3C3OA

Alix bro1-domain:chmip4a co-crystal structure
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
357
structure length
357
Chain Sequence
ATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Programmed cell death 6-interacting protein
publication title ALIX-CHMP4 interactions in the human ESCRT pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 130
structure length 357
sequence length 357
ec nomenclature
pdb deposition date 2008-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3c3oA00
3UM0A 3C3QA 3ULYA 1ZB1A 2XS1A 2R03A 2R05A 2R02A 3C3RA 2XS8A 3UM2A 2OEVA 3ZXPA 2OEWA 3R9MA 5CRUA 3UM1A 3UM3A 3RAUA 3C3OA 5CRVA
chains in the Genus database with same CATH superfamily
2XZDG 2J4DA 4DK5A 4XZ4A 3ULQA 4AXHA 3AG1E 1Z3XA 3UT4A 4PUCA 5BUZA 3ZKJA 5G05C 3SGHA 2YNQA 3RAUA 1DVPA 1NI1A 5HQ8A 5LX8A 3C3QA 1FCHA 1KT0A 4N3BA 3JCKC 3MV3B 3KSLA 3ZXPA 3Q9NC 3AAAC 4EBAA 2AXVA 3CVLA 5ENTD 3QJZA 1HO8A 1O1SA 1H6OA 4LUNU 3V2OA 4ANUA 5G04J 3HXBA 3FUHA 3QKYA 5CEAA 2BKKB 1OCCE 3CHSA 1OCZE 4UI9K 5KJKA 4N3CA 4HOTA 4FA6A 1JPLA 4U07A 3T5VA 3U4TA 2Y3AA 4ATGA 3SO8A 1HH8A 4GYYA 1ELKA 3CVYA 2NYJA 3ABLE 2AW6A 4CT0A 1O1RA 3FH5A 4O1OA 5G05J 4RG9A 1WAO1 3E4BA 2CG2A 2WQ7A 3IHVA 4ACLA 4AV7A 1TN8A 4HQDA 5JA4D 4APOA 4CDMA 3CK8A 3E34A 5EIBE 3HXEA 3L08A 4ME2A 1GW6A 3K9IA 1KT1A 3TWXA 1BD8A 2XENA 4U8VD 3MA5A 5ITZF 5AYWD 2KBXA 3P2BA 3FEYA 2PL2A 5LP0A 3VLDA 4DI3A 4BSXA 4I1OB 2P9KG 2VSNA 2PM7A 3BG0B 2Y0BG 3MX3A 2BEDA 3ENEA 2KC7A 5BV1A 3CVNA 3T8MA 4G2VA 2ILRA 3RRUA 1JCSA 1HZ4A 5JJ6A 3L16A 4M7CA 2ETCA 2KXPC 2ETAA 3PDNA 2F8XK 3L9TA 3ZW3A 4GZ6A 4I1AA 4BERA 2PQRA 1DCQA 5M72A 4B93B 3CHOA 1NA3A 5AAOA 2IEJA 1H2UA 2IFUA 1JCRA 5AIJA 3L82A 5ENQD 5ARGA 3B7UX 1LTXA 3FH7A 3FTSA 4BX9A 2E2EA 4F53A 3BEEA 2LAHA 3Q7AA 3I3NA 5G55A 1W3BA 3CSFA 4YDWA 5B1BE 4G1TA 2WM9A 5C1DA 3SFYA 5CBNA 1TNBA 3PS6A 4GTVA 2MYOA 2XEVA 3VTXA 4UI9C 4OVUA 3FU3A 4TUUA 4J0UA 3GZ1A 3DEOA 4F7AA 2DYRE 3Q7FA 3V79K 1TNYA 4FJZA 1EYHA 4KT6B 3Q73A 1NP7A 2I1JA 2E0IA 4N2QA 3RSEG 3BUAA 4CDNA 2WXHA 3Q9UC 3FTZA 4J8DA 3TWUA 5A23A 5H7PA 3S2AA 3ZIMA 5BNWA 2IO3C 3ZHEA 3I4GA 4AOFA 3EIJA 4N5CA 4CRWA 2QYJA 4HLEA 4TV3A 1ZBPA 5LFAA 3D9HA 1QZ2A 1E8XA 4R7LA 4DPRA 2OV8A 4J8EA 4C9BB 4AEZC 3Q5MA 3VLFA 4JPSA 4WWOA 4HI8A 1SW6A 3QNKA 4GMRA 2AXUA 4BY6A 2YINA 4U8HA 4ANWA 4WNEA 1E8ZA 3MGBA 4K5CA 1K1AA 5ENOD 5C2YA 3IKOB 5D0QD 5BW8C 3Q15A 5ENPD 1UN8A 3CVPA 3KD7A 3W9GA 4UUCA 4HOSA 3CVXA 1D9SA 2IONA 2AJAA 1EDUA 1HX8A 1SZ9A 2XCBA 2JABA 2WXJA 3RRNB 1E8YA 4UWHA 3L6AA 3C3OA 4AY6A 2OCCE 1IYGA 1OWOA 1ZU2A 4I6GA 3UINC 5EX3A 5KJNA 3QC1A 4AP2A 3EU5A 2CFZA 4YNDA 4HVBA 4JA9A 2VGXA 4AJWA 2J09A 1O5MA 3OAWA 3SD5A 3CGHA 3PUJA 4WNFA 3QARA 1PC2A 1K3ZD 4QQIA 2WXKA 4YDEA 1MX2A 1P5QA 1FT1A 1HG2A 2WMOA 3PNLB 2KCVA 4A1GA 1YMPA 1N0RA 3AS8A 3SBTB 5ANRA 5LOZA 4APFA 3GYZA 5BT1A 2P9IG 4MBGA 4WAFA 2FBNA 3LCAA 1SZAA 4GTOA 3BG1B 4CYMD 4O1PA 1KLXA 3L13A 2J4BA 4J7WA 4RLYA 4YDOA 3DSXA 4F1PA 5KCMA 4JC8A 2F8YA 3FTUA 4G25A 2ETBA 4DRXE 4KMOA 2KCLA 2NXPA 3C5RA 2WVIA 4J8YA 2QYUA 3SF4A 4EZKA 4NRHB 3B95A 3ASHA 4GTTA 3HDXA 3FUNA 3GW4A 1OWLA 3LY8A 2BKGA 4P29A 3FULA 4YVQC 3HXDA 3HYMB 2KZTA 3G2SA 2MHKA 4PS7A 4FULA 4RG6A 1A17A 3TWWA 1OWNA 1VDYA 3PE4A 1IKND 2OVFA 4JA7A 1TNOA 4Q96A 1H2VC 4I9EA 5T4YA 2DVWA 4L9PA 2WXIA 3TGOA 3I5PA 4GA0A 3Q49B 1H6KA 5B3SE 4D10C 3G2TA 1UW4B 4X8QA 3UIOC 3UTMA 5E75A 3L54A 5EN5D 1N95A 5FQ8A 1TNZA 2L0IA 4I2ZA 4EHMA 2PZIA 1UOHA 4JHJA 4CGWA 4ZFHA 3E30A 4NQ0A 1N4SA 3ML8A 3FU0A 3BQOA 2GRLA 3KEZA 1NZNA 3CSTA 3UKUG 3UM1A 2LUHA 2XRZA 3FUMA 5G04C 5HRYA 4JHRA 1NL4A 3NAWA 4BEPA 2XHEA 4KYOB 1N4RA 2IF4A 2B6CA 4F1SA 3EJNA 2LNIA 5ARFA 3FUJA 3MKQB 3DSVA 5EX0A 4A1SA 2P2CP 5DIZA 2XPZA 3FTYA 1AWCB 2KCKA 3SZ7A 5KNHD 2HM8A 1TJFA 1WM5A 4JVSA 1L5JA 4XI9A 4KXKB 2VQ2A 3N71A 2WQ6A 4I1MA 1WY6A 3LY7A 3DSWA 4ANXA 2A4ZA 3TJPA 3IXEA 4GTQA 3TG5A 4J8FA 4LRZA 1OUVA 2WXQA 5JMND 4BESA 3CKCA 3NOCD 2GW1A 3LYAA 4LNUD 5A7DB 3C98A 3EHRA 1IQRA 3SFXA 1H6PA 1Z3YA 5CHEE 3ZU7B 4U04A 3QWWA 5AENA 3NBNB 1JCQA 3TL5A 1MX4A 2XS1A 3ONLA 3TWRA 3MCXA 1PAQA 2FEZA 2XGMA 1TR4A 4B94A 3UXGA 3AJIA 2OOEA 3HVEB 3DXKG 3TAXA 2VTBA 4I17A 2IOLA 4K0RA 3JUEA 3ASDA 3G2UA 2XEHA 3D9IA 4HRMB 2YHEA 5B1AE 3IHYA 3ASNE 1TJCA 2OEWA 4AIFA 1E7UA 2WXOA 1N54A 4ACKA 4HXIA 2WXNA 3D9OA 4LSZE 4FLHA 2R17C 5G2NA 3RKVA 4EECA 4G24A 5CBOA 4GTMA 1N52A 2A5UA 5T8IA 1JUQA 3UKRG 2P58C 5ANLA 3UM3A 4JEHA 3QDNA 4TUMA 5A6CA 4U95D 4K5BA 4L2YA 1H2TC 2R05A 2PQNA 3G2WA 1Y8MA 2UY1B 3NZSA 3PVLA 3NZUA 2LSUA 3CR3A 3SI5A 2EIME 4TXRA 4H7XA 1K1BA 5EILA 4I6JA 4LERA 3APCA 3FDHA 4GMLA 1WDYA 2R2LA 2RG8A 3ULYA 4GZDA 3ABME 3FHEA 1YYHA 2HE0A 1Z6TA 3EDTB 1BLXB 3L17A 4KZCA 1TEZA 4UQXA 3ZEFA 4GZ3A 4LCTA 1INZA 2J07A 4ZHBA 5ENNA 3OTNA 2GRPB 3Q79A 3WXXA 2GRRB 2I9CA 3Q75A 5AJDA 3FEXA 3UM2A 2EIJE 4GPMA 3LEWA 4JW1A 2CHZA 4HRLA 2HO1A 3KAEA 2QC9A 3CQGB 3FUFA 2WXRA 1HG5A 2PNNA 3U3WA 2I6HA 2QZAA 5FINA 2DYSE 2H6GA 3MYVA 5D66A 3LDZA 2Y1LE 3D9KA 3UUXA 3QAQA 3TXMA 1SQMA 1HS6A 4EZJA 3VLEA 4WNDA 5AQBA 4A63B 1SA5A 2C0LA 1UG3A 3SHFA 1N0QA 5EYLA 2WB2A 3J5QB 1X81A 2R02A 4JL0A 4K03A 2I2OA 1H19A 1QNFA 4GCOA 4HNAD 3B7BA 3TG4A 5E76A 1E7VA 4EPZA 2KATA 3DSSA 3DSTA 3HG0D 3ISMC 3F6QA 2H6IA 3CKBA 2J8SD 3JXIA 2X6HA 4GB9A 3DBSA 5FTPA 4A3VA 5CCLA 3NOGD 2NC9A 1ELWA 1MX6A 1V54E 2WPVA 5AQ7A 2WQHA 1E96B 1LD7A 4HFGA 4FHJA 3NF1A 5HKPA 3KS2A 3B7SA 3CIAA 2H6HA 1HXIA 4DX2A 2GRQB 3QK0A 1SA4A 4YDYA 2VGYA 2X3MA 3EIQC 3JQ0A 4NURA 3FWVA 2V5FA 5BXOA 1PY1A 3HXFA 5ENRD 5D2MC 3E37A 4HI9A 3S7DA 4FADA 4PS8A 4V3IA 4G8LA 3ULEG 4RVBA 2P9UG 5AARA 4OAUC 5EIDA 5JJTA 3FU5A 4MLPA 5DBKA 3FUEA 1IXVA 4W9RA 1ELRA 1N4PA 1N94A 2OEVA 3FTVA 4B8AA 1IHBA 5FQ6A 3ZYMA 3OXGA 4ANVA 5ENSD 2VJ8A 2ZU6B 3EUVA 4IYPA 2Y4UA 1S0PA 4B8CB 3B7RL 3TWTA 4BT9A 3RU0A 3V31A 1KZPA 3DXMG 3ZYKA 3PREA 4IN3B 4CGVA 3IBEA 4KVOA 2V4HC 4F3VA 4CDRA 3PZDA 4XKBA 4Q94A 1E8WA 4TXQA 3SY2A 3FP3A 4N5QA 2XEEA 4URKA 3PEUB 2L6BA 2I1KA 4FLBA 3T8KA 4DUIA 1KPSB 4B0ZA 4E6HA 1OCOE 1E90A 4CEMA 3EHNA 3V2XA 1IHGA 2GRMA 1MZCA 2CHWA 4U7EB 2J49A 1D8EA 4N2SA 3ABKE 3UPVA 3CVWA 1N11A 3JXJA 4J6IA 2L6JA 2R03A 3FH8A 4JZYA 4HOQA 3RO2A 2F0YA 5EYPF 3CV0A 1UN9A 2CHXA 2LSVA 3J5PA 2BF0X 2QFCA 2P9SG 1ZB1A 4YVOA 3RK6A 4CZ2D 1HU3A 3PE3A 2HYZA 4FJYA 4LEUA 3FFLA 3ZRHA 5CRVA 3UT8A 1NFIE 5HS0A 4ABNA 3HRAA 3PZ4A 1U3CA 2XGSA 4UQZA 3UX4A 4LNGA 3I4RB 2A5EA 4MS6A 2WXPA 2X38A 3MKRA 3EHMA 5KNGA 1S63A 4EQFA 4EZLA 4JD2G 2WXFA 3LVRE 4KVMA 4FP7A 4XKCA 2X6FA 4C48B 3E32A 4DX6D 5T3RA 2RFMA 1B89A 4U0SA 4GYOA 3PZ2A 1UJKA 2XPYA 5EKQD 3JUIA 1HF8A 2IJGX 3CK9A 1XNFA 3R7QA 2WMNA 3Q4AB 2XS8A 4PS3A 1LD8A 3DRAA 4N39A 2CFUA 3ESLA 4O6FA 4QFVA 3WG7E 3LY9A 1KZOA 3BU8A 2NSZA 3V30A 4AY5A 2XPIA 3LVQE 4CCAA 1DC2A 3CHQA 3T9KA 1A5EA 1EPUA 3QOUA 4RSYA 3ZHEB 3B7TA 1RW2A 5BPPA 5FZQA 5KBAA 1OXJA 1S64A 2P9LG 4DX5D 4UWFA 2RD0A 3D9MA 3RO3A 3D9LA 4BFRA 4J8SA 3NB2A 3FUIA 4ILHB 1Y6IA 2FO7A 3GZ2A 1U2VG 3EU9A 3HIZA 4B89A 3B13A 3R9MA 2UWJG 4G26A 2B0OE 2J08A 1JWFA 1FVFA 3U66A 2LXMA 5J90A 3ZGQA 2MRIA 2VSYA 4BT8A 1YCSB 3UMVA 2ZXWE 1QBQA 3KEAA 2FI7A 3DEPA 2GRNB 4Y6WA 3VTYA 5BXUA 4K5AB 1XGWA 2WXLA 4M3OA 5AJLA 2DZOA 2WXGA 3RIBA 2X6KA 3W9FA 1FT2A 3UM0A 2LAIA 2V8SE 3C72A 1DNPA 4FHKA 3CHRA 3PEVB 4WWPA 4G23A 1S70B 3RJVA 4JB8P 1TNUA 4BWRA 3L22A 4LG6A 1OT8A 1DCEA 2YQ8A 3U9WA 5LCWC 2VGXB 3FUKA 3FTXA 3P1UA 3AS4A 3QWPA 1BU9A 4U0ZA 2IQCA 1MHQA 4BTBA 3ZPJA 3C3RA 3R9AB 4HRNA 3G2VA 5AN8A 2M63A 1BPOA 2DIWA 1MQSA 1OY3D 4L1BA 4O60A 5CECB 1NA0A 2LO6A 4XI0A 4DLQA 2EILE 3MV2B 5FWQA 1D8DA 3S7BA 4I9CA 4ILIA 2JEKA 1WG0A 4HB5A 3CQCB 4Q69A 3PZ1A 2R5SA 4F6RD 4JXTA 4GMJA 2C0MA 4N3AA 5LCWJ 4U0UA 3PZ3A 5CMWA 1N9AA 4TXPA 3EHQA 3O48A 3OXLA 1O1TA 3NQPA 5EDSA 4AVXA 3R7RA 4L2LA 2VSXE 3LJNA 3LPZA 4HBDA 2H6FA 4DLOA 2FO1E 2GROB 4TRQA 4Y6CA 4U8YD 3E33A 4NIKA 3D3MA 2VGEA 4I6EA 4OAVB 3TWQA 2KZTB 2R59A 1UJJA 3UI2A 1MJ0A 4GTSA 2XCCA 5BV0A 3O4ZA 4C0MA 3ZFWA 2ZISA 3TWVA 3MKQA 4HLLA 3CHPA 3URZA 1N4QA 4XE0A 4KZ0A 4A55A 3IEGA 3AU4A 4BETA 5J08A 2DBAA 5JHAA 2AWIA 4JHKA 3ZVVA 3QB2A 1SVXA 3AU5A 1FVHA 1TN7A 3ZUVB 1BI7B 2P9PG 2V5QC 5FIOA 3LJ3A 1BI8B 5CRUA 2Y4TA 3ZXSA 1EF1C 4HORA 5KWDA 3SFZA 3AG4E 2XGOA 2L0TB 1RZ4A 5KJLA 2JLBA 3S7FA 4IULA 5AQAA 1QQEA 4GYWA 3CEQA 2FF4A 3ASOE 4UWLA 4UI9J 3LKUA 4GZCA 1FPPA 3FU6A 4U63A 1OWMA 4WUYA 4MRUA 1G3NB 3JQ1A 4GZ5A 3CVVA 2C2LA 3SQVA 2VSOE 2ZIRA 3GZSA 4UWGA 3HVEA 1TN6A 3LS8A 3SNXA 4UQYA 4OYSA 2EINE 3TWSA 1OCRE 5HI7A 3PUKA 4I2WA 2Q7FA 5JHBA 1HFAA 5IY5E 2IU1A 2AVPA 2DCPA 4HS2A 4L7TA 2Y69E 5FT9A 3UT7A 3CVQA 3DPDA 4C0EA 2OVBA 3APDA 3MEKA 2YHCA 4JEUA 3KSQA 4U96D 1HE8A 3ML9A 4PDXA 4GCNA 3S7JA 4BTAA 3TXNA 3AG2E 4GA2A 2EQXA 3ESKA 5CERB 2F37A 2X6JA 1IQUA 3DSUA 2UY1A 3JYSA 2MOWA 1OWPA 1AP7A 3ASGA 1U3DA 2XRYA 2LXLA 4OVVA 2VTBB 2RFAA 2IY0C 1Z5SC 3QWVA 4H7YA 4FC8A 4RQIA 4PH4B 4ILGA 1LF8A 2WXMA 3ASFA 5CCMA 2RKKA 3Q78A 3DWLG 4BX8A 5CEDB 3PH0C 3PNTB 4XIFA 3U64A 2V4LA 4XX5A 2VYIA 3MJWA 4HOUA 4LNBA 4DI4A 5FZRA 3OXFA 3PRZA 4E85A 1YA0A 3ONKA 4GAAA 4DX7D 2BTDA 2QY7A 2XZTG 3T5XA 4A3TA 3DPYA 5FQ4A 2X6IA 3HHMA 4CT4A 4AM9A 5CMYA 4WWNA 2IO2C 5AQ9A 5FQ7A 4Z68A 4GU5A 2P9NG 2GGFA 3D9PA 5JJ7A 2CG3A 2DWZA 3X2QE 4ATZD 3CLJA 4L23A 3FY4A 2KM4A 3ZNGA 3FUDA 4I43A 3MZLB 2J9QA 4G8KA 3D9NA 1MYOA 3ZYLA 2V0PA 3UIPC 2IOSA 3HXCA 2HR2A 1V55E 5FJYA 2ONDA 4GTPA 3SBSA 2XQ0A 1Q2ZA 1QYMA 5KJMA 4WNGA 3RRMB 3UQ3A 4G11A 2DZNA 3Q47B 1X5BA 5D0OD 4GTRA 3ZN3A 3LXUX 3FTWA 4EBAG 4GA1A 4NACA 2ZGDA 4UWKA 3D9JA 2PM6A 3APFA 4XEIG 4DJAA 4IRUA 4MKTA 2ZGGA 3ZYQA 4BSZB 4DX1A 3AG3E 3AS5A 3CVUA 3CK7A 2BUGA 3IV0A 1K8KG 4KBQA 4GPKA 3CHMA 2EIKE 5FZSA 1H0AA 2AXZA 4FU3A 2FULA 2L9BA 1JWGA 1TYQG
chains in the Genus database with same CATH topology
3UM0A 3C3QA 4JIOA 3ULYA 1ZB1A 2XS1A 2R03A 2OEXA 2R02A 2R05A 3C3RA 2XS8A 3UM2A 2OEVA 3ZXPA 2OEWA 3R9MA 5CRUA 3UM1A 3UM3A 3RAUA 3C3OA 5CRVA 2OJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UM0 A;  3C3Q A;  3ULY A;  1ZB1 A;  2XS1 A;  2R03 A;  2R05 A;  2R02 A;  3C3R A;  2XS8 A;  3UM2 A;  2OEV A;  3ZXP A;  2OEW A;  3R9M A;  5CRU A;  3UM1 A;  3UM3 A;  3RAU A;  3C3O A;  5CRV A; 
#chains in the Genus database with same CATH topology
 2XZD G;  2J4D A;  4DK5 A;  4XZ4 A;  3ULQ A;  4AXH A;  3AG1 E;  1Z3X A;  3UT4 A;  4PUC A;  5BUZ A;  3ZKJ A;  5G05 C;  3SGH A;  2YNQ A;  3RAU A;  1DVP A;  1NI1 A;  5HQ8 A;  5LX8 A;  3C3Q A;  1FCH A;  1KT0 A;  4N3B A;  3JCK C;  3MV3 B;  3KSL A;  3ZXP A;  3Q9N C;  3AAA C;  4EBA A;  2AXV A;  3CVL A;  5ENT D;  3QJZ A;  1HO8 A;  1O1S A;  1H6O A;  4LUN U;  3V2O A;  4ANU A;  5G04 J;  3HXB A;  3FUH A;  3QKY A;  5CEA A;  2BKK B;  1OCC E;  3CHS A;  1OCZ E;  4UI9 K;  5KJK A;  4N3C A;  4HOT A;  4FA6 A;  1JPL A;  4U07 A;  3T5V A;  3U4T A;  2Y3A A;  4ATG A;  3SO8 A;  1HH8 A;  4GYY A;  1ELK A;  3CVY A;  2NYJ A;  3ABL E;  2AW6 A;  4CT0 A;  1O1R A;  3FH5 A;  4O1O A;  5G05 J;  4RG9 A;  1WAO 1;  3E4B A;  2CG2 A;  2WQ7 A;  3IHV A;  4ACL A;  4AV7 A;  1TN8 A;  4HQD A;  5JA4 D;  4APO A;  4CDM A;  3CK8 A;  3E34 A;  5EIB E;  3HXE A;  3L08 A;  4ME2 A;  1GW6 A;  3K9I A;  1KT1 A;  3TWX A;  1BD8 A;  2XEN A;  4U8V D;  3MA5 A;  5ITZ F;  5AYW D;  2KBX A;  3P2B A;  3FEY A;  2PL2 A;  5LP0 A;  3VLD A;  4DI3 A;  4BSX A;  4I1O B;  2P9K G;  2VSN A;  2PM7 A;  3BG0 B;  2Y0B G;  3MX3 A;  2BED A;  3ENE A;  2KC7 A;  5BV1 A;  3CVN A;  3T8M A;  4G2V A;  2ILR A;  3RRU A;  1JCS A;  1HZ4 A;  5JJ6 A;  3L16 A;  4M7C A;  2ETC A;  2KXP C;  2ETA A;  3PDN A;  2F8X K;  3L9T A;  3ZW3 A;  4GZ6 A;  4I1A A;  4BER A;  2PQR A;  1DCQ A;  5M72 A;  4B93 B;  3CHO A;  1NA3 A;  5AAO A;  2IEJ A;  1H2U A;  2IFU A;  1JCR A;  5AIJ A;  3L82 A;  5ENQ D;  5ARG A;  3B7U X;  1LTX A;  3FH7 A;  3FTS A;  4BX9 A;  2E2E A;  4F53 A;  3BEE A;  2LAH A;  3Q7A A;  3I3N A;  5G55 A;  1W3B A;  3CSF A;  4YDW A;  5B1B E;  4G1T A;  2WM9 A;  5C1D A;  3SFY A;  5CBN A;  1TNB A;  3PS6 A;  4GTV A;  2MYO A;  2XEV A;  3VTX A;  4UI9 C;  4OVU A;  3FU3 A;  4TUU A;  4J0U A;  3GZ1 A;  3DEO A;  4F7A A;  2DYR E;  3Q7F A;  3V79 K;  1TNY A;  4FJZ A;  1EYH A;  4KT6 B;  3Q73 A;  1NP7 A;  2I1J A;  2E0I A;  4N2Q A;  3RSE G;  3BUA A;  4CDN A;  2WXH A;  3Q9U C;  3FTZ A;  4J8D A;  3TWU A;  5A23 A;  5H7P A;  3S2A A;  3ZIM A;  5BNW A;  2IO3 C;  3ZHE A;  3I4G A;  4AOF A;  3EIJ A;  4N5C A;  4CRW A;  2QYJ A;  4HLE A;  4TV3 A;  1ZBP A;  5LFA A;  3D9H A;  1QZ2 A;  1E8X A;  4R7L A;  4DPR A;  2OV8 A;  4J8E A;  4C9B B;  4AEZ C;  3Q5M A;  3VLF A;  4JPS A;  4WWO A;  4HI8 A;  1SW6 A;  3QNK A;  4GMR A;  2AXU A;  4BY6 A;  2YIN A;  4U8H A;  4ANW A;  4WNE A;  1E8Z A;  3MGB A;  4K5C A;  1K1A A;  5ENO D;  5C2Y A;  3IKO B;  5D0Q D;  5BW8 C;  3Q15 A;  5ENP D;  1UN8 A;  3CVP A;  3KD7 A;  3W9G A;  4UUC A;  4HOS A;  3CVX A;  1D9S A;  2ION A;  2AJA A;  1EDU A;  1HX8 A;  1SZ9 A;  2XCB A;  2JAB A;  2WXJ A;  3RRN B;  1E8Y A;  4UWH A;  3L6A A;  3C3O A;  4AY6 A;  2OCC E;  1IYG A;  1OWO A;  1ZU2 A;  4I6G A;  3UIN C;  5EX3 A;  5KJN A;  3QC1 A;  4AP2 A;  3EU5 A;  2CFZ A;  4YND A;  4HVB A;  4JA9 A;  2VGX A;  4AJW A;  2J09 A;  1O5M A;  3OAW A;  3SD5 A;  3CGH A;  3PUJ A;  4WNF A;  3QAR A;  1PC2 A;  1K3Z D;  4QQI A;  2WXK A;  4YDE A;  1MX2 A;  1P5Q A;  1FT1 A;  1HG2 A;  2WMO A;  3PNL B;  2KCV A;  4A1G A;  1YMP A;  1N0R A;  3AS8 A;  3SBT B;  5ANR A;  5LOZ A;  4APF A;  3GYZ A;  5BT1 A;  2P9I G;  4MBG A;  4WAF A;  2FBN A;  3LCA A;  1SZA A;  4GTO A;  3BG1 B;  4CYM D;  4O1P A;  1KLX A;  3L13 A;  2J4B A;  4J7W A;  4RLY A;  4YDO A;  3DSX A;  4F1P A;  5KCM A;  4JC8 A;  2F8Y A;  3FTU A;  4G25 A;  2ETB A;  4DRX E;  4KMO A;  2KCL A;  2NXP A;  3C5R A;  2WVI A;  4J8Y A;  2QYU A;  3SF4 A;  4EZK A;  4NRH B;  3B95 A;  3ASH A;  4GTT A;  3HDX A;  3FUN A;  3GW4 A;  1OWL A;  3LY8 A;  2BKG A;  4P29 A;  3FUL A;  4YVQ C;  3HXD A;  3HYM B;  2KZT A;  3G2S A;  2MHK A;  4PS7 A;  4FUL A;  4RG6 A;  1A17 A;  3TWW A;  1OWN A;  1VDY A;  3PE4 A;  1IKN D;  2OVF A;  4JA7 A;  1TNO A;  4Q96 A;  1H2V C;  4I9E A;  5T4Y A;  2DVW A;  4L9P A;  2WXI A;  3TGO A;  3I5P A;  4GA0 A;  3Q49 B;  1H6K A;  5B3S E;  4D10 C;  3G2T A;  1UW4 B;  4X8Q A;  3UIO C;  3UTM A;  5E75 A;  3L54 A;  5EN5 D;  1N95 A;  5FQ8 A;  1TNZ A;  2L0I A;  4I2Z A;  4EHM A;  2PZI A;  1UOH A;  4JHJ A;  4CGW A;  4ZFH A;  3E30 A;  4NQ0 A;  1N4S A;  3ML8 A;  3FU0 A;  3BQO A;  2GRL A;  3KEZ A;  1NZN A;  3CST A;  3UKU G;  3UM1 A;  2LUH A;  2XRZ A;  3FUM A;  5G04 C;  5HRY A;  4JHR A;  1NL4 A;  3NAW A;  4BEP A;  2XHE A;  4KYO B;  1N4R A;  2IF4 A;  2B6C A;  4F1S A;  3EJN A;  2LNI A;  5ARF A;  3FUJ A;  3MKQ B;  3DSV A;  5EX0 A;  4A1S A;  2P2C P;  5DIZ A;  2XPZ A;  3FTY A;  1AWC B;  2KCK A;  3SZ7 A;  5KNH D;  2HM8 A;  1TJF A;  1WM5 A;  4JVS A;  1L5J A;  4XI9 A;  4KXK B;  2VQ2 A;  3N71 A;  2WQ6 A;  4I1M A;  1WY6 A;  3LY7 A;  3DSW A;  4ANX A;  2A4Z A;  3TJP A;  3IXE A;  4GTQ A;  3TG5 A;  4J8F A;  4LRZ A;  1OUV A;  2WXQ A;  5JMN D;  4BES A;  3CKC A;  3NOC D;  2GW1 A;  3LYA A;  4LNU D;  5A7D B;  3C98 A;  3EHR A;  1IQR A;  3SFX A;  1H6P A;  1Z3Y A;  5CHE E;  3ZU7 B;  4U04 A;  3QWW A;  5AEN A;  3NBN B;  1JCQ A;  3TL5 A;  1MX4 A;  2XS1 A;  3ONL A;  3TWR A;  3MCX A;  1PAQ A;  2FEZ A;  2XGM A;  1TR4 A;  4B94 A;  3UXG A;  3AJI A;  2OOE A;  3HVE B;  3DXK G;  3TAX A;  2VTB A;  4I17 A;  2IOL A;  4K0R A;  3JUE A;  3ASD A;  3G2U A;  2XEH A;  3D9I A;  4HRM B;  2YHE A;  5B1A E;  3IHY A;  3ASN E;  1TJC A;  2OEW A;  4AIF A;  1E7U A;  2WXO A;  1N54 A;  4ACK A;  4HXI A;  2WXN A;  3D9O A;  4LSZ E;  4FLH A;  2R17 C;  5G2N A;  3RKV A;  4EEC A;  4G24 A;  5CBO A;  4GTM A;  1N52 A;  2A5U A;  5T8I A;  1JUQ A;  3UKR G;  2P58 C;  5ANL A;  3UM3 A;  4JEH A;  3QDN A;  4TUM A;  5A6C A;  4U95 D;  4K5B A;  4L2Y A;  1H2T C;  2R05 A;  2PQN A;  3G2W A;  1Y8M A;  2UY1 B;  3NZS A;  3PVL A;  3NZU A;  2LSU A;  3CR3 A;  3SI5 A;  2EIM E;  4TXR A;  4H7X A;  1K1B A;  5EIL A;  4I6J A;  4LER A;  3APC A;  3FDH A;  4GML A;  1WDY A;  2R2L A;  2RG8 A;  3ULY A;  4GZD A;  3ABM E;  3FHE A;  1YYH A;  2HE0 A;  1Z6T A;  3EDT B;  1BLX B;  3L17 A;  4KZC A;  1TEZ A;  4UQX A;  3ZEF A;  4GZ3 A;  4LCT A;  1INZ A;  2J07 A;  4ZHB A;  5ENN A;  3OTN A;  2GRP B;  3Q79 A;  3WXX A;  2GRR B;  2I9C A;  3Q75 A;  5AJD A;  3FEX A;  3UM2 A;  2EIJ E;  4GPM A;  3LEW A;  4JW1 A;  2CHZ A;  4HRL A;  2HO1 A;  3KAE A;  2QC9 A;  3CQG B;  3FUF A;  2WXR A;  1HG5 A;  2PNN A;  3U3W A;  2I6H A;  2QZA A;  5FIN A;  2DYS E;  2H6G A;  3MYV A;  5D66 A;  3LDZ A;  2Y1L E;  3D9K A;  3UUX A;  3QAQ A;  3TXM A;  1SQM A;  1HS6 A;  4EZJ A;  3VLE A;  4WND A;  5AQB A;  4A63 B;  1SA5 A;  2C0L A;  1UG3 A;  3SHF A;  1N0Q A;  5EYL A;  2WB2 A;  3J5Q B;  1X81 A;  2R02 A;  4JL0 A;  4K03 A;  2I2O A;  1H19 A;  1QNF A;  4GCO A;  4HNA D;  3B7B A;  3TG4 A;  5E76 A;  1E7V A;  4EPZ A;  2KAT A;  3DSS A;  3DST A;  3HG0 D;  3ISM C;  3F6Q A;  2H6I A;  3CKB A;  2J8S D;  3JXI A;  2X6H A;  4GB9 A;  3DBS A;  5FTP A;  4A3V A;  5CCL A;  3NOG D;  2NC9 A;  1ELW A;  1MX6 A;  1V54 E;  2WPV A;  5AQ7 A;  2WQH A;  1E96 B;  1LD7 A;  4HFG A;  4FHJ A;  3NF1 A;  5HKP A;  3KS2 A;  3B7S A;  3CIA A;  2H6H A;  1HXI A;  4DX2 A;  2GRQ B;  3QK0 A;  1SA4 A;  4YDY A;  2VGY A;  2X3M A;  3EIQ C;  3JQ0 A;  4NUR A;  3FWV A;  2V5F A;  5BXO A;  1PY1 A;  3HXF A;  5ENR D;  5D2M C;  3E37 A;  4HI9 A;  3S7D A;  4FAD A;  4PS8 A;  4V3I A;  4G8L A;  3ULE G;  4RVB A;  2P9U G;  5AAR A;  4OAU C;  5EID A;  5JJT A;  3FU5 A;  4MLP A;  5DBK A;  3FUE A;  1IXV A;  4W9R A;  1ELR A;  1N4P A;  1N94 A;  2OEV A;  3FTV A;  4B8A A;  1IHB A;  5FQ6 A;  3ZYM A;  3OXG A;  4ANV A;  5ENS D;  2VJ8 A;  2ZU6 B;  3EUV A;  4IYP A;  2Y4U A;  1S0P A;  4B8C B;  3B7R L;  3TWT A;  4BT9 A;  3RU0 A;  3V31 A;  1KZP A;  3DXM G;  3ZYK A;  3PRE A;  4IN3 B;  4CGV A;  3IBE A;  4KVO A;  2V4H C;  4F3V A;  4CDR A;  3PZD A;  4XKB A;  4Q94 A;  1E8W A;  4TXQ A;  3SY2 A;  3FP3 A;  4N5Q A;  2XEE A;  4URK A;  3PEU B;  2L6B A;  2I1K A;  4FLB A;  3T8K A;  4DUI A;  1KPS B;  4B0Z A;  4E6H A;  1OCO E;  1E90 A;  4CEM A;  3EHN A;  3V2X A;  1IHG A;  2GRM A;  1MZC A;  2CHW A;  4U7E B;  2J49 A;  1D8E A;  4N2S A;  3ABK E;  3UPV A;  3CVW A;  1N11 A;  3JXJ A;  4J6I A;  2L6J A;  2R03 A;  3FH8 A;  4JZY A;  4HOQ A;  3RO2 A;  2F0Y A;  5EYP F;  3CV0 A;  1UN9 A;  2CHX A;  2LSV A;  3J5P A;  2BF0 X;  2QFC A;  2P9S G;  1ZB1 A;  4YVO A;  3RK6 A;  4CZ2 D;  1HU3 A;  3PE3 A;  2HYZ A;  4FJY A;  4LEU A;  3FFL A;  3ZRH A;  5CRV A;  3UT8 A;  1NFI E;  5HS0 A;  4ABN A;  3HRA A;  3PZ4 A;  1U3C A;  2XGS A;  4UQZ A;  3UX4 A;  4LNG A;  3I4R B;  2A5E A;  4MS6 A;  2WXP A;  2X38 A;  3MKR A;  3EHM A;  5KNG A;  1S63 A;  4EQF A;  4EZL A;  4JD2 G;  2WXF A;  3LVR E;  4KVM A;  4FP7 A;  4XKC A;  2X6F A;  4C48 B;  3E32 A;  4DX6 D;  5T3R A;  2RFM A;  1B89 A;  4U0S A;  4GYO A;  3PZ2 A;  1UJK A;  2XPY A;  5EKQ D;  3JUI A;  1HF8 A;  2IJG X;  3CK9 A;  1XNF A;  3R7Q A;  2WMN A;  3Q4A B;  2XS8 A;  4PS3 A;  1LD8 A;  3DRA A;  4N39 A;  2CFU A;  3ESL A;  4O6F A;  4QFV A;  3WG7 E;  3LY9 A;  1KZO A;  3BU8 A;  2NSZ A;  3V30 A;  4AY5 A;  2XPI A;  3LVQ E;  4CCA A;  1DC2 A;  3CHQ A;  3T9K A;  1A5E A;  1EPU A;  3QOU A;  4RSY A;  3ZHE B;  3B7T A;  1RW2 A;  5BPP A;  5FZQ A;  5KBA A;  1OXJ A;  1S64 A;  2P9L G;  4DX5 D;  4UWF A;  2RD0 A;  3D9M A;  3RO3 A;  3D9L A;  4BFR A;  4J8S A;  3NB2 A;  3FUI A;  4ILH B;  1Y6I A;  2FO7 A;  3GZ2 A;  1U2V G;  3EU9 A;  3HIZ A;  4B89 A;  3B13 A;  3R9M A;  2UWJ G;  4G26 A;  2B0O E;  2J08 A;  1JWF A;  1FVF A;  3U66 A;  2LXM A;  5J90 A;  3ZGQ A;  2MRI A;  2VSY A;  4BT8 A;  1YCS B;  3UMV A;  2ZXW E;  1QBQ A;  3KEA A;  2FI7 A;  3DEP A;  2GRN B;  4Y6W A;  3VTY A;  5BXU A;  4K5A B;  1XGW A;  2WXL A;  4M3O A;  5AJL A;  2DZO A;  2WXG A;  3RIB A;  2X6K A;  3W9F A;  1FT2 A;  3UM0 A;  2LAI A;  2V8S E;  3C72 A;  1DNP A;  4FHK A;  3CHR A;  3PEV B;  4WWP A;  4G23 A;  1S70 B;  3RJV A;  4JB8 P;  1TNU A;  4BWR A;  3L22 A;  4LG6 A;  1OT8 A;  1DCE A;  2YQ8 A;  3U9W A;  5LCW C;  2VGX B;  3FUK A;  3FTX A;  3P1U A;  3AS4 A;  3QWP A;  1BU9 A;  4U0Z A;  2IQC A;  1MHQ A;  4BTB A;  3ZPJ A;  3C3R A;  3R9A B;  4HRN A;  3G2V A;  5AN8 A;  2M63 A;  1BPO A;  2DIW A;  1MQS A;  1OY3 D;  4L1B A;  4O60 A;  5CEC B;  1NA0 A;  2LO6 A;  4XI0 A;  4DLQ A;  2EIL E;  3MV2 B;  5FWQ A;  1D8D A;  3S7B A;  4I9C A;  4ILI A;  2JEK A;  1WG0 A;  4HB5 A;  3CQC B;  4Q69 A;  3PZ1 A;  2R5S A;  4F6R D;  4JXT A;  4GMJ A;  2C0M A;  4N3A A;  5LCW J;  4U0U A;  3PZ3 A;  5CMW A;  1N9A A;  4TXP A;  3EHQ A;  3O48 A;  3OXL A;  1O1T A;  3NQP A;  5EDS A;  4AVX A;  3R7R A;  4L2L A;  2VSX E;  3LJN A;  3LPZ A;  4HBD A;  2H6F A;  4DLO A;  2FO1 E;  2GRO B;  4TRQ A;  4Y6C A;  4U8Y D;  3E33 A;  4NIK A;  3D3M A;  2VGE A;  4I6E A;  4OAV B;  3TWQ A;  2KZT B;  2R59 A;  1UJJ A;  3UI2 A;  1MJ0 A;  4GTS A;  2XCC A;  5BV0 A;  3O4Z A;  4C0M A;  3ZFW A;  2ZIS A;  3TWV A;  3MKQ A;  4HLL A;  3CHP A;  3URZ A;  1N4Q A;  4XE0 A;  4KZ0 A;  4A55 A;  3IEG A;  3AU4 A;  4BET A;  5J08 A;  2DBA A;  5JHA A;  2AWI A;  4JHK A;  3ZVV A;  3QB2 A;  1SVX A;  3AU5 A;  1FVH A;  1TN7 A;  3ZUV B;  1BI7 B;  2P9P G;  2V5Q C;  5FIO A;  3LJ3 A;  1BI8 B;  5CRU A;  2Y4T A;  3ZXS A;  1EF1 C;  4HOR A;  5KWD A;  3SFZ A;  3AG4 E;  2XGO A;  2L0T B;  1RZ4 A;  5KJL A;  2JLB A;  3S7F A;  4IUL A;  5AQA A;  1QQE A;  4GYW A;  3CEQ A;  2FF4 A;  3ASO E;  4UWL A;  4UI9 J;  3LKU A;  4GZC A;  1FPP A;  3FU6 A;  4U63 A;  1OWM A;  4WUY A;  4MRU A;  1G3N B;  3JQ1 A;  4GZ5 A;  3CVV A;  2C2L A;  3SQV A;  2VSO E;  2ZIR A;  3GZS A;  4UWG A;  3HVE A;  1TN6 A;  3LS8 A;  3SNX A;  4UQY A;  4OYS A;  2EIN E;  3TWS A;  1OCR E;  5HI7 A;  3PUK A;  4I2W A;  2Q7F A;  5JHB A;  1HFA A;  5IY5 E;  2IU1 A;  2AVP A;  2DCP A;  4HS2 A;  4L7T A;  2Y69 E;  5FT9 A;  3UT7 A;  3CVQ A;  3DPD A;  4C0E A;  2OVB A;  3APD A;  3MEK A;  2YHC A;  4JEU A;  3KSQ A;  4U96 D;  1HE8 A;  3ML9 A;  4PDX A;  4GCN A;  3S7J A;  4BTA A;  3TXN A;  3AG2 E;  4GA2 A;  2EQX A;  3ESK A;  5CER B;  2F37 A;  2X6J A;  1IQU A;  3DSU A;  2UY1 A;  3JYS A;  2MOW A;  1OWP A;  1AP7 A;  3ASG A;  1U3D A;  2XRY A;  2LXL A;  4OVV A;  2VTB B;  2RFA A;  2IY0 C;  1Z5S C;  3QWV A;  4H7Y A;  4FC8 A;  4RQI A;  4PH4 B;  4ILG A;  1LF8 A;  2WXM A;  3ASF A;  5CCM A;  2RKK A;  3Q78 A;  3DWL G;  4BX8 A;  5CED B;  3PH0 C;  3PNT B;  4XIF A;  3U64 A;  2V4L A;  4XX5 A;  2VYI A;  3MJW A;  4HOU A;  4LNB A;  4DI4 A;  5FZR A;  3OXF A;  3PRZ A;  4E85 A;  1YA0 A;  3ONK A;  4GAA A;  4DX7 D;  2BTD A;  2QY7 A;  2XZT G;  3T5X A;  4A3T A;  3DPY A;  5FQ4 A;  2X6I A;  3HHM A;  4CT4 A;  4AM9 A;  5CMY A;  4WWN A;  2IO2 C;  5AQ9 A;  5FQ7 A;  4Z68 A;  4GU5 A;  2P9N G;  2GGF A;  3D9P A;  5JJ7 A;  2CG3 A;  2DWZ A;  3X2Q E;  4ATZ D;  3CLJ A;  4L23 A;  3FY4 A;  2KM4 A;  3ZNG A;  3FUD A;  4I43 A;  3MZL B;  2J9Q A;  4G8K A;  3D9N A;  1MYO A;  3ZYL A;  2V0P A;  3UIP C;  2IOS A;  3HXC A;  2HR2 A;  1V55 E;  5FJY A;  2OND A;  4GTP A;  3SBS A;  2XQ0 A;  1Q2Z A;  1QYM A;  5KJM A;  4WNG A;  3RRM B;  3UQ3 A;  4G11 A;  2DZN A;  3Q47 B;  1X5B A;  5D0O D;  4GTR A;  3ZN3 A;  3LXU X;  3FTW A;  4EBA G;  4GA1 A;  4NAC A;  2ZGD A;  4UWK A;  3D9J A;  2PM6 A;  3APF A;  4XEI G;  4DJA A;  4IRU A;  4MKT A;  2ZGG A;  3ZYQ A;  4BSZ B;  4DX1 A;  3AG3 E;  3AS5 A;  3CVU A;  3CK7 A;  2BUG A;  3IV0 A;  1K8K G;  4KBQ A;  4GPK A;  3CHM A;  2EIK E;  5FZS A;  1H0A A;  2AXZ A;  4FU3 A;  2FUL A;  2L9B A;  1JWG A;  1TYQ G; 
#chains in the Genus database with same CATH homology
 3UM0 A;  3C3Q A;  4JIO A;  3ULY A;  1ZB1 A;  2XS1 A;  2R03 A;  2OEX A;  2R02 A;  2R05 A;  3C3R A;  2XS8 A;  3UM2 A;  2OEV A;  3ZXP A;  2OEW A;  3R9M A;  5CRU A;  3UM1 A;  3UM3 A;  3RAU A;  3C3O A;  5CRV A;  2OJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...