2UWJG

Structure of the heterotrimeric complex which regulates type iii secretion needle formation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
b'DTSLIRELAELALAGSGQHCHEEALCIAEWLERLGQDEAARLIRISSLANQGRYQEALAFAHGNPWPALEPWFALCEWHLGLGAALDRRLAGLGGSSDPALADFAAGMRAQVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III EXPORT PROTEIN PSCE
publication title Structure of the heterotrimeric complex that regulates type III secretion needle formation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2007-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF09477 Type_III_YscG Bacterial type II secretion system chaperone protein (type_III_yscG)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2uwjG00
4N2SA 5CCMA 2VSYA 4J0UA 2PQNA 4JA9A 3ASFA 4UQZA 5D0QD 4A1SA 3ZN3A 5D0OD 2VGYA 3QWPA 4GA2A 3TG5A 2JLBA 3LKUA 4GZ3A 4EQFA 5KJKA 3PE4A 3CV0A 3RU0A 5A7DB 5EKQD 2FF4A 3RO3A 1P5QA 3MV2B 3TAXA 5HQ8A 4AM9A 2V5FA 4HOTA 3QKYA 2YHCA 2LSUA 1KT0A 2KC7A 3S7DA 3ASGA 5FZSA 4AY6A 4AY5A 4RG6A 4I17A 2NC9A 3ZFWA 2PL2A 4YVOA 2VGXB 1WAO1 4HORA 1ZBPA 2UY1B 2YQ8A 2WQHA 3EDTB 2WPVA 5FTPA 5AYWD 3PE3A 4N5CA 4J8EA 4H7XA 1KT1A 3MV3B 2PQRA 5BNWA 3FP3A 2KATA 1IHGA 4YNDA 3Q5MA 4G2VA 2VGXA 3LCAA 3UQ3A 5EX3A 4CDRA 3GZ1A 1ELWA 3CVPA 3QDNA 1ZU2A 3ASDA 2KCVA 5JJTA 3FFLA 5BT1A 3U4TA 1W3BA 3GYZA 2XGOA 2PZIA 4N3AA 2KCLA 4NQ0A 2FBNA 3CK9A 3RIBA 3CKBA 3OXLA 3RO2A 3NF1A 2MHKA 2Q7FA 3CVQA 5ARGA 4ME2A 4NRHB 5HI7A 3VTXA 5KJMA 4J8FA 5ARFA 4XI0A 3E4BA 3GW4A 3MKRA 3KD7A 5LCWC 4U0SA 2XPIA 3O48A 3Q49B 2BUGA 4G23A 4G26A 3S7FA 4BT9A 1NA0A 2FO7A 2VYIA 3Q15A 1IYGA 5FZRA 2L6JA 1TJCA 1NA3A 4APOA 3TG4A 4XI9A 4U04A 2DBAA 2J9QA 4JHRA 2XCBA 2HO1A 2OOEA 5FZQA 4GYOA 3CKCA 4N39A 5DBKA 3UPVA 4GZ5A 1NZNA 3CK8A 4I9CA 3U3WA 1HZ4A 3ASHA 4JL0A 3R9AB 3LY7A 2ONDA 4I1AA 3CVNA 1A17A 1KLXA 2C0MA 4N2QA 2GW1A 4WNFA 5KJNA 3GZ2A 3LY9A 3S7BA 4W9RA 3QWWA 5LCWJ 3LYAA 4G1TA 3OXGA 4AIFA 5C1DA 1B89A 2UY1A 4KYOB 5DIZA 3VTYA 2VSNA 4GA1A 4IN3B 4UI9K 4WNEA 3BEEA 5CHEE 3AS4A 4JA7A 2KCKA 3JYSA 2Y4UA 4U0ZA 2FI7A 3FWVA 4CGWA 2QFCA 4XIFA 4UQYA 4GCNA 4UI9C 3IEGA 3N71A 5G05J 4HOQA 2LNIA 4WNDA 4J8DA 1HXIA 5KJLA 4Y6WA 3HYMB 4WNGA 5CCLA 3PDNA 5G04C 1QQEA 4GA0A 3SF4A 4H7YA 3UUXA 4WUYA 3CK7A 3TGOA 1FCHA 4BTBA 2Y4TA 2LSVA 1Y8MA 3LPZA 3S7JA 2XCCA 4I9EA 3CVLA 3MEKA 4U07A 2HR2A 4BT8A 3QOUA 4UI9J 3ZGQA 4YVQC 4I2WA 4GCOA 4N3BA 3WXXA 3AS8A 2E2EA 1PC2A 5BW8C 4F3VA 1HH8A 4KXKB 3ULQA 2C0LA 5FJYA 5G05C 4UQXA 4ABNA 3LY8A 4B94A 3SZ7A 3URZA 2P58C 5G04J 5EX0A 1WM5A 3AS5A 1YA0A 3ESKA 4GPKA 3OXFA 2I6HA 3Q47B 4BTAA 3RJVA 4Y6CA 2XGMA 1QZ2A 4BWRA 4GZ6A 4HOUA 2XGSA 4CGVA 3RKVA 4G25A 3ZHEB 4O6FA 5A6CA 4U0UA 3CEQA 4GYWA 4RG9A 3K9IA 5JJ6A 4N3CA 4I2ZA 2AVPA 3ZHEA 3Q4AB 2XEVA 3MA5A 3QWVA 4LEUA 4HOSA 5JJ7A 2R5SA 1ELRA 2IF4A 2C2LA 2UWJG 4KBQA 4G24A 2FEZA 4GYYA 2IFUA 5M72A 5FT9A 3KS2A 2HYZA 2VQ2A 3KAEA 3ZPJA 1E96B 1XNFA 1OUVA
chains in the Genus database with same CATH superfamily
1TNUA 4UUCA 3ML8A 2GRLA 5CCMA 4YDYA 3HVEB 2LO6A 4B0ZA 3G2TA 3ASFA 4QQIA 1H2UA 3SFXA 1TEZA 5AARA 4KMOA 2JLBA 5EKQD 4HQDA 1EF1C 1P5QA 1DNPA 2XQ0A 1GW6A 1OCZE 5HQ8A 2V5FA 2LSUA 1KT0A 3EHNA 5CEAA 3S7DA 3ASGA 4RG6A 4AY5A 1SZAA 5A23A 4HRNA 4OVVA 5BXUA 4XE0A 1N0RA 3TWQA 1OT8A 4C48B 1OWPA 3EDTB 2WPVA 4BX8A 3V30A 4N5CA 4FHJA 1S63A 3ASOE 3ZVVA 4A3TA 2EIJE 3FDHA 2KM4A 4HBDA 1SA4A 2VGXA 1BD8A 4LNBA 1N52A 3ZKJA 3ENEA 1ZU2A 4FJZA 2B0OE 1DCQA 4K5CA 5JJTA 4EBAA 3CHMA 1SVXA 5FINA 1NP7A 2Y0BG 3ESLA 2IONA 4PUCA 3U66A 2NYJA 4FJYA 4NQ0A 4BY6A 3OXLA 4A63B 4ZHBA 3HIZA 3NF1A 1H2VC 3ASNE 2DZOA 3FUHA 5B1AE 2H6FA 4NRHB 4GTRA 4EHMA 5KJMA 4XI0A 3TWRA 1TN8A 3OTNA 3CGHA 4I6EA 4O60A 5LCWC 4U0SA 3ULYA 2XPIA 2YNQA 2BUGA 3X2QE 1UW4B 5EILA 3S7FA 4BSZB 2AXZA 1FVFA 3C98A 3TG4A 4DI3A 3MZLB 4IULA 4JHRA 2HM8A 2DYRE 4ILIA 2IJGX 4BFRA 3MX3A 4LSZE 3HHMA 3KSLA 3WG7E 2OVFA 3CVXA 1HZ4A 5JHAA 3PUKA 3ABME 3LY7A 4FLBA 2ONDA 1KLXA 2C0MA 2GW1A 1HX8A 3QNKA 1FVHA 1O5MA 2IOSA 3FUNA 3MKQB 3D3MA 4G1TA 4AIFA 5C1DA 2UY1A 1IKND 5DIZA 3VTYA 2VSNA 4GA1A 4UI9K 4EBAG 5CHEE 1TYQG 3FTYA 2KCKA 4D10C 1JPLA 4U0ZA 2FI7A 4GPMA 3JCKC 2QFCA 1X5BA 1MJ0A 4HI8A 4GCNA 1TN7A 2ZXWE 4HXIA 1OCRE 4J8DA 3DRAA 2LXMA 4WNGA 5CCLA 4B89A 1EYHA 2L9BA 4G8KA 2FULA 3SF4A 2E0IA 4XX5A 3UUXA 3TWVA 2QYUA 2DWZA 4HLLA 3FULA 3TXMA 3FUKA 3TGOA 3ML9A 2OV8A 3R7QA 1H6PA 5CRVA 3SGHA 3EJNA 3UM3A 4NACA 3IHYA 1EDUA 2QY7A 3CVLA 1S0PA 3NZUA 3FU0A 4J7WA 2HR2A 4BT8A 1D8EA 3UX4A 3ZGQA 5FIOA 4AEZC 3ONLA 4C0MA 1UJJA 4GCOA 4N3BA 4ACKA 2CFZA 1PC2A 5BW8C 1HH8A 3ULQA 2C0LA 3FTSA 4BESA 4MRUA 4F1SA 5FQ6A 4YDEA 3LS8A 2DIWA 3UXGA 2OEWA 4M3OA 5G04J 1JUQA 2J4DA 1V54E 2R03A 3V2XA 3Q7AA 5FQ8A 2WMOA 3AS5A 3NOCD 5AN8A 1FT1A 4B8AA 1DCEA 3I4GA 3OXFA 1X81A 3RJVA 4Y6CA 2WB2A 2P9PG 2XENA 3MYVA 2NSZA 4JD2G 3HXEA 2BEDA 4G25A 2I2OA 3CHQA 4U8HA 2WXJA 3QK0A 2J49A 3FUDA 3FTZA 4A55A 2ETAA 2V4HC 2EIME 2X6KA 5C2YA 3RK6A 4GMRA 4MBGA 2J08A 1OWLA 3LVQE 4XKCA 3SBTB 3Q7FA 3ZHEA 4ZFHA 4O1OA 4DPRA 5JJ7A 1PAQA 1ELRA 2IF4A 2C2LA 1N94A 3I5PA 4DX7D 2FEZA 5AJLA 3L17A 2IFUA 4DX5D 2HYZA 5IY5E 3ZPJA 2GRPB 1XNFA 4ATGA 3VLEA 2MYOA 3SO8A 3CVUA 3LEWA 4MKTA 2J4BA 2VSYA 2WXNA 3DSVA 2VTBA 3FUMA 4UQZA 5D0QD 1IQRA 3ZN3A 5CMYA 3QWPA 4BERA 3CHOA 3D9OA 4EQFA 3RU0A 1OY3D 3FU3A 4KVMA 3RO3A 3S2AA 3FTWA 5G55A 3CHSA 4V3IA 3SFYA 2YHCA 2KBXA 3KSQA 2XS1A 4LNGA 3W9GA 3Q9UC 3QAQA 4AY6A 1IHBA 1JCQA 2R05A 1WG0A 3TJPA 1WAO1 3Q75A 3FEYA 2UY1B 2P2CP 5H7PA 2MRIA 2LAIA 2YQ8A 4F7AA 2WQHA 3FUFA 1TNBA 4BSXA 4H7XA 5CMWA 2DYSE 2KATA 2NXPA 1IHGA 1Z3XA 3TWUA 4OVUA 2KXPC 1TNZA 1LD7A 3IV0A 4LERA 2F8XK 4CDRA 4CEMA 3GZ1A 4TUUA 4DUIA 3RRUA 2RFMA 4DLQA 3TWSA 3D9NA 2KCVA 1JCSA 3UKUG 5AQ7A 3AG3E 4OAUC 1JCRA 2GRRB 2FBNA 4PH4B 4GTPA 3CK9A 3RIBA 1Z6TA 3LVRE 1QBQA 2RFAA 2IO2C 2CFUA 4PDXA 5KBAA 3L82A 4AVXA 4ME2A 3ZYMA 5KNHD 4KZ0A 3TWTA 5HI7A 2IU1A 3ZU7B 2F8YA 3E4BA 3V31A 3GW4A 2RKKA 3PNTB 3KD7A 4X8QA 4G23A 4G26A 5HRYA 4Q96A 2P9KG 3PZ2A 1TN6A 3FTXA 3EU5A 2VYIA 3Q15A 3B13A 5ANLA 4KZCA 4APOA 1BI7B 3PVLA 3LXUX 4U04A 2WXHA 3RSEG 4E85A 2R59A 3Q79A 2XRZA 1O1RA 3CKCA 4K5AB 4ILGA 4XZ4A 4JEHA 3E34A 3PUJA 3DSSA 3ASHA 1MX4A 4TXPA 3D9JA 3ZXSA 1HFAA 3W9FA 3CVNA 3QJZA 1A17A 4MS6A 1Z5SC 3S7BA 2DVWA 3LJNA 3SY2A 5LCWJ 4U95D 1N4SA 5D66A 3ZEFA 3PZDA 4GAAA 1L5JA 2R2LA 5HKPA 3J5QB 4FA6A 2ZISA 3QC1A 1N4QA 1HF8A 4WNEA 2BF0X 4PS8A 3AS4A 3DXMG 1QYMA 3CQGB 4GZCA 4L7TA 3FWVA 3T5XA 4KT6B 2AWIA 4XIFA 3ISMC 2CG3A 3IEGA 3N71A 3FY4A 2XRYA 2VGEA 4BX9A 3CSFA 4E6HA 4WAFA 2A5UA 3APCA 1N4PA 2VJ8A 5B1BE 5B3SE 3DEPA 1N11A 4JZYA 3G2WA 1D8DA 4F6RD 3SI5A 3DSTA 3B95A 3B7UX 4H7YA 4LG6A 3UMVA 2V0PA 1U3DA 3EHQA 4GTMA 3NB2A 2LSVA 1KZOA 3IHVA 3L13A 2CHXA 3LPZA 5CERB 4I9EA 2KZTA 3MEKA 2P9SG 3UTMA 3QOUA 1UJKA 4BETA 2X6JA 4YVQC 2WXMA 1O1SA 3DXKG 4Q69A 1OWOA 3WXXA 3NBNB 4U7EB 2L0IA 2P9IG 3FUJA 4UQXA 3TWXA 1LTXA 2BKGA 4B94A 3SZ7A 1H6KA 3UKRG 5EX0A 1WM5A 5G2NA 2XZDG 3FH7A 4R7LA 3U9WA 3T8KA 2X3MA 3UI2A 4CDNA 2I6HA 2AXVA 3JUIA 5ENTD 4P29A 5ENOD 4EPZA 4GZ6A 4HOUA 2XGSA 3AJIA 3RKVA 4FULA 4WWPA 4DK5A 3UM0A 4OYSA 3CIAA 4HFGA 3CEQA 1ZB1A 2Y69E 3DSUA 3B7BA 3D9PA 4FP7A 4ILHB 1RZ4A 3K9IA 3MCXA 2IEJA 4JPSA 4N3CA 1BLXB 2AVPA 2XEVA 3DSXA 4CDMA 1N54A 3B7SA 3EIQC 3C3RA 4CT4A 4EECA 4DLOA 2IOLA 3DEOA 3FH8A 3LJ3A 3ZNGA 3UINC 5BUZA 4J8YA 2UWJG 2VSOE 4ACLA 1HS6A 2FO1E 5M72A 3PREA 1VDYA 4N2SA 4Z68A 2L0TB 3E33A 1N9AA 3IBEA 4J0UA 4JA9A 3ZRHA 1MZCA 5BV0A 1K1AA 1YCSB 5LFAA 4GZDA 1MQSA 4GA2A 3RRMB 2I1JA 2WXLA 3LKUA 2EILE 3FUIA 2WM9A 2M63A 4GTQA 2FF4A 1SZ9A 3VLFA 3PRZA 3HVEA 4AM9A 4HOTA 3NZSA 1EPUA 4CCAA 3CR3A 2ETBA 4J6IA 2ILRA 2BTDA 3MGBA 5EYLA 2NC9A 4TRQA 2QZAA 2VGXB 4C9BB 3UT8A 1SW6A 2LUHA 4JHKA 3TWWA 4HB5A 2EINE 3AAAC 1E90A 3EU9A 5AQAA 1V55E 4EZKA 1JWFA 3HXBA 2VSXE 3MV3B 3FP3A 4YNDA 5J90A 2X6IA 1YMPA 3UQ3A 5EX3A 1NFIE 3CVPA 3ABKE 3D9KA 2GGFA 1U2VG 2OCCE 3FFLA 3BU8A 3U4TA 4YDWA 2WXQA 2XGOA 2PZIA 3L08A 5EIBE 4N3AA 4FHKA 3CKBA 1INZA 3RO2A 3SQVA 3DPDA 2MHKA 2JEKA 2Q7FA 3BG0B 5FWQA 3ZXPA 3U64A 1JWGA 4I6GA 1H0AA 4RSYA 4LNUD 5ITZF 4J8FA 3B7TA 1HE8A 3IKOB 2WXIA 2OEVA 4PS7A 3MKRA 3O48A 3Q49B 4I43A 4CZ2D 2WMNA 2XHEA 3CLJA 2XEHA 3R7RA 1U3CA 4BT9A 3B7RL 1NA0A 3FUEA 4TV3A 2J09A 2FO7A 2Y3AA 4LCTA 2L6JA 1TJCA 1NA3A 2P9LG 3AG4E 2DBAA 2GRNB 3C3QA 1D9SA 2HO1A 3AU4A 4GYOA 4RQIA 4F53A 4O1PA 4QFVA 4N39A 2P9UG 5DBKA 3ZYQA 2PNNA 3FTUA 4GZ5A 1NZNA 3T5VA 1AP7A 3OAWA 3R9AB 5ENQD 3R9MA 3APFA 1OXJA 1E7VA 1SQMA 3GZ2A 3LY9A 4W9RA 3C72A 2EIKE 3QWWA 5KCMA 4ATZD 3LYAA 3FEXA 4XEIG 4MLPA 3JXJA 1QNFA 5JA4D 3PEVB 1B89A 5HS0A 3FHEA 3UT4A 1SA5A 1NI1A 2CG2A 2V8SE 4ANUA 4K0RA 2H6HA 5EN5D 3JYSA 2ZIRA 4CGWA 2IQCA 4U96D 2JABA 3MKQA 4KVOA 4UI9C 3HRAA 5ENPD 4HOQA 4GTOA 4WNDA 1HXIA 5JMND 4K5BA 4Y6WA 3HYMB 4HI9A 2XS8A 3PDNA 3EHRA 4A1GA 3LDZA 2F37A 1QQEA 1DC2A 3KEZA 3L22A 4L23A 3CK7A 4EZJA 1N95A 3SD5A 4JEUA 2ZU6B 3DBSA 3F6QA 1Y8MA 4WWNA 5LX8A 3S7JA 5EYPF 4HRLA 4FU3A 4U07A 4ANVA 2V4LA 4A3VA 4JC8A 1UN8A 5CBOA 2LXLA 4JW1A 2YINA 3AS8A 5E75A 2E2EA 1OCCE 3PEUB 4GB9A 4F3VA 4KXKB 4AV7A 5FJYA 4RLYA 2QC9A 1HO8A 1E8WA 4UWHA 3HXDA 2H6GA 2XPZA 5CECB 1BPOA 1YA0A 3NQPA 1LF8A 3AU5A 4GPKA 4BTAA 4GTSA 5AJDA 2L6BA 2WXPA 3EIJA 3L54A 1E8ZA 1OCOE 2XGMA 3I4RB 3HXFA 2OVBA 1BU9A 1S64A 4CGVA 3ZHEB 3ZUVB 2CHWA 4UWGA 2AW6A 5A6CA 2PM7A 3CVYA 4TXQA 4HS2A 4AXHA 3FU6A 3CVWA 4HVBA 4CYMD 2GRQB 3EUVA 5EDSA 4M7CA 3AG1E 3ZYLA 4I6JA 4I2ZA 3G2SA 3TL5A 1E8XA 2GRMA 1IXVA 2EQXA 3UIOC 3QWVA 4LEUA 4CT0A 4CRWA 4AP2A 2R5SA 2VTBB 3HG0D 4FADA 5D2MC 4F1PA 4KBQA 4G24A 3JXIA 4HRMB 4GYYA 4GTVA 4UWKA 5FT9A 2VQ2A 3KAEA 2WQ6A 3JQ0A 3NOGD 4N5QA 2PQNA 5ENSD 3PZ1A 5D0OD 4A1SA 2VGYA 3FTVA 3TG5A 2J8SD 4GZ3A 2I1KA 5KJKA 3PE4A 3VLDA 3CV0A 4FC8A 2WXKA 2DZNA 3D9HA 5A7DB 2WXRA 3MV2B 3IXEA 3TAXA 3SFZA 5CBNA 3QKYA 5AQ9A 4PS3A 3V79K 1IQUA 1NL4A 2KC7A 1DVPA 5FQ4A 2LAHA 5KNGA 1Q2ZA 5FZSA 4EZLA 3MJWA 4I17A 3ZFWA 1Y6IA 1LD8A 4DI4A 2PL2A 1G3NB 4YVOA 1YYHA 4DX1A 4HORA 1OWNA 1ZBPA 3HXCA 3G2VA 5FTPA 5AYWD 3PE3A 4J8EA 1KT1A 2PQRA 3Q78A 5BNWA 3CQCB 4NURA 3D9IA 2I9CA 3Q5MA 3D9LA 4JVSA 5AIJA 4G2VA 1MX2A 4B93B 3LCAA 1TJFA 5ENRD 2R17C 5AAOA 1ELWA 3ONKA 3QDNA 4I1OB 3ASDA 5BXOA 5BT1A 4ANWA 4ANXA 1W3BA 1BI8B 3UM1A 3GYZA 2DCPA 4JB8P 2KCLA 4UWFA 1K1BA 4C0EA 3PH0C 5BV1A 4LUNU 4DX2A 4TXRA 1TNYA 2XZTG 3CVQA 5ARGA 3PS6A 3ZIMA 3VTXA 5AENA 5ARFA 4L1BA 3ZW3A 5FQ7A 5T4YA 5T8IA 2HE0A 3I3NA 1H2TC 1OWMA 3J5PA 3DPYA 4U63A 1ELKA 5CRUA 2ETCA 2X38A 3PZ4A 3E30A 3ULEG 1IYGA 2PM6A 1RW2A 5FZRA 4XI9A 4URKA 2J9QA 4BEPA 5JHBA 2XCBA 5BPPA 4L2LA 2OOEA 5FZQA 3SBSA 3UIPC 4J8SA 3HDXA 4HNAD 4K03A 3ABLE 1N4RA 3UPVA 2YHEA 4TUMA 2WVIA 2J07A 3CK8A 4I9CA 3AG2E 2WQ7A 3U3WA 1Z3YA 4JL0A 5AQBA 4DRXE 2IO3C 2AXUA 4I1AA 3CSTA 1N0QA 4N2QA 2ZGGA 4WNFA 5KJNA 3TXNA 3KEAA 3UM2A 3T9KA 3L6AA 3OXGA 1FPPA 3O4ZA 4KYOB 4U8VD 4IN3B 2MOWA 2X6FA 3BEEA 5KWDA 4JA7A 3P1UA 3PNLB 2ZGDA 4WWOA 2Y4UA 4UWLA 3DWLG 3SNXA 4IYPA 3C5RA 1S70B 2WXFA 4UQYA 4GU5A 3E37A 5G05J 1XGWA 3G2UA 2A5EA 3CHRA 2LNIA 3JQ1A 5KJLA 3D9MA 3APDA 2F0YA 2GROB 4IRUA 4B8CB 1E8YA 1KZPA 2WXGA 4YDOA 5T3RA 1AWCB 3FH5A 5G04C 2XPYA 4GA0A 4APFA 2KZTB 3V2OA 3EHMA 1MHQA 3DSWA 4WUYA 1H19A 3BG1B 4G11A 3BUAA 2R02A 1FCHA 4BTBA 2Y4TA 4GTTA 2X6HA 2H6IA 3RRNB 1UG3A 4U8YD 4L9PA 3ZYKA 4I1MA 4XKBA 2XCCA 1H6OA 3T8MA 4LRZA 1WDYA 4JHJA 4UI9J 4OAVB 3QB2A 4FLHA 4I2WA 4Q94A 4AOFA 2QYJA 2B6CA 5EIDA 4GMLA 1O1TA 5G05C 4ABNA 2BKKB 1A5EA 3CVVA 3LY8A 3NAWA 3URZA 2P58C 3CHPA 3C3OA 3FU5A 4DJAA 3GZSA 5E76A 2Y1LE 1PY1A 5J08A 2RD0A 2XEEA 2RG8A 3ESKA 2A4ZA 1MX6A 1HG5A 2P9NG 3Q47B 4JXTA 1WY6A 1K8KG 2WXOA 1MYOA 5LP0A 1HG2A 4GMJA 1QZ2A 4BWRA 2AJAA 3Q9NC 2IY0C 3UT7A 5ANRA 4O6FA 3PZ3A 1TR4A 3QARA 4U0UA 1FT2A 4L2YA 3SHFA 3E32A 5CEDB 4GYWA 4HLEA 4RG9A 3L16A 2CHZA 2V5QC 1HU3A 5JJ6A 4NIKA 4RVBA 1TNOA 3Q4AB 1UOHA 5LOZA 3MA5A 3Q73A 4DX6D 5ENNA 4HOSA 1E7UA 4G8LA 3P2BA 1UN9A 3RAUA 3JUEA 1K3ZD 1KPSB 3L9TA 4AJWA 3KS2A 3BQOA 1E96B 1OUVA
chains in the Genus database with same CATH topology
3PREA 3JQ0A 3CVUA 1VDYA 3ML8A 4N2SA 2GRLA 3LEWA 4MKTA 5CCMA 2L0TB 2J4BA 2VSYA 2WXNA 3IBEA 3HVEB 2LO6A 4J0UA 4B0ZA 2PQNA 3G2TA 4JA9A 3ASFA 2VTBA 3FUMA 4UQZA 3ZRHA 5D0QD 1IQRA 5BV0A 4A1SA 1H2UA 5D0OD 3ZN3A 2VGYA 5CMYA 3QWPA 1TEZA 5LFAA 4GZDA 1MQSA 3FTVA 4GA2A 3TG5A 4KMOA 3RRMB 2I1JA 2JLBA 2WXLA 3LKUA 4GZ3A 3CHOA 3D9OA 2I1KA 4EQFA 5KJKA 3PE4A 3VLDA 3CV0A 3FUIA 2WM9A 4FC8A 2WXKA 3RU0A 3FU3A 5A7DB 2M63A 4KVMA 5EKQD 1EF1C 2FF4A 1SZ9A 1P5QA 2WXRA 3RO3A 3S2AA 3MV2B 1DNPA 2XQ0A 3FTWA 3VLFA 3PRZA 5G55A 1GW6A 3CHSA 3TAXA 3HVEA 5HQ8A 3SFZA 4V3IA 4AM9A 2V5FA 4HOTA 3NZSA 3QKYA 2YHCA 1EPUA 4PS3A 2LSUA 4CCAA 1KT0A 1IQUA 3CR3A 3EHNA 2KC7A 1DVPA 4J6IA 5FQ4A 2ILRA 2LAHA 3S7DA 3ASGA 3QAQA 2BTDA 3MGBA 5FZSA 3MJWA 4I17A 4RG6A 2NC9A 3ZFWA 1SZAA 4AY5A 1Y6IA 5A23A 4DI4A 2PL2A 4OVVA 4TRQA 3TJPA 4YVOA 2VGXB 4C9BB 3UT8A 1WAO1 4XE0A 4JHKA 4HORA 1OWNA 3FEYA 1ZBPA 2UY1B 2MRIA 2LAIA 1OWPA 2YQ8A 4F7AA 2WQHA 3G2VA 3EDTB 3FUFA 2WPVA 5FTPA 5AYWD 4BX8A 3PE3A 4N5CA 1E90A 4BSXA 4FHJA 4J8EA 4H7XA 4EZKA 1JWFA 3ZVVA 1KT1A 4A3TA 2VSXE 3MV3B 5CMWA 2PQRA 5BNWA 3FDHA 3CQCB 2KATA 2NXPA 3D9IA 3FP3A 1IHGA 2KM4A 4NURA 1Z3XA 4YNDA 2I9CA 3Q5MA 3D9LA 4JVSA 5J90A 5AIJA 4G2VA 4OVUA 2VGXA 2X6IA 3IV0A 3LCAA 1TJFA 3UQ3A 4LERA 5EX3A 2R17C 4CDRA 4CEMA 1N52A 3GZ1A 4TUUA 1ELWA 3ONKA 3ENEA 3CVPA 3QDNA 1ZU2A 4FJZA 3D9KA 2GGFA 4I1OB 3RRUA 4DLQA 3ASDA 3D9NA 2KCVA 4EBAA 3FFLA 5JJTA 5BT1A 3CHMA 4ANWA 3U4TA 4ANXA 1W3BA 2WXQA 3GYZA 1NP7A 2XGOA 2PZIA 3L08A 3ESLA 2IONA 4PUCA 2DCPA 4N3AA 3U66A 4FJYA 2KCLA 4UWFA 4NQ0A 4C0EA 3PH0C 2FBNA 4PH4B 4BY6A 3CK9A 4FHKA 3RIBA 5BV1A 3CKBA 3OXLA 1INZA 1Z6TA 3RO2A 4LUNU 3LVRE 3HIZA 3NF1A 3DPDA 2CFUA 2JEKA 2MHKA 2Q7FA 3BG0B 3CVQA 4PDXA 5ARGA 1H2VC 5FWQA 4AVXA 4ME2A 3U64A 3ZYMA 3FUHA 1JWGA 3PS6A 4I6GA 1H0AA 4NRHB 4RSYA 3ZIMA 4KZ0A 5HI7A 2IU1A 3VTXA 5KJMA 5AENA 4J8FA 5ARFA 4L1BA 3B7TA 3ZW3A 4XI0A 1HE8A 3IKOB 3OTNA 3E4BA 2WXIA 3CGHA 5FQ7A 5T4YA 5T8IA 3GW4A 3I3NA 4I6EA 4PS7A 3MKRA 1H2TC 3PNTB 1OWMA 3KD7A 5LCWC 4U0SA 2XPIA 3O48A 2YNQA 3Q49B 2BUGA 4I43A 4U63A 4G23A 1ELKA 1UW4B 4G26A 2WMNA 2XHEA 3CLJA 4Q96A 3R7RA 1U3CA 3S7FA 4BT9A 2X38A 3B7RL 1NA0A 2AXZA 3FUEA 1FVFA 4TV3A 2J09A 3FTXA 2FO7A 2VYIA 3Q15A 2Y3AA 1IYGA 2PM6A 3B13A 4LCTA 5ANLA 2L6JA 5FZRA 3C98A 1TJCA 1NA3A 4KZCA 4APOA 3PVLA 3TG4A 3LXUX 4U04A 4XI9A 2WXHA 4E85A 4URKA 4DI3A 2DBAA 2R59A 3MZLB 2J9QA 4IULA 5JHBA 4JHRA 2XRZA 2HM8A 2XCBA 2HO1A 5BPPA 4L2LA 2OOEA 5FZQA 3SBSA 3AU4A 4GYOA 3CKCA 4ILIA 4F53A 2IJGX 4J8SA 3HDXA 4ILGA 4K03A 4QFVA 4N39A 4JEHA 4XZ4A 4BFRA 3MX3A 5DBKA 3UPVA 2YHEA 3ZYQA 3FTUA 4GZ5A 1NZNA 2WVIA 2J07A 3T5VA 3CK8A 4I9CA 3PUJA 2WQ7A 3HHMA 3U3WA 2OVFA 3CVXA 3OAWA 1HZ4A 1Z3YA 3ASHA 4JL0A 5JHAA 3PUKA 3R9AB 3D9JA 3LY7A 3ZXSA 1HFAA 2AXUA 4FLBA 2ONDA 4I1AA 3CVNA 3CSTA 3QJZA 1A17A 1KLXA 4MS6A 2C0MA 4N2QA 3APFA 2GW1A 4WNFA 1E7VA 1HX8A 1SQMA 5KJNA 3GZ2A 3LY9A 3QNKA 3TXNA 1FVHA 3S7BA 4W9RA 3QWWA 5KCMA 5LCWJ 2IOSA 3ZEFA 3PZDA 3LYAA 3FEXA 3FUNA 3MKQB 4GAAA 1L5JA 3D3MA 4MLPA 1QNFA 3L6AA 4G1TA 3OXGA 4AIFA 3PEVB 5C1DA 1B89A 3O4ZA 2UY1A 3FHEA 4FA6A 4KYOB 5DIZA 3VTYA 2VSNA 4GA1A 4IN3B 4UI9K 3QC1A 3UT4A 4EBAG 1HF8A 2CG2A 2MOWA 4WNEA 2V8SE 2BF0X 4ANUA 4PS8A 2X6FA 3BEEA 4K0RA 5CHEE 3AS4A 3P1UA 3FTYA 2KCKA 3CQGB 3PNLB 4JA7A 4D10C 3JYSA 4WWOA 1JPLA 2Y4UA 4UWLA 4U0ZA 4GZCA 2FI7A 4L7TA 3FWVA 4CGWA 4EZLA 2IQCA 3SNXA 3JCKC 3T5XA 2QFCA 4KT6B 1X5BA 2AWIA 4XIFA 2CG3A 4IYPA 3MKQA 2WXFA 4UQYA 4GCNA 4KVOA 4UI9C 3IEGA 3N71A 3FY4A 4GU5A 5G05J 1XGWA 2XRYA 4HOQA 3G2UA 4BX9A 3CSFA 3CHRA 4E6HA 2LNIA 4WAFA 2A5UA 4HXIA 4WNDA 3JQ1A 3APCA 4J8DA 2VJ8A 1HXIA 5KJLA 3D9MA 4Y6WA 3HYMB 4JZYA 4WNGA 5CCLA 3APDA 3G2WA 4B8CB 4IRUA 4B89A 3PDNA 1EYHA 3SI5A 1E8YA 4A1GA 2L9BA 3LDZA 2WXGA 5T3RA 2FULA 3FH5A 5G04C 1QQEA 2XPYA 4GA0A 4APFA 2KZTB 3SF4A 3KEZA 2E0IA 3B7UX 4H7YA 3L22A 4XX5A 3UUXA 3EHMA 1MHQA 3UMVA 4WUYA 2V0PA 1U3DA 3CK7A 4L23A 1H19A 3FULA 3TXMA 3FUKA 4EZJA 3TGOA 3BG1B 3ML9A 4G11A 3SD5A 2OV8A 4JEUA 1FCHA 4BTBA 2Y4TA 3R7QA 2LSVA 2X6HA 3RRNB 3IHVA 2ZU6B 3DBSA 1UG3A 1Y8MA 3L13A 2CHXA 3LPZA 4WWNA 3SGHA 3EJNA 3ZYKA 5LX8A 4I1MA 4XKBA 3S7JA 4NACA 2XCCA 4I9EA 3IHYA 1EDUA 2QY7A 3CVLA 2KZTA 1S0PA 3MEKA 3T8MA 3NZUA 4LRZA 4FU3A 4U07A 3FU0A 2V4LA 2HR2A 4ANVA 4JHJA 3QOUA 4BT8A 3UX4A 1UJKA 4UI9J 3ZGQA 2X6JA 4YVQC 4JC8A 4A3VA 1UN8A 4AEZC 3QB2A 2WXMA 4FLHA 3ONLA 4I2WA 4JW1A 4Q94A 4C0MA 1UJJA 4GCOA 4Q69A 1OWOA 2YINA 4AOFA 4N3BA 3WXXA 4ACKA 2CFZA 3AS8A 5E75A 2E2EA 1PC2A 5BW8C 3PEUB 4GB9A 4F3VA 1HH8A 4GMLA 2L0IA 2C0LA 3FTSA 4KXKB 3ULQA 4AV7A 5FJYA 4MRUA 5G05C 3FUJA 4UQXA 4F1SA 5FQ6A 4ABNA 1HO8A 1E8WA 4UWHA 3CVVA 3LY8A 4B94A 3LS8A 3SZ7A 3URZA 2DIWA 2XPZA 4M3OA 1H6KA 2P58C 5G04J 1JUQA 2J4DA 1BPOA 5EX0A 1WM5A 3CHPA 5G2NA 3FU5A 4DJAA 5FQ8A 2WMOA 3AS5A 3GZSA 5E76A 3FH7A 1PY1A 4R7LA 5J08A 1YA0A 3U9WA 2RD0A 4B8AA 2RG8A 3NQPA 3ESKA 2X3MA 1LF8A 4CDNA 3AU5A 2A4ZA 4GPKA 3I4GA 3OXFA 1HG5A 2I6HA 3Q47B 4BTAA 2AXVA 4JXTA 5AJDA 3RJVA 3JUIA 1WY6A 2WXPA 4P29A 2WXOA 3EIJA 3L54A 4Y6CA 2WB2A 1E8ZA 5LP0A 1HG2A 2XGMA 3MYVA 4GMJA 1QZ2A 4BWRA 4EPZA 3I4RB 4GZ6A 4HOUA 2NSZA 2OVBA 2XGSA 4CGVA 3RKVA 4G25A 3ZHEB 3UT7A 4FULA 2I2OA 3CHQA 4U8HA 2CHWA 2WXJA 3QK0A 4UWGA 4WWPA 2J49A 4DK5A 4AY6A 5ANRA 4OYSA 4O6FA 2AW6A 3CIAA 5A6CA 3FUDA 4HFGA 3FTZA 3QARA 4U0UA 2PM7A 3CVYA 3CEQA 4A55A 4L2YA 3SHFA 4HS2A 4AXHA 3FU6A 3CVWA 4HVBA 3D9PA 4FP7A 5EDSA 4GYWA 2X6KA 4ILHB 5C2YA 3RK6A 4HLEA 4RG9A 3L16A 2CHZA 3K9IA 1HU3A 2J08A 3MCXA 3ZYLA 1OWLA 5JJ6A 4I6JA 4JPSA 4N3CA 3LVQE 4XKCA 4I2ZA 3SBTB 4RVBA 2AVPA 3G2SA 3ZHEA 3TL5A 1E8XA 3Q4AB 2GRMA 5LOZA 2XEVA 3MA5A 2EQXA 4CDMA 1N54A 3B7SA 3EIQC 4CT4A 3QWVA 4LEUA 4DPRA 4DLOA 5ENNA 4EECA 4CT0A 2IOLA 5JJ7A 4HOSA 4CRWA 4AP2A 3FH8A 1PAQA 3LJ3A 2R5SA 5BUZA 2VTBB 1ELRA 1E7UA 4FADA 2IF4A 2C2LA 2UWJG 2VSOE 3P2BA 4G24A 4KBQA 3I5PA 1UN9A 2FEZA 4ACLA 4GYYA 3L17A 5AJLA 1HS6A 4UWKA 2IFUA 4AJWA 5M72A 5FT9A 3KS2A 2HYZA 2VQ2A 3KAEA 3ZPJA 2WQ6A 1E96B 1XNFA 4ATGA 1OUVA 3VLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N2S A;  5CCM A;  2VSY A;  4J0U A;  2PQN A;  4JA9 A;  3ASF A;  4UQZ A;  5D0Q D;  4A1S A;  3ZN3 A;  5D0O D;  2VGY A;  3QWP A;  4GA2 A;  3TG5 A;  2JLB A;  3LKU A;  4GZ3 A;  4EQF A;  5KJK A;  3PE4 A;  3CV0 A;  3RU0 A;  5A7D B;  5EKQ D;  2FF4 A;  3RO3 A;  1P5Q A;  3MV2 B;  3TAX A;  5HQ8 A;  4AM9 A;  2V5F A;  4HOT A;  3QKY A;  2YHC A;  2LSU A;  1KT0 A;  2KC7 A;  3S7D A;  3ASG A;  5FZS A;  4AY6 A;  4AY5 A;  4RG6 A;  4I17 A;  2NC9 A;  3ZFW A;  2PL2 A;  4YVO A;  2VGX B;  1WAO 1;  4HOR A;  1ZBP A;  2UY1 B;  2YQ8 A;  2WQH A;  3EDT B;  2WPV A;  5FTP A;  5AYW D;  3PE3 A;  4N5C A;  4J8E A;  4H7X A;  1KT1 A;  3MV3 B;  2PQR A;  5BNW A;  3FP3 A;  2KAT A;  1IHG A;  4YND A;  3Q5M A;  4G2V A;  2VGX A;  3LCA A;  3UQ3 A;  5EX3 A;  4CDR A;  3GZ1 A;  1ELW A;  3CVP A;  3QDN A;  1ZU2 A;  3ASD A;  2KCV A;  5JJT A;  3FFL A;  5BT1 A;  3U4T A;  1W3B A;  3GYZ A;  2XGO A;  2PZI A;  4N3A A;  2KCL A;  4NQ0 A;  2FBN A;  3CK9 A;  3RIB A;  3CKB A;  3OXL A;  3RO2 A;  3NF1 A;  2MHK A;  2Q7F A;  3CVQ A;  5ARG A;  4ME2 A;  4NRH B;  5HI7 A;  3VTX A;  5KJM A;  4J8F A;  5ARF A;  4XI0 A;  3E4B A;  3GW4 A;  3MKR A;  3KD7 A;  5LCW C;  4U0S A;  2XPI A;  3O48 A;  3Q49 B;  2BUG A;  4G23 A;  4G26 A;  3S7F A;  4BT9 A;  1NA0 A;  2FO7 A;  2VYI A;  3Q15 A;  1IYG A;  5FZR A;  2L6J A;  1TJC A;  1NA3 A;  4APO A;  3TG4 A;  4XI9 A;  4U04 A;  2DBA A;  2J9Q A;  4JHR A;  2XCB A;  2HO1 A;  2OOE A;  5FZQ A;  4GYO A;  3CKC A;  4N39 A;  5DBK A;  3UPV A;  4GZ5 A;  1NZN A;  3CK8 A;  4I9C A;  3U3W A;  1HZ4 A;  3ASH A;  4JL0 A;  3R9A B;  3LY7 A;  2OND A;  4I1A A;  3CVN A;  1A17 A;  1KLX A;  2C0M A;  4N2Q A;  2GW1 A;  4WNF A;  5KJN A;  3GZ2 A;  3LY9 A;  3S7B A;  4W9R A;  3QWW A;  5LCW J;  3LYA A;  4G1T A;  3OXG A;  4AIF A;  5C1D A;  1B89 A;  2UY1 A;  4KYO B;  5DIZ A;  3VTY A;  2VSN A;  4GA1 A;  4IN3 B;  4UI9 K;  4WNE A;  3BEE A;  5CHE E;  3AS4 A;  4JA7 A;  2KCK A;  3JYS A;  2Y4U A;  4U0Z A;  2FI7 A;  3FWV A;  4CGW A;  2QFC A;  4XIF A;  4UQY A;  4GCN A;  4UI9 C;  3IEG A;  3N71 A;  5G05 J;  4HOQ A;  2LNI A;  4WND A;  4J8D A;  1HXI A;  5KJL A;  4Y6W A;  3HYM B;  4WNG A;  5CCL A;  3PDN A;  5G04 C;  1QQE A;  4GA0 A;  3SF4 A;  4H7Y A;  3UUX A;  4WUY A;  3CK7 A;  3TGO A;  1FCH A;  4BTB A;  2Y4T A;  2LSV A;  1Y8M A;  3LPZ A;  3S7J A;  2XCC A;  4I9E A;  3CVL A;  3MEK A;  4U07 A;  2HR2 A;  4BT8 A;  3QOU A;  4UI9 J;  3ZGQ A;  4YVQ C;  4I2W A;  4GCO A;  4N3B A;  3WXX A;  3AS8 A;  2E2E A;  1PC2 A;  5BW8 C;  4F3V A;  1HH8 A;  4KXK B;  3ULQ A;  2C0L A;  5FJY A;  5G05 C;  4UQX A;  4ABN A;  3LY8 A;  4B94 A;  3SZ7 A;  3URZ A;  2P58 C;  5G04 J;  5EX0 A;  1WM5 A;  3AS5 A;  1YA0 A;  3ESK A;  4GPK A;  3OXF A;  2I6H A;  3Q47 B;  4BTA A;  3RJV A;  4Y6C A;  2XGM A;  1QZ2 A;  4BWR A;  4GZ6 A;  4HOU A;  2XGS A;  4CGV A;  3RKV A;  4G25 A;  3ZHE B;  4O6F A;  5A6C A;  4U0U A;  3CEQ A;  4GYW A;  4RG9 A;  3K9I A;  5JJ6 A;  4N3C A;  4I2Z A;  2AVP A;  3ZHE A;  3Q4A B;  2XEV A;  3MA5 A;  3QWV A;  4LEU A;  4HOS A;  5JJ7 A;  2R5S A;  1ELR A;  2IF4 A;  2C2L A;  2UWJ G;  4KBQ A;  4G24 A;  2FEZ A;  4GYY A;  2IFU A;  5M72 A;  5FT9 A;  3KS2 A;  2HYZ A;  2VQ2 A;  3KAE A;  3ZPJ A;  1E96 B;  1XNF A;  1OUV A; 
#chains in the Genus database with same CATH topology
 1TNU A;  4UUC A;  3ML8 A;  2GRL A;  5CCM A;  4YDY A;  3HVE B;  2LO6 A;  4B0Z A;  3G2T A;  3ASF A;  4QQI A;  1H2U A;  3SFX A;  1TEZ A;  5AAR A;  4KMO A;  2JLB A;  5EKQ D;  4HQD A;  1EF1 C;  1P5Q A;  1DNP A;  2XQ0 A;  1GW6 A;  1OCZ E;  5HQ8 A;  2V5F A;  2LSU A;  1KT0 A;  3EHN A;  5CEA A;  3S7D A;  3ASG A;  4RG6 A;  4AY5 A;  1SZA A;  5A23 A;  4HRN A;  4OVV A;  5BXU A;  4XE0 A;  1N0R A;  3TWQ A;  1OT8 A;  4C48 B;  1OWP A;  3EDT B;  2WPV A;  4BX8 A;  3V30 A;  4N5C A;  4FHJ A;  1S63 A;  3ASO E;  3ZVV A;  4A3T A;  2EIJ E;  3FDH A;  2KM4 A;  4HBD A;  1SA4 A;  2VGX A;  1BD8 A;  4LNB A;  1N52 A;  3ZKJ A;  3ENE A;  1ZU2 A;  4FJZ A;  2B0O E;  1DCQ A;  4K5C A;  5JJT A;  4EBA A;  3CHM A;  1SVX A;  5FIN A;  1NP7 A;  2Y0B G;  3ESL A;  2ION A;  4PUC A;  3U66 A;  2NYJ A;  4FJY A;  4NQ0 A;  4BY6 A;  3OXL A;  4A63 B;  4ZHB A;  3HIZ A;  3NF1 A;  1H2V C;  3ASN E;  2DZO A;  3FUH A;  5B1A E;  2H6F A;  4NRH B;  4GTR A;  4EHM A;  5KJM A;  4XI0 A;  3TWR A;  1TN8 A;  3OTN A;  3CGH A;  4I6E A;  4O60 A;  5LCW C;  4U0S A;  3ULY A;  2XPI A;  2YNQ A;  2BUG A;  3X2Q E;  1UW4 B;  5EIL A;  3S7F A;  4BSZ B;  2AXZ A;  1FVF A;  3C98 A;  3TG4 A;  4DI3 A;  3MZL B;  4IUL A;  4JHR A;  2HM8 A;  2DYR E;  4ILI A;  2IJG X;  4BFR A;  3MX3 A;  4LSZ E;  3HHM A;  3KSL A;  3WG7 E;  2OVF A;  3CVX A;  1HZ4 A;  5JHA A;  3PUK A;  3ABM E;  3LY7 A;  4FLB A;  2OND A;  1KLX A;  2C0M A;  2GW1 A;  1HX8 A;  3QNK A;  1FVH A;  1O5M A;  2IOS A;  3FUN A;  3MKQ B;  3D3M A;  4G1T A;  4AIF A;  5C1D A;  2UY1 A;  1IKN D;  5DIZ A;  3VTY A;  2VSN A;  4GA1 A;  4UI9 K;  4EBA G;  5CHE E;  1TYQ G;  3FTY A;  2KCK A;  4D10 C;  1JPL A;  4U0Z A;  2FI7 A;  4GPM A;  3JCK C;  2QFC A;  1X5B A;  1MJ0 A;  4HI8 A;  4GCN A;  1TN7 A;  2ZXW E;  4HXI A;  1OCR E;  4J8D A;  3DRA A;  2LXM A;  4WNG A;  5CCL A;  4B89 A;  1EYH A;  2L9B A;  4G8K A;  2FUL A;  3SF4 A;  2E0I A;  4XX5 A;  3UUX A;  3TWV A;  2QYU A;  2DWZ A;  4HLL A;  3FUL A;  3TXM A;  3FUK A;  3TGO A;  3ML9 A;  2OV8 A;  3R7Q A;  1H6P A;  5CRV A;  3SGH A;  3EJN A;  3UM3 A;  4NAC A;  3IHY A;  1EDU A;  2QY7 A;  3CVL A;  1S0P A;  3NZU A;  3FU0 A;  4J7W A;  2HR2 A;  4BT8 A;  1D8E A;  3UX4 A;  3ZGQ A;  5FIO A;  4AEZ C;  3ONL A;  4C0M A;  1UJJ A;  4GCO A;  4N3B A;  4ACK A;  2CFZ A;  1PC2 A;  5BW8 C;  1HH8 A;  3ULQ A;  2C0L A;  3FTS A;  4BES A;  4MRU A;  4F1S A;  5FQ6 A;  4YDE A;  3LS8 A;  2DIW A;  3UXG A;  2OEW A;  4M3O A;  5G04 J;  1JUQ A;  2J4D A;  1V54 E;  2R03 A;  3V2X A;  3Q7A A;  5FQ8 A;  2WMO A;  3AS5 A;  3NOC D;  5AN8 A;  1FT1 A;  4B8A A;  1DCE A;  3I4G A;  3OXF A;  1X81 A;  3RJV A;  4Y6C A;  2WB2 A;  2P9P G;  2XEN A;  3MYV A;  2NSZ A;  4JD2 G;  3HXE A;  2BED A;  4G25 A;  2I2O A;  3CHQ A;  4U8H A;  2WXJ A;  3QK0 A;  2J49 A;  3FUD A;  3FTZ A;  4A55 A;  2ETA A;  2V4H C;  2EIM E;  2X6K A;  5C2Y A;  3RK6 A;  4GMR A;  4MBG A;  2J08 A;  1OWL A;  3LVQ E;  4XKC A;  3SBT B;  3Q7F A;  3ZHE A;  4ZFH A;  4O1O A;  4DPR A;  5JJ7 A;  1PAQ A;  1ELR A;  2IF4 A;  2C2L A;  1N94 A;  3I5P A;  4DX7 D;  2FEZ A;  5AJL A;  3L17 A;  2IFU A;  4DX5 D;  2HYZ A;  5IY5 E;  3ZPJ A;  2GRP B;  1XNF A;  4ATG A;  3VLE A;  2MYO A;  3SO8 A;  3CVU A;  3LEW A;  4MKT A;  2J4B A;  2VSY A;  2WXN A;  3DSV A;  2VTB A;  3FUM A;  4UQZ A;  5D0Q D;  1IQR A;  3ZN3 A;  5CMY A;  3QWP A;  4BER A;  3CHO A;  3D9O A;  4EQF A;  3RU0 A;  1OY3 D;  3FU3 A;  4KVM A;  3RO3 A;  3S2A A;  3FTW A;  5G55 A;  3CHS A;  4V3I A;  3SFY A;  2YHC A;  2KBX A;  3KSQ A;  2XS1 A;  4LNG A;  3W9G A;  3Q9U C;  3QAQ A;  4AY6 A;  1IHB A;  1JCQ A;  2R05 A;  1WG0 A;  3TJP A;  1WAO 1;  3Q75 A;  3FEY A;  2UY1 B;  2P2C P;  5H7P A;  2MRI A;  2LAI A;  2YQ8 A;  4F7A A;  2WQH A;  3FUF A;  1TNB A;  4BSX A;  4H7X A;  5CMW A;  2DYS E;  2KAT A;  2NXP A;  1IHG A;  1Z3X A;  3TWU A;  4OVU A;  2KXP C;  1TNZ A;  1LD7 A;  3IV0 A;  4LER A;  2F8X K;  4CDR A;  4CEM A;  3GZ1 A;  4TUU A;  4DUI A;  3RRU A;  2RFM A;  4DLQ A;  3TWS A;  3D9N A;  2KCV A;  1JCS A;  3UKU G;  5AQ7 A;  3AG3 E;  4OAU C;  1JCR A;  2GRR B;  2FBN A;  4PH4 B;  4GTP A;  3CK9 A;  3RIB A;  1Z6T A;  3LVR E;  1QBQ A;  2RFA A;  2IO2 C;  2CFU A;  4PDX A;  5KBA A;  3L82 A;  4AVX A;  4ME2 A;  3ZYM A;  5KNH D;  4KZ0 A;  3TWT A;  5HI7 A;  2IU1 A;  3ZU7 B;  2F8Y A;  3E4B A;  3V31 A;  3GW4 A;  2RKK A;  3PNT B;  3KD7 A;  4X8Q A;  4G23 A;  4G26 A;  5HRY A;  4Q96 A;  2P9K G;  3PZ2 A;  1TN6 A;  3FTX A;  3EU5 A;  2VYI A;  3Q15 A;  3B13 A;  5ANL A;  4KZC A;  4APO A;  1BI7 B;  3PVL A;  3LXU X;  4U04 A;  2WXH A;  3RSE G;  4E85 A;  2R59 A;  3Q79 A;  2XRZ A;  1O1R A;  3CKC A;  4K5A B;  4ILG A;  4XZ4 A;  4JEH A;  3E34 A;  3PUJ A;  3DSS A;  3ASH A;  1MX4 A;  4TXP A;  3D9J A;  3ZXS A;  1HFA A;  3W9F A;  3CVN A;  3QJZ A;  1A17 A;  4MS6 A;  1Z5S C;  3S7B A;  2DVW A;  3LJN A;  3SY2 A;  5LCW J;  4U95 D;  1N4S A;  5D66 A;  3ZEF A;  3PZD A;  4GAA A;  1L5J A;  2R2L A;  5HKP A;  3J5Q B;  4FA6 A;  2ZIS A;  3QC1 A;  1N4Q A;  1HF8 A;  4WNE A;  2BF0 X;  4PS8 A;  3AS4 A;  3DXM G;  1QYM A;  3CQG B;  4GZC A;  4L7T A;  3FWV A;  3T5X A;  4KT6 B;  2AWI A;  4XIF A;  3ISM C;  2CG3 A;  3IEG A;  3N71 A;  3FY4 A;  2XRY A;  2VGE A;  4BX9 A;  3CSF A;  4E6H A;  4WAF A;  2A5U A;  3APC A;  1N4P A;  2VJ8 A;  5B1B E;  5B3S E;  3DEP A;  1N11 A;  4JZY A;  3G2W A;  1D8D A;  4F6R D;  3SI5 A;  3DST A;  3B95 A;  3B7U X;  4H7Y A;  4LG6 A;  3UMV A;  2V0P A;  1U3D A;  3EHQ A;  4GTM A;  3NB2 A;  2LSV A;  1KZO A;  3IHV A;  3L13 A;  2CHX A;  3LPZ A;  5CER B;  4I9E A;  2KZT A;  3MEK A;  2P9S G;  3UTM A;  3QOU A;  1UJK A;  4BET A;  2X6J A;  4YVQ C;  2WXM A;  1O1S A;  3DXK G;  4Q69 A;  1OWO A;  3WXX A;  3NBN B;  4U7E B;  2L0I A;  2P9I G;  3FUJ A;  4UQX A;  3TWX A;  1LTX A;  2BKG A;  4B94 A;  3SZ7 A;  1H6K A;  3UKR G;  5EX0 A;  1WM5 A;  5G2N A;  2XZD G;  3FH7 A;  4R7L A;  3U9W A;  3T8K A;  2X3M A;  3UI2 A;  4CDN A;  2I6H A;  2AXV A;  3JUI A;  5ENT D;  4P29 A;  5ENO D;  4EPZ A;  4GZ6 A;  4HOU A;  2XGS A;  3AJI A;  3RKV A;  4FUL A;  4WWP A;  4DK5 A;  3UM0 A;  4OYS A;  3CIA A;  4HFG A;  3CEQ A;  1ZB1 A;  2Y69 E;  3DSU A;  3B7B A;  3D9P A;  4FP7 A;  4ILH B;  1RZ4 A;  3K9I A;  3MCX A;  2IEJ A;  4JPS A;  4N3C A;  1BLX B;  2AVP A;  2XEV A;  3DSX A;  4CDM A;  1N54 A;  3B7S A;  3EIQ C;  3C3R A;  4CT4 A;  4EEC A;  4DLO A;  2IOL A;  3DEO A;  3FH8 A;  3LJ3 A;  3ZNG A;  3UIN C;  5BUZ A;  4J8Y A;  2UWJ G;  2VSO E;  4ACL A;  1HS6 A;  2FO1 E;  5M72 A;  3PRE A;  1VDY A;  4N2S A;  4Z68 A;  2L0T B;  3E33 A;  1N9A A;  3IBE A;  4J0U A;  4JA9 A;  3ZRH A;  1MZC A;  5BV0 A;  1K1A A;  1YCS B;  5LFA A;  4GZD A;  1MQS A;  4GA2 A;  3RRM B;  2I1J A;  2WXL A;  3LKU A;  2EIL E;  3FUI A;  2WM9 A;  2M63 A;  4GTQ A;  2FF4 A;  1SZ9 A;  3VLF A;  3PRZ A;  3HVE A;  4AM9 A;  4HOT A;  3NZS A;  1EPU A;  4CCA A;  3CR3 A;  2ETB A;  4J6I A;  2ILR A;  2BTD A;  3MGB A;  5EYL A;  2NC9 A;  4TRQ A;  2QZA A;  2VGX B;  4C9B B;  3UT8 A;  1SW6 A;  2LUH A;  4JHK A;  3TWW A;  4HB5 A;  2EIN E;  3AAA C;  1E90 A;  3EU9 A;  5AQA A;  1V55 E;  4EZK A;  1JWF A;  3HXB A;  2VSX E;  3MV3 B;  3FP3 A;  4YND A;  5J90 A;  2X6I A;  1YMP A;  3UQ3 A;  5EX3 A;  1NFI E;  3CVP A;  3ABK E;  3D9K A;  2GGF A;  1U2V G;  2OCC E;  3FFL A;  3BU8 A;  3U4T A;  4YDW A;  2WXQ A;  2XGO A;  2PZI A;  3L08 A;  5EIB E;  4N3A A;  4FHK A;  3CKB A;  1INZ A;  3RO2 A;  3SQV A;  3DPD A;  2MHK A;  2JEK A;  2Q7F A;  3BG0 B;  5FWQ A;  3ZXP A;  3U64 A;  1JWG A;  4I6G A;  1H0A A;  4RSY A;  4LNU D;  5ITZ F;  4J8F A;  3B7T A;  1HE8 A;  3IKO B;  2WXI A;  2OEV A;  4PS7 A;  3MKR A;  3O48 A;  3Q49 B;  4I43 A;  4CZ2 D;  2WMN A;  2XHE A;  3CLJ A;  2XEH A;  3R7R A;  1U3C A;  4BT9 A;  3B7R L;  1NA0 A;  3FUE A;  4TV3 A;  2J09 A;  2FO7 A;  2Y3A A;  4LCT A;  2L6J A;  1TJC A;  1NA3 A;  2P9L G;  3AG4 E;  2DBA A;  2GRN B;  3C3Q A;  1D9S A;  2HO1 A;  3AU4 A;  4GYO A;  4RQI A;  4F53 A;  4O1P A;  4QFV A;  4N39 A;  2P9U G;  5DBK A;  3ZYQ A;  2PNN A;  3FTU A;  4GZ5 A;  1NZN A;  3T5V A;  1AP7 A;  3OAW A;  3R9A B;  5ENQ D;  3R9M A;  3APF A;  1OXJ A;  1E7V A;  1SQM A;  3GZ2 A;  3LY9 A;  4W9R A;  3C72 A;  2EIK E;  3QWW A;  5KCM A;  4ATZ D;  3LYA A;  3FEX A;  4XEI G;  4MLP A;  3JXJ A;  1QNF A;  5JA4 D;  3PEV B;  1B89 A;  5HS0 A;  3FHE A;  3UT4 A;  1SA5 A;  1NI1 A;  2CG2 A;  2V8S E;  4ANU A;  4K0R A;  2H6H A;  5EN5 D;  3JYS A;  2ZIR A;  4CGW A;  2IQC A;  4U96 D;  2JAB A;  3MKQ A;  4KVO A;  4UI9 C;  3HRA A;  5ENP D;  4HOQ A;  4GTO A;  4WND A;  1HXI A;  5JMN D;  4K5B A;  4Y6W A;  3HYM B;  4HI9 A;  2XS8 A;  3PDN A;  3EHR A;  4A1G A;  3LDZ A;  2F37 A;  1QQE A;  1DC2 A;  3KEZ A;  3L22 A;  4L23 A;  3CK7 A;  4EZJ A;  1N95 A;  3SD5 A;  4JEU A;  2ZU6 B;  3DBS A;  3F6Q A;  1Y8M A;  4WWN A;  5LX8 A;  3S7J A;  5EYP F;  4HRL A;  4FU3 A;  4U07 A;  4ANV A;  2V4L A;  4A3V A;  4JC8 A;  1UN8 A;  5CBO A;  2LXL A;  4JW1 A;  2YIN A;  3AS8 A;  5E75 A;  2E2E A;  1OCC E;  3PEU B;  4GB9 A;  4F3V A;  4KXK B;  4AV7 A;  5FJY A;  4RLY A;  2QC9 A;  1HO8 A;  1E8W A;  4UWH A;  3HXD A;  2H6G A;  2XPZ A;  5CEC B;  1BPO A;  1YA0 A;  3NQP A;  1LF8 A;  3AU5 A;  4GPK A;  4BTA A;  4GTS A;  5AJD A;  2L6B A;  2WXP A;  3EIJ A;  3L54 A;  1E8Z A;  1OCO E;  2XGM A;  3I4R B;  3HXF A;  2OVB A;  1BU9 A;  1S64 A;  4CGV A;  3ZHE B;  3ZUV B;  2CHW A;  4UWG A;  2AW6 A;  5A6C A;  2PM7 A;  3CVY A;  4TXQ A;  4HS2 A;  4AXH A;  3FU6 A;  3CVW A;  4HVB A;  4CYM D;  2GRQ B;  3EUV A;  5EDS A;  4M7C A;  3AG1 E;  3ZYL A;  4I6J A;  4I2Z A;  3G2S A;  3TL5 A;  1E8X A;  2GRM A;  1IXV A;  2EQX A;  3UIO C;  3QWV A;  4LEU A;  4CT0 A;  4CRW A;  4AP2 A;  2R5S A;  2VTB B;  3HG0 D;  4FAD A;  5D2M C;  4F1P A;  4KBQ A;  4G24 A;  3JXI A;  4HRM B;  4GYY A;  4GTV A;  4UWK A;  5FT9 A;  2VQ2 A;  3KAE A;  2WQ6 A;  3JQ0 A;  3NOG D;  4N5Q A;  2PQN A;  5ENS D;  3PZ1 A;  5D0O D;  4A1S A;  2VGY A;  3FTV A;  3TG5 A;  2J8S D;  4GZ3 A;  2I1K A;  5KJK A;  3PE4 A;  3VLD A;  3CV0 A;  4FC8 A;  2WXK A;  2DZN A;  3D9H A;  5A7D B;  2WXR A;  3MV2 B;  3IXE A;  3TAX A;  3SFZ A;  5CBN A;  3QKY A;  5AQ9 A;  4PS3 A;  3V79 K;  1IQU A;  1NL4 A;  2KC7 A;  1DVP A;  5FQ4 A;  2LAH A;  5KNG A;  1Q2Z A;  5FZS A;  4EZL A;  3MJW A;  4I17 A;  3ZFW A;  1Y6I A;  1LD8 A;  4DI4 A;  2PL2 A;  1G3N B;  4YVO A;  1YYH A;  4DX1 A;  4HOR A;  1OWN A;  1ZBP A;  3HXC A;  3G2V A;  5FTP A;  5AYW D;  3PE3 A;  4J8E A;  1KT1 A;  2PQR A;  3Q78 A;  5BNW A;  3CQC B;  4NUR A;  3D9I A;  2I9C A;  3Q5M A;  3D9L A;  4JVS A;  5AIJ A;  4G2V A;  1MX2 A;  4B93 B;  3LCA A;  1TJF A;  5ENR D;  2R17 C;  5AAO A;  1ELW A;  3ONK A;  3QDN A;  4I1O B;  3ASD A;  5BXO A;  5BT1 A;  4ANW A;  4ANX A;  1W3B A;  1BI8 B;  3UM1 A;  3GYZ A;  2DCP A;  4JB8 P;  2KCL A;  4UWF A;  1K1B A;  4C0E A;  3PH0 C;  5BV1 A;  4LUN U;  4DX2 A;  4TXR A;  1TNY A;  2XZT G;  3CVQ A;  5ARG A;  3PS6 A;  3ZIM A;  3VTX A;  5AEN A;  5ARF A;  4L1B A;  3ZW3 A;  5FQ7 A;  5T4Y A;  5T8I A;  2HE0 A;  3I3N A;  1H2T C;  1OWM A;  3J5P A;  3DPY A;  4U63 A;  1ELK A;  5CRU A;  2ETC A;  2X38 A;  3PZ4 A;  3E30 A;  3ULE G;  1IYG A;  2PM6 A;  1RW2 A;  5FZR A;  4XI9 A;  4URK A;  2J9Q A;  4BEP A;  5JHB A;  2XCB A;  5BPP A;  4L2L A;  2OOE A;  5FZQ A;  3SBS A;  3UIP C;  4J8S A;  3HDX A;  4HNA D;  4K03 A;  3ABL E;  1N4R A;  3UPV A;  2YHE A;  4TUM A;  2WVI A;  2J07 A;  3CK8 A;  4I9C A;  3AG2 E;  2WQ7 A;  3U3W A;  1Z3Y A;  4JL0 A;  5AQB A;  4DRX E;  2IO3 C;  2AXU A;  4I1A A;  3CST A;  1N0Q A;  4N2Q A;  2ZGG A;  4WNF A;  5KJN A;  3TXN A;  3KEA A;  3UM2 A;  3T9K A;  3L6A A;  3OXG A;  1FPP A;  3O4Z A;  4KYO B;  4U8V D;  4IN3 B;  2MOW A;  2X6F A;  3BEE A;  5KWD A;  4JA7 A;  3P1U A;  3PNL B;  2ZGD A;  4WWO A;  2Y4U A;  4UWL A;  3DWL G;  3SNX A;  4IYP A;  3C5R A;  1S70 B;  2WXF A;  4UQY A;  4GU5 A;  3E37 A;  5G05 J;  1XGW A;  3G2U A;  2A5E A;  3CHR A;  2LNI A;  3JQ1 A;  5KJL A;  3D9M A;  3APD A;  2F0Y A;  2GRO B;  4IRU A;  4B8C B;  1E8Y A;  1KZP A;  2WXG A;  4YDO A;  5T3R A;  1AWC B;  3FH5 A;  5G04 C;  2XPY A;  4GA0 A;  4APF A;  2KZT B;  3V2O A;  3EHM A;  1MHQ A;  3DSW A;  4WUY A;  1H19 A;  3BG1 B;  4G11 A;  3BUA A;  2R02 A;  1FCH A;  4BTB A;  2Y4T A;  4GTT A;  2X6H A;  2H6I A;  3RRN B;  1UG3 A;  4U8Y D;  4L9P A;  3ZYK A;  4I1M A;  4XKB A;  2XCC A;  1H6O A;  3T8M A;  4LRZ A;  1WDY A;  4JHJ A;  4UI9 J;  4OAV B;  3QB2 A;  4FLH A;  4I2W A;  4Q94 A;  4AOF A;  2QYJ A;  2B6C A;  5EID A;  4GML A;  1O1T A;  5G05 C;  4ABN A;  2BKK B;  1A5E A;  3CVV A;  3LY8 A;  3NAW A;  3URZ A;  2P58 C;  3CHP A;  3C3O A;  3FU5 A;  4DJA A;  3GZS A;  5E76 A;  2Y1L E;  1PY1 A;  5J08 A;  2RD0 A;  2XEE A;  2RG8 A;  3ESK A;  2A4Z A;  1MX6 A;  1HG5 A;  2P9N G;  3Q47 B;  4JXT A;  1WY6 A;  1K8K G;  2WXO A;  1MYO A;  5LP0 A;  1HG2 A;  4GMJ A;  1QZ2 A;  4BWR A;  2AJA A;  3Q9N C;  2IY0 C;  3UT7 A;  5ANR A;  4O6F A;  3PZ3 A;  1TR4 A;  3QAR A;  4U0U A;  1FT2 A;  4L2Y A;  3SHF A;  3E32 A;  5CED B;  4GYW A;  4HLE A;  4RG9 A;  3L16 A;  2CHZ A;  2V5Q C;  1HU3 A;  5JJ6 A;  4NIK A;  4RVB A;  1TNO A;  3Q4A B;  1UOH A;  5LOZ A;  3MA5 A;  3Q73 A;  4DX6 D;  5ENN A;  4HOS A;  1E7U A;  4G8L A;  3P2B A;  1UN9 A;  3RAU A;  3JUE A;  1K3Z D;  1KPS B;  3L9T A;  4AJW A;  3KS2 A;  3BQO A;  1E96 B;  1OUV A; 
#chains in the Genus database with same CATH homology
 3PRE A;  3JQ0 A;  3CVU A;  1VDY A;  3ML8 A;  4N2S A;  2GRL A;  3LEW A;  4MKT A;  5CCM A;  2L0T B;  2J4B A;  2VSY A;  2WXN A;  3IBE A;  3HVE B;  2LO6 A;  4J0U A;  4B0Z A;  2PQN A;  3G2T A;  4JA9 A;  3ASF A;  2VTB A;  3FUM A;  4UQZ A;  3ZRH A;  5D0Q D;  1IQR A;  5BV0 A;  4A1S A;  1H2U A;  5D0O D;  3ZN3 A;  2VGY A;  5CMY A;  3QWP A;  1TEZ A;  5LFA A;  4GZD A;  1MQS A;  3FTV A;  4GA2 A;  3TG5 A;  4KMO A;  3RRM B;  2I1J A;  2JLB A;  2WXL A;  3LKU A;  4GZ3 A;  3CHO A;  3D9O A;  2I1K A;  4EQF A;  5KJK A;  3PE4 A;  3VLD A;  3CV0 A;  3FUI A;  2WM9 A;  4FC8 A;  2WXK A;  3RU0 A;  3FU3 A;  5A7D B;  2M63 A;  4KVM A;  5EKQ D;  1EF1 C;  2FF4 A;  1SZ9 A;  1P5Q A;  2WXR A;  3RO3 A;  3S2A A;  3MV2 B;  1DNP A;  2XQ0 A;  3FTW A;  3VLF A;  3PRZ A;  5G55 A;  1GW6 A;  3CHS A;  3TAX A;  3HVE A;  5HQ8 A;  3SFZ A;  4V3I A;  4AM9 A;  2V5F A;  4HOT A;  3NZS A;  3QKY A;  2YHC A;  1EPU A;  4PS3 A;  2LSU A;  4CCA A;  1KT0 A;  1IQU A;  3CR3 A;  3EHN A;  2KC7 A;  1DVP A;  4J6I A;  5FQ4 A;  2ILR A;  2LAH A;  3S7D A;  3ASG A;  3QAQ A;  2BTD A;  3MGB A;  5FZS A;  3MJW A;  4I17 A;  4RG6 A;  2NC9 A;  3ZFW A;  1SZA A;  4AY5 A;  1Y6I A;  5A23 A;  4DI4 A;  2PL2 A;  4OVV A;  4TRQ A;  3TJP A;  4YVO A;  2VGX B;  4C9B B;  3UT8 A;  1WAO 1;  4XE0 A;  4JHK A;  4HOR A;  1OWN A;  3FEY A;  1ZBP A;  2UY1 B;  2MRI A;  2LAI A;  1OWP A;  2YQ8 A;  4F7A A;  2WQH A;  3G2V A;  3EDT B;  3FUF A;  2WPV A;  5FTP A;  5AYW D;  4BX8 A;  3PE3 A;  4N5C A;  1E90 A;  4BSX A;  4FHJ A;  4J8E A;  4H7X A;  4EZK A;  1JWF A;  3ZVV A;  1KT1 A;  4A3T A;  2VSX E;  3MV3 B;  5CMW A;  2PQR A;  5BNW A;  3FDH A;  3CQC B;  2KAT A;  2NXP A;  3D9I A;  3FP3 A;  1IHG A;  2KM4 A;  4NUR A;  1Z3X A;  4YND A;  2I9C A;  3Q5M A;  3D9L A;  4JVS A;  5J90 A;  5AIJ A;  4G2V A;  4OVU A;  2VGX A;  2X6I A;  3IV0 A;  3LCA A;  1TJF A;  3UQ3 A;  4LER A;  5EX3 A;  2R17 C;  4CDR A;  4CEM A;  1N52 A;  3GZ1 A;  4TUU A;  1ELW A;  3ONK A;  3ENE A;  3CVP A;  3QDN A;  1ZU2 A;  4FJZ A;  3D9K A;  2GGF A;  4I1O B;  3RRU A;  4DLQ A;  3ASD A;  3D9N A;  2KCV A;  4EBA A;  3FFL A;  5JJT A;  5BT1 A;  3CHM A;  4ANW A;  3U4T A;  4ANX A;  1W3B A;  2WXQ A;  3GYZ A;  1NP7 A;  2XGO A;  2PZI A;  3L08 A;  3ESL A;  2ION A;  4PUC A;  2DCP A;  4N3A A;  3U66 A;  4FJY A;  2KCL A;  4UWF A;  4NQ0 A;  4C0E A;  3PH0 C;  2FBN A;  4PH4 B;  4BY6 A;  3CK9 A;  4FHK A;  3RIB A;  5BV1 A;  3CKB A;  3OXL A;  1INZ A;  1Z6T A;  3RO2 A;  4LUN U;  3LVR E;  3HIZ A;  3NF1 A;  3DPD A;  2CFU A;  2JEK A;  2MHK A;  2Q7F A;  3BG0 B;  3CVQ A;  4PDX A;  5ARG A;  1H2V C;  5FWQ A;  4AVX A;  4ME2 A;  3U64 A;  3ZYM A;  3FUH A;  1JWG A;  3PS6 A;  4I6G A;  1H0A A;  4NRH B;  4RSY A;  3ZIM A;  4KZ0 A;  5HI7 A;  2IU1 A;  3VTX A;  5KJM A;  5AEN A;  4J8F A;  5ARF A;  4L1B A;  3B7T A;  3ZW3 A;  4XI0 A;  1HE8 A;  3IKO B;  3OTN A;  3E4B A;  2WXI A;  3CGH A;  5FQ7 A;  5T4Y A;  5T8I A;  3GW4 A;  3I3N A;  4I6E A;  4PS7 A;  3MKR A;  1H2T C;  3PNT B;  1OWM A;  3KD7 A;  5LCW C;  4U0S A;  2XPI A;  3O48 A;  2YNQ A;  3Q49 B;  2BUG A;  4I43 A;  4U63 A;  4G23 A;  1ELK A;  1UW4 B;  4G26 A;  2WMN A;  2XHE A;  3CLJ A;  4Q96 A;  3R7R A;  1U3C A;  3S7F A;  4BT9 A;  2X38 A;  3B7R L;  1NA0 A;  2AXZ A;  3FUE A;  1FVF A;  4TV3 A;  2J09 A;  3FTX A;  2FO7 A;  2VYI A;  3Q15 A;  2Y3A A;  1IYG A;  2PM6 A;  3B13 A;  4LCT A;  5ANL A;  2L6J A;  5FZR A;  3C98 A;  1TJC A;  1NA3 A;  4KZC A;  4APO A;  3PVL A;  3TG4 A;  3LXU X;  4U04 A;  4XI9 A;  2WXH A;  4E85 A;  4URK A;  4DI3 A;  2DBA A;  2R59 A;  3MZL B;  2J9Q A;  4IUL A;  5JHB A;  4JHR A;  2XRZ A;  2HM8 A;  2XCB A;  2HO1 A;  5BPP A;  4L2L A;  2OOE A;  5FZQ A;  3SBS A;  3AU4 A;  4GYO A;  3CKC A;  4ILI A;  4F53 A;  2IJG X;  4J8S A;  3HDX A;  4ILG A;  4K03 A;  4QFV A;  4N39 A;  4JEH A;  4XZ4 A;  4BFR A;  3MX3 A;  5DBK A;  3UPV A;  2YHE A;  3ZYQ A;  3FTU A;  4GZ5 A;  1NZN A;  2WVI A;  2J07 A;  3T5V A;  3CK8 A;  4I9C A;  3PUJ A;  2WQ7 A;  3HHM A;  3U3W A;  2OVF A;  3CVX A;  3OAW A;  1HZ4 A;  1Z3Y A;  3ASH A;  4JL0 A;  5JHA A;  3PUK A;  3R9A B;  3D9J A;  3LY7 A;  3ZXS A;  1HFA A;  2AXU A;  4FLB A;  2OND A;  4I1A A;  3CVN A;  3CST A;  3QJZ A;  1A17 A;  1KLX A;  4MS6 A;  2C0M A;  4N2Q A;  3APF A;  2GW1 A;  4WNF A;  1E7V A;  1HX8 A;  1SQM A;  5KJN A;  3GZ2 A;  3LY9 A;  3QNK A;  3TXN A;  1FVH A;  3S7B A;  4W9R A;  3QWW A;  5KCM A;  5LCW J;  2IOS A;  3ZEF A;  3PZD A;  3LYA A;  3FEX A;  3FUN A;  3MKQ B;  4GAA A;  1L5J A;  3D3M A;  4MLP A;  1QNF A;  3L6A A;  4G1T A;  3OXG A;  4AIF A;  3PEV B;  5C1D A;  1B89 A;  3O4Z A;  2UY1 A;  3FHE A;  4FA6 A;  4KYO B;  5DIZ A;  3VTY A;  2VSN A;  4GA1 A;  4IN3 B;  4UI9 K;  3QC1 A;  3UT4 A;  4EBA G;  1HF8 A;  2CG2 A;  2MOW A;  4WNE A;  2V8S E;  2BF0 X;  4ANU A;  4PS8 A;  2X6F A;  3BEE A;  4K0R A;  5CHE E;  3AS4 A;  3P1U A;  3FTY A;  2KCK A;  3CQG B;  3PNL B;  4JA7 A;  4D10 C;  3JYS A;  4WWO A;  1JPL A;  2Y4U A;  4UWL A;  4U0Z A;  4GZC A;  2FI7 A;  4L7T A;  3FWV A;  4CGW A;  4EZL A;  2IQC A;  3SNX A;  3JCK C;  3T5X A;  2QFC A;  4KT6 B;  1X5B A;  2AWI A;  4XIF A;  2CG3 A;  4IYP A;  3MKQ A;  2WXF A;  4UQY A;  4GCN A;  4KVO A;  4UI9 C;  3IEG A;  3N71 A;  3FY4 A;  4GU5 A;  5G05 J;  1XGW A;  2XRY A;  4HOQ A;  3G2U A;  4BX9 A;  3CSF A;  3CHR A;  4E6H A;  2LNI A;  4WAF A;  2A5U A;  4HXI A;  4WND A;  3JQ1 A;  3APC A;  4J8D A;  2VJ8 A;  1HXI A;  5KJL A;  3D9M A;  4Y6W A;  3HYM B;  4JZY A;  4WNG A;  5CCL A;  3APD A;  3G2W A;  4B8C B;  4IRU A;  4B89 A;  3PDN A;  1EYH A;  3SI5 A;  1E8Y A;  4A1G A;  2L9B A;  3LDZ A;  2WXG A;  5T3R A;  2FUL A;  3FH5 A;  5G04 C;  1QQE A;  2XPY A;  4GA0 A;  4APF A;  2KZT B;  3SF4 A;  3KEZ A;  2E0I A;  3B7U X;  4H7Y A;  3L22 A;  4XX5 A;  3UUX A;  3EHM A;  1MHQ A;  3UMV A;  4WUY A;  2V0P A;  1U3D A;  3CK7 A;  4L23 A;  1H19 A;  3FUL A;  3TXM A;  3FUK A;  4EZJ A;  3TGO A;  3BG1 B;  3ML9 A;  4G11 A;  3SD5 A;  2OV8 A;  4JEU A;  1FCH A;  4BTB A;  2Y4T A;  3R7Q A;  2LSV A;  2X6H A;  3RRN B;  3IHV A;  2ZU6 B;  3DBS A;  1UG3 A;  1Y8M A;  3L13 A;  2CHX A;  3LPZ A;  4WWN A;  3SGH A;  3EJN A;  3ZYK A;  5LX8 A;  4I1M A;  4XKB A;  3S7J A;  4NAC A;  2XCC A;  4I9E A;  3IHY A;  1EDU A;  2QY7 A;  3CVL A;  2KZT A;  1S0P A;  3MEK A;  3T8M A;  3NZU A;  4LRZ A;  4FU3 A;  4U07 A;  3FU0 A;  2V4L A;  2HR2 A;  4ANV A;  4JHJ A;  3QOU A;  4BT8 A;  3UX4 A;  1UJK A;  4UI9 J;  3ZGQ A;  2X6J A;  4YVQ C;  4JC8 A;  4A3V A;  1UN8 A;  4AEZ C;  3QB2 A;  2WXM A;  4FLH A;  3ONL A;  4I2W A;  4JW1 A;  4Q94 A;  4C0M A;  1UJJ A;  4GCO A;  4Q69 A;  1OWO A;  2YIN A;  4AOF A;  4N3B A;  3WXX A;  4ACK A;  2CFZ A;  3AS8 A;  5E75 A;  2E2E A;  1PC2 A;  5BW8 C;  3PEU B;  4GB9 A;  4F3V A;  1HH8 A;  4GML A;  2L0I A;  2C0L A;  3FTS A;  4KXK B;  3ULQ A;  4AV7 A;  5FJY A;  4MRU A;  5G05 C;  3FUJ A;  4UQX A;  4F1S A;  5FQ6 A;  4ABN A;  1HO8 A;  1E8W A;  4UWH A;  3CVV A;  3LY8 A;  4B94 A;  3LS8 A;  3SZ7 A;  3URZ A;  2DIW A;  2XPZ A;  4M3O A;  1H6K A;  2P58 C;  5G04 J;  1JUQ A;  2J4D A;  1BPO A;  5EX0 A;  1WM5 A;  3CHP A;  5G2N A;  3FU5 A;  4DJA A;  5FQ8 A;  2WMO A;  3AS5 A;  3GZS A;  5E76 A;  3FH7 A;  1PY1 A;  4R7L A;  5J08 A;  1YA0 A;  3U9W A;  2RD0 A;  4B8A A;  2RG8 A;  3NQP A;  3ESK A;  2X3M A;  1LF8 A;  4CDN A;  3AU5 A;  2A4Z A;  4GPK A;  3I4G A;  3OXF A;  1HG5 A;  2I6H A;  3Q47 B;  4BTA A;  2AXV A;  4JXT A;  5AJD A;  3RJV A;  3JUI A;  1WY6 A;  2WXP A;  4P29 A;  2WXO A;  3EIJ A;  3L54 A;  4Y6C A;  2WB2 A;  1E8Z A;  5LP0 A;  1HG2 A;  2XGM A;  3MYV A;  4GMJ A;  1QZ2 A;  4BWR A;  4EPZ A;  3I4R B;  4GZ6 A;  4HOU A;  2NSZ A;  2OVB A;  2XGS A;  4CGV A;  3RKV A;  4G25 A;  3ZHE B;  3UT7 A;  4FUL A;  2I2O A;  3CHQ A;  4U8H A;  2CHW A;  2WXJ A;  3QK0 A;  4UWG A;  4WWP A;  2J49 A;  4DK5 A;  4AY6 A;  5ANR A;  4OYS A;  4O6F A;  2AW6 A;  3CIA A;  5A6C A;  3FUD A;  4HFG A;  3FTZ A;  3QAR A;  4U0U A;  2PM7 A;  3CVY A;  3CEQ A;  4A55 A;  4L2Y A;  3SHF A;  4HS2 A;  4AXH A;  3FU6 A;  3CVW A;  4HVB A;  3D9P A;  4FP7 A;  5EDS A;  4GYW A;  2X6K A;  4ILH B;  5C2Y A;  3RK6 A;  4HLE A;  4RG9 A;  3L16 A;  2CHZ A;  3K9I A;  1HU3 A;  2J08 A;  3MCX A;  3ZYL A;  1OWL A;  5JJ6 A;  4I6J A;  4JPS A;  4N3C A;  3LVQ E;  4XKC A;  4I2Z A;  3SBT B;  4RVB A;  2AVP A;  3G2S A;  3ZHE A;  3TL5 A;  1E8X A;  3Q4A B;  2GRM A;  5LOZ A;  2XEV A;  3MA5 A;  2EQX A;  4CDM A;  1N54 A;  3B7S A;  3EIQ C;  4CT4 A;  3QWV A;  4LEU A;  4DPR A;  4DLO A;  5ENN A;  4EEC A;  4CT0 A;  2IOL A;  5JJ7 A;  4HOS A;  4CRW A;  4AP2 A;  3FH8 A;  1PAQ A;  3LJ3 A;  2R5S A;  5BUZ A;  2VTB B;  1ELR A;  1E7U A;  4FAD A;  2IF4 A;  2C2L A;  2UWJ G;  2VSO E;  3P2B A;  4G24 A;  4KBQ A;  3I5P A;  1UN9 A;  2FEZ A;  4ACL A;  4GYY A;  3L17 A;  5AJL A;  1HS6 A;  4UWK A;  2IFU A;  4AJW A;  5M72 A;  5FT9 A;  3KS2 A;  2HYZ A;  2VQ2 A;  3KAE A;  3ZPJ A;  2WQ6 A;  1E96 B;  1XNF A;  4ATG A;  1OUV A;  3VLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...