2HM8A

Solution structure of the c-terminal ma-3 domain of pdcd4
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
136
Chain Sequence
GPLGSGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords Pdcd4 C-terminal MA-3 domain
publication title Structure of the C-terminal MA-3 domain of the tumour suppressor protein Pdcd4 and characterization of its interaction with eIF4A
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hm8A00
3EIJA 1HU3A 4IULA 1H2VC 3RK6A 2VSXE 2IOLA 2IOSA 1H2TC 2FULA 2KZTB 3FEYA 5ANRA 3FEXA 4CT4A 2KZTA 3EIQC 4B8AA 2RG8A 4GMJA 4JHKA 2VSOE 1UW4B 2ZU6B 3L6AA 1N54A 4C9BB 1UG3A 2GGFA 2NSZA 2HM8A 3JUIA 2IU1A 4B8CB 1PAQA 4CEMA 2IONA 2I2OA 4GMLA 4JHJA 3D3MA 4LUNU 4B89A 4CRWA 1H2UA 1H6KA 1N52A
chains in the Genus database with same CATH superfamily
2IJGX 1RZ4A 2DBAA 4ACLA 3UM3A 3NZSA 4FU3A 1WDYA 3AS5A 4NIKA 2WXPA 4LNBA 3EIQC 1HH8A 5KJMA 2QFCA 3CVXA 1N94A 2JABA 3DXKG 5G2NA 4KVMA 4M7CA 3OTNA 4J7WA 4JL0A 2F0YA 3EU5A 3HG0D 1V54E 4DPRA 4HOSA 3TWXA 1QZ2A 3FU6A 4HRNA 1O1SA 3CHOA 1K3ZD 1MYOA 4MS6A 1KLXA 2XZDG 2WB2A 3NAWA 3QJZA 1ELKA 3UKRG 4UQXA 4EHMA 3FDHA 3CVLA 5AQAA 4GMJA 3Q47B 2GRNB 4IN3B 3D9JA 3FUMA 2GRMA 3D9IA 1OWLA 4BFRA 2R59A 5FJYA 4U07A 4CRWA 2Q7FA 3DSVA 3FULA 4DX2A 1K1AA 3RIBA 1Z3XA 3SFZA 4O6FA 3T8KA 2VJ8A 3PEVB 3FTVA 1TYQG 3B7RL 4JHRA 2QYUA 3QNKA 4DLOA 3Q73A 4FP7A 5FT9A 4TUMA 2GRPB 2AXZA 3PE3A 4K0RA 2KCLA 3QARA 4KZCA 4N2QA 3RAUA 3PNTB 3ENEA 2LSVA 3EU9A 4AXHA 3HXFA 4YVQC 4DLQA 3SF4A 5LFAA 4HVBA 3C5RA 3ESKA 1TR4A 2PL2A 3Q7FA 3EHMA 1NZNA 1FT2A 2RFAA 1PC2A 2EQXA 1N0RA 4EECA 3FUHA 5CEAA 3ML8A 4HOUA 2OVFA 3V30A 4F1PA 1N4RA 1HG5A 1JUQA 4TXPA 3HRAA 4UWHA 4BERA 4KMOA 3DSTA 1JPLA 3N71A 1MX2A 4WNEA 1TN8A 1SW6A 2I1JA 3NOGD 1HFAA 3KSLA 2BKKB 3ONLA 1WM5A 4MRUA 4BESA 4HRLA 2IONA 1QYMA 2ZISA 2X6HA 4XI0A 4UWGA 2V5QC 2GRLA 4G2VA 4XE0A 1MX6A 3ZYMA 4G25A 5ARGA 4A3TA 3FUJA 2R03A 1Y8MA 3U66A 1OUVA 2X6FA 4HNAD 4ILIA 4HI8A 4WNFA 3FUFA 3Q78A 2E2EA 3PVLA 1UJJA 4I6GA 1H19A 2IU1A 2V0PA 4GPKA 3C3RA 3Q9UC 3JQ0A 4V3IA 3U64A 2L6JA 4J6IA 3HVEA 5D0OD 2J08A 2KZTA 3CGHA 2E0IA 5KBAA 4KT6B 2R05A 3DEOA 4ANWA 1VDYA 5FIOA 3OXLA 5BXOA 3BUAA 1OCZE 2J49A 3B7SA 1BU9A 2P2CP 1HZ4A 2VSNA 3DBSA 1O1TA 3PZ3A 2WMNA 2BTDA 1FVHA 3ASHA 4B0ZA 1H0AA 3MX3A 4HLLA 3MKQB 3CHPA 3Q49B 2XGMA 3R7RA 1E7VA 4JXTA 3CR3A 3R7QA 5EX3A 4UWFA 1N52A 4BY6A 3D9KA 3JCKC 3TXNA 2LNIA 3FY4A 1OCOE 2ONDA 2WXQA 4U0UA 3D9NA 4I1OB 4L9PA 5EILA 2I6HA 4F7AA 5A23A 5B3SE 1E8YA 1BLXB 1HXIA 3UT7A 2DVWA 2P9NG 2YINA 4LNUD 3HXDA 3TWVA 4KBQA 4QFVA 3J5PA 2DYRE 3CVPA 3NOCD 4K5CA 2LXLA 1SA5A 4FLBA 5BT1A 3GYZA 2QY7A 5IY5E 2VSXE 2UWJG 4OAUC 4HOTA 1MQSA 3LCAA 3AAAC 3PZ4A 3PNLB 1QBQA 3APCA 4GPMA 3FTUA 4WWNA 4URKA 1DNPA 3U3WA 2VGXA 3TL5A 4PUCA 1FPPA 3FUNA 5HI7A 4AP2A 1BD8A 3RU0A 2GW1A 1H2TC 3ABKE 2L9BA 3RRMB 4A63B 3BU8A 3CKCA 4GZCA 4FLHA 3BG1B 2LAIA 3ZW3A 3IEGA 5FINA 3SO8A 1N11A 1O1RA 4G23A 3ASNE 4A1SA 3DPYA 1H2UA 1U2VG 3Q75A 2AXUA 2XPYA 3CHMA 3FTZA 4CGVA 5KJKA 1EPUA 1LTXA 3FEYA 3ABME 5EYLA 3D9OA 1HE8A 2CHXA 3RRUA 4HLEA 3NF1A 5CMYA 3FP3A 3TWQA 4X8QA 4OAVB 1KZOA 1EF1C 4JD2G 4B89A 4HBDA 3KSQA 4IULA 5EYPF 3CQCB 3E33A 2ETBA 3K9IA 1TEZA 4RG6A 3UIOC 2IO2C 4FULA 4I6JA 4KXKB 2I2OA 4JHJA 3AS4A 1IXVA 3L9TA 2RFMA 3FHEA 2R5SA 4CDRA 4BSXA 2AVPA 1LF8A 3ZIMA 3SBTB 2WMOA 3CQGB 3R9MA 2XEVA 2WXKA 2DIWA 4UI9K 3UIPC 2X6JA 3SBSA 4XI9A 1OY3D 3S7FA 3KD7A 2CG2A 1LD8A 5M72A 1E8ZA 4OVUA 3DPDA 2Y3AA 3ASGA 4RQIA 5FTPA 5EN5D 3FUKA 4Q96A 4U8YD 1AWCB 1GW6A 2A5EA 5B1AE 2B6CA 3X2QE 2NXPA 2UY1A 5AN8A 2H6IA 5HS0A 4EZLA 1Q2ZA 3V2XA 3HIZA 4ILHB 3SY2A 3UTMA 3S7BA 2I1KA 5FZQA 4CGWA 3BQOA 2KBXA 4OYSA 2FI7A 2IOSA 2IFUA 5CECB 2IEJA 3DSSA 3RO3A 3RRNB 3AU5A 4MLPA 1A5EA 2VSYA 3QOUA 4RSYA 1NI1A 4EBAG 4JPSA 5KNHD 3FFLA 2EIJE 3ZYLA 3LY7A 4FJYA 4BX8A 2J4DA 4LSZE 1SZAA 4XEIG 5JHAA 2OVBA 4CDNA 5BUZA 2HM8A 3ASFA 1UN9A 2XGSA 4BX9A 5FQ8A 4GAAA 4KVOA 3UXGA 1YYHA 5FQ4A 5ANRA 3P2BA 5A6CA 3SFYA 3MEKA 4MKTA 2NC9A 3AJIA 4AM9A 4YVOA 4LUNU 3UM2A 2WXOA 3LVQE 3CVNA 5FQ7A 4H7YA 2WVIA 2DZNA 5EX0A 4BT9A 3ZEFA 5AQBA 2FBNA 3JQ1A 2Y4UA 3RJVA 4AIFA 2AW6A 3Q15A 3E37A 2P9SG 2RKKA 3CHRA 4M3OA 3ZN3A 4KZ0A 1WY6A 1BI8B 3GZ1A 5C1DA 3T8MA 4WNDA 3PEUB 5HKPA 3DSUA 5C2YA 3LJ3A 4UQYA 1TNZA 1TNBA 4IYPA 5JJ6A 3L13A 3C98A 2NSZA 1TJCA 4LERA 3CK9A 5CERB 2XCCA 4A1GA 4CCAA 1S64A 4JZYA 4TXQA 4BTBA 3VLEA 3SFXA 1SQMA 2H6GA 1SVXA 1FVFA 4GYOA 1NA0A 3ULEG 3ZYQA 3RKVA 2J9QA 3S7DA 1QNFA 3Q9NC 4AEZC 4N3BA 2P9IG 1N4PA 3FEXA 4APOA 3ZYKA 2P58C 5AQ9A 3B7TA 4GYYA 2VGYA 5CMWA 3G2TA 4FHKA 1H6OA 3UX4A 3BG0B 3FTWA 2RD0A 3I5PA 2CFZA 4PS7A 4J8FA 3LXUX 5CBNA 3RSEG 3URZA 1KT1A 3PDNA 3AG1E 2J07A 3EJNA 3MGBA 1OWOA 1JWGA 1IKND 2OEWA 2WXJA 4Y6WA 4U04A 4EPZA 4ILGA 1NFIE 1DVPA 4FA6A 3FH7A 3DSXA 2BF0X 3MKRA 5E75A 4U95D 2AWIA 3W9FA 5FZRA 2F37A 1W3BA 1N0QA 3IV0A 4DX7D 3D3MA 4QQIA 3MJWA 4U0SA 2H6HA 3LEWA 4NURA 3NB2A 4WAFA 4A3VA 1E7UA 4CDMA 3TG4A 1S0PA 3MA5A 4GTTA 2FO7A 2VTBA 3JUIA 1FCHA 2I9CA 3D9LA 3IBEA 4WWPA 3ZKJA 4GTOA 5LOZA 3AG2E 4XKBA 1TNYA 3L54A 3L6AA 3ASOE 2EIKE 2XEEA 1TNUA 2DCPA 2WXNA 3CLJA 3UM1A 4LEUA 2WQ7A 4GB9A 1N4SA 5ENOD 2KCKA 3KEZA 1SZ9A 2YQ8A 3Q7AA 2XENA 1ZBPA 4APFA 1H6KA 2IY0C 4DX1A 3EIJA 4IRUA 4GTRA 2AXVA 1H6PA 4GA0A 2KZTB 2R02A 5D0QD 3LY8A 3ZUVB 3G2WA 1DCEA 4C48B 2NYJA 3CIAA 3JXIA 5AQ7A 2A5UA 1HX8A 1TN6A 1UJKA 4GTVA 3Q5MA 3QDNA 4YDWA 1PY1A 2PZIA 3CVWA 4N39A 1E8XA 4O60A 1OCRE 2WXGA 4HB5A 4OVVA 2X6IA 2CHWA 3ASDA 2J09A 3QKYA 3JYSA 3MYVA 5ENTD 5BNWA 3L82A 2Y4TA 3GW4A 1ELWA 3FH8A 4RVBA 3VTYA 1U3DA 3Q4AB 5G05C 5AAOA 2H6FA 3CVQA 5BV0A 3FUDA 5B1BE 3CK7A 3CSTA 3U9WA 4B94A 5G05J 1IHBA 3LVRE 5JJ7A 4K5AB 3UQ3A 5CCLA 3NQPA 2X3MA 3NZUA 4WUYA 3VLDA 5A7DB 2Y1LE 4GA2A 3V31A 4JEUA 2DYSE 4F6RD 3ZVVA 4GTSA 1MHQA 4LG6A 1OWPA 3EDTB 3G2VA 4PH4B 2EILE 4I6EA 4GCNA 3L17A 3F6QA 2VGXB 4AV7A 4N5CA 3C3OA 4GTQA 5AYWD 3G2SA 3D9PA 3PS6A 3WG7E 4C0EA 3PREA 4U96D 4YDOA 2MHKA 5HRYA 1DC2A 3GZSA 3JUEA 3DSWA 2Y69E 1MZCA 3L16A 2MOWA 1Z5SC 4K5BA 3FTSA 4RG9A 5AENA 1HU3A 1TNOA 1D8EA 3FU0A 2GROB 5J08A 5ENPD 2WM9A 5FWQA 2QZAA 2WXLA 4U7EB 5KJNA 4L7TA 1SA4A 1KT0A 3WXXA 2B0OE 4J8YA 4YDYA 1ELRA 2XS1A 3E4BA 3FTXA 4EZKA 1N9AA 5EKQD 2HE0A 4UWKA 3C72A 3IKOB 3ZXPA 3ZHEA 4GMRA 3TAXA 3T5VA 5BW8C 2WQHA 3E32A 4G11A 4O1PA 4JW1A 3S7JA 4HOQA 2ZIRA 4FADA 3EHNA 4BWRA 2XPZA 4JHKA 3E34A 3DXMG 1DCQA 4PS8A 2R17C 4JA7A 1EYHA 5JHBA 4L2YA 5G55A 3IHVA 4DK5A 1IQRA 5D66A 2M63A 3I4GA 5ANLA 2BEDA 5ENQD 3UINC 2KXPC 3KS2A 1MX4A 1UOHA 4J8EA 4BSZB 3CEQA 4DJAA 3PE4A 4LNGA 3VLFA 2WPVA 3B7BA 4FC8A 4JEHA 4DX5D 2EINE 3I3NA 4BTAA 4G24A 2UY1B 3TWRA 2X6KA 4AVXA 4ACKA 5KWDA 1OXJA 1IYGA 5H7PA 4A55A 3ZU7B 5ITZF 4BEPA 3D9HA 3APFA 4DI4A 3SI5A 4J8SA 2Y0BG 5ENSD 1HG2A 4CT0A 1INZA 3AS8A 3TXMA 2OOEA 3IHYA 4I9EA 3RO2A 3UM0A 1FT1A 4N3CA 3SD5A 4C9BB 4TUUA 3Q79A 3FU3A 4O1OA 1OT8A 5CCMA 1HS6A 2WXRA 1K1BA 1HF8A 4YNDA 1L5JA 5J90A 2VGEA 3PZ2A 4ANUA 3FU5A 4U8HA 2EIME 5EIBE 3L08A 5G04C 1E96B 2R2LA 3UMVA 4EBAA 1ZB1A 1K8KG 2DWZA 5G04J 4I1MA 1V55E 3HXBA 2LO6A 3IXEA 3B7UX 1N95A 4U63A 2BKGA 5BXUA 1JCRA 5ARFA 1P5QA 1UG3A 4PS3A 3SQVA 3T5XA 3QB2A 2CFUA 4G26A 1N4QA 4P29A 4F53A 3CVYA 4UUCA 2C0MA 4UQZA 4DRXE 5AJDA 5AARA 5T8IA 1XNFA 3SHFA 4AY5A 2FEZA 3EHQA 2PM7A 4GZDA 4WWOA 4GMLA 3R9AB 3FUIA 3OXFA 3EUVA 3UPVA 5T4YA 3LY9A 5CBOA 3ONKA 3T9KA 3CHQA 2VYIA 4ATZD 3TGOA 2J8SD 3DWLG 1YMPA 3UI2A 4ME2A 3VTXA 4GZ5A 2XHEA 5JJTA 4FJZA 4HORA 5KNGA 4GU5A 3LDZA 3UKUG 2QC9A 1E8WA 2AJAA 4U0ZA 4DX6D 4I9CA 2CG3A 3FH5A 4GA1A 3AU4A 2JLBA 1NL4A 4HI9A 3KAEA 2WQ6A 3OAWA 2JEKA 3ESLA 1QQEA 2LUHA 3V2OA 2KC7A 1H2VC 2KM4A 2WXFA 4LRZA 1KPSB 4JA9A 4R7LA 4UWLA 4AOFA 4XZ4A 5KCMA 2XS8A 4DUIA 4B93B 2YHEA 2MRIA 1S70B 2VSOE 1UW4B 1OCCE 2P9UG 1N54A 2ZGGA 4YDEA 3TWUA 3AG3E 4Q69A 1D9SA 4NACA 5EDSA 4I17A 4G1TA 4L23A 1JCQA 1Y6IA 4Z68A 1YA0A 3TWTA 4BETA 1WG0A 1XGWA 3I4RB 4ZFHA 4ABNA 3V79K 2PNNA 1RW2A 1AP7A 2XGOA 3TWSA 3DRAA 3EHRA 3SNXA 3ISMC 1MJ0A 2IOLA 2A4ZA 2ETCA 1WAO1 3NBNB 3DEPA 5KJLA 2FO1E 4B8CB 3S2AA 3MV3B 3MKQA 2PQRA 5CHEE 3LYAA 1O5MA 1IHGA 5ENNA 3LKUA 3MZLB 1JCSA 2V8SE 1BPOA 2QYJA 4D10C 4F1SA 2WXIA 3B13A 3ABLE 2WXMA 2VTBB 2CHZA 5HQ8A 3O4ZA 4EQFA 4N3AA 5EIDA 2PM6A 4ZHBA 2F8XK 4G8KA 4J0UA 4HQDA 2P9PG 1NP7A 4C0MA 2XPIA 3ULQA 3HVEB 3CHSA 3GZ2A 4JVSA 2XZTG 5D2MC 5CRVA 1HO8A 2WXHA 5DBKA 2P9KG 4NRHB 1PAQA 3FTYA 2LXMA 1U3CA 2IF4A 4PDXA 5ENRD 3PZDA 3CK8A 3QC1A 5JMND 2IO3C 4XKCA 3FUEA 3PUJA 4H7XA 3QAQA 2F8YA 2OCCE 2ZU6B 3CV0A 4J8DA 4GCOA 5JA4D 3L22A 3PH0C 4K03A 4TV3A 3CVVA 1EDUA 4ANXA 5LP0A 2GRQB 5CRUA 3BEEA 2L0TB 5LX8A 2DZOA 4TXRA 1OWNA 4CEMA 2HO1A 4XX5A 4HS2A 1OWMA 3LJNA 3CKBA 2XRYA 4WNGA 4FHJA 1IQUA 3D9MA 2RG8A 4JC8A 4G8LA 5LCWC 1D8DA 3ML9A 2LAHA 5FZSA 2C2LA 3E30A 3QWVA 4MBGA 5LCWJ 3KEAA 1E90A 2HYZA 2C0LA 2FF4A 4LCTA 3ZXSA 3RK6A 4GZ6A 3TG5A 3QWWA 1G3NB 1Z6TA 1TJFA 1UN8A 4EZJA 3AG4E 5BV1A 3P1UA 3HHMA 4ANVA 1B89A 3LPZA 5BPPA 3ZGQA 3UT8A 2P9LG 3QK0A 3MV2B 2BUGA 3LS8A 4I2ZA 3HDXA 3QWPA 4L1BA 2IQCA 3PRZA 2PQNA 2YNQA 4N2SA 5FQ6A 3MCXA 4UI9C 2OEVA 4RLYA 4JB8P 4AJWA 4BT8A 3UUXA 3TJPA 4AY6A 2ZXWE 4UI9J 4N5QA 2MYOA 3PZ1A 5E76A 2FULA 4GTPA 2L0IA 2V4HC 4TRQA 4Y6CA 2J4BA 4HXIA 4U8VD 1JWFA 2L6BA 4DI3A 1A17A 2LSUA 1KZPA 2KCVA 4E85A 2OV8A 3O48A 2XQ0A 3SZ7A 4I1AA 3JXJA 4B8AA 2XEHA 2XRZA 5DIZA 2GGFA 3TWWA 3HYMB 2ZGDA 2VQ2A 3ZNGA 2HR2A 4CYMD 3C3QA 2ETAA 4GTMA 3OXGA 5T3RA 2X38A 2KATA 3PUKA 1X81A 4CZ2D 4ATGA 4F3VA 4HFGA 2YHCA 1LD7A 4NQ0A 2GRRB 5AIJA 4KYOB 1TN7A 4GYWA 1X5BA 2V5FA 3HXCA 4GZ3A 1Z3YA 2XCBA 4Q94A 3FWVA 4HRMB 5AJLA 3HXEA 3ZPJA 4I2WA 2V4LA 3CSFA 3ZHEB 4E6HA 3ULYA 3APDA 3B95A 1S63A 4I43A 5CEDB 3J5QB 3ZFWA 4W9RA 4CT4A 1BI7B 3SGHA 2ILRA 4XIFA 1YCSB 3W9GA 3CVUA 3U4TA 1NA3A 3UT4A 1ZU2A 3G2UA 3ZRHA 4L2LA
chains in the Genus database with same CATH topology
1E8WA 2IJGX 3EIJA 4IULA 2DBAA 4ACLA 4IRUA 3NZSA 2AXVA 3CQCB 4GA0A 4FU3A 3AS5A 2KZTB 4U0ZA 2WXPA 3EIQC 1HH8A 5D0QD 3LY8A 4I9CA 5KJMA 3G2WA 2CG3A 3FH5A 3K9IA 4GA1A 1TEZA 2QFCA 4RG6A 3AU4A 2JLBA 3CIAA 3CVXA 2A5UA 4FULA 1HX8A 3KAEA 4I6JA 5G2NA 4KXKB 4KVMA 2WQ6A 1UJKA 2I2OA 4JHJA 3OAWA 3OTNA 2JEKA 3AS4A 3ESLA 3Q5MA 3QDNA 1QQEA 4JL0A 2KC7A 1H2VC 1PY1A 2KM4A 2WXFA 4LRZA 4JA9A 3FHEA 4R7LA 2R5SA 4UWLA 4XZ4A 2PZIA 5KCMA 4AOFA 4DPRA 3CVWA 4N39A 1E8XA 4CDRA 4HOSA 4BSXA 1QZ2A 2AVPA 2VSOE 2MRIA 1LF8A 1UW4B 2YHEA 3FU6A 1N54A 3ZIMA 3CHOA 4MS6A 2WXGA 3SBTB 4Q69A 4OVVA 2X6IA 2WMOA 2CHWA 3CQGB 1KLXA 2J09A 2XEVA 3ASDA 3QKYA 2WXKA 3JYSA 2DIWA 3MYVA 5BNWA 2WB2A 4UI9K 4NACA 2X6JA 5EDSA 2Y4TA 3GW4A 4I17A 3QJZA 1ELKA 3SBSA 4G1TA 1ELWA 4L23A 4XI9A 4UQXA 3S7FA 3KD7A 3FH8A 1Y6IA 2CG2A 1YA0A 3FDHA 3CVLA 4GMJA 4RVBA 3VTYA 5M72A 1E8ZA 3Q47B 4OVUA 3DPDA 2Y3AA 3ASGA 1U3DA 1XGWA 4IN3B 5FTPA 3D9JA 3FUMA 3I4RB 2GRMA 3D9IA 1OWLA 4BFRA 3FUKA 4Q96A 4ABNA 3Q4AB 2R59A 5FJYA 5G05C 1GW6A 4U07A 2XGOA 5BV0A 3CVQA 4CRWA 3FUDA 2Q7FA 2NXPA 3FULA 3CK7A 3CSTA 3RIBA 3SNXA 2UY1A 3U9WA 4B94A 4BTAA 1Z3XA 2IOLA 5G05J 4EZLA 3SFZA 4O6FA 2VJ8A 3LVRE 2A4ZA 1WAO1 3PEVB 5JJ7A 3FTVA 3HIZA 3UQ3A 5CCLA 3NQPA 4ILHB 3B7RL 4JHRA 5KJLA 2X3MA 3QNKA 3NZUA 4WUYA 4B8CB 3S2AA 3MV3B 3S7BA 3VLDA 4DLOA 3MKQA 2PQRA 4FP7A 3LYAA 5CHEE 4GA2A 5FT9A 5A7DB 4JEUA 2I1KA 1IHGA 5ENNA 2AXZA 3LKUA 5FZQA 3PE3A 4K0RA 4CGWA 3MZLB 2KCLA 3ZVVA 3QARA 2V8SE 1BPOA 4OYSA 4D10C 2FI7A 4KZCA 4N2QA 2IOSA 4F1SA 2IFUA 1MHQA 1OWPA 2WXIA 3PNTB 3ENEA 3B13A 2LSVA 3EDTB 3RO3A 3G2VA 4PH4B 2WXMA 3AU5A 3RRNB 2VTBB 2CHZA 5HQ8A 4MLPA 4I6EA 4AXHA 4GCNA 4YVQC 3O4ZA 4DLQA 3L17A 2VSYA 3QOUA 2VGXB 4RSYA 4EQFA 3SF4A 4AV7A 4N3AA 5LFAA 4EBAG 2PM6A 4N5CA 4HVBA 4JPSA 4J0UA 3ESKA 2PL2A 3FFLA 1NP7A 3EHMA 5AYWD 4C0MA 2XPIA 3G2SA 3ULQA 3HVEB 1NZNA 3ZYLA 3LY7A 4FJYA 4BX8A 2J4DA 3CHSA 3D9PA 1SZAA 3GZ2A 3PS6A 4C0EA 3PREA 4JVSA 5JHAA 2MHKA 1PC2A 1HO8A 3GZSA 2WXHA 2OVBA 4CDNA 3L16A 5DBKA 5BUZA 2HM8A 3ASFA 4NRHB 1UN9A 2MOWA 2EQXA 4EECA 1PAQA 3FTYA 3FUHA 2XGSA 1U3CA 3FTSA 3ML8A 4HOUA 4BX9A 5FQ8A 2OVFA 4GAAA 2IF4A 4PDXA 4RG9A 4KVOA 3PZDA 5AENA 3CK8A 3QC1A 1HG5A 1JUQA 1HU3A 4UWHA 4XKCA 4KMOA 1JPLA 3N71A 5FQ4A 3FUEA 4WNEA 5ANRA 3PUJA 4H7XA 3QAQA 3P2BA 2I1JA 3FU0A 2ZU6B 5A6CA 5J08A 1HFAA 5FWQA 2WM9A 3MEKA 3CV0A 2WXLA 3ONLA 1WM5A 4MRUA 5KJNA 4J8DA 4L7TA 4GCOA 4MKTA 1KT0A 2NC9A 2IONA 3WXXA 3L22A 4AM9A 3PH0C 4LUNU 4YVOA 4K03A 1ELRA 2X6HA 3E4BA 4XI0A 3FTXA 2WXOA 4EZKA 4TV3A 3LVQE 3CVNA 5FQ7A 3CVVA 1EDUA 4UWGA 4H7YA 2GRLA 4ANXA 5LP0A 5EKQD 4G2VA 2WVIA 3BEEA 4UWKA 4XE0A 4A3TA 5EX0A 4G25A 5ARGA 2L0TB 3ZEFA 3ZYMA 4BT9A 5LX8A 3FUJA 3IKOB 2FBNA 1Y8MA 3JQ1A 3ZHEA 2Y4UA 1OWNA 3U66A 3RJVA 1OUVA 2HO1A 4CEMA 4AIFA 3TAXA 2X6FA 2AW6A 4XX5A 4HS2A 1OWMA 3T5VA 3Q15A 5BW8C 2WQHA 4ILIA 4G11A 3CKBA 3CHRA 4M3OA 4WNFA 3ZN3A 2XRYA 4JW1A 4KZ0A 1WY6A 3GZ1A 3FUFA 5C1DA 4WNGA 4HOQA 3S7JA 4FADA 3T8MA 3EHNA 4FHJA 1IQUA 3D9MA 4WNDA 3PEUB 2RG8A 4JC8A 5C2YA 2E2EA 4BWRA 2XPZA 4JHKA 3LJ3A 3PVLA 5LCWC 4UQYA 1UJJA 4IYPA 3ML9A 4PS8A 3L13A 5JJ6A 2LAHA 2NSZA 1TJCA 3C98A 2R17C 4I6GA 4JA7A 4LERA 1H19A 1EYHA 5FZSA 2IU1A 2V0PA 5JHBA 4GPKA 2C2LA 4L2YA 5G55A 3CK9A 3QWVA 3IHVA 3JQ0A 2XCCA 4DK5A 5LCWJ 1IQRA 1E90A 4V3IA 2HYZA 3U64A 2M63A 2C0LA 2FF4A 3I4GA 4LCTA 2L6JA 5ANLA 3RK6A 4A1GA 3ZXSA 4CCAA 4J6IA 3HVEA 4GZ6A 3TG5A 4JZYA 5D0OD 2J08A 2KZTA 3KS2A 3QWWA 3CGHA 1Z6TA 4BTBA 2E0IA 1TJFA 4J8EA 1UN8A 4KT6B 3VLEA 4EZJA 5BV1A 3CEQA 3P1UA 4DJAA 3HHMA 1SQMA 4ANWA 3PE4A 4ANVA 1VDYA 1B89A 3LPZA 4GYOA 1FVFA 2WPVA 1NA0A 4FC8A 3UT8A 3VLFA 3ZGQA 3QK0A 3OXLA 4JEHA 3ZYQA 3MV2B 3I3NA 2BUGA 2J49A 2J9QA 3LS8A 3HDXA 3B7SA 4G24A 4I2ZA 1QNFA 2UY1B 3S7DA 3QWPA 4L1BA 4AEZC 2X6KA 2IQCA 4N3BA 4AVXA 3PRZA 4ACKA 1HZ4A 2PQNA 2VSNA 2YNQA 3DBSA 3FEXA 4N2SA 4APOA 1IYGA 2WMNA 5FQ6A 4A55A 3ZYKA 3MCXA 2BTDA 2P58C 4UI9C 1FVHA 3ASHA 3APFA 4B0ZA 1H0AA 3MX3A 3MKQB 4AJWA 4DI4A 3CHPA 3Q49B 4J8SA 3SI5A 2XGMA 3R7RA 4BT8A 1E7VA 3B7TA 3UUXA 4GYYA 2VGYA 1HG2A 4JXTA 4CT0A 3TJPA 1INZA 5CMWA 3CR3A 4AY6A 3AS8A 4UI9J 3R7QA 3TXMA 2OOEA 5EX3A 4UWFA 3IHYA 1N52A 4BY6A 4I9EA 3D9KA 3JCKC 3G2TA 2LNIA 5E76A 3TXNA 3FY4A 3RO2A 4FHKA 2ONDA 2FULA 2L0IA 3UX4A 2WXQA 3BG0B 4U0UA 3FTWA 3D9NA 4TRQA 4I1OB 4Y6CA 2J4BA 2RD0A 3I5PA 2CFZA 4N3CA 4HXIA 3SD5A 4C9BB 4TUUA 4F7AA 2I6HA 5A23A 4PS7A 3FU3A 1E8YA 3LXUX 4J8FA 5CCMA 3URZA 1KT1A 1HS6A 1JWFA 3PDNA 2WXRA 4DI3A 1HF8A 1HXIA 2J07A 4YNDA 1A17A 1L5JA 2LSUA 1OWOA 2YINA 3EJNA 3MGBA 3UT7A 1JWGA 5J90A 2KCVA 2WXJA 4Y6WA 4U04A 4EPZA 4ILGA 4E85A 1DVPA 4FA6A 2OV8A 4ANUA 3FH7A 3FU5A 3O48A 4KBQA 4QFVA 4U8HA 2XQ0A 3SZ7A 2BF0X 3L08A 3CVPA 5G04C 4I1AA 3MKRA 1E96B 4B8AA 5E75A 3UMVA 4EBAA 5DIZA 2XRZA 2AWIA 2GGFA 5FZRA 3HYMB 3RKVA 1W3BA 3IV0A 4FLBA 2VQ2A 5G04J 4I1MA 2HR2A 3D3MA 3MJWA 4U0SA 3GYZA 3OXGA 5BT1A 5T3RA 3LEWA 2LO6A 2X38A 2KATA 3B7UX 4NURA 2QY7A 2VSXE 2UWJG 3PUKA 4U63A 4HOTA 4ATGA 4F3VA 4HFGA 4WAFA 4A3VA 1E7UA 1MQSA 4CDMA 2YHCA 3LCAA 4NQ0A 3TG4A 5ARFA 1S0PA 5AIJA 1P5QA 3PNLB 4KYOB 1UG3A 3MA5A 3APCA 2FO7A 2VTBA 4PS3A 3JUIA 3T5XA 1FCHA 3QB2A 2I9CA 3FTUA 3D9LA 4GYWA 4WWNA 4URKA 1DNPA 2CFUA 1X5BA 2V5FA 3U3WA 3IBEA 2VGXA 4WWPA 4GZ3A 3TL5A 4G26A 4PUCA 5LOZA 1Z3YA 2XCBA 4Q94A 3FWVA 4P29A 5BPPA 3FUNA 5HI7A 4AP2A 4F53A 3CVYA 3RU0A 2GW1A 1H2TC 4XKBA 3L54A 2C0MA 2L9BA 4UQZA 5AJLA 3RRMB 5AJDA 3CKCA 3L6AA 3ZPJA 4GZCA 4FLHA 4I2WA 2V4LA 3CSFA 5T8IA 3BG1B 1XNFA 2LAIA 3SHFA 3ZHEB 3ZW3A 3IEGA 2FEZA 4AY5A 4GZDA 2PM7A 4E6HA 4WWOA 4G23A 4GMLA 4A1SA 2DCPA 3R9AB 2WXNA 1H2UA 3APDA 3FUIA 3OXFA 4I43A 3CLJA 2AXUA 4LEUA 2XPYA 3CHMA 3FTZA 4CGVA 2WQ7A 5KJKA 4GB9A 1EPUA 3ZFWA 3UPVA 4W9RA 3FEYA 3LY9A 5T4YA 4CT4A 3D9OA 3ONKA 3SGHA 2KCKA 2ILRA 1HE8A 3CHQA 2VYIA 3KEZA 2CHXA 4XIFA 1SZ9A 3RRUA 4HLEA 3TGOA 3CVUA 2YQ8A 3NF1A 5CMYA 4ME2A 3VTXA 3FP3A 4GZ5A 3U4TA 2XHEA 1NA3A 4FJZA 5JJTA 3UT4A 4HORA 1ZU2A 4GU5A 1EF1C 3G2UA 3LDZA 4B89A 3ZRHA 1ZBPA 4APFA 1H6KA 4L2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIJ A;  1HU3 A;  4IUL A;  1H2V C;  3RK6 A;  2VSX E;  2IOL A;  2IOS A;  1H2T C;  2FUL A;  2KZT B;  3FEY A;  5ANR A;  3FEX A;  4CT4 A;  2KZT A;  3EIQ C;  4B8A A;  2RG8 A;  4GMJ A;  4JHK A;  2VSO E;  1UW4 B;  2ZU6 B;  3L6A A;  1N54 A;  4C9B B;  1UG3 A;  2GGF A;  2NSZ A;  2HM8 A;  3JUI A;  2IU1 A;  4B8C B;  1PAQ A;  4CEM A;  2ION A;  2I2O A;  4GML A;  4JHJ A;  3D3M A;  4LUN U;  4B89 A;  4CRW A;  1H2U A;  1H6K A;  1N52 A; 
#chains in the Genus database with same CATH topology
 2IJG X;  1RZ4 A;  2DBA A;  4ACL A;  3UM3 A;  3NZS A;  4FU3 A;  1WDY A;  3AS5 A;  4NIK A;  2WXP A;  4LNB A;  3EIQ C;  1HH8 A;  5KJM A;  2QFC A;  3CVX A;  1N94 A;  2JAB A;  3DXK G;  5G2N A;  4KVM A;  4M7C A;  3OTN A;  4J7W A;  4JL0 A;  2F0Y A;  3EU5 A;  3HG0 D;  1V54 E;  4DPR A;  4HOS A;  3TWX A;  1QZ2 A;  3FU6 A;  4HRN A;  1O1S A;  3CHO A;  1K3Z D;  1MYO A;  4MS6 A;  1KLX A;  2XZD G;  2WB2 A;  3NAW A;  3QJZ A;  1ELK A;  3UKR G;  4UQX A;  4EHM A;  3FDH A;  3CVL A;  5AQA A;  4GMJ A;  3Q47 B;  2GRN B;  4IN3 B;  3D9J A;  3FUM A;  2GRM A;  3D9I A;  1OWL A;  4BFR A;  2R59 A;  5FJY A;  4U07 A;  4CRW A;  2Q7F A;  3DSV A;  3FUL A;  4DX2 A;  1K1A A;  3RIB A;  1Z3X A;  3SFZ A;  4O6F A;  3T8K A;  2VJ8 A;  3PEV B;  3FTV A;  1TYQ G;  3B7R L;  4JHR A;  2QYU A;  3QNK A;  4DLO A;  3Q73 A;  4FP7 A;  5FT9 A;  4TUM A;  2GRP B;  2AXZ A;  3PE3 A;  4K0R A;  2KCL A;  3QAR A;  4KZC A;  4N2Q A;  3RAU A;  3PNT B;  3ENE A;  2LSV A;  3EU9 A;  4AXH A;  3HXF A;  4YVQ C;  4DLQ A;  3SF4 A;  5LFA A;  4HVB A;  3C5R A;  3ESK A;  1TR4 A;  2PL2 A;  3Q7F A;  3EHM A;  1NZN A;  1FT2 A;  2RFA A;  1PC2 A;  2EQX A;  1N0R A;  4EEC A;  3FUH A;  5CEA A;  3ML8 A;  4HOU A;  2OVF A;  3V30 A;  4F1P A;  1N4R A;  1HG5 A;  1JUQ A;  4TXP A;  3HRA A;  4UWH A;  4BER A;  4KMO A;  3DST A;  1JPL A;  3N71 A;  1MX2 A;  4WNE A;  1TN8 A;  1SW6 A;  2I1J A;  3NOG D;  1HFA A;  3KSL A;  2BKK B;  3ONL A;  1WM5 A;  4MRU A;  4BES A;  4HRL A;  2ION A;  1QYM A;  2ZIS A;  2X6H A;  4XI0 A;  4UWG A;  2V5Q C;  2GRL A;  4G2V A;  4XE0 A;  1MX6 A;  3ZYM A;  4G25 A;  5ARG A;  4A3T A;  3FUJ A;  2R03 A;  1Y8M A;  3U66 A;  1OUV A;  2X6F A;  4HNA D;  4ILI A;  4HI8 A;  4WNF A;  3FUF A;  3Q78 A;  2E2E A;  3PVL A;  1UJJ A;  4I6G A;  1H19 A;  2IU1 A;  2V0P A;  4GPK A;  3C3R A;  3Q9U C;  3JQ0 A;  4V3I A;  3U64 A;  2L6J A;  4J6I A;  3HVE A;  5D0O D;  2J08 A;  2KZT A;  3CGH A;  2E0I A;  5KBA A;  4KT6 B;  2R05 A;  3DEO A;  4ANW A;  1VDY A;  5FIO A;  3OXL A;  5BXO A;  3BUA A;  1OCZ E;  2J49 A;  3B7S A;  1BU9 A;  2P2C P;  1HZ4 A;  2VSN A;  3DBS A;  1O1T A;  3PZ3 A;  2WMN A;  2BTD A;  1FVH A;  3ASH A;  4B0Z A;  1H0A A;  3MX3 A;  4HLL A;  3MKQ B;  3CHP A;  3Q49 B;  2XGM A;  3R7R A;  1E7V A;  4JXT A;  3CR3 A;  3R7Q A;  5EX3 A;  4UWF A;  1N52 A;  4BY6 A;  3D9K A;  3JCK C;  3TXN A;  2LNI A;  3FY4 A;  1OCO E;  2OND A;  2WXQ A;  4U0U A;  3D9N A;  4I1O B;  4L9P A;  5EIL A;  2I6H A;  4F7A A;  5A23 A;  5B3S E;  1E8Y A;  1BLX B;  1HXI A;  3UT7 A;  2DVW A;  2P9N G;  2YIN A;  4LNU D;  3HXD A;  3TWV A;  4KBQ A;  4QFV A;  3J5P A;  2DYR E;  3CVP A;  3NOC D;  4K5C A;  2LXL A;  1SA5 A;  4FLB A;  5BT1 A;  3GYZ A;  2QY7 A;  5IY5 E;  2VSX E;  2UWJ G;  4OAU C;  4HOT A;  1MQS A;  3LCA A;  3AAA C;  3PZ4 A;  3PNL B;  1QBQ A;  3APC A;  4GPM A;  3FTU A;  4WWN A;  4URK A;  1DNP A;  3U3W A;  2VGX A;  3TL5 A;  4PUC A;  1FPP A;  3FUN A;  5HI7 A;  4AP2 A;  1BD8 A;  3RU0 A;  2GW1 A;  1H2T C;  3ABK E;  2L9B A;  3RRM B;  4A63 B;  3BU8 A;  3CKC A;  4GZC A;  4FLH A;  3BG1 B;  2LAI A;  3ZW3 A;  3IEG A;  5FIN A;  3SO8 A;  1N11 A;  1O1R A;  4G23 A;  3ASN E;  4A1S A;  3DPY A;  1H2U A;  1U2V G;  3Q75 A;  2AXU A;  2XPY A;  3CHM A;  3FTZ A;  4CGV A;  5KJK A;  1EPU A;  1LTX A;  3FEY A;  3ABM E;  5EYL A;  3D9O A;  1HE8 A;  2CHX A;  3RRU A;  4HLE A;  3NF1 A;  5CMY A;  3FP3 A;  3TWQ A;  4X8Q A;  4OAV B;  1KZO A;  1EF1 C;  4JD2 G;  4B89 A;  4HBD A;  3KSQ A;  4IUL A;  5EYP F;  3CQC B;  3E33 A;  2ETB A;  3K9I A;  1TEZ A;  4RG6 A;  3UIO C;  2IO2 C;  4FUL A;  4I6J A;  4KXK B;  2I2O A;  4JHJ A;  3AS4 A;  1IXV A;  3L9T A;  2RFM A;  3FHE A;  2R5S A;  4CDR A;  4BSX A;  2AVP A;  1LF8 A;  3ZIM A;  3SBT B;  2WMO A;  3CQG B;  3R9M A;  2XEV A;  2WXK A;  2DIW A;  4UI9 K;  3UIP C;  2X6J A;  3SBS A;  4XI9 A;  1OY3 D;  3S7F A;  3KD7 A;  2CG2 A;  1LD8 A;  5M72 A;  1E8Z A;  4OVU A;  3DPD A;  2Y3A A;  3ASG A;  4RQI A;  5FTP A;  5EN5 D;  3FUK A;  4Q96 A;  4U8Y D;  1AWC B;  1GW6 A;  2A5E A;  5B1A E;  2B6C A;  3X2Q E;  2NXP A;  2UY1 A;  5AN8 A;  2H6I A;  5HS0 A;  4EZL A;  1Q2Z A;  3V2X A;  3HIZ A;  4ILH B;  3SY2 A;  3UTM A;  3S7B A;  2I1K A;  5FZQ A;  4CGW A;  3BQO A;  2KBX A;  4OYS A;  2FI7 A;  2IOS A;  2IFU A;  5CEC B;  2IEJ A;  3DSS A;  3RO3 A;  3RRN B;  3AU5 A;  4MLP A;  1A5E A;  2VSY A;  3QOU A;  4RSY A;  1NI1 A;  4EBA G;  4JPS A;  5KNH D;  3FFL A;  2EIJ E;  3ZYL A;  3LY7 A;  4FJY A;  4BX8 A;  2J4D A;  4LSZ E;  1SZA A;  4XEI G;  5JHA A;  2OVB A;  4CDN A;  5BUZ A;  2HM8 A;  3ASF A;  1UN9 A;  2XGS A;  4BX9 A;  5FQ8 A;  4GAA A;  4KVO A;  3UXG A;  1YYH A;  5FQ4 A;  5ANR A;  3P2B A;  5A6C A;  3SFY A;  3MEK A;  4MKT A;  2NC9 A;  3AJI A;  4AM9 A;  4YVO A;  4LUN U;  3UM2 A;  2WXO A;  3LVQ E;  3CVN A;  5FQ7 A;  4H7Y A;  2WVI A;  2DZN A;  5EX0 A;  4BT9 A;  3ZEF A;  5AQB A;  2FBN A;  3JQ1 A;  2Y4U A;  3RJV A;  4AIF A;  2AW6 A;  3Q15 A;  3E37 A;  2P9S G;  2RKK A;  3CHR A;  4M3O A;  3ZN3 A;  4KZ0 A;  1WY6 A;  1BI8 B;  3GZ1 A;  5C1D A;  3T8M A;  4WND A;  3PEU B;  5HKP A;  3DSU A;  5C2Y A;  3LJ3 A;  4UQY A;  1TNZ A;  1TNB A;  4IYP A;  5JJ6 A;  3L13 A;  3C98 A;  2NSZ A;  1TJC A;  4LER A;  3CK9 A;  5CER B;  2XCC A;  4A1G A;  4CCA A;  1S64 A;  4JZY A;  4TXQ A;  4BTB A;  3VLE A;  3SFX A;  1SQM A;  2H6G A;  1SVX A;  1FVF A;  4GYO A;  1NA0 A;  3ULE G;  3ZYQ A;  3RKV A;  2J9Q A;  3S7D A;  1QNF A;  3Q9N C;  4AEZ C;  4N3B A;  2P9I G;  1N4P A;  3FEX A;  4APO A;  3ZYK A;  2P58 C;  5AQ9 A;  3B7T A;  4GYY A;  2VGY A;  5CMW A;  3G2T A;  4FHK A;  1H6O A;  3UX4 A;  3BG0 B;  3FTW A;  2RD0 A;  3I5P A;  2CFZ A;  4PS7 A;  4J8F A;  3LXU X;  5CBN A;  3RSE G;  3URZ A;  1KT1 A;  3PDN A;  3AG1 E;  2J07 A;  3EJN A;  3MGB A;  1OWO A;  1JWG A;  1IKN D;  2OEW A;  2WXJ A;  4Y6W A;  4U04 A;  4EPZ A;  4ILG A;  1NFI E;  1DVP A;  4FA6 A;  3FH7 A;  3DSX A;  2BF0 X;  3MKR A;  5E75 A;  4U95 D;  2AWI A;  3W9F A;  5FZR A;  2F37 A;  1W3B A;  1N0Q A;  3IV0 A;  4DX7 D;  3D3M A;  4QQI A;  3MJW A;  4U0S A;  2H6H A;  3LEW A;  4NUR A;  3NB2 A;  4WAF A;  4A3V A;  1E7U A;  4CDM A;  3TG4 A;  1S0P A;  3MA5 A;  4GTT A;  2FO7 A;  2VTB A;  3JUI A;  1FCH A;  2I9C A;  3D9L A;  3IBE A;  4WWP A;  3ZKJ A;  4GTO A;  5LOZ A;  3AG2 E;  4XKB A;  1TNY A;  3L54 A;  3L6A A;  3ASO E;  2EIK E;  2XEE A;  1TNU A;  2DCP A;  2WXN A;  3CLJ A;  3UM1 A;  4LEU A;  2WQ7 A;  4GB9 A;  1N4S A;  5ENO D;  2KCK A;  3KEZ A;  1SZ9 A;  2YQ8 A;  3Q7A A;  2XEN A;  1ZBP A;  4APF A;  1H6K A;  2IY0 C;  4DX1 A;  3EIJ A;  4IRU A;  4GTR A;  2AXV A;  1H6P A;  4GA0 A;  2KZT B;  2R02 A;  5D0Q D;  3LY8 A;  3ZUV B;  3G2W A;  1DCE A;  4C48 B;  2NYJ A;  3CIA A;  3JXI A;  5AQ7 A;  2A5U A;  1HX8 A;  1TN6 A;  1UJK A;  4GTV A;  3Q5M A;  3QDN A;  4YDW A;  1PY1 A;  2PZI A;  3CVW A;  4N39 A;  1E8X A;  4O60 A;  1OCR E;  2WXG A;  4HB5 A;  4OVV A;  2X6I A;  2CHW A;  3ASD A;  2J09 A;  3QKY A;  3JYS A;  3MYV A;  5ENT D;  5BNW A;  3L82 A;  2Y4T A;  3GW4 A;  1ELW A;  3FH8 A;  4RVB A;  3VTY A;  1U3D A;  3Q4A B;  5G05 C;  5AAO A;  2H6F A;  3CVQ A;  5BV0 A;  3FUD A;  5B1B E;  3CK7 A;  3CST A;  3U9W A;  4B94 A;  5G05 J;  1IHB A;  3LVR E;  5JJ7 A;  4K5A B;  3UQ3 A;  5CCL A;  3NQP A;  2X3M A;  3NZU A;  4WUY A;  3VLD A;  5A7D B;  2Y1L E;  4GA2 A;  3V31 A;  4JEU A;  2DYS E;  4F6R D;  3ZVV A;  4GTS A;  1MHQ A;  4LG6 A;  1OWP A;  3EDT B;  3G2V A;  4PH4 B;  2EIL E;  4I6E A;  4GCN A;  3L17 A;  3F6Q A;  2VGX B;  4AV7 A;  4N5C A;  3C3O A;  4GTQ A;  5AYW D;  3G2S A;  3D9P A;  3PS6 A;  3WG7 E;  4C0E A;  3PRE A;  4U96 D;  4YDO A;  2MHK A;  5HRY A;  1DC2 A;  3GZS A;  3JUE A;  3DSW A;  2Y69 E;  1MZC A;  3L16 A;  2MOW A;  1Z5S C;  4K5B A;  3FTS A;  4RG9 A;  5AEN A;  1HU3 A;  1TNO A;  1D8E A;  3FU0 A;  2GRO B;  5J08 A;  5ENP D;  2WM9 A;  5FWQ A;  2QZA A;  2WXL A;  4U7E B;  5KJN A;  4L7T A;  1SA4 A;  1KT0 A;  3WXX A;  2B0O E;  4J8Y A;  4YDY A;  1ELR A;  2XS1 A;  3E4B A;  3FTX A;  4EZK A;  1N9A A;  5EKQ D;  2HE0 A;  4UWK A;  3C72 A;  3IKO B;  3ZXP A;  3ZHE A;  4GMR A;  3TAX A;  3T5V A;  5BW8 C;  2WQH A;  3E32 A;  4G11 A;  4O1P A;  4JW1 A;  3S7J A;  4HOQ A;  2ZIR A;  4FAD A;  3EHN A;  4BWR A;  2XPZ A;  4JHK A;  3E34 A;  3DXM G;  1DCQ A;  4PS8 A;  2R17 C;  4JA7 A;  1EYH A;  5JHB A;  4L2Y A;  5G55 A;  3IHV A;  4DK5 A;  1IQR A;  5D66 A;  2M63 A;  3I4G A;  5ANL A;  2BED A;  5ENQ D;  3UIN C;  2KXP C;  3KS2 A;  1MX4 A;  1UOH A;  4J8E A;  4BSZ B;  3CEQ A;  4DJA A;  3PE4 A;  4LNG A;  3VLF A;  2WPV A;  3B7B A;  4FC8 A;  4JEH A;  4DX5 D;  2EIN E;  3I3N A;  4BTA A;  4G24 A;  2UY1 B;  3TWR A;  2X6K A;  4AVX A;  4ACK A;  5KWD A;  1OXJ A;  1IYG A;  5H7P A;  4A55 A;  3ZU7 B;  5ITZ F;  4BEP A;  3D9H A;  3APF A;  4DI4 A;  3SI5 A;  4J8S A;  2Y0B G;  5ENS D;  1HG2 A;  4CT0 A;  1INZ A;  3AS8 A;  3TXM A;  2OOE A;  3IHY A;  4I9E A;  3RO2 A;  3UM0 A;  1FT1 A;  4N3C A;  3SD5 A;  4C9B B;  4TUU A;  3Q79 A;  3FU3 A;  4O1O A;  1OT8 A;  5CCM A;  1HS6 A;  2WXR A;  1K1B A;  1HF8 A;  4YND A;  1L5J A;  5J90 A;  2VGE A;  3PZ2 A;  4ANU A;  3FU5 A;  4U8H A;  2EIM E;  5EIB E;  3L08 A;  5G04 C;  1E96 B;  2R2L A;  3UMV A;  4EBA A;  1ZB1 A;  1K8K G;  2DWZ A;  5G04 J;  4I1M A;  1V55 E;  3HXB A;  2LO6 A;  3IXE A;  3B7U X;  1N95 A;  4U63 A;  2BKG A;  5BXU A;  1JCR A;  5ARF A;  1P5Q A;  1UG3 A;  4PS3 A;  3SQV A;  3T5X A;  3QB2 A;  2CFU A;  4G26 A;  1N4Q A;  4P29 A;  4F53 A;  3CVY A;  4UUC A;  2C0M A;  4UQZ A;  4DRX E;  5AJD A;  5AAR A;  5T8I A;  1XNF A;  3SHF A;  4AY5 A;  2FEZ A;  3EHQ A;  2PM7 A;  4GZD A;  4WWO A;  4GML A;  3R9A B;  3FUI A;  3OXF A;  3EUV A;  3UPV A;  5T4Y A;  3LY9 A;  5CBO A;  3ONK A;  3T9K A;  3CHQ A;  2VYI A;  4ATZ D;  3TGO A;  2J8S D;  3DWL G;  1YMP A;  3UI2 A;  4ME2 A;  3VTX A;  4GZ5 A;  2XHE A;  5JJT A;  4FJZ A;  4HOR A;  5KNG A;  4GU5 A;  3LDZ A;  3UKU G;  2QC9 A;  1E8W A;  2AJA A;  4U0Z A;  4DX6 D;  4I9C A;  2CG3 A;  3FH5 A;  4GA1 A;  3AU4 A;  2JLB A;  1NL4 A;  4HI9 A;  3KAE A;  2WQ6 A;  3OAW A;  2JEK A;  3ESL A;  1QQE A;  2LUH A;  3V2O A;  2KC7 A;  1H2V C;  2KM4 A;  2WXF A;  4LRZ A;  1KPS B;  4JA9 A;  4R7L A;  4UWL A;  4AOF A;  4XZ4 A;  5KCM A;  2XS8 A;  4DUI A;  4B93 B;  2YHE A;  2MRI A;  1S70 B;  2VSO E;  1UW4 B;  1OCC E;  2P9U G;  1N54 A;  2ZGG A;  4YDE A;  3TWU A;  3AG3 E;  4Q69 A;  1D9S A;  4NAC A;  5EDS A;  4I17 A;  4G1T A;  4L23 A;  1JCQ A;  1Y6I A;  4Z68 A;  1YA0 A;  3TWT A;  4BET A;  1WG0 A;  1XGW A;  3I4R B;  4ZFH A;  4ABN A;  3V79 K;  2PNN A;  1RW2 A;  1AP7 A;  2XGO A;  3TWS A;  3DRA A;  3EHR A;  3SNX A;  3ISM C;  1MJ0 A;  2IOL A;  2A4Z A;  2ETC A;  1WAO 1;  3NBN B;  3DEP A;  5KJL A;  2FO1 E;  4B8C B;  3S2A A;  3MV3 B;  3MKQ A;  2PQR A;  5CHE E;  3LYA A;  1O5M A;  1IHG A;  5ENN A;  3LKU A;  3MZL B;  1JCS A;  2V8S E;  1BPO A;  2QYJ A;  4D10 C;  4F1S A;  2WXI A;  3B13 A;  3ABL E;  2WXM A;  2VTB B;  2CHZ A;  5HQ8 A;  3O4Z A;  4EQF A;  4N3A A;  5EID A;  2PM6 A;  4ZHB A;  2F8X K;  4G8K A;  4J0U A;  4HQD A;  2P9P G;  1NP7 A;  4C0M A;  2XPI A;  3ULQ A;  3HVE B;  3CHS A;  3GZ2 A;  4JVS A;  2XZT G;  5D2M C;  5CRV A;  1HO8 A;  2WXH A;  5DBK A;  2P9K G;  4NRH B;  1PAQ A;  3FTY A;  2LXM A;  1U3C A;  2IF4 A;  4PDX A;  5ENR D;  3PZD A;  3CK8 A;  3QC1 A;  5JMN D;  2IO3 C;  4XKC A;  3FUE A;  3PUJ A;  4H7X A;  3QAQ A;  2F8Y A;  2OCC E;  2ZU6 B;  3CV0 A;  4J8D A;  4GCO A;  5JA4 D;  3L22 A;  3PH0 C;  4K03 A;  4TV3 A;  3CVV A;  1EDU A;  4ANX A;  5LP0 A;  2GRQ B;  5CRU A;  3BEE A;  2L0T B;  5LX8 A;  2DZO A;  4TXR A;  1OWN A;  4CEM A;  2HO1 A;  4XX5 A;  4HS2 A;  1OWM A;  3LJN A;  3CKB A;  2XRY A;  4WNG A;  4FHJ A;  1IQU A;  3D9M A;  2RG8 A;  4JC8 A;  4G8L A;  5LCW C;  1D8D A;  3ML9 A;  2LAH A;  5FZS A;  2C2L A;  3E30 A;  3QWV A;  4MBG A;  5LCW J;  3KEA A;  1E90 A;  2HYZ A;  2C0L A;  2FF4 A;  4LCT A;  3ZXS A;  3RK6 A;  4GZ6 A;  3TG5 A;  3QWW A;  1G3N B;  1Z6T A;  1TJF A;  1UN8 A;  4EZJ A;  3AG4 E;  5BV1 A;  3P1U A;  3HHM A;  4ANV A;  1B89 A;  3LPZ A;  5BPP A;  3ZGQ A;  3UT8 A;  2P9L G;  3QK0 A;  3MV2 B;  2BUG A;  3LS8 A;  4I2Z A;  3HDX A;  3QWP A;  4L1B A;  2IQC A;  3PRZ A;  2PQN A;  2YNQ A;  4N2S A;  5FQ6 A;  3MCX A;  4UI9 C;  2OEV A;  4RLY A;  4JB8 P;  4AJW A;  4BT8 A;  3UUX A;  3TJP A;  4AY6 A;  2ZXW E;  4UI9 J;  4N5Q A;  2MYO A;  3PZ1 A;  5E76 A;  2FUL A;  4GTP A;  2L0I A;  2V4H C;  4TRQ A;  4Y6C A;  2J4B A;  4HXI A;  4U8V D;  1JWF A;  2L6B A;  4DI3 A;  1A17 A;  2LSU A;  1KZP A;  2KCV A;  4E85 A;  2OV8 A;  3O48 A;  2XQ0 A;  3SZ7 A;  4I1A A;  3JXJ A;  4B8A A;  2XEH A;  2XRZ A;  5DIZ A;  2GGF A;  3TWW A;  3HYM B;  2ZGD A;  2VQ2 A;  3ZNG A;  2HR2 A;  4CYM D;  3C3Q A;  2ETA A;  4GTM A;  3OXG A;  5T3R A;  2X38 A;  2KAT A;  3PUK A;  1X81 A;  4CZ2 D;  4ATG A;  4F3V A;  4HFG A;  2YHC A;  1LD7 A;  4NQ0 A;  2GRR B;  5AIJ A;  4KYO B;  1TN7 A;  4GYW A;  1X5B A;  2V5F A;  3HXC A;  4GZ3 A;  1Z3Y A;  2XCB A;  4Q94 A;  3FWV A;  4HRM B;  5AJL A;  3HXE A;  3ZPJ A;  4I2W A;  2V4L A;  3CSF A;  3ZHE B;  4E6H A;  3ULY A;  3APD A;  3B95 A;  1S63 A;  4I43 A;  5CED B;  3J5Q B;  3ZFW A;  4W9R A;  4CT4 A;  1BI7 B;  3SGH A;  2ILR A;  4XIF A;  1YCS B;  3W9G A;  3CVU A;  3U4T A;  1NA3 A;  3UT4 A;  1ZU2 A;  3G2U A;  3ZRH A;  4L2L A; 
#chains in the Genus database with same CATH homology
 1E8W A;  2IJG X;  3EIJ A;  4IUL A;  2DBA A;  4ACL A;  4IRU A;  3NZS A;  2AXV A;  3CQC B;  4GA0 A;  4FU3 A;  3AS5 A;  2KZT B;  4U0Z A;  2WXP A;  3EIQ C;  1HH8 A;  5D0Q D;  3LY8 A;  4I9C A;  5KJM A;  3G2W A;  2CG3 A;  3FH5 A;  3K9I A;  4GA1 A;  1TEZ A;  2QFC A;  4RG6 A;  3AU4 A;  2JLB A;  3CIA A;  3CVX A;  2A5U A;  4FUL A;  1HX8 A;  3KAE A;  4I6J A;  5G2N A;  4KXK B;  4KVM A;  2WQ6 A;  1UJK A;  2I2O A;  4JHJ A;  3OAW A;  3OTN A;  2JEK A;  3AS4 A;  3ESL A;  3Q5M A;  3QDN A;  1QQE A;  4JL0 A;  2KC7 A;  1H2V C;  1PY1 A;  2KM4 A;  2WXF A;  4LRZ A;  4JA9 A;  3FHE A;  4R7L A;  2R5S A;  4UWL A;  4XZ4 A;  2PZI A;  5KCM A;  4AOF A;  4DPR A;  3CVW A;  4N39 A;  1E8X A;  4CDR A;  4HOS A;  4BSX A;  1QZ2 A;  2AVP A;  2VSO E;  2MRI A;  1LF8 A;  1UW4 B;  2YHE A;  3FU6 A;  1N54 A;  3ZIM A;  3CHO A;  4MS6 A;  2WXG A;  3SBT B;  4Q69 A;  4OVV A;  2X6I A;  2WMO A;  2CHW A;  3CQG B;  1KLX A;  2J09 A;  2XEV A;  3ASD A;  3QKY A;  2WXK A;  3JYS A;  2DIW A;  3MYV A;  5BNW A;  2WB2 A;  4UI9 K;  4NAC A;  2X6J A;  5EDS A;  2Y4T A;  3GW4 A;  4I17 A;  3QJZ A;  1ELK A;  3SBS A;  4G1T A;  1ELW A;  4L23 A;  4XI9 A;  4UQX A;  3S7F A;  3KD7 A;  3FH8 A;  1Y6I A;  2CG2 A;  1YA0 A;  3FDH A;  3CVL A;  4GMJ A;  4RVB A;  3VTY A;  5M72 A;  1E8Z A;  3Q47 B;  4OVU A;  3DPD A;  2Y3A A;  3ASG A;  1U3D A;  1XGW A;  4IN3 B;  5FTP A;  3D9J A;  3FUM A;  3I4R B;  2GRM A;  3D9I A;  1OWL A;  4BFR A;  3FUK A;  4Q96 A;  4ABN A;  3Q4A B;  2R59 A;  5FJY A;  5G05 C;  1GW6 A;  4U07 A;  2XGO A;  5BV0 A;  3CVQ A;  4CRW A;  3FUD A;  2Q7F A;  2NXP A;  3FUL A;  3CK7 A;  3CST A;  3RIB A;  3SNX A;  2UY1 A;  3U9W A;  4B94 A;  4BTA A;  1Z3X A;  2IOL A;  5G05 J;  4EZL A;  3SFZ A;  4O6F A;  2VJ8 A;  3LVR E;  2A4Z A;  1WAO 1;  3PEV B;  5JJ7 A;  3FTV A;  3HIZ A;  3UQ3 A;  5CCL A;  3NQP A;  4ILH B;  3B7R L;  4JHR A;  5KJL A;  2X3M A;  3QNK A;  3NZU A;  4WUY A;  4B8C B;  3S2A A;  3MV3 B;  3S7B A;  3VLD A;  4DLO A;  3MKQ A;  2PQR A;  4FP7 A;  3LYA A;  5CHE E;  4GA2 A;  5FT9 A;  5A7D B;  4JEU A;  2I1K A;  1IHG A;  5ENN A;  2AXZ A;  3LKU A;  5FZQ A;  3PE3 A;  4K0R A;  4CGW A;  3MZL B;  2KCL A;  3ZVV A;  3QAR A;  2V8S E;  1BPO A;  4OYS A;  4D10 C;  2FI7 A;  4KZC A;  4N2Q A;  2IOS A;  4F1S A;  2IFU A;  1MHQ A;  1OWP A;  2WXI A;  3PNT B;  3ENE A;  3B13 A;  2LSV A;  3EDT B;  3RO3 A;  3G2V A;  4PH4 B;  2WXM A;  3AU5 A;  3RRN B;  2VTB B;  2CHZ A;  5HQ8 A;  4MLP A;  4I6E A;  4AXH A;  4GCN A;  4YVQ C;  3O4Z A;  4DLQ A;  3L17 A;  2VSY A;  3QOU A;  2VGX B;  4RSY A;  4EQF A;  3SF4 A;  4AV7 A;  4N3A A;  5LFA A;  4EBA G;  2PM6 A;  4N5C A;  4HVB A;  4JPS A;  4J0U A;  3ESK A;  2PL2 A;  3FFL A;  1NP7 A;  3EHM A;  5AYW D;  4C0M A;  2XPI A;  3G2S A;  3ULQ A;  3HVE B;  1NZN A;  3ZYL A;  3LY7 A;  4FJY A;  4BX8 A;  2J4D A;  3CHS A;  3D9P A;  1SZA A;  3GZ2 A;  3PS6 A;  4C0E A;  3PRE A;  4JVS A;  5JHA A;  2MHK A;  1PC2 A;  1HO8 A;  3GZS A;  2WXH A;  2OVB A;  4CDN A;  3L16 A;  5DBK A;  5BUZ A;  2HM8 A;  3ASF A;  4NRH B;  1UN9 A;  2MOW A;  2EQX A;  4EEC A;  1PAQ A;  3FTY A;  3FUH A;  2XGS A;  1U3C A;  3FTS A;  3ML8 A;  4HOU A;  4BX9 A;  5FQ8 A;  2OVF A;  4GAA A;  2IF4 A;  4PDX A;  4RG9 A;  4KVO A;  3PZD A;  5AEN A;  3CK8 A;  3QC1 A;  1HG5 A;  1JUQ A;  1HU3 A;  4UWH A;  4XKC A;  4KMO A;  1JPL A;  3N71 A;  5FQ4 A;  3FUE A;  4WNE A;  5ANR A;  3PUJ A;  4H7X A;  3QAQ A;  3P2B A;  2I1J A;  3FU0 A;  2ZU6 B;  5A6C A;  5J08 A;  1HFA A;  5FWQ A;  2WM9 A;  3MEK A;  3CV0 A;  2WXL A;  3ONL A;  1WM5 A;  4MRU A;  5KJN A;  4J8D A;  4L7T A;  4GCO A;  4MKT A;  1KT0 A;  2NC9 A;  2ION A;  3WXX A;  3L22 A;  4AM9 A;  3PH0 C;  4LUN U;  4YVO A;  4K03 A;  1ELR A;  2X6H A;  3E4B A;  4XI0 A;  3FTX A;  2WXO A;  4EZK A;  4TV3 A;  3LVQ E;  3CVN A;  5FQ7 A;  3CVV A;  1EDU A;  4UWG A;  4H7Y A;  2GRL A;  4ANX A;  5LP0 A;  5EKQ D;  4G2V A;  2WVI A;  3BEE A;  4UWK A;  4XE0 A;  4A3T A;  5EX0 A;  4G25 A;  5ARG A;  2L0T B;  3ZEF A;  3ZYM A;  4BT9 A;  5LX8 A;  3FUJ A;  3IKO B;  2FBN A;  1Y8M A;  3JQ1 A;  3ZHE A;  2Y4U A;  1OWN A;  3U66 A;  3RJV A;  1OUV A;  2HO1 A;  4CEM A;  4AIF A;  3TAX A;  2X6F A;  2AW6 A;  4XX5 A;  4HS2 A;  1OWM A;  3T5V A;  3Q15 A;  5BW8 C;  2WQH A;  4ILI A;  4G11 A;  3CKB A;  3CHR A;  4M3O A;  4WNF A;  3ZN3 A;  2XRY A;  4JW1 A;  4KZ0 A;  1WY6 A;  3GZ1 A;  3FUF A;  5C1D A;  4WNG A;  4HOQ A;  3S7J A;  4FAD A;  3T8M A;  3EHN A;  4FHJ A;  1IQU A;  3D9M A;  4WND A;  3PEU B;  2RG8 A;  4JC8 A;  5C2Y A;  2E2E A;  4BWR A;  2XPZ A;  4JHK A;  3LJ3 A;  3PVL A;  5LCW C;  4UQY A;  1UJJ A;  4IYP A;  3ML9 A;  4PS8 A;  3L13 A;  5JJ6 A;  2LAH A;  2NSZ A;  1TJC A;  3C98 A;  2R17 C;  4I6G A;  4JA7 A;  4LER A;  1H19 A;  1EYH A;  5FZS A;  2IU1 A;  2V0P A;  5JHB A;  4GPK A;  2C2L A;  4L2Y A;  5G55 A;  3CK9 A;  3QWV A;  3IHV A;  3JQ0 A;  2XCC A;  4DK5 A;  5LCW J;  1IQR A;  1E90 A;  4V3I A;  2HYZ A;  3U64 A;  2M63 A;  2C0L A;  2FF4 A;  3I4G A;  4LCT A;  2L6J A;  5ANL A;  3RK6 A;  4A1G A;  3ZXS A;  4CCA A;  4J6I A;  3HVE A;  4GZ6 A;  3TG5 A;  4JZY A;  5D0O D;  2J08 A;  2KZT A;  3KS2 A;  3QWW A;  3CGH A;  1Z6T A;  4BTB A;  2E0I A;  1TJF A;  4J8E A;  1UN8 A;  4KT6 B;  3VLE A;  4EZJ A;  5BV1 A;  3CEQ A;  3P1U A;  4DJA A;  3HHM A;  1SQM A;  4ANW A;  3PE4 A;  4ANV A;  1VDY A;  1B89 A;  3LPZ A;  4GYO A;  1FVF A;  2WPV A;  1NA0 A;  4FC8 A;  3UT8 A;  3VLF A;  3ZGQ A;  3QK0 A;  3OXL A;  4JEH A;  3ZYQ A;  3MV2 B;  3I3N A;  2BUG A;  2J49 A;  2J9Q A;  3LS8 A;  3HDX A;  3B7S A;  4G24 A;  4I2Z A;  1QNF A;  2UY1 B;  3S7D A;  3QWP A;  4L1B A;  4AEZ C;  2X6K A;  2IQC A;  4N3B A;  4AVX A;  3PRZ A;  4ACK A;  1HZ4 A;  2PQN A;  2VSN A;  2YNQ A;  3DBS A;  3FEX A;  4N2S A;  4APO A;  1IYG A;  2WMN A;  5FQ6 A;  4A55 A;  3ZYK A;  3MCX A;  2BTD A;  2P58 C;  4UI9 C;  1FVH A;  3ASH A;  3APF A;  4B0Z A;  1H0A A;  3MX3 A;  3MKQ B;  4AJW A;  4DI4 A;  3CHP A;  3Q49 B;  4J8S A;  3SI5 A;  2XGM A;  3R7R A;  4BT8 A;  1E7V A;  3B7T A;  3UUX A;  4GYY A;  2VGY A;  1HG2 A;  4JXT A;  4CT0 A;  3TJP A;  1INZ A;  5CMW A;  3CR3 A;  4AY6 A;  3AS8 A;  4UI9 J;  3R7Q A;  3TXM A;  2OOE A;  5EX3 A;  4UWF A;  3IHY A;  1N52 A;  4BY6 A;  4I9E A;  3D9K A;  3JCK C;  3G2T A;  2LNI A;  5E76 A;  3TXN A;  3FY4 A;  3RO2 A;  4FHK A;  2OND A;  2FUL A;  2L0I A;  3UX4 A;  2WXQ A;  3BG0 B;  4U0U A;  3FTW A;  3D9N A;  4TRQ A;  4I1O B;  4Y6C A;  2J4B A;  2RD0 A;  3I5P A;  2CFZ A;  4N3C A;  4HXI A;  3SD5 A;  4C9B B;  4TUU A;  4F7A A;  2I6H A;  5A23 A;  4PS7 A;  3FU3 A;  1E8Y A;  3LXU X;  4J8F A;  5CCM A;  3URZ A;  1KT1 A;  1HS6 A;  1JWF A;  3PDN A;  2WXR A;  4DI3 A;  1HF8 A;  1HXI A;  2J07 A;  4YND A;  1A17 A;  1L5J A;  2LSU A;  1OWO A;  2YIN A;  3EJN A;  3MGB A;  3UT7 A;  1JWG A;  5J90 A;  2KCV A;  2WXJ A;  4Y6W A;  4U04 A;  4EPZ A;  4ILG A;  4E85 A;  1DVP A;  4FA6 A;  2OV8 A;  4ANU A;  3FH7 A;  3FU5 A;  3O48 A;  4KBQ A;  4QFV A;  4U8H A;  2XQ0 A;  3SZ7 A;  2BF0 X;  3L08 A;  3CVP A;  5G04 C;  4I1A A;  3MKR A;  1E96 B;  4B8A A;  5E75 A;  3UMV A;  4EBA A;  5DIZ A;  2XRZ A;  2AWI A;  2GGF A;  5FZR A;  3HYM B;  3RKV A;  1W3B A;  3IV0 A;  4FLB A;  2VQ2 A;  5G04 J;  4I1M A;  2HR2 A;  3D3M A;  3MJW A;  4U0S A;  3GYZ A;  3OXG A;  5BT1 A;  5T3R A;  3LEW A;  2LO6 A;  2X38 A;  2KAT A;  3B7U X;  4NUR A;  2QY7 A;  2VSX E;  2UWJ G;  3PUK A;  4U63 A;  4HOT A;  4ATG A;  4F3V A;  4HFG A;  4WAF A;  4A3V A;  1E7U A;  1MQS A;  4CDM A;  2YHC A;  3LCA A;  4NQ0 A;  3TG4 A;  5ARF A;  1S0P A;  5AIJ A;  1P5Q A;  3PNL B;  4KYO B;  1UG3 A;  3MA5 A;  3APC A;  2FO7 A;  2VTB A;  4PS3 A;  3JUI A;  3T5X A;  1FCH A;  3QB2 A;  2I9C A;  3FTU A;  3D9L A;  4GYW A;  4WWN A;  4URK A;  1DNP A;  2CFU A;  1X5B A;  2V5F A;  3U3W A;  3IBE A;  2VGX A;  4WWP A;  4GZ3 A;  3TL5 A;  4G26 A;  4PUC A;  5LOZ A;  1Z3Y A;  2XCB A;  4Q94 A;  3FWV A;  4P29 A;  5BPP A;  3FUN A;  5HI7 A;  4AP2 A;  4F53 A;  3CVY A;  3RU0 A;  2GW1 A;  1H2T C;  4XKB A;  3L54 A;  2C0M A;  2L9B A;  4UQZ A;  5AJL A;  3RRM B;  5AJD A;  3CKC A;  3L6A A;  3ZPJ A;  4GZC A;  4FLH A;  4I2W A;  2V4L A;  3CSF A;  5T8I A;  3BG1 B;  1XNF A;  2LAI A;  3SHF A;  3ZHE B;  3ZW3 A;  3IEG A;  2FEZ A;  4AY5 A;  4GZD A;  2PM7 A;  4E6H A;  4WWO A;  4G23 A;  4GML A;  4A1S A;  2DCP A;  3R9A B;  2WXN A;  1H2U A;  3APD A;  3FUI A;  3OXF A;  4I43 A;  3CLJ A;  2AXU A;  4LEU A;  2XPY A;  3CHM A;  3FTZ A;  4CGV A;  2WQ7 A;  5KJK A;  4GB9 A;  1EPU A;  3ZFW A;  3UPV A;  4W9R A;  3FEY A;  3LY9 A;  5T4Y A;  4CT4 A;  3D9O A;  3ONK A;  3SGH A;  2KCK A;  2ILR A;  1HE8 A;  3CHQ A;  2VYI A;  3KEZ A;  2CHX A;  4XIF A;  1SZ9 A;  3RRU A;  4HLE A;  3TGO A;  3CVU A;  2YQ8 A;  3NF1 A;  5CMY A;  4ME2 A;  3VTX A;  3FP3 A;  4GZ5 A;  3U4T A;  2XHE A;  1NA3 A;  4FJZ A;  5JJT A;  3UT4 A;  4HOR A;  1ZU2 A;  4GU5 A;  1EF1 C;  3G2U A;  3LDZ A;  4B89 A;  3ZRH A;  1ZBP A;  4APF A;  1H6K A;  4L2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...