2HM8A

Solution structure of the c-terminal ma-3 domain of pdcd4
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
136
structure length
136
Chain Sequence
GPLGSGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pdcd4 C-terminal MA-3 domain
publication title Structure of the C-terminal MA-3 domain of the tumour suppressor protein Pdcd4 and characterization of its interaction with eIF4A
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis
total genus 32
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2hm8A00
1H6KA 4C9BB 2VSXE 3JUIA 4JHKA 2VSOE 2FULA 1H2TC 4CT4A 2KZTB 4CRWA 1N54A 4GMJA 2IONA 4GMLA 2IU1A 1H2UA 3L6AA 3D3MA 4CEMA 1N52A 4B8CB 2IOSA 2NSZA 2IOLA 1PAQA 1HU3A 2I2OA 3RK6A 4LUNU 3EIQC 5ANRA 4B8AA 3FEYA 1UW4B 1UG3A 3FEXA 4IULA 1H2VC 2HM8A 3EIJA 4B89A 2GGFA 4JHJA 2ZU6B 2RG8A 2KZTA
chains in the Genus database with same CATH superfamily
1LD8A 3T8MA 4TXQA 5FQ7A 4A3VA 1QQEA 2XQ0A 3UINC 3L22A 4J7WA 2WQ7A 3SBSA 4APFA 3LY7A 3J5QB 2L6BA 3SNXA 3SF4A 3DSXA 2OVFA 3PZ4A 4GA2A 3L6AA 2P9NG 4L23A 2LAIA 5E75A 2I2OA 2P58C 4OAVB 3X2QE 3E34A 3PNTB 5KJNA 3IEGA 4U8HA 2QYUA 5B1AE 2PL2A 3K9IA 4JPSA 4C9BB 3ML9A 1KT0A 3UI2A 3EDTB 4WUYA 2WMNA 4CT0A 1IXVA 3OTNA 1N9AA 4WAFA 2OVBA 5D66A 3DBSA 2WXLA 2EIJE 2KZTB 1OCRE 3FUMA 3UX4A 3J5PA 2WXPA 2NXPA 4DX5D 2IY0C 4YDEA 2I6HA 3ZYLA 5DBKA 3BU8A 1N0RA 3EU9A 1DCQA 3DRAA 4YDOA 1SVXA 5CMYA 1EYHA 4EZJA 2H6HA 3F6QA 2X6KA 2WM9A 2L6JA 3Q5MA 3PEVB 5CHEE 1TN8A 4Z68A 2MOWA 3D9HA 1YYHA 2P9SG 2UY1A 1V55E 3UM0A 2LUHA 5CRVA 4IYPA 3JQ1A 1OCCE 3UM3A 4BSXA 2XPZA 3RO2A 4XIFA 4U0UA 1H19A 1UG3A 1S63A 5D0QD 3AS5A 2LXMA 4NQ0A 4TXPA 3BEEA 4GU5A 2PM6A 5EILA 2P9UG 3CVPA 4GTQA 4CGVA 3AU4A 3MV3B 4ANUA 1JWGA 4M3OA 3L82A 4DPRA 1SQMA 1TNBA 4J0UA 5G2NA 4O60A 5KJMA 4GPMA 3I3NA 5ENTD 4PUCA 3E37A 4LEUA 4ME2A 4U07A 3CHOA 3PZ2A 3APFA 2WXJA 3B7BA 4URKA 1E90A 2V4LA 1L5JA 5BV0A 5FZSA 5BNWA 3AS4A 4KT6B 4F3VA 1N0QA 2XGOA 4RQIA 3Q73A 2XPYA 3HYMB 2C0MA 1EDUA 2EQXA 3UKRG 2GGFA 2R17C 2RG8A 3TWTA 2GRMA 3ZXSA 3QAQA 3Q9NC 1Z3YA 3CSFA 3NB2A 3RO3A 2H6GA 4AXHA 4L7TA 1E8YA 2BF0X 3JUEA 3HXBA 1BU9A 2V0PA 5T4YA 4L1BA 2DZOA 3CQGB 1BLXB 1U3CA 2JEKA 4ANXA 5ENQD 4GTPA 1H2TC 3T5XA 3SHFA 3ZUVB 3KEZA 2AVPA 3S7BA 2GRRB 3FDHA 3PUJA 5BT1A 5CECB 3D9OA 4B93B 3CVVA 1FPPA 1FT2A 1UW4B 2QYJA 5A6CA 3VLEA 3PDNA 2RFAA 3CEQA 4ILHB 3FTYA 2PQRA 2WVIA 3U9WA 5CRUA 4X8QA 2P9KG 3SO8A 3U64A 3OXGA 2RD0A 3CK8A 5CMWA 4XI0A 1Z3XA 3FUFA 3QWWA 4UQXA 5G55A 4EHMA 4GYYA 3BG0B 4G24A 5FQ8A 3NBNB 4GB9A 3G2SA 3SZ7A 2WXHA 2CHZA 3EHQA 3CIAA 2ZGDA 3Q49B 4GYWA 5ANLA 1OWOA 2IU1A 3HG0D 3D3MA 4CEMA 4NURA 1E7VA 3RRNB 2XRZA 2FO7A 4N39A 3DSTA 5ENNA 4PS7A 1E8XA 4CGWA 1UN8A 3HRAA 4U63A 5KJKA 2VSXE 3QJZA 3ESKA 4JL0A 4BT8A 5HRYA 3S2AA 2PM7A 3MKQA 3RAUA 1KLXA 3FTXA 4UI9K 5FINA 2MRIA 1UOHA 5BXUA 3SQVA 1N4SA 4GPKA 3L54A 1ZBPA 2VTBB 3ZPJA 3AS8A 3UT8A 2AWIA 4GMRA 4UI9J 3FH8A 2WXRA 3PH0C 3TG4A 4B8CB 3ZW3A 2Y69E 4YVOA 2XCBA 1NL4A 3HXEA 2LAHA 3ASDA 2J4BA 4DX7D 2XEEA 5T8IA 4AJWA 1RZ4A 4CRWA 5FJYA 2EIKE 1H2UA 2CHWA 3ZU7B 1E8WA 3D9IA 2CFZA 1B89A 5ENPD 4UQYA 1HH8A 3QARA 2RFMA 1N4RA 3PUKA 2GRNB 3B95A 3FUHA 3MZLB 4F53A 3CK9A 4A1SA 4IN3B 3S7JA 4U0SA 3ESLA 3UT7A 3L16A 3DSSA 4KZCA 4J8DA 4U04A 5ANRA 4QFVA 5FQ6A 1TNZA 1TNOA 3CGHA 3LEWA 2J9QA 3FTZA 2DCPA 1X81A 4DLQA 3I5PA 2HE0A 3D9KA 5ENOD 2R59A 4FC8A 3AG4E 1OCZE 4ZFHA 1OWNA 2R2LA 2Y4UA 2XCCA 4AM9A 2BKKB 5HI7A 1N94A 4G2VA 4HRMB 1JWFA 3ZFWA 2IJGX 5AQAA 4GZ5A 5T3RA 3Q75A 2B6CA 3EU5A 3Q47B 4HI9A 5LCWC 4G8KA 5EN5D 1MX2A 3NAWA 5A7DB 1ELWA 4LERA 4WWNA 5JA4D 2YINA 1HX8A 3O48A 1TEZA 3R7RA 3ASGA 3HVEB 3ENEA 1NA3A 2YHEA 5EX0A 2A5UA 4RG9A 1A5EA 2BKGA 2IEJA 3Q79A 4UWLA 5LX8A 2DWZA 2A4ZA 3FTVA 4HOTA 4XKBA 4UQZA 4BFRA 5EIBE 1K1BA 1YA0A 3EHMA 3GW4A 3SBTB 3LDZA 4GTSA 1P5QA 4JHRA 1N4PA 2WXMA 5AARA 4DI4A 1D8DA 4N3AA 3DSWA 4APOA 4YVQC 4JA7A 3CLJA 4HOQA 5KWDA 1NA0A 1RW2A 3ULEG 5EX3A 1XNFA 3ABLE 4L2YA 4Y6WA 2QY7A 3IBEA 2X6IA 2XHEA 3D9JA 3LVRE 3VTYA 3FFLA 4JZYA 1H6OA 4J8FA 3UPVA 2X3MA 4JC8A 3ZHEB 3E4BA 2CG3A 2P2CP 2VGXB 1A17A 1K1AA 4Q69A 4LUNU 3PZ3A 4LNGA 4W9RA 4L2LA 1TN6A 4HS2A 4UWGA 3TG5A 5HKPA 5AAOA 3OXFA 3ULQA 1ZU2A 3B7UX 4GTMA 1N11A 4L9PA 3CR3A 4PS3A 3RK6A 1SZAA 1WM5A 4GZ3A 3LVQE 1BPOA 3JCKC 5FZRA 4HRLA 2PNNA 4EZLA 4BTAA 4DX6D 4DLOA 4KZ0A 1U2VG 1JPLA 2VSNA 1QBQA 4AVXA 1DCEA 4CZ2D 4ATZD 3ABKE 3KD7A 3PE4A 3ZYKA 2P9PG 2I1KA 5CERB 5EIDA 4AY6A 2P9IG 3AG1E 1E8ZA 5KNHD 1UN9A 5AQBA 4GCNA 4I6GA 4XKCA 2ONDA 1EPUA 5JJ6A 3PZ1A 3EIQC 1WAO1 1N4QA 2WXKA 2E0IA 2OCCE 2JLBA 1ELKA 3JYSA 4DI3A 2FI7A 3S7DA 1JUQA 4G25A 4EPZA 5G05C 3P2BA 4FULA 2WPVA 3DSVA 4G26A 4KMOA 1IHGA 4FU3A 2J07A 4BETA 2X6FA 1S0PA 1HXIA 3T9KA 4MLPA 1KZOA 3ZGQA 4GZDA 1Y8MA 3MA5A 2ZXWE 2FEZA 4HBDA 5FIOA 2VYIA 3ZNGA 1O5MA 2WXQA 1MYOA 3GZSA 4K5AB 2WXOA 1Z6TA 3MX3A 3UMVA 2WQHA 3C3OA 2R05A 1JCQA 2DYSE 3NOGD 4LRZA 4FP7A 1VDYA 2HR2A 1H0AA 3LY9A 2VGEA 2UY1B 2L0TB 5EDSA 3HXFA 3TXMA 2J09A 4NACA 1Z5SC 5AJDA 2XRYA 2XZTG 3FUJA 2ETCA 3CQCB 4RVBA 5KBAA 2F0YA 4WNEA 4IRUA 4U8YD 3Q7FA 3TGOA 3IHVA 2I1JA 3UIPC 4AOFA 3CVQA 2RKKA 3UTMA 2I9CA 4ANWA 2KBXA 3MV2B 1HS6A 3CVYA 4F1PA 1N95A 4EBAA 4I9EA 2NYJA 5FT9A 3BG1B 1MJ0A 1QYMA 2Y4TA 3MYVA 3T5VA 2KM4A 3PEUB 1H6KA 4KVMA 3W9FA 1QZ2A 1WDYA 3FTWA 4HLLA 1LF8A 4F1SA 3Q4AB 1KT1A 4BEPA 3EUVA 2C0LA 4N2QA 3MGBA 4TV3A 2R03A 1NI1A 2XZDG 4ACKA 4PDXA 3G2WA 1DVPA 3DPYA 4AV7A 5FZQA 2ZU6B 4I1OB 4I43A 4CYMD 5BV1A 3RKVA 5CCMA 3VLDA 2QC9A 4GYOA 4KXKB 1H2VC 4GTOA 4RG6A 5JHAA 4ATGA 4B89A 3ASOE 1HF8A 4I6JA 4JW1A 3DPDA 3B7RL 2GRPB 3ML8A 1WG0A 1LD7A 3KEAA 3CK7A 5AJLA 2DYRE 3V2OA 4FA6A 4HORA 3FTSA 2WXGA 4H7YA 1BI8B 3UM2A 3KSLA 1G3NB 1K8KG 2XS8A 5KJLA 3CSTA 3AG3E 4N5CA 4FHJA 2VJ8A 3ASHA 5JJ7A 2V4HC 2ETBA 5EYPF 2YHCA 1E96B 1OY3D 1X5BA 4DUIA 3NZUA 2FO1E 4MBGA 4EQFA 2DVWA 4N2SA 1H6PA 1NFIE 3FUDA 4HLEA 5D2MC 4TRQA 2GW1A 2LO6A 4JA9A 3ZYMA 3QWVA 2R5SA 4OAUC 3LS8A 2R02A 2OEVA 4A55A 4GTTA 5G04C 2LXLA 4NIKA 4CDRA 4J8YA 3T8KA 3Q9UC 3L08A 3APDA 2ZGGA 4FJZA 4NRHB 1UJJA 2KXPC 3MKQB 4XEIG 3AU5A 1IYGA 4CDNA 3MCXA 3HXDA 2EILE 4XI9A 4HRNA 2WB2A 3QKYA 4BT9A 5FQ4A 3DWLG 2IOSA 2NSZA 2X6HA 3QB2A 4HXIA 4XE0A 3TWXA 5JHBA 1MQSA 1EF1C 3EHRA 4G11A 4I9CA 2YQ8A 3D9NA 2XENA 3FU6A 4GMJA 4ZHBA 5LFAA 1SW6A 3ABME 1SA5A 2XGMA 3FP3A 2YNQA 3JQ0A 2CHXA 4BY6A 4GTRA 3SY2A 3FY4A 2UWJG 2VQ2A 4EBAG 4A3TA 2WXIA 2J8SD 4HQDA 3TWQA 4A1GA 1MX4A 5LCWJ 1IQUA 2F8XK 3NF1A 2BEDA 1OWPA 1MZCA 3QOUA 4KVOA 4BX8A 1OT8A 2L9BA 2KCLA 4O6FA 4I6EA 3PVLA 4Q94A 1JCSA 5D0OD 3CVUA 2XEHA 3VLFA 2XEVA 4LSZE 4KYOB 2DBAA 3ASFA 2VSOE 3SFXA 3QDNA 2J4DA 3I4RB 4GA1A 1HG2A 1ELRA 3FHEA 4QQIA 3HIZA 3ZKJA 4GZ6A 3TWRA 2KCKA 3MEKA 2DZNA 4JEUA 4I2WA 5IY5E 5AQ7A 1E7UA 3ZEFA 4GMLA 2L0IA 5BW8C 5HQ8A 3IXEA 5C2YA 3U3WA 3JXJA 1BI7B 3D9LA 2HO1A 4MRUA 3TWWA 1OWLA 4GZCA 4R7LA 3FUKA 3ZHEA 1N54A 2V5QC 4BTBA 3GZ2A 3CVXA 2H6IA 5CEDB 3LY8A 4E6HA 5EKQD 4LCTA 1DC2A 4ILGA 3ZIMA 3FWVA 3LJ3A 4U95D 3WG7E 1TJFA 4PS8A 3FU3A 1D9SA 3SFZA 5FTPA 1FT1A 4BESA 2AW6A 2LSVA 1NP7A 3ISMC 3V2XA 4MS6A 4M7CA 5AYWD 4N5QA 3IV0A 4EZKA 4JXTA 4DK5A 1FVHA 3VTXA 1HE8A 2F8YA 5M72A 2PQNA 2GRQB 3MKRA 3IKOB 5J90A 5CEAA 3AAAC 4H7XA 2EIME 4I1AA 2A5EA 3I4GA 1YCSB 2AXVA 5HS0A 2AJAA 3LJNA 5ENSD 2KZTA 3ZXPA 5BPPA 3B7TA 1D8EA 3IHYA 1NZNA 1ZB1A 4U7EB 2OOEA 4FLBA 2ZIRA 1TR4A 3R7QA 3V30A 2WXFA 3LKUA 4OVUA 3CKCA 3ZN3A 4UWKA 2ILRA 4PH4B 1KZPA 3B13A 5H7PA 2IFUA 1GW6A 5AQ9A 2Y0BG 3APCA 3LYAA 4WNDA 4OVVA 3AJIA 1XGWA 4YNDA 5BXOA 2ETAA 4LNBA 5G05J 3S7FA 3LXUX 3AG2E 3RRMB 4O1PA 4BWRA 2AXUA 2H6FA 2XPIA 3PE3A 4HNAD 3B7SA 5FWQA 1KPSB 2VSYA 5ARFA 3RIBA 4C0EA 4JVSA 1O1TA 3BUAA 1OUVA 4JHJA 2B0OE 4WWOA 3N71A 2FULA 3U4TA 3RJVA 3TWVA 2CG2A 3UT4A 2X6JA 2Y3AA 4F6RD 2F37A 3PZDA 4AEZC 5AIJA 3EIJA 3ZRHA 4K0RA 3QWPA 4TXRA 3GZ1A 4B0ZA 3DSUA 3MJWA 4UUCA 1INZA 1SA4A 1Y6IA 4WNFA 4HB5A 1AP7A 3KAEA 2C2LA 2E2EA 5AN8A 4Q96A 3DEPA 3CHMA 1MHQA 4OYSA 4D10C 3G2TA 3Q78A 4HVBA 3SGHA 5B3SE 2QFCA 3D9MA 2CFUA 3ASNE 4AP2A 1WY6A 2IONA 1TN7A 2GRLA 1IKND 3C98A 3SD5A 4DX1A 4F7AA 2VGYA 4ILIA 3TAXA 4TUMA 3UQ3A 4XZ4A 4BERA 4I1MA 2P9LG 3HXCA 3E32A 3NQPA 1O1SA 3FUEA 1FVFA 3CHRA 2EINE 4J8EA 3UXGA 3FUNA 2FBNA 3FEYA 4CCAA 4G23A 3TXNA 3L13A 5J08A 3NOCD 5LP0A 3WXXA 3DEOA 2KC7A 4GAAA 3DXMG 2IOLA 3ZVVA 4HOUA 2FF4A 2JABA 3C5RA 4BSZB 3OXLA 4P29A 3FULA 1JCRA 3NZSA 3RRUA 5C1DA 3QC1A 2XGSA 3URZA 3P1UA 5CCLA 3TWSA 3CVWA 1TYQG 4V3IA 4B94A 4CDMA 4I17A 4BX9A 5E76A 2WXNA 4K03A 2V8SE 3W9GA 4FADA 3GYZA 3G2UA 3EJNA 1K3ZD 3JXIA 3RSEG 2PZIA 1O1RA 2WQ6A 4DX2A 1HU3A 3UIOC 3SFYA 3TJPA 5BUZA 5JJTA 4MKTA 3V31A 1LTXA 2VTBA 4N3BA 3OAWA 1BD8A 1HZ4A 4CT4A 3QNKA 3CKBA 1TNUA 4AIFA 1S64A 4AY5A 2IO3C 2OV8A 2IQCA 4GA0A 5A23A 4XX5A 3DXKG 2MYOA 3O4ZA 1MX6A 3ULYA 1TJCA 3QK0A 4DRXE 4GTVA 3HHMA 4G8LA 4TUUA 2QZAA 3PRZA 5CBOA 5G04J 4ACLA 4UWFA 4HOSA 1V54E 4HFGA 5B1BE 1TNYA 3CHSA 4U96D 4ANVA 3ZYQA 3FH5A 3KS2A 1DNPA 1OXJA 4I2ZA 3V79K 3LCAA 3L9TA 2DIWA 2IF4A 3FH7A 3ONKA 2XS1A 3L17A 4ABNA 4WNGA 4DJAA 3BQOA 3UUXA 3UKUG 3CVLA 2M63A 2ZISA 4C0MA 4UI9C 3EHNA 3TWUA 5AENA 3CHPA 4U0ZA 1N52A 4JEHA 4WWPA 1SZ9A 3G2VA 4LNUD 4UWHA 5EYLA 5KCMA 5CBNA 1YMPA 1HFAA 2LSUA 3CVNA 4N3CA 1FCHA 3Q7AA 4HI8A 4B8AA 4J8SA 1U3DA 2HM8A 3KSQA 4K5CA 3R9AB 4FJYA 4JHKA 4KBQA 2J49A 3HVEA 4FHKA 4JD2G 1OWMA 3FTUA 2AXZA 3LPZA 3E33A 2IO2C 4G1TA 1HO8A 2MHKA 4J6IA 4LG6A 3FUIA 3PNLB 4YDWA 3JUIA 2HYZA 3SI5A 5ENRD 2BTDA 2Q7FA 3ONLA 3D9PA 1PY1A 1QNFA 3C3RA 3C72A 2NC9A 3TL5A 2GROB 3E30A 3HDXA 3FU5A 3PS6A 3UM1A 3U66A 1HG5A 1AWCB 2Y1LE 2KCVA 3CHQA 3PREA 3FU0A 4RSYA 4C48B 1PAQA 3Q15A 4IULA 4EECA 4GCOA 4JB8P 4K5BA 1S70B 1W3BA 4Y6CA 2V5FA 5JMND 4E85A 2VGXA 1IHBA 3CV0A 5DIZA 5LOZA 1IQRA 2OEWA 4FLHA 3FEXA 2LNIA 4U8VD 1Q2ZA 5ITZF 1UJKA 2BUGA 2WMOA 4YDYA 5ARGA 1PC2A 3RU0A 5KNGA 4O1OA 2KATA 2X38A 3C3QA 4A63B 3R9MA 2J08A 4RLYA 1OCOE
chains in the Genus database with same CATH topology
3QWPA 3LEWA 3GZ1A 4JW1A 2J9QA 3DPDA 3T8MA 3B7RL 3FTZA 3ML8A 3MJWA 4B0ZA 2DCPA 5FQ7A 4A3VA 4DLQA 1QQEA 3CK7A 2XQ0A 5AJLA 1INZA 3I5PA 1Y6IA 3L22A 4WNFA 3D9KA 2WQ7A 3KAEA 2R59A 3SBSA 2C2LA 4FC8A 2E2EA 4FA6A 4HORA 4Q96A 3FTSA 2WXGA 4H7YA 4APFA 3CHMA 1MHQA 4OYSA 4D10C 3G2TA 1OWNA 3LY7A 4HVBA 3SGHA 2Y4UA 2QFCA 2XCCA 3D9MA 5KJLA 4AM9A 3CSTA 5HI7A 4G2VA 3SNXA 2CFUA 4N5CA 4FHJA 3SF4A 2OVFA 3ASHA 2VJ8A 4AP2A 1WY6A 5JJ7A 1JWFA 3ZFWA 4K0RA 2IJGX 4GZ5A 2IONA 5T3RA 4GA2A 3L6AA 2YHCA 2GRLA 4L23A 2LAIA 3C98A 5E75A 1E96B 3SD5A 4F7AA 2VGYA 2I2OA 3Q47B 2P58C 4ILIA 1X5BA 3TAXA 3NZUA 3UQ3A 5LCWC 4XZ4A 4EQFA 3PNTB 4N2SA 5A7DB 1ELWA 5KJNA 3IEGA 4I1MA 4U8HA 4LERA 2PL2A 3K9IA 4WWNA 4JPSA 2YINA 3FUDA 4C9BB 4HLEA 1HX8A 3O48A 1TEZA 3ML9A 1KT0A 3NQPA 3R7RA 3FUEA 3EDTB 4TRQA 1FVFA 3CHRA 4WUYA 3ASGA 4J8EA 2GW1A 2LO6A 3HVEB 4JA9A 3ZYMA 2WMNA 2R5SA 3ENEA 3QWVA 4CT0A 1NA3A 2YHEA 3LS8A 3OTNA 5EX0A 4A55A 2A5UA 3FUNA 2FBNA 3FEYA 5G04C 4CCAA 4G23A 4RG9A 4CDRA 4WAFA 3TXNA 2OVBA 3L13A 5J08A 3DBSA 5LP0A 4UWLA 5LX8A 2WXLA 3L08A 2KZTB 3APDA 3WXXA 2A4ZA 3FTVA 4HOTA 3FUMA 4XKBA 2KC7A 4UQZA 4GAAA 4FJZA 4BFRA 4NRHB 2IOLA 1UJJA 1YA0A 3MKQB 3EHMA 3ZVVA 3GW4A 3SBTB 3LDZA 4HOUA 3AU5A 1P5QA 4JHRA 3UX4A 2FF4A 2WXMA 1IYGA 4CDNA 3OXLA 4P29A 2WXPA 4DI4A 2NXPA 3FULA 3MCXA 3NZSA 4N3AA 3RRUA 2I6HA 5C1DA 3QC1A 4APOA 4YVQC 5DBKA 4XI9A 3ZYLA 2XGSA 2WB2A 4JA7A 3QKYA 3CLJA 4BT9A 3URZA 5FQ4A 4HOQA 5CMYA 1EYHA 3P1UA 4EZJA 1NA0A 5CCLA 2IOSA 2NSZA 2X6HA 3QB2A 4HXIA 4XE0A 4V3IA 3CVWA 4B94A 4CDMA 4I17A 4BX9A 2X6KA 2WM9A 2L6JA 5JHBA 3Q5MA 3PEVB 5E76A 5CHEE 2WXNA 4K03A 2V8SE 1MQSA 1EF1C 4FADA 3GYZA 3G2UA 5EX3A 3EJNA 1XNFA 4L2YA 4Y6WA 2QY7A 3IBEA 2X6IA 2XHEA 3D9JA 4G11A 2MOWA 3LVRE 2UY1A 4I9CA 3VTYA 2YQ8A 3FFLA 3D9NA 3FU6A 4GMJA 5LFAA 4JZYA 4IYPA 4J8FA 3JQ1A 3UPVA 2X3MA 4JC8A 2PZIA 3ZHEB 3E4BA 2CG3A 4BSXA 2XGMA 2WQ6A 2VGXB 2XPZA 1A17A 3RO2A 4Q69A 4XIFA 3FP3A 4U0UA 2YNQA 1HU3A 1H19A 3JQ0A 4LUNU 2CHXA 4BY6A 3TJPA 3FY4A 5BUZA 5JJTA 1UG3A 4W9RA 2UWJG 2VQ2A 4L2LA 4MKTA 5D0QD 4EBAG 3AS5A 4A3TA 2WXIA 4HS2A 4NQ0A 2VTBA 3BEEA 4GU5A 2PM6A 4N3BA 3OAWA 4UWGA 3TG5A 3CVPA 4A1GA 4CGVA 3AU4A 3MV3B 4ANUA 1HZ4A 5LCWJ 3OXFA 3ULQA 4CT4A 1JWGA 4M3OA 1IQUA 3QNKA 1ZU2A 4DPRA 3NF1A 1OWPA 3CKBA 4AIFA 1SQMA 3B7UX 4AY5A 3QOUA 4J0UA 4KVOA 4BX8A 5G2NA 2L9BA 2KCLA 4O6FA 2OV8A 4I6EA 3CR3A 4PS3A 5KJMA 3PVLA 2IQCA 4Q94A 3RK6A 1SZAA 3I3NA 4GA0A 5A23A 4XX5A 1WM5A 5D0OD 3CVUA 4PUCA 3O4ZA 4LEUA 4U07A 4ME2A 3CHOA 1TJCA 3QK0A 4GZ3A 3VLFA 2XEVA 3LVQE 1BPOA 3JCKC 3HHMA 5FZRA 3APFA 2WXJA 4TUUA 4URKA 4KYOB 2DBAA 3PRZA 1E90A 2V4LA 1L5JA 3ASFA 2VSOE 5G04J 5BV0A 4ACLA 4EZLA 5FZSA 4BTAA 5BNWA 3AS4A 4KT6B 4F3VA 3QDNA 2J4DA 3I4RB 4GA1A 4UWFA 4DLOA 2XGOA 4KZ0A 4HOSA 1HG2A 1ELRA 4HFGA 1JPLA 2XPYA 3CHSA 3HYMB 2VSNA 3FHEA 4AVXA 3HIZA 2C0MA 1EDUA 4GZ6A 2EQXA 3KD7A 3PE4A 4ANVA 3ZYQA 3FH5A 3ZYKA 3KS2A 2I1KA 2GGFA 4AY6A 2R17C 1DNPA 2RG8A 2KCKA 3MEKA 2GRMA 3ZXSA 4I2ZA 3QAQA 1E8ZA 4JEUA 1UN9A 4I2WA 4GCNA 1Z3YA 1E7UA 4I6GA 3ZEFA 4GMLA 2L0IA 5BW8C 5HQ8A 4XKCA 3CSFA 3RO3A 4AXHA 4L7TA 1E8YA 2ONDA 3LCAA 2BF0X 1EPUA 2DIWA 2IF4A 3FH7A 3ONKA 5JJ6A 3L17A 4ABNA 4WNGA 5C2YA 3EIQC 2V0PA 5T4YA 4DJAA 3U3WA 1WAO1 4L1BA 3UUXA 2WXKA 2E0IA 2JLBA 3CVLA 2M63A 3D9LA 4C0MA 2HO1A 3CQGB 1ELKA 1U3CA 2JEKA 4UI9C 4MRUA 1OWLA 4GZCA 4R7LA 3FUKA 3JYSA 4ANXA 4DI3A 3ZHEA 1H2TC 3EHNA 2FI7A 1N54A 3T5XA 3SHFA 5AENA 3CHPA 3KEZA 3S7DA 1JUQA 2AVPA 4BTBA 3GZ2A 3CVXA 4G25A 4U0ZA 3LY8A 3S7BA 1N52A 4JEHA 4E6HA 5EKQD 4EPZA 4WWPA 1SZ9A 3FDHA 3G2VA 4LCTA 5G05C 3PUJA 5BT1A 4ILGA 3ZIMA 3D9OA 3P2BA 4FULA 3FWVA 2WPVA 3LJ3A 3CVVA 4UWHA 1UW4B 4G26A 5A6CA 3VLEA 3PDNA 5KCMA 1TJFA 3CEQA 4ILHB 4KMOA 3FTYA 4PS8A 1IHGA 2PQRA 3FU3A 4FU3A 1HFAA 2LSUA 2WVIA 2J07A 3U9WA 3CVNA 3SFZA 5FTPA 2X6FA 1S0PA 1HXIA 3U64A 3OXGA 2RD0A 4MLPA 2AW6A 3CK8A 3ZGQA 4GZDA 2LSVA 1NP7A 4N3CA 1FCHA 1Y8MA 5CMWA 4XI0A 1Z3XA 3MA5A 3FUFA 3QWWA 4MS6A 4UQXA 5G55A 4B8AA 5AYWD 2FEZA 4J8SA 3IV0A 4GYYA 3BG0B 4EZKA 1U3DA 2HM8A 4G24A 2VYIA 4JXTA 5FQ8A 4DK5A 4GB9A 3G2SA 3R9AB 4FJYA 1FVHA 3SZ7A 2WXHA 1HE8A 3VTXA 2CHZA 4JHKA 4KBQA 2J49A 3CIAA 5M72A 3Q49B 2WXQA 3HVEA 4GYWA 2PQNA 4FHKA 5ANLA 1OWOA 3IKOB 2IU1A 3GZSA 3MKRA 5J90A 3D3MA 4CEMA 1OWMA 3FTUA 4H7XA 2WXOA 4I1AA 1Z6TA 4NURA 2AXZA 3LPZA 1E7VA 3RRNB 2XRZA 3I4GA 2FO7A 4N39A 3MX3A 4G1TA 3UMVA 5ENNA 2AXVA 1HO8A 4PS7A 1E8XA 2MHKA 2WQHA 4J6IA 4CGWA 3FUIA 1UN8A 3PNLB 2KZTA 4U63A 5KJKA 5BPPA 3B7TA 3IHYA 2VSXE 3JUIA 3QJZA 2HYZA 4LRZA 3ESKA 4FP7A 1NZNA 1VDYA 2HR2A 4JL0A 3SI5A 1H0AA 4BT8A 3LY9A 3S2AA 2OOEA 2PM7A 3MKQA 4FLBA 1KLXA 2BTDA 2L0TB 2UY1B 5EDSA 3FTXA 2Q7FA 3R7QA 3TXMA 3ONLA 2J09A 3D9PA 4NACA 1PY1A 1QNFA 4UI9K 2NC9A 5AJDA 2WXFA 3TL5A 2XRYA 3FUJA 2MRIA 3LKUA 3CQCB 4OVUA 4RVBA 3CKCA 4WNEA 3HDXA 3ZN3A 4UWKA 2ILRA 4IRUA 4PH4B 3FU5A 3PS6A 3TGOA 4GPKA 3L54A 3IHVA 2I1JA 1ZBPA 3B13A 3U66A 2VTBB 4AOFA 2IFUA 3CVQA 3ZPJA 3AS8A 3UT8A 1HG5A 2AWIA 1GW6A 2I9CA 4ANWA 4UI9J 3FH8A 3MV2B 2WXRA 3APCA 2KCVA 3CHQA 3PH0C 3PREA 1HS6A 3FU0A 4RSYA 3TG4A 4B8CB 1PAQA 3ZW3A 3CVYA 3LYAA 4WNDA 4OVVA 1XGWA 4YVOA 4EBAA 2XCBA 4I9EA 3Q15A 5FT9A 4YNDA 4IULA 4EECA 4GCOA 2LAHA 3BG1B 2Y4TA 3MYVA 5G05J 3S7FA 3T5VA 2KM4A 3PEUB 3ASDA 1W3BA 2J4BA 3LXUX 5T8IA 1H6KA 4Y6CA 4KVMA 4AJWA 1QZ2A 3FTWA 4F1SA 1LF8A 3RRMB 3Q4AB 4CRWA 1KT1A 5FJYA 2V5FA 4E85A 2VGXA 1H2UA 2C0LA 4BWRA 4N2QA 3MGBA 4TV3A 2AXUA 3CV0A 5DIZA 2XPIA 3PE3A 3B7SA 5LOZA 5FWQA 2CHWA 1IQRA 4ACKA 1E8WA 4PDXA 2VSYA 3D9IA 2CFZA 3G2WA 5ARFA 3RIBA 4FLHA 1B89A 4JVSA 4C0EA 1DVPA 3FEXA 4UQYA 2LNIA 4AV7A 5FZQA 1OUVA 1UJKA 4JHJA 2ZU6B 1HH8A 3QARA 4I1OB 4WWOA 4I43A 3PUKA 3N71A 3FUHA 2BUGA 2FULA 3MZLB 2WMOA 4F53A 5ARGA 1PC2A 3U4TA 3RJVA 3CK9A 2CG2A 4A1SA 4IN3B 3UT4A 3S7JA 5BV1A 4U0SA 3RU0A 3ESLA 3UT7A 3RKVA 3L16A 2X6JA 4KZCA 4J8DA 4U04A 2KATA 2Y3AA 2X38A 3VLDA 5ANRA 5CCMA 4GYOA 4QFVA 3PZDA 4KXKB 2J08A 1H2VC 5FQ6A 4AEZC 5AIJA 3EIJA 4RG6A 4ATGA 3ZRHA 5JHAA 4B89A 1HF8A 3CGHA 4I6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6K A;  4C9B B;  2VSX E;  3JUI A;  4JHK A;  2VSO E;  2FUL A;  1H2T C;  4CT4 A;  2KZT B;  4CRW A;  1N54 A;  4GMJ A;  2ION A;  4GML A;  2IU1 A;  1H2U A;  3L6A A;  3D3M A;  4CEM A;  1N52 A;  4B8C B;  2IOS A;  2NSZ A;  2IOL A;  1PAQ A;  1HU3 A;  2I2O A;  3RK6 A;  4LUN U;  3EIQ C;  5ANR A;  4B8A A;  3FEY A;  1UW4 B;  1UG3 A;  3FEX A;  4IUL A;  1H2V C;  2HM8 A;  3EIJ A;  4B89 A;  2GGF A;  4JHJ A;  2ZU6 B;  2RG8 A;  2KZT A; 
#chains in the Genus database with same CATH topology
 1LD8 A;  3T8M A;  4TXQ A;  5FQ7 A;  4A3V A;  1QQE A;  2XQ0 A;  3UIN C;  3L22 A;  4J7W A;  2WQ7 A;  3SBS A;  4APF A;  3LY7 A;  3J5Q B;  2L6B A;  3SNX A;  3SF4 A;  3DSX A;  2OVF A;  3PZ4 A;  4GA2 A;  3L6A A;  2P9N G;  4L23 A;  2LAI A;  5E75 A;  2I2O A;  2P58 C;  4OAV B;  3X2Q E;  3E34 A;  3PNT B;  5KJN A;  3IEG A;  4U8H A;  2QYU A;  5B1A E;  2PL2 A;  3K9I A;  4JPS A;  4C9B B;  3ML9 A;  1KT0 A;  3UI2 A;  3EDT B;  4WUY A;  2WMN A;  4CT0 A;  1IXV A;  3OTN A;  1N9A A;  4WAF A;  2OVB A;  5D66 A;  3DBS A;  2WXL A;  2EIJ E;  2KZT B;  1OCR E;  3FUM A;  3UX4 A;  3J5P A;  2WXP A;  2NXP A;  4DX5 D;  2IY0 C;  4YDE A;  2I6H A;  3ZYL A;  5DBK A;  3BU8 A;  1N0R A;  3EU9 A;  1DCQ A;  3DRA A;  4YDO A;  1SVX A;  5CMY A;  1EYH A;  4EZJ A;  2H6H A;  3F6Q A;  2X6K A;  2WM9 A;  2L6J A;  3Q5M A;  3PEV B;  5CHE E;  1TN8 A;  4Z68 A;  2MOW A;  3D9H A;  1YYH A;  2P9S G;  2UY1 A;  1V55 E;  3UM0 A;  2LUH A;  5CRV A;  4IYP A;  3JQ1 A;  1OCC E;  3UM3 A;  4BSX A;  2XPZ A;  3RO2 A;  4XIF A;  4U0U A;  1H19 A;  1UG3 A;  1S63 A;  5D0Q D;  3AS5 A;  2LXM A;  4NQ0 A;  4TXP A;  3BEE A;  4GU5 A;  2PM6 A;  5EIL A;  2P9U G;  3CVP A;  4GTQ A;  4CGV A;  3AU4 A;  3MV3 B;  4ANU A;  1JWG A;  4M3O A;  3L82 A;  4DPR A;  1SQM A;  1TNB A;  4J0U A;  5G2N A;  4O60 A;  5KJM A;  4GPM A;  3I3N A;  5ENT D;  4PUC A;  3E37 A;  4LEU A;  4ME2 A;  4U07 A;  3CHO A;  3PZ2 A;  3APF A;  2WXJ A;  3B7B A;  4URK A;  1E90 A;  2V4L A;  1L5J A;  5BV0 A;  5FZS A;  5BNW A;  3AS4 A;  4KT6 B;  4F3V A;  1N0Q A;  2XGO A;  4RQI A;  3Q73 A;  2XPY A;  3HYM B;  2C0M A;  1EDU A;  2EQX A;  3UKR G;  2GGF A;  2R17 C;  2RG8 A;  3TWT A;  2GRM A;  3ZXS A;  3QAQ A;  3Q9N C;  1Z3Y A;  3CSF A;  3NB2 A;  3RO3 A;  2H6G A;  4AXH A;  4L7T A;  1E8Y A;  2BF0 X;  3JUE A;  3HXB A;  1BU9 A;  2V0P A;  5T4Y A;  4L1B A;  2DZO A;  3CQG B;  1BLX B;  1U3C A;  2JEK A;  4ANX A;  5ENQ D;  4GTP A;  1H2T C;  3T5X A;  3SHF A;  3ZUV B;  3KEZ A;  2AVP A;  3S7B A;  2GRR B;  3FDH A;  3PUJ A;  5BT1 A;  5CEC B;  3D9O A;  4B93 B;  3CVV A;  1FPP A;  1FT2 A;  1UW4 B;  2QYJ A;  5A6C A;  3VLE A;  3PDN A;  2RFA A;  3CEQ A;  4ILH B;  3FTY A;  2PQR A;  2WVI A;  3U9W A;  5CRU A;  4X8Q A;  2P9K G;  3SO8 A;  3U64 A;  3OXG A;  2RD0 A;  3CK8 A;  5CMW A;  4XI0 A;  1Z3X A;  3FUF A;  3QWW A;  4UQX A;  5G55 A;  4EHM A;  4GYY A;  3BG0 B;  4G24 A;  5FQ8 A;  3NBN B;  4GB9 A;  3G2S A;  3SZ7 A;  2WXH A;  2CHZ A;  3EHQ A;  3CIA A;  2ZGD A;  3Q49 B;  4GYW A;  5ANL A;  1OWO A;  2IU1 A;  3HG0 D;  3D3M A;  4CEM A;  4NUR A;  1E7V A;  3RRN B;  2XRZ A;  2FO7 A;  4N39 A;  3DST A;  5ENN A;  4PS7 A;  1E8X A;  4CGW A;  1UN8 A;  3HRA A;  4U63 A;  5KJK A;  2VSX E;  3QJZ A;  3ESK A;  4JL0 A;  4BT8 A;  5HRY A;  3S2A A;  2PM7 A;  3MKQ A;  3RAU A;  1KLX A;  3FTX A;  4UI9 K;  5FIN A;  2MRI A;  1UOH A;  5BXU A;  3SQV A;  1N4S A;  4GPK A;  3L54 A;  1ZBP A;  2VTB B;  3ZPJ A;  3AS8 A;  3UT8 A;  2AWI A;  4GMR A;  4UI9 J;  3FH8 A;  2WXR A;  3PH0 C;  3TG4 A;  4B8C B;  3ZW3 A;  2Y69 E;  4YVO A;  2XCB A;  1NL4 A;  3HXE A;  2LAH A;  3ASD A;  2J4B A;  4DX7 D;  2XEE A;  5T8I A;  4AJW A;  1RZ4 A;  4CRW A;  5FJY A;  2EIK E;  1H2U A;  2CHW A;  3ZU7 B;  1E8W A;  3D9I A;  2CFZ A;  1B89 A;  5ENP D;  4UQY A;  1HH8 A;  3QAR A;  2RFM A;  1N4R A;  3PUK A;  2GRN B;  3B95 A;  3FUH A;  3MZL B;  4F53 A;  3CK9 A;  4A1S A;  4IN3 B;  3S7J A;  4U0S A;  3ESL A;  3UT7 A;  3L16 A;  3DSS A;  4KZC A;  4J8D A;  4U04 A;  5ANR A;  4QFV A;  5FQ6 A;  1TNZ A;  1TNO A;  3CGH A;  3LEW A;  2J9Q A;  3FTZ A;  2DCP A;  1X81 A;  4DLQ A;  3I5P A;  2HE0 A;  3D9K A;  5ENO D;  2R59 A;  4FC8 A;  3AG4 E;  1OCZ E;  4ZFH A;  1OWN A;  2R2L A;  2Y4U A;  2XCC A;  4AM9 A;  2BKK B;  5HI7 A;  1N94 A;  4G2V A;  4HRM B;  1JWF A;  3ZFW A;  2IJG X;  5AQA A;  4GZ5 A;  5T3R A;  3Q75 A;  2B6C A;  3EU5 A;  3Q47 B;  4HI9 A;  5LCW C;  4G8K A;  5EN5 D;  1MX2 A;  3NAW A;  5A7D B;  1ELW A;  4LER A;  4WWN A;  5JA4 D;  2YIN A;  1HX8 A;  3O48 A;  1TEZ A;  3R7R A;  3ASG A;  3HVE B;  3ENE A;  1NA3 A;  2YHE A;  5EX0 A;  2A5U A;  4RG9 A;  1A5E A;  2BKG A;  2IEJ A;  3Q79 A;  4UWL A;  5LX8 A;  2DWZ A;  2A4Z A;  3FTV A;  4HOT A;  4XKB A;  4UQZ A;  4BFR A;  5EIB E;  1K1B A;  1YA0 A;  3EHM A;  3GW4 A;  3SBT B;  3LDZ A;  4GTS A;  1P5Q A;  4JHR A;  1N4P A;  2WXM A;  5AAR A;  4DI4 A;  1D8D A;  4N3A A;  3DSW A;  4APO A;  4YVQ C;  4JA7 A;  3CLJ A;  4HOQ A;  5KWD A;  1NA0 A;  1RW2 A;  3ULE G;  5EX3 A;  1XNF A;  3ABL E;  4L2Y A;  4Y6W A;  2QY7 A;  3IBE A;  2X6I A;  2XHE A;  3D9J A;  3LVR E;  3VTY A;  3FFL A;  4JZY A;  1H6O A;  4J8F A;  3UPV A;  2X3M A;  4JC8 A;  3ZHE B;  3E4B A;  2CG3 A;  2P2C P;  2VGX B;  1A17 A;  1K1A A;  4Q69 A;  4LUN U;  3PZ3 A;  4LNG A;  4W9R A;  4L2L A;  1TN6 A;  4HS2 A;  4UWG A;  3TG5 A;  5HKP A;  5AAO A;  3OXF A;  3ULQ A;  1ZU2 A;  3B7U X;  4GTM A;  1N11 A;  4L9P A;  3CR3 A;  4PS3 A;  3RK6 A;  1SZA A;  1WM5 A;  4GZ3 A;  3LVQ E;  1BPO A;  3JCK C;  5FZR A;  4HRL A;  2PNN A;  4EZL A;  4BTA A;  4DX6 D;  4DLO A;  4KZ0 A;  1U2V G;  1JPL A;  2VSN A;  1QBQ A;  4AVX A;  1DCE A;  4CZ2 D;  4ATZ D;  3ABK E;  3KD7 A;  3PE4 A;  3ZYK A;  2P9P G;  2I1K A;  5CER B;  5EID A;  4AY6 A;  2P9I G;  3AG1 E;  1E8Z A;  5KNH D;  1UN9 A;  5AQB A;  4GCN A;  4I6G A;  4XKC A;  2OND A;  1EPU A;  5JJ6 A;  3PZ1 A;  3EIQ C;  1WAO 1;  1N4Q A;  2WXK A;  2E0I A;  2OCC E;  2JLB A;  1ELK A;  3JYS A;  4DI3 A;  2FI7 A;  3S7D A;  1JUQ A;  4G25 A;  4EPZ A;  5G05 C;  3P2B A;  4FUL A;  2WPV A;  3DSV A;  4G26 A;  4KMO A;  1IHG A;  4FU3 A;  2J07 A;  4BET A;  2X6F A;  1S0P A;  1HXI A;  3T9K A;  4MLP A;  1KZO A;  3ZGQ A;  4GZD A;  1Y8M A;  3MA5 A;  2ZXW E;  2FEZ A;  4HBD A;  5FIO A;  2VYI A;  3ZNG A;  1O5M A;  2WXQ A;  1MYO A;  3GZS A;  4K5A B;  2WXO A;  1Z6T A;  3MX3 A;  3UMV A;  2WQH A;  3C3O A;  2R05 A;  1JCQ A;  2DYS E;  3NOG D;  4LRZ A;  4FP7 A;  1VDY A;  2HR2 A;  1H0A A;  3LY9 A;  2VGE A;  2UY1 B;  2L0T B;  5EDS A;  3HXF A;  3TXM A;  2J09 A;  4NAC A;  1Z5S C;  5AJD A;  2XRY A;  2XZT G;  3FUJ A;  2ETC A;  3CQC B;  4RVB A;  5KBA A;  2F0Y A;  4WNE A;  4IRU A;  4U8Y D;  3Q7F A;  3TGO A;  3IHV A;  2I1J A;  3UIP C;  4AOF A;  3CVQ A;  2RKK A;  3UTM A;  2I9C A;  4ANW A;  2KBX A;  3MV2 B;  1HS6 A;  3CVY A;  4F1P A;  1N95 A;  4EBA A;  4I9E A;  2NYJ A;  5FT9 A;  3BG1 B;  1MJ0 A;  1QYM A;  2Y4T A;  3MYV A;  3T5V A;  2KM4 A;  3PEU B;  1H6K A;  4KVM A;  3W9F A;  1QZ2 A;  1WDY A;  3FTW A;  4HLL A;  1LF8 A;  4F1S A;  3Q4A B;  1KT1 A;  4BEP A;  3EUV A;  2C0L A;  4N2Q A;  3MGB A;  4TV3 A;  2R03 A;  1NI1 A;  2XZD G;  4ACK A;  4PDX A;  3G2W A;  1DVP A;  3DPY A;  4AV7 A;  5FZQ A;  2ZU6 B;  4I1O B;  4I43 A;  4CYM D;  5BV1 A;  3RKV A;  5CCM A;  3VLD A;  2QC9 A;  4GYO A;  4KXK B;  1H2V C;  4GTO A;  4RG6 A;  5JHA A;  4ATG A;  4B89 A;  3ASO E;  1HF8 A;  4I6J A;  4JW1 A;  3DPD A;  3B7R L;  2GRP B;  3ML8 A;  1WG0 A;  1LD7 A;  3KEA A;  3CK7 A;  5AJL A;  2DYR E;  3V2O A;  4FA6 A;  4HOR A;  3FTS A;  2WXG A;  4H7Y A;  1BI8 B;  3UM2 A;  3KSL A;  1G3N B;  1K8K G;  2XS8 A;  5KJL A;  3CST A;  3AG3 E;  4N5C A;  4FHJ A;  2VJ8 A;  3ASH A;  5JJ7 A;  2V4H C;  2ETB A;  5EYP F;  2YHC A;  1E96 B;  1OY3 D;  1X5B A;  4DUI A;  3NZU A;  2FO1 E;  4MBG A;  4EQF A;  2DVW A;  4N2S A;  1H6P A;  1NFI E;  3FUD A;  4HLE A;  5D2M C;  4TRQ A;  2GW1 A;  2LO6 A;  4JA9 A;  3ZYM A;  3QWV A;  2R5S A;  4OAU C;  3LS8 A;  2R02 A;  2OEV A;  4A55 A;  4GTT A;  5G04 C;  2LXL A;  4NIK A;  4CDR A;  4J8Y A;  3T8K A;  3Q9U C;  3L08 A;  3APD A;  2ZGG A;  4FJZ A;  4NRH B;  1UJJ A;  2KXP C;  3MKQ B;  4XEI G;  3AU5 A;  1IYG A;  4CDN A;  3MCX A;  3HXD A;  2EIL E;  4XI9 A;  4HRN A;  2WB2 A;  3QKY A;  4BT9 A;  5FQ4 A;  3DWL G;  2IOS A;  2NSZ A;  2X6H A;  3QB2 A;  4HXI A;  4XE0 A;  3TWX A;  5JHB A;  1MQS A;  1EF1 C;  3EHR A;  4G11 A;  4I9C A;  2YQ8 A;  3D9N A;  2XEN A;  3FU6 A;  4GMJ A;  4ZHB A;  5LFA A;  1SW6 A;  3ABM E;  1SA5 A;  2XGM A;  3FP3 A;  2YNQ A;  3JQ0 A;  2CHX A;  4BY6 A;  4GTR A;  3SY2 A;  3FY4 A;  2UWJ G;  2VQ2 A;  4EBA G;  4A3T A;  2WXI A;  2J8S D;  4HQD A;  3TWQ A;  4A1G A;  1MX4 A;  5LCW J;  1IQU A;  2F8X K;  3NF1 A;  2BED A;  1OWP A;  1MZC A;  3QOU A;  4KVO A;  4BX8 A;  1OT8 A;  2L9B A;  2KCL A;  4O6F A;  4I6E A;  3PVL A;  4Q94 A;  1JCS A;  5D0O D;  3CVU A;  2XEH A;  3VLF A;  2XEV A;  4LSZ E;  4KYO B;  2DBA A;  3ASF A;  2VSO E;  3SFX A;  3QDN A;  2J4D A;  3I4R B;  4GA1 A;  1HG2 A;  1ELR A;  3FHE A;  4QQI A;  3HIZ A;  3ZKJ A;  4GZ6 A;  3TWR A;  2KCK A;  3MEK A;  2DZN A;  4JEU A;  4I2W A;  5IY5 E;  5AQ7 A;  1E7U A;  3ZEF A;  4GML A;  2L0I A;  5BW8 C;  5HQ8 A;  3IXE A;  5C2Y A;  3U3W A;  3JXJ A;  1BI7 B;  3D9L A;  2HO1 A;  4MRU A;  3TWW A;  1OWL A;  4GZC A;  4R7L A;  3FUK A;  3ZHE A;  1N54 A;  2V5Q C;  4BTB A;  3GZ2 A;  3CVX A;  2H6I A;  5CED B;  3LY8 A;  4E6H A;  5EKQ D;  4LCT A;  1DC2 A;  4ILG A;  3ZIM A;  3FWV A;  3LJ3 A;  4U95 D;  3WG7 E;  1TJF A;  4PS8 A;  3FU3 A;  1D9S A;  3SFZ A;  5FTP A;  1FT1 A;  4BES A;  2AW6 A;  2LSV A;  1NP7 A;  3ISM C;  3V2X A;  4MS6 A;  4M7C A;  5AYW D;  4N5Q A;  3IV0 A;  4EZK A;  4JXT A;  4DK5 A;  1FVH A;  3VTX A;  1HE8 A;  2F8Y A;  5M72 A;  2PQN A;  2GRQ B;  3MKR A;  3IKO B;  5J90 A;  5CEA A;  3AAA C;  4H7X A;  2EIM E;  4I1A A;  2A5E A;  3I4G A;  1YCS B;  2AXV A;  5HS0 A;  2AJA A;  3LJN A;  5ENS D;  2KZT A;  3ZXP A;  5BPP A;  3B7T A;  1D8E A;  3IHY A;  1NZN A;  1ZB1 A;  4U7E B;  2OOE A;  4FLB A;  2ZIR A;  1TR4 A;  3R7Q A;  3V30 A;  2WXF A;  3LKU A;  4OVU A;  3CKC A;  3ZN3 A;  4UWK A;  2ILR A;  4PH4 B;  1KZP A;  3B13 A;  5H7P A;  2IFU A;  1GW6 A;  5AQ9 A;  2Y0B G;  3APC A;  3LYA A;  4WND A;  4OVV A;  3AJI A;  1XGW A;  4YND A;  5BXO A;  2ETA A;  4LNB A;  5G05 J;  3S7F A;  3LXU X;  3AG2 E;  3RRM B;  4O1P A;  4BWR A;  2AXU A;  2H6F A;  2XPI A;  3PE3 A;  4HNA D;  3B7S A;  5FWQ A;  1KPS B;  2VSY A;  5ARF A;  3RIB A;  4C0E A;  4JVS A;  1O1T A;  3BUA A;  1OUV A;  4JHJ A;  2B0O E;  4WWO A;  3N71 A;  2FUL A;  3U4T A;  3RJV A;  3TWV A;  2CG2 A;  3UT4 A;  2X6J A;  2Y3A A;  4F6R D;  2F37 A;  3PZD A;  4AEZ C;  5AIJ A;  3EIJ A;  3ZRH A;  4K0R A;  3QWP A;  4TXR A;  3GZ1 A;  4B0Z A;  3DSU A;  3MJW A;  4UUC A;  1INZ A;  1SA4 A;  1Y6I A;  4WNF A;  4HB5 A;  1AP7 A;  3KAE A;  2C2L A;  2E2E A;  5AN8 A;  4Q96 A;  3DEP A;  3CHM A;  1MHQ A;  4OYS A;  4D10 C;  3G2T A;  3Q78 A;  4HVB A;  3SGH A;  5B3S E;  2QFC A;  3D9M A;  2CFU A;  3ASN E;  4AP2 A;  1WY6 A;  2ION A;  1TN7 A;  2GRL A;  1IKN D;  3C98 A;  3SD5 A;  4DX1 A;  4F7A A;  2VGY A;  4ILI A;  3TAX A;  4TUM A;  3UQ3 A;  4XZ4 A;  4BER A;  4I1M A;  2P9L G;  3HXC A;  3E32 A;  3NQP A;  1O1S A;  3FUE A;  1FVF A;  3CHR A;  2EIN E;  4J8E A;  3UXG A;  3FUN A;  2FBN A;  3FEY A;  4CCA A;  4G23 A;  3TXN A;  3L13 A;  5J08 A;  3NOC D;  5LP0 A;  3WXX A;  3DEO A;  2KC7 A;  4GAA A;  3DXM G;  2IOL A;  3ZVV A;  4HOU A;  2FF4 A;  2JAB A;  3C5R A;  4BSZ B;  3OXL A;  4P29 A;  3FUL A;  1JCR A;  3NZS A;  3RRU A;  5C1D A;  3QC1 A;  2XGS A;  3URZ A;  3P1U A;  5CCL A;  3TWS A;  3CVW A;  1TYQ G;  4V3I A;  4B94 A;  4CDM A;  4I17 A;  4BX9 A;  5E76 A;  2WXN A;  4K03 A;  2V8S E;  3W9G A;  4FAD A;  3GYZ A;  3G2U A;  3EJN A;  1K3Z D;  3JXI A;  3RSE G;  2PZI A;  1O1R A;  2WQ6 A;  4DX2 A;  1HU3 A;  3UIO C;  3SFY A;  3TJP A;  5BUZ A;  5JJT A;  4MKT A;  3V31 A;  1LTX A;  2VTB A;  4N3B A;  3OAW A;  1BD8 A;  1HZ4 A;  4CT4 A;  3QNK A;  3CKB A;  1TNU A;  4AIF A;  1S64 A;  4AY5 A;  2IO3 C;  2OV8 A;  2IQC A;  4GA0 A;  5A23 A;  4XX5 A;  3DXK G;  2MYO A;  3O4Z A;  1MX6 A;  3ULY A;  1TJC A;  3QK0 A;  4DRX E;  4GTV A;  3HHM A;  4G8L A;  4TUU A;  2QZA A;  3PRZ A;  5CBO A;  5G04 J;  4ACL A;  4UWF A;  4HOS A;  1V54 E;  4HFG A;  5B1B E;  1TNY A;  3CHS A;  4U96 D;  4ANV A;  3ZYQ A;  3FH5 A;  3KS2 A;  1DNP A;  1OXJ A;  4I2Z A;  3V79 K;  3LCA A;  3L9T A;  2DIW A;  2IF4 A;  3FH7 A;  3ONK A;  2XS1 A;  3L17 A;  4ABN A;  4WNG A;  4DJA A;  3BQO A;  3UUX A;  3UKU G;  3CVL A;  2M63 A;  2ZIS A;  4C0M A;  4UI9 C;  3EHN A;  3TWU A;  5AEN A;  3CHP A;  4U0Z A;  1N52 A;  4JEH A;  4WWP A;  1SZ9 A;  3G2V A;  4LNU D;  4UWH A;  5EYL A;  5KCM A;  5CBN A;  1YMP A;  1HFA A;  2LSU A;  3CVN A;  4N3C A;  1FCH A;  3Q7A A;  4HI8 A;  4B8A A;  4J8S A;  1U3D A;  2HM8 A;  3KSQ A;  4K5C A;  3R9A B;  4FJY A;  4JHK A;  4KBQ A;  2J49 A;  3HVE A;  4FHK A;  4JD2 G;  1OWM A;  3FTU A;  2AXZ A;  3LPZ A;  3E33 A;  2IO2 C;  4G1T A;  1HO8 A;  2MHK A;  4J6I A;  4LG6 A;  3FUI A;  3PNL B;  4YDW A;  3JUI A;  2HYZ A;  3SI5 A;  5ENR D;  2BTD A;  2Q7F A;  3ONL A;  3D9P A;  1PY1 A;  1QNF A;  3C3R A;  3C72 A;  2NC9 A;  3TL5 A;  2GRO B;  3E30 A;  3HDX A;  3FU5 A;  3PS6 A;  3UM1 A;  3U66 A;  1HG5 A;  1AWC B;  2Y1L E;  2KCV A;  3CHQ A;  3PRE A;  3FU0 A;  4RSY A;  4C48 B;  1PAQ A;  3Q15 A;  4IUL A;  4EEC A;  4GCO A;  4JB8 P;  4K5B A;  1S70 B;  1W3B A;  4Y6C A;  2V5F A;  5JMN D;  4E85 A;  2VGX A;  1IHB A;  3CV0 A;  5DIZ A;  5LOZ A;  1IQR A;  2OEW A;  4FLH A;  3FEX A;  2LNI A;  4U8V D;  1Q2Z A;  5ITZ F;  1UJK A;  2BUG A;  2WMO A;  4YDY A;  5ARG A;  1PC2 A;  3RU0 A;  5KNG A;  4O1O A;  2KAT A;  2X38 A;  3C3Q A;  4A63 B;  3R9M A;  2J08 A;  4RLY A;  1OCO E; 
#chains in the Genus database with same CATH homology
 3QWP A;  3LEW A;  3GZ1 A;  4JW1 A;  2J9Q A;  3DPD A;  3T8M A;  3B7R L;  3FTZ A;  3ML8 A;  3MJW A;  4B0Z A;  2DCP A;  5FQ7 A;  4A3V A;  4DLQ A;  1QQE A;  3CK7 A;  2XQ0 A;  5AJL A;  1INZ A;  3I5P A;  1Y6I A;  3L22 A;  4WNF A;  3D9K A;  2WQ7 A;  3KAE A;  2R59 A;  3SBS A;  2C2L A;  4FC8 A;  2E2E A;  4FA6 A;  4HOR A;  4Q96 A;  3FTS A;  2WXG A;  4H7Y A;  4APF A;  3CHM A;  1MHQ A;  4OYS A;  4D10 C;  3G2T A;  1OWN A;  3LY7 A;  4HVB A;  3SGH A;  2Y4U A;  2QFC A;  2XCC A;  3D9M A;  5KJL A;  4AM9 A;  3CST A;  5HI7 A;  4G2V A;  3SNX A;  2CFU A;  4N5C A;  4FHJ A;  3SF4 A;  2OVF A;  3ASH A;  2VJ8 A;  4AP2 A;  1WY6 A;  5JJ7 A;  1JWF A;  3ZFW A;  4K0R A;  2IJG X;  4GZ5 A;  2ION A;  5T3R A;  4GA2 A;  3L6A A;  2YHC A;  2GRL A;  4L23 A;  2LAI A;  3C98 A;  5E75 A;  1E96 B;  3SD5 A;  4F7A A;  2VGY A;  2I2O A;  3Q47 B;  2P58 C;  4ILI A;  1X5B A;  3TAX A;  3NZU A;  3UQ3 A;  5LCW C;  4XZ4 A;  4EQF A;  3PNT B;  4N2S A;  5A7D B;  1ELW A;  5KJN A;  3IEG A;  4I1M A;  4U8H A;  4LER A;  2PL2 A;  3K9I A;  4WWN A;  4JPS A;  2YIN A;  3FUD A;  4C9B B;  4HLE A;  1HX8 A;  3O48 A;  1TEZ A;  3ML9 A;  1KT0 A;  3NQP A;  3R7R A;  3FUE A;  3EDT B;  4TRQ A;  1FVF A;  3CHR A;  4WUY A;  3ASG A;  4J8E A;  2GW1 A;  2LO6 A;  3HVE B;  4JA9 A;  3ZYM A;  2WMN A;  2R5S A;  3ENE A;  3QWV A;  4CT0 A;  1NA3 A;  2YHE A;  3LS8 A;  3OTN A;  5EX0 A;  4A55 A;  2A5U A;  3FUN A;  2FBN A;  3FEY A;  5G04 C;  4CCA A;  4G23 A;  4RG9 A;  4CDR A;  4WAF A;  3TXN A;  2OVB A;  3L13 A;  5J08 A;  3DBS A;  5LP0 A;  4UWL A;  5LX8 A;  2WXL A;  3L08 A;  2KZT B;  3APD A;  3WXX A;  2A4Z A;  3FTV A;  4HOT A;  3FUM A;  4XKB A;  2KC7 A;  4UQZ A;  4GAA A;  4FJZ A;  4BFR A;  4NRH B;  2IOL A;  1UJJ A;  1YA0 A;  3MKQ B;  3EHM A;  3ZVV A;  3GW4 A;  3SBT B;  3LDZ A;  4HOU A;  3AU5 A;  1P5Q A;  4JHR A;  3UX4 A;  2FF4 A;  2WXM A;  1IYG A;  4CDN A;  3OXL A;  4P29 A;  2WXP A;  4DI4 A;  2NXP A;  3FUL A;  3MCX A;  3NZS A;  4N3A A;  3RRU A;  2I6H A;  5C1D A;  3QC1 A;  4APO A;  4YVQ C;  5DBK A;  4XI9 A;  3ZYL A;  2XGS A;  2WB2 A;  4JA7 A;  3QKY A;  3CLJ A;  4BT9 A;  3URZ A;  5FQ4 A;  4HOQ A;  5CMY A;  1EYH A;  3P1U A;  4EZJ A;  1NA0 A;  5CCL A;  2IOS A;  2NSZ A;  2X6H A;  3QB2 A;  4HXI A;  4XE0 A;  4V3I A;  3CVW A;  4B94 A;  4CDM A;  4I17 A;  4BX9 A;  2X6K A;  2WM9 A;  2L6J A;  5JHB A;  3Q5M A;  3PEV B;  5E76 A;  5CHE E;  2WXN A;  4K03 A;  2V8S E;  1MQS A;  1EF1 C;  4FAD A;  3GYZ A;  3G2U A;  5EX3 A;  3EJN A;  1XNF A;  4L2Y A;  4Y6W A;  2QY7 A;  3IBE A;  2X6I A;  2XHE A;  3D9J A;  4G11 A;  2MOW A;  3LVR E;  2UY1 A;  4I9C A;  3VTY A;  2YQ8 A;  3FFL A;  3D9N A;  3FU6 A;  4GMJ A;  5LFA A;  4JZY A;  4IYP A;  4J8F A;  3JQ1 A;  3UPV A;  2X3M A;  4JC8 A;  2PZI A;  3ZHE B;  3E4B A;  2CG3 A;  4BSX A;  2XGM A;  2WQ6 A;  2VGX B;  2XPZ A;  1A17 A;  3RO2 A;  4Q69 A;  4XIF A;  3FP3 A;  4U0U A;  2YNQ A;  1HU3 A;  1H19 A;  3JQ0 A;  4LUN U;  2CHX A;  4BY6 A;  3TJP A;  3FY4 A;  5BUZ A;  5JJT A;  1UG3 A;  4W9R A;  2UWJ G;  2VQ2 A;  4L2L A;  4MKT A;  5D0Q D;  4EBA G;  3AS5 A;  4A3T A;  2WXI A;  4HS2 A;  4NQ0 A;  2VTB A;  3BEE A;  4GU5 A;  2PM6 A;  4N3B A;  3OAW A;  4UWG A;  3TG5 A;  3CVP A;  4A1G A;  4CGV A;  3AU4 A;  3MV3 B;  4ANU A;  1HZ4 A;  5LCW J;  3OXF A;  3ULQ A;  4CT4 A;  1JWG A;  4M3O A;  1IQU A;  3QNK A;  1ZU2 A;  4DPR A;  3NF1 A;  1OWP A;  3CKB A;  4AIF A;  1SQM A;  3B7U X;  4AY5 A;  3QOU A;  4J0U A;  4KVO A;  4BX8 A;  5G2N A;  2L9B A;  2KCL A;  4O6F A;  2OV8 A;  4I6E A;  3CR3 A;  4PS3 A;  5KJM A;  3PVL A;  2IQC A;  4Q94 A;  3RK6 A;  1SZA A;  3I3N A;  4GA0 A;  5A23 A;  4XX5 A;  1WM5 A;  5D0O D;  3CVU A;  4PUC A;  3O4Z A;  4LEU A;  4U07 A;  4ME2 A;  3CHO A;  1TJC A;  3QK0 A;  4GZ3 A;  3VLF A;  2XEV A;  3LVQ E;  1BPO A;  3JCK C;  3HHM A;  5FZR A;  3APF A;  2WXJ A;  4TUU A;  4URK A;  4KYO B;  2DBA A;  3PRZ A;  1E90 A;  2V4L A;  1L5J A;  3ASF A;  2VSO E;  5G04 J;  5BV0 A;  4ACL A;  4EZL A;  5FZS A;  4BTA A;  5BNW A;  3AS4 A;  4KT6 B;  4F3V A;  3QDN A;  2J4D A;  3I4R B;  4GA1 A;  4UWF A;  4DLO A;  2XGO A;  4KZ0 A;  4HOS A;  1HG2 A;  1ELR A;  4HFG A;  1JPL A;  2XPY A;  3CHS A;  3HYM B;  2VSN A;  3FHE A;  4AVX A;  3HIZ A;  2C0M A;  1EDU A;  4GZ6 A;  2EQX A;  3KD7 A;  3PE4 A;  4ANV A;  3ZYQ A;  3FH5 A;  3ZYK A;  3KS2 A;  2I1K A;  2GGF A;  4AY6 A;  2R17 C;  1DNP A;  2RG8 A;  2KCK A;  3MEK A;  2GRM A;  3ZXS A;  4I2Z A;  3QAQ A;  1E8Z A;  4JEU A;  1UN9 A;  4I2W A;  4GCN A;  1Z3Y A;  1E7U A;  4I6G A;  3ZEF A;  4GML A;  2L0I A;  5BW8 C;  5HQ8 A;  4XKC A;  3CSF A;  3RO3 A;  4AXH A;  4L7T A;  1E8Y A;  2OND A;  3LCA A;  2BF0 X;  1EPU A;  2DIW A;  2IF4 A;  3FH7 A;  3ONK A;  5JJ6 A;  3L17 A;  4ABN A;  4WNG A;  5C2Y A;  3EIQ C;  2V0P A;  5T4Y A;  4DJA A;  3U3W A;  1WAO 1;  4L1B A;  3UUX A;  2WXK A;  2E0I A;  2JLB A;  3CVL A;  2M63 A;  3D9L A;  4C0M A;  2HO1 A;  3CQG B;  1ELK A;  1U3C A;  2JEK A;  4UI9 C;  4MRU A;  1OWL A;  4GZC A;  4R7L A;  3FUK A;  3JYS A;  4ANX A;  4DI3 A;  3ZHE A;  1H2T C;  3EHN A;  2FI7 A;  1N54 A;  3T5X A;  3SHF A;  5AEN A;  3CHP A;  3KEZ A;  3S7D A;  1JUQ A;  2AVP A;  4BTB A;  3GZ2 A;  3CVX A;  4G25 A;  4U0Z A;  3LY8 A;  3S7B A;  1N52 A;  4JEH A;  4E6H A;  5EKQ D;  4EPZ A;  4WWP A;  1SZ9 A;  3FDH A;  3G2V A;  4LCT A;  5G05 C;  3PUJ A;  5BT1 A;  4ILG A;  3ZIM A;  3D9O A;  3P2B A;  4FUL A;  3FWV A;  2WPV A;  3LJ3 A;  3CVV A;  4UWH A;  1UW4 B;  4G26 A;  5A6C A;  3VLE A;  3PDN A;  5KCM A;  1TJF A;  3CEQ A;  4ILH B;  4KMO A;  3FTY A;  4PS8 A;  1IHG A;  2PQR A;  3FU3 A;  4FU3 A;  1HFA A;  2LSU A;  2WVI A;  2J07 A;  3U9W A;  3CVN A;  3SFZ A;  5FTP A;  2X6F A;  1S0P A;  1HXI A;  3U64 A;  3OXG A;  2RD0 A;  4MLP A;  2AW6 A;  3CK8 A;  3ZGQ A;  4GZD A;  2LSV A;  1NP7 A;  4N3C A;  1FCH A;  1Y8M A;  5CMW A;  4XI0 A;  1Z3X A;  3MA5 A;  3FUF A;  3QWW A;  4MS6 A;  4UQX A;  5G55 A;  4B8A A;  5AYW D;  2FEZ A;  4J8S A;  3IV0 A;  4GYY A;  3BG0 B;  4EZK A;  1U3D A;  2HM8 A;  4G24 A;  2VYI A;  4JXT A;  5FQ8 A;  4DK5 A;  4GB9 A;  3G2S A;  3R9A B;  4FJY A;  1FVH A;  3SZ7 A;  2WXH A;  1HE8 A;  3VTX A;  2CHZ A;  4JHK A;  4KBQ A;  2J49 A;  3CIA A;  5M72 A;  3Q49 B;  2WXQ A;  3HVE A;  4GYW A;  2PQN A;  4FHK A;  5ANL A;  1OWO A;  3IKO B;  2IU1 A;  3GZS A;  3MKR A;  5J90 A;  3D3M A;  4CEM A;  1OWM A;  3FTU A;  4H7X A;  2WXO A;  4I1A A;  1Z6T A;  4NUR A;  2AXZ A;  3LPZ A;  1E7V A;  3RRN B;  2XRZ A;  3I4G A;  2FO7 A;  4N39 A;  3MX3 A;  4G1T A;  3UMV A;  5ENN A;  2AXV A;  1HO8 A;  4PS7 A;  1E8X A;  2MHK A;  2WQH A;  4J6I A;  4CGW A;  3FUI A;  1UN8 A;  3PNL B;  2KZT A;  4U63 A;  5KJK A;  5BPP A;  3B7T A;  3IHY A;  2VSX E;  3JUI A;  3QJZ A;  2HYZ A;  4LRZ A;  3ESK A;  4FP7 A;  1NZN A;  1VDY A;  2HR2 A;  4JL0 A;  3SI5 A;  1H0A A;  4BT8 A;  3LY9 A;  3S2A A;  2OOE A;  2PM7 A;  3MKQ A;  4FLB A;  1KLX A;  2BTD A;  2L0T B;  2UY1 B;  5EDS A;  3FTX A;  2Q7F A;  3R7Q A;  3TXM A;  3ONL A;  2J09 A;  3D9P A;  4NAC A;  1PY1 A;  1QNF A;  4UI9 K;  2NC9 A;  5AJD A;  2WXF A;  3TL5 A;  2XRY A;  3FUJ A;  2MRI A;  3LKU A;  3CQC B;  4OVU A;  4RVB A;  3CKC A;  4WNE A;  3HDX A;  3ZN3 A;  4UWK A;  2ILR A;  4IRU A;  4PH4 B;  3FU5 A;  3PS6 A;  3TGO A;  4GPK A;  3L54 A;  3IHV A;  2I1J A;  1ZBP A;  3B13 A;  3U66 A;  2VTB B;  4AOF A;  2IFU A;  3CVQ A;  3ZPJ A;  3AS8 A;  3UT8 A;  1HG5 A;  2AWI A;  1GW6 A;  2I9C A;  4ANW A;  4UI9 J;  3FH8 A;  3MV2 B;  2WXR A;  3APC A;  2KCV A;  3CHQ A;  3PH0 C;  3PRE A;  1HS6 A;  3FU0 A;  4RSY A;  3TG4 A;  4B8C B;  1PAQ A;  3ZW3 A;  3CVY A;  3LYA A;  4WND A;  4OVV A;  1XGW A;  4YVO A;  4EBA A;  2XCB A;  4I9E A;  3Q15 A;  5FT9 A;  4YND A;  4IUL A;  4EEC A;  4GCO A;  2LAH A;  3BG1 B;  2Y4T A;  3MYV A;  5G05 J;  3S7F A;  3T5V A;  2KM4 A;  3PEU B;  3ASD A;  1W3B A;  2J4B A;  3LXU X;  5T8I A;  1H6K A;  4Y6C A;  4KVM A;  4AJW A;  1QZ2 A;  3FTW A;  4F1S A;  1LF8 A;  3RRM B;  3Q4A B;  4CRW A;  1KT1 A;  5FJY A;  2V5F A;  4E85 A;  2VGX A;  1H2U A;  2C0L A;  4BWR A;  4N2Q A;  3MGB A;  4TV3 A;  2AXU A;  3CV0 A;  5DIZ A;  2XPI A;  3PE3 A;  3B7S A;  5LOZ A;  5FWQ A;  2CHW A;  1IQR A;  4ACK A;  1E8W A;  4PDX A;  2VSY A;  3D9I A;  2CFZ A;  3G2W A;  5ARF A;  3RIB A;  4FLH A;  1B89 A;  4JVS A;  4C0E A;  1DVP A;  3FEX A;  4UQY A;  2LNI A;  4AV7 A;  5FZQ A;  1OUV A;  1UJK A;  4JHJ A;  2ZU6 B;  1HH8 A;  3QAR A;  4I1O B;  4WWO A;  4I43 A;  3PUK A;  3N71 A;  3FUH A;  2BUG A;  2FUL A;  3MZL B;  2WMO A;  4F53 A;  5ARG A;  1PC2 A;  3U4T A;  3RJV A;  3CK9 A;  2CG2 A;  4A1S A;  4IN3 B;  3UT4 A;  3S7J A;  5BV1 A;  4U0S A;  3RU0 A;  3ESL A;  3UT7 A;  3RKV A;  3L16 A;  2X6J A;  4KZC A;  4J8D A;  4U04 A;  2KAT A;  2Y3A A;  2X38 A;  3VLD A;  5ANR A;  5CCM A;  4GYO A;  4QFV A;  3PZD A;  4KXK B;  2J08 A;  1H2V C;  5FQ6 A;  4AEZ C;  5AIJ A;  3EIJ A;  4RG6 A;  4ATG A;  3ZRH A;  5JHA A;  4B89 A;  1HF8 A;  3CGH A;  4I6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...