4I9EA

Crystal structure of aspartyl phosphate phosphatase f from bacillus subtilis
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
383
structure length
383
Chain Sequence
GAMTGVISSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGVSLYEIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of Rap phosphatase inhibition by Phr peptides
pubmed doi rcsb
source organism Bacillus subtilis
total genus 155
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i9eA00
5C1DA 3OXFA 2PQRA 3PE3A 5ARFA 3ZGQA 5EX0A 2IF4A 4LEUA 2VGXB 3QOUA 5ARGA 4ABNA 2P58C 1WM5A 2WPVA 4WNGA 1KT1A 3ESKA 1ELWA 2JLBA 4WNDA 5FT9A 3FFLA 2XGMA 3AS5A 4Y6WA 2UY1B 4YVQC 2ONDA 5BNWA 4UQZA 1YA0A 2DBAA 3LKUA 4AY6A 2KCKA 2YHCA 4WNFA 3PE4A 2LSUA 4W9RA 5A7DB 3TG5A 3CKCA 1W3BA 3LY7A 3Q49B 4BT8A 5D0OD 4KYOB 4RG6A 1ZBPA 4GZ5A 4I17A 3TAXA 3CVQA 4APOA 2NC9A 3CK8A 2HYZA 2I6HA 2YQ8A 4N5CA 5KJLA 1Y8MA 1QQEA 3KS2A 5KJKA 3RO3A 2XCCA 4I1AA 3UPVA 1ZU2A 4XI0A 3RO2A 1P5QA 5EKQD 4BTAA 3AS8A 4G23A 2E2EA 3GYZA 3QDNA 3GZ2A 2OOEA 5CHEE 5FZSA 5A6CA 3ZFWA 1KLXA 5D0QD 1NZNA 3ZHEA 4EQFA 2GW1A 2HO1A 3N71A 4ME2A 3S7BA 2LNIA 4J8DA 3LCAA 3E4BA 3VTXA 4N2QA 2Y4TA 5DBKA 1ELRA 2WQHA 4O6FA 5G04C 3MKRA 4N3AA 2PQNA 3CK7A 3Q47B 5G05J 1B89A 4JHRA 3OXLA 4N2SA 4BWRA 3SF4A 2Q7FA 1IHGA 1IYGA 2Y4UA 3LY9A 1HZ4A 3RJVA 4CGVA 5LCWC 4JL0A 5BT1A 4J0UA 1PC2A 3Q5MA 4RG9A 2QFCA 3ZHEB 4UI9J 5CCLA 4GA2A 4N3BA 4GA0A 3MEKA 4GPKA 1E96B 4U07A 5BW8C 4HOSA 2UWJG 1XNFA 3S7DA 5FZQA 2R5SA 3AS4A 4XIFA 3CV0A 1FCHA 3GZ1A 4UI9K 2C0LA 3UUXA 4G2VA 5HQ8A 3FWVA 2IFUA 3NF1A 2XGSA 3EDTB 4AY5A 4HORA 4H7YA 5DIZA 2FEZA 3OXGA 2KCVA 3GW4A 4YVOA 4U0ZA 2HR2A 3KAEA 4GYOA 4BT9A 3LPZA 3MV2B 3CKBA 4GA1A 3ASDA 3BEEA 1NA0A 3FP3A 4U0SA 2AVPA 2VSYA 4I9CA 1HH8A 3CVPA 3URZA 3WXXA 4I2WA 3MA5A 3LYAA 5KJNA 4IN3B 3ULQA 4GYWA 4KBQA 2V5FA 4I2ZA 4G1TA 2KATA 4J8FA 2KCLA 3S7JA 3PDNA 2BUGA 2XPIA 4G26A 3ZN3A 3RU0A 1KT0A 4N3CA 2LSVA 2VYIA 4AIFA 1TJCA 3TG4A 3MV3B 5CCMA 4UQYA 2XCBA 3CEQA 3UQ3A 5JJ7A 4F3VA 3ASHA 3QWVA 2XGOA 4B94A 1NA3A 2PL2A 4AM9A 4BTBA 4NRHB 4YNDA 3U4TA 4Y6CA 3K9IA 3TGOA 2FO7A 3IEGA 3ASFA 3QKYA 3QWPA 4XI9A 3JYSA 2VSNA 2C0MA 3O48A 5G04J 5KJMA 4I9EA 3QWWA 4HOUA 4UQXA 3R9AB 2VGYA 5JJTA 3Q4AB 4GCOA 4WUYA 5FTPA 1OUVA 2L6JA 4GZ3A 4CDRA 5LCWJ 4J8EA 5M72A 2FBNA 3Q15A 4CGWA 2XEVA 3KD7A 3HYMB 1HXIA 4G25A 4NQ0A 5FZRA 2VQ2A 4GZ6A 5FJYA 1QZ2A 3SZ7A 5G05C 3RIBA 4GYYA 2J9QA 4H7XA 3RKVA 4JA9A 2VGXA 4HOTA 3CVLA 3CVNA 5HI7A 3CK9A 4N39A 4WNEA 4UI9C 4KXKB 5JJ6A 4HOQA 5EX3A 3ZPJA 2FI7A 2UY1A 2MHKA 5AYWD 2C2LA 2KC7A 4A1SA 3LY8A 4GCNA 3VTYA 3ASGA 4U04A 4U0UA 1A17A 1WAO1 3S7FA 2PZIA 2FF4A 3U3WA 4G24A 4JA7A
chains in the Genus database with same CATH superfamily
4IYPA 3NOGD 5CRVA 3EHQA 4FHKA 2J4DA 4GZDA 1MX2A 2LXMA 5EX0A 2IF4A 3ZGQA 4JEHA 4F1PA 4GTPA 3B7RL 3TWSA 1H19A 1WM5A 1V54E 2WPVA 4WNGA 2IOSA 3CQCB 2JLBA 5C2YA 2H6FA 5FWQA 3LXUX 4Y6WA 2R2LA 2ONDA 5CBOA 1IQUA 4CEMA 2KCKA 3UTMA 2WXRA 2X3MA 4PUCA 4W9RA 4DX1A 5BV0A 2DZNA 4DI4A 1PY1A 1K3ZD 1TNZA 3MJWA 3D9KA 5JMND 2WXJA 2H6GA 4GMJA 1ZBPA 4DPRA 1NI1A 3TAXA 4GTOA 4EZLA 2P2CP 2WMNA 3CK8A 2LO6A 3T8KA 1QYMA 3DSSA 4N5CA 5AENA 1QQEA 1FVHA 3V2OA 2V4HC 2J8SD 2WXMA 4UWHA 4I1AA 4HFGA 4JPSA 1P5QA 3JUEA 1KZPA 1LD8A 3R7QA 1N0RA 3AS8A 4WWOA 3DPYA 2DZOA 1Z5SC 2OOEA 5FZSA 3NZUA 1D8EA 5A23A 1KLXA 1NZNA 3ZHEA 2GW1A 2HO1A 5FIOA 3N71A 2WQ6A 4NIKA 4A3TA 3D9HA 2ZGDA 1EDUA 3PNTB 2ETAA 1X5BA 3SQVA 1IKND 3E33A 2WQHA 1H2VC 3MKRA 3KSLA 2VJ8A 3P2BA 4FULA 1B89A 3ONLA 3APDA 1YYHA 4GAAA 4X8QA 1IHGA 3T5VA 2X6FA 5LCWC 1BPOA 2NYJA 3ZYQA 2A5EA 3Q5MA 2QFCA 3TWVA 1UG3A 5CCLA 2QYUA 5J08A 3VLFA 5CEAA 3MEKA 3SFZA 4L23A 1HU3A 2XQ0A 2RKKA 1HS6A 4HOSA 1DCQA 2UWJG 2XENA 1Q2ZA 4CZ2D 3AS4A 4K5AB 3CV0A 2I1KA 5FQ7A 4YDEA 4UI9K 3FH5A 5HQ8A 1JPLA 3FWVA 3IXEA 4AY5A 4V3IA 3SNXA 2GRMA 2CHWA 2XS1A 3ASNE 5KBAA 4TXRA 3CQGB 3KEZA 3E37A 3GW4A 2A4ZA 1HF8A 1AWCB 4GA1A 3HXFA 1E8XA 3LEWA 3L17A 4OYSA 2ZGGA 5EYLA 3Q7FA 4CYMD 1E7VA 5KJNA 2GROB 2YNQA 4IN3B 4GYWA 4QQIA 1OT8A 4EECA 2QZAA 2V5FA 4I2ZA 2WQ7A 2KCLA 4U8HA 3PDNA 2H6HA 1KT0A 5CRUA 2R17C 2LSVA 3L9TA 3FDHA 1SA5A 3DWLG 4AIFA 1OCZE 4I1OB 2J07A 3VLEA 1TJCA 4AVXA 1SW6A 2XHEA 4F7AA 2CFZA 4Q96A 4GTTA 5CCMA 2XCBA 3CEQA 3BQOA 3PREA 1JCQA 3AU4A 2XGOA 4U8YD 3PS6A 3QJZA 3PVLA 4AM9A 5ENSD 3RSEG 4YNDA 3DSTA 4ATZD 2OCCE 2BTDA 3IHYA 4OAUC 3D9NA 3JYSA 2C0MA 5ENOD 3ZNGA 3FU3A 3LJNA 3L13A 5JJTA 2NSZA 2OVFA 3IBEA 1JCRA 1NFIE 2L6JA 4GZ3A 5LCWJ 4J8EA 3JXJA 5M72A 5E75A 1H0AA 3KD7A 3O4ZA 4NQ0A 2ZXWE 2WXNA 2E0IA 4WWNA 1E8WA 4AP2A 1Z6TA 5LP0A 3MKQB 3DSWA 1TYQG 1QZ2A 1JCSA 1E7UA 5G05C 3RIBA 5BUZA 3ML8A 5BV1A 3HG0D 4H7XA 1DC2A 1H2TC 4HOTA 2VTBB 3JUIA 3SBSA 1ZB1A 4N39A 3FU5A 4PS7A 1N94A 4WNEA 1ELKA 2MYOA 2WXGA 2AW6A 1OXJA 3BU8A 3C3OA 4GCNA 4GTRA 3ASGA 3CHRA 1WAO1 4KMOA 2BEDA 3OTNA 3SI5A 2I2OA 2PZIA 3I3NA 2KZTB 1KZOA 3AU5A 4G24A 4LCTA 1AP7A 5C1DA 4RLYA 2J09A 2PQRA 2GGFA 4UWLA 1H6KA 4LEUA 5ARGA 2P58C 3UT4A 4J6IA 2OVBA 3L6AA 3QB2A 4FLBA 1S64A 3PEUB 3ZYLA 2XGMA 3FUFA 2UY1B 5ENNA 5KNGA 5BNWA 3PH0C 4UQZA 4EHMA 3ZU7B 3GZSA 4AY6A 5FQ4A 3HVEB 4HLEA 3UINC 4O1OA 5A7DB 4BSXA 3WG7E 3LDZA 3HXEA 3SFXA 3ZXPA 2OEWA 2CHXA 3AG4E 4I1MA 3SY2A 4JZYA 3D9PA 3G2TA 2F37A 3UI2A 4EPZA 2DWZA 3BG0B 4I6GA 3EHMA 4CCAA 4I17A 5G55A 2IJGX 2NC9A 5J90A 5CECB 3V79K 3FUDA 2HYZA 2YQ8A 4CRWA 4K5BA 5KJLA 2Y0BG 2RFMA 3D3MA 4EBAG 4U63A 1SZAA 1GW6A 1A5EA 2XCCA 2OEVA 3OAWA 3RO2A 4MKTA 4ANXA 4ILIA 5HRYA 3TWXA 1DCEA 2E2EA 4O1PA 3IV0A 3QDNA 3GZ2A 3Q9NC 5CHEE 5CBNA 2HM8A 4XEIG 3PEVB 4F53A 3BUAA 3D9LA 2LNIA 2BF0X 3FTZA 5FQ6A 1S0PA 3E4BA 2WXQA 3CSTA 4I6EA 2Y1LE 4OVVA 3VTXA 3FUEA 2Y4TA 5ENPD 3DEOA 5G04C 1O1RA 4N3AA 5EDSA 3V30A 2R05A 3Q47B 5AQAA 5G05J 4E85A 4KZCA 1S63A 4JHRA 2FO1E 1MX6A 4BWRA 2F8YA 5G2NA 2CHZA 4M7CA 3G2WA 4ILHB 1HZ4A 4CGVA 1N0QA 4JL0A 3TWTA 1INZA 2B6CA 4J0UA 5B3SE 4K5CA 2EQXA 1OCCE 1V55E 3FTXA 5AARA 3L16A 1UJJA 4N3BA 4DJAA 4GPKA 1O5MA 2JABA 1XNFA 5FZQA 5EYPF 1WDYA 4XIFA 4U7EB 1H2UA 4HBDA 3UMVA 1FCHA 2EIME 2ZISA 2C0LA 3TXNA 4ANVA 1JWGA 2IFUA 3NF1A 2XGSA 2P9LG 3ESLA 5BPPA 5DIZA 3C98A 3FTVA 3OXGA 4HXIA 2KCVA 2HR2A 3KAEA 3LPZA 3MV2B 4TXQA 3CKBA 5H7PA 3PNLB 3LS8A 4WWPA 2X6KA 1K8KG 4U95D 2XZTG 4U0SA 2VSYA 5BXUA 5ANLA 3FULA 3JQ1A 2DYSE 2F8XK 3BG1B 4I6JA 3ULQA 3RRMB 1N54A 1D9SA 2JEKA 4G1TA 4BETA 2AWIA 2BUGA 3IHVA 4HRNA 3RU0A 2LXLA 3HXCA 5HKPA 3UM2A 2VSXE 3I4RB 3C3RA 3TG4A 2ZU6B 3FUKA 3RK6A 2GRLA 4UQYA 3G2UA 3UQ3A 1TN8A 2R02A 3ASHA 4RQIA 2EILE 3QNKA 1N11A 3APCA 3CVVA 2IONA 3U4TA 2J08A 3T9KA 1E90A 1IQRA 3K9IA 2BKGA 1TR4A 1DVPA 3TGOA 3SO8A 2FO7A 3IEGA 3QK0A 4L7TA 4EZJA 4B89A 4FC8A 1TEZA 5G04J 3O48A 4RSYA 4UQXA 3CLJA 1L5JA 3AG2E 2VGYA 4CDMA 4B8AA 3DSXA 3Q4AB 4GTSA 3QAQA 4UWGA 5FTPA 3PRZA 3ZYMA 4LERA 5LFAA 3E30A 2FBNA 1NP7A 4YDOA 4AXHA 4DUIA 1HXIA 4KZ0A 4BESA 1SVXA 4BX9A 5FZRA 2QY7A 4JEUA 4GPMA 3DBSA 5E76A 2P9PG 4P29A 1K1BA 4GZCA 2J9QA 1LD7A 2ILRA 4JA9A 1N4SA 3CVLA 2XRZA 2F0YA 2KM4A 4APFA 2ETBA 4ACLA 4UI9C 4CT0A 5JJ6A 3G2VA 4HOQA 5JHBA 2WXIA 5EX3A 4PH4B 4XZ4A 3UX4A 2PM7A 2C2LA 4KVMA 3LY8A 1RW2A 2BKKB 4JVSA 1D8DA 3G2SA 3CVXA 4K03A 4ANWA 4HI8A 3NAWA 3DRAA 2FF4A 3U3WA 4JA7A 1EF1C 3TXMA 1S70B 2VGXB 4UWFA 4J7WA 4ABNA 2WXPA 1EYHA 2EINE 3Q73A 3ESKA 1ELWA 1UJKA 2WM9A 4WNDA 3TWWA 3AS5A 2AXZA 1YA0A 3LKUA 1KPSB 5ENQD 5AIJA 3EIQC 2WXFA 1PAQA 2LSUA 4J8YA 1WG0A 4GB9A 1W3BA 3FTYA 4L1BA 4B0ZA 1U3CA 3LY7A 5D0OD 1BD8A 2B0OE 5KCMA 4AEZC 4GTVA 4KYOB 4RG6A 3R9MA 3HIZA 5KNHD 4UWKA 2WXHA 2RD0A 3UM3A 4APOA 3PZ3A 4C48B 3SHFA 3ENEA 4LUNU 1Y8MA 3CHOA 3FEYA 4NURA 1N4PA 3RO3A 3CHPA 1TJFA 4N5QA 2CG3A 1OWLA 3UPVA 1ZU2A 4OAVB 2DYRE 5T3RA 3UT8A 4HRLA 3JXIA 4BSZB 4BTAA 1HFAA 4L2LA 4G23A 3I5PA 1X81A 3HDXA 4PS3A 3GYZA 5B1BE 5A6CA 3AAAC 5ENTD 3S7BA 3LCAA 4BY6A 3B7SA 4DK5A 4TV3A 2YHEA 3ZEFA 1FT2A 4C0EA 3LVRE 4N2QA 3PZDA 1ELRA 2P9KG 4FP7A 1TNBA 3UIPC 3U64A 3CK7A 4HNAD 4GMLA 3CR3A 4N2SA 3ABLE 2X38A 4QFVA 3DPDA 4TUMA 3ABKE 1IYGA 2Y4UA 2XEHA 3NZSA 4JB8P 1PC2A 1HX8A 2I1JA 3RRUA 3ZHEB 3SGHA 4UI9J 4A63B 1NL4A 2IOLA 1E8ZA 4IRUA 4ATGA 4GA0A 3ZYKA 5BW8C 3S7DA 3FH8A 2XPYA 1QBQA 3ZVVA 2GRNB 3GZ1A 5CMWA 2EIJE 3UUXA 2IY0C 5CEDB 4GTMA 4IULA 4HORA 3UT7A 1OWOA 2V8SE 3J5QB 5D66A 4U0ZA 4GYOA 4BT9A 3B13A 2R59A 3V31A 3I4GA 1NA0A 1FPPA 2NXPA 3FP3A 1VDYA 2AVPA 1EPUA 4I9CA 1HH8A 3URZA 3WXXA 5AAOA 4ZHBA 4I2WA 3AG1E 3MA5A 4JD2G 1OWNA 4GTQA 3RRNB 3UIOC 2EIKE 1OWMA 3TJPA 4J8FA 2XEEA 4FA6A 3S7JA 4AJWA 4DLOA 4E6HA 2XPIA 5LX8A 3FTWA 1MJ0A 3ZN3A 4YDWA 5AJLA 4DLQA 2V4LA 1YMPA 2VYIA 2WVIA 1OY3D 3ML9A 4ACKA 2GRPB 3TWRA 1H6OA 2KBXA 1O1TA 3Q79A 4C0MA 3MZLB 2J49A 1HG2A 3MV3B 3ULYA 5JJ7A 4F3VA 1LF8A 3UXGA 2KXPC 3QARA 5AQBA 5IY5E 1LTXA 3DEPA 2VSOE 3NBNB 4NRHB 4JHJA 2DVWA 3D9MA 3MKQA 4DX6D 2A5UA 3L08A 3ASFA 3QKYA 2L0TB 2MOWA 2J4BA 4G11A 4XKBA 5T8IA 2WXLA 3B7TA 1MQSA 2VSNA 5KJMA 2RG8A 1MZCA 2V5QC 4HOUA 1N4QA 3D9OA 3FU0A 3NOCD 3R9AB 5KWDA 2VTBA 4HI9A 5ITZF 3FTSA 4GMRA 4WUYA 4FADA 4Z68A 3B95A 3DXKG 4CDRA 4ILGA 2PNNA 4RVBA 2V0PA 3Q15A 3S2AA 2XEVA 3E34A 4U8VD 1UW4B 3TWQA 1Y6IA 2VQ2A 2DCPA 2XZDG 3ONKA 4GZ6A 3U66A 5FINA 4TRQA 5FJYA 4MBGA 4HLLA 4M3OA 4J8SA 3FTUA 3R7RA 3SZ7A 2KZTA 4GYYA 3FUNA 3RKVA 4L9PA 4Q94A 4BEPA 1BI7B 3F6QA 1UOHA 4KT6B 4PDXA 2YINA 3J5PA 4KXKB 1MX4A 3Q9UC 2IQCA 2FI7A 2UY1A 1WY6A 2MHKA 3X2QE 3W9FA 4A1SA 4HB5A 3ZW3A 2Y3AA 2L9BA 3HVEA 4U0UA 4DRXE 3UKRG 3S7FA 3PUJA 2P9IG 4Q69A 2XRYA 2L0IA 3EHNA 3OXFA 3FH7A 3PE3A 5ARFA 3Q7AA 3CVWA 1QNFA 3HXDA 3ZIMA 3QOUA 2XS8A 1HO8A 3RAUA 3C72A 1KT1A 4G8KA 4PS8A 3ASOE 4DX5D 3FU6A 5FT9A 3FFLA 3TL5A 3DXMG 4YVQC 4BERA 3ZUVB 2DBAA 5D2MC 3JCKC 2YHCA 1TNOA 2CG2A 4WNFA 1HE8A 3CGHA 3PE4A 4GU5A 3ULEG 3MX3A 3TG5A 1TNYA 3APFA 3CKCA 4LNUD 4A1GA 4OVUA 5T4YA 4ANUA 4B93B 3Q49B 1JWFA 4BT8A 3D9IA 1E8YA 3L22A 5AQ9A 1UN9A 2IO3C 3L82A 3L54A 1U3DA 4GZ5A 3CVQA 1SQMA 5CMYA 3FUHA 3ZXSA 1G3NB 3D9JA 4R7LA 2I6HA 3FUIA 2IU1A 2ZIRA 3EU9A 2AXUA 2HE0A 3AJIA 2R03A 3KS2A 5KJKA 5JA4D 4FJYA 2I9CA 3KSQA 4XI0A 4KVOA 5FQ8A 4UUCA 3HHMA 5EKQD 1YCSB 2RFAA 4MRUA 4EZKA 2X6IA 4D10C 3ISMC 1SZ9A 3ZFWA 5D0QD 1Z3YA 4EQFA 4AOFA 2OV8A 4B8CB 4A55A 3NQPA 4ME2A 4J8DA 3IKOB 5EILA 3TWUA 4DX2A 1OCRE 3UM0A 4A3VA 5DBKA 2ETCA 4TUUA 4O6FA 5BXOA 4FLHA 3B7BA 2PQNA 3HXBA 3OXLA 2GRQB 3EHRA 3SF4A 2Q7FA 3CHQA 3LY9A 5EIDA 3RJVA 4BFRA 5BT1A 4LG6A 3C5RA 4RG9A 3CIAA 5CERB 4GA2A 4CDNA 3MGBA 2QYJA 2H6IA 3ZKJA 2X6HA 2DIWA 4YDYA 1E96B 3LJ3A 4U07A 1UN8A 3T5XA 3HRAA 3QC1A 1N95A 3P1UA 1N4RA 3ABME 5AQ7A 5AN8A 4FHJA 1XGWA 4JC8A 2R5SA 3U9WA 4L2YA 5JHAA 3AG3E 3PZ2A 3EUVA 4G2VA 2WXKA 3EDTB 1TNUA 5EIBE 3DSUA 5AJDA 4H7YA 4O60A 4F1SA 4ZFHA 2FEZA 3C3QA 4YVOA 5ANRA 2XPZA 4HQDA 4XX5A 3ASDA 3BEEA 4K0RA 2PM6A 3SFYA 4FU3A 1MYOA 3CVPA 4URKA 3EIJA 2AXVA 3LYAA 1FT1A 5EN5D 3JQ0A 3EJNA 4KBQA 2KATA 2VGEA 4XKCA 3ZRHA 4G26A 4N3CA 1MHQA 3FUJA 4LSZE 4C9BB 1K1AA 1OWPA 2WB2A 4BX8A 3PZ1A 3KEAA 3UKUG 5HS0A 2LAHA 2LUHA 3DSVA 3QWVA 4B94A 2M63A 2MRIA 2WXOA 4JXTA 1NA3A 2PL2A 4BTBA 3PZ4A 3SBTB 2IEJA 3UM1A 2WMOA 4Y6CA 3CVYA 2L6BA 1U2VG 2Y69E 3QWPA 1IHBA 4XI9A 4HS2A 2LAIA 4LRZA 1N52A 1O1SA 4I9EA 3QWWA 1N9AA 1TN6A 4DI3A 1TN7A 4TXPA 1H6PA 4LNGA 3T8MA 4GCOA 3SD5A 4AV7A 2FULA 1OUVA 4U96D 3EU5A 1BLXB 4CGWA 2CFUA 2IO2C 3HYMB 4G25A 4MLPA 2QC9A 1DNPA 1FVFA 1BU9A 2P9NG 3W9GA 4F6RD 1HG5A 1SA4A 3PUKA 3Q75A 3MCXA 1RZ4A 4LNBA 4I43A 4MS6A 5LOZA 3FY4A 4G8LA 3NB2A 1Z3XA 4FJZA 4HVBA 3CHSA 3MYVA 2VGXA 2P9SG 4JW1A 3VLDA 3CVNA 5HI7A 3FEXA 2X6JA 3CK9A 4WAFA 3E32A 1BI8B 2GRRB 3LVQE 2AJAA 1JUQA 4CT4A 1IXVA 4HRMB 3Q78A 3ZPJA 3B7UX 1OCOE 5AYWD 3CVUA 2P9UG 2KC7A 4DX7D 5B1AE 3VTYA 4U04A 3V2XA 1A17A 3FHEA 4EBAA 4NACA 3FUMA 4XE0A 5ENRD 4JHKA 3CHMA 3CSFA
chains in the Genus database with same CATH topology
4IYPA 3EHNA 1EF1C 5C1DA 3OXFA 3TXMA 4FHKA 2J4DA 3FH7A 2J09A 2PQRA 3PE3A 2GGFA 4UWLA 5ARFA 4GZDA 3CVWA 3ZGQA 5EX0A 1H6KA 2IF4A 1QNFA 4JEHA 4LEUA 2VGXB 4UWFA 3ZIMA 3QOUA 5ARGA 4ABNA 2P58C 3B7RL 2WXPA 1HO8A 3UT4A 4J6IA 1H19A 1WM5A 2WPVA 1EYHA 2OVBA 4WNGA 1KT1A 3L6AA 3QB2A 3ESKA 2IOSA 4FLBA 3CQCB 1ELWA 2JLBA 1UJKA 4PS8A 2WM9A 3PEUB 3FU6A 4WNFA 4WNDA 3ZYLA 5FT9A 5C2YA 4JA7A 3FFLA 2XGMA 3FUFA 3AS5A 5FWQA 3LXUX 4Y6WA 3TL5A 2UY1B 4YVQC 5ENNA 2ONDA 5BNWA 3PH0C 2AXZA 4UQZA 1YA0A 2DBAA 3JCKC 1IQUA 3GZSA 3LKUA 2KCKA 4CEMA 4AY6A 5FQ4A 2YHCA 3HVEB 4HLEA 2CG2A 5AIJA 1HE8A 2WXRA 3CGHA 2WXFA 1PAQA 2LSUA 3EIQC 3PE4A 4GU5A 2X3MA 4PUCA 4W9RA 5BV0A 3MX3A 5A7DB 3TG5A 4BSXA 4DI4A 3APFA 3CKCA 1PY1A 4GB9A 1W3BA 4A1GA 3LDZA 4OVUA 5T4YA 3FTYA 4L1BA 4B0ZA 4ANUA 1U3CA 3LY7A 2CHXA 3Q49B 1JWFA 4BT8A 5D0OD 5KCMA 4I1MA 4AEZC 4KYOB 4JZYA 3D9IA 3D9PA 3G2TA 1E8YA 3MJWA 3D9KA 4RG6A 3HIZA 4EPZA 3L22A 3BG0B 2WXJA 1UN9A 4I6GA 3EHMA 4GMJA 4CCAA 3L54A 1ZBPA 4DPRA 1U3DA 4GZ5A 2WXHA 4I17A 4UWKA 2RD0A 3CVQA 3TAXA 1SQMA 5CMYA 3FUHA 5G55A 3ZXSA 2IJGX 4EZLA 4APOA 2NC9A 3D9JA 2WMNA 5J90A 3CK8A 2LO6A 4R7LA 3ENEA 3SHFA 3FUDA 2HYZA 2I6HA 2YQ8A 4CRWA 3FUIA 2IU1A 4N5CA 5AENA 5KJLA 4LUNU 1Y8MA 4EBAG 1QQEA 2AXUA 3D3MA 4U63A 3KS2A 3CHOA 3FEYA 4NURA 5KJKA 1SZAA 3RO3A 1FVHA 3CHPA 1GW6A 1TJFA 2CG3A 4FJYA 2WXMA 2XCCA 1OWLA 4UWHA 4I1AA 2I9CA 4HFGA 3UPVA 1ZU2A 4JPSA 4XI0A 4KVOA 3OAWA 5FQ8A 3RO2A 4MKTA 3HHMA 1P5QA 5T3RA 5EKQD 4ANXA 3R7QA 3UT8A 4BTAA 1HFAA 4ILIA 3AS8A 4L2LA 4MRUA 4WWOA 4EZKA 4G23A 2E2EA 2X6IA 3HDXA 3I5PA 4PS3A 3IV0A 3GYZA 3QDNA 3GZ2A 2OOEA 5CHEE 5FZSA 3NZUA 4D10C 2HM8A 5A6CA 1SZ9A 3ZFWA 5A23A 1KLXA 5D0QD 1NZNA 1Z3YA 3ZHEA 4EQFA 3PEVB 2OV8A 4AOFA 4B8CB 2GW1A 4A55A 4F53A 3NQPA 2HO1A 3N71A 3D9LA 4G24A 4ME2A 3S7BA 2WQ6A 2LNIA 4J8DA 3IKOB 3LCAA 4BY6A 2BF0X 3FTZA 3B7SA 5FQ6A 4TV3A 4A3TA 1S0PA 3E4BA 4DK5A 2YHEA 2WXQA 3ZEFA 3CSTA 4I6EA 1EDUA 4OVVA 4C0EA 3PNTB 3LVRE 3VTXA 4N2QA 1X5BA 3PZDA 3FUEA 2Y4TA 4A3VA 5DBKA 1ELRA 4TUUA 2WQHA 4O6FA 5G04C 1H2VC 3MKRA 4FP7A 4N3AA 2VJ8A 4FLHA 5EDSA 3P2BA 3U64A 2PQNA 3CK7A 4FULA 3Q47B 5G05J 4E85A 4KZCA 4GMLA 1B89A 4JHRA 3OXLA 3CR3A 3ONLA 3APDA 4BWRA 4N2SA 5G2NA 2X38A 4QFVA 3SF4A 2CHZA 2Q7FA 4GAAA 1IHGA 3DPDA 3G2WA 3CHQA 1IYGA 2Y4UA 3LY9A 4ILHB 3T5VA 1HZ4A 3RJVA 4CGVA 2X6FA 5LCWC 1BPOA 3ZYQA 3NZSA 4JL0A 4BFRA 5BT1A 1INZA 4J0UA 1PC2A 3Q5MA 4RG9A 1HX8A 2EQXA 2QFCA 2I1JA 3CIAA 3RRUA 3ZHEB 3SGHA 4UI9J 3FTXA 1UG3A 5CCLA 4GA2A 4CDNA 2IOLA 3MGBA 1E8ZA 3L16A 4IRUA 5J08A 1UJJA 4ATGA 3VLFA 2X6HA 2DIWA 4N3BA 4GA0A 3MEKA 4DJAA 4GPKA 3ZYKA 1E96B 3LJ3A 4L23A 4U07A 1UN8A 3SFZA 3T5XA 5BW8C 1HU3A 2XQ0A 3QC1A 1HS6A 4HOSA 3P1UA 2UWJG 4FHJA 1XNFA 1XGWA 3S7DA 4JC8A 5FZQA 2R5SA 3AS4A 4XIFA 3CV0A 3U9WA 2I1KA 5FQ7A 1H2UA 2XPYA 3FH8A 3UMVA 3ZVVA 1FCHA 3GZ1A 4UI9K 4L2YA 2C0LA 5CMWA 5JHAA 3TXNA 3FH5A 3UUXA 4ANVA 1JWGA 2WXKA 4G2VA 5HQ8A 1JPLA 3FWVA 2IFUA 3NF1A 2XGSA 3EDTB 4AY5A 3ESLA 5AJDA 4IULA 4V3IA 4HORA 4H7YA 3SNXA 3UT7A 2GRMA 2CHWA 5BPPA 1OWOA 2V8SE 5DIZA 4F1SA 3C98A 2FEZA 3FTVA 3OXGA 3CQGB 3KEZA 4HXIA 2KCVA 3GW4A 4YVOA 5ANRA 2A4ZA 4U0ZA 2HR2A 3KAEA 2XPZA 4GYOA 3LPZA 3B13A 4BT9A 2R59A 3MV2B 1HF8A 3CKBA 4GA1A 3PNLB 4XX5A 3ASDA 3I4GA 3LS8A 4WWPA 3BEEA 2X6KA 1E8XA 1NA0A 4K0RA 2PM6A 2NXPA 3FP3A 1VDYA 4U0SA 2AVPA 1EPUA 4FU3A 3LEWA 2VSYA 4I9CA 3L17A 1HH8A 3CVPA 3URZA 4URKA 3WXXA 5ANLA 3FULA 3EIJA 4I2WA 2AXVA 4OYSA 3JQ1A 3MA5A 1E7VA 3LYAA 5KJNA 1OWNA 2YNQA 3BG1B 4I6JA 4IN3B 4GYWA 3RRMB 3RRNB 3ULQA 3JQ0A 3EJNA 4EECA 4KBQA 1N54A 2V5FA 1OWMA 2JEKA 4I2ZA 4G1TA 2KATA 3TJPA 4J8FA 2WQ7A 4FA6A 4XKCA 2AWIA 2KCLA 3S7JA 4U8HA 3ZRHA 4AJWA 3PDNA 4DLOA 4E6HA 2BUGA 2XPIA 5LX8A 3FTWA 4G26A 3ZN3A 3IHVA 3RU0A 1KT0A 5AJLA 2R17C 4N3CA 4DLQA 2LSVA 2V4LA 2VYIA 3FDHA 2WVIA 1MHQA 4AIFA 3ML9A 3FUJA 4C9BB 4ACKA 4I1OB 2J07A 2VSXE 1TJCA 3I4RB 3VLEA 4AVXA 4C0MA 3TG4A 2XHEA 4F7AA 1OWPA 2CFZA 1HG2A 2J49A 3MZLB 3MV3B 4Q96A 2ZU6B 2WB2A 3FUKA 4BX8A 3RK6A 2GRLA 5CCMA 4UQYA 3G2UA 2XCBA 3CEQA 3PREA 3UQ3A 5JJ7A 4F3VA 2LAHA 1LF8A 3ASHA 3AU4A 3QNKA 3QWVA 2XGOA 4B94A 3QARA 2MRIA 2M63A 2WXOA 4JXTA 3PS6A 3QJZA 3PVLA 1NA3A 2PL2A 2VSOE 4AM9A 4BTBA 4NRHB 3APCA 3CVVA 2IONA 4YNDA 4JHJA 3U4TA 3SBTB 2J08A 3D9MA 1E90A 2WMOA 4Y6CA 3CVYA 3MKQA 1IQRA 3K9IA 1DVPA 3TGOA 2FO7A 2A5UA 3IEGA 3L08A 3ASFA 3QKYA 3QK0A 2L0TB 2MOWA 3QWPA 4L7TA 2J4BA 4G11A 4EZJA 4XI9A 4B89A 2BTDA 3IHYA 4FC8A 4HS2A 4XKBA 5T8IA 2LAIA 2WXLA 3B7TA 3D9NA 3JYSA 4LRZA 1TEZA 1MQSA 2C0MA 2VSNA 1N52A 2RG8A 3O48A 5G04J 5KJMA 4I9EA 4RSYA 3QWWA 4HOUA 4UQXA 3CLJA 1L5JA 3D9OA 4DI3A 3FU0A 3FU3A 3R9AB 2VGYA 4CDMA 2VTBA 4B8AA 3L13A 5JJTA 3FTSA 3Q4AB 3T8MA 4GCOA 3QAQA 2NSZA 4WUYA 3SD5A 4FADA 4UWGA 5FTPA 2FULA 1OUVA 2OVFA 3IBEA 3PRZA 3ZYMA 4AV7A 2L6JA 4LERA 4GZ3A 4CDRA 4ILGA 5LFAA 4RVBA 5LCWJ 4J8EA 5M72A 2FBNA 1NP7A 2V0PA 3Q15A 5E75A 3S2AA 1H0AA 4CGWA 2XEVA 3KD7A 2CFUA 3HYMB 4AXHA 1HXIA 4G25A 4MLPA 1DNPA 3O4ZA 4NQ0A 4KZ0A 2WXNA 2E0IA 1FVFA 4BX9A 4WWNA 5FZRA 1E8WA 1UW4B 4AP2A 1Z6TA 1HG5A 1Y6IA 2QY7A 5LP0A 2VQ2A 2DCPA 3MKQB 3ONKA 3PUKA 4JEUA 4GZ6A 3U66A 4TRQA 5FJYA 3MCXA 3DBSA 4M3OA 5E76A 4J8SA 3FTUA 3R7RA 1QZ2A 4I43A 3SZ7A 2KZTA 4MS6A 5LOZA 1E7UA 5G05C 3FY4A 3RIBA 4P29A 1Z3XA 4GYYA 3FUNA 4FJZA 4GZCA 5BUZA 3ML8A 2J9QA 5BV1A 4H7XA 3RKVA 2ILRA 4JA9A 4HVBA 3CHSA 1H2TC 3MYVA 4Q94A 2VGXA 4HOTA 4JW1A 3VLDA 2VTBB 3CVLA 3CVNA 5HI7A 2XRZA 3FEXA 2X6JA 3CK9A 3JUIA 4WAFA 3SBSA 2KM4A 4KT6B 4APFA 4PDXA 4N39A 3FU5A 4ACLA 4PS7A 3LVQE 4WNEA 1ELKA 1JUQA 2YINA 4UI9C 4CT4A 4CT0A 4KXKB 5JJ6A 2IQCA 2WXGA 2AW6A 3G2VA 4HOQA 5JHBA 2WXIA 5EX3A 4PH4B 3ZPJA 4XZ4A 2UY1A 2FI7A 3B7UX 3UX4A 1WY6A 2MHKA 5AYWD 3CVUA 2PM7A 2C2LA 2KC7A 4KVMA 4A1SA 3LY8A 4GCNA 3ZW3A 4JVSA 2Y3AA 3VTYA 2L9BA 3ASGA 4U04A 3HVEA 4U0UA 3CHRA 1A17A 1WAO1 3G2SA 3FHEA 3CVXA 4KMOA 4K03A 4EBAA 3S7FA 3OTNA 4NACA 2I2OA 2PZIA 3SI5A 3FUMA 3PUJA 4ANWA 3I3NA 2KZTB 2FF4A 4XE0A 3U3WA 3AU5A 4Q69A 2XRYA 2L0IA 4LCTA 4JHKA 3CHMA 3CSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1D A;  3OXF A;  2PQR A;  3PE3 A;  5ARF A;  3ZGQ A;  5EX0 A;  2IF4 A;  4LEU A;  2VGX B;  3QOU A;  5ARG A;  4ABN A;  2P58 C;  1WM5 A;  2WPV A;  4WNG A;  1KT1 A;  3ESK A;  1ELW A;  2JLB A;  4WND A;  5FT9 A;  3FFL A;  2XGM A;  3AS5 A;  4Y6W A;  2UY1 B;  4YVQ C;  2OND A;  5BNW A;  4UQZ A;  1YA0 A;  2DBA A;  3LKU A;  4AY6 A;  2KCK A;  2YHC A;  4WNF A;  3PE4 A;  2LSU A;  4W9R A;  5A7D B;  3TG5 A;  3CKC A;  1W3B A;  3LY7 A;  3Q49 B;  4BT8 A;  5D0O D;  4KYO B;  4RG6 A;  1ZBP A;  4GZ5 A;  4I17 A;  3TAX A;  3CVQ A;  4APO A;  2NC9 A;  3CK8 A;  2HYZ A;  2I6H A;  2YQ8 A;  4N5C A;  5KJL A;  1Y8M A;  1QQE A;  3KS2 A;  5KJK A;  3RO3 A;  2XCC A;  4I1A A;  3UPV A;  1ZU2 A;  4XI0 A;  3RO2 A;  1P5Q A;  5EKQ D;  4BTA A;  3AS8 A;  4G23 A;  2E2E A;  3GYZ A;  3QDN A;  3GZ2 A;  2OOE A;  5CHE E;  5FZS A;  5A6C A;  3ZFW A;  1KLX A;  5D0Q D;  1NZN A;  3ZHE A;  4EQF A;  2GW1 A;  2HO1 A;  3N71 A;  4ME2 A;  3S7B A;  2LNI A;  4J8D A;  3LCA A;  3E4B A;  3VTX A;  4N2Q A;  2Y4T A;  5DBK A;  1ELR A;  2WQH A;  4O6F A;  5G04 C;  3MKR A;  4N3A A;  2PQN A;  3CK7 A;  3Q47 B;  5G05 J;  1B89 A;  4JHR A;  3OXL A;  4N2S A;  4BWR A;  3SF4 A;  2Q7F A;  1IHG A;  1IYG A;  2Y4U A;  3LY9 A;  1HZ4 A;  3RJV A;  4CGV A;  5LCW C;  4JL0 A;  5BT1 A;  4J0U A;  1PC2 A;  3Q5M A;  4RG9 A;  2QFC A;  3ZHE B;  4UI9 J;  5CCL A;  4GA2 A;  4N3B A;  4GA0 A;  3MEK A;  4GPK A;  1E96 B;  4U07 A;  5BW8 C;  4HOS A;  2UWJ G;  1XNF A;  3S7D A;  5FZQ A;  2R5S A;  3AS4 A;  4XIF A;  3CV0 A;  1FCH A;  3GZ1 A;  4UI9 K;  2C0L A;  3UUX A;  4G2V A;  5HQ8 A;  3FWV A;  2IFU A;  3NF1 A;  2XGS A;  3EDT B;  4AY5 A;  4HOR A;  4H7Y A;  5DIZ A;  2FEZ A;  3OXG A;  2KCV A;  3GW4 A;  4YVO A;  4U0Z A;  2HR2 A;  3KAE A;  4GYO A;  4BT9 A;  3LPZ A;  3MV2 B;  3CKB A;  4GA1 A;  3ASD A;  3BEE A;  1NA0 A;  3FP3 A;  4U0S A;  2AVP A;  2VSY A;  4I9C A;  1HH8 A;  3CVP A;  3URZ A;  3WXX A;  4I2W A;  3MA5 A;  3LYA A;  5KJN A;  4IN3 B;  3ULQ A;  4GYW A;  4KBQ A;  2V5F A;  4I2Z A;  4G1T A;  2KAT A;  4J8F A;  2KCL A;  3S7J A;  3PDN A;  2BUG A;  2XPI A;  4G26 A;  3ZN3 A;  3RU0 A;  1KT0 A;  4N3C A;  2LSV A;  2VYI A;  4AIF A;  1TJC A;  3TG4 A;  3MV3 B;  5CCM A;  4UQY A;  2XCB A;  3CEQ A;  3UQ3 A;  5JJ7 A;  4F3V A;  3ASH A;  3QWV A;  2XGO A;  4B94 A;  1NA3 A;  2PL2 A;  4AM9 A;  4BTB A;  4NRH B;  4YND A;  3U4T A;  4Y6C A;  3K9I A;  3TGO A;  2FO7 A;  3IEG A;  3ASF A;  3QKY A;  3QWP A;  4XI9 A;  3JYS A;  2VSN A;  2C0M A;  3O48 A;  5G04 J;  5KJM A;  4I9E A;  3QWW A;  4HOU A;  4UQX A;  3R9A B;  2VGY A;  5JJT A;  3Q4A B;  4GCO A;  4WUY A;  5FTP A;  1OUV A;  2L6J A;  4GZ3 A;  4CDR A;  5LCW J;  4J8E A;  5M72 A;  2FBN A;  3Q15 A;  4CGW A;  2XEV A;  3KD7 A;  3HYM B;  1HXI A;  4G25 A;  4NQ0 A;  5FZR A;  2VQ2 A;  4GZ6 A;  5FJY A;  1QZ2 A;  3SZ7 A;  5G05 C;  3RIB A;  4GYY A;  2J9Q A;  4H7X A;  3RKV A;  4JA9 A;  2VGX A;  4HOT A;  3CVL A;  3CVN A;  5HI7 A;  3CK9 A;  4N39 A;  4WNE A;  4UI9 C;  4KXK B;  5JJ6 A;  4HOQ A;  5EX3 A;  3ZPJ A;  2FI7 A;  2UY1 A;  2MHK A;  5AYW D;  2C2L A;  2KC7 A;  4A1S A;  3LY8 A;  4GCN A;  3VTY A;  3ASG A;  4U04 A;  4U0U A;  1A17 A;  1WAO 1;  3S7F A;  2PZI A;  2FF4 A;  3U3W A;  4G24 A;  4JA7 A; 
#chains in the Genus database with same CATH topology
 4IYP A;  3NOG D;  5CRV A;  3EHQ A;  4FHK A;  2J4D A;  4GZD A;  1MX2 A;  2LXM A;  5EX0 A;  2IF4 A;  3ZGQ A;  4JEH A;  4F1P A;  4GTP A;  3B7R L;  3TWS A;  1H19 A;  1WM5 A;  1V54 E;  2WPV A;  4WNG A;  2IOS A;  3CQC B;  2JLB A;  5C2Y A;  2H6F A;  5FWQ A;  3LXU X;  4Y6W A;  2R2L A;  2OND A;  5CBO A;  1IQU A;  4CEM A;  2KCK A;  3UTM A;  2WXR A;  2X3M A;  4PUC A;  4W9R A;  4DX1 A;  5BV0 A;  2DZN A;  4DI4 A;  1PY1 A;  1K3Z D;  1TNZ A;  3MJW A;  3D9K A;  5JMN D;  2WXJ A;  2H6G A;  4GMJ A;  1ZBP A;  4DPR A;  1NI1 A;  3TAX A;  4GTO A;  4EZL A;  2P2C P;  2WMN A;  3CK8 A;  2LO6 A;  3T8K A;  1QYM A;  3DSS A;  4N5C A;  5AEN A;  1QQE A;  1FVH A;  3V2O A;  2V4H C;  2J8S D;  2WXM A;  4UWH A;  4I1A A;  4HFG A;  4JPS A;  1P5Q A;  3JUE A;  1KZP A;  1LD8 A;  3R7Q A;  1N0R A;  3AS8 A;  4WWO A;  3DPY A;  2DZO A;  1Z5S C;  2OOE A;  5FZS A;  3NZU A;  1D8E A;  5A23 A;  1KLX A;  1NZN A;  3ZHE A;  2GW1 A;  2HO1 A;  5FIO A;  3N71 A;  2WQ6 A;  4NIK A;  4A3T A;  3D9H A;  2ZGD A;  1EDU A;  3PNT B;  2ETA A;  1X5B A;  3SQV A;  1IKN D;  3E33 A;  2WQH A;  1H2V C;  3MKR A;  3KSL A;  2VJ8 A;  3P2B A;  4FUL A;  1B89 A;  3ONL A;  3APD A;  1YYH A;  4GAA A;  4X8Q A;  1IHG A;  3T5V A;  2X6F A;  5LCW C;  1BPO A;  2NYJ A;  3ZYQ A;  2A5E A;  3Q5M A;  2QFC A;  3TWV A;  1UG3 A;  5CCL A;  2QYU A;  5J08 A;  3VLF A;  5CEA A;  3MEK A;  3SFZ A;  4L23 A;  1HU3 A;  2XQ0 A;  2RKK A;  1HS6 A;  4HOS A;  1DCQ A;  2UWJ G;  2XEN A;  1Q2Z A;  4CZ2 D;  3AS4 A;  4K5A B;  3CV0 A;  2I1K A;  5FQ7 A;  4YDE A;  4UI9 K;  3FH5 A;  5HQ8 A;  1JPL A;  3FWV A;  3IXE A;  4AY5 A;  4V3I A;  3SNX A;  2GRM A;  2CHW A;  2XS1 A;  3ASN E;  5KBA A;  4TXR A;  3CQG B;  3KEZ A;  3E37 A;  3GW4 A;  2A4Z A;  1HF8 A;  1AWC B;  4GA1 A;  3HXF A;  1E8X A;  3LEW A;  3L17 A;  4OYS A;  2ZGG A;  5EYL A;  3Q7F A;  4CYM D;  1E7V A;  5KJN A;  2GRO B;  2YNQ A;  4IN3 B;  4GYW A;  4QQI A;  1OT8 A;  4EEC A;  2QZA A;  2V5F A;  4I2Z A;  2WQ7 A;  2KCL A;  4U8H A;  3PDN A;  2H6H A;  1KT0 A;  5CRU A;  2R17 C;  2LSV A;  3L9T A;  3FDH A;  1SA5 A;  3DWL G;  4AIF A;  1OCZ E;  4I1O B;  2J07 A;  3VLE A;  1TJC A;  4AVX A;  1SW6 A;  2XHE A;  4F7A A;  2CFZ A;  4Q96 A;  4GTT A;  5CCM A;  2XCB A;  3CEQ A;  3BQO A;  3PRE A;  1JCQ A;  3AU4 A;  2XGO A;  4U8Y D;  3PS6 A;  3QJZ A;  3PVL A;  4AM9 A;  5ENS D;  3RSE G;  4YND A;  3DST A;  4ATZ D;  2OCC E;  2BTD A;  3IHY A;  4OAU C;  3D9N A;  3JYS A;  2C0M A;  5ENO D;  3ZNG A;  3FU3 A;  3LJN A;  3L13 A;  5JJT A;  2NSZ A;  2OVF A;  3IBE A;  1JCR A;  1NFI E;  2L6J A;  4GZ3 A;  5LCW J;  4J8E A;  3JXJ A;  5M72 A;  5E75 A;  1H0A A;  3KD7 A;  3O4Z A;  4NQ0 A;  2ZXW E;  2WXN A;  2E0I A;  4WWN A;  1E8W A;  4AP2 A;  1Z6T A;  5LP0 A;  3MKQ B;  3DSW A;  1TYQ G;  1QZ2 A;  1JCS A;  1E7U A;  5G05 C;  3RIB A;  5BUZ A;  3ML8 A;  5BV1 A;  3HG0 D;  4H7X A;  1DC2 A;  1H2T C;  4HOT A;  2VTB B;  3JUI A;  3SBS A;  1ZB1 A;  4N39 A;  3FU5 A;  4PS7 A;  1N94 A;  4WNE A;  1ELK A;  2MYO A;  2WXG A;  2AW6 A;  1OXJ A;  3BU8 A;  3C3O A;  4GCN A;  4GTR A;  3ASG A;  3CHR A;  1WAO 1;  4KMO A;  2BED A;  3OTN A;  3SI5 A;  2I2O A;  2PZI A;  3I3N A;  2KZT B;  1KZO A;  3AU5 A;  4G24 A;  4LCT A;  1AP7 A;  5C1D A;  4RLY A;  2J09 A;  2PQR A;  2GGF A;  4UWL A;  1H6K A;  4LEU A;  5ARG A;  2P58 C;  3UT4 A;  4J6I A;  2OVB A;  3L6A A;  3QB2 A;  4FLB A;  1S64 A;  3PEU B;  3ZYL A;  2XGM A;  3FUF A;  2UY1 B;  5ENN A;  5KNG A;  5BNW A;  3PH0 C;  4UQZ A;  4EHM A;  3ZU7 B;  3GZS A;  4AY6 A;  5FQ4 A;  3HVE B;  4HLE A;  3UIN C;  4O1O A;  5A7D B;  4BSX A;  3WG7 E;  3LDZ A;  3HXE A;  3SFX A;  3ZXP A;  2OEW A;  2CHX A;  3AG4 E;  4I1M A;  3SY2 A;  4JZY A;  3D9P A;  3G2T A;  2F37 A;  3UI2 A;  4EPZ A;  2DWZ A;  3BG0 B;  4I6G A;  3EHM A;  4CCA A;  4I17 A;  5G55 A;  2IJG X;  2NC9 A;  5J90 A;  5CEC B;  3V79 K;  3FUD A;  2HYZ A;  2YQ8 A;  4CRW A;  4K5B A;  5KJL A;  2Y0B G;  2RFM A;  3D3M A;  4EBA G;  4U63 A;  1SZA A;  1GW6 A;  1A5E A;  2XCC A;  2OEV A;  3OAW A;  3RO2 A;  4MKT A;  4ANX A;  4ILI A;  5HRY A;  3TWX A;  1DCE A;  2E2E A;  4O1P A;  3IV0 A;  3QDN A;  3GZ2 A;  3Q9N C;  5CHE E;  5CBN A;  2HM8 A;  4XEI G;  3PEV B;  4F53 A;  3BUA A;  3D9L A;  2LNI A;  2BF0 X;  3FTZ A;  5FQ6 A;  1S0P A;  3E4B A;  2WXQ A;  3CST A;  4I6E A;  2Y1L E;  4OVV A;  3VTX A;  3FUE A;  2Y4T A;  5ENP D;  3DEO A;  5G04 C;  1O1R A;  4N3A A;  5EDS A;  3V30 A;  2R05 A;  3Q47 B;  5AQA A;  5G05 J;  4E85 A;  4KZC A;  1S63 A;  4JHR A;  2FO1 E;  1MX6 A;  4BWR A;  2F8Y A;  5G2N A;  2CHZ A;  4M7C A;  3G2W A;  4ILH B;  1HZ4 A;  4CGV A;  1N0Q A;  4JL0 A;  3TWT A;  1INZ A;  2B6C A;  4J0U A;  5B3S E;  4K5C A;  2EQX A;  1OCC E;  1V55 E;  3FTX A;  5AAR A;  3L16 A;  1UJJ A;  4N3B A;  4DJA A;  4GPK A;  1O5M A;  2JAB A;  1XNF A;  5FZQ A;  5EYP F;  1WDY A;  4XIF A;  4U7E B;  1H2U A;  4HBD A;  3UMV A;  1FCH A;  2EIM E;  2ZIS A;  2C0L A;  3TXN A;  4ANV A;  1JWG A;  2IFU A;  3NF1 A;  2XGS A;  2P9L G;  3ESL A;  5BPP A;  5DIZ A;  3C98 A;  3FTV A;  3OXG A;  4HXI A;  2KCV A;  2HR2 A;  3KAE A;  3LPZ A;  3MV2 B;  4TXQ A;  3CKB A;  5H7P A;  3PNL B;  3LS8 A;  4WWP A;  2X6K A;  1K8K G;  4U95 D;  2XZT G;  4U0S A;  2VSY A;  5BXU A;  5ANL A;  3FUL A;  3JQ1 A;  2DYS E;  2F8X K;  3BG1 B;  4I6J A;  3ULQ A;  3RRM B;  1N54 A;  1D9S A;  2JEK A;  4G1T A;  4BET A;  2AWI A;  2BUG A;  3IHV A;  4HRN A;  3RU0 A;  2LXL A;  3HXC A;  5HKP A;  3UM2 A;  2VSX E;  3I4R B;  3C3R A;  3TG4 A;  2ZU6 B;  3FUK A;  3RK6 A;  2GRL A;  4UQY A;  3G2U A;  3UQ3 A;  1TN8 A;  2R02 A;  3ASH A;  4RQI A;  2EIL E;  3QNK A;  1N11 A;  3APC A;  3CVV A;  2ION A;  3U4T A;  2J08 A;  3T9K A;  1E90 A;  1IQR A;  3K9I A;  2BKG A;  1TR4 A;  1DVP A;  3TGO A;  3SO8 A;  2FO7 A;  3IEG A;  3QK0 A;  4L7T A;  4EZJ A;  4B89 A;  4FC8 A;  1TEZ A;  5G04 J;  3O48 A;  4RSY A;  4UQX A;  3CLJ A;  1L5J A;  3AG2 E;  2VGY A;  4CDM A;  4B8A A;  3DSX A;  3Q4A B;  4GTS A;  3QAQ A;  4UWG A;  5FTP A;  3PRZ A;  3ZYM A;  4LER A;  5LFA A;  3E30 A;  2FBN A;  1NP7 A;  4YDO A;  4AXH A;  4DUI A;  1HXI A;  4KZ0 A;  4BES A;  1SVX A;  4BX9 A;  5FZR A;  2QY7 A;  4JEU A;  4GPM A;  3DBS A;  5E76 A;  2P9P G;  4P29 A;  1K1B A;  4GZC A;  2J9Q A;  1LD7 A;  2ILR A;  4JA9 A;  1N4S A;  3CVL A;  2XRZ A;  2F0Y A;  2KM4 A;  4APF A;  2ETB A;  4ACL A;  4UI9 C;  4CT0 A;  5JJ6 A;  3G2V A;  4HOQ A;  5JHB A;  2WXI A;  5EX3 A;  4PH4 B;  4XZ4 A;  3UX4 A;  2PM7 A;  2C2L A;  4KVM A;  3LY8 A;  1RW2 A;  2BKK B;  4JVS A;  1D8D A;  3G2S A;  3CVX A;  4K03 A;  4ANW A;  4HI8 A;  3NAW A;  3DRA A;  2FF4 A;  3U3W A;  4JA7 A;  1EF1 C;  3TXM A;  1S70 B;  2VGX B;  4UWF A;  4J7W A;  4ABN A;  2WXP A;  1EYH A;  2EIN E;  3Q73 A;  3ESK A;  1ELW A;  1UJK A;  2WM9 A;  4WND A;  3TWW A;  3AS5 A;  2AXZ A;  1YA0 A;  3LKU A;  1KPS B;  5ENQ D;  5AIJ A;  3EIQ C;  2WXF A;  1PAQ A;  2LSU A;  4J8Y A;  1WG0 A;  4GB9 A;  1W3B A;  3FTY A;  4L1B A;  4B0Z A;  1U3C A;  3LY7 A;  5D0O D;  1BD8 A;  2B0O E;  5KCM A;  4AEZ C;  4GTV A;  4KYO B;  4RG6 A;  3R9M A;  3HIZ A;  5KNH D;  4UWK A;  2WXH A;  2RD0 A;  3UM3 A;  4APO A;  3PZ3 A;  4C48 B;  3SHF A;  3ENE A;  4LUN U;  1Y8M A;  3CHO A;  3FEY A;  4NUR A;  1N4P A;  3RO3 A;  3CHP A;  1TJF A;  4N5Q A;  2CG3 A;  1OWL A;  3UPV A;  1ZU2 A;  4OAV B;  2DYR E;  5T3R A;  3UT8 A;  4HRL A;  3JXI A;  4BSZ B;  4BTA A;  1HFA A;  4L2L A;  4G23 A;  3I5P A;  1X81 A;  3HDX A;  4PS3 A;  3GYZ A;  5B1B E;  5A6C A;  3AAA C;  5ENT D;  3S7B A;  3LCA A;  4BY6 A;  3B7S A;  4DK5 A;  4TV3 A;  2YHE A;  3ZEF A;  1FT2 A;  4C0E A;  3LVR E;  4N2Q A;  3PZD A;  1ELR A;  2P9K G;  4FP7 A;  1TNB A;  3UIP C;  3U64 A;  3CK7 A;  4HNA D;  4GML A;  3CR3 A;  4N2S A;  3ABL E;  2X38 A;  4QFV A;  3DPD A;  4TUM A;  3ABK E;  1IYG A;  2Y4U A;  2XEH A;  3NZS A;  4JB8 P;  1PC2 A;  1HX8 A;  2I1J A;  3RRU A;  3ZHE B;  3SGH A;  4UI9 J;  4A63 B;  1NL4 A;  2IOL A;  1E8Z A;  4IRU A;  4ATG A;  4GA0 A;  3ZYK A;  5BW8 C;  3S7D A;  3FH8 A;  2XPY A;  1QBQ A;  3ZVV A;  2GRN B;  3GZ1 A;  5CMW A;  2EIJ E;  3UUX A;  2IY0 C;  5CED B;  4GTM A;  4IUL A;  4HOR A;  3UT7 A;  1OWO A;  2V8S E;  3J5Q B;  5D66 A;  4U0Z A;  4GYO A;  4BT9 A;  3B13 A;  2R59 A;  3V31 A;  3I4G A;  1NA0 A;  1FPP A;  2NXP A;  3FP3 A;  1VDY A;  2AVP A;  1EPU A;  4I9C A;  1HH8 A;  3URZ A;  3WXX A;  5AAO A;  4ZHB A;  4I2W A;  3AG1 E;  3MA5 A;  4JD2 G;  1OWN A;  4GTQ A;  3RRN B;  3UIO C;  2EIK E;  1OWM A;  3TJP A;  4J8F A;  2XEE A;  4FA6 A;  3S7J A;  4AJW A;  4DLO A;  4E6H A;  2XPI A;  5LX8 A;  3FTW A;  1MJ0 A;  3ZN3 A;  4YDW A;  5AJL A;  4DLQ A;  2V4L A;  1YMP A;  2VYI A;  2WVI A;  1OY3 D;  3ML9 A;  4ACK A;  2GRP B;  3TWR A;  1H6O A;  2KBX A;  1O1T A;  3Q79 A;  4C0M A;  3MZL B;  2J49 A;  1HG2 A;  3MV3 B;  3ULY A;  5JJ7 A;  4F3V A;  1LF8 A;  3UXG A;  2KXP C;  3QAR A;  5AQB A;  5IY5 E;  1LTX A;  3DEP A;  2VSO E;  3NBN B;  4NRH B;  4JHJ A;  2DVW A;  3D9M A;  3MKQ A;  4DX6 D;  2A5U A;  3L08 A;  3ASF A;  3QKY A;  2L0T B;  2MOW A;  2J4B A;  4G11 A;  4XKB A;  5T8I A;  2WXL A;  3B7T A;  1MQS A;  2VSN A;  5KJM A;  2RG8 A;  1MZC A;  2V5Q C;  4HOU A;  1N4Q A;  3D9O A;  3FU0 A;  3NOC D;  3R9A B;  5KWD A;  2VTB A;  4HI9 A;  5ITZ F;  3FTS A;  4GMR A;  4WUY A;  4FAD A;  4Z68 A;  3B95 A;  3DXK G;  4CDR A;  4ILG A;  2PNN A;  4RVB A;  2V0P A;  3Q15 A;  3S2A A;  2XEV A;  3E34 A;  4U8V D;  1UW4 B;  3TWQ A;  1Y6I A;  2VQ2 A;  2DCP A;  2XZD G;  3ONK A;  4GZ6 A;  3U66 A;  5FIN A;  4TRQ A;  5FJY A;  4MBG A;  4HLL A;  4M3O A;  4J8S A;  3FTU A;  3R7R A;  3SZ7 A;  2KZT A;  4GYY A;  3FUN A;  3RKV A;  4L9P A;  4Q94 A;  4BEP A;  1BI7 B;  3F6Q A;  1UOH A;  4KT6 B;  4PDX A;  2YIN A;  3J5P A;  4KXK B;  1MX4 A;  3Q9U C;  2IQC A;  2FI7 A;  2UY1 A;  1WY6 A;  2MHK A;  3X2Q E;  3W9F A;  4A1S A;  4HB5 A;  3ZW3 A;  2Y3A A;  2L9B A;  3HVE A;  4U0U A;  4DRX E;  3UKR G;  3S7F A;  3PUJ A;  2P9I G;  4Q69 A;  2XRY A;  2L0I A;  3EHN A;  3OXF A;  3FH7 A;  3PE3 A;  5ARF A;  3Q7A A;  3CVW A;  1QNF A;  3HXD A;  3ZIM A;  3QOU A;  2XS8 A;  1HO8 A;  3RAU A;  3C72 A;  1KT1 A;  4G8K A;  4PS8 A;  3ASO E;  4DX5 D;  3FU6 A;  5FT9 A;  3FFL A;  3TL5 A;  3DXM G;  4YVQ C;  4BER A;  3ZUV B;  2DBA A;  5D2M C;  3JCK C;  2YHC A;  1TNO A;  2CG2 A;  4WNF A;  1HE8 A;  3CGH A;  3PE4 A;  4GU5 A;  3ULE G;  3MX3 A;  3TG5 A;  1TNY A;  3APF A;  3CKC A;  4LNU D;  4A1G A;  4OVU A;  5T4Y A;  4ANU A;  4B93 B;  3Q49 B;  1JWF A;  4BT8 A;  3D9I A;  1E8Y A;  3L22 A;  5AQ9 A;  1UN9 A;  2IO3 C;  3L82 A;  3L54 A;  1U3D A;  4GZ5 A;  3CVQ A;  1SQM A;  5CMY A;  3FUH A;  3ZXS A;  1G3N B;  3D9J A;  4R7L A;  2I6H A;  3FUI A;  2IU1 A;  2ZIR A;  3EU9 A;  2AXU A;  2HE0 A;  3AJI A;  2R03 A;  3KS2 A;  5KJK A;  5JA4 D;  4FJY A;  2I9C A;  3KSQ A;  4XI0 A;  4KVO A;  5FQ8 A;  4UUC A;  3HHM A;  5EKQ D;  1YCS B;  2RFA A;  4MRU A;  4EZK A;  2X6I A;  4D10 C;  3ISM C;  1SZ9 A;  3ZFW A;  5D0Q D;  1Z3Y A;  4EQF A;  4AOF A;  2OV8 A;  4B8C B;  4A55 A;  3NQP A;  4ME2 A;  4J8D A;  3IKO B;  5EIL A;  3TWU A;  4DX2 A;  1OCR E;  3UM0 A;  4A3V A;  5DBK A;  2ETC A;  4TUU A;  4O6F A;  5BXO A;  4FLH A;  3B7B A;  2PQN A;  3HXB A;  3OXL A;  2GRQ B;  3EHR A;  3SF4 A;  2Q7F A;  3CHQ A;  3LY9 A;  5EID A;  3RJV A;  4BFR A;  5BT1 A;  4LG6 A;  3C5R A;  4RG9 A;  3CIA A;  5CER B;  4GA2 A;  4CDN A;  3MGB A;  2QYJ A;  2H6I A;  3ZKJ A;  2X6H A;  2DIW A;  4YDY A;  1E96 B;  3LJ3 A;  4U07 A;  1UN8 A;  3T5X A;  3HRA A;  3QC1 A;  1N95 A;  3P1U A;  1N4R A;  3ABM E;  5AQ7 A;  5AN8 A;  4FHJ A;  1XGW A;  4JC8 A;  2R5S A;  3U9W A;  4L2Y A;  5JHA A;  3AG3 E;  3PZ2 A;  3EUV A;  4G2V A;  2WXK A;  3EDT B;  1TNU A;  5EIB E;  3DSU A;  5AJD A;  4H7Y A;  4O60 A;  4F1S A;  4ZFH A;  2FEZ A;  3C3Q A;  4YVO A;  5ANR A;  2XPZ A;  4HQD A;  4XX5 A;  3ASD A;  3BEE A;  4K0R A;  2PM6 A;  3SFY A;  4FU3 A;  1MYO A;  3CVP A;  4URK A;  3EIJ A;  2AXV A;  3LYA A;  1FT1 A;  5EN5 D;  3JQ0 A;  3EJN A;  4KBQ A;  2KAT A;  2VGE A;  4XKC A;  3ZRH A;  4G26 A;  4N3C A;  1MHQ A;  3FUJ A;  4LSZ E;  4C9B B;  1K1A A;  1OWP A;  2WB2 A;  4BX8 A;  3PZ1 A;  3KEA A;  3UKU G;  5HS0 A;  2LAH A;  2LUH A;  3DSV A;  3QWV A;  4B94 A;  2M63 A;  2MRI A;  2WXO A;  4JXT A;  1NA3 A;  2PL2 A;  4BTB A;  3PZ4 A;  3SBT B;  2IEJ A;  3UM1 A;  2WMO A;  4Y6C A;  3CVY A;  2L6B A;  1U2V G;  2Y69 E;  3QWP A;  1IHB A;  4XI9 A;  4HS2 A;  2LAI A;  4LRZ A;  1N52 A;  1O1S A;  4I9E A;  3QWW A;  1N9A A;  1TN6 A;  4DI3 A;  1TN7 A;  4TXP A;  1H6P A;  4LNG A;  3T8M A;  4GCO A;  3SD5 A;  4AV7 A;  2FUL A;  1OUV A;  4U96 D;  3EU5 A;  1BLX B;  4CGW A;  2CFU A;  2IO2 C;  3HYM B;  4G25 A;  4MLP A;  2QC9 A;  1DNP A;  1FVF A;  1BU9 A;  2P9N G;  3W9G A;  4F6R D;  1HG5 A;  1SA4 A;  3PUK A;  3Q75 A;  3MCX A;  1RZ4 A;  4LNB A;  4I43 A;  4MS6 A;  5LOZ A;  3FY4 A;  4G8L A;  3NB2 A;  1Z3X A;  4FJZ A;  4HVB A;  3CHS A;  3MYV A;  2VGX A;  2P9S G;  4JW1 A;  3VLD A;  3CVN A;  5HI7 A;  3FEX A;  2X6J A;  3CK9 A;  4WAF A;  3E32 A;  1BI8 B;  2GRR B;  3LVQ E;  2AJA A;  1JUQ A;  4CT4 A;  1IXV A;  4HRM B;  3Q78 A;  3ZPJ A;  3B7U X;  1OCO E;  5AYW D;  3CVU A;  2P9U G;  2KC7 A;  4DX7 D;  5B1A E;  3VTY A;  4U04 A;  3V2X A;  1A17 A;  3FHE A;  4EBA A;  4NAC A;  3FUM A;  4XE0 A;  5ENR D;  4JHK A;  3CHM A;  3CSF A; 
#chains in the Genus database with same CATH homology
 4IYP A;  3EHN A;  1EF1 C;  5C1D A;  3OXF A;  3TXM A;  4FHK A;  2J4D A;  3FH7 A;  2J09 A;  2PQR A;  3PE3 A;  2GGF A;  4UWL A;  5ARF A;  4GZD A;  3CVW A;  3ZGQ A;  5EX0 A;  1H6K A;  2IF4 A;  1QNF A;  4JEH A;  4LEU A;  2VGX B;  4UWF A;  3ZIM A;  3QOU A;  5ARG A;  4ABN A;  2P58 C;  3B7R L;  2WXP A;  1HO8 A;  3UT4 A;  4J6I A;  1H19 A;  1WM5 A;  2WPV A;  1EYH A;  2OVB A;  4WNG A;  1KT1 A;  3L6A A;  3QB2 A;  3ESK A;  2IOS A;  4FLB A;  3CQC B;  1ELW A;  2JLB A;  1UJK A;  4PS8 A;  2WM9 A;  3PEU B;  3FU6 A;  4WNF A;  4WND A;  3ZYL A;  5FT9 A;  5C2Y A;  4JA7 A;  3FFL A;  2XGM A;  3FUF A;  3AS5 A;  5FWQ A;  3LXU X;  4Y6W A;  3TL5 A;  2UY1 B;  4YVQ C;  5ENN A;  2OND A;  5BNW A;  3PH0 C;  2AXZ A;  4UQZ A;  1YA0 A;  2DBA A;  3JCK C;  1IQU A;  3GZS A;  3LKU A;  2KCK A;  4CEM A;  4AY6 A;  5FQ4 A;  2YHC A;  3HVE B;  4HLE A;  2CG2 A;  5AIJ A;  1HE8 A;  2WXR A;  3CGH A;  2WXF A;  1PAQ A;  2LSU A;  3EIQ C;  3PE4 A;  4GU5 A;  2X3M A;  4PUC A;  4W9R A;  5BV0 A;  3MX3 A;  5A7D B;  3TG5 A;  4BSX A;  4DI4 A;  3APF A;  3CKC A;  1PY1 A;  4GB9 A;  1W3B A;  4A1G A;  3LDZ A;  4OVU A;  5T4Y A;  3FTY A;  4L1B A;  4B0Z A;  4ANU A;  1U3C A;  3LY7 A;  2CHX A;  3Q49 B;  1JWF A;  4BT8 A;  5D0O D;  5KCM A;  4I1M A;  4AEZ C;  4KYO B;  4JZY A;  3D9I A;  3D9P A;  3G2T A;  1E8Y A;  3MJW A;  3D9K A;  4RG6 A;  3HIZ A;  4EPZ A;  3L22 A;  3BG0 B;  2WXJ A;  1UN9 A;  4I6G A;  3EHM A;  4GMJ A;  4CCA A;  3L54 A;  1ZBP A;  4DPR A;  1U3D A;  4GZ5 A;  2WXH A;  4I17 A;  4UWK A;  2RD0 A;  3CVQ A;  3TAX A;  1SQM A;  5CMY A;  3FUH A;  5G55 A;  3ZXS A;  2IJG X;  4EZL A;  4APO A;  2NC9 A;  3D9J A;  2WMN A;  5J90 A;  3CK8 A;  2LO6 A;  4R7L A;  3ENE A;  3SHF A;  3FUD A;  2HYZ A;  2I6H A;  2YQ8 A;  4CRW A;  3FUI A;  2IU1 A;  4N5C A;  5AEN A;  5KJL A;  4LUN U;  1Y8M A;  4EBA G;  1QQE A;  2AXU A;  3D3M A;  4U63 A;  3KS2 A;  3CHO A;  3FEY A;  4NUR A;  5KJK A;  1SZA A;  3RO3 A;  1FVH A;  3CHP A;  1GW6 A;  1TJF A;  2CG3 A;  4FJY A;  2WXM A;  2XCC A;  1OWL A;  4UWH A;  4I1A A;  2I9C A;  4HFG A;  3UPV A;  1ZU2 A;  4JPS A;  4XI0 A;  4KVO A;  3OAW A;  5FQ8 A;  3RO2 A;  4MKT A;  3HHM A;  1P5Q A;  5T3R A;  5EKQ D;  4ANX A;  3R7Q A;  3UT8 A;  4BTA A;  1HFA A;  4ILI A;  3AS8 A;  4L2L A;  4MRU A;  4WWO A;  4EZK A;  4G23 A;  2E2E A;  2X6I A;  3HDX A;  3I5P A;  4PS3 A;  3IV0 A;  3GYZ A;  3QDN A;  3GZ2 A;  2OOE A;  5CHE E;  5FZS A;  3NZU A;  4D10 C;  2HM8 A;  5A6C A;  1SZ9 A;  3ZFW A;  5A23 A;  1KLX A;  5D0Q D;  1NZN A;  1Z3Y A;  3ZHE A;  4EQF A;  3PEV B;  2OV8 A;  4AOF A;  4B8C B;  2GW1 A;  4A55 A;  4F53 A;  3NQP A;  2HO1 A;  3N71 A;  3D9L A;  4G24 A;  4ME2 A;  3S7B A;  2WQ6 A;  2LNI A;  4J8D A;  3IKO B;  3LCA A;  4BY6 A;  2BF0 X;  3FTZ A;  3B7S A;  5FQ6 A;  4TV3 A;  4A3T A;  1S0P A;  3E4B A;  4DK5 A;  2YHE A;  2WXQ A;  3ZEF A;  3CST A;  4I6E A;  1EDU A;  4OVV A;  4C0E A;  3PNT B;  3LVR E;  3VTX A;  4N2Q A;  1X5B A;  3PZD A;  3FUE A;  2Y4T A;  4A3V A;  5DBK A;  1ELR A;  4TUU A;  2WQH A;  4O6F A;  5G04 C;  1H2V C;  3MKR A;  4FP7 A;  4N3A A;  2VJ8 A;  4FLH A;  5EDS A;  3P2B A;  3U64 A;  2PQN A;  3CK7 A;  4FUL A;  3Q47 B;  5G05 J;  4E85 A;  4KZC A;  4GML A;  1B89 A;  4JHR A;  3OXL A;  3CR3 A;  3ONL A;  3APD A;  4BWR A;  4N2S A;  5G2N A;  2X38 A;  4QFV A;  3SF4 A;  2CHZ A;  2Q7F A;  4GAA A;  1IHG A;  3DPD A;  3G2W A;  3CHQ A;  1IYG A;  2Y4U A;  3LY9 A;  4ILH B;  3T5V A;  1HZ4 A;  3RJV A;  4CGV A;  2X6F A;  5LCW C;  1BPO A;  3ZYQ A;  3NZS A;  4JL0 A;  4BFR A;  5BT1 A;  1INZ A;  4J0U A;  1PC2 A;  3Q5M A;  4RG9 A;  1HX8 A;  2EQX A;  2QFC A;  2I1J A;  3CIA A;  3RRU A;  3ZHE B;  3SGH A;  4UI9 J;  3FTX A;  1UG3 A;  5CCL A;  4GA2 A;  4CDN A;  2IOL A;  3MGB A;  1E8Z A;  3L16 A;  4IRU A;  5J08 A;  1UJJ A;  4ATG A;  3VLF A;  2X6H A;  2DIW A;  4N3B A;  4GA0 A;  3MEK A;  4DJA A;  4GPK A;  3ZYK A;  1E96 B;  3LJ3 A;  4L23 A;  4U07 A;  1UN8 A;  3SFZ A;  3T5X A;  5BW8 C;  1HU3 A;  2XQ0 A;  3QC1 A;  1HS6 A;  4HOS A;  3P1U A;  2UWJ G;  4FHJ A;  1XNF A;  1XGW A;  3S7D A;  4JC8 A;  5FZQ A;  2R5S A;  3AS4 A;  4XIF A;  3CV0 A;  3U9W A;  2I1K A;  5FQ7 A;  1H2U A;  2XPY A;  3FH8 A;  3UMV A;  3ZVV A;  1FCH A;  3GZ1 A;  4UI9 K;  4L2Y A;  2C0L A;  5CMW A;  5JHA A;  3TXN A;  3FH5 A;  3UUX A;  4ANV A;  1JWG A;  2WXK A;  4G2V A;  5HQ8 A;  1JPL A;  3FWV A;  2IFU A;  3NF1 A;  2XGS A;  3EDT B;  4AY5 A;  3ESL A;  5AJD A;  4IUL A;  4V3I A;  4HOR A;  4H7Y A;  3SNX A;  3UT7 A;  2GRM A;  2CHW A;  5BPP A;  1OWO A;  2V8S E;  5DIZ A;  4F1S A;  3C98 A;  2FEZ A;  3FTV A;  3OXG A;  3CQG B;  3KEZ A;  4HXI A;  2KCV A;  3GW4 A;  4YVO A;  5ANR A;  2A4Z A;  4U0Z A;  2HR2 A;  3KAE A;  2XPZ A;  4GYO A;  3LPZ A;  3B13 A;  4BT9 A;  2R59 A;  3MV2 B;  1HF8 A;  3CKB A;  4GA1 A;  3PNL B;  4XX5 A;  3ASD A;  3I4G A;  3LS8 A;  4WWP A;  3BEE A;  2X6K A;  1E8X A;  1NA0 A;  4K0R A;  2PM6 A;  2NXP A;  3FP3 A;  1VDY A;  4U0S A;  2AVP A;  1EPU A;  4FU3 A;  3LEW A;  2VSY A;  4I9C A;  3L17 A;  1HH8 A;  3CVP A;  3URZ A;  4URK A;  3WXX A;  5ANL A;  3FUL A;  3EIJ A;  4I2W A;  2AXV A;  4OYS A;  3JQ1 A;  3MA5 A;  1E7V A;  3LYA A;  5KJN A;  1OWN A;  2YNQ A;  3BG1 B;  4I6J A;  4IN3 B;  4GYW A;  3RRM B;  3RRN B;  3ULQ A;  3JQ0 A;  3EJN A;  4EEC A;  4KBQ A;  1N54 A;  2V5F A;  1OWM A;  2JEK A;  4I2Z A;  4G1T A;  2KAT A;  3TJP A;  4J8F A;  2WQ7 A;  4FA6 A;  4XKC A;  2AWI A;  2KCL A;  3S7J A;  4U8H A;  3ZRH A;  4AJW A;  3PDN A;  4DLO A;  4E6H A;  2BUG A;  2XPI A;  5LX8 A;  3FTW A;  4G26 A;  3ZN3 A;  3IHV A;  3RU0 A;  1KT0 A;  5AJL A;  2R17 C;  4N3C A;  4DLQ A;  2LSV A;  2V4L A;  2VYI A;  3FDH A;  2WVI A;  1MHQ A;  4AIF A;  3ML9 A;  3FUJ A;  4C9B B;  4ACK A;  4I1O B;  2J07 A;  2VSX E;  1TJC A;  3I4R B;  3VLE A;  4AVX A;  4C0M A;  3TG4 A;  2XHE A;  4F7A A;  1OWP A;  2CFZ A;  1HG2 A;  2J49 A;  3MZL B;  3MV3 B;  4Q96 A;  2ZU6 B;  2WB2 A;  3FUK A;  4BX8 A;  3RK6 A;  2GRL A;  5CCM A;  4UQY A;  3G2U A;  2XCB A;  3CEQ A;  3PRE A;  3UQ3 A;  5JJ7 A;  4F3V A;  2LAH A;  1LF8 A;  3ASH A;  3AU4 A;  3QNK A;  3QWV A;  2XGO A;  4B94 A;  3QAR A;  2MRI A;  2M63 A;  2WXO A;  4JXT A;  3PS6 A;  3QJZ A;  3PVL A;  1NA3 A;  2PL2 A;  2VSO E;  4AM9 A;  4BTB A;  4NRH B;  3APC A;  3CVV A;  2ION A;  4YND A;  4JHJ A;  3U4T A;  3SBT B;  2J08 A;  3D9M A;  1E90 A;  2WMO A;  4Y6C A;  3CVY A;  3MKQ A;  1IQR A;  3K9I A;  1DVP A;  3TGO A;  2FO7 A;  2A5U A;  3IEG A;  3L08 A;  3ASF A;  3QKY A;  3QK0 A;  2L0T B;  2MOW A;  3QWP A;  4L7T A;  2J4B A;  4G11 A;  4EZJ A;  4XI9 A;  4B89 A;  2BTD A;  3IHY A;  4FC8 A;  4HS2 A;  4XKB A;  5T8I A;  2LAI A;  2WXL A;  3B7T A;  3D9N A;  3JYS A;  4LRZ A;  1TEZ A;  1MQS A;  2C0M A;  2VSN A;  1N52 A;  2RG8 A;  3O48 A;  5G04 J;  5KJM A;  4I9E A;  4RSY A;  3QWW A;  4HOU A;  4UQX A;  3CLJ A;  1L5J A;  3D9O A;  4DI3 A;  3FU0 A;  3FU3 A;  3R9A B;  2VGY A;  4CDM A;  2VTB A;  4B8A A;  3L13 A;  5JJT A;  3FTS A;  3Q4A B;  3T8M A;  4GCO A;  3QAQ A;  2NSZ A;  4WUY A;  3SD5 A;  4FAD A;  4UWG A;  5FTP A;  2FUL A;  1OUV A;  2OVF A;  3IBE A;  3PRZ A;  3ZYM A;  4AV7 A;  2L6J A;  4LER A;  4GZ3 A;  4CDR A;  4ILG A;  5LFA A;  4RVB A;  5LCW J;  4J8E A;  5M72 A;  2FBN A;  1NP7 A;  2V0P A;  3Q15 A;  5E75 A;  3S2A A;  1H0A A;  4CGW A;  2XEV A;  3KD7 A;  2CFU A;  3HYM B;  4AXH A;  1HXI A;  4G25 A;  4MLP A;  1DNP A;  3O4Z A;  4NQ0 A;  4KZ0 A;  2WXN A;  2E0I A;  1FVF A;  4BX9 A;  4WWN A;  5FZR A;  1E8W A;  1UW4 B;  4AP2 A;  1Z6T A;  1HG5 A;  1Y6I A;  2QY7 A;  5LP0 A;  2VQ2 A;  2DCP A;  3MKQ B;  3ONK A;  3PUK A;  4JEU A;  4GZ6 A;  3U66 A;  4TRQ A;  5FJY A;  3MCX A;  3DBS A;  4M3O A;  5E76 A;  4J8S A;  3FTU A;  3R7R A;  1QZ2 A;  4I43 A;  3SZ7 A;  2KZT A;  4MS6 A;  5LOZ A;  1E7U A;  5G05 C;  3FY4 A;  3RIB A;  4P29 A;  1Z3X A;  4GYY A;  3FUN A;  4FJZ A;  4GZC A;  5BUZ A;  3ML8 A;  2J9Q A;  5BV1 A;  4H7X A;  3RKV A;  2ILR A;  4JA9 A;  4HVB A;  3CHS A;  1H2T C;  3MYV A;  4Q94 A;  2VGX A;  4HOT A;  4JW1 A;  3VLD A;  2VTB B;  3CVL A;  3CVN A;  5HI7 A;  2XRZ A;  3FEX A;  2X6J A;  3CK9 A;  3JUI A;  4WAF A;  3SBS A;  2KM4 A;  4KT6 B;  4APF A;  4PDX A;  4N39 A;  3FU5 A;  4ACL A;  4PS7 A;  3LVQ E;  4WNE A;  1ELK A;  1JUQ A;  2YIN A;  4UI9 C;  4CT4 A;  4CT0 A;  4KXK B;  5JJ6 A;  2IQC A;  2WXG A;  2AW6 A;  3G2V A;  4HOQ A;  5JHB A;  2WXI A;  5EX3 A;  4PH4 B;  3ZPJ A;  4XZ4 A;  2UY1 A;  2FI7 A;  3B7U X;  3UX4 A;  1WY6 A;  2MHK A;  5AYW D;  3CVU A;  2PM7 A;  2C2L A;  2KC7 A;  4KVM A;  4A1S A;  3LY8 A;  4GCN A;  3ZW3 A;  4JVS A;  2Y3A A;  3VTY A;  2L9B A;  3ASG A;  4U04 A;  3HVE A;  4U0U A;  3CHR A;  1A17 A;  1WAO 1;  3G2S A;  3FHE A;  3CVX A;  4KMO A;  4K03 A;  4EBA A;  3S7F A;  3OTN A;  4NAC A;  2I2O A;  2PZI A;  3SI5 A;  3FUM A;  3PUJ A;  4ANW A;  3I3N A;  2KZT B;  2FF4 A;  4XE0 A;  3U3W A;  3AU5 A;  4Q69 A;  2XRY A;  2L0I A;  4LCT A;  4JHK A;  3CHM A;  3CSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...