2A 4KXKB 5BT1A 3ML8A 3HVEB 4NIKA 3ZPJA 4LERA 2LAHA 5G55A 2GGFA 4CGWA 4AP2A 1BD8A 4HFGA 3U3WA 3TWTA 4BTBA 2FBNA 3OXGA 3PVLA 3DSUA 4AVXA 1NI1A 2PZIA 2YNQA 4WNGA 3ULYA 4JW1A 3C72A 3FWVA 3LY7A 4X8QA 3IEGA 3C3QA 3SY2A 2AWIA 3RJVA 4WWNA 3B7UX 1SA5A 3ZHEB 3ENEA 2WXKA 3SNXA 1E90A 4QQIA 3ONLA 5G04J 4ATZD 2GRRB 5IY5E 3HIZA 3FTWA 3B13A 5LP0A 3HDXA 2R2LA 3DRAA 4BTAA 3RO2A 1V55E 1H2VC 3FU6A 3CGHA 4O1PA 4HXIA 1UW4B 3IHVA 2WQ7A 3PZDA 2VSNA 2WMOA 1FVFA 4PS3A 3GZ2A 1S63A 3X2QE 1HH8A 5ITZF 1E8WA 4OAVB 3IXEA 3EHQA 4G2VA 4HBDA 4JPSA 1IXVA 4N2QA 5AJLA 1IHGA 4YVQC 2XS8A 4CEMA 3T8MA 3DPYA 5FQ4A 3ESLA 3Q4AB 2E0IA 4ILHB 4L9PA 4NURA 3HXDA 1N9AA 1KZOA 3MEKA 2V5QC 4XEIG 3EHRA 2I2OA 1NL4A 3EHMA 2P2CP 1BU9A 2OVBA 3ABLE 4L23A 4EBAA 3EU5A 4L2YA 4HOTA 1H2TC 3MCXA 4LNGA 3ZUVB 1AWCB 4I6GA 3O48A 5EILA 3MV2B 4FULA 3ESKA 4P29A 5CEDB 4XX5A 4A1GA 4HRMB 1JWFA 1Z3XA 2KATA 4BETA 5ENOD 5HS0A 4GTPA 3UXGA 5BUZA 3KEAA 4PH4B 5ARGA 3UIOC 3UUXA 3P1UA 3UKRG 2QFCA 2AJAA 3ZU7B 2MYOA 4N39A 3EUVA 2KM4A 2Y4UA 4W9RA 4Q94A 2CFZA 2I1KA 3CK8A 3APCA 3FUFA 1BI8B 3GZSA 3LKUA 2CHWA 2OVFA 4K5BA 2BUGA 2FI7A 2J9QA 1TN8A 4UWHA 3JXIA 3APFA 3UQ3A 2X6HA 3V2XA 3FTZA 1OCRE 3IKOB 4CGVA 1UN9A 2WXJA 5E75A 2VTBA 1OWLA 1YYHA 2NXPA 2WPVA 4L1BA 2DZNA 1XGWA 3VTXA 3QC1A 2F0YA 2EQXA 4YNDA 1W3BA 3KS2A 3D3MA 1IQUA 4EZKA 5CRVA 3FEYA 1E8XA 4HOUA 1E7UA 4PDXA 5B1BE 1HF8A 2LSVA 2XGOA 3CVQA 1OUVA 4I9CA 4V3IA 3HYMB 2Y69E 1WM5A 3GZ1A 3C3OA 4AXHA 3MYVA 3CSFA 3PUJA 2HE0A 4PUCA 3SO8A 4TXPA 3D9KA 3EIQC 1TNBA 5EDSA 4FP7A 4GA2A 5C1DA 4NACA 2H6FA 2B0OE 2L6JA 4GTSA 2JLBA 3FP3A 3TG5A 3RAUA 1SW6A 3PE3A 2HM8A 3ASHA 2IJGX 4B0ZA 4N3CA 3AS8A 4FADA 4HB5A 3SGHA 3UTMA 1K1AA 4OVUA 3UKUG 5ENSD 3LY8A 4GA1A 3F6QA 1E96B 4EBAG 4N2SA 2BF0X 4F1PA 2IO3C 1TEZA 4BY6A 5AQ9A 4CYMD 5AQ7A 2KZTB 3L13A 3ZIMA 4BT9A 3Q79A 3CLJA 2NC9A 2LSUA 1WAO1 4CT0A 1KT0A 3FUEA 2J49A 3JQ1A 4J8SA 1TN7A 3DSTA 2ETAA 1S70B 4OVVA 4H7XA 2P9LG 5AAOA 4ILIA 5T8IA 1UJJA 4LNBA 2R17C 1ELWA 5M72A 1OT8A 3BUAA 2OV8A 2KBXA 4TUUA 2XENA 3U64A 4JZYA 3APDA 3R7QA 2IEJA 4A3TA 4A1SA 2Y0BG 2YHCA 3TWRA 3TJPA 3Q49B 5EN5D 2MOWA 4LRZA 4Y6CA 1WG0A 4GTRA 1Y6IA 3CV0A 5ENTD 3PNTB 1LD8A 2QC9A 1PC2A 1Y8MA 4U04A 1SQMA 3RK6A 1JCQA 4CDNA 1FPPA 1OCOE 4J7WA 3TWSA 4Q69A 2J08A 3IBEA 5DBKA 2ONDA 4Y6WA 3TXNA 2JEKA 3HRAA 3MX3A 4MKTA 2DWZA 2ZXWE 3FUNA 2FO1E 3ONKA 3VLFA 2J4DA 4BFRA 2XEVA 3DSVA 4WNDA 4JEHA 4F1SA 3K9IA 5T3RA 2WXIA 1H6KA 4A63B 4XE0A 3LEWA 3J5PA 3C3RA 3ZGQA 3ZYMA 2XZDG 1YCSB 4JB8P 5FZSA 1K1BA 3HHMA 1TJFA 3RO3A 3L54A 3TWXA 4CDRA 3LXUX 4GTOA 4C0EA 4BX8A 3SBTB 3SD5A 1MYOA 3S2AA 2IOLA 4WWOA 1D9SA 2KC7A 5D66A 3ZHEA 2X38A 2CHZA 5FINA 4QFVA 4NRHB 2WXQA 5FJYA 2ETCA 3FTVA 1P5QA 2UY1A 3E37A 1HG5A 2X6JA 5KNGA 3BG1B 4UI9J 1JPLA 1QYMA 4HS2A 5EX0A 3NF1A 4MRUA 3V2OA 1TNYA 3W9GA 4UI9C 4APOA 4ME2A 2VGEA 3B7RL 2PQNA 2QYUA 3TL5A 2FF4A 2GRQB 1DCQA 5ENRD 2ZGDA 2BEDA 3EU9A 2GRNB 4DX1A 3I3NA 4TV3A 3Q9NC 5JA4D 3FUIA 4XKCA 3LY9A 4HLLA 3KSLA 1NP7A 3DXKG 1UN8A 5CCMA 4DX6D 2WB2A 2UY1B 3TG4A 1N11A 2VSXE 2EIKE 3QKYA 4J8YA 4DUIA 1O5MA 3D9MA 2XQ0A 3E30A 4UWFA 1FVHA 2EIJE 2I9CA 2A5EA 1HG2A 3MJWA 2J4BA 4LG6A 4I1OB 1TNOA 1S0PA 4HOQA 5ANRA 1A5EA 3P2BA 3G2VA 4N3AA 1LF8A 2PM6A 4GTTA 4GCNA 4ACKA 5AYWD 5JJ7A 2P9PG 4E85A 5BV0A 5FZRA 4YDOA 4FLBA 2MHKA 4I9EA 5C2YA 4DK5A 4APFA 4FLHA 3B95A 2P9NG 3UX4A 3T8KA 3CK7A 3V30A 3PNLB 1BI7B 4GZ3A 2WXPA 4GB9A 4B8AA 5J08A 5HRYA 5CEAA 4U0ZA 2R59A 1MJ0A 4LEUA 2QY7A 4A3VA 4I2ZA 3AAAC 3MV3B 5BPPA 2XPYA 1PAQA 1DC2A 2VSYA 3CK9A 2H6IA 1U3CA 4RG9A 2V0PA 2XGMA 5AQAA 1TN6A 4U8VD 3Q9UC 3B7SA 4RVBA 3V31A 3CSTA 4KVOA 4DRXE 3AG3E 4IYPA 4DLOA 3NOGD 4UWGA 3QWWA 3BQOA 3MKRA 5EX3A 2XS1A 4Z68A 3PH0C 4BSXA 3LVQE 5KBAA 1AP7A 4F7AA 5EIBE 3QOUA 1SVXA 3CKCA 1OCZE 3TWUA 2GW1A 2DYRE 2YQ8A 1INZA 3D9PA 5B3SE 4B94A 3Q47B 2Y3AA 3D9NA 2LAIA 3SF4A 3LJNA 4AY5A 2WXLA 3PRZA 3EJNA 4BSZB 5CHEE 4ANVA 2J8SD 1MHQA 2WVIA 4GCOA 4BEPA 3VLDA 1KZPA 3RRMB 5FT9A 3FTUA 2C2LA 3ZFWA 4CCAA 3OXFA 3AU5A 3L17A 4C48B 5LCWJ 3DXMG 2RFMA 1NA3A 3CIAA 4YVOA 3OXLA 3IHYA 1RZ4A 4GMRA 5CERB 5LCWC 1HS6A 3T5VA 2OEWA 5CRUA 2WMNA 5EKQD 2EIME 3RU0A 5H7PA 1E7VA 4E6HA 2PM7A 3PDNA 1NFIE 3LPZA 3FHEA 2ETBA 4ILGA 4KT6B 4NQ0A 2ZIRA 3CVWA 3QJZA 3UMVA 2X6FA 4U07A 4HRLA 3QWPA 2XRYA 2Y1LE 2KZTA 3FUJA 4XI9A 4I6EA 5DIZA 1HFAA 1LTXA 1UJKA 5ENNA 4C0MA 3BG0B 3QDNA 3O4ZA 5BV1A 1Z6TA 2V5FA 4GZ6A 1HE8A 4I43A 1EPUA 3JQ0A 3RKVA 1X81A 3UM1A 4F6RD 4JD2G 3BU8A 3L16A 4G1TA 3I5PA 2FEZA 2X6KA 1N54A 3OTNA 4GAAA 1UG3A 2LUHA 3RRUA 4KBQA 2HYZA 4U0SA 4BX9A 2OOEA 2JABA 3QB2A 5AARA 3ZNGA 4GPMA 3ML9A 2YHEA 2B6CA 3I4RB 2RFAA 4GA0A 4XIFA 4CT4A 3FDHA 3HXBA 1OCCE 3NQPA 5A23A 3L22A 1N4SA 4JL0A 1QBQA 2ZISA 2P58C 3FTYA 4ATGA 4TXQA 4RG6A 4I6JA 5FQ8A 4HNAD 2ZU6B 1H19A 1ZB1A 3RSEG 1IKND 2XPZA 1E8ZA 3PEUB 3J5QB 5CMWA 5JJTA 5EIDA 3DBSA 1O1RA 2BKKB 1ELKA 4UQZA 4XZ4A 2GRLA 3NAWA 2L0IA 4RQIA 5HQ8A 5KJMA 3DSSA 3S7JA 1Z3YA 5G05C 3ASOE 2I6HA 5AIJA 3R9AB 2R02A 1Z5SC 3PREA 1H6PA 2PL2A 3LS8A 2QZAA 3UT8A 3LDZA 3UT4A 4CRWA 1IQRA 2IFUA 4M3OA 2GRMA 2P9SG 2PQRA 4U63A 1TNUA 4U8HA 5KNHD 1U3DA 1QQEA 3KAEA 1EYHA 1HX8A 3FU5A 3HG0D 4F53A 3U4TA 3BEEA 4HQDA 4KMOA 1TJCA 3N71A 2WXRA 3QK0A 4FA6A 3Q78A 2J09A 1BLXB 1DCEA 3AG2E 4JEUA 1WDYA 3WG7E 1S64A 1N4QA 4L7TA 3ZN3A 5AENA 3T5XA 4DX2A 5E76A 2VYIA 4ZFHA 1IYGA 3GYZA 3HXEA 4K5CA 2RD0A 1H0AA 1N94A 1MZCA 2WXMA 3CHPA 3JUIA 3LYAA 4M7CA 3ZXSA 2OCCE 3G2UA 3LJ3A 5KWDA 3ZYKA 3L82A 1N4RA 5JJ6A 2LXMA 5ANLA 4PS8A 1XNFA 1KLXA 3G2WA 2Q7FA 4AY6A 3ASDA 4FC8A 3U66A 2WXNA 2WM9A 3L6AA 1OWMA 3CVYA 1SZ9A 3CHSA 3FH5A 4N5CA 2KCLA 5ENPD 1QNFA 3T9KA 3CVLA 5A6CA 4RLYA 4J6IA 2R03A 1O1SA 5BXUA 3G2TA 2CFUA 4GMLA 5HI7A 3R7RA 2FO7A 1IHBA 5CECB 4HVBA 3E33A 2J07A 3CHQA 4KZCA 1BPOA 4UUCA 4BWRA 4AOFA 3S7FA 3SFXA 2C0MA 3WXXA 5J90A 1ZBPA 2BTDA 3URZA 3ZKJA 3FY4A 4DI3A 4B93B 2H6GA 3AG1E 1A17A 4FU3A 4U0UA 3RRNB 5D0OD 4UQXA 5ARFA 4I17A 3SI5A 4FJZA 3ZEFA 4DI4A 3NOCD 4MBGA 4TRQA 2VGXB 4LNUD 5FZQA 4U7EB 3OAWA 4G8LA 4GTMA 4TUMA 3D9OA 3NBNB 3FFLA 3UINC 4GZDA 2X3MA 3C98A 3TXMA 2L0TB 5KJKA 1KT1A 3CKBA 5G04C 3SZ7A 2H6HA 3FU0A 5FQ7A 4J8FA 2WXOA 3CVNA 3PZ4A 3DSWA 5BW8C 3JUEA 5B1AE 3Q5MA 5ENQD 2RG8A 2IO2C 2I1JA 4KYOB 3KD7A 5FQ6A 2P9UG 3HXCA 4ACLA 5AN8A 4I1AA 2P9IG 4FHJA 4OYSA 5AJDA 3ZYLA 1E8YA 4JVSA 1JUQA 4HOSA 4H7YA 5T4YA 3SHFA 4AIFA 2M63A 2VSOE 2F37A 4FHKA 3FH8A 4O60A 1LD7A 3NZSA 2WQHA 4URKA 4ANWA 3PUKA 4WNFA 2KCKA 4AM9A 1G3NB 3FTSA 1EF1C 3ASFA 3U9WA 4ABNA 4ANXA 3CR3A 4GTQA 4BESA 4G8KA 3FH7A 3R9MA 1OWOA 3TWQA 3DSXA 3DWLG 4GZ5A 1X5BA 1OY3D 3QWVA 5AQBA 5LFAA 1HZ4A 3S7DA 3TAXA 4YDWA 4DJAA 3ISMC 4K03A 3KEZA 4DX7D 1L5JA 3C5RA 2LNIA 4DLQA 4TXRA 2CG2A 3MA5A 4U95D 2L9BA 3IV0A 3AG4E 4I1MA 4XKBA 1O1TA 3ABKE 3QNKA 3CHOA 1FT1A 2XEEA 3EHNA 2IONA 3V79K 2UWJG 2LXLA 4UQYA 4CZ2D 1H6OA 2NYJA 4JC8A 4F3VA 2V4HC 4OAUC 3E32A 2VJ8A 4RSYA 2PNNA 5G2NA 2DCPA 2HR2A 1QZ2A 4HI9A 2C0LA 5LOZA 3GW4A 3FEXA 3ULQA 3MZLB 2A4ZA 3UT7A 4D10C 4XI0A 1HU3A 5HKPA 4GZCA 3ASGA 2R5SA 3VTYA 2MRIA 4LCTA 3L08A 1YMPA 3CVXA 3JXJA 1TNZA 3B7BA 4AJWA 2WXFA 4BERA 2CG3A 4YDEA 3FUKA 2AXUA 3ZXPA 2AXVA 2V8SE 1NA0A 3CQGB 3SQVA 4J8EA 1WY6A 3AJIA 3G2SA 4EHMA 3LCAA 2XRZA 4B8CB 3Q15A 3CHMA 1OWPA 3FUHA 3DEPA 3LVRE 5JHAA 5BXOA 4YDYA 2AW6A 4O1OA 2F8XK 3MGBA 4BT8A 3UM0A 4ZHBA 2E2EA 3SBSA 5FTPA 4IN3B 1MX4A 1UOHA 1VDYA 2XPIA 3FU3A 2IY0C 2XGSA 4G23A 2WXHA 2WQ6A 2AXZA 3UPVA 1K8KG 4EQFA 4R7LA 4JHRA 1GW6A 1D8EA 1TR4A 2VTBB 3CEQA 3MKQA 1KPSB 3EDTB 3D9IA 1N0RA 1OXJA 2A5UA 2GRPB 3NZUA 4GYOA 2VGYA 1PY1A 2FULA 4DPRA 3FUDA 2R05A 3DEOA 4N5QA 3JCKC 4HRNA 1RW2A 4J0UA 2IOSA 5CMYA 5FWQA 4WNEA 1FCHA 1D8DA 2F8YA 5D2MC 3CVVA 3AS5A 4JA7A 3ZW3A 4MLPA 2IQCA 1EDUA 2DYSE 1DNPA
chains in the Genus database with same CATH topology
2VYIA 4Q94A 2CFZA 2I1KA 3CK8A 3MJWA 3APCA 1IYGA 3FUFA 3GYZA 2J4BA 3D9JA 4I1OB 2KCVA 2RD0A 4ANUA 3GZSA 1S0PA 4HOQA 5ANRA 1DVPA 1H0AA 1OWNA 3P2BA 2WXMA 3CHPA 3G2VA 1LF8A 3JUIA 2CHWA 3LKUA 3LYAA 4N3AA 5KJLA 2OVFA 3ZXSA 2PM6A 3TGOA 2BUGA 2FI7A 2Y4TA 2J9QA 3G2UA 4GCNA 3LJ3A 4UWHA 4WAFA 4ACKA 4L2LA 5AYWD 1N52A 3APFA 3UQ3A 5JJ7A 3ZYKA 2X6HA 3MKQB 4E85A 5JJ6A 5ANLA 2NSZA 4WWPA 5BV0A 1B89A 4PS8A 1XNFA 3FTZA 5KJNA 1KLXA 3G2WA 3IKOB 4CGVA 1UN9A 2Q7FA 5FZRA 2WXJA 3ZRHA 5E75A 2VTBA 3CVUA 4AY6A 2XCBA 4N3BA 2HO1A 3ASDA 4FC8A 4FLBA 1HO8A 1OWLA 2MHKA 4I9EA 5C2YA 2DBAA 3U66A 2NXPA 2WXNA 2WPVA 4L1BA 2WM9A 4FJYA 4DK5A 4APFA 3L6AA 1OWMA 5G05J 3CVYA 1XGWA 4EPZA 1SZ9A 3CHSA 4FLHA 3QC1A 3VTXA 3UX4A 3CQCB 4AV7A 2EQXA 3CK7A 4O6FA 3ZYQA 3FH5A 4N5CA 2KCLA 4YNDA 1QNFA 3FTXA 1W3BA 3KS2A 3D3MA 4LUNU 1IQUA 4J8DA 3PNLB 3FEYA 3CVLA 4EZKA 4GZ3A 2WXPA 1E8XA 4GB9A 4HOUA 4B8AA 4C9BB 3DPDA 4EECA 5A6CA 4HORA 5J08A 1E7UA 4UI9K 1MQSA 2CHXA 4PDXA 4UWLA 4J6IA 4U0ZA 2R59A 1HF8A 2LSVA 2XGOA 4GMJA 2X6IA 1H2UA 3CVQA 1OUVA 4LEUA 3G2TA 2CFUA 4I9CA 3S7BA 4GMLA 4V3IA 5HI7A 3R7RA 2FO7A 3PEVB 2QY7A 3HYMB 4A3VA 1WM5A 4I2ZA 4HLEA 3GZ1A 3MV3B 5BPPA 2XPYA 4WUYA 2V4LA 4HVBA 1PAQA 4IULA 4GYWA 4MS6A 2J07A 2VSYA 3CHQA 1BPOA 4KZCA 4BWRA 4AOFA 4GYYA 3S7FA 4AXHA 3CK9A 4A55A 2C0MA 3WXXA 1U3CA 5J90A 1ZBPA 3MYVA 3CSFA 4RG9A 2V0PA 2XGMA 3PUJA 2BTDA 4B89A 3URZA 3B7SA 4PUCA 4RVBA 2IF4A 3FY4A 4DI3A 3CSTA 4PS7A 1YA0A 3QARA 1A17A 4FU3A 3I4GA 4KVOA 4U0UA 3RRNB 4GPKA 4IRUA 4IYPA 3D9KA 4DLOA 3EIQC 5D0OD 4UQXA 5JHBA 4UWGA 3QWWA 5EDSA 5ARFA 3MKRA 4I17A 4EZLA 3SI5A 4CDMA 4FP7A 4GU5A 4GA2A 5C1DA 4FJZA 4NACA 5EX3A 1JWGA 3ZEFA 3D9LA 2L6JA 3JYSA 3FUMA 2VQ2A 3PH0C 2AVPA 2JLBA 3RIBA 3LVQE 4JXTA 4BSXA 4DI4A 5FZQA 4I2WA 2VGXB 4TRQA 3ZVVA 3QOUA 4F7AA 3CKCA 3FP3A 3TG5A 3OAWA 3PE3A 1HXIA 2HM8A 3D9OA 2GW1A 5BNWA 2XCCA 3ASHA 2YQ8A 2DIWA 5KCMA 1INZA 3D9PA 2IJGX 4B0ZA 5LX8A 4N3CA 3FFLA 4GZDA 3AS8A 4B94A 2X3MA 4FADA 3C98A 4KVMA 2L0TB 3TXMA 3E4BA 3Q47B 2Y3AA 3SGHA 3D9NA 2LAIA 5KJKA 1KT1A 3CKBA 1ZU2A 4OVUA 5G04C 4G26A 3CVPA 4JHJA 3SF4A 3SZ7A 3LY8A 4GA1A 4AY5A 2WXLA 1E96B 3FU0A 3PRZA 5FQ7A 4EBAG 3EJNA 4AEZC 4N2SA 2BF0X 3QAQA 3AS4A 3PE4A 5CHEE 1TEZA 4J8FA 3EIJA 4BY6A 2WXOA 3CVNA 1SZAA 4ANVA 4JHKA 4G25A 1MHQA 2KZTB 2WVIA 4GCOA 3L13A 5BW8C 3ZIMA 4BT9A 3VLDA 3HVEA 3RRMB 3B7TA 5FT9A 3Q5MA 3FTUA 3CLJA 2NC9A 2C2LA 2RG8A 3ZFWA 4CCAA 2LSUA 1WAO1 3OXFA 4EZJA 3AU5A 4CT0A 1KT0A 3FUEA 3L17A 2J49A 3JQ1A 2I1JA 4KYOB 3KD7A 5LCWJ 4G11A 5FQ6A 4J8SA 2XHEA 4ACLA 2WXGA 3VLEA 4I1AA 1NA3A 3CIAA 4YVOA 3OXLA 3IHYA 4FHJA 4OVVA 4OYSA 4H7XA 5AJDA 5A7DB 3ZYLA 1E8YA 4ILIA 3FULA 5T8IA 4JVSA 1JUQA 5LCWC 4HOSA 1HS6A 3SFZA 4H7YA 1UJJA 2IU1A 4KZ0A 5T4YA 3T5VA 2R17C 2VGXA 1ELWA 3SHFA 5M72A 4Q96A 4AIFA 4K0RA 2M63A 2WMNA 5EKQD 2OV8A 2VSOE 3RU0A 5D0QD 4TUUA 2ILRA 2YINA 3PS6A 3U64A 3AU4A 4FHKA 2LO6A 4JZYA 1E7VA 3APDA 4E6HA 4JA9A 2PM7A 3R7QA 5CCLA 3FH8A 3PDNA 4A3TA 4A1SA 3NZSA 2YHCA 3LPZA 2WQHA 3TJPA 3Q49B 4URKA 3FHEA 4ANWA 2MOWA 3PUKA 4LRZA 4Y6CA 4WNFA 1Y6IA 2KCKA 3CV0A 3FTSA 4UWKA 4AM9A 1NZNA 4ILGA 1ELRA 1EF1C 3PNTB 3ASFA 4KT6B 3CHRA 3U9WA 4NQ0A 4G24A 4ABNA 4ANXA 3CR3A 3CVWA 4KXKB 5BT1A 1PC2A 1Y8MA 3HVEB 3ML8A 3QJZA 4LERA 2LAHA 4U04A 3FH7A 1SQMA 1OWOA 2GGFA 2X6FA 4U07A 5G55A 3UMVA 4AP2A 3RK6A 4CGWA 4HFGA 3QWPA 4CDNA 2XRYA 3U3WA 4GZ5A 2KZTA 1X5BA 3FUJA 4Q69A 4BTBA 4XI9A 3QWVA 4I6EA 2FBNA 2J08A 3IBEA 3OXGA 1HFAA 3PVLA 5DIZA 4AVXA 5LFAA 5DBKA 1HZ4A 1UJKA 5ENNA 2ONDA 4C0MA 3S7DA 2PZIA 4Y6WA 2YNQA 3BG0B 4WNGA 3TXNA 3QDNA 4JW1A 3TAXA 3O4ZA 3FWVA 5BV1A 1Z6TA 2JEKA 2V5FA 3LY7A 4GZ6A 4DJAA 3IEGA 1HE8A 4I43A 4K03A 3KEZA 1EPUA 1L5JA 3JQ0A 2AWIA 3MX3A 3RJVA 4WWNA 2LNIA 4MKTA 3B7UX 4DLQA 3ZHEB 3RKVA 2CG2A 3MA5A 3L16A 2L9BA 3FUNA 3ENEA 3IV0A 2WXKA 4G1TA 3SNXA 3ONKA 4I1MA 3VLFA 3I5PA 4XKBA 1E90A 2FEZA 2J4DA 3ONLA 2X6KA 5G04J 3QNKA 4BFRA 3CHOA 3EHNA 3HIZA 1N54A 2IONA 2XEVA 3FTWA 2UWJG 3B13A 3OTNA 4GAAA 4UQYA 1UG3A 4JC8A 5LP0A 4F3VA 4WNDA 4JEHA 4F1SA 3HDXA 3K9IA 5T3RA 4BTAA 2WXIA 1H6KA 4XE0A 3LEWA 3RRUA 4KBQA 2HYZA 4U0SA 4BX9A 2VJ8A 2OOEA 3RO2A 3ZGQA 4RSYA 3ZYMA 3QB2A 5G2NA 2DCPA 1H2VC 3FU6A 3CGHA 2HR2A 1QZ2A 2C0LA 5FZSA 5LOZA 4HXIA 1UW4B 3GW4A 3IHVA 2WQ7A 3ML9A 2YHEA 3PZDA 3I4RB 2VSNA 3FEXA 2WMOA 3ULQA 1FVFA 3MZLB 4PS3A 4GA0A 2A4ZA 3GZ2A 4XIFA 4CT4A 3UT7A 3HHMA 1TJFA 4D10C 4XI0A 1HU3A 1HH8A 3FDHA 3RO3A 3L54A 4GZCA 1E8WA 4CDRA 3ASGA 3LXUX 2R5SA 3NQPA 5A23A 3L22A 4G2VA 2MRIA 4JL0A 3VTYA 4C0EA 4BX8A 4JPSA 4LCTA 3L08A 4N2QA 2P58C 5AJLA 3SBTB 1IHGA 4YVQC 3CVXA 3FTYA 4ATGA 4AJWA 3SD5A 4CEMA 2WXFA 4RG6A 3S2AA 4I6JA 5FQ8A 2CG3A 2IOLA 3FUKA 2ZU6B 1H19A 4WWOA 2AXUA 3T8MA 2AXVA 2XPZA 5FQ4A 2KC7A 1NA0A 1E8ZA 2V8SE 3CQGB 3PEUB 5CMWA 2X38A 2CHZA 3ESLA 1WY6A 3G2SA 4J8EA 3Q4AB 3ZHEA 5JJTA 2E0IA 3DBSA 3LCAA 2XRZA 4ILHB 1ELKA 4UQZA 4XZ4A 4NURA 4QFVA 4NRHB 2WXQA 4B8CB 5FJYA 2GRLA 3FTVA 3Q15A 3CHMA 1OWPA 1P5QA 2UY1A 3FUHA 2L0IA 3MEKA 1HG5A 2X6JA 3LVRE 5HQ8A 5KJMA 3BG1B 4UI9J 5JHAA 3S7JA 1Z3YA 5G05C 2I2OA 1JPLA 2AW6A 2I6HA 3EHMA 5AIJA 3MGBA 4HS2A 5EX0A 3NF1A 3R9AB 4BT8A 4MRUA 2E2EA 3PREA 4UI9C 2PL2A 4APOA 3LS8A 2OVBA 3SBSA 4ME2A 3UT8A 4CRWA 3LDZA 5FTPA 4IN3B 3UT4A 4L23A 4EBAA 1VDYA 1IQRA 2XPIA 2IFUA 3B7RL 2PQNA 3FU3A 4L2YA 1H2TC 3MCXA 4HOTA 4M3OA 3TL5A 2XGSA 2FF4A 4G23A 2WXHA 2GRMA 2WQ6A 2AXZA 4I6GA 3O48A 3UPVA 2PQRA 3MV2B 4FULA 4U63A 4U8HA 4EQFA 4R7LA 4JHRA 1U3DA 1QQEA 3ESKA 1GW6A 3KAEA 4P29A 2VTBB 1EYHA 3I3NA 3CEQA 4XX5A 4TV3A 1HX8A 3FU5A 3MKQA 4A1GA 3EDTB 1JWFA 2A5UA 3D9IA 1Z3XA 3FUIA 4F53A 2KATA 4XKCA 3LY9A 3NZUA 4GYOA 3U4TA 2VGYA 3BEEA 1PY1A 2FULA 4KMOA 4DPRA 1TJCA 1NP7A 3N71A 2WXRA 3FUDA 1UN8A 5BUZA 5CCMA 3QK0A 4FA6A 4PH4B 5ARGA 2WB2A 2J09A 3UUXA 2UY1B 3TG4A 3P1UA 2VSXE 2QFCA 3JCKC 4JEUA 3QKYA 4J0UA 2IOSA 5CMYA 5FWQA 4WNEA 1FCHA 3D9MA 4L7TA 3ZN3A 2XQ0A 4N39A 5AENA 3CVVA 3T5XA 3AS5A 4JA7A 3ZPJA 4UWFA 3ZW3A 1FVHA 5E76A 4MLPA 2KM4A 2I9CA 2IQCA 2Y4UA 1EDUA 4W9RA 1DNPA 1HG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYI A;  3CK8 A;  1IYG A;  3GYZ A;  2KCV A;  4HOQ A;  3LKU A;  3LYA A;  4N3A A;  5KJL A;  3TGO A;  2BUG A;  2FI7 A;  2Y4T A;  2J9Q A;  4GCN A;  5AYW D;  5JJ7 A;  3UQ3 A;  5JJ6 A;  1B89 A;  1XNF A;  5KJN A;  1KLX A;  4CGV A;  2Q7F A;  5FZR A;  4AY6 A;  2XCB A;  4N3B A;  2HO1 A;  3ASD A;  2MHK A;  4I9E A;  2DBA A;  2WPV A;  5G05 J;  3VTX A;  3CK7 A;  4O6F A;  4N5C A;  2KCL A;  4YND A;  1W3B A;  3KS2 A;  4J8D A;  3CVL A;  4GZ3 A;  4HOU A;  5A6C A;  4HOR A;  4UI9 K;  4U0Z A;  2LSV A;  2XGO A;  3CVQ A;  4LEU A;  1OUV A;  4I9C A;  3S7B A;  5HI7 A;  2FO7 A;  3HYM B;  1WM5 A;  4I2Z A;  3GZ1 A;  3MV3 B;  4WUY A;  4GYW A;  2VSY A;  4BWR A;  4GYY A;  3S7F A;  3CK9 A;  2C0M A;  3WXX A;  1ZBP A;  4RG9 A;  2XGM A;  3URZ A;  2IF4 A;  1YA0 A;  1A17 A;  4U0U A;  4GPK A;  5D0O D;  4UQX A;  3QWW A;  5ARF A;  4I17 A;  3MKR A;  4GA2 A;  5C1D A;  5EX3 A;  2L6J A;  3JYS A;  2VQ2 A;  2AVP A;  2JLB A;  3RIB A;  5FZQ A;  4I2W A;  2VGX B;  3QOU A;  3CKC A;  3FP3 A;  3TG5 A;  3PE3 A;  1HXI A;  5BNW A;  2GW1 A;  2XCC A;  3ASH A;  2YQ8 A;  4N3C A;  3FFL A;  3AS8 A;  4B94 A;  3E4B A;  3Q47 B;  5KJK A;  1KT1 A;  3CKB A;  1ZU2 A;  5G04 C;  4G26 A;  3CVP A;  3SF4 A;  3SZ7 A;  3LY8 A;  4GA1 A;  4AY5 A;  1E96 B;  4N2S A;  3AS4 A;  3PE4 A;  5CHE E;  4J8F A;  3CVN A;  4G25 A;  4GCO A;  5BW8 C;  4BT9 A;  5FT9 A;  3Q5M A;  2NC9 A;  2C2L A;  3ZFW A;  2LSU A;  1WAO 1;  3OXF A;  1KT0 A;  4KYO B;  3KD7 A;  5LCW J;  4I1A A;  1NA3 A;  4YVO A;  3OXL A;  4H7X A;  5A7D B;  5LCW C;  4HOS A;  4H7Y A;  2VGX A;  1ELW A;  5M72 A;  4AIF A;  5EKQ D;  3RU0 A;  5D0Q D;  5CCL A;  4JA9 A;  3PDN A;  4A1S A;  2YHC A;  3LPZ A;  2WQH A;  3Q49 B;  4Y6C A;  4WNF A;  2KCK A;  3CV0 A;  4AM9 A;  1NZN A;  1ELR A;  3ASF A;  4NQ0 A;  4G24 A;  4ABN A;  4KXK B;  5BT1 A;  1PC2 A;  1Y8M A;  3ZPJ A;  4U04 A;  4U07 A;  4CGW A;  3QWP A;  3U3W A;  4GZ5 A;  4BTB A;  4XI9 A;  3QWV A;  2FBN A;  3OXG A;  5DIZ A;  5DBK A;  1HZ4 A;  2OND A;  3S7D A;  2PZI A;  4Y6W A;  4WNG A;  3QDN A;  3TAX A;  3FWV A;  2V5F A;  3LY7 A;  4GZ6 A;  3IEG A;  3RJV A;  2LNI A;  3ZHE B;  3RKV A;  3MA5 A;  4G1T A;  2FEZ A;  5G04 J;  2XEV A;  2UWJ G;  4UQY A;  4F3V A;  4WND A;  3K9I A;  4BTA A;  4KBQ A;  2HYZ A;  4U0S A;  2OOE A;  3RO2 A;  3ZGQ A;  2HR2 A;  1QZ2 A;  2C0L A;  5FZS A;  3GW4 A;  2VSN A;  3ULQ A;  4GA0 A;  4XIF A;  3GZ2 A;  4XI0 A;  1HH8 A;  3RO3 A;  4CDR A;  3ASG A;  2R5S A;  4G2V A;  4JL0 A;  3VTY A;  4N2Q A;  2P58 C;  1IHG A;  4YVQ C;  4RG6 A;  2KC7 A;  1NA0 A;  4J8E A;  3ZHE A;  5JJT A;  3Q4A B;  3LCA A;  4UQZ A;  4NRH B;  5FJY A;  3Q15 A;  1P5Q A;  2UY1 A;  3MEK A;  5HQ8 A;  5KJM A;  4UI9 J;  3S7J A;  5G05 C;  2I6H A;  5EX0 A;  3NF1 A;  4BT8 A;  3R9A B;  2E2E A;  4UI9 C;  2PL2 A;  4APO A;  4ME2 A;  5FTP A;  4IN3 B;  2XPI A;  2IFU A;  4HOT A;  2PQN A;  2XGS A;  2FF4 A;  4G23 A;  3O48 A;  3UPV A;  2PQR A;  3MV2 B;  4EQF A;  4JHR A;  3ESK A;  1QQE A;  3KAE A;  3CEQ A;  3EDT B;  2KAT A;  3LY9 A;  4GYO A;  3U4T A;  2VGY A;  3BEE A;  1TJC A;  3N71 A;  5CCM A;  5ARG A;  3UUX A;  2UY1 B;  3TG4 A;  2QFC A;  3QKY A;  4J0U A;  4WNE A;  1FCH A;  3ZN3 A;  4N39 A;  3AS5 A;  4JA7 A;  2Y4U A;  4W9R A; 
#chains in the Genus database with same CATH topology
 3UM2 A;  3D9J A;  2OEV A;  2KCV A;  4ANU A;  2EIN E;  1DVP A;  3ABM E;  1OWN A;  5KJL A;  3HXF A;  3TGO A;  2Y4T A;  3UI2 A;  4WAF A;  4L2L A;  1N52 A;  3MKQ B;  1MX6 A;  4U96 D;  2NSZ A;  3TWV A;  4WWP A;  3UIP C;  1B89 A;  5KJN A;  2ZGG A;  3ZRH A;  3CVU A;  2XCB A;  4N3B A;  2HO1 A;  1HO8 A;  2DBA A;  4FJY A;  5G05 J;  4EPZ A;  3CQC B;  4AV7 A;  3UM3 A;  4O6F A;  3ZYQ A;  4K5A B;  2BKG A;  3FTX A;  4LUN U;  4J8D A;  2GRO B;  3ASN E;  4EEC A;  2DZO A;  4C9B B;  3DPD A;  4HOR A;  5JMN D;  4UI9 K;  1MQS A;  2CHX A;  2XZT G;  4UWL A;  4GMJ A;  2RKK A;  2X6I A;  1H2U A;  3Q7A A;  3S7B A;  3PEV B;  4HLE A;  1TYQ G;  4GTV A;  3Q75 A;  4WUY A;  2V4L A;  4IUL A;  4GYW A;  4MS6 A;  5EYP F;  3KSQ A;  5CBN A;  4GYY A;  2P9K G;  1N0Q A;  4DX5 D;  4A55 A;  4B89 A;  2IF4 A;  4PS7 A;  1YA0 A;  3QAR A;  2KXP C;  3I4G A;  4GPK A;  4HI8 A;  4IRU A;  5JHB A;  4EZL A;  4CDM A;  4GU5 A;  1JWG A;  1Q2Z A;  4LSZ E;  3D9L A;  3JYS A;  2EIL E;  2VQ2 A;  3FUM A;  2AVP A;  3RIB A;  4JXT A;  4I2W A;  3ZVV A;  1N4P A;  3NB2 A;  1HXI A;  5BNW A;  2XCC A;  3D9H A;  5KCM A;  2DIW A;  2XEH A;  5FIO A;  2L6B A;  5LX8 A;  4KVM A;  3Q7F A;  3E4B A;  1ZU2 A;  4G26 A;  3CVP A;  4JHJ A;  4U8Y D;  3Q73 A;  4AEZ C;  3QAQ A;  3AS4 A;  3PE4 A;  3EIJ A;  1JCS A;  3PZ1 A;  1SZA A;  4JHK A;  3L9T A;  3PZ3 A;  4G25 A;  3HVE A;  3B7T A;  4EZJ A;  1SA4 A;  4G11 A;  1U2V G;  2XHE A;  1FT2 A;  2WXG A;  3VLE A;  1N95 A;  5CBO A;  2DVW A;  5A7D B;  1MX2 A;  3FUL A;  5EYL A;  3SFZ A;  2IU1 A;  4KZ0 A;  2VGX A;  4Q96 A;  3E34 A;  3ULE G;  4K0R A;  5D0Q D;  2ILR A;  2YIN A;  3PS6 A;  1K3Z D;  3AU4 A;  1V54 E;  2LO6 A;  5CCL A;  4JA9 A;  3W9F A;  2QYJ A;  3TWW A;  1JCR A;  4UWK A;  1NZN A;  1ELR A;  3CHR A;  4G24 A;  3SFY A;  3PZ2 A;  4KXK B;  5BT1 A;  3ML8 A;  3HVE B;  4NIK A;  3ZPJ A;  4LER A;  2LAH A;  5G55 A;  2GGF A;  4CGW A;  4AP2 A;  1BD8 A;  4HFG A;  3U3W A;  3TWT A;  4BTB A;  2FBN A;  3OXG A;  3PVL A;  3DSU A;  4AVX A;  1NI1 A;  2PZI A;  2YNQ A;  4WNG A;  3ULY A;  4JW1 A;  3C72 A;  3FWV A;  3LY7 A;  4X8Q A;  3IEG A;  3C3Q A;  3SY2 A;  2AWI A;  3RJV A;  4WWN A;  3B7U X;  1SA5 A;  3ZHE B;  3ENE A;  2WXK A;  3SNX A;  1E90 A;  4QQI A;  3ONL A;  5G04 J;  4ATZ D;  2GRR B;  5IY5 E;  3HIZ A;  3FTW A;  3B13 A;  5LP0 A;  3HDX A;  2R2L A;  3DRA A;  4BTA A;  3RO2 A;  1V55 E;  1H2V C;  3FU6 A;  3CGH A;  4O1P A;  4HXI A;  1UW4 B;  3IHV A;  2WQ7 A;  3PZD A;  2VSN A;  2WMO A;  1FVF A;  4PS3 A;  3GZ2 A;  1S63 A;  3X2Q E;  1HH8 A;  5ITZ F;  1E8W A;  4OAV B;  3IXE A;  3EHQ A;  4G2V A;  4HBD A;  4JPS A;  1IXV A;  4N2Q A;  5AJL A;  1IHG A;  4YVQ C;  2XS8 A;  4CEM A;  3T8M A;  3DPY A;  5FQ4 A;  3ESL A;  3Q4A B;  2E0I A;  4ILH B;  4L9P A;  4NUR A;  3HXD A;  1N9A A;  1KZO A;  3MEK A;  2V5Q C;  4XEI G;  3EHR A;  2I2O A;  1NL4 A;  3EHM A;  2P2C P;  1BU9 A;  2OVB A;  3ABL E;  4L23 A;  4EBA A;  3EU5 A;  4L2Y A;  4HOT A;  1H2T C;  3MCX A;  4LNG A;  3ZUV B;  1AWC B;  4I6G A;  3O48 A;  5EIL A;  3MV2 B;  4FUL A;  3ESK A;  4P29 A;  5CED B;  4XX5 A;  4A1G A;  4HRM B;  1JWF A;  1Z3X A;  2KAT A;  4BET A;  5ENO D;  5HS0 A;  4GTP A;  3UXG A;  5BUZ A;  3KEA A;  4PH4 B;  5ARG A;  3UIO C;  3UUX A;  3P1U A;  3UKR G;  2QFC A;  2AJA A;  3ZU7 B;  2MYO A;  4N39 A;  3EUV A;  2KM4 A;  2Y4U A;  4W9R A;  4Q94 A;  2CFZ A;  2I1K A;  3CK8 A;  3APC A;  3FUF A;  1BI8 B;  3GZS A;  3LKU A;  2CHW A;  2OVF A;  4K5B A;  2BUG A;  2FI7 A;  2J9Q A;  1TN8 A;  4UWH A;  3JXI A;  3APF A;  3UQ3 A;  2X6H A;  3V2X A;  3FTZ A;  1OCR E;  3IKO B;  4CGV A;  1UN9 A;  2WXJ A;  5E75 A;  2VTB A;  1OWL A;  1YYH A;  2NXP A;  2WPV A;  4L1B A;  2DZN A;  1XGW A;  3VTX A;  3QC1 A;  2F0Y A;  2EQX A;  4YND A;  1W3B A;  3KS2 A;  3D3M A;  1IQU A;  4EZK A;  5CRV A;  3FEY A;  1E8X A;  4HOU A;  1E7U A;  4PDX A;  5B1B E;  1HF8 A;  2LSV A;  2XGO A;  3CVQ A;  1OUV A;  4I9C A;  4V3I A;  3HYM B;  2Y69 E;  1WM5 A;  3GZ1 A;  3C3O A;  4AXH A;  3MYV A;  3CSF A;  3PUJ A;  2HE0 A;  4PUC A;  3SO8 A;  4TXP A;  3D9K A;  3EIQ C;  1TNB A;  5EDS A;  4FP7 A;  4GA2 A;  5C1D A;  4NAC A;  2H6F A;  2B0O E;  2L6J A;  4GTS A;  2JLB A;  3FP3 A;  3TG5 A;  3RAU A;  1SW6 A;  3PE3 A;  2HM8 A;  3ASH A;  2IJG X;  4B0Z A;  4N3C A;  3AS8 A;  4FAD A;  4HB5 A;  3SGH A;  3UTM A;  1K1A A;  4OVU A;  3UKU G;  5ENS D;  3LY8 A;  4GA1 A;  3F6Q A;  1E96 B;  4EBA G;  4N2S A;  2BF0 X;  4F1P A;  2IO3 C;  1TEZ A;  4BY6 A;  5AQ9 A;  4CYM D;  5AQ7 A;  2KZT B;  3L13 A;  3ZIM A;  4BT9 A;  3Q79 A;  3CLJ A;  2NC9 A;  2LSU A;  1WAO 1;  4CT0 A;  1KT0 A;  3FUE A;  2J49 A;  3JQ1 A;  4J8S A;  1TN7 A;  3DST A;  2ETA A;  1S70 B;  4OVV A;  4H7X A;  2P9L G;  5AAO A;  4ILI A;  5T8I A;  1UJJ A;  4LNB A;  2R17 C;  1ELW A;  5M72 A;  1OT8 A;  3BUA A;  2OV8 A;  2KBX A;  4TUU A;  2XEN A;  3U64 A;  4JZY A;  3APD A;  3R7Q A;  2IEJ A;  4A3T A;  4A1S A;  2Y0B G;  2YHC A;  3TWR A;  3TJP A;  3Q49 B;  5EN5 D;  2MOW A;  4LRZ A;  4Y6C A;  1WG0 A;  4GTR A;  1Y6I A;  3CV0 A;  5ENT D;  3PNT B;  1LD8 A;  2QC9 A;  1PC2 A;  1Y8M A;  4U04 A;  1SQM A;  3RK6 A;  1JCQ A;  4CDN A;  1FPP A;  1OCO E;  4J7W A;  3TWS A;  4Q69 A;  2J08 A;  3IBE A;  5DBK A;  2OND A;  4Y6W A;  3TXN A;  2JEK A;  3HRA A;  3MX3 A;  4MKT A;  2DWZ A;  2ZXW E;  3FUN A;  2FO1 E;  3ONK A;  3VLF A;  2J4D A;  4BFR A;  2XEV A;  3DSV A;  4WND A;  4JEH A;  4F1S A;  3K9I A;  5T3R A;  2WXI A;  1H6K A;  4A63 B;  4XE0 A;  3LEW A;  3J5P A;  3C3R A;  3ZGQ A;  3ZYM A;  2XZD G;  1YCS B;  4JB8 P;  5FZS A;  1K1B A;  3HHM A;  1TJF A;  3RO3 A;  3L54 A;  3TWX A;  4CDR A;  3LXU X;  4GTO A;  4C0E A;  4BX8 A;  3SBT B;  3SD5 A;  1MYO A;  3S2A A;  2IOL A;  4WWO A;  1D9S A;  2KC7 A;  5D66 A;  3ZHE A;  2X38 A;  2CHZ A;  5FIN A;  4QFV A;  4NRH B;  2WXQ A;  5FJY A;  2ETC A;  3FTV A;  1P5Q A;  2UY1 A;  3E37 A;  1HG5 A;  2X6J A;  5KNG A;  3BG1 B;  4UI9 J;  1JPL A;  1QYM A;  4HS2 A;  5EX0 A;  3NF1 A;  4MRU A;  3V2O A;  1TNY A;  3W9G A;  4UI9 C;  4APO A;  4ME2 A;  2VGE A;  3B7R L;  2PQN A;  2QYU A;  3TL5 A;  2FF4 A;  2GRQ B;  1DCQ A;  5ENR D;  2ZGD A;  2BED A;  3EU9 A;  2GRN B;  4DX1 A;  3I3N A;  4TV3 A;  3Q9N C;  5JA4 D;  3FUI A;  4XKC A;  3LY9 A;  4HLL A;  3KSL A;  1NP7 A;  3DXK G;  1UN8 A;  5CCM A;  4DX6 D;  2WB2 A;  2UY1 B;  3TG4 A;  1N11 A;  2VSX E;  2EIK E;  3QKY A;  4J8Y A;  4DUI A;  1O5M A;  3D9M A;  2XQ0 A;  3E30 A;  4UWF A;  1FVH A;  2EIJ E;  2I9C A;  2A5E A;  1HG2 A;  3MJW A;  2J4B A;  4LG6 A;  4I1O B;  1TNO A;  1S0P A;  4HOQ A;  5ANR A;  1A5E A;  3P2B A;  3G2V A;  4N3A A;  1LF8 A;  2PM6 A;  4GTT A;  4GCN A;  4ACK A;  5AYW D;  5JJ7 A;  2P9P G;  4E85 A;  5BV0 A;  5FZR A;  4YDO A;  4FLB A;  2MHK A;  4I9E A;  5C2Y A;  4DK5 A;  4APF A;  4FLH A;  3B95 A;  2P9N G;  3UX4 A;  3T8K A;  3CK7 A;  3V30 A;  3PNL B;  1BI7 B;  4GZ3 A;  2WXP A;  4GB9 A;  4B8A A;  5J08 A;  5HRY A;  5CEA A;  4U0Z A;  2R59 A;  1MJ0 A;  4LEU A;  2QY7 A;  4A3V A;  4I2Z A;  3AAA C;  3MV3 B;  5BPP A;  2XPY A;  1PAQ A;  1DC2 A;  2VSY A;  3CK9 A;  2H6I A;  1U3C A;  4RG9 A;  2V0P A;  2XGM A;  5AQA A;  1TN6 A;  4U8V D;  3Q9U C;  3B7S A;  4RVB A;  3V31 A;  3CST A;  4KVO A;  4DRX E;  3AG3 E;  4IYP A;  4DLO A;  3NOG D;  4UWG A;  3QWW A;  3BQO A;  3MKR A;  5EX3 A;  2XS1 A;  4Z68 A;  3PH0 C;  4BSX A;  3LVQ E;  5KBA A;  1AP7 A;  4F7A A;  5EIB E;  3QOU A;  1SVX A;  3CKC A;  1OCZ E;  3TWU A;  2GW1 A;  2DYR E;  2YQ8 A;  1INZ A;  3D9P A;  5B3S E;  4B94 A;  3Q47 B;  2Y3A A;  3D9N A;  2LAI A;  3SF4 A;  3LJN A;  4AY5 A;  2WXL A;  3PRZ A;  3EJN A;  4BSZ B;  5CHE E;  4ANV A;  2J8S D;  1MHQ A;  2WVI A;  4GCO A;  4BEP A;  3VLD A;  1KZP A;  3RRM B;  5FT9 A;  3FTU A;  2C2L A;  3ZFW A;  4CCA A;  3OXF A;  3AU5 A;  3L17 A;  4C48 B;  5LCW J;  3DXM G;  2RFM A;  1NA3 A;  3CIA A;  4YVO A;  3OXL A;  3IHY A;  1RZ4 A;  4GMR A;  5CER B;  5LCW C;  1HS6 A;  3T5V A;  2OEW A;  5CRU A;  2WMN A;  5EKQ D;  2EIM E;  3RU0 A;  5H7P A;  1E7V A;  4E6H A;  2PM7 A;  3PDN A;  1NFI E;  3LPZ A;  3FHE A;  2ETB A;  4ILG A;  4KT6 B;  4NQ0 A;  2ZIR A;  3CVW A;  3QJZ A;  3UMV A;  2X6F A;  4U07 A;  4HRL A;  3QWP A;  2XRY A;  2Y1L E;  2KZT A;  3FUJ A;  4XI9 A;  4I6E A;  5DIZ A;  1HFA A;  1LTX A;  1UJK A;  5ENN A;  4C0M A;  3BG0 B;  3QDN A;  3O4Z A;  5BV1 A;  1Z6T A;  2V5F A;  4GZ6 A;  1HE8 A;  4I43 A;  1EPU A;  3JQ0 A;  3RKV A;  1X81 A;  3UM1 A;  4F6R D;  4JD2 G;  3BU8 A;  3L16 A;  4G1T A;  3I5P A;  2FEZ A;  2X6K A;  1N54 A;  3OTN A;  4GAA A;  1UG3 A;  2LUH A;  3RRU A;  4KBQ A;  2HYZ A;  4U0S A;  4BX9 A;  2OOE A;  2JAB A;  3QB2 A;  5AAR A;  3ZNG A;  4GPM A;  3ML9 A;  2YHE A;  2B6C A;  3I4R B;  2RFA A;  4GA0 A;  4XIF A;  4CT4 A;  3FDH A;  3HXB A;  1OCC E;  3NQP A;  5A23 A;  3L22 A;  1N4S A;  4JL0 A;  1QBQ A;  2ZIS A;  2P58 C;  3FTY A;  4ATG A;  4TXQ A;  4RG6 A;  4I6J A;  5FQ8 A;  4HNA D;  2ZU6 B;  1H19 A;  1ZB1 A;  3RSE G;  1IKN D;  2XPZ A;  1E8Z A;  3PEU B;  3J5Q B;  5CMW A;  5JJT A;  5EID A;  3DBS A;  1O1R A;  2BKK B;  1ELK A;  4UQZ A;  4XZ4 A;  2GRL A;  3NAW A;  2L0I A;  4RQI A;  5HQ8 A;  5KJM A;  3DSS A;  3S7J A;  1Z3Y A;  5G05 C;  3ASO E;  2I6H A;  5AIJ A;  3R9A B;  2R02 A;  1Z5S C;  3PRE A;  1H6P A;  2PL2 A;  3LS8 A;  2QZA A;  3UT8 A;  3LDZ A;  3UT4 A;  4CRW A;  1IQR A;  2IFU A;  4M3O A;  2GRM A;  2P9S G;  2PQR A;  4U63 A;  1TNU A;  4U8H A;  5KNH D;  1U3D A;  1QQE A;  3KAE A;  1EYH A;  1HX8 A;  3FU5 A;  3HG0 D;  4F53 A;  3U4T A;  3BEE A;  4HQD A;  4KMO A;  1TJC A;  3N71 A;  2WXR A;  3QK0 A;  4FA6 A;  3Q78 A;  2J09 A;  1BLX B;  1DCE A;  3AG2 E;  4JEU A;  1WDY A;  3WG7 E;  1S64 A;  1N4Q A;  4L7T A;  3ZN3 A;  5AEN A;  3T5X A;  4DX2 A;  5E76 A;  2VYI A;  4ZFH A;  1IYG A;  3GYZ A;  3HXE A;  4K5C A;  2RD0 A;  1H0A A;  1N94 A;  1MZC A;  2WXM A;  3CHP A;  3JUI A;  3LYA A;  4M7C A;  3ZXS A;  2OCC E;  3G2U A;  3LJ3 A;  5KWD A;  3ZYK A;  3L82 A;  1N4R A;  5JJ6 A;  2LXM A;  5ANL A;  4PS8 A;  1XNF A;  1KLX A;  3G2W A;  2Q7F A;  4AY6 A;  3ASD A;  4FC8 A;  3U66 A;  2WXN A;  2WM9 A;  3L6A A;  1OWM A;  3CVY A;  1SZ9 A;  3CHS A;  3FH5 A;  4N5C A;  2KCL A;  5ENP D;  1QNF A;  3T9K A;  3CVL A;  5A6C A;  4RLY A;  4J6I A;  2R03 A;  1O1S A;  5BXU A;  3G2T A;  2CFU A;  4GML A;  5HI7 A;  3R7R A;  2FO7 A;  1IHB A;  5CEC B;  4HVB A;  3E33 A;  2J07 A;  3CHQ A;  4KZC A;  1BPO A;  4UUC A;  4BWR A;  4AOF A;  3S7F A;  3SFX A;  2C0M A;  3WXX A;  5J90 A;  1ZBP A;  2BTD A;  3URZ A;  3ZKJ A;  3FY4 A;  4DI3 A;  4B93 B;  2H6G A;  3AG1 E;  1A17 A;  4FU3 A;  4U0U A;  3RRN B;  5D0O D;  4UQX A;  5ARF A;  4I17 A;  3SI5 A;  4FJZ A;  3ZEF A;  4DI4 A;  3NOC D;  4MBG A;  4TRQ A;  2VGX B;  4LNU D;  5FZQ A;  4U7E B;  3OAW A;  4G8L A;  4GTM A;  4TUM A;  3D9O A;  3NBN B;  3FFL A;  3UIN C;  4GZD A;  2X3M A;  3C98 A;  3TXM A;  2L0T B;  5KJK A;  1KT1 A;  3CKB A;  5G04 C;  3SZ7 A;  2H6H A;  3FU0 A;  5FQ7 A;  4J8F A;  2WXO A;  3CVN A;  3PZ4 A;  3DSW A;  5BW8 C;  3JUE A;  5B1A E;  3Q5M A;  5ENQ D;  2RG8 A;  2IO2 C;  2I1J A;  4KYO B;  3KD7 A;  5FQ6 A;  2P9U G;  3HXC A;  4ACL A;  5AN8 A;  4I1A A;  2P9I G;  4FHJ A;  4OYS A;  5AJD A;  3ZYL A;  1E8Y A;  4JVS A;  1JUQ A;  4HOS A;  4H7Y A;  5T4Y A;  3SHF A;  4AIF A;  2M63 A;  2VSO E;  2F37 A;  4FHK A;  3FH8 A;  4O60 A;  1LD7 A;  3NZS A;  2WQH A;  4URK A;  4ANW A;  3PUK A;  4WNF A;  2KCK A;  4AM9 A;  1G3N B;  3FTS A;  1EF1 C;  3ASF A;  3U9W A;  4ABN A;  4ANX A;  3CR3 A;  4GTQ A;  4BES A;  4G8K A;  3FH7 A;  3R9M A;  1OWO A;  3TWQ A;  3DSX A;  3DWL G;  4GZ5 A;  1X5B A;  1OY3 D;  3QWV A;  5AQB A;  5LFA A;  1HZ4 A;  3S7D A;  3TAX A;  4YDW A;  4DJA A;  3ISM C;  4K03 A;  3KEZ A;  4DX7 D;  1L5J A;  3C5R A;  2LNI A;  4DLQ A;  4TXR A;  2CG2 A;  3MA5 A;  4U95 D;  2L9B A;  3IV0 A;  3AG4 E;  4I1M A;  4XKB A;  1O1T A;  3ABK E;  3QNK A;  3CHO A;  1FT1 A;  2XEE A;  3EHN A;  2ION A;  3V79 K;  2UWJ G;  2LXL A;  4UQY A;  4CZ2 D;  1H6O A;  2NYJ A;  4JC8 A;  4F3V A;  2V4H C;  4OAU C;  3E32 A;  2VJ8 A;  4RSY A;  2PNN A;  5G2N A;  2DCP A;  2HR2 A;  1QZ2 A;  4HI9 A;  2C0L A;  5LOZ A;  3GW4 A;  3FEX A;  3ULQ A;  3MZL B;  2A4Z A;  3UT7 A;  4D10 C;  4XI0 A;  1HU3 A;  5HKP A;  4GZC A;  3ASG A;  2R5S A;  3VTY A;  2MRI A;  4LCT A;  3L08 A;  1YMP A;  3CVX A;  3JXJ A;  1TNZ A;  3B7B A;  4AJW A;  2WXF A;  4BER A;  2CG3 A;  4YDE A;  3FUK A;  2AXU A;  3ZXP A;  2AXV A;  2V8S E;  1NA0 A;  3CQG B;  3SQV A;  4J8E A;  1WY6 A;  3AJI A;  3G2S A;  4EHM A;  3LCA A;  2XRZ A;  4B8C B;  3Q15 A;  3CHM A;  1OWP A;  3FUH A;  3DEP A;  3LVR E;  5JHA A;  5BXO A;  4YDY A;  2AW6 A;  4O1O A;  2F8X K;  3MGB A;  4BT8 A;  3UM0 A;  4ZHB A;  2E2E A;  3SBS A;  5FTP A;  4IN3 B;  1MX4 A;  1UOH A;  1VDY A;  2XPI A;  3FU3 A;  2IY0 C;  2XGS A;  4G23 A;  2WXH A;  2WQ6 A;  2AXZ A;  3UPV A;  1K8K G;  4EQF A;  4R7L A;  4JHR A;  1GW6 A;  1D8E A;  1TR4 A;  2VTB B;  3CEQ A;  3MKQ A;  1KPS B;  3EDT B;  3D9I A;  1N0R A;  1OXJ A;  2A5U A;  2GRP B;  3NZU A;  4GYO A;  2VGY A;  1PY1 A;  2FUL A;  4DPR A;  3FUD A;  2R05 A;  3DEO A;  4N5Q A;  3JCK C;  4HRN A;  1RW2 A;  4J0U A;  2IOS A;  5CMY A;  5FWQ A;  4WNE A;  1FCH A;  1D8D A;  2F8Y A;  5D2M C;  3CVV A;  3AS5 A;  4JA7 A;  3ZW3 A;  4MLP A;  2IQC A;  1EDU A;  2DYS E;  1DNP A; 
#chains in the Genus database with same CATH homology
 2VYI A;  4Q94 A;  2CFZ A;  2I1K A;  3CK8 A;  3MJW A;  3APC A;  1IYG A;  3FUF A;  3GYZ A;  2J4B A;  3D9J A;  4I1O B;  2KCV A;  2RD0 A;  4ANU A;  3GZS A;  1S0P A;  4HOQ A;  5ANR A;  1DVP A;  1H0A A;  1OWN A;  3P2B A;  2WXM A;  3CHP A;  3G2V A;  1LF8 A;  3JUI A;  2CHW A;  3LKU A;  3LYA A;  4N3A A;  5KJL A;  2OVF A;  3ZXS A;  2PM6 A;  3TGO A;  2BUG A;  2FI7 A;  2Y4T A;  2J9Q A;  3G2U A;  4GCN A;  3LJ3 A;  4UWH A;  4WAF A;  4ACK A;  4L2L A;  5AYW D;  1N52 A;  3APF A;  3UQ3 A;  5JJ7 A;  3ZYK A;  2X6H A;  3MKQ B;  4E85 A;  5JJ6 A;  5ANL A;  2NSZ A;  4WWP A;  5BV0 A;  1B89 A;  4PS8 A;  1XNF A;  3FTZ A;  5KJN A;  1KLX A;  3G2W A;  3IKO B;  4CGV A;  1UN9 A;  2Q7F A;  5FZR A;  2WXJ A;  3ZRH A;  5E75 A;  2VTB A;  3CVU A;  4AY6 A;  2XCB A;  4N3B A;  2HO1 A;  3ASD A;  4FC8 A;  4FLB A;  1HO8 A;  1OWL A;  2MHK A;  4I9E A;  5C2Y A;  2DBA A;  3U66 A;  2NXP A;  2WXN A;  2WPV A;  4L1B A;  2WM9 A;  4FJY A;  4DK5 A;  4APF A;  3L6A A;  1OWM A;  5G05 J;  3CVY A;  1XGW A;  4EPZ A;  1SZ9 A;  3CHS A;  4FLH A;  3QC1 A;  3VTX A;  3UX4 A;  3CQC B;  4AV7 A;  2EQX A;  3CK7 A;  4O6F A;  3ZYQ A;  3FH5 A;  4N5C A;  2KCL A;  4YND A;  1QNF A;  3FTX A;  1W3B A;  3KS2 A;  3D3M A;  4LUN U;  1IQU A;  4J8D A;  3PNL B;  3FEY A;  3CVL A;  4EZK A;  4GZ3 A;  2WXP A;  1E8X A;  4GB9 A;  4HOU A;  4B8A A;  4C9B B;  3DPD A;  4EEC A;  5A6C A;  4HOR A;  5J08 A;  1E7U A;  4UI9 K;  1MQS A;  2CHX A;  4PDX A;  4UWL A;  4J6I A;  4U0Z A;  2R59 A;  1HF8 A;  2LSV A;  2XGO A;  4GMJ A;  2X6I A;  1H2U A;  3CVQ A;  1OUV A;  4LEU A;  3G2T A;  2CFU A;  4I9C A;  3S7B A;  4GML A;  4V3I A;  5HI7 A;  3R7R A;  2FO7 A;  3PEV B;  2QY7 A;  3HYM B;  4A3V A;  1WM5 A;  4I2Z A;  4HLE A;  3GZ1 A;  3MV3 B;  5BPP A;  2XPY A;  4WUY A;  2V4L A;  4HVB A;  1PAQ A;  4IUL A;  4GYW A;  4MS6 A;  2J07 A;  2VSY A;  3CHQ A;  1BPO A;  4KZC A;  4BWR A;  4AOF A;  4GYY A;  3S7F A;  4AXH A;  3CK9 A;  4A55 A;  2C0M A;  3WXX A;  1U3C A;  5J90 A;  1ZBP A;  3MYV A;  3CSF A;  4RG9 A;  2V0P A;  2XGM A;  3PUJ A;  2BTD A;  4B89 A;  3URZ A;  3B7S A;  4PUC A;  4RVB A;  2IF4 A;  3FY4 A;  4DI3 A;  3CST A;  4PS7 A;  1YA0 A;  3QAR A;  1A17 A;  4FU3 A;  3I4G A;  4KVO A;  4U0U A;  3RRN B;  4GPK A;  4IRU A;  4IYP A;  3D9K A;  4DLO A;  3EIQ C;  5D0O D;  4UQX A;  5JHB A;  4UWG A;  3QWW A;  5EDS A;  5ARF A;  3MKR A;  4I17 A;  4EZL A;  3SI5 A;  4CDM A;  4FP7 A;  4GU5 A;  4GA2 A;  5C1D A;  4FJZ A;  4NAC A;  5EX3 A;  1JWG A;  3ZEF A;  3D9L A;  2L6J A;  3JYS A;  3FUM A;  2VQ2 A;  3PH0 C;  2AVP A;  2JLB A;  3RIB A;  3LVQ E;  4JXT A;  4BSX A;  4DI4 A;  5FZQ A;  4I2W A;  2VGX B;  4TRQ A;  3ZVV A;  3QOU A;  4F7A A;  3CKC A;  3FP3 A;  3TG5 A;  3OAW A;  3PE3 A;  1HXI A;  2HM8 A;  3D9O A;  2GW1 A;  5BNW A;  2XCC A;  3ASH A;  2YQ8 A;  2DIW A;  5KCM A;  1INZ A;  3D9P A;  2IJG X;  4B0Z A;  5LX8 A;  4N3C A;  3FFL A;  4GZD A;  3AS8 A;  4B94 A;  2X3M A;  4FAD A;  3C98 A;  4KVM A;  2L0T B;  3TXM A;  3E4B A;  3Q47 B;  2Y3A A;  3SGH A;  3D9N A;  2LAI A;  5KJK A;  1KT1 A;  3CKB A;  1ZU2 A;  4OVU A;  5G04 C;  4G26 A;  3CVP A;  4JHJ A;  3SF4 A;  3SZ7 A;  3LY8 A;  4GA1 A;  4AY5 A;  2WXL A;  1E96 B;  3FU0 A;  3PRZ A;  5FQ7 A;  4EBA G;  3EJN A;  4AEZ C;  4N2S A;  2BF0 X;  3QAQ A;  3AS4 A;  3PE4 A;  5CHE E;  1TEZ A;  4J8F A;  3EIJ A;  4BY6 A;  2WXO A;  3CVN A;  1SZA A;  4ANV A;  4JHK A;  4G25 A;  1MHQ A;  2KZT B;  2WVI A;  4GCO A;  3L13 A;  5BW8 C;  3ZIM A;  4BT9 A;  3VLD A;  3HVE A;  3RRM B;  3B7T A;  5FT9 A;  3Q5M A;  3FTU A;  3CLJ A;  2NC9 A;  2C2L A;  2RG8 A;  3ZFW A;  4CCA A;  2LSU A;  1WAO 1;  3OXF A;  4EZJ A;  3AU5 A;  4CT0 A;  1KT0 A;  3FUE A;  3L17 A;  2J49 A;  3JQ1 A;  2I1J A;  4KYO B;  3KD7 A;  5LCW J;  4G11 A;  5FQ6 A;  4J8S A;  2XHE A;  4ACL A;  2WXG A;  3VLE A;  4I1A A;  1NA3 A;  3CIA A;  4YVO A;  3OXL A;  3IHY A;  4FHJ A;  4OVV A;  4OYS A;  4H7X A;  5AJD A;  5A7D B;  3ZYL A;  1E8Y A;  4ILI A;  3FUL A;  5T8I A;  4JVS A;  1JUQ A;  5LCW C;  4HOS A;  1HS6 A;  3SFZ A;  4H7Y A;  1UJJ A;  2IU1 A;  4KZ0 A;  5T4Y A;  3T5V A;  2R17 C;  2VGX A;  1ELW A;  3SHF A;  5M72 A;  4Q96 A;  4AIF A;  4K0R A;  2M63 A;  2WMN A;  5EKQ D;  2OV8 A;  2VSO E;  3RU0 A;  5D0Q D;  4TUU A;  2ILR A;  2YIN A;  3PS6 A;  3U64 A;  3AU4 A;  4FHK A;  2LO6 A;  4JZY A;  1E7V A;  3APD A;  4E6H A;  4JA9 A;  2PM7 A;  3R7Q A;  5CCL A;  3FH8 A;  3PDN A;  4A3T A;  4A1S A;  3NZS A;  2YHC A;  3LPZ A;  2WQH A;  3TJP A;  3Q49 B;  4URK A;  3FHE A;  4ANW A;  2MOW A;  3PUK A;  4LRZ A;  4Y6C A;  4WNF A;  1Y6I A;  2KCK A;  3CV0 A;  3FTS A;  4UWK A;  4AM9 A;  1NZN A;  4ILG A;  1ELR A;  1EF1 C;  3PNT B;  3ASF A;  4KT6 B;  3CHR A;  3U9W A;  4NQ0 A;  4G24 A;  4ABN A;  4ANX A;  3CR3 A;  3CVW A;  4KXK B;  5BT1 A;  1PC2 A;  1Y8M A;  3HVE B;  3ML8 A;  3QJZ A;  4LER A;  2LAH A;  4U04 A;  3FH7 A;  1SQM A;  1OWO A;  2GGF A;  2X6F A;  4U07 A;  5G55 A;  3UMV A;  4AP2 A;  3RK6 A;  4CGW A;  4HFG A;  3QWP A;  4CDN A;  2XRY A;  3U3W A;  4GZ5 A;  2KZT A;  1X5B A;  3FUJ A;  4Q69 A;  4BTB A;  4XI9 A;  3QWV A;  4I6E A;  2FBN A;  2J08 A;  3IBE A;  3OXG A;  1HFA A;  3PVL A;  5DIZ A;  4AVX A;  5LFA A;  5DBK A;  1HZ4 A;  1UJK A;  5ENN A;  2OND A;  4C0M A;  3S7D A;  2PZI A;  4Y6W A;  2YNQ A;  3BG0 B;  4WNG A;  3TXN A;  3QDN A;  4JW1 A;  3TAX A;  3O4Z A;  3FWV A;  5BV1 A;  1Z6T A;  2JEK A;  2V5F A;  3LY7 A;  4GZ6 A;  4DJA A;  3IEG A;  1HE8 A;  4I43 A;  4K03 A;  3KEZ A;  1EPU A;  1L5J A;  3JQ0 A;  2AWI A;  3MX3 A;  3RJV A;  4WWN A;  2LNI A;  4MKT A;  3B7U X;  4DLQ A;  3ZHE B;  3RKV A;  2CG2 A;  3MA5 A;  3L16 A;  2L9B A;  3FUN A;  3ENE A;  3IV0 A;  2WXK A;  4G1T A;  3SNX A;  3ONK A;  4I1M A;  3VLF A;  3I5P A;  4XKB A;  1E90 A;  2FEZ A;  2J4D A;  3ONL A;  2X6K A;  5G04 J;  3QNK A;  4BFR A;  3CHO A;  3EHN A;  3HIZ A;  1N54 A;  2ION A;  2XEV A;  3FTW A;  2UWJ G;  3B13 A;  3OTN A;  4GAA A;  4UQY A;  1UG3 A;  4JC8 A;  5LP0 A;  4F3V A;  4WND A;  4JEH A;  4F1S A;  3HDX A;  3K9I A;  5T3R A;  4BTA A;  2WXI A;  1H6K A;  4XE0 A;  3LEW A;  3RRU A;  4KBQ A;  2HYZ A;  4U0S A;  4BX9 A;  2VJ8 A;  2OOE A;  3RO2 A;  3ZGQ A;  4RSY A;  3ZYM A;  3QB2 A;  5G2N A;  2DCP A;  1H2V C;  3FU6 A;  3CGH A;  2HR2 A;  1QZ2 A;  2C0L A;  5FZS A;  5LOZ A;  4HXI A;  1UW4 B;  3GW4 A;  3IHV A;  2WQ7 A;  3ML9 A;  2YHE A;  3PZD A;  3I4R B;  2VSN A;  3FEX A;  2WMO A;  3ULQ A;  1FVF A;  3MZL B;  4PS3 A;  4GA0 A;  2A4Z A;  3GZ2 A;  4XIF A;  4CT4 A;  3UT7 A;  3HHM A;  1TJF A;  4D10 C;  4XI0 A;  1HU3 A;  1HH8 A;  3FDH A;  3RO3 A;  3L54 A;  4GZC A;  1E8W A;  4CDR A;  3ASG A;  3LXU X;  2R5S A;  3NQP A;  5A23 A;  3L22 A;  4G2V A;  2MRI A;  4JL0 A;  3VTY A;  4C0E A;  4BX8 A;  4JPS A;  4LCT A;  3L08 A;  4N2Q A;  2P58 C;  5AJL A;  3SBT B;  1IHG A;  4YVQ C;  3CVX A;  3FTY A;  4ATG A;  4AJW A;  3SD5 A;  4CEM A;  2WXF A;  4RG6 A;  3S2A A;  4I6J A;  5FQ8 A;  2CG3 A;  2IOL A;  3FUK A;  2ZU6 B;  1H19 A;  4WWO A;  2AXU A;  3T8M A;  2AXV A;  2XPZ A;  5FQ4 A;  2KC7 A;  1NA0 A;  1E8Z A;  2V8S E;  3CQG B;  3PEU B;  5CMW A;  2X38 A;  2CHZ A;  3ESL A;  1WY6 A;  3G2S A;  4J8E A;  3Q4A B;  3ZHE A;  5JJT A;  2E0I A;  3DBS A;  3LCA A;  2XRZ A;  4ILH B;  1ELK A;  4UQZ A;  4XZ4 A;  4NUR A;  4QFV A;  4NRH B;  2WXQ A;  4B8C B;  5FJY A;  2GRL A;  3FTV A;  3Q15 A;  3CHM A;  1OWP A;  1P5Q A;  2UY1 A;  3FUH A;  2L0I A;  3MEK A;  1HG5 A;  2X6J A;  3LVR E;  5HQ8 A;  5KJM A;  3BG1 B;  4UI9 J;  5JHA A;  3S7J A;  1Z3Y A;  5G05 C;  2I2O A;  1JPL A;  2AW6 A;  2I6H A;  3EHM A;  5AIJ A;  3MGB A;  4HS2 A;  5EX0 A;  3NF1 A;  3R9A B;  4BT8 A;  4MRU A;  2E2E A;  3PRE A;  4UI9 C;  2PL2 A;  4APO A;  3LS8 A;  2OVB A;  3SBS A;  4ME2 A;  3UT8 A;  4CRW A;  3LDZ A;  5FTP A;  4IN3 B;  3UT4 A;  4L23 A;  4EBA A;  1VDY A;  1IQR A;  2XPI A;  2IFU A;  3B7R L;  2PQN A;  3FU3 A;  4L2Y A;  1H2T C;  3MCX A;  4HOT A;  4M3O A;  3TL5 A;  2XGS A;  2FF4 A;  4G23 A;  2WXH A;  2GRM A;  2WQ6 A;  2AXZ A;  4I6G A;  3O48 A;  3UPV A;  2PQR A;  3MV2 B;  4FUL A;  4U63 A;  4U8H A;  4EQF A;  4R7L A;  4JHR A;  1U3D A;  1QQE A;  3ESK A;  1GW6 A;  3KAE A;  4P29 A;  2VTB B;  1EYH A;  3I3N A;  3CEQ A;  4XX5 A;  4TV3 A;  1HX8 A;  3FU5 A;  3MKQ A;  4A1G A;  3EDT B;  1JWF A;  2A5U A;  3D9I A;  1Z3X A;  3FUI A;  4F53 A;  2KAT A;  4XKC A;  3LY9 A;  3NZU A;  4GYO A;  3U4T A;  2VGY A;  3BEE A;  1PY1 A;  2FUL A;  4KMO A;  4DPR A;  1TJC A;  1NP7 A;  3N71 A;  2WXR A;  3FUD A;  1UN8 A;  5BUZ A;  5CCM A;  3QK0 A;  4FA6 A;  4PH4 B;  5ARG A;  2WB2 A;  2J09 A;  3UUX A;  2UY1 B;  3TG4 A;  3P1U A;  2VSX E;  2QFC A;  3JCK C;  4JEU A;  3QKY A;  4J0U A;  2IOS A;  5CMY A;  5FWQ A;  4WNE A;  1FCH A;  3D9M A;  4L7T A;  3ZN3 A;  2XQ0 A;  4N39 A;  5AEN A;  3CVV A;  3T5X A;  3AS5 A;  4JA7 A;  3ZPJ A;  4UWF A;  3ZW3 A;  1FVH A;  5E76 A;  4MLP A;  2KM4 A;  2I9C A;  2IQC A;  2Y4U A;  1EDU A;  4W9R A;  1DNP A;  1HG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...