2UWJG

Structure of the heterotrimeric complex which regulates type iii secretion needle formation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
DTSLIRELAELALAGSGQHCHEEALCIAEWLERLGQDEAARLIRISSLANQGRYQEALAFAHGNPWPALEPWFALCEWHLGLGAALDRRLAGLGGSSDPALADFAAGMRAQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the heterotrimeric complex that regulates type III secretion needle formation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone
molecule keywords TYPE III EXPORT PROTEIN PSCE
total genus 44
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF09477 Type_III_YscG Bacterial type II secretion system chaperone protein (type_III_yscG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2uwjG00
3LPZA 3ZN3A 4XI9A 4EQFA 4BWRA 3PE3A 2C0MA 4HOSA 1A17A 3OXLA 4NRHB 4G24A 2L6JA 3TGOA 5ARGA 2VYIA 3PE4A 3IEGA 3RU0A 5CHEE 2FEZA 2PZIA 3CEQA 1Y8MA 2IF4A 4I2ZA 2FO7A 4I2WA 4LEUA 3AS8A 4Y6CA 2PL2A 3LY7A 4XIFA 3S7FA 3TAXA 1KT1A 4U0ZA 1PC2A 3FP3A 3ZPJA 4BT8A 2FI7A 4F3VA 4HOUA 5CCMA 3S7JA 4WNDA 5EKQD 4XI0A 2YQ8A 4AIFA 2NC9A 2FBNA 2Q7FA 1YA0A 4G2VA 5DIZA 3FFLA 2KCKA 4N2SA 3CK8A 4G23A 4I9CA 4UQXA 2HO1A 4U07A 2QFCA 4BT9A 1B89A 2UY1B 4IN3B 1HZ4A 4J8FA 3TG5A 5JJTA 1ELWA 3JYSA 5G04J 3RJVA 2VQ2A 3K9IA 2DBAA 3TG4A 3FWVA 3MKRA 3CVNA 5JJ7A 5DBKA 3LY8A 3RO3A 4WNEA 5D0QD 2WQHA 3Q49B 4YNDA 5FZRA 5KJKA 2KATA 1NA0A 1ZU2A 2ONDA 4GZ3A 2C0LA 3MEKA 3LY9A 2J9QA 3ASHA 3U4TA 4AY6A 4H7YA 4N3AA 4AY5A 4WNFA 2P58C 4I17A 3R9AB 1NA3A 4CGWA 3PDNA 4NQ0A 1HXIA 1W3BA 2KC7A 3CKCA 2YHCA 3O48A 1E96B 5FZQA 4JA9A 3GYZA 4B94A 2IFUA 1P5QA 5EX0A 3AS5A 4UQZA 2I6HA 3KS2A 3ZGQA 3ZFWA 1IHGA 3OXGA 1FCHA 4GYYA 3ASDA 2PQNA 4U04A 3ASGA 2Y4TA 3MV3B 3OXFA 3UUXA 4I9EA 2R5SA 1HH8A 5EX3A 2BUGA 3HYMB 1KLXA 3Q4AB 5FZSA 3WXXA 2VGYA 4CDRA 2XGMA 4J8EA 3CK9A 2LSUA 2AVPA 2UY1A 1XNFA 2C2LA 4G1TA 2E2EA 2JLBA 3E4BA 4GYWA 4Y6WA 4YVQC 3KAEA 5ARFA 3VTYA 1OUVA 4GA2A 3Q5MA 5JJ6A 4KXKB 4N3BA 2KCLA 3NF1A 2LNIA 2HR2A 3CVLA 3LKUA 4RG9A 4BTBA 5BNWA 4HOQA 3ULQA 4HORA 3LYAA 5BW8C 3URZA 4JA7A 3UQ3A 3CKBA 3U3WA 2LSVA 2HYZA 4YVOA 3Q47B 5FTPA 2UWJG 4O6FA 4UI9K 5G05C 1TJCA 4UQYA 4BTAA 5KJMA 5G04C 4J8DA 4WNGA 2XCBA 2XCCA 4GA1A 1ZBPA 4W9RA 5D0OD 5G05J 5HQ8A 4G25A 4GA0A 5HI7A 2PQRA 3GZ1A 4CGVA 3BEEA 4ABNA 1QQEA 4GCOA 5C1DA 5KJLA 1WM5A 4WUYA 3SZ7A 3ZHEA 1IYGA 3CV0A 1KT0A 1QZ2A 2WPVA 3QWWA 5A7DB 4U0UA 3QWPA 1NZNA 3AS4A 4UI9C 2VSNA 2MHKA 2VSYA 3S7BA 3ZHEB 3KD7A 2Y4UA 2VGXB 3EDTB 4JL0A 3N71A 3CVQA 4H7XA 4GPKA 5KJNA 4N3CA 4U0SA 3VTXA 4UI9J 5M72A 4HOTA 4J0UA 5A6CA 3MV2B 4GYOA 5AYWD 5BT1A 4KYOB 4RG6A 4AM9A 1WAO1 3ESKA 4GZ6A 2VGXA 2XGOA 3GW4A 3QWVA 2GW1A 3RO2A 5CCLA 3RKVA 2KCVA 3QDNA 4GZ5A 3SF4A 4N5CA 4APOA 3CVPA 5LCWC 2OOEA 2XPIA 2XGSA 3RIBA 4GCNA 5FJYA 5FT9A 3LCAA 4ME2A 3CK7A 4G26A 3GZ2A 4I1AA 4KBQA 3S7DA 2XEVA 4JHRA 4N39A 1ELRA 3ASFA 3QOUA 5LCWJ 3Q15A 3MA5A 4A1SA 3UPVA 2V5FA 2FF4A 4N2QA 3QKYA
chains in the Genus database with same CATH superfamily
4K5CA 2FO1E 2GRLA 2C0MA 4LNBA 3FU0A 4GMJA 3BU8A 1JCRA 4U0ZA 3PEVB 5AAOA 2XQ0A 2IQCA 2NC9A 2ETAA 4XZ4A 4JEHA 3TG5A 3JYSA 3FWVA 4RQIA 1JCSA 3FULA 3MZLB 4H7YA 4I17A 1IXVA 4DUIA 2IFUA 2LXLA 1JUQA 3QAQA 5AQ7A 3QARA 4DX1A 2B6CA 1MYOA 2BKKB 4EBAA 2C2LA 4F1SA 2E2EA 5IY5E 1OUVA 4GA2A 5FQ8A 5HRYA 4MBGA 3FTUA 4NACA 1OWMA 2BTDA 4U8HA 1UW4B 2EIKE 2ZISA 5HQ8A 3HRAA 4L2LA 3NAWA 1HX8A 1MHQA 3BUAA 2P9KG 4WUYA 3ABLE 2R17C 4JL0A 4C48B 2P9LG 3D9KA 3EIJA 2P2CP 3DPDA 2XPIA 4U8YD 4ME2A 3B7UX 5KNGA 4HOSA 4KMOA 4XKCA 3RU0A 2PZIA 2FO7A 4FHKA 2FI7A 3FTVA 4G2VA 4D10C 2EINE 3L08A 2XPZA 1E7UA 4K5BA 3HXEA 1N4RA 4GZCA 4JA9A 3UKRG 3ASGA 3MV3B 5EIDA 3UKUG 4A63B 2CFZA 3BG1B 2CHZA 2MOWA 3KAEA 4FLHA 2LNIA 2HR2A 2R59A 1MX2A 4RG9A 4EHMA 3VLEA 2XEHA 3LYAA 5CEAA 1OWOA 4L7TA 1H19A 2R03A 5FTPA 4B8AA 4JPSA 5CMYA 2WXRA 2WXQA 3QK0A 4GTTA 4HI8A 4AEZC 2GROB 3ENEA 4JHJA 5CECB 1TNBA 2IJGX 5A7DB 2VGXB 2RFAA 1E90A 4J0UA 2VSOE 1PAQA 5G2NA 3LJNA 5CCLA 1S0PA 2I1JA 4APOA 1N95A 3CHPA 2Y3AA 5FT9A 3EHRA 2L0IA 2IY0C 2WXIA 4NIKA 3ZN3A 4HRMB 1JCQA 3ML9A 5AQAA 4G24A 3ZUVB 4HS2A 3S2AA 2ZXWE 4XKBA 3TAXA 4GTRA 3ZPJA 2CG3A 2FBNA 2WQ7A 2CG2A 2HO1A 2UY1B 3TWVA 2M63A 1OWNA 3PZ2A 2J9QA 3ASHA 3EHQA 4WNFA 4TUUA 3QC1A 1DCEA 1MJ0A 1BLXB 1E8YA 2V4LA 4CYMD 2VJ8A 1IHGA 2OCCE 3OXGA 3KSLA 4XE0A 2R5SA 1HH8A 2BUGA 3ULEG 3SFXA 3PZ1A 5AN8A 2AVPA 3NQPA 1Z3YA 4KXKB 1QBQA 4BTBA 4DI3A 4A3TA 4HOQA 5BNWA 3I3NA 3IV0A 3UQ3A 3U3WA 3I5PA 4UI9K 3DSSA 5EIBE 1NI1A 3TJPA 4WWPA 3TL5A 4KVOA 2XCBA 1DNPA 2PQRA 3SO8A 3BEEA 3R7QA 4GCOA 3AS4A 2VSNA 4WWNA 2WXKA 2R05A 2GRPB 1Z3XA 3SI5A 2KZTB 5ENQD 5BT1A 1DCQA 2PNNA 1O1RA 3PS6A 2QYUA 3Q7AA 2LAIA 3LCAA 1LD8A 3V30A 4OAUC 1DC2A 3Q15A 4B93B 4ZHBA 4IRUA 3ZYQA 4J8SA 2L6JA 1INZA 4WWOA 5C2YA 2PL2A 3L22A 2CHWA 2F8YA 4DX5D 1PY1A 4UQXA 4ANVA 3MJWA 1HF8A 5DBKA 1OCCE 3TXNA 5AIJA 3FTYA 3FU3A 3EUVA 2I6HA 4JC8A 2XZDG 4BERA 4LNGA 1N0QA 2YINA 4UWLA 2CFUA 4J6IA 1QYMA 3T9KA 4YVQC 5ARFA 3ZXSA 4N3BA 2I2OA 3LKUA 3CVLA 1NP7A 3FTSA 1TNZA 2J8SD 3Q47B 2UWJG 5G05C 5BV0A 2J4DA 1H2TC 4WNGA 5BXUA 2YNQA 4FC8A 1OCRE 3DBSA 4FP7A 1N94A 1XGWA 5KJLA 3IKOB 2WXHA 3KD7A 3RSEG 1TN8A 4Q69A 5FQ7A 3SGHA 3MV2B 5CBOA 2L9BA 4RLYA 1HG5A 4OVUA 3ZYLA 3B7TA 3Q78A 4R7LA 4J8YA 4EQFA 4M7CA 2X38A 3ZEFA 3APFA 4PDXA 2LAHA 1H0AA 2KZTA 3LEWA 2GGFA 3CHRA 4I2WA 4I2ZA 2WQ6A 3RRNB 1KT1A 4HFGA 4HOUA 3UMVA 4AIFA 2A5EA 3UM0A 2Q7FA 2XEEA 1G3NB 3TG4A 3CVNA 4GTQA 2X6HA 3FUKA 5EILA 4JVSA 4N3AA 4Z68A 1KZOA 2EIME 3OXFA 2IOLA 1HS6A 1NL4A 5FZSA 3R7RA 2VGYA 3V31A 2DWZA 1XNFA 1H6KA 3C3QA 1SA5A 2KCLA 1RW2A 4O60A 1S64A 3URZA 2LSVA 2HYZA 4GTSA 5KJMA 5HI7A 4DX2A 4EZKA 3SNXA 2P9UG 3JUIA 5AJLA 4ACLA 4HLLA 3ZHEA 1LF8A 1OT8A 2QC9A 2Y4UA 4MRUA 3CSTA 3SBTB 4G11A 1OCZE 3C3OA 1FPPA 2VGXA 3RO2A 3L82A 4I1AA 2XEVA 3QOUA 4EBAG 3ABKE 3DSVA 1A17A 1N54A 1LTXA 3PE4A 3ONLA 3OAWA 3HXCA 3AS8A 1IKND 3T8KA 1TN7A 3LVQE 1YA0A 5DIZA 2OVBA 4IN3B 4IYPA 4PH4B 4YNDA 3NOCD 2IO2C 5AQBA 5B3SE 4AY6A 1MZCA 2P58C 4Q94A 4ILGA 4DK5A 1W3BA 2KC7A 3SHFA 5CRUA 4MLPA 3D9JA 5EX0A 2ILRA 3L54A 3KS2A 1UJJA 3ZFWA 4KVMA 4OAVB 4GTPA 2AW6A 4DPRA 1N52A 3VTYA 3QB2A 4GYWA 4KZCA 3D9LA 1U3DA 5T8IA 4E6HA 3D9NA 3PEUB 1AWCB 5LOZA 4YDOA 5B1BE 4LUNU 5AQ9A 4GMRA 4W9RA 3DSXA 4CGVA 2RFMA 2AXVA 3QWWA 4U63A 4DJAA 3N71A 5KJNA 4C9BB 5A6CA 5ENNA 3SD5A 3HVEB 4U96D 2H6HA 3RKVA 3AG2E 5AENA 3GZ2A 3EU9A 4EPZA 3SFZA 5LCWJ 4CDNA 3FTZA 3FUIA 5LP0A 4DLQA 2KBXA 3ZU7B 1K8KG 1BI8B 2YHEA 2VYIA 1N4QA 1TJFA 1BPOA 3CEQA 3FDHA 3PUJA 1HO8A 5AARA 4LERA 3G2UA 2MYOA 2HM8A 2ZIRA 2VTBA 2E0IA 2V4HC 4C0EA 3JXJA 3EHMA 5ENRD 3RO3A 3NOGD 4AP2A 1NA0A 1ZU2A 2MRIA 4ZFHA 4FJYA 3U4TA 5T3RA 4LRZA 3LJ3A 4I1OB 3Q73A 4URKA 3CVXA 1E96B 2IONA 4B89A 3W9GA 3HG0D 3CVVA 4GB9A 3ZVVA 4V3IA 3B95A 4Y6WA 3UT4A 4K5AB 2XPYA 3NBNB 5T4YA 3DXKG 2BEDA 4O6FA 1HFAA 3ZYKA 4UUCA 4GA1A 2V8SE 3U66A 4ATGA 4UWFA 3AG3E 2WPVA 4HB5A 1N0RA 2ZGGA 3IHYA 1TNYA 2WXFA 5AYWD 1GW6A 4AM9A 2DYSE 4TXPA 1N4SA 4XEIG 4QFVA 3ZNGA 3MA5A 4BY6A 2P9SG 4N2QA 4UWGA 3TWTA 5ARGA 4TXRA 2DIWA 3ULYA 4QQIA 1JPLA 2EILE 4XI0A 2F37A 5E75A 3APCA 1B89A 2OEVA 3MKRA 3AG1E 5D0QD 4I1MA 3ZXPA 5EYLA 3R9AB 1IQRA 1UN8A 4F6RD 1DVPA 4B94A 4TUMA 2WXPA 1K1BA 3J5PA 3B7RL 3MKQB 3Q4AB 3GZSA 2QZAA 4DX6D 4A1GA 5EDSA 2A4ZA 4L1BA 3CVYA 1SZ9A 4JA7A 3CKBA 4O1PA 2JEKA 3FHEA 2Y69E 4HRNA 3NZSA 4ABNA 3U9WA 2WMOA 4CCAA 1KT0A 1QZ2A 3G2SA 3IHVA 3FUEA 2MHKA 1L5JA 3FTWA 3UI2A 3ZIMA 4KYOB 4RG6A 4K03A 5G55A 2AXZA 4FADA 3TWQA 2V5FA 3QKYA 4BWRA 3PE3A 2XZTG 3C5RA 4ANXA 3FY4A 1OWLA 2PM7A 5CHEE 2IF4A 3DPYA 3CGHA 4Y6CA 4BT8A 5CCMA 4WNDA 1ELKA 3PNLB 2KCKA 4N2SA 4I9CA 2QFCA 4L2YA 5G04J 4BSZB 3G2TA 1YYHA 2WQHA 3RRMB 2V5QC 5FZRA 3FUNA 5ENOD 4TXQA 4ANWA 3NB2A 2RKKA 3T8MA 3O48A 3ABME 3AS5A 1N11A 3UUXA 3D9IA 3AJIA 3FU5A 1KLXA 5B1AE 4JEUA 2NYJA 1WDYA 1HU3A 4FHJA 2X6IA 4Q96A 3HVEA 3EHNA 3UX4A 2OEWA 2X6JA 3J5QB 4LNUD 4M3OA 3APDA 3VLDA 1UJKA 3MX3A 1VDYA 5C1DA 3QWPA 4A3VA 3CVQA 5EYPF 4HOTA 5M72A 3UT7A 2XRZA 3G2WA 5KCMA 2VGEA 3AAAC 3QDNA 5LCWC 2XGSA 4UWHA 2XS8A 3ASOE 4TV3A 5ENTD 1MQSA 3CHQA 3RRUA 3LVRE 3JXIA 2GRQB 5EN5D 1E8XA 4HVBA 3PUKA 3D9PA 5FWQA 4ILIA 4JW1A 4DI4A 3SY2A 1PC2A 2PM6A 1MX6A 4E85A 3RJVA 4ANUA 3ZW3A 4DRXE 1OCOE 3DEOA 2J08A 1HG2A 4AY5A 2Y1LE 2XRYA 3TWRA 2RG8A 2DZOA 3CKCA 3P1UA 1SVXA 3GYZA 3C98A 3ZGQA 2PQNA 1LD7A 2Y4TA 3ZRHA 4CDRA 4I6GA 3FUJA 4J8EA 1EPUA 5JHBA 3Q5MA 4CDMA 2HE0A 4BX8A 4B0ZA 3D3MA 3FH8A 3E37A 1E7VA 4BTAA 2XCCA 2XS1A 2ETBA 3PVLA 3EDTB 4GPKA 4HXIA 1TN6A 4UI9J 3WG7E 4GYOA 3SFYA 3SF4A 4N5CA 4HNAD 4GCNA 1O1TA 3Q75A 4JHRA 1FT1A 1UG3A 2J4BA 2WVIA 3CHOA 5FIOA 4GMLA 3MGBA 3HIZA 3V79K 2V0PA 1S70B 3Q7FA 4F3VA 2B0OE 5LFAA 3FFLA 3TWUA 4MS6A 1ELWA 5ANRA 5HS0A 3K9IA 2L6BA 3EJNA 1NFIE 3AG4E 2I9CA 1NA3A 3DEPA 3CVWA 3T5VA 4AOFA 3T5XA 3JQ1A 3E32A 4AV7A 1IQUA 4I9EA 3U64A 3MCXA 1TNOA 3PZ4A 5J08A 4HBDA 3ASNE 5E76A 2VTBB 4G1TA 1FVFA 1H6PA 4N5QA 1D8EA 4XX5A 5JHAA 5H7PA 3IBEA 3ONKA 2H6GA 1UN9A 5JMND 1O5MA 2H6FA 2J07A 5CMWA 3RAUA 2CHXA 1FT2A 4U0SA 4BETA 4WAFA 3GW4A 3BG0B 1D9SA 4TRQA 2X6FA 4N39A 4BEPA 1K3ZD 4I43A 1KPSB 2ZGDA 1RZ4A 2LO6A 3CLJA 3C72A 3FH7A 2J09A 2NXPA 2DVWA 3S7JA 4JZYA 4FLBA 1IHBA 3JCKC 3L9TA 1HZ4A 5JJTA 4O1OA 4P29A 2ONDA 4GZ3A 4APFA 2A5UA 4PS7A 3PDNA 3PH0C 5CERB 1OY3D 1FVHA 5FZQA 2LUHA 3CQCB 3FEYA 4GYYA 4U04A 3ASDA 3R9MA 1ZB1A 1WY6A 2IEJA 1SQMA 3WXXA 3QJZA 2XGMA 2JLBA 3OTNA 4UWKA 2BKGA 3E33A 3TWWA 5BXOA 3QNKA 1TYQG 3LS8A 4YVOA 2ETCA 3MKQA 4JB8P 2F0YA 2KXPC 4IULA 5D0OD 3GZ1A 1N9AA 2I1KA 2Y0BG 3ZKJA 2QY7A 3FTXA 3UXGA 4FA6A 3HXDA 2P9PG 3P2BA 1WAO1 4GTOA 4GZ6A 4GU5A 3CK7A 3CHSA 3S7DA 3ASFA 4A1SA 4OVVA 3LPZA 4XI9A 1TEZA 4J7WA 4RSYA 4NRHB 2LXMA 5FQ6A 4EZLA 1Y8MA 3DRAA 3PZDA 3CSFA 3I4GA 4XIFA 1TR4A 3TXMA 2GRNB 3ML8A 4F53A 3KEAA 4U7EB 4CEMA 3DXMG 2OVFA 4U07A 4G8LA 3X2QE 4J8FA 3DSWA 3TWXA 1X81A 1QNFA 2IOSA 5JJ7A 3UIOC 3UT8A 3Q49B 4EZJA 4BX9A 4I6EA 1BD8A 5CRVA 1P5QA 4JD2G 3CIAA 2DZNA 2WB2A 3FUHA 4CT0A 2LSUA 3D9MA 4BSXA 5FINA 3HHMA 2XHEA 2J49A 3ISMC 2JABA 3VLFA 3L16A 5BPPA 4UQYA 5FQ4A 5G04C 5J90A 4J8DA 5G05J 3B7BA 4F1PA 4G25A 5KBAA 1O1SA 2GRRB 4PS8A 2ZU6B 3UIPC 3CV0A 3FEXA 4UI9C 3S7BA 4CZ2D 1SW6A 3CVUA 4H7XA 3W9FA 2GRMA 4N3CA 1U2VG 4KT6B 4DLOA 4YDYA 4GZDA 4RVBA 3HXBA 2WXMA 5FJYA 5KWDA 3B7SA 1V55E 2WXLA 2NSZA 3SQVA 1SZAA 3EIQC 4NURA 4U8VD 2FEZA 3D9HA 3DSUA 4LEUA 4L9PA 3FUFA 2YQ8A 5ANLA 3F6QA 2IU1A 3CK8A 4YDWA 3UM3A 3E30A 1YMPA 1N4PA 4WNEA 3MEKA 3LY9A 4HRLA 3UM2A 3ESLA 3AU5A 4NQ0A 1AP7A 1HXIA 1D8DA 2R2LA 1U3CA 4UQZA 3UPVA 1Z5SC 1OXJA 3PREA 3G2VA 2R02A 1H6OA 4EECA 1WG0A 2P9IG 3Q9NC 1H2VC 1TJCA 3IXEA 1EYHA 2WMNA 1E8ZA 2DYRE 4G8KA 1ZBPA 2VSXE 5D66A 4GA0A 5ENSD 1QQEA 1IYGA 3Q79A 1KZPA 4I6JA 2AJAA 1JWGA 3FU6A 3PZ3A 3CR3A 2GW1A 2KCVA 4AXHA 4G26A 4KBQA 3PNTB 4LSZE 2H6IA 4GAAA 1S63A 1BI7B 3UTMA 3V2OA 1K1AA 5A23A 2AXUA 2QYJA 3TGOA 4X8QA 3IEGA 1TNUA 3LY7A 3S7FA 3KEZA 3LXUX 2F8XK 5EKQD 4DX7D 5LX8A 4LG6A 4BT9A 5KNHD 3L13A 2DBAA 3EU5A 5KJKA 4CRWA 3LDZA 4KZ0A 2EIJE 4U95D 1FCHA 2X3MA 1EDUA 3V2XA 4GTVA 3DWLG 2UY1A 3ZHEB 3E4BA 5BUZA 5BV1A 5ITZF 3ZYMA 1X5BA 2WXJA 4HORA 1A5EA 4ACKA 4MKTA 3CQGB 4AJWA 1EF1C 3DSTA 1YCSB 3C3RA 2OV8A 4OYSA 4JHKA 4HI9A 2AWIA 3ESKA 2XGOA 4FULA 5AJDA 3CVPA 5CBNA 3E34A 3JQ0A 1ELRA 1E8WA 5CEDB 2FF4A 3CHMA 3O4ZA 3OXLA 4FJZA 3TWSA 2EQXA 1Z6TA 3L6AA 4JXTA 4GPMA 3D9OA 3FP3A 2IO3C 5HKPA 3PRZA 4G23A 3Q9UC 3FH5A 1MX4A 2VQ2A 3I4RB 3LY8A 2KATA 2C0LA 3RK6A 4AVXA 4HLEA 4GTMA 4CGWA 3BQOA 2YHCA 2KM4A 4HQDA 4PS3A 2WM9A 5JA4D 5EX3A 3HYMB 3CK9A 2X6KA 5ENPD 4FU3A 3HXFA 3NZUA 5D2MC 5JJ6A 3NF1A 2WXNA 3JUEA 3KSQA 2XENA 3UM1A 3ULQA 1V54E 5BW8C 4PUCA 4A55A 4CT4A 2BF0X 3FUMA 4ATZD 2DCPA 1H2UA 3L17A 1OWPA 4C0MA 1BU9A 3UINC 2L0TB 3AU4A 1WM5A 3SZ7A 4F7AA 4BFRA 4U0UA 2WXOA 1NZNA 4ILHB 1HE8A 2VSYA 4L23A 4K0RA 1Y6IA 4LCTA 3VTXA 1SA4A 2RD0A 2FULA 2P9NG 3FUDA 1UOHA 4B8CB 2WXGA 3B13A 3QWVA 4BESA 4GZ5A 1Q2ZA 2OOEA 3RIBA 1JWFA 4YDEA 3HDXA 3SBSA 3MYVA
chains in the Genus database with same CATH topology
3LPZA 4XI9A 4EQFA 4BWRA 2GRLA 2X38A 3PE3A 3ZEFA 1TEZA 2C0MA 4RSYA 3APFA 4NRHB 4ANXA 4PDXA 2LAHA 1H0AA 3FU0A 3FY4A 2KZTA 5FQ6A 4GMJA 3LEWA 1OWLA 2GGFA 2PM7A 5CHEE 3CHRA 1Y8MA 2IF4A 4I2ZA 4I2WA 4EZLA 3PZDA 3CSFA 3CGHA 3I4GA 4Y6CA 4XIFA 3RRNB 3TXMA 1KT1A 4U0ZA 3ML8A 4HFGA 3PEVB 4BT8A 5CCMA 4HOUA 4F53A 2XQ0A 4WNDA 3UMVA 4AIFA 2IQCA 2NC9A 2Q7FA 1ELKA 3PNLB 2KCKA 4N2SA 4CEMA 4I9CA 4XZ4A 2OVFA 2QFCA 4U07A 4JEHA 4J8FA 4L2YA 3TG5A 3JYSA 5G04J 1QNFA 3TG4A 3G2TA 3FWVA 3CVNA 2IOSA 5JJ7A 3UT8A 2WQHA 3Q49B 3RRMB 5FZRA 4EZJA 4BX9A 2X6HA 3FUKA 3FUNA 3FULA 3MZLB 4JVSA 4H7YA 4I6EA 4N3AA 4I17A 4ANWA 3T8MA 3O48A 2IFUA 1P5QA 3AS5A 1JUQA 3CIAA 3QAQA 3UUXA 3D9IA 3OXFA 3QARA 2IOLA 1HS6A 3FU5A 1KLXA 4JEUA 5FZSA 3R7RA 3FUHA 2WB2A 2VGYA 4CT0A 1HU3A 4EBAA 4FHJA 2LSUA 3D9MA 4BSXA 1XNFA 2C2LA 4F1SA 2E2EA 2X6IA 3HHMA 1H6KA 1OUVA 4GA2A 5FQ8A 2XHEA 2KCLA 4Q96A 3HVEA 2WQ6A 2J49A 3EHNA 3FTUA 3URZA 4NACA 1OWMA 3VLFA 2LSVA 2HYZA 3L16A 5BPPA 3UX4A 4UQYA 2X6JA 5KJMA 5FQ4A 5G04C 2BTDA 3APDA 4M3OA 4U8HA 1UW4B 4J8DA 3VLDA 5J90A 1UJKA 3MX3A 5G05J 5HQ8A 4L2LA 4G25A 5HI7A 1HX8A 4EZKA 1VDYA 3SNXA 1MHQA 4PS8A 2ZU6B 3JUIA 5AJLA 5C1DA 4ACLA 4WUYA 3ZHEA 3CV0A 3FEXA 1LF8A 3QWPA 4UI9C 3S7BA 2R17C 3CVUA 2Y4UA 4MRUA 4A3VA 4JL0A 3CVQA 4H7XA 2GRMA 3CSTA 4N3CA 4HOTA 5M72A 3SBTB 4KT6B 4G11A 3UT7A 4DLOA 2XRZA 3D9KA 3EIJA 4GZDA 3G2WA 5KCMA 2VGXA 3RO2A 3QDNA 4RVBA 3DPDA 5LCWC 2WXMA 2XPIA 2XGSA 5FJYA 4UWHA 4ME2A 3B7SA 4I1AA 2XEVA 2WXLA 2NSZA 3QOUA 4TV3A 1MQSA 3CHQA 3RRUA 3LVRE 3B7UX 4EBAG 1E8XA 4HVBA 3PUKA 4HOSA 4KMOA 1A17A 1N54A 1SZAA 3D9PA 5FWQA 3EIQC 3PE4A 4NURA 4ILIA 3ONLA 4XKCA 4JW1A 3RU0A 3OAWA 2FEZA 2PZIA 4LEUA 2FO7A 4DI4A 3AS8A 3FUFA 4FHKA 1PC2A 2FI7A 3FTVA 2YQ8A 3LVQE 5ANLA 4G2VA 1YA0A 4D10C 2PM6A 5DIZA 2IU1A 3CK8A 2OVBA 3L08A 4IN3B 2XPZA 4E85A 4IYPA 3RJVA 4ANUA 4PH4B 3ZW3A 4WNEA 4YNDA 2J08A 3MEKA 1E7UA 1HG2A 3LY9A 4AY6A 4AY5A 2P58C 4ILGA 4Q94A 2XRYA 4DK5A 3ESLA 2RG8A 3AU5A 4GZCA 1HXIA 4NQ0A 1W3BA 2KC7A 3CKCA 3SHFA 3P1UA 4MLPA 3D9JA 4JA9A 3GYZA 3C98A 5EX0A 1U3CA 2ILRA 3L54A 3KS2A 1UJJA 4UQZA 3ZGQA 3ZFWA 4KVMA 3UPVA 2PQNA 3ASGA 2Y4TA 3MV3B 3PREA 3G2VA 3ZRHA 4CDRA 2CFZA 4I6GA 2AW6A 3FUJA 1N52A 4J8EA 1EPUA 4DPRA 3BG1B 2CHZA 5JHBA 2MOWA 3VTYA 3QB2A 4GYWA 4KZCA 4EECA 3D9LA 3KAEA 1U3DA 3Q5MA 4FLHA 4CDMA 2LNIA 2HR2A 2R59A 4RG9A 5T8IA 4BX8A 4B0ZA 4E6HA 3VLEA 3LYAA 3D9NA 1OWOA 3D3MA 4L7TA 3PEUB 1H19A 3FH8A 5FTPA 4B8AA 4JPSA 5LOZA 1E7VA 1H2VC 1TJCA 4BTAA 4LUNU 2WXRA 5CMYA 2WXQA 3QK0A 1EYHA 2WMNA 1E8ZA 2XCCA 4AEZC 1ZBPA 2VSXE 4W9RA 4GA0A 4CGVA 3ENEA 1QQEA 4JHJA 1IYGA 2IJGX 2AXVA 3QWWA 5A7DB 4U63A 4DJAA 3PVLA 2VGXB 3EDTB 4GPKA 3N71A 4HXIA 4I6JA 5KJNA 1E90A 1JWGA 3FU6A 3CR3A 4UI9J 4C9BB 4J0UA 2VSOE 1PAQA 5ENNA 5G2NA 5A6CA 4GYOA 3SD5A 5CCLA 3HVEB 1S0PA 2GW1A 2I1JA 3RKVA 2KCVA 3SF4A 4APOA 4N5CA 3CHPA 2Y3AA 4GCNA 5FT9A 4AXHA 4G26A 5AENA 3GZ2A 4EPZA 4KBQA 3PNTB 2L0IA 4JHRA 1UG3A 3SFZA 2J4BA 2WXIA 4GAAA 5LCWJ 2WVIA 3FTZA 4CDNA 3CHOA 4GMLA 3FUIA 3ZN3A 5LP0A 3MGBA 4DLQA 3ML9A 5A23A 3HIZA 2AXUA 4G24A 2YHEA 3TGOA 2VYIA 2V0PA 3IEGA 1TJFA 1BPOA 4HS2A 3S2AA 3CEQA 4XKBA 3FDHA 3LY7A 3TAXA 3S7FA 3PUJA 3ZPJA 4F3VA 3KEZA 3LXUX 1HO8A 5EKQD 4LERA 2CG3A 3G2UA 2FBNA 5LFAA 5LX8A 2HM8A 3FFLA 2WQ7A 4BT9A 2CG2A 2HO1A 4MS6A 2UY1B 2VTBA 2E0IA 1ELWA 4C0EA 5ANRA 3K9IA 3L13A 2DBAA 3EHMA 3RO3A 2M63A 3EJNA 5KJKA 4AP2A 1NA0A 1ZU2A 1OWNA 2MRIA 2J9QA 3ASHA 4FJYA 3U4TA 5T3RA 3LDZA 4LRZA 3LJ3A 4CRWA 4TUUA 3QC1A 4WNFA 2I9CA 1NA3A 4I1OB 4KZ0A 3CVWA 3T5VA 4URKA 3CVXA 1E96B 1E8YA 4AOFA 2IONA 4B89A 3T5XA 2V4LA 3JQ1A 2VJ8A 1IHGA 3OXGA 1FCHA 2X3MA 4AV7A 1IQUA 3CVVA 4I9EA 4XE0A 2R5SA 3MCXA 1HH8A 1EDUA 4GB9A 2BUGA 3U64A 5J08A 5E76A 3ZVVA 4V3IA 2AVPA 2UY1A 2VTBB 3ZHEB 4G1TA 3E4BA 4Y6WA 3UT4A 5BUZA 3NQPA 5BV1A 1FVFA 1Z3YA 4KXKB 2XPYA 4BTBA 4DI3A 4A3TA 4HOQA 5BNWA 3ZYMA 1X5BA 3I3NA 2WXJA 4HORA 3IV0A 4XX5A 5T4YA 3UQ3A 3U3WA 3I5PA 5JHAA 4UI9K 4O6FA 1HFAA 3IBEA 4WWPA 3TJPA 3TL5A 4MKTA 4KVOA 2XCBA 4GA1A 3ONKA 3ZYKA 4ACKA 1UN9A 1DNPA 2V8SE 2PQRA 3U66A 3CQGB 3BEEA 4AJWA 4ATGA 1EF1C 4GCOA 3R7QA 4UWFA 2WPVA 3AS4A 2VSNA 3IHYA 2J07A 2OV8A 2WXKA 4WWNA 5CMWA 2CHXA 1Z3XA 4OYSA 3SI5A 4JHKA 2KZTB 4U0SA 2WXFA 5AYWD 5BT1A 2AWIA 1GW6A 3PS6A 4AM9A 4WAFA 3ESKA 3GW4A 2XGOA 4FULA 5AJDA 3BG0B 3CVPA 2LAIA 3JQ0A 3LCAA 4QFVA 4TRQA 2X6FA 4N39A 1ELRA 1E8WA 3Q15A 3MA5A 2FF4A 4BY6A 4N2QA 3CHMA 4UWGA 3O4ZA 4IRUA 4I43A 3OXLA 4FJZA 3ZYQA 4J8SA 2EQXA 2L6JA 5ARGA 1INZA 4WWOA 1Z6TA 3L6AA 4JXTA 3CLJA 2LO6A 3FH7A 2DIWA 2J09A 3D9OA 5C2YA 2NXPA 2PL2A 3FP3A 1JPLA 3S7JA 4XI0A 3L22A 2CHWA 5E75A 4JZYA 3APCA 3PRZA 1PY1A 4FLBA 4G23A 3FH5A 4UQXA 3JCKC 1B89A 1HZ4A 5JJTA 4ANVA 3MJWA 1HF8A 2VQ2A 3I4RB 3MKRA 5DBKA 3LY8A 5D0QD 4P29A 3TXNA 2KATA 2ONDA 4GZ3A 2C0LA 3RK6A 4I1MA 4APFA 4AVXA 5AIJA 4HLEA 2A5UA 3R9AB 3FTYA 4PS7A 4CGWA 1IQRA 3PDNA 3PH0C 1UN8A 2YHCA 1FVHA 2KM4A 5FZQA 1DVPA 3CQCB 3FEYA 3FU3A 4PS3A 4B94A 2WM9A 2I6HA 4JC8A 2WXPA 4GYYA 4U04A 3ASDA 1WY6A 2YINA 3B7RL 3MKQB 4UWLA 5EX3A 3HYMB 3Q4AB 1SQMA 3WXXA 3GZSA 3QJZA 2XGMA 3CK9A 2CFUA 2X6KA 4J6IA 4A1GA 4FU3A 4YVQC 2JLBA 5ARFA 5EDSA 3NZUA 3ZXSA 3OTNA 4UWKA 5JJ6A 4N3BA 2I2OA 2A4ZA 2WXNA 3LKUA 3CVLA 3NF1A 4L1BA 1NP7A 3FTSA 3QNKA 3ULQA 3CVYA 1SZ9A 5BW8C 4JA7A 4PUCA 3CKBA 3LS8A 2JEKA 4A55A 4CT4A 4YVOA 2BF0X 3Q47B 2UWJG 5G05C 5BV0A 2J4DA 3MKQA 3FUMA 2DCPA 1H2TC 1H2UA 3FHEA 4WNGA 2YNQA 3L17A 4FC8A 1OWPA 3DBSA 4C0MA 4IULA 5D0OD 4FP7A 2L0TB 3AU4A 3GZ1A 3NZSA 1XGWA 4ABNA 5KJLA 3U9WA 2WMOA 3IKOB 2I1KA 1WM5A 3SZ7A 4CCAA 1KT0A 2WXHA 1QZ2A 3G2SA 3IHVA 4BFRA 4U0UA 4F7AA 2WXOA 1NZNA 3FUEA 4ILHB 1HE8A 2MHKA 2VSYA 3KD7A 2QY7A 3FTXA 4L23A 4K0RA 1Y6IA 4FA6A 4Q69A 4LCTA 1L5JA 3FTWA 5FQ7A 3VTXA 2RD0A 3P2BA 2FULA 3MV2B 3SGHA 3FUDA 3ZIMA 2L9BA 4KYOB 4RG6A 1HG5A 2WXGA 3B13A 1WAO1 4OVUA 3ZYLA 4B8CB 4GZ6A 4K03A 3QWVA 5G55A 3B7TA 4GU5A 4GZ5A 2OOEA 3RIBA 1JWFA 3HDXA 3CK7A 2AXZA 3CHSA 3SBSA 4R7LA 3S7DA 4FADA 3ASFA 3MYVA 4A1SA 2V5FA 4OVVA 3QKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPZ A;  3ZN3 A;  4XI9 A;  4EQF A;  4BWR A;  3PE3 A;  2C0M A;  4HOS A;  1A17 A;  3OXL A;  4NRH B;  4G24 A;  2L6J A;  3TGO A;  5ARG A;  2VYI A;  3PE4 A;  3IEG A;  3RU0 A;  5CHE E;  2FEZ A;  2PZI A;  3CEQ A;  1Y8M A;  2IF4 A;  4I2Z A;  2FO7 A;  4I2W A;  4LEU A;  3AS8 A;  4Y6C A;  2PL2 A;  3LY7 A;  4XIF A;  3S7F A;  3TAX A;  1KT1 A;  4U0Z A;  1PC2 A;  3FP3 A;  3ZPJ A;  4BT8 A;  2FI7 A;  4F3V A;  4HOU A;  5CCM A;  3S7J A;  4WND A;  5EKQ D;  4XI0 A;  2YQ8 A;  4AIF A;  2NC9 A;  2FBN A;  2Q7F A;  1YA0 A;  4G2V A;  5DIZ A;  3FFL A;  2KCK A;  4N2S A;  3CK8 A;  4G23 A;  4I9C A;  4UQX A;  2HO1 A;  4U07 A;  2QFC A;  4BT9 A;  1B89 A;  2UY1 B;  4IN3 B;  1HZ4 A;  4J8F A;  3TG5 A;  5JJT A;  1ELW A;  3JYS A;  5G04 J;  3RJV A;  2VQ2 A;  3K9I A;  2DBA A;  3TG4 A;  3FWV A;  3MKR A;  3CVN A;  5JJ7 A;  5DBK A;  3LY8 A;  3RO3 A;  4WNE A;  5D0Q D;  2WQH A;  3Q49 B;  4YND A;  5FZR A;  5KJK A;  2KAT A;  1NA0 A;  1ZU2 A;  2OND A;  4GZ3 A;  2C0L A;  3MEK A;  3LY9 A;  2J9Q A;  3ASH A;  3U4T A;  4AY6 A;  4H7Y A;  4N3A A;  4AY5 A;  4WNF A;  2P58 C;  4I17 A;  3R9A B;  1NA3 A;  4CGW A;  3PDN A;  4NQ0 A;  1HXI A;  1W3B A;  2KC7 A;  3CKC A;  2YHC A;  3O48 A;  1E96 B;  5FZQ A;  4JA9 A;  3GYZ A;  4B94 A;  2IFU A;  1P5Q A;  5EX0 A;  3AS5 A;  4UQZ A;  2I6H A;  3KS2 A;  3ZGQ A;  3ZFW A;  1IHG A;  3OXG A;  1FCH A;  4GYY A;  3ASD A;  2PQN A;  4U04 A;  3ASG A;  2Y4T A;  3MV3 B;  3OXF A;  3UUX A;  4I9E A;  2R5S A;  1HH8 A;  5EX3 A;  2BUG A;  3HYM B;  1KLX A;  3Q4A B;  5FZS A;  3WXX A;  2VGY A;  4CDR A;  2XGM A;  4J8E A;  3CK9 A;  2LSU A;  2AVP A;  2UY1 A;  1XNF A;  2C2L A;  4G1T A;  2E2E A;  2JLB A;  3E4B A;  4GYW A;  4Y6W A;  4YVQ C;  3KAE A;  5ARF A;  3VTY A;  1OUV A;  4GA2 A;  3Q5M A;  5JJ6 A;  4KXK B;  4N3B A;  2KCL A;  3NF1 A;  2LNI A;  2HR2 A;  3CVL A;  3LKU A;  4RG9 A;  4BTB A;  5BNW A;  4HOQ A;  3ULQ A;  4HOR A;  3LYA A;  5BW8 C;  3URZ A;  4JA7 A;  3UQ3 A;  3CKB A;  3U3W A;  2LSV A;  2HYZ A;  4YVO A;  3Q47 B;  5FTP A;  2UWJ G;  4O6F A;  4UI9 K;  5G05 C;  1TJC A;  4UQY A;  4BTA A;  5KJM A;  5G04 C;  4J8D A;  4WNG A;  2XCB A;  2XCC A;  4GA1 A;  1ZBP A;  4W9R A;  5D0O D;  5G05 J;  5HQ8 A;  4G25 A;  4GA0 A;  5HI7 A;  2PQR A;  3GZ1 A;  4CGV A;  3BEE A;  4ABN A;  1QQE A;  4GCO A;  5C1D A;  5KJL A;  1WM5 A;  4WUY A;  3SZ7 A;  3ZHE A;  1IYG A;  3CV0 A;  1KT0 A;  1QZ2 A;  2WPV A;  3QWW A;  5A7D B;  4U0U A;  3QWP A;  1NZN A;  3AS4 A;  4UI9 C;  2VSN A;  2MHK A;  2VSY A;  3S7B A;  3ZHE B;  3KD7 A;  2Y4U A;  2VGX B;  3EDT B;  4JL0 A;  3N71 A;  3CVQ A;  4H7X A;  4GPK A;  5KJN A;  4N3C A;  4U0S A;  3VTX A;  4UI9 J;  5M72 A;  4HOT A;  4J0U A;  5A6C A;  3MV2 B;  4GYO A;  5AYW D;  5BT1 A;  4KYO B;  4RG6 A;  4AM9 A;  1WAO 1;  3ESK A;  4GZ6 A;  2VGX A;  2XGO A;  3GW4 A;  3QWV A;  2GW1 A;  3RO2 A;  5CCL A;  3RKV A;  2KCV A;  3QDN A;  4GZ5 A;  3SF4 A;  4N5C A;  4APO A;  3CVP A;  5LCW C;  2OOE A;  2XPI A;  2XGS A;  3RIB A;  4GCN A;  5FJY A;  5FT9 A;  3LCA A;  4ME2 A;  3CK7 A;  4G26 A;  3GZ2 A;  4I1A A;  4KBQ A;  3S7D A;  2XEV A;  4JHR A;  4N39 A;  1ELR A;  3ASF A;  3QOU A;  5LCW J;  3Q15 A;  3MA5 A;  4A1S A;  3UPV A;  2V5F A;  2FF4 A;  4N2Q A;  3QKY A; 
#chains in the Genus database with same CATH topology
 4K5C A;  2FO1 E;  2GRL A;  2C0M A;  4LNB A;  3FU0 A;  4GMJ A;  3BU8 A;  1JCR A;  4U0Z A;  3PEV B;  5AAO A;  2XQ0 A;  2IQC A;  2NC9 A;  2ETA A;  4XZ4 A;  4JEH A;  3TG5 A;  3JYS A;  3FWV A;  4RQI A;  1JCS A;  3FUL A;  3MZL B;  4H7Y A;  4I17 A;  1IXV A;  4DUI A;  2IFU A;  2LXL A;  1JUQ A;  3QAQ A;  5AQ7 A;  3QAR A;  4DX1 A;  2B6C A;  1MYO A;  2BKK B;  4EBA A;  2C2L A;  4F1S A;  2E2E A;  5IY5 E;  1OUV A;  4GA2 A;  5FQ8 A;  5HRY A;  4MBG A;  3FTU A;  4NAC A;  1OWM A;  2BTD A;  4U8H A;  1UW4 B;  2EIK E;  2ZIS A;  5HQ8 A;  3HRA A;  4L2L A;  3NAW A;  1HX8 A;  1MHQ A;  3BUA A;  2P9K G;  4WUY A;  3ABL E;  2R17 C;  4JL0 A;  4C48 B;  2P9L G;  3D9K A;  3EIJ A;  2P2C P;  3DPD A;  2XPI A;  4U8Y D;  4ME2 A;  3B7U X;  5KNG A;  4HOS A;  4KMO A;  4XKC A;  3RU0 A;  2PZI A;  2FO7 A;  4FHK A;  2FI7 A;  3FTV A;  4G2V A;  4D10 C;  2EIN E;  3L08 A;  2XPZ A;  1E7U A;  4K5B A;  3HXE A;  1N4R A;  4GZC A;  4JA9 A;  3UKR G;  3ASG A;  3MV3 B;  5EID A;  3UKU G;  4A63 B;  2CFZ A;  3BG1 B;  2CHZ A;  2MOW A;  3KAE A;  4FLH A;  2LNI A;  2HR2 A;  2R59 A;  1MX2 A;  4RG9 A;  4EHM A;  3VLE A;  2XEH A;  3LYA A;  5CEA A;  1OWO A;  4L7T A;  1H19 A;  2R03 A;  5FTP A;  4B8A A;  4JPS A;  5CMY A;  2WXR A;  2WXQ A;  3QK0 A;  4GTT A;  4HI8 A;  4AEZ C;  2GRO B;  3ENE A;  4JHJ A;  5CEC B;  1TNB A;  2IJG X;  5A7D B;  2VGX B;  2RFA A;  1E90 A;  4J0U A;  2VSO E;  1PAQ A;  5G2N A;  3LJN A;  5CCL A;  1S0P A;  2I1J A;  4APO A;  1N95 A;  3CHP A;  2Y3A A;  5FT9 A;  3EHR A;  2L0I A;  2IY0 C;  2WXI A;  4NIK A;  3ZN3 A;  4HRM B;  1JCQ A;  3ML9 A;  5AQA A;  4G24 A;  3ZUV B;  4HS2 A;  3S2A A;  2ZXW E;  4XKB A;  3TAX A;  4GTR A;  3ZPJ A;  2CG3 A;  2FBN A;  2WQ7 A;  2CG2 A;  2HO1 A;  2UY1 B;  3TWV A;  2M63 A;  1OWN A;  3PZ2 A;  2J9Q A;  3ASH A;  3EHQ A;  4WNF A;  4TUU A;  3QC1 A;  1DCE A;  1MJ0 A;  1BLX B;  1E8Y A;  2V4L A;  4CYM D;  2VJ8 A;  1IHG A;  2OCC E;  3OXG A;  3KSL A;  4XE0 A;  2R5S A;  1HH8 A;  2BUG A;  3ULE G;  3SFX A;  3PZ1 A;  5AN8 A;  2AVP A;  3NQP A;  1Z3Y A;  4KXK B;  1QBQ A;  4BTB A;  4DI3 A;  4A3T A;  4HOQ A;  5BNW A;  3I3N A;  3IV0 A;  3UQ3 A;  3U3W A;  3I5P A;  4UI9 K;  3DSS A;  5EIB E;  1NI1 A;  3TJP A;  4WWP A;  3TL5 A;  4KVO A;  2XCB A;  1DNP A;  2PQR A;  3SO8 A;  3BEE A;  3R7Q A;  4GCO A;  3AS4 A;  2VSN A;  4WWN A;  2WXK A;  2R05 A;  2GRP B;  1Z3X A;  3SI5 A;  2KZT B;  5ENQ D;  5BT1 A;  1DCQ A;  2PNN A;  1O1R A;  3PS6 A;  2QYU A;  3Q7A A;  2LAI A;  3LCA A;  1LD8 A;  3V30 A;  4OAU C;  1DC2 A;  3Q15 A;  4B93 B;  4ZHB A;  4IRU A;  3ZYQ A;  4J8S A;  2L6J A;  1INZ A;  4WWO A;  5C2Y A;  2PL2 A;  3L22 A;  2CHW A;  2F8Y A;  4DX5 D;  1PY1 A;  4UQX A;  4ANV A;  3MJW A;  1HF8 A;  5DBK A;  1OCC E;  3TXN A;  5AIJ A;  3FTY A;  3FU3 A;  3EUV A;  2I6H A;  4JC8 A;  2XZD G;  4BER A;  4LNG A;  1N0Q A;  2YIN A;  4UWL A;  2CFU A;  4J6I A;  1QYM A;  3T9K A;  4YVQ C;  5ARF A;  3ZXS A;  4N3B A;  2I2O A;  3LKU A;  3CVL A;  1NP7 A;  3FTS A;  1TNZ A;  2J8S D;  3Q47 B;  2UWJ G;  5G05 C;  5BV0 A;  2J4D A;  1H2T C;  4WNG A;  5BXU A;  2YNQ A;  4FC8 A;  1OCR E;  3DBS A;  4FP7 A;  1N94 A;  1XGW A;  5KJL A;  3IKO B;  2WXH A;  3KD7 A;  3RSE G;  1TN8 A;  4Q69 A;  5FQ7 A;  3SGH A;  3MV2 B;  5CBO A;  2L9B A;  4RLY A;  1HG5 A;  4OVU A;  3ZYL A;  3B7T A;  3Q78 A;  4R7L A;  4J8Y A;  4EQF A;  4M7C A;  2X38 A;  3ZEF A;  3APF A;  4PDX A;  2LAH A;  1H0A A;  2KZT A;  3LEW A;  2GGF A;  3CHR A;  4I2W A;  4I2Z A;  2WQ6 A;  3RRN B;  1KT1 A;  4HFG A;  4HOU A;  3UMV A;  4AIF A;  2A5E A;  3UM0 A;  2Q7F A;  2XEE A;  1G3N B;  3TG4 A;  3CVN A;  4GTQ A;  2X6H A;  3FUK A;  5EIL A;  4JVS A;  4N3A A;  4Z68 A;  1KZO A;  2EIM E;  3OXF A;  2IOL A;  1HS6 A;  1NL4 A;  5FZS A;  3R7R A;  2VGY A;  3V31 A;  2DWZ A;  1XNF A;  1H6K A;  3C3Q A;  1SA5 A;  2KCL A;  1RW2 A;  4O60 A;  1S64 A;  3URZ A;  2LSV A;  2HYZ A;  4GTS A;  5KJM A;  5HI7 A;  4DX2 A;  4EZK A;  3SNX A;  2P9U G;  3JUI A;  5AJL A;  4ACL A;  4HLL A;  3ZHE A;  1LF8 A;  1OT8 A;  2QC9 A;  2Y4U A;  4MRU A;  3CST A;  3SBT B;  4G11 A;  1OCZ E;  3C3O A;  1FPP A;  2VGX A;  3RO2 A;  3L82 A;  4I1A A;  2XEV A;  3QOU A;  4EBA G;  3ABK E;  3DSV A;  1A17 A;  1N54 A;  1LTX A;  3PE4 A;  3ONL A;  3OAW A;  3HXC A;  3AS8 A;  1IKN D;  3T8K A;  1TN7 A;  3LVQ E;  1YA0 A;  5DIZ A;  2OVB A;  4IN3 B;  4IYP A;  4PH4 B;  4YND A;  3NOC D;  2IO2 C;  5AQB A;  5B3S E;  4AY6 A;  1MZC A;  2P58 C;  4Q94 A;  4ILG A;  4DK5 A;  1W3B A;  2KC7 A;  3SHF A;  5CRU A;  4MLP A;  3D9J A;  5EX0 A;  2ILR A;  3L54 A;  3KS2 A;  1UJJ A;  3ZFW A;  4KVM A;  4OAV B;  4GTP A;  2AW6 A;  4DPR A;  1N52 A;  3VTY A;  3QB2 A;  4GYW A;  4KZC A;  3D9L A;  1U3D A;  5T8I A;  4E6H A;  3D9N A;  3PEU B;  1AWC B;  5LOZ A;  4YDO A;  5B1B E;  4LUN U;  5AQ9 A;  4GMR A;  4W9R A;  3DSX A;  4CGV A;  2RFM A;  2AXV A;  3QWW A;  4U63 A;  4DJA A;  3N71 A;  5KJN A;  4C9B B;  5A6C A;  5ENN A;  3SD5 A;  3HVE B;  4U96 D;  2H6H A;  3RKV A;  3AG2 E;  5AEN A;  3GZ2 A;  3EU9 A;  4EPZ A;  3SFZ A;  5LCW J;  4CDN A;  3FTZ A;  3FUI A;  5LP0 A;  4DLQ A;  2KBX A;  3ZU7 B;  1K8K G;  1BI8 B;  2YHE A;  2VYI A;  1N4Q A;  1TJF A;  1BPO A;  3CEQ A;  3FDH A;  3PUJ A;  1HO8 A;  5AAR A;  4LER A;  3G2U A;  2MYO A;  2HM8 A;  2ZIR A;  2VTB A;  2E0I A;  2V4H C;  4C0E A;  3JXJ A;  3EHM A;  5ENR D;  3RO3 A;  3NOG D;  4AP2 A;  1NA0 A;  1ZU2 A;  2MRI A;  4ZFH A;  4FJY A;  3U4T A;  5T3R A;  4LRZ A;  3LJ3 A;  4I1O B;  3Q73 A;  4URK A;  3CVX A;  1E96 B;  2ION A;  4B89 A;  3W9G A;  3HG0 D;  3CVV A;  4GB9 A;  3ZVV A;  4V3I A;  3B95 A;  4Y6W A;  3UT4 A;  4K5A B;  2XPY A;  3NBN B;  5T4Y A;  3DXK G;  2BED A;  4O6F A;  1HFA A;  3ZYK A;  4UUC A;  4GA1 A;  2V8S E;  3U66 A;  4ATG A;  4UWF A;  3AG3 E;  2WPV A;  4HB5 A;  1N0R A;  2ZGG A;  3IHY A;  1TNY A;  2WXF A;  5AYW D;  1GW6 A;  4AM9 A;  2DYS E;  4TXP A;  1N4S A;  4XEI G;  4QFV A;  3ZNG A;  3MA5 A;  4BY6 A;  2P9S G;  4N2Q A;  4UWG A;  3TWT A;  5ARG A;  4TXR A;  2DIW A;  3ULY A;  4QQI A;  1JPL A;  2EIL E;  4XI0 A;  2F37 A;  5E75 A;  3APC A;  1B89 A;  2OEV A;  3MKR A;  3AG1 E;  5D0Q D;  4I1M A;  3ZXP A;  5EYL A;  3R9A B;  1IQR A;  1UN8 A;  4F6R D;  1DVP A;  4B94 A;  4TUM A;  2WXP A;  1K1B A;  3J5P A;  3B7R L;  3MKQ B;  3Q4A B;  3GZS A;  2QZA A;  4DX6 D;  4A1G A;  5EDS A;  2A4Z A;  4L1B A;  3CVY A;  1SZ9 A;  4JA7 A;  3CKB A;  4O1P A;  2JEK A;  3FHE A;  2Y69 E;  4HRN A;  3NZS A;  4ABN A;  3U9W A;  2WMO A;  4CCA A;  1KT0 A;  1QZ2 A;  3G2S A;  3IHV A;  3FUE A;  2MHK A;  1L5J A;  3FTW A;  3UI2 A;  3ZIM A;  4KYO B;  4RG6 A;  4K03 A;  5G55 A;  2AXZ A;  4FAD A;  3TWQ A;  2V5F A;  3QKY A;  4BWR A;  3PE3 A;  2XZT G;  3C5R A;  4ANX A;  3FY4 A;  1OWL A;  2PM7 A;  5CHE E;  2IF4 A;  3DPY A;  3CGH A;  4Y6C A;  4BT8 A;  5CCM A;  4WND A;  1ELK A;  3PNL B;  2KCK A;  4N2S A;  4I9C A;  2QFC A;  4L2Y A;  5G04 J;  4BSZ B;  3G2T A;  1YYH A;  2WQH A;  3RRM B;  2V5Q C;  5FZR A;  3FUN A;  5ENO D;  4TXQ A;  4ANW A;  3NB2 A;  2RKK A;  3T8M A;  3O48 A;  3ABM E;  3AS5 A;  1N11 A;  3UUX A;  3D9I A;  3AJI A;  3FU5 A;  1KLX A;  5B1A E;  4JEU A;  2NYJ A;  1WDY A;  1HU3 A;  4FHJ A;  2X6I A;  4Q96 A;  3HVE A;  3EHN A;  3UX4 A;  2OEW A;  2X6J A;  3J5Q B;  4LNU D;  4M3O A;  3APD A;  3VLD A;  1UJK A;  3MX3 A;  1VDY A;  5C1D A;  3QWP A;  4A3V A;  3CVQ A;  5EYP F;  4HOT A;  5M72 A;  3UT7 A;  2XRZ A;  3G2W A;  5KCM A;  2VGE A;  3AAA C;  3QDN A;  5LCW C;  2XGS A;  4UWH A;  2XS8 A;  3ASO E;  4TV3 A;  5ENT D;  1MQS A;  3CHQ A;  3RRU A;  3LVR E;  3JXI A;  2GRQ B;  5EN5 D;  1E8X A;  4HVB A;  3PUK A;  3D9P A;  5FWQ A;  4ILI A;  4JW1 A;  4DI4 A;  3SY2 A;  1PC2 A;  2PM6 A;  1MX6 A;  4E85 A;  3RJV A;  4ANU A;  3ZW3 A;  4DRX E;  1OCO E;  3DEO A;  2J08 A;  1HG2 A;  4AY5 A;  2Y1L E;  2XRY A;  3TWR A;  2RG8 A;  2DZO A;  3CKC A;  3P1U A;  1SVX A;  3GYZ A;  3C98 A;  3ZGQ A;  2PQN A;  1LD7 A;  2Y4T A;  3ZRH A;  4CDR A;  4I6G A;  3FUJ A;  4J8E A;  1EPU A;  5JHB A;  3Q5M A;  4CDM A;  2HE0 A;  4BX8 A;  4B0Z A;  3D3M A;  3FH8 A;  3E37 A;  1E7V A;  4BTA A;  2XCC A;  2XS1 A;  2ETB A;  3PVL A;  3EDT B;  4GPK A;  4HXI A;  1TN6 A;  4UI9 J;  3WG7 E;  4GYO A;  3SFY A;  3SF4 A;  4N5C A;  4HNA D;  4GCN A;  1O1T A;  3Q75 A;  4JHR A;  1FT1 A;  1UG3 A;  2J4B A;  2WVI A;  3CHO A;  5FIO A;  4GML A;  3MGB A;  3HIZ A;  3V79 K;  2V0P A;  1S70 B;  3Q7F A;  4F3V A;  2B0O E;  5LFA A;  3FFL A;  3TWU A;  4MS6 A;  1ELW A;  5ANR A;  5HS0 A;  3K9I A;  2L6B A;  3EJN A;  1NFI E;  3AG4 E;  2I9C A;  1NA3 A;  3DEP A;  3CVW A;  3T5V A;  4AOF A;  3T5X A;  3JQ1 A;  3E32 A;  4AV7 A;  1IQU A;  4I9E A;  3U64 A;  3MCX A;  1TNO A;  3PZ4 A;  5J08 A;  4HBD A;  3ASN E;  5E76 A;  2VTB B;  4G1T A;  1FVF A;  1H6P A;  4N5Q A;  1D8E A;  4XX5 A;  5JHA A;  5H7P A;  3IBE A;  3ONK A;  2H6G A;  1UN9 A;  5JMN D;  1O5M A;  2H6F A;  2J07 A;  5CMW A;  3RAU A;  2CHX A;  1FT2 A;  4U0S A;  4BET A;  4WAF A;  3GW4 A;  3BG0 B;  1D9S A;  4TRQ A;  2X6F A;  4N39 A;  4BEP A;  1K3Z D;  4I43 A;  1KPS B;  2ZGD A;  1RZ4 A;  2LO6 A;  3CLJ A;  3C72 A;  3FH7 A;  2J09 A;  2NXP A;  2DVW A;  3S7J A;  4JZY A;  4FLB A;  1IHB A;  3JCK C;  3L9T A;  1HZ4 A;  5JJT A;  4O1O A;  4P29 A;  2OND A;  4GZ3 A;  4APF A;  2A5U A;  4PS7 A;  3PDN A;  3PH0 C;  5CER B;  1OY3 D;  1FVH A;  5FZQ A;  2LUH A;  3CQC B;  3FEY A;  4GYY A;  4U04 A;  3ASD A;  3R9M A;  1ZB1 A;  1WY6 A;  2IEJ A;  1SQM A;  3WXX A;  3QJZ A;  2XGM A;  2JLB A;  3OTN A;  4UWK A;  2BKG A;  3E33 A;  3TWW A;  5BXO A;  3QNK A;  1TYQ G;  3LS8 A;  4YVO A;  2ETC A;  3MKQ A;  4JB8 P;  2F0Y A;  2KXP C;  4IUL A;  5D0O D;  3GZ1 A;  1N9A A;  2I1K A;  2Y0B G;  3ZKJ A;  2QY7 A;  3FTX A;  3UXG A;  4FA6 A;  3HXD A;  2P9P G;  3P2B A;  1WAO 1;  4GTO A;  4GZ6 A;  4GU5 A;  3CK7 A;  3CHS A;  3S7D A;  3ASF A;  4A1S A;  4OVV A;  3LPZ A;  4XI9 A;  1TEZ A;  4J7W A;  4RSY A;  4NRH B;  2LXM A;  5FQ6 A;  4EZL A;  1Y8M A;  3DRA A;  3PZD A;  3CSF A;  3I4G A;  4XIF A;  1TR4 A;  3TXM A;  2GRN B;  3ML8 A;  4F53 A;  3KEA A;  4U7E B;  4CEM A;  3DXM G;  2OVF A;  4U07 A;  4G8L A;  3X2Q E;  4J8F A;  3DSW A;  3TWX A;  1X81 A;  1QNF A;  2IOS A;  5JJ7 A;  3UIO C;  3UT8 A;  3Q49 B;  4EZJ A;  4BX9 A;  4I6E A;  1BD8 A;  5CRV A;  1P5Q A;  4JD2 G;  3CIA A;  2DZN A;  2WB2 A;  3FUH A;  4CT0 A;  2LSU A;  3D9M A;  4BSX A;  5FIN A;  3HHM A;  2XHE A;  2J49 A;  3ISM C;  2JAB A;  3VLF A;  3L16 A;  5BPP A;  4UQY A;  5FQ4 A;  5G04 C;  5J90 A;  4J8D A;  5G05 J;  3B7B A;  4F1P A;  4G25 A;  5KBA A;  1O1S A;  2GRR B;  4PS8 A;  2ZU6 B;  3UIP C;  3CV0 A;  3FEX A;  4UI9 C;  3S7B A;  4CZ2 D;  1SW6 A;  3CVU A;  4H7X A;  3W9F A;  2GRM A;  4N3C A;  1U2V G;  4KT6 B;  4DLO A;  4YDY A;  4GZD A;  4RVB A;  3HXB A;  2WXM A;  5FJY A;  5KWD A;  3B7S A;  1V55 E;  2WXL A;  2NSZ A;  3SQV A;  1SZA A;  3EIQ C;  4NUR A;  4U8V D;  2FEZ A;  3D9H A;  3DSU A;  4LEU A;  4L9P A;  3FUF A;  2YQ8 A;  5ANL A;  3F6Q A;  2IU1 A;  3CK8 A;  4YDW A;  3UM3 A;  3E30 A;  1YMP A;  1N4P A;  4WNE A;  3MEK A;  3LY9 A;  4HRL A;  3UM2 A;  3ESL A;  3AU5 A;  4NQ0 A;  1AP7 A;  1HXI A;  1D8D A;  2R2L A;  1U3C A;  4UQZ A;  3UPV A;  1Z5S C;  1OXJ A;  3PRE A;  3G2V A;  2R02 A;  1H6O A;  4EEC A;  1WG0 A;  2P9I G;  3Q9N C;  1H2V C;  1TJC A;  3IXE A;  1EYH A;  2WMN A;  1E8Z A;  2DYR E;  4G8K A;  1ZBP A;  2VSX E;  5D66 A;  4GA0 A;  5ENS D;  1QQE A;  1IYG A;  3Q79 A;  1KZP A;  4I6J A;  2AJA A;  1JWG A;  3FU6 A;  3PZ3 A;  3CR3 A;  2GW1 A;  2KCV A;  4AXH A;  4G26 A;  4KBQ A;  3PNT B;  4LSZ E;  2H6I A;  4GAA A;  1S63 A;  1BI7 B;  3UTM A;  3V2O A;  1K1A A;  5A23 A;  2AXU A;  2QYJ A;  3TGO A;  4X8Q A;  3IEG A;  1TNU A;  3LY7 A;  3S7F A;  3KEZ A;  3LXU X;  2F8X K;  5EKQ D;  4DX7 D;  5LX8 A;  4LG6 A;  4BT9 A;  5KNH D;  3L13 A;  2DBA A;  3EU5 A;  5KJK A;  4CRW A;  3LDZ A;  4KZ0 A;  2EIJ E;  4U95 D;  1FCH A;  2X3M A;  1EDU A;  3V2X A;  4GTV A;  3DWL G;  2UY1 A;  3ZHE B;  3E4B A;  5BUZ A;  5BV1 A;  5ITZ F;  3ZYM A;  1X5B A;  2WXJ A;  4HOR A;  1A5E A;  4ACK A;  4MKT A;  3CQG B;  4AJW A;  1EF1 C;  3DST A;  1YCS B;  3C3R A;  2OV8 A;  4OYS A;  4JHK A;  4HI9 A;  2AWI A;  3ESK A;  2XGO A;  4FUL A;  5AJD A;  3CVP A;  5CBN A;  3E34 A;  3JQ0 A;  1ELR A;  1E8W A;  5CED B;  2FF4 A;  3CHM A;  3O4Z A;  3OXL A;  4FJZ A;  3TWS A;  2EQX A;  1Z6T A;  3L6A A;  4JXT A;  4GPM A;  3D9O A;  3FP3 A;  2IO3 C;  5HKP A;  3PRZ A;  4G23 A;  3Q9U C;  3FH5 A;  1MX4 A;  2VQ2 A;  3I4R B;  3LY8 A;  2KAT A;  2C0L A;  3RK6 A;  4AVX A;  4HLE A;  4GTM A;  4CGW A;  3BQO A;  2YHC A;  2KM4 A;  4HQD A;  4PS3 A;  2WM9 A;  5JA4 D;  5EX3 A;  3HYM B;  3CK9 A;  2X6K A;  5ENP D;  4FU3 A;  3HXF A;  3NZU A;  5D2M C;  5JJ6 A;  3NF1 A;  2WXN A;  3JUE A;  3KSQ A;  2XEN A;  3UM1 A;  3ULQ A;  1V54 E;  5BW8 C;  4PUC A;  4A55 A;  4CT4 A;  2BF0 X;  3FUM A;  4ATZ D;  2DCP A;  1H2U A;  3L17 A;  1OWP A;  4C0M A;  1BU9 A;  3UIN C;  2L0T B;  3AU4 A;  1WM5 A;  3SZ7 A;  4F7A A;  4BFR A;  4U0U A;  2WXO A;  1NZN A;  4ILH B;  1HE8 A;  2VSY A;  4L23 A;  4K0R A;  1Y6I A;  4LCT A;  3VTX A;  1SA4 A;  2RD0 A;  2FUL A;  2P9N G;  3FUD A;  1UOH A;  4B8C B;  2WXG A;  3B13 A;  3QWV A;  4BES A;  4GZ5 A;  1Q2Z A;  2OOE A;  3RIB A;  1JWF A;  4YDE A;  3HDX A;  3SBS A;  3MYV A; 
#chains in the Genus database with same CATH homology
 3LPZ A;  4XI9 A;  4EQF A;  4BWR A;  2GRL A;  2X38 A;  3PE3 A;  3ZEF A;  1TEZ A;  2C0M A;  4RSY A;  3APF A;  4NRH B;  4ANX A;  4PDX A;  2LAH A;  1H0A A;  3FU0 A;  3FY4 A;  2KZT A;  5FQ6 A;  4GMJ A;  3LEW A;  1OWL A;  2GGF A;  2PM7 A;  5CHE E;  3CHR A;  1Y8M A;  2IF4 A;  4I2Z A;  4I2W A;  4EZL A;  3PZD A;  3CSF A;  3CGH A;  3I4G A;  4Y6C A;  4XIF A;  3RRN B;  3TXM A;  1KT1 A;  4U0Z A;  3ML8 A;  4HFG A;  3PEV B;  4BT8 A;  5CCM A;  4HOU A;  4F53 A;  2XQ0 A;  4WND A;  3UMV A;  4AIF A;  2IQC A;  2NC9 A;  2Q7F A;  1ELK A;  3PNL B;  2KCK A;  4N2S A;  4CEM A;  4I9C A;  4XZ4 A;  2OVF A;  2QFC A;  4U07 A;  4JEH A;  4J8F A;  4L2Y A;  3TG5 A;  3JYS A;  5G04 J;  1QNF A;  3TG4 A;  3G2T A;  3FWV A;  3CVN A;  2IOS A;  5JJ7 A;  3UT8 A;  2WQH A;  3Q49 B;  3RRM B;  5FZR A;  4EZJ A;  4BX9 A;  2X6H A;  3FUK A;  3FUN A;  3FUL A;  3MZL B;  4JVS A;  4H7Y A;  4I6E A;  4N3A A;  4I17 A;  4ANW A;  3T8M A;  3O48 A;  2IFU A;  1P5Q A;  3AS5 A;  1JUQ A;  3CIA A;  3QAQ A;  3UUX A;  3D9I A;  3OXF A;  3QAR A;  2IOL A;  1HS6 A;  3FU5 A;  1KLX A;  4JEU A;  5FZS A;  3R7R A;  3FUH A;  2WB2 A;  2VGY A;  4CT0 A;  1HU3 A;  4EBA A;  4FHJ A;  2LSU A;  3D9M A;  4BSX A;  1XNF A;  2C2L A;  4F1S A;  2E2E A;  2X6I A;  3HHM A;  1H6K A;  1OUV A;  4GA2 A;  5FQ8 A;  2XHE A;  2KCL A;  4Q96 A;  3HVE A;  2WQ6 A;  2J49 A;  3EHN A;  3FTU A;  3URZ A;  4NAC A;  1OWM A;  3VLF A;  2LSV A;  2HYZ A;  3L16 A;  5BPP A;  3UX4 A;  4UQY A;  2X6J A;  5KJM A;  5FQ4 A;  5G04 C;  2BTD A;  3APD A;  4M3O A;  4U8H A;  1UW4 B;  4J8D A;  3VLD A;  5J90 A;  1UJK A;  3MX3 A;  5G05 J;  5HQ8 A;  4L2L A;  4G25 A;  5HI7 A;  1HX8 A;  4EZK A;  1VDY A;  3SNX A;  1MHQ A;  4PS8 A;  2ZU6 B;  3JUI A;  5AJL A;  5C1D A;  4ACL A;  4WUY A;  3ZHE A;  3CV0 A;  3FEX A;  1LF8 A;  3QWP A;  4UI9 C;  3S7B A;  2R17 C;  3CVU A;  2Y4U A;  4MRU A;  4A3V A;  4JL0 A;  3CVQ A;  4H7X A;  2GRM A;  3CST A;  4N3C A;  4HOT A;  5M72 A;  3SBT B;  4KT6 B;  4G11 A;  3UT7 A;  4DLO A;  2XRZ A;  3D9K A;  3EIJ A;  4GZD A;  3G2W A;  5KCM A;  2VGX A;  3RO2 A;  3QDN A;  4RVB A;  3DPD A;  5LCW C;  2WXM A;  2XPI A;  2XGS A;  5FJY A;  4UWH A;  4ME2 A;  3B7S A;  4I1A A;  2XEV A;  2WXL A;  2NSZ A;  3QOU A;  4TV3 A;  1MQS A;  3CHQ A;  3RRU A;  3LVR E;  3B7U X;  4EBA G;  1E8X A;  4HVB A;  3PUK A;  4HOS A;  4KMO A;  1A17 A;  1N54 A;  1SZA A;  3D9P A;  5FWQ A;  3EIQ C;  3PE4 A;  4NUR A;  4ILI A;  3ONL A;  4XKC A;  4JW1 A;  3RU0 A;  3OAW A;  2FEZ A;  2PZI A;  4LEU A;  2FO7 A;  4DI4 A;  3AS8 A;  3FUF A;  4FHK A;  1PC2 A;  2FI7 A;  3FTV A;  2YQ8 A;  3LVQ E;  5ANL A;  4G2V A;  1YA0 A;  4D10 C;  2PM6 A;  5DIZ A;  2IU1 A;  3CK8 A;  2OVB A;  3L08 A;  4IN3 B;  2XPZ A;  4E85 A;  4IYP A;  3RJV A;  4ANU A;  4PH4 B;  3ZW3 A;  4WNE A;  4YND A;  2J08 A;  3MEK A;  1E7U A;  1HG2 A;  3LY9 A;  4AY6 A;  4AY5 A;  2P58 C;  4ILG A;  4Q94 A;  2XRY A;  4DK5 A;  3ESL A;  2RG8 A;  3AU5 A;  4GZC A;  1HXI A;  4NQ0 A;  1W3B A;  2KC7 A;  3CKC A;  3SHF A;  3P1U A;  4MLP A;  3D9J A;  4JA9 A;  3GYZ A;  3C98 A;  5EX0 A;  1U3C A;  2ILR A;  3L54 A;  3KS2 A;  1UJJ A;  4UQZ A;  3ZGQ A;  3ZFW A;  4KVM A;  3UPV A;  2PQN A;  3ASG A;  2Y4T A;  3MV3 B;  3PRE A;  3G2V A;  3ZRH A;  4CDR A;  2CFZ A;  4I6G A;  2AW6 A;  3FUJ A;  1N52 A;  4J8E A;  1EPU A;  4DPR A;  3BG1 B;  2CHZ A;  5JHB A;  2MOW A;  3VTY A;  3QB2 A;  4GYW A;  4KZC A;  4EEC A;  3D9L A;  3KAE A;  1U3D A;  3Q5M A;  4FLH A;  4CDM A;  2LNI A;  2HR2 A;  2R59 A;  4RG9 A;  5T8I A;  4BX8 A;  4B0Z A;  4E6H A;  3VLE A;  3LYA A;  3D9N A;  1OWO A;  3D3M A;  4L7T A;  3PEU B;  1H19 A;  3FH8 A;  5FTP A;  4B8A A;  4JPS A;  5LOZ A;  1E7V A;  1H2V C;  1TJC A;  4BTA A;  4LUN U;  2WXR A;  5CMY A;  2WXQ A;  3QK0 A;  1EYH A;  2WMN A;  1E8Z A;  2XCC A;  4AEZ C;  1ZBP A;  2VSX E;  4W9R A;  4GA0 A;  4CGV A;  3ENE A;  1QQE A;  4JHJ A;  1IYG A;  2IJG X;  2AXV A;  3QWW A;  5A7D B;  4U63 A;  4DJA A;  3PVL A;  2VGX B;  3EDT B;  4GPK A;  3N71 A;  4HXI A;  4I6J A;  5KJN A;  1E90 A;  1JWG A;  3FU6 A;  3CR3 A;  4UI9 J;  4C9B B;  4J0U A;  2VSO E;  1PAQ A;  5ENN A;  5G2N A;  5A6C A;  4GYO A;  3SD5 A;  5CCL A;  3HVE B;  1S0P A;  2GW1 A;  2I1J A;  3RKV A;  2KCV A;  3SF4 A;  4APO A;  4N5C A;  3CHP A;  2Y3A A;  4GCN A;  5FT9 A;  4AXH A;  4G26 A;  5AEN A;  3GZ2 A;  4EPZ A;  4KBQ A;  3PNT B;  2L0I A;  4JHR A;  1UG3 A;  3SFZ A;  2J4B A;  2WXI A;  4GAA A;  5LCW J;  2WVI A;  3FTZ A;  4CDN A;  3CHO A;  4GML A;  3FUI A;  3ZN3 A;  5LP0 A;  3MGB A;  4DLQ A;  3ML9 A;  5A23 A;  3HIZ A;  2AXU A;  4G24 A;  2YHE A;  3TGO A;  2VYI A;  2V0P A;  3IEG A;  1TJF A;  1BPO A;  4HS2 A;  3S2A A;  3CEQ A;  4XKB A;  3FDH A;  3LY7 A;  3TAX A;  3S7F A;  3PUJ A;  3ZPJ A;  4F3V A;  3KEZ A;  3LXU X;  1HO8 A;  5EKQ D;  4LER A;  2CG3 A;  3G2U A;  2FBN A;  5LFA A;  5LX8 A;  2HM8 A;  3FFL A;  2WQ7 A;  4BT9 A;  2CG2 A;  2HO1 A;  4MS6 A;  2UY1 B;  2VTB A;  2E0I A;  1ELW A;  4C0E A;  5ANR A;  3K9I A;  3L13 A;  2DBA A;  3EHM A;  3RO3 A;  2M63 A;  3EJN A;  5KJK A;  4AP2 A;  1NA0 A;  1ZU2 A;  1OWN A;  2MRI A;  2J9Q A;  3ASH A;  4FJY A;  3U4T A;  5T3R A;  3LDZ A;  4LRZ A;  3LJ3 A;  4CRW A;  4TUU A;  3QC1 A;  4WNF A;  2I9C A;  1NA3 A;  4I1O B;  4KZ0 A;  3CVW A;  3T5V A;  4URK A;  3CVX A;  1E96 B;  1E8Y A;  4AOF A;  2ION A;  4B89 A;  3T5X A;  2V4L A;  3JQ1 A;  2VJ8 A;  1IHG A;  3OXG A;  1FCH A;  2X3M A;  4AV7 A;  1IQU A;  3CVV A;  4I9E A;  4XE0 A;  2R5S A;  3MCX A;  1HH8 A;  1EDU A;  4GB9 A;  2BUG A;  3U64 A;  5J08 A;  5E76 A;  3ZVV A;  4V3I A;  2AVP A;  2UY1 A;  2VTB B;  3ZHE B;  4G1T A;  3E4B A;  4Y6W A;  3UT4 A;  5BUZ A;  3NQP A;  5BV1 A;  1FVF A;  1Z3Y A;  4KXK B;  2XPY A;  4BTB A;  4DI3 A;  4A3T A;  4HOQ A;  5BNW A;  3ZYM A;  1X5B A;  3I3N A;  2WXJ A;  4HOR A;  3IV0 A;  4XX5 A;  5T4Y A;  3UQ3 A;  3U3W A;  3I5P A;  5JHA A;  4UI9 K;  4O6F A;  1HFA A;  3IBE A;  4WWP A;  3TJP A;  3TL5 A;  4MKT A;  4KVO A;  2XCB A;  4GA1 A;  3ONK A;  3ZYK A;  4ACK A;  1UN9 A;  1DNP A;  2V8S E;  2PQR A;  3U66 A;  3CQG B;  3BEE A;  4AJW A;  4ATG A;  1EF1 C;  4GCO A;  3R7Q A;  4UWF A;  2WPV A;  3AS4 A;  2VSN A;  3IHY A;  2J07 A;  2OV8 A;  2WXK A;  4WWN A;  5CMW A;  2CHX A;  1Z3X A;  4OYS A;  3SI5 A;  4JHK A;  2KZT B;  4U0S A;  2WXF A;  5AYW D;  5BT1 A;  2AWI A;  1GW6 A;  3PS6 A;  4AM9 A;  4WAF A;  3ESK A;  3GW4 A;  2XGO A;  4FUL A;  5AJD A;  3BG0 B;  3CVP A;  2LAI A;  3JQ0 A;  3LCA A;  4QFV A;  4TRQ A;  2X6F A;  4N39 A;  1ELR A;  1E8W A;  3Q15 A;  3MA5 A;  2FF4 A;  4BY6 A;  4N2Q A;  3CHM A;  4UWG A;  3O4Z A;  4IRU A;  4I43 A;  3OXL A;  4FJZ A;  3ZYQ A;  4J8S A;  2EQX A;  2L6J A;  5ARG A;  1INZ A;  4WWO A;  1Z6T A;  3L6A A;  4JXT A;  3CLJ A;  2LO6 A;  3FH7 A;  2DIW A;  2J09 A;  3D9O A;  5C2Y A;  2NXP A;  2PL2 A;  3FP3 A;  1JPL A;  3S7J A;  4XI0 A;  3L22 A;  2CHW A;  5E75 A;  4JZY A;  3APC A;  3PRZ A;  1PY1 A;  4FLB A;  4G23 A;  3FH5 A;  4UQX A;  3JCK C;  1B89 A;  1HZ4 A;  5JJT A;  4ANV A;  3MJW A;  1HF8 A;  2VQ2 A;  3I4R B;  3MKR A;  5DBK A;  3LY8 A;  5D0Q D;  4P29 A;  3TXN A;  2KAT A;  2OND A;  4GZ3 A;  2C0L A;  3RK6 A;  4I1M A;  4APF A;  4AVX A;  5AIJ A;  4HLE A;  2A5U A;  3R9A B;  3FTY A;  4PS7 A;  4CGW A;  1IQR A;  3PDN A;  3PH0 C;  1UN8 A;  2YHC A;  1FVH A;  2KM4 A;  5FZQ A;  1DVP A;  3CQC B;  3FEY A;  3FU3 A;  4PS3 A;  4B94 A;  2WM9 A;  2I6H A;  4JC8 A;  2WXP A;  4GYY A;  4U04 A;  3ASD A;  1WY6 A;  2YIN A;  3B7R L;  3MKQ B;  4UWL A;  5EX3 A;  3HYM B;  3Q4A B;  1SQM A;  3WXX A;  3GZS A;  3QJZ A;  2XGM A;  3CK9 A;  2CFU A;  2X6K A;  4J6I A;  4A1G A;  4FU3 A;  4YVQ C;  2JLB A;  5ARF A;  5EDS A;  3NZU A;  3ZXS A;  3OTN A;  4UWK A;  5JJ6 A;  4N3B A;  2I2O A;  2A4Z A;  2WXN A;  3LKU A;  3CVL A;  3NF1 A;  4L1B A;  1NP7 A;  3FTS A;  3QNK A;  3ULQ A;  3CVY A;  1SZ9 A;  5BW8 C;  4JA7 A;  4PUC A;  3CKB A;  3LS8 A;  2JEK A;  4A55 A;  4CT4 A;  4YVO A;  2BF0 X;  3Q47 B;  2UWJ G;  5G05 C;  5BV0 A;  2J4D A;  3MKQ A;  3FUM A;  2DCP A;  1H2T C;  1H2U A;  3FHE A;  4WNG A;  2YNQ A;  3L17 A;  4FC8 A;  1OWP A;  3DBS A;  4C0M A;  4IUL A;  5D0O D;  4FP7 A;  2L0T B;  3AU4 A;  3GZ1 A;  3NZS A;  1XGW A;  4ABN A;  5KJL A;  3U9W A;  2WMO A;  3IKO B;  2I1K A;  1WM5 A;  3SZ7 A;  4CCA A;  1KT0 A;  2WXH A;  1QZ2 A;  3G2S A;  3IHV A;  4BFR A;  4U0U A;  4F7A A;  2WXO A;  1NZN A;  3FUE A;  4ILH B;  1HE8 A;  2MHK A;  2VSY A;  3KD7 A;  2QY7 A;  3FTX A;  4L23 A;  4K0R A;  1Y6I A;  4FA6 A;  4Q69 A;  4LCT A;  1L5J A;  3FTW A;  5FQ7 A;  3VTX A;  2RD0 A;  3P2B A;  2FUL A;  3MV2 B;  3SGH A;  3FUD A;  3ZIM A;  2L9B A;  4KYO B;  4RG6 A;  1HG5 A;  2WXG A;  3B13 A;  1WAO 1;  4OVU A;  3ZYL A;  4B8C B;  4GZ6 A;  4K03 A;  3QWV A;  5G55 A;  3B7T A;  4GU5 A;  4GZ5 A;  2OOE A;  3RIB A;  1JWF A;  3HDX A;  3CK7 A;  2AXZ A;  3CHS A;  3SBS A;  4R7L A;  3S7D A;  4FAD A;  3ASF A;  3MYV A;  4A1S A;  2V5F A;  4OVV A;  3QKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...