3C3OA

Alix bro1-domain:chmip4a co-crystal structure
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
357
structure length
357
Chain Sequence
ATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ALIX-CHMP4 interactions in the human ESCRT pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Programmed cell death 6-interacting protein
total genus 130
structure length 357
sequence length 357
ec nomenclature
pdb deposition date 2008-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3c3oA00
2XS1A 3ULYA 3R9MA 3UM3A 3UM0A 3RAUA 2XS8A 3ZXPA 2R05A 5CRVA 3C3OA 2OEWA 3C3QA 3C3RA 1ZB1A 5CRUA 2R03A 3UM1A 3UM2A 2R02A 2OEVA
chains in the Genus database with same CATH superfamily
3SO8A 2AWIA 1V54E 2IJGX 3F6QA 1AWCB 4BSXA 3D9LA 1NA0A 5KWDA 3IXEA 3HXEA 3AS4A 3FTUA 2RG8A 3IHVA 4JD2G 3PNTB 4RG6A 5IY5E 2M63A 4GZCA 2MOWA 5KBAA 3AG2E 4U96D 1N4QA 2KXPC 4GTPA 5ENOD 4E6HA 4N5CA 2R2LA 5ITZF 2C2LA 3T8MA 3FEXA 1NA3A 4EBAG 4G23A 3FY4A 1OT8A 4ACLA 3B7SA 4QQIA 2A4ZA 2EIME 3J5PA 2XENA 5FZQA 2KCLA 2J09A 3L54A 3U3WA 2OCCE 1QYMA 3JUEA 4BX9A 3PZ3A 3Q75A 4GCNA 4IN3B 4WWPA 3MKQB 2PQRA 5CECB 2KM4A 1RW2A 1FT2A 4URKA 2QZAA 5B3SE 3D9PA 3HVEB 3LVQE 3FH5A 2XGMA 3ML9A 4GZ6A 4TV3A 2J4BA 1WAO1 3DXMG 3CQCB 2LXLA 1TNOA 1RZ4A 3PREA 3EHRA 1UN8A 4EHMA 1TNBA 3SHFA 3PUJA 2Q7FA 3ZW3A 5EYPF 2I1JA 3FH8A 5ARGA 1INZA 2EIJE 3N71A 4N5QA 3EHNA 3ZRHA 4LEUA 3JXJA 5ENTD 4C0MA 2HO1A 2R03A 2P58C 5C1DA 2IQCA 3LY8A 3ZGQA 5LCWJ 1E8YA 1DNPA 3FTYA 4NACA 3AU5A 1EF1C 5CEAA 3E30A 1E8WA 5G2NA 3ZYMA 4GB9A 3KEAA 1UN9A 4W9RA 2BUGA 2IF4A 3SF4A 4BERA 1X81A 4DX6D 1E7VA 2UY1A 2V8SE 2HR2A 3CVYA 3CVVA 3ZHEA 3FU6A 4BWRA 4EZJA 2XPZA 4HOSA 4DX5D 3TWTA 3LJ3A 3U4TA 2LAHA 2WXPA 4LNBA 1K3ZD 1DCEA 3DEOA 5FZSA 3LCAA 3FU3A 5JJTA 3TWQA 5JMND 3QWPA 5B1AE 3FUDA 2CFUA 3L08A 2OV8A 3ASGA 4ANWA 1PY1A 4A63B 5BPPA 4XE0A 3QNKA 1NFIE 1ELWA 2VTBB 2WXMA 3FFLA 4EZKA 4LNUD 2X38A 2V4LA 2RKKA 4AJWA 1XGWA 1OWLA 4DLQA 5G05J 4DJAA 3CVNA 4KZCA 2V5FA 1KPSB 1N4PA 4JPSA 3ZXSA 5HRYA 5AIJA 4YDWA 1Y6IA 5KCMA 2F0YA 4JHRA 4MRUA 2XRYA 1HE8A 3JQ1A 1BU9A 4EZLA 4K5AB 2DVWA 3Q73A 2L0IA 2WQ7A 3FEYA 2WXJA 1N0RA 3W9GA 3AG3E 2MRIA 1E96B 3ZFWA 4R7LA 3MGBA 1OUVA 5M72A 2XEEA 3ZXPA 2OOEA 2WXQA 1L5JA 1BPOA 2VTBA 4KVMA 1MQSA 3HRAA 4GPMA 5CMYA 2XHEA 3E4BA 5DBKA 4FHJA 2XRZA 1S70B 4KT6B 3R7RA 3R7QA 1BD8A 4FHKA 5EN5D 3HDXA 3G2VA 5JHBA 2R5SA 3ASDA 1WDYA 3EIQC 1IXVA 1MJ0A 2JLBA 4A55A 3FHEA 4GYWA 4GYYA 3DSUA 4G26A 3NB2A 2P9IG 3IV0A 3NOCD 2LXMA 4XEIG 4I6JA 3LEWA 4PDXA 3FUHA 4K5BA 2AXZA 1MX2A 1TNZA 2GRNB 3ZKJA 2ZIRA 2FBNA 2F8YA 2QFCA 4N39A 1PAQA 3TWWA 3SBTB 2OVFA 4RG9A 3QB2A 2J07A 4JEUA 2C0LA 4HLLA 4WUYA 4NRHB 3R9AB 3ABME 3S7JA 3L16A 3EJNA 2YNQA 3AS8A 3ASFA 5AQBA 4UQYA 3ZVVA 3UMVA 1U2VG 2VSYA 4I2WA 3SZ7A 4DUIA 4KBQA 1A5EA 5A23A 2YHCA 3BQOA 4RVBA 3PEVB 3KS2A 2I6HA 3DPDA 3ZYQA 5D0OD 4KXKB 3EU9A 4LG6A 4LRZA 2KCVA 5G04C 3Q47B 2EIKE 2GRQB 4GTTA 4CZ2D 1S0PA 4GZ5A 4TXPA 3VLDA 3CKBA 3ZHEB 2FULA 3OTNA 3ASNE 1B89A 4LCTA 1JUQA 3ZN3A 3HVEA 3DRAA 5BNWA 2XQ0A 4O1PA 1JWGA 1Z5SC 1KLXA 3Q9NC 3T8KA 1HX8A 4I9CA 4UI9K 3I4RB 3PVLA 3Q7AA 1D9SA 4U0SA 4C48B 4G24A 4HS2A 4WNGA 5ENNA 4U8YD 2Y69E 4ATZD 4J8DA 4ANXA 1N52A 3FTZA 5LFAA 2BKGA 5CCMA 5EX3A 1KZPA 3X2QE 4XI0A 2GRMA 3CK9A 3E34A 3QKYA 3CHPA 4B8AA 2JABA 3FTVA 4HI8A 2RD0A 3CVXA 2KZTA 4XKBA 4HRNA 3QK0A 5DIZA 4TUMA 5AN8A 4B8CB 1JCRA 3TWUA 3WXXA 3LY9A 4FA6A 4U0UA 2E2EA 2WXLA 3NAWA 4F1PA 4FLHA 1K8KG 1U3DA 4HRLA 2UY1B 2AXUA 3CEQA 4B94A 3ZYKA 1OWMA 2CHZA 1O1TA 3GYZA 2IONA 5EILA 4CT0A 2LAIA 5FT9A 4FADA 5AQAA 4ILHB 3LS8A 1E7UA 4GTQA 2BF0X 3V2OA 3IHYA 4F7AA 2WXIA 5E75A 4GA1A 2DCPA 2AJAA 3PZDA 2GROB 3DSTA 4G25A 4L2LA 3GZ2A 3D9KA 2ZU6B 4XIFA 3BUAA 4BESA 3KAEA 3VLEA 2VGEA 2ETBA 5BT1A 3MX3A 4JXTA 2RFAA 4K0RA 4O1OA 3FUMA 4LUNU 2NXPA 3U64A 5J90A 1N9AA 1YMPA 4AIFA 3ZEFA 3UM2A 3CHMA 3G2TA 2H6FA 3OAWA 5ANRA 4WNDA 3UT8A 5FTPA 5HI7A 5FINA 1NZNA 3AG4E 1EPUA 2JEKA 1QBQA 2HE0A 3KSLA 4AV7A 2MYOA 4UI9J 3TGOA 4UQZA 4KVOA 3SFZA 4OVUA 2YHEA 3PNLB 3R9MA 1IQRA 1YYHA 4EPZA 5EX0A 4G11A 1MX6A 5BV1A 2ZISA 4CGVA 2WVIA 1H2TC 3S7BA 3HXBA 2L9BA 2BTDA 5FJYA 5T3RA 2ETCA 2OEVA 4OAUC 2V4HC 3LXUX 3ZYLA 3QC1A 5E76A 2J4DA 4MBGA 4F6RD 5AQ7A 1BI7B 4FJYA 2BKKB 3B13A 3HXCA 4AM9A 4JZYA 4F1SA 1TYQG 1N4SA 2I1KA 3GZ1A 3HXDA 4UWLA 5FWQA 2WXRA 5BV0A 3L9TA 3NZSA 3T9KA 2XCBA 1MX4A 2F8XK 4N2SA 1E8XA 3Q78A 3CVPA 3LVRE 4L1BA 5AENA 3CV0A 1OWNA 2EILE 4GAAA 1UW4B 1QNFA 3FUNA 1H0AA 4CYMD 3SNXA 3ESLA 4ILIA 3V31A 2LNIA 4JW1A 2ZGGA 3B7RL 4JB8P 5CRUA 3PRZA 5BW8C 4GTOA 5FQ4A 3RO2A 2QYUA 3D9IA 2PQNA 1LTXA 1OXJA 4E85A 4LNGA 4CDRA 2C0MA 2P9LG 3JYSA 4APOA 3SBSA 1H2VC 4WWNA 2MHKA 3TWRA 4HNAD 1N4RA 3TWVA 2J8SD 2P9UG 2PL2A 3JUIA 4O60A 4FULA 3EUVA 1N95A 2XPIA 4EECA 3RKVA 4GMRA 2X6KA 2DZNA 3TWSA 3AG1E 1HH8A 1Z3XA 4BSZB 3FU5A 3PZ4A 4D10C 3D9MA 2HYZA 4TUUA 2KCKA 1HXIA 1BLXB 4APFA 2VSOE 3ENEA 4WNFA 4AY5A 3Q9UC 4LERA 5EKQD 2Y1LE 4DX2A 5KJNA 1HFAA 5ANLA 1SA5A 2H6GA 5D2MC 4N3AA 3FP3A 4U8HA 3D9NA 4HOUA 3MEKA 3PUKA 4RQIA 4J6IA 5EIBE 1W3BA 4DLOA 2QYJA 3RU0A 4ILGA 3MA5A 3CVLA 3CSTA 2XPYA 3KD7A 2DZOA 1JWFA 1DC2A 3E37A 5A6CA 4GTSA 1XNFA 4CCAA 2AVPA 4JHJA 3RIBA 4DX7D 3I3NA 2XS8A 2PNNA 4RSYA 4JA9A 4BTAA 2IO2C 3TL5A 4M3OA 4YDYA 3RRUA 5FQ6A 2A5EA 3WG7E 1O5MA 3ULYA 4UWFA 2X3MA 4F3VA 1HG2A 1MZCA 3CHQA 5G05C 1N11A 2PM7A 4L7TA 1TNYA 2OEWA 1WG0A 3DBSA 2IO3C 2WXNA 1FT1A 3P2BA 5CCLA 5T4YA 4J0UA 5FIOA 2VGXB 1N94A 3PDNA 2LSVA 1EDUA 4IYPA 5CRVA 3TG5A 1HG5A 3TG4A 3D9OA 3FDHA 3PZ2A 1DCQA 2WM9A 2VSNA 3KEZA 2YINA 4NURA 1VDYA 4HXIA 5AJDA 1N54A 3Q15A 4GU5A 2KZTB 2P9NG 4HB5A 4WNEA 1X5BA 5HKPA 3MV3B 3PEUB 4AP2A 2PM6A 1TJCA 4HFGA 4JC8A 3V30A 1SVXA 3C72A 2J08A 4PS7A 5A7DB 3ABLE 3FUFA 4ACKA 3HIZA 3OXFA 2AXVA 2NYJA 3L82A 4TXRA 1S63A 1U3CA 1LF8A 3FU0A 4OVVA 1Z6TA 4RLYA 3ONLA 4FLBA 4UWGA 2XGSA 2WXGA 5KNGA 3UQ3A 3D3MA 4U95D 4CRWA 2WQ6A 4U07A 3FTWA 3QARA 4CT4A 2AW6A 3S7DA 4Q94A 2KATA 3DSVA 4DX1A 3AU4A 3ABKE 2IOLA 1NL4A 3FULA 5G55A 4K5CA 1HS6A 4HI9A 4B93B 3APDA 3QOUA 3OXGA 3VTYA 2QY7A 4PS3A 4N2QA 4GA0A 3CSFA 2WPVA 1FCHA 1HO8A 3CVQA 3UIOC 1IYGA 1N0QA 4J8SA 2L6BA 1TJFA 3B7BA 3W9FA 4U63A 4AEZC 4B0ZA 4NIKA 2OVBA 1ZB1A 2I9CA 4ANVA 4JA7A 3G2UA 3ZUVB 4KZ0A 3ZU7B 3QWWA 4MS6A 2YQ8A 3FWVA 5AAOA 5JHAA 3DEPA 4DI4A 2V0PA 4BX8A 5JJ7A 4EBAA 1SA4A 3CHOA 4H7YA 5EDSA 4N3CA 4HOTA 4I2ZA 4YNDA 2WB2A 3DSSA 1OCZE 5HQ8A 3BEEA 3BG1B 3Q49B 2WMOA 4NQ0A 3CR3A 4AY6A 1KZOA 1NP7A 4V3IA 4TXQA 3VLFA 4LSZE 3NZUA 4A1GA 5D66A 3L22A 3NOGD 3QDNA 2H6IA 1H6KA 1Z3YA 3VTXA 4OYSA 3RAUA 1TNUA 3I4GA 3Q5MA 1OWOA 4DI3A 2DYRE 3L6AA 1UG3A 4GYOA 3V2XA 5CMWA 3CVUA 5FZRA 2LO6A 3PH0C 4CGWA 2LSUA 4YVQC 4EQFA 3C98A 5ENRD 1SW6A 1OY3D 1IKND 3G2SA 3NF1A 5JJ6A 2B6CA 4GTVA 4QFVA 4YDOA 2R02A 3O48A 2CG2A 2DIWA 2VYIA 2XS1A 3IKOB 5KJKA 1ZU2A 5AQ9A 4Y6CA 4K03A 2LUHA 1E90A 3ZNGA 3UM3A 1H19A 1JCQA 3EHQA 4MKTA 4ZFHA 3DSXA 2V5QC 2VJ8A 3JXIA 3T5XA 1JPLA 3QJZA 2ETAA 3E33A 3MCXA 3BU8A 4UQXA 1NI1A 2NSZA 3FH7A 3LDZA 1LD7A 1IHGA 3TXNA 3B95A 1IQUA 3URZA 4GTMA 4A3TA 4U0ZA 4YVOA 2VGXA 3CK8A 3HHMA 4I1AA 4X8QA 2GRPB 2Y0BG 2DWZA 3CQGB 5BXOA 1O1SA 3DPYA 1IHBA 4H7XA 3QWVA 3UI2A 3ASHA 4G8KA 3CLJA 2WXHA 4J8FA 4KYOB 3LYAA 2ILRA 4HVBA 4B89A 4Y6WA 2WQHA 5J08A 1OCRE 5LCWC 4MLPA 4N3BA 2HM8A 2P9PG 3SD5A 3CIAA 3B7TA 5ENPD 4UI9C 5ENQD 4HLEA 3UIPC 2GRLA 3EDTB 3PZ1A 2VSXE 3AJIA 4JL0A 2IY0C 1K1AA 3J5QB 2IU1A 2FO7A 2A5UA 3GW4A 2CHWA 4UWKA 4XKCA 1A17A 5AARA 3FTXA 2R05A 3EIJA 3FUJA 3U9WA 3SI5A 2J9QA 3RRMB 2P9SG 4AVXA 5LOZA 2XGOA 3LKUA 5G04J 3FUEA 4FC8A 2KBXA 4L2YA 2GGFA 2DBAA 4JVSA 4IULA 2GW1A 3C3OA 3C3QA 1D8EA 4ATGA 4WAFA 5BUZA 2FF4A 3UT7A 4I6EA 5ENSD 4GMJA 3UINC 2H6HA 4HRMB 4YDEA 2Y4UA 1SZAA 3IBEA 3UM0A 3ULQA 3TWXA 3D9HA 4L23A 4GZ3A 3UTMA 3ZIMA 3QAQA 3ZPJA 3CK7A 3AAAC 1UOHA 3I5PA 2Y4TA 2IFUA 2L6JA 1HU3A 3NBNB 4L9PA 4J8YA 4OAVB 2CFZA 4HORA 3SFXA 5T8IA 2E0IA 2KC7A 4WWOA 5KNHD 3RRNB 4AXHA 2PZIA 4U8VD 4BT8A 4XI9A 3ONKA 1OCCE 2R59A 4GZDA 4P29A 2X6JA 3ASOE 3MJWA 5KJMA 1TN8A 2IEJA 4GMLA 3K9IA 1FVHA 4IRUA 3SY2A 5B1BE 4XZ4A 1P5QA 4C9BB 3RK6A 3ML8A 4ME2A 3MKQA 3DXKG 4ZHBA 2WMNA 2P9KG 4G2VA 1MHQA 1FVFA 4PH4B 3UXGA 1E8ZA 5C2YA 3KSQA 1Q2ZA 3UPVA 4A1SA 5JA4D 5FQ8A 4HQDA 2UWJG 2F37A 2FO1E 3L13A 2FI7A 1TN6A 5EYLA 4BETA 1YA0A 3UT4A 1EYHA 2CHXA 1ZBPA 1UJJA 5CEDB 4XX5A 4I6GA 2P2CP 1ELKA 1SZ9A 2VQ2A 3TAXA 3PE4A 4BEPA 1WM5A 4PUCA 4Z68A 1TN7A 2Y3AA 5EIDA 3FUKA 3MZLB 4UUCA 4TRQA 1QQEA 2QC9A 3RO3A 4G1TA 4FU3A 3Q7FA 1FPPA 2R17C 2X6FA 4BFRA 3LPZA 3UKRG 4F53A 1G3NB 2RFMA 1YCSB 3ULEG 2VGYA 2XEHA 2BEDA 3MV2B 3ISMC 4GTRA 1JCSA 2J49A 2I2OA 1AP7A 4CDNA 3EHMA 4GA2A 4DK5A 1H6OA 1OWPA 3MYVA 3JQ0A 1H6PA 1K1BA 3UKUG 4J7WA 5ARFA 1KT1A 1PC2A 3PE3A 4BY6A 1TEZA 4UWHA 1SQMA 3C3RA 1MYOA 4ABNA 1KT0A 1S64A 1QZ2A 3LJNA 3C5RA 3FTSA 3T5VA 3Q79A 3TXMA 1TR4A 1WY6A 3Q4AB 2EINE 3V79K 4JHKA 2FEZA 4JEHA 2CG3A 3FUIA 2L0TB 2B0OE 3HYMB 3CHSA 3UX4A 5LP0A 4I17A 4ANUA 3OXLA 4FJZA 4J8EA 4BT9A 4Q96A 1DVPA 3DWLG 4I43A 2WXKA 3TJPA 4FP7A 5AYWD 3S7FA 3S2AA 4U7EB 4O6FA 4U04A 4KMOA 3PS6A 3SQVA 3JCKC 3P1UA 2X6HA 4HOQA 3DSWA 1V55E 3CVWA 1D8DA 2WXOA 4PS8A 5KJLA 1LD8A 1H2UA 5LX8A 3APFA 2XZDG 3AS5A 2NC9A 4CEMA 4I9EA 1BI8B 3GZSA 3L17A 3G2WA 4GPKA 3HXFA 3SGHA 4DPRA 3IEGA 5CHEE 2XZTG 3NQPA 4I1MA 4BTBA 4C0EA 4GCOA 3MKRA 4Q69A 2X6IA 3SFYA 4CDMA 3UUXA 3HG0D 1ELRA 4M7CA 3O4ZA 3B7UX 5CBOA 3APCA 5D0QD 3CGHA 1HF8A 2EQXA 3EU5A 5CERB 3RSEG 3CKCA 5CBNA 2WXFA 3LY7A 3UM1A 1Y8MA 5FQ7A 1UJKA 2ZXWE 4AOFA 3BG0B 3D9JA 1O1RA 3ESKA 5AJLA 2ONDA 5HS0A 3E32A 4I1OB 3RJVA 2IOSA 4G8LA 4DRXE 1HZ4A 1OCOE 2DYSE 3CHRA 5H7PA 2ZGDA 1GW6A 2XEVA 4HBDA 2GRRB 2XCCA 3U66A 5BXUA 4A3VA
chains in the Genus database with same CATH topology
2XS1A 3ULYA 3R9MA 3UM3A 3UM0A 3RAUA 2XS8A 4JIOA 2R05A 3ZXPA 2OEXA 5CRVA 3C3OA 2OEWA 3C3QA 3C3RA 1ZB1A 5CRUA 2OJQA 2R03A 3UM1A 3UM2A 2R02A 2OEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XS1 A;  3ULY A;  3R9M A;  3UM3 A;  3UM0 A;  3RAU A;  2XS8 A;  3ZXP A;  2R05 A;  5CRV A;  3C3O A;  2OEW A;  3C3Q A;  3C3R A;  1ZB1 A;  5CRU A;  2R03 A;  3UM1 A;  3UM2 A;  2R02 A;  2OEV A; 
#chains in the Genus database with same CATH topology
 3SO8 A;  2AWI A;  1V54 E;  2IJG X;  3F6Q A;  1AWC B;  4BSX A;  3D9L A;  1NA0 A;  5KWD A;  3IXE A;  3HXE A;  3AS4 A;  3FTU A;  2RG8 A;  3IHV A;  4JD2 G;  3PNT B;  4RG6 A;  5IY5 E;  2M63 A;  4GZC A;  2MOW A;  5KBA A;  3AG2 E;  4U96 D;  1N4Q A;  2KXP C;  4GTP A;  5ENO D;  4E6H A;  4N5C A;  2R2L A;  5ITZ F;  2C2L A;  3T8M A;  3FEX A;  1NA3 A;  4EBA G;  4G23 A;  3FY4 A;  1OT8 A;  4ACL A;  3B7S A;  4QQI A;  2A4Z A;  2EIM E;  3J5P A;  2XEN A;  5FZQ A;  2KCL A;  2J09 A;  3L54 A;  3U3W A;  2OCC E;  1QYM A;  3JUE A;  4BX9 A;  3PZ3 A;  3Q75 A;  4GCN A;  4IN3 B;  4WWP A;  3MKQ B;  2PQR A;  5CEC B;  2KM4 A;  1RW2 A;  1FT2 A;  4URK A;  2QZA A;  5B3S E;  3D9P A;  3HVE B;  3LVQ E;  3FH5 A;  2XGM A;  3ML9 A;  4GZ6 A;  4TV3 A;  2J4B A;  1WAO 1;  3DXM G;  3CQC B;  2LXL A;  1TNO A;  1RZ4 A;  3PRE A;  3EHR A;  1UN8 A;  4EHM A;  1TNB A;  3SHF A;  3PUJ A;  2Q7F A;  3ZW3 A;  5EYP F;  2I1J A;  3FH8 A;  5ARG A;  1INZ A;  2EIJ E;  3N71 A;  4N5Q A;  3EHN A;  3ZRH A;  4LEU A;  3JXJ A;  5ENT D;  4C0M A;  2HO1 A;  2R03 A;  2P58 C;  5C1D A;  2IQC A;  3LY8 A;  3ZGQ A;  5LCW J;  1E8Y A;  1DNP A;  3FTY A;  4NAC A;  3AU5 A;  1EF1 C;  5CEA A;  3E30 A;  1E8W A;  5G2N A;  3ZYM A;  4GB9 A;  3KEA A;  1UN9 A;  4W9R A;  2BUG A;  2IF4 A;  3SF4 A;  4BER A;  1X81 A;  4DX6 D;  1E7V A;  2UY1 A;  2V8S E;  2HR2 A;  3CVY A;  3CVV A;  3ZHE A;  3FU6 A;  4BWR A;  4EZJ A;  2XPZ A;  4HOS A;  4DX5 D;  3TWT A;  3LJ3 A;  3U4T A;  2LAH A;  2WXP A;  4LNB A;  1K3Z D;  1DCE A;  3DEO A;  5FZS A;  3LCA A;  3FU3 A;  5JJT A;  3TWQ A;  5JMN D;  3QWP A;  5B1A E;  3FUD A;  2CFU A;  3L08 A;  2OV8 A;  3ASG A;  4ANW A;  1PY1 A;  4A63 B;  5BPP A;  4XE0 A;  3QNK A;  1NFI E;  1ELW A;  2VTB B;  2WXM A;  3FFL A;  4EZK A;  4LNU D;  2X38 A;  2V4L A;  2RKK A;  4AJW A;  1XGW A;  1OWL A;  4DLQ A;  5G05 J;  4DJA A;  3CVN A;  4KZC A;  2V5F A;  1KPS B;  1N4P A;  4JPS A;  3ZXS A;  5HRY A;  5AIJ A;  4YDW A;  1Y6I A;  5KCM A;  2F0Y A;  4JHR A;  4MRU A;  2XRY A;  1HE8 A;  3JQ1 A;  1BU9 A;  4EZL A;  4K5A B;  2DVW A;  3Q73 A;  2L0I A;  2WQ7 A;  3FEY A;  2WXJ A;  1N0R A;  3W9G A;  3AG3 E;  2MRI A;  1E96 B;  3ZFW A;  4R7L A;  3MGB A;  1OUV A;  5M72 A;  2XEE A;  3ZXP A;  2OOE A;  2WXQ A;  1L5J A;  1BPO A;  2VTB A;  4KVM A;  1MQS A;  3HRA A;  4GPM A;  5CMY A;  2XHE A;  3E4B A;  5DBK A;  4FHJ A;  2XRZ A;  1S70 B;  4KT6 B;  3R7R A;  3R7Q A;  1BD8 A;  4FHK A;  5EN5 D;  3HDX A;  3G2V A;  5JHB A;  2R5S A;  3ASD A;  1WDY A;  3EIQ C;  1IXV A;  1MJ0 A;  2JLB A;  4A55 A;  3FHE A;  4GYW A;  4GYY A;  3DSU A;  4G26 A;  3NB2 A;  2P9I G;  3IV0 A;  3NOC D;  2LXM A;  4XEI G;  4I6J A;  3LEW A;  4PDX A;  3FUH A;  4K5B A;  2AXZ A;  1MX2 A;  1TNZ A;  2GRN B;  3ZKJ A;  2ZIR A;  2FBN A;  2F8Y A;  2QFC A;  4N39 A;  1PAQ A;  3TWW A;  3SBT B;  2OVF A;  4RG9 A;  3QB2 A;  2J07 A;  4JEU A;  2C0L A;  4HLL A;  4WUY A;  4NRH B;  3R9A B;  3ABM E;  3S7J A;  3L16 A;  3EJN A;  2YNQ A;  3AS8 A;  3ASF A;  5AQB A;  4UQY A;  3ZVV A;  3UMV A;  1U2V G;  2VSY A;  4I2W A;  3SZ7 A;  4DUI A;  4KBQ A;  1A5E A;  5A23 A;  2YHC A;  3BQO A;  4RVB A;  3PEV B;  3KS2 A;  2I6H A;  3DPD A;  3ZYQ A;  5D0O D;  4KXK B;  3EU9 A;  4LG6 A;  4LRZ A;  2KCV A;  5G04 C;  3Q47 B;  2EIK E;  2GRQ B;  4GTT A;  4CZ2 D;  1S0P A;  4GZ5 A;  4TXP A;  3VLD A;  3CKB A;  3ZHE B;  2FUL A;  3OTN A;  3ASN E;  1B89 A;  4LCT A;  1JUQ A;  3ZN3 A;  3HVE A;  3DRA A;  5BNW A;  2XQ0 A;  4O1P A;  1JWG A;  1Z5S C;  1KLX A;  3Q9N C;  3T8K A;  1HX8 A;  4I9C A;  4UI9 K;  3I4R B;  3PVL A;  3Q7A A;  1D9S A;  4U0S A;  4C48 B;  4G24 A;  4HS2 A;  4WNG A;  5ENN A;  4U8Y D;  2Y69 E;  4ATZ D;  4J8D A;  4ANX A;  1N52 A;  3FTZ A;  5LFA A;  2BKG A;  5CCM A;  5EX3 A;  1KZP A;  3X2Q E;  4XI0 A;  2GRM A;  3CK9 A;  3E34 A;  3QKY A;  3CHP A;  4B8A A;  2JAB A;  3FTV A;  4HI8 A;  2RD0 A;  3CVX A;  2KZT A;  4XKB A;  4HRN A;  3QK0 A;  5DIZ A;  4TUM A;  5AN8 A;  4B8C B;  1JCR A;  3TWU A;  3WXX A;  3LY9 A;  4FA6 A;  4U0U A;  2E2E A;  2WXL A;  3NAW A;  4F1P A;  4FLH A;  1K8K G;  1U3D A;  4HRL A;  2UY1 B;  2AXU A;  3CEQ A;  4B94 A;  3ZYK A;  1OWM A;  2CHZ A;  1O1T A;  3GYZ A;  2ION A;  5EIL A;  4CT0 A;  2LAI A;  5FT9 A;  4FAD A;  5AQA A;  4ILH B;  3LS8 A;  1E7U A;  4GTQ A;  2BF0 X;  3V2O A;  3IHY A;  4F7A A;  2WXI A;  5E75 A;  4GA1 A;  2DCP A;  2AJA A;  3PZD A;  2GRO B;  3DST A;  4G25 A;  4L2L A;  3GZ2 A;  3D9K A;  2ZU6 B;  4XIF A;  3BUA A;  4BES A;  3KAE A;  3VLE A;  2VGE A;  2ETB A;  5BT1 A;  3MX3 A;  4JXT A;  2RFA A;  4K0R A;  4O1O A;  3FUM A;  4LUN U;  2NXP A;  3U64 A;  5J90 A;  1N9A A;  1YMP A;  4AIF A;  3ZEF A;  3UM2 A;  3CHM A;  3G2T A;  2H6F A;  3OAW A;  5ANR A;  4WND A;  3UT8 A;  5FTP A;  5HI7 A;  5FIN A;  1NZN A;  3AG4 E;  1EPU A;  2JEK A;  1QBQ A;  2HE0 A;  3KSL A;  4AV7 A;  2MYO A;  4UI9 J;  3TGO A;  4UQZ A;  4KVO A;  3SFZ A;  4OVU A;  2YHE A;  3PNL B;  3R9M A;  1IQR A;  1YYH A;  4EPZ A;  5EX0 A;  4G11 A;  1MX6 A;  5BV1 A;  2ZIS A;  4CGV A;  2WVI A;  1H2T C;  3S7B A;  3HXB A;  2L9B A;  2BTD A;  5FJY A;  5T3R A;  2ETC A;  2OEV A;  4OAU C;  2V4H C;  3LXU X;  3ZYL A;  3QC1 A;  5E76 A;  2J4D A;  4MBG A;  4F6R D;  5AQ7 A;  1BI7 B;  4FJY A;  2BKK B;  3B13 A;  3HXC A;  4AM9 A;  4JZY A;  4F1S A;  1TYQ G;  1N4S A;  2I1K A;  3GZ1 A;  3HXD A;  4UWL A;  5FWQ A;  2WXR A;  5BV0 A;  3L9T A;  3NZS A;  3T9K A;  2XCB A;  1MX4 A;  2F8X K;  4N2S A;  1E8X A;  3Q78 A;  3CVP A;  3LVR E;  4L1B A;  5AEN A;  3CV0 A;  1OWN A;  2EIL E;  4GAA A;  1UW4 B;  1QNF A;  3FUN A;  1H0A A;  4CYM D;  3SNX A;  3ESL A;  4ILI A;  3V31 A;  2LNI A;  4JW1 A;  2ZGG A;  3B7R L;  4JB8 P;  5CRU A;  3PRZ A;  5BW8 C;  4GTO A;  5FQ4 A;  3RO2 A;  2QYU A;  3D9I A;  2PQN A;  1LTX A;  1OXJ A;  4E85 A;  4LNG A;  4CDR A;  2C0M A;  2P9L G;  3JYS A;  4APO A;  3SBS A;  1H2V C;  4WWN A;  2MHK A;  3TWR A;  4HNA D;  1N4R A;  3TWV A;  2J8S D;  2P9U G;  2PL2 A;  3JUI A;  4O60 A;  4FUL A;  3EUV A;  1N95 A;  2XPI A;  4EEC A;  3RKV A;  4GMR A;  2X6K A;  2DZN A;  3TWS A;  3AG1 E;  1HH8 A;  1Z3X A;  4BSZ B;  3FU5 A;  3PZ4 A;  4D10 C;  3D9M A;  2HYZ A;  4TUU A;  2KCK A;  1HXI A;  1BLX B;  4APF A;  2VSO E;  3ENE A;  4WNF A;  4AY5 A;  3Q9U C;  4LER A;  5EKQ D;  2Y1L E;  4DX2 A;  5KJN A;  1HFA A;  5ANL A;  1SA5 A;  2H6G A;  5D2M C;  4N3A A;  3FP3 A;  4U8H A;  3D9N A;  4HOU A;  3MEK A;  3PUK A;  4RQI A;  4J6I A;  5EIB E;  1W3B A;  4DLO A;  2QYJ A;  3RU0 A;  4ILG A;  3MA5 A;  3CVL A;  3CST A;  2XPY A;  3KD7 A;  2DZO A;  1JWF A;  1DC2 A;  3E37 A;  5A6C A;  4GTS A;  1XNF A;  4CCA A;  2AVP A;  4JHJ A;  3RIB A;  4DX7 D;  3I3N A;  2XS8 A;  2PNN A;  4RSY A;  4JA9 A;  4BTA A;  2IO2 C;  3TL5 A;  4M3O A;  4YDY A;  3RRU A;  5FQ6 A;  2A5E A;  3WG7 E;  1O5M A;  3ULY A;  4UWF A;  2X3M A;  4F3V A;  1HG2 A;  1MZC A;  3CHQ A;  5G05 C;  1N11 A;  2PM7 A;  4L7T A;  1TNY A;  2OEW A;  1WG0 A;  3DBS A;  2IO3 C;  2WXN A;  1FT1 A;  3P2B A;  5CCL A;  5T4Y A;  4J0U A;  5FIO A;  2VGX B;  1N94 A;  3PDN A;  2LSV A;  1EDU A;  4IYP A;  5CRV A;  3TG5 A;  1HG5 A;  3TG4 A;  3D9O A;  3FDH A;  3PZ2 A;  1DCQ A;  2WM9 A;  2VSN A;  3KEZ A;  2YIN A;  4NUR A;  1VDY A;  4HXI A;  5AJD A;  1N54 A;  3Q15 A;  4GU5 A;  2KZT B;  2P9N G;  4HB5 A;  4WNE A;  1X5B A;  5HKP A;  3MV3 B;  3PEU B;  4AP2 A;  2PM6 A;  1TJC A;  4HFG A;  4JC8 A;  3V30 A;  1SVX A;  3C72 A;  2J08 A;  4PS7 A;  5A7D B;  3ABL E;  3FUF A;  4ACK A;  3HIZ A;  3OXF A;  2AXV A;  2NYJ A;  3L82 A;  4TXR A;  1S63 A;  1U3C A;  1LF8 A;  3FU0 A;  4OVV A;  1Z6T A;  4RLY A;  3ONL A;  4FLB A;  4UWG A;  2XGS A;  2WXG A;  5KNG A;  3UQ3 A;  3D3M A;  4U95 D;  4CRW A;  2WQ6 A;  4U07 A;  3FTW A;  3QAR A;  4CT4 A;  2AW6 A;  3S7D A;  4Q94 A;  2KAT A;  3DSV A;  4DX1 A;  3AU4 A;  3ABK E;  2IOL A;  1NL4 A;  3FUL A;  5G55 A;  4K5C A;  1HS6 A;  4HI9 A;  4B93 B;  3APD A;  3QOU A;  3OXG A;  3VTY A;  2QY7 A;  4PS3 A;  4N2Q A;  4GA0 A;  3CSF A;  2WPV A;  1FCH A;  1HO8 A;  3CVQ A;  3UIO C;  1IYG A;  1N0Q A;  4J8S A;  2L6B A;  1TJF A;  3B7B A;  3W9F A;  4U63 A;  4AEZ C;  4B0Z A;  4NIK A;  2OVB A;  1ZB1 A;  2I9C A;  4ANV A;  4JA7 A;  3G2U A;  3ZUV B;  4KZ0 A;  3ZU7 B;  3QWW A;  4MS6 A;  2YQ8 A;  3FWV A;  5AAO A;  5JHA A;  3DEP A;  4DI4 A;  2V0P A;  4BX8 A;  5JJ7 A;  4EBA A;  1SA4 A;  3CHO A;  4H7Y A;  5EDS A;  4N3C A;  4HOT A;  4I2Z A;  4YND A;  2WB2 A;  3DSS A;  1OCZ E;  5HQ8 A;  3BEE A;  3BG1 B;  3Q49 B;  2WMO A;  4NQ0 A;  3CR3 A;  4AY6 A;  1KZO A;  1NP7 A;  4V3I A;  4TXQ A;  3VLF A;  4LSZ E;  3NZU A;  4A1G A;  5D66 A;  3L22 A;  3NOG D;  3QDN A;  2H6I A;  1H6K A;  1Z3Y A;  3VTX A;  4OYS A;  3RAU A;  1TNU A;  3I4G A;  3Q5M A;  1OWO A;  4DI3 A;  2DYR E;  3L6A A;  1UG3 A;  4GYO A;  3V2X A;  5CMW A;  3CVU A;  5FZR A;  2LO6 A;  3PH0 C;  4CGW A;  2LSU A;  4YVQ C;  4EQF A;  3C98 A;  5ENR D;  1SW6 A;  1OY3 D;  1IKN D;  3G2S A;  3NF1 A;  5JJ6 A;  2B6C A;  4GTV A;  4QFV A;  4YDO A;  2R02 A;  3O48 A;  2CG2 A;  2DIW A;  2VYI A;  2XS1 A;  3IKO B;  5KJK A;  1ZU2 A;  5AQ9 A;  4Y6C A;  4K03 A;  2LUH A;  1E90 A;  3ZNG A;  3UM3 A;  1H19 A;  1JCQ A;  3EHQ A;  4MKT A;  4ZFH A;  3DSX A;  2V5Q C;  2VJ8 A;  3JXI A;  3T5X A;  1JPL A;  3QJZ A;  2ETA A;  3E33 A;  3MCX A;  3BU8 A;  4UQX A;  1NI1 A;  2NSZ A;  3FH7 A;  3LDZ A;  1LD7 A;  1IHG A;  3TXN A;  3B95 A;  1IQU A;  3URZ A;  4GTM A;  4A3T A;  4U0Z A;  4YVO A;  2VGX A;  3CK8 A;  3HHM A;  4I1A A;  4X8Q A;  2GRP B;  2Y0B G;  2DWZ A;  3CQG B;  5BXO A;  1O1S A;  3DPY A;  1IHB A;  4H7X A;  3QWV A;  3UI2 A;  3ASH A;  4G8K A;  3CLJ A;  2WXH A;  4J8F A;  4KYO B;  3LYA A;  2ILR A;  4HVB A;  4B89 A;  4Y6W A;  2WQH A;  5J08 A;  1OCR E;  5LCW C;  4MLP A;  4N3B A;  2HM8 A;  2P9P G;  3SD5 A;  3CIA A;  3B7T A;  5ENP D;  4UI9 C;  5ENQ D;  4HLE A;  3UIP C;  2GRL A;  3EDT B;  3PZ1 A;  2VSX E;  3AJI A;  4JL0 A;  2IY0 C;  1K1A A;  3J5Q B;  2IU1 A;  2FO7 A;  2A5U A;  3GW4 A;  2CHW A;  4UWK A;  4XKC A;  1A17 A;  5AAR A;  3FTX A;  2R05 A;  3EIJ A;  3FUJ A;  3U9W A;  3SI5 A;  2J9Q A;  3RRM B;  2P9S G;  4AVX A;  5LOZ A;  2XGO A;  3LKU A;  5G04 J;  3FUE A;  4FC8 A;  2KBX A;  4L2Y A;  2GGF A;  2DBA A;  4JVS A;  4IUL A;  2GW1 A;  3C3O A;  3C3Q A;  1D8E A;  4ATG A;  4WAF A;  5BUZ A;  2FF4 A;  3UT7 A;  4I6E A;  5ENS D;  4GMJ A;  3UIN C;  2H6H A;  4HRM B;  4YDE A;  2Y4U A;  1SZA A;  3IBE A;  3UM0 A;  3ULQ A;  3TWX A;  3D9H A;  4L23 A;  4GZ3 A;  3UTM A;  3ZIM A;  3QAQ A;  3ZPJ A;  3CK7 A;  3AAA C;  1UOH A;  3I5P A;  2Y4T A;  2IFU A;  2L6J A;  1HU3 A;  3NBN B;  4L9P A;  4J8Y A;  4OAV B;  2CFZ A;  4HOR A;  3SFX A;  5T8I A;  2E0I A;  2KC7 A;  4WWO A;  5KNH D;  3RRN B;  4AXH A;  2PZI A;  4U8V D;  4BT8 A;  4XI9 A;  3ONK A;  1OCC E;  2R59 A;  4GZD A;  4P29 A;  2X6J A;  3ASO E;  3MJW A;  5KJM A;  1TN8 A;  2IEJ A;  4GML A;  3K9I A;  1FVH A;  4IRU A;  3SY2 A;  5B1B E;  4XZ4 A;  1P5Q A;  4C9B B;  3RK6 A;  3ML8 A;  4ME2 A;  3MKQ A;  3DXK G;  4ZHB A;  2WMN A;  2P9K G;  4G2V A;  1MHQ A;  1FVF A;  4PH4 B;  3UXG A;  1E8Z A;  5C2Y A;  3KSQ A;  1Q2Z A;  3UPV A;  4A1S A;  5JA4 D;  5FQ8 A;  4HQD A;  2UWJ G;  2F37 A;  2FO1 E;  3L13 A;  2FI7 A;  1TN6 A;  5EYL A;  4BET A;  1YA0 A;  3UT4 A;  1EYH A;  2CHX A;  1ZBP A;  1UJJ A;  5CED B;  4XX5 A;  4I6G A;  2P2C P;  1ELK A;  1SZ9 A;  2VQ2 A;  3TAX A;  3PE4 A;  4BEP A;  1WM5 A;  4PUC A;  4Z68 A;  1TN7 A;  2Y3A A;  5EID A;  3FUK A;  3MZL B;  4UUC A;  4TRQ A;  1QQE A;  2QC9 A;  3RO3 A;  4G1T A;  4FU3 A;  3Q7F A;  1FPP A;  2R17 C;  2X6F A;  4BFR A;  3LPZ A;  3UKR G;  4F53 A;  1G3N B;  2RFM A;  1YCS B;  3ULE G;  2VGY A;  2XEH A;  2BED A;  3MV2 B;  3ISM C;  4GTR A;  1JCS A;  2J49 A;  2I2O A;  1AP7 A;  4CDN A;  3EHM A;  4GA2 A;  4DK5 A;  1H6O A;  1OWP A;  3MYV A;  3JQ0 A;  1H6P A;  1K1B A;  3UKU G;  4J7W A;  5ARF A;  1KT1 A;  1PC2 A;  3PE3 A;  4BY6 A;  1TEZ A;  4UWH A;  1SQM A;  3C3R A;  1MYO A;  4ABN A;  1KT0 A;  1S64 A;  1QZ2 A;  3LJN A;  3C5R A;  3FTS A;  3T5V A;  3Q79 A;  3TXM A;  1TR4 A;  1WY6 A;  3Q4A B;  2EIN E;  3V79 K;  4JHK A;  2FEZ A;  4JEH A;  2CG3 A;  3FUI A;  2L0T B;  2B0O E;  3HYM B;  3CHS A;  3UX4 A;  5LP0 A;  4I17 A;  4ANU A;  3OXL A;  4FJZ A;  4J8E A;  4BT9 A;  4Q96 A;  1DVP A;  3DWL G;  4I43 A;  2WXK A;  3TJP A;  4FP7 A;  5AYW D;  3S7F A;  3S2A A;  4U7E B;  4O6F A;  4U04 A;  4KMO A;  3PS6 A;  3SQV A;  3JCK C;  3P1U A;  2X6H A;  4HOQ A;  3DSW A;  1V55 E;  3CVW A;  1D8D A;  2WXO A;  4PS8 A;  5KJL A;  1LD8 A;  1H2U A;  5LX8 A;  3APF A;  2XZD G;  3AS5 A;  2NC9 A;  4CEM A;  4I9E A;  1BI8 B;  3GZS A;  3L17 A;  3G2W A;  4GPK A;  3HXF A;  3SGH A;  4DPR A;  3IEG A;  5CHE E;  2XZT G;  3NQP A;  4I1M A;  4BTB A;  4C0E A;  4GCO A;  3MKR A;  4Q69 A;  2X6I A;  3SFY A;  4CDM A;  3UUX A;  3HG0 D;  1ELR A;  4M7C A;  3O4Z A;  3B7U X;  5CBO A;  3APC A;  5D0Q D;  3CGH A;  1HF8 A;  2EQX A;  3EU5 A;  5CER B;  3RSE G;  3CKC A;  5CBN A;  2WXF A;  3LY7 A;  3UM1 A;  1Y8M A;  5FQ7 A;  1UJK A;  2ZXW E;  4AOF A;  3BG0 B;  3D9J A;  1O1R A;  3ESK A;  5AJL A;  2OND A;  5HS0 A;  3E32 A;  4I1O B;  3RJV A;  2IOS A;  4G8L A;  4DRX E;  1HZ4 A;  1OCO E;  2DYS E;  3CHR A;  5H7P A;  2ZGD A;  1GW6 A;  2XEV A;  4HBD A;  2GRR B;  2XCC A;  3U66 A;  5BXU A;  4A3V A; 
#chains in the Genus database with same CATH homology
 2XS1 A;  3ULY A;  3R9M A;  3UM3 A;  3UM0 A;  3RAU A;  2XS8 A;  4JIO A;  2R05 A;  3ZXP A;  2OEX A;  5CRV A;  3C3O A;  2OEW A;  3C3Q A;  3C3R A;  1ZB1 A;  5CRU A;  2OJQ A;  2R03 A;  3UM1 A;  3UM2 A;  2R02 A;  2OEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...