4RG9A

Crystal structure of apc3-apc16 complex (selenomethionine derivative)
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
497
structure length
471
Chain Sequence
b'EPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division cycle protein 27 homolog
publication title Structure of an APC3-APC16 Complex: Insights into Assembly of the Anaphase-Promoting Complex/Cyclosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 156
structure length 471
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg9A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg9A03
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg9A04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg9A02
3CVQA 4G25A 4UI9K 5FJYA 3CK7A 4IN3B 4BWRA 2PL2A 1HH8A 4U07A 4Y6CA 5HI7A 4N39A 3PDNA 4UI9J 5EX0A 2VGXB 4AM9A 2Y4TA 4RG9A 4N3CA 2Q7FA 2FEZA 2HYZA 2V5FA 2KATA 3KAEA 4GYWA 4Y6WA 4U0SA 4JA9A 4J8DA 4LEUA 3Q4AB 2MHKA 4YVOA 5FT9A 2HO1A 2IF4A 3MV2B 2XGMA 4N3BA 3CKBA 3Q47B 4XI9A 4ABNA 3N71A 4BTBA 4JL0A 3KS2A 3SF4A 4J8EA 4KYOB 3RU0A 4GA2A 3CVLA 4F3VA 2XCBA 5DBKA 1FCHA 3RO2A 4G26A 4XI0A 3S7BA 4BT8A 3FWVA 4RG6A 3QWPA 3LCAA 3VTXA 4GZ5A 3CVNA 3ZHEA 2XCCA 1ZU2A 3IEGA 2JLBA 5D0QD 2FO7A 2AVPA 2IFUA 4GA1A 1W3BA 4I2WA 1E96B 3KD7A 2OOEA 2HR2A 4CGWA 4HOUA 2FBNA 5CCMA 4U0ZA 2XPIA 4GPKA 2Y4UA 3TG5A 4GCNA 1NZNA 5ARGA 3ZFWA 3HYMB 5HQ8A 4JA7A 4WNGA 4J8FA 4N2SA 4U04A 3ASFA 2VGYA 3RKVA 3LY7A 5D0OD 2XEVA 3MV3B 1ELRA 4ME2A 2C2LA 2GW1A 3R9AB 2YHCA 3PE3A 1ELWA 1IYGA 4A1SA 5KJNA 3RIBA 3WXXA 4WNFA 3Q15A 3SZ7A 1OUVA 4N5CA 1B89A 2KCVA 4YNDA 3QWWA 5G05C 5LCWC 1WAO1 4XIFA 3ASHA 2KCKA 4CDRA 1TJCA 5AYWD 4B94A 2LNIA 2WPVA 2WQHA 5DIZA 4I9EA 3LKUA 2UY1B 3ZHEB 2QFCA 4H7XA 2KC7A 3UUXA 2LSVA 3RO3A 3GYZA 3CKCA 3AS4A 2NC9A 3UPVA 5KJKA 2PQNA 4BT9A 4HOQA 4NQ0A 4W9RA 2FI7A 4HOTA 3URZA 2FF4A 3QWVA 1HXIA 4AIFA 3QOUA 2VQ2A 5JJTA 3MKRA 3NF1A 3PE4A 3CVPA 3OXFA 4GYOA 3ZPJA 3LYAA 5A7DB 3AS8A 3ASDA 4J0UA 3O48A 2PQRA 1HZ4A 3MA5A 5JJ6A 1WM5A 5JJ7A 1ZBPA 3E4BA 3RJVA 5EX3A 3ZGQA 3MEKA 4WNDA 5FZRA 4KXKB 4GCOA 1QQEA 3JYSA 3LY9A 4BTAA 2XGSA 5G04C 4APOA 3GZ2A 1P5QA 4I9CA 3ASGA 5C1DA 3TGOA 2XGOA 3OXGA 2VSYA 2L6JA 1IHGA 1NA3A 4G2VA 4HORA 4UQXA 3OXLA 2C0MA 1KLXA 4WNEA 3Q5MA 5A6CA 5BNWA 2VSNA 3K9IA 2I6HA 4UQYA 4CGVA 1QZ2A 5G05J 5LCWJ 4UI9C 2UWJG 3QKYA 4H7YA 4GZ6A 3TAXA 4JHRA 4GA0A 2YQ8A 1YA0A 2ONDA 4G1TA 5BT1A 2E2EA 4N3AA 3GW4A 3CEQA 1PC2A 3U4TA 1NA0A 4I1AA 3LY8A 4YVQC 3CV0A 3FP3A 3UQ3A 3GZ1A 5KJMA 1KT0A 4G24A 5CCLA 4I2ZA 4GZ3A 3LPZA 4KBQA 2LSUA 3ESKA 5EKQD 4U0UA 2VGXA 5ARFA 4N2QA 3CK8A 3BEEA 3S7JA 3U3WA 5KJLA 4EQFA 5BW8C 2KCLA 2VYIA 3ZN3A 4NRHB 3ULQA 4I17A 5FTPA 5M72A 2UY1A 5CHEE 3EDTB 2BUGA 3QDNA 2J9QA 3Q49B 3AS5A 2PZIA 4GYYA 2P58C 4UQZA 4HOSA 4AY5A 4G23A 2DBAA 5FZQA 1KT1A 5G04J 4WUYA 2C0LA 3S7FA 1Y8MA 4AY6A 3CK9A 3FFLA 2R5SA 5FZSA 3VTYA 3S7DA 4O6FA 1XNFA 3TG4A 1A17A
chains in the Genus database with same CATH superfamily
1BD8A 5JHBA 4G25A 3CVYA 4A3TA 2BF0X 4IN3B 4BWRA 3KSLA 2PL2A 2OEVA 3U9WA 1N94A 4UI9J 1UJJA 4AM9A 1Z6TA 3DXMG 2DVWA 3R7QA 5G2NA 2OV8A 4EZKA 5ENNA 2NXPA 3CSFA 1OWLA 5C2YA 4MKTA 5BPPA 1SVXA 5CMYA 5FT9A 4LNGA 2IF4A 2I1JA 3MV2B 4AJWA 2NYJA 2LO6A 2JABA 3CVXA 2LAIA 4F7AA 3VLEA 5AQ7A 1YMPA 5J90A 4JPSA 2RD0A 4F3VA 2XCBA 1OWMA 3L54A 5DBKA 3RO2A 4DX5D 2I2OA 4BT8A 3TWWA 3QWPA 4A1GA 3QJZA 3CVNA 3ZHEA 2DZOA 2VTBA 2JLBA 2MYOA 3IHYA 4I1OB 1EF1C 4LG6A 4TRQA 3CVUA 4CRWA 2V4LA 2X6IA 2HR2A 2GRRB 4CDMA 1BI7B 2FBNA 2AXVA 5E76A 2XPIA 2Y4UA 1NZNA 3Q7FA 3MYVA 3ZFWA 2IO2C 3FU6A 3HYMB 3W9GA 2IEJA 2B6CA 3Q79A 2XRYA 5JA4D 2Y3AA 2F37A 5BV0A 1GW6A 5FWQA 4B8AA 3ASFA 3EU9A 3LDZA 1UOHA 4LNBA 4RVBA 3R9AB 3BG1B 2YHCA 2KBXA 3ESLA 2PNNA 2RG8A 3ML9A 1IYGA 1H6PA 5KJNA 1INZA 2EINE 1OY3D 4BSXA 1JCQA 2DZNA 3QWWA 2XPYA 3DEPA 3NZUA 1WAO1 4EBAA 4CDRA 2X6FA 3ZYMA 1TJCA 5AYWD 2LNIA 3TWVA 1DVPA 3C98A 2WQHA 4JVSA 5BUZA 2UY1B 2PM6A 2X6HA 1QYMA 3ZHEB 1EYHA 3UUXA 4G8KA 3RO3A 3JCKC 3UPVA 5KJKA 4ILIA 2WXNA 1SA4A 4NQ0A 4W9RA 4U63A 5BXUA 3U66A 2FI7A 4HOTA 3URZA 3Q78A 3QWVA 4AIFA 2VQ2A 5ENPD 1MQSA 1G3NB 4A55A 3FUIA 3AU5A 3OXFA 4GYOA 2ZXWE 4BSZB 4J0UA 2WXIA 2OVFA 4HNAD 4CDNA 3MA5A 5JJ6A 1Q2ZA 2X6KA 1D9SA 4TXRA 3U64A 5EIDA 3C3QA 1UJKA 4C9BB 2QY7A 3L17A 2YHEA 3FTXA 4WNDA 5FZRA 4BTAA 3HG0D 5JHAA 4ANWA 1TN7A 3HXCA 2XS8A 4APOA 1BLXB 1P5QA 3AG1E 4F6RD 5ANLA 4PS7A 4YDEA 3D3MA 3ZIMA 3OXGA 2VSYA 3SBSA 2XEHA 1E7UA 2L6JA 3IBEA 3MX3A 3UT4A 1SW6A 3RSEG 2H6FA 3SNXA 4WWOA 1KLXA 2XZTG 3Q7AA 2B0OE 3L22A 3SO8A 2VSNA 1IQRA 1IKND 3RAUA 4V3IA 4UQYA 4CGVA 3WG7E 5G05J 3FUDA 3FUHA 2UWJG 5KNHD 3ZYQA 4HFGA 2VGEA 3LEWA 1N52A 3I3NA 3SFYA 4E85A 3D9NA 3U4TA 1NA0A 4CYMD 4PS8A 3SFXA 4YVQC 1SZ9A 3FP3A 3UQ3A 4IYPA 5KCMA 5KJMA 3PZ3A 4E6HA 4AV7A 2GROB 3CVWA 3FH8A 3HXFA 4O1OA 2QC9A 3OTNA 1OCOE 3ESKA 1K8KG 2VGXA 5EYPF 4DX6D 3APFA 3S7JA 3U3WA 5J08A 4D10C 5LX8A 4MLPA 4BEPA 1N4RA 5BW8C 4M7CA 2DYRE 4JHJA 2VYIA 3ZN3A 4N5QA 5B1BE 5FTPA 3MKQA 4EZLA 3AJIA 5T4YA 2CHZA 3J5PA 3EIQC 3FEXA 5CRUA 3AS5A 2IOLA 5AIJA 4AY5A 3ABLE 5CEDB 2P2CP 2QYUA 5FZQA 1K1BA 5A23A 3P2BA 2C0LA 4DX7D 3S7FA 1V55E 2LAHA 4DI4A 1HE8A 3VTYA 3S7DA 4F53A 3FUNA 1NFIE 3CVQA 3IV0A 2AWIA 2E0IA 5FJYA 2A5EA 2FO1E 2DCPA 1HH8A 5HI7A 5EX0A 2VGXB 3C72A 4GTQA 2MOWA 1EDUA 1TJFA 2LUHA 3DSVA 2H6GA 2ETBA 4GTOA 1QBQA 5AAOA 5BV1A 4J8DA 3SFZA 3UIPC 2WM9A 3Q4AB 2MHKA 4YVOA 3NOCD 3MKQB 2HO1A 2CG2A 1HS6A 3FTVA 1MHQA 3NOGD 3ZKJA 5AARA 3CKBA 3CLJA 3B7TA 1WG0A 3ISMC 3DXKG 3P1UA 3SF4A 2EIME 4DX2A 5ENSD 2AJAA 5BXOA 1JCSA 2XZDG 3CVLA 4WWPA 3PUKA 2WXLA 2P9NG 3HDXA 2H6HA 2IQCA 4XI0A 3S7BA 3PNLB 5AQAA 1TN8A 2J49A 3FWVA 3CVVA 3G2TA 4GZ5A 1QNFA 1SA5A 1HG5A 3CGHA 3TL5A 3ML8A 3PZ2A 4GMLA 4MRUA 4K5BA 1BI8B 2J4BA 4I2WA 4L7TA 4CGWA 4HLLA 4XEIG 4B0ZA 3FTZA 1RZ4A 4U0ZA 4PDXA 4J8SA 3TG5A 4DX1A 3UINC 3FH7A 5EYLA 3PZ1A 2J4DA 5ENOD 3B13A 4JA7A 1UW4B 3B95A 2JEKA 3ZYKA 4J8FA 5EN5D 2F8XK 1N4QA 4BERA 4UWLA 4KVOA 3LY7A 2XEVA 3MV3B 1ELRA 1E8WA 4ME2A 2GW1A 3PNTB 3SHFA 4WWNA 2BTDA 2MRIA 3PE3A 1N4PA 3L16A 3UMVA 1N9AA 4B8CB 3WXXA 4GMJA 3SZ7A 4FHJA 2GGFA 1OUVA 4YNDA 5LCWC 1TNYA 2CHXA 4XIFA 2P9KG 5FINA 4UUCA 1O1TA 2WPVA 4JW1A 1KPSB 3LVQE 4Q94A 3LKUA 4G8LA 1LTXA 3LVRE 2KC7A 4UWGA 1H6OA 5AJDA 2LSVA 4B93B 1NI1A 2NC9A 4K0RA 3PREA 5LFAA 2H6IA 3BU8A 3APCA 1ELKA 1TN6A 4K03A 1HXIA 3MCXA 5D2MC 3NF1A 3J5QB 1LD8A 3ENEA 2WXRA 4GB9A 3ASDA 1JWFA 3JUIA 2X38A 2KXPC 2IY0C 1WM5A 2R17C 1E90A 3B7SA 3CIAA 1MYOA 2J09A 4FLHA 4EECA 1ZBPA 2WXHA 4UWHA 3E4BA 1TNOA 3G2VA 4ACLA 1E8XA 4L2LA 1WY6A 3EHMA 5B3SE 2DYSE 2WB2A 3ZGQA 3EHRA 3TWUA 2WXMA 1QQEA 2F0YA 3JYSA 4GTPA 2XEEA 2WXGA 3L82A 4KZ0A 4AXHA 1PAQA 2XGSA 3FDHA 1H19A 3GZ2A 3KEAA 2QYJA 2AXZA 2VJ8A 3TGOA 5ANRA 3D9HA 3D9KA 1NA3A 4I43A 4U96D 4AP2A 4CZ2D 1LD7A 1RW2A 4JZYA 3FTYA 4HRNA 3ABME 2L6BA 2V8SE 4Z68A 3K9IA 2ILRA 3G2UA 2I6HA 3Q9NC 1H6KA 4UI9C 4HI8A 3AG4E 3QKYA 4H7YA 4GZ6A 3TAXA 1YA0A 3TWRA 3TWTA 5BT1A 2E2EA 4N3AA 3CEQA 2VTBB 4YDYA 4I1AA 1E7VA 3GZ1A 4G24A 5ITZF 5IY5E 1Z3YA 3PZDA 3QAQA 3CSTA 4PH4B 1A5EA 4U0UA 3IXEA 4N2QA 3B7RL 3CHQA 4DUIA 3BEEA 3TWSA 4FA6A 2DIWA 2IU1A 5FQ4A 3GZSA 1O1RA 2KCLA 4WAFA 2XS1A 5T3RA 5M72A 3PS6A 3CHSA 3QDNA 3NAWA 4KMOA 4JB8P 4TUMA 1OXJA 2FULA 2PZIA 3VLDA 4UQZA 4DPRA 4TUUA 5G04J 1K3ZD 4NURA 5AENA 4WUYA 4GTTA 2RFMA 3R7RA 4AY6A 3T8MA 3FFLA 5FZSA 1IHBA 4IRUA 4CCAA 3AU4A 4DRXE 3TG4A 4R7LA 1A17A 4ACKA 2RKKA 2WXFA 3JUEA 4Q69A 4OVUA 5CECB 2J07A 4MS6A 4CT4A 5D66A 4U07A 4Y6CA 4DLQA 4URKA 4HS2A 4LRZA 4JXTA 4M3OA 1IQUA 4U95D 4XZ4A 1MJ0A 2Y4TA 1DC2A 2M63A 3JQ1A 2V5FA 1S64A 2XPZA 4Y6WA 3T5VA 3RRMB 4JA9A 3DBSA 3JXIA 4HVBA 2WXPA 3O4ZA 2IO3C 3D9JA 3D9MA 1H2VC 3Q47B 4JEHA 4ABNA 3SGHA 3N71A 4BTBA 3KSQA 3E37A 4JL0A 4KZCA 1OCRE 4KYOB 2EIJE 3RU0A 4GA2A 4GAAA 2NSZA 4U7EB 1HG2A 4JC8A 1H2TC 3FUFA 3ONLA 5ENTD 4G26A 2R2LA 3T5XA 3EU5A 3SI5A 4U8YD 3EHQA 4RG6A 4EHMA 3VTXA 3RRUA 2I1KA 3HHMA 2R05A 3W9FA 1ZU2A 2YINA 3B7BA 4BY6A 2AVPA 2IFUA 1MX6A 3EIJA 1OWOA 3KD7A 2OOEA 3FY4A 5CCMA 3B7UX 2X6JA 4KVMA 3Q73A 3PEVB 5HQ8A 4JEUA 3UT7A 3UX4A 1ZB1A 3BQOA 2ZIRA 3FEYA 2VGYA 4OAUC 2BEDA 5CBOA 2LXLA 1ELWA 5KWDA 4Q96A 3QC1A 5AN8A 1O5MA 1B89A 3DWLG 2KCVA 1VDYA 3RK6A 5G05C 1H2UA 3ASHA 4L2YA 4B94A 1U3DA 5ENRD 4X8QA 3SD5A 3SQVA 4K5AB 5E75A 2WXKA 1UG3A 2QFCA 3SY2A 3T9KA 3UM2A 5EIBE 2IONA 3FUEA 1WDYA 2PQNA 4APFA 4HOQA 4RLYA 5ENQD 2A4ZA 1FVHA 2FF4A 4TV3A 3ZW3A 1IXVA 4FU3A 2ETCA 3FTSA 4U8VD 4FJYA 3CVPA 3EJNA 3ZU7B 3ZPJA 5A7DB 3AS8A 3CHRA 5JMND 5EILA 3UM1A 2PQRA 2YNQA 4GMRA 5JJ7A 4FADA 3HXDA 1BU9A 1N0QA 3RJVA 5EX3A 4L23A 3MEKA 4J7WA 3PUJA 3QB2A 3UKUG 1SZAA 2EILE 1K1AA 2IJGX 3FUKA 4RSYA 4F1SA 3DSWA 5FQ8A 2J08A 2WVIA 3ASGA 5C1DA 3DPYA 4CEMA 2XGOA 2GRLA 1TR4A 2BKKB 3AG3E 5KBAA 1IHGA 3D9IA 4DK5A 3R9MA 4G2VA 4I6EA 4HORA 4UQXA 3MGBA 5KNGA 3OXLA 3AAAC 4LUNU 4XKBA 2C0MA 3L13A 5A6CA 4GU5A 1E8ZA 3CHOA 4ANXA 2IOSA 1YCSB 4BESA 1QZ2A 4GZCA 3NBNB 4JD2G 4JHRA 4GA0A 2YQ8A 4KT6B 2V0PA 1PY1A 2HM8A 3NZSA 3GW4A 3PH0C 1PC2A 4XE0A 3UM3A 5CEAA 4C0EA 1DCEA 2R59A 5CERB 3CV0A 3DEOA 1X5BA 4AVXA 2L0TB 1KT0A 1UN8A 3LPZA 3FUJA 1TNUA 5B1AE 3X2QE 2AW6A 2LSUA 4HI9A 4JHKA 5EKQD 3LXUX 2LXMA 3CK8A 1AP7A 2ZU6B 3AG2E 3ZXSA 4YDWA 3D9PA 3PEUB 4EQFA 5HS0A 4BX8A 3ULQA 3UKRG 2EQXA 3EUVA 3V79K 2R03A 3ZNGA 4HRMB 2UY1A 5FQ7A 1YYHA 3UXGA 1H0AA 3E33A 2BUGA 3E34A 1BPOA 3Q75A 4HXIA 4L1BA 3QARA 4GTRA 2J9QA 5FQ6A 1OT8A 2F8YA 3HRAA 4G11A 3HXBA 4HOSA 2GRMA 5AQBA 1TNBA 4G23A 2DBAA 4TXQA 3FTUA 3FH5A 2WQ6A 4LERA 5CBNA 4QFVA 1MZCA 4ANVA 2R5SA 3I4RB 3FU3A 4O6FA 1JUQA 2KM4A 1XNFA 2WXJA 1U2VG 3FUMA 4DJAA 4UI9K 3CK7A 4GTSA 4ZFHA 3ULYA 4N39A 3PDNA 1HF8A 4DLOA 3C5RA 2J8SD 4FLBA 1SQMA 1N54A 2Y0BG 4N3CA 4RG9A 4EZJA 4ATZD 2Q7FA 2FEZA 2HYZA 2KATA 3KAEA 3NQPA 4GYWA 1LF8A 2CFUA 4U0SA 3ZUVB 4LEUA 1JPLA 3RRNB 2QZAA 2XGMA 4N3BA 4NACA 2XENA 4XI9A 1KZOA 2ZISA 2KZTA 4I1MA 1D8DA 3ZXPA 3KS2A 4J8EA 1E8YA 3G2WA 5H7PA 4NIKA 3UT8A 4TXPA 4HLEA 2I9CA 4QQIA 1FCHA 4HQDA 5HKPA 4O1PA 3UTMA 3EHNA 3LCAA 2GRQB 2OEWA 1EPUA 3CR3A 2XCCA 3IEGA 5D0QD 2Y69E 2FO7A 4C48B 3MZLB 4EBAG 3E32A 2ETAA 1N0RA 4GA1A 1W3BA 1E96B 4MBGA 5T8IA 4J6IA 4HOUA 4RQIA 4F1PA 3FTWA 4HBDA 4GPKA 4DI3A 5AJLA 3UM0A 3ONKA 4GCNA 3CHMA 3ZVVA 2OCCE 4ILGA 2L9BA 4BETA 5ARGA 2HE0A 2XRZA 4XKCA 4A63B 2XHEA 1V54E 4WNGA 1S70B 1NP7A 4N2SA 4U04A 3IKOB 3ABKE 2AXUA 3QK0A 3CQCB 3RKVA 5D0OD 1JWGA 2C2LA 4B89A 4J8YA 1N11A 4CT0A 2KZTB 3E30A 3I4GA 3TJPA 2GRNB 3ASOE 5AQ9A 4A1SA 3V2OA 3RIBA 4WNFA 3Q15A 3SBTB 3V2XA 4N5CA 5CRVA 1Z5SC 3PVLA 1MX2A 4OVVA 1TNZA 2KCKA 3D9OA 3FHEA 1NL4A 5DIZA 4I9EA 1FVFA 4ANUA 4GTMA 5LP0A 3FU0A 2P9UG 1N4SA 4LSZE 3ASNE 4H7XA 3G2SA 2WQ7A 3T8KA 3GYZA 3CKCA 3AS4A 1AWCB 3FULA 2PM7A 4AEZC 4BT9A 2WMOA 3UI2A 3JXJA 1HFAA 1UN9A 1HX8A 4ATGA 3QOUA 5JJTA 3MKRA 4GZDA 3NB2A 3C3OA 2CFZA 3PE4A 4HRLA 1FT2A 4EPZA 3LYAA 3MJWA 3TWXA 5HRYA 4GPMA 3DSSA 1L5JA 3O48A 4I6JA 1HZ4A 3DSUA 3FU5A 4ILHB 4ZHBA 4XX5A 3I5PA 4UWFA 3ZYLA 4YDOA 4OAVB 4KXKB 1X81A 1HO8A 4GCOA 3L9TA 3LY9A 1U3CA 4OYSA 3LJ3A 4P29A 3HVEA 3UIOC 4BFRA 4FHKA 1DCQA 4FULA 5G04C 2P9IG 1S0PA 4I9CA 4U8HA 2P9SG 4C0MA 2BKGA 4GTVA 3D9LA 2L0IA 4FP7A 4UWKA 1OWNA 2RFAA 4IULA 2VSXE 5FIOA 2P9PG 4WNEA 3L08A 2CHWA 3LJNA 1MX4A 3Q5MA 1Z3XA 4FC8A 5BNWA 2R02A 1N95A 1OCCE 5CMWA 1OCZE 2GRPB 2DWZA 1KZPA 3Q9UC 3V31A 3ZEFA 3F6QA 5LCWJ 4FJZA 2XQ0A 1D8EA 3LS8A 3ULEG 4PS3A 3L6AA 3PRZA 4BX9A 3OAWA 3JQ0A 2ONDA 4G1TA 3VLFA 2WXOA 3DSTA 4PUCA 3BUAA 4AOFA 1FT1A 2WXQA 2A5UA 3LY8A 1O1SA 2VSOE 1Y6IA 1DNPA 4O60A 4I6GA 5CCLA 4I2ZA 2V4HC 3S2AA 4GZ3A 2ZGDA 3DSXA 3DPDA 4KBQA 2WMNA 4LCTA 3CHPA 2CG3A 5ARFA 3HVEB 4LNUD 3V30A 3TXMA 5KJLA 1JCRA 4K5CA 2P9LG 1TEZA 3TWQA 3APDA 2X3MA 1TYQG 4NRHB 1FPPA 4I17A 2ZGGA 3HXEA 5CHEE 3DRAA 3EDTB 3QNKA 3IHVA 3Q49B 5EDSA 1OWPA 1HU3A 2Y1LE 4GYYA 2P58C 4A3VA 3TXNA 3KEZA 1KT1A 2V5QC 2OVBA 1S63A 4L9PA 3PZ4A 3HIZA 1Y8MA 3ZRHA 3CK9A 4HB5A 1XGWA 5LOZA 3CQGB 3BG0B 3C3RA 2EIKE 5G55A
chains in the Genus database with same CATH topology
4ACKA 3CVQA 3FUMA 3IV0A 2AWIA 2WXFA 4DJAA 5JHBA 2E0IA 4G25A 3CVYA 4UI9K 5FJYA 3CK7A 4A3TA 2DCPA 4Q69A 4OVUA 2BF0X 4IN3B 2J07A 4BWRA 2PL2A 4MS6A 1HH8A 4CT4A 4U07A 4Y6CA 4DLQA 5HI7A 3U9WA 4HS2A 4N39A 3PDNA 4URKA 4LRZA 1HF8A 4DLOA 4UI9J 4JXTA 4M3OA 5EX0A 1IQUA 2VGXB 1UJJA 4FLBA 4AM9A 1SQMA 4XZ4A 1N54A 2Y4TA 4N3CA 4RG9A 4EZJA 1Z6TA 2M63A 3JQ1A 2Q7FA 2FEZA 2MOWA 1EDUA 1TJFA 2HYZA 2V5FA 3R7QA 5G2NA 2KATA 3KAEA 3NQPA 2XPZA 4GYWA 1LF8A 2OV8A 4Y6WA 4EZKA 2CFUA 3T5VA 3RRMB 5ENNA 2NXPA 3CSFA 4U0SA 5BV1A 4JA9A 1OWLA 4J8DA 5C2YA 4MKTA 3SFZA 5BPPA 4LEUA 2WM9A 3DBSA 3Q4AB 4HVBA 2MHKA 1JPLA 2WXPA 5CMYA 4YVOA 5FT9A 3O4ZA 3MKQB 2HO1A 2CG2A 2IF4A 2I1JA 3RRNB 1HS6A 3MV2B 3D9JA 3FTVA 1MHQA 3D9MA 2XGMA 4AJWA 4N3BA 3CKBA 4NACA 3CLJA 2LO6A 3B7TA 1H2VC 3Q47B 4XI9A 4JEHA 3CVXA 2KZTA 4ABNA 2LAIA 4I1MA 3SGHA 4F7AA 3N71A 4BTBA 3VLEA 3P1UA 4JL0A 3KS2A 4KZCA 3SF4A 4J8EA 4KYOB 1E8YA 3G2WA 3RU0A 3UT8A 4GA2A 4GAAA 2NSZA 2I9CA 2RD0A 3CVLA 4JPSA 4HLEA 5J90A 1HG2A 4JC8A 1H2TC 2XCBA 4F3VA 4WWPA 1OWMA 3L54A 3FUFA 2WXLA 3PUKA 5DBKA 1FCHA 3ONLA 3RO2A 3HDXA 2IQCA 4G26A 2I2OA 4XI0A 3S7BA 3T5XA 3PNLB 3SI5A 4BT8A 3EHNA 2J49A 3FWVA 4RG6A 3QWPA 3CVVA 3LCAA 3VTXA 4A1GA 3G2TA 3RRUA 4GZ5A 1QNFA 3CVNA 3QJZA 1EPUA 3ZHEA 3CR3A 2I1KA 3HHMA 2XCCA 2VTBA 1ZU2A 2YINA 1HG5A 3CGHA 3TL5A 3IEGA 3ML8A 2JLBA 5D0QD 4GMLA 4MRUA 3IHYA 4I1OB 2FO7A 4BY6A 1EF1C 2AVPA 4TRQA 2IFUA 3CVUA 3MZLB 4CRWA 3EIJA 4EBAG 2J4BA 1OWOA 4GA1A 1W3BA 4I2WA 2V4LA 1E96B 4L7TA 5T8IA 3KD7A 4J6IA 2X6IA 2OOEA 2HR2A 3FY4A 4CDMA 4CGWA 4HOUA 2FBNA 4B0ZA 3FTZA 2AXVA 3FTWA 5E76A 5CCMA 4U0ZA 4PDXA 2XPIA 4GPKA 3B7UX 2X6JA 2Y4UA 4DI3A 5AJLA 4J8SA 3TG5A 3ONKA 4GCNA 3CHMA 4KVMA 3ZVVA 4ILGA 1NZNA 2L9BA 3FH7A 3MYVA 5ARGA 2J4DA 3ZFWA 3FU6A 2XRZA 3PEVB 3HYMB 4XKCA 2XHEA 5HQ8A 4JEUA 3B13A 4JA7A 1UW4B 2XRYA 4R7LA 2JEKA 3UT7A 3UX4A 3ZYKA 2Y3AA 4WNGA 1NP7A 4J8FA 4N2SA 4U04A 5BV0A 3IKOB 1GW6A 2AXUA 5FWQA 3QK0A 3FEYA 4B8AA 3ASFA 3CQCB 2VGYA 4UWLA 3LDZA 4KVOA 3RKVA 3LY7A 5D0OD 2XEVA 3MV3B 1ELRA 1E8WA 4ME2A 4RVBA 1JWGA 2C2LA 2GW1A 3PNTB 3BG1B 3R9AB 3SHFA 2YHCA 4B89A 4WWNA 2BTDA 4CT0A 3ESLA 2MRIA 2RG8A 3PE3A 3ML9A 2KZTB 1ELWA 3I4GA 1IYGA 4Q96A 3TJPA 3QC1A 3L16A 4A1SA 3UMVA 5KJNA 4B8CB 3RIBA 3WXXA 4GMJA 3Q15A 4WNFA 4FHJA 2GGFA 3SZ7A 1INZA 3SBTB 1OUVA 4N5CA 1B89A 2KCVA 1VDYA 4YNDA 4BSXA 3RK6A 3QWWA 5G05C 2XPYA 5LCWC 3PVLA 2CHXA 3NZUA 1WAO1 1H2UA 4OVVA 3ASHA 4XIFA 4EBAA 2KCKA 4L2YA 4CDRA 2X6FA 3ZYMA 1TJCA 5AYWD 4B94A 2LNIA 1U3DA 1DVPA 3D9OA 2WPVA 3C98A 2WQHA 3FHEA 5DIZA 4I9EA 4JVSA 3SD5A 1FVFA 4JW1A 5E75A 4ANUA 3LVQE 4Q94A 2WXKA 3LKUA 1UG3A 5BUZA 2UY1B 2PM6A 5LP0A 3FU0A 2X6HA 3ZHEB 3LVRE 2QFCA 1EYHA 4H7XA 2KC7A 4UWGA 3UUXA 3G2SA 5AJDA 2WQ7A 2LSVA 3RO3A 3GYZA 2IONA 3AS4A 3CKCA 3FUEA 2NC9A 3JCKC 3UPVA 4K0RA 3PREA 3FULA 5KJKA 2PM7A 4ILIA 2PQNA 4AEZC 4BT9A 2WMOA 4APFA 2WXNA 5LFAA 4HOQA 1HFAA 1UN9A 4NQ0A 4W9RA 4U63A 3U66A 2A4ZA 3APCA 2FI7A 1ELKA 4HOTA 1FVHA 1HX8A 3URZA 4ATGA 2FF4A 4K03A 3QWVA 1HXIA 3MCXA 3QOUA 4TV3A 4AIFA 3ZW3A 4FU3A 2VQ2A 3FTSA 5JJTA 3MKRA 4FJYA 1MQSA 3NF1A 4GZDA 2CFZA 3PE4A 4A55A 3CVPA 3EJNA 3ENEA 4EPZA 2WXRA 3AU5A 3FUIA 3OXFA 4GB9A 4GYOA 3ZPJA 3LYAA 5A7DB 3MJWA 3AS8A 3ASDA 3CHRA 1JWFA 4J0UA 2WXIA 1L5JA 3JUIA 2OVFA 3O48A 2PQRA 4I6JA 4CDNA 2X38A 2YNQA 1HZ4A 3FU5A 3MA5A 5JJ6A 1WM5A 2R17C 1E90A 2X6KA 3B7SA 3CIAA 5JJ7A 2J09A 3U64A 4FLHA 1UJKA 4FADA 4C9BB 1ZBPA 2QY7A 2WXHA 3L17A 4EECA 4UWHA 3E4BA 4ILHB 3G2VA 4ACLA 1E8XA 4L2LA 4XX5A 3I5PA 1WY6A 3EHMA 4UWFA 3RJVA 5EX3A 2YHEA 2WB2A 4L23A 3ZGQA 3ZYLA 3MEKA 3FTXA 3PUJA 4WNDA 5FZRA 4KXKB 3QB2A 1HO8A 4GCOA 2WXMA 1SZAA 1QQEA 3JYSA 3LY9A 2IJGX 4BTAA 1U3CA 2WXGA 4OYSA 3FUKA 3LJ3A 4KZ0A 4RSYA 4F1SA 4P29A 3HVEA 4AXHA 5JHAA 4ANWA 4BFRA 1PAQA 4FHKA 2XGSA 3FDHA 5FQ8A 4FULA 5G04C 4APOA 1H19A 3GZ2A 1P5QA 3FUNA 1S0PA 2J08A 4I9CA 4U8HA 2WVIA 5ANLA 4PS7A 4C0MA 3ASGA 5C1DA 2AXZA 3D3MA 3D9LA 2VJ8A 2L0IA 3TGOA 4FP7A 2XGOA 3ZIMA 4CEMA 2GRLA 3OXGA 4UWKA 2VSYA 5ANRA 3SBSA 1OWNA 1E7UA 2L6JA 3IBEA 3MX3A 4IULA 2VSXE 3D9KA 1IHGA 3D9IA 3UT4A 1NA3A 4I43A 3SNXA 4DK5A 4G2VA 4WWOA 4I6EA 4HORA 4UQXA 4AP2A 3MGBA 3OXLA 4LUNU 2C0MA 1KLXA 3L13A 3L08A 4WNEA 4XKBA 2CHWA 4JZYA 3FTYA 3Q5MA 5A6CA 4GU5A 1Z3XA 4FC8A 5BNWA 3L22A 1E8ZA 3CHOA 2VSNA 1IQRA 2V8SE 4ANXA 5CMWA 3K9IA 2IOSA 2ILRA 3G2UA 4V3IA 2I6HA 4UQYA 4CGVA 1H6KA 3ZEFA 1QZ2A 5G05J 3FUDA 5LCWJ 4FJZA 2XQ0A 4UI9C 3FUHA 2UWJG 3QKYA 3LS8A 4H7YA 4HFGA 3ZYQA 4GZ6A 3TAXA 4PS3A 4GZCA 3L6AA 3LEWA 3PRZA 4BX9A 3OAWA 4JHRA 3JQ0A 2YQ8A 1YA0A 4GA0A 1N52A 2V0PA 4KT6B 1PY1A 3I3NA 2ONDA 4G1TA 2HM8A 3NZSA 5BT1A 3VLFA 2E2EA 2WXOA 4N3AA 4E85A 3GW4A 3PH0C 3CEQA 3D9NA 2VTBB 1PC2A 4PUCA 4XE0A 3U4TA 1NA0A 4I1AA 4PS8A 4AOFA 4C0EA 2WXQA 2A5UA 3LY8A 4YVQC 2R59A 2VSOE 1E7VA 3CV0A 1X5BA 1Y6IA 1DNPA 1SZ9A 3FP3A 3UQ3A 4AVXA 3GZ1A 2L0TB 4IYPA 5KCMA 1KT0A 5KJMA 4G24A 4I6GA 4E6HA 4AV7A 5CCLA 1UN8A 4I2ZA 3S2AA 4GZ3A 3LPZA 3FUJA 3FH8A 3CVWA 1Z3YA 3PZDA 3DPDA 3QAQA 3CSTA 4KBQA 4PH4B 2WMNA 3OTNA 2AW6A 2LSUA 3ESKA 4JHKA 5EKQD 4U0UA 4LCTA 2VGXA 3LXUX 3CHPA 2CG3A 5ARFA 4N2QA 3B7RL 3CK8A 3CHQA 3BEEA 3HVEB 3APFA 3S7JA 2ZU6B 3U3WA 5J08A 3ZXSA 4D10C 3TXMA 5KJLA 5LX8A 3D9PA 3PEUB 4MLPA 4EQFA 5BW8C 4FA6A 2DIWA 2IU1A 5FQ4A 3GZSA 4BX8A 2KCLA 4JHJA 3APDA 4WAFA 2VYIA 3ZN3A 2X3MA 4NRHB 1TEZA 3ULQA 4I17A 5T3RA 5FTPA 2EQXA 5M72A 3MKQA 3PS6A 4EZLA 2UY1A 3CHSA 5FQ7A 1H0AA 5CHEE 5T4YA 2CHZA 3EDTB 2BUGA 3QDNA 3QNKA 1BPOA 3EIQC 4HXIA 3FEXA 4L1BA 3IHVA 3QARA 2J9QA 4KMOA 5FQ6A 3Q49B 5EDSA 1OWPA 2FULA 3AS5A 4G11A 2IOLA 1HU3A 2PZIA 3VLDA 4GYYA 2P58C 4UQZA 4A3VA 4HOSA 5AIJA 4AY5A 2GRMA 3TXNA 4DPRA 4G23A 2DBAA 3KEZA 4TUUA 1KT1A 5FZQA 5G04J 3FTUA 3FH5A 5A23A 4NURA 2WQ6A 3P2BA 4LERA 5AENA 2OVBA 4WUYA 2C0LA 3S7FA 4QFVA 3R7RA 3HIZA 1Y8MA 3ZRHA 4AY6A 3CK9A 4ANVA 3T8MA 3FFLA 2R5SA 2LAHA 1XGWA 1HE8A 3I4RB 5FZSA 3FU3A 5LOZA 3S7DA 3VTYA 4DI4A 4O6FA 1JUQA 3CQGB 2KM4A 3BG0B 4IRUA 5G55A 4CCAA 4F53A 3AU4A 1XNFA 3TG4A 2WXJA 1A17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVQ A;  4G25 A;  4UI9 K;  5FJY A;  3CK7 A;  4IN3 B;  4BWR A;  2PL2 A;  1HH8 A;  4U07 A;  4Y6C A;  5HI7 A;  4N39 A;  3PDN A;  4UI9 J;  5EX0 A;  2VGX B;  4AM9 A;  2Y4T A;  4RG9 A;  4N3C A;  2Q7F A;  2FEZ A;  2HYZ A;  2V5F A;  2KAT A;  3KAE A;  4GYW A;  4Y6W A;  4U0S A;  4JA9 A;  4J8D A;  4LEU A;  3Q4A B;  2MHK A;  4YVO A;  5FT9 A;  2HO1 A;  2IF4 A;  3MV2 B;  2XGM A;  4N3B A;  3CKB A;  3Q47 B;  4XI9 A;  4ABN A;  3N71 A;  4BTB A;  4JL0 A;  3KS2 A;  3SF4 A;  4J8E A;  4KYO B;  3RU0 A;  4GA2 A;  3CVL A;  4F3V A;  2XCB A;  5DBK A;  1FCH A;  3RO2 A;  4G26 A;  4XI0 A;  3S7B A;  4BT8 A;  3FWV A;  4RG6 A;  3QWP A;  3LCA A;  3VTX A;  4GZ5 A;  3CVN A;  3ZHE A;  2XCC A;  1ZU2 A;  3IEG A;  2JLB A;  5D0Q D;  2FO7 A;  2AVP A;  2IFU A;  4GA1 A;  1W3B A;  4I2W A;  1E96 B;  3KD7 A;  2OOE A;  2HR2 A;  4CGW A;  4HOU A;  2FBN A;  5CCM A;  4U0Z A;  2XPI A;  4GPK A;  2Y4U A;  3TG5 A;  4GCN A;  1NZN A;  5ARG A;  3ZFW A;  3HYM B;  5HQ8 A;  4JA7 A;  4WNG A;  4J8F A;  4N2S A;  4U04 A;  3ASF A;  2VGY A;  3RKV A;  3LY7 A;  5D0O D;  2XEV A;  3MV3 B;  1ELR A;  4ME2 A;  2C2L A;  2GW1 A;  3R9A B;  2YHC A;  3PE3 A;  1ELW A;  1IYG A;  4A1S A;  5KJN A;  3RIB A;  3WXX A;  4WNF A;  3Q15 A;  3SZ7 A;  1OUV A;  4N5C A;  1B89 A;  2KCV A;  4YND A;  3QWW A;  5G05 C;  5LCW C;  1WAO 1;  4XIF A;  3ASH A;  2KCK A;  4CDR A;  1TJC A;  5AYW D;  4B94 A;  2LNI A;  2WPV A;  2WQH A;  5DIZ A;  4I9E A;  3LKU A;  2UY1 B;  3ZHE B;  2QFC A;  4H7X A;  2KC7 A;  3UUX A;  2LSV A;  3RO3 A;  3GYZ A;  3CKC A;  3AS4 A;  2NC9 A;  3UPV A;  5KJK A;  2PQN A;  4BT9 A;  4HOQ A;  4NQ0 A;  4W9R A;  2FI7 A;  4HOT A;  3URZ A;  2FF4 A;  3QWV A;  1HXI A;  4AIF A;  3QOU A;  2VQ2 A;  5JJT A;  3MKR A;  3NF1 A;  3PE4 A;  3CVP A;  3OXF A;  4GYO A;  3ZPJ A;  3LYA A;  5A7D B;  3AS8 A;  3ASD A;  4J0U A;  3O48 A;  2PQR A;  1HZ4 A;  3MA5 A;  5JJ6 A;  1WM5 A;  5JJ7 A;  1ZBP A;  3E4B A;  3RJV A;  5EX3 A;  3ZGQ A;  3MEK A;  4WND A;  5FZR A;  4KXK B;  4GCO A;  1QQE A;  3JYS A;  3LY9 A;  4BTA A;  2XGS A;  5G04 C;  4APO A;  3GZ2 A;  1P5Q A;  4I9C A;  3ASG A;  5C1D A;  3TGO A;  2XGO A;  3OXG A;  2VSY A;  2L6J A;  1IHG A;  1NA3 A;  4G2V A;  4HOR A;  4UQX A;  3OXL A;  2C0M A;  1KLX A;  4WNE A;  3Q5M A;  5A6C A;  5BNW A;  2VSN A;  3K9I A;  2I6H A;  4UQY A;  4CGV A;  1QZ2 A;  5G05 J;  5LCW J;  4UI9 C;  2UWJ G;  3QKY A;  4H7Y A;  4GZ6 A;  3TAX A;  4JHR A;  4GA0 A;  2YQ8 A;  1YA0 A;  2OND A;  4G1T A;  5BT1 A;  2E2E A;  4N3A A;  3GW4 A;  3CEQ A;  1PC2 A;  3U4T A;  1NA0 A;  4I1A A;  3LY8 A;  4YVQ C;  3CV0 A;  3FP3 A;  3UQ3 A;  3GZ1 A;  5KJM A;  1KT0 A;  4G24 A;  5CCL A;  4I2Z A;  4GZ3 A;  3LPZ A;  4KBQ A;  2LSU A;  3ESK A;  5EKQ D;  4U0U A;  2VGX A;  5ARF A;  4N2Q A;  3CK8 A;  3BEE A;  3S7J A;  3U3W A;  5KJL A;  4EQF A;  5BW8 C;  2KCL A;  2VYI A;  3ZN3 A;  4NRH B;  3ULQ A;  4I17 A;  5FTP A;  5M72 A;  2UY1 A;  5CHE E;  3EDT B;  2BUG A;  3QDN A;  2J9Q A;  3Q49 B;  3AS5 A;  2PZI A;  4GYY A;  2P58 C;  4UQZ A;  4HOS A;  4AY5 A;  4G23 A;  2DBA A;  5FZQ A;  1KT1 A;  5G04 J;  4WUY A;  2C0L A;  3S7F A;  1Y8M A;  4AY6 A;  3CK9 A;  3FFL A;  2R5S A;  5FZS A;  3VTY A;  3S7D A;  4O6F A;  1XNF A;  3TG4 A;  1A17 A; 
#chains in the Genus database with same CATH topology
 1BD8 A;  5JHB A;  4G25 A;  3CVY A;  4A3T A;  2BF0 X;  4IN3 B;  4BWR A;  3KSL A;  2PL2 A;  2OEV A;  3U9W A;  1N94 A;  4UI9 J;  1UJJ A;  4AM9 A;  1Z6T A;  3DXM G;  2DVW A;  3R7Q A;  5G2N A;  2OV8 A;  4EZK A;  5ENN A;  2NXP A;  3CSF A;  1OWL A;  5C2Y A;  4MKT A;  5BPP A;  1SVX A;  5CMY A;  5FT9 A;  4LNG A;  2IF4 A;  2I1J A;  3MV2 B;  4AJW A;  2NYJ A;  2LO6 A;  2JAB A;  3CVX A;  2LAI A;  4F7A A;  3VLE A;  5AQ7 A;  1YMP A;  5J90 A;  4JPS A;  2RD0 A;  4F3V A;  2XCB A;  1OWM A;  3L54 A;  5DBK A;  3RO2 A;  4DX5 D;  2I2O A;  4BT8 A;  3TWW A;  3QWP A;  4A1G A;  3QJZ A;  3CVN A;  3ZHE A;  2DZO A;  2VTB A;  2JLB A;  2MYO A;  3IHY A;  4I1O B;  1EF1 C;  4LG6 A;  4TRQ A;  3CVU A;  4CRW A;  2V4L A;  2X6I A;  2HR2 A;  2GRR B;  4CDM A;  1BI7 B;  2FBN A;  2AXV A;  5E76 A;  2XPI A;  2Y4U A;  1NZN A;  3Q7F A;  3MYV A;  3ZFW A;  2IO2 C;  3FU6 A;  3HYM B;  3W9G A;  2IEJ A;  2B6C A;  3Q79 A;  2XRY A;  5JA4 D;  2Y3A A;  2F37 A;  5BV0 A;  1GW6 A;  5FWQ A;  4B8A A;  3ASF A;  3EU9 A;  3LDZ A;  1UOH A;  4LNB A;  4RVB A;  3R9A B;  3BG1 B;  2YHC A;  2KBX A;  3ESL A;  2PNN A;  2RG8 A;  3ML9 A;  1IYG A;  1H6P A;  5KJN A;  1INZ A;  2EIN E;  1OY3 D;  4BSX A;  1JCQ A;  2DZN A;  3QWW A;  2XPY A;  3DEP A;  3NZU A;  1WAO 1;  4EBA A;  4CDR A;  2X6F A;  3ZYM A;  1TJC A;  5AYW D;  2LNI A;  3TWV A;  1DVP A;  3C98 A;  2WQH A;  4JVS A;  5BUZ A;  2UY1 B;  2PM6 A;  2X6H A;  1QYM A;  3ZHE B;  1EYH A;  3UUX A;  4G8K A;  3RO3 A;  3JCK C;  3UPV A;  5KJK A;  4ILI A;  2WXN A;  1SA4 A;  4NQ0 A;  4W9R A;  4U63 A;  5BXU A;  3U66 A;  2FI7 A;  4HOT A;  3URZ A;  3Q78 A;  3QWV A;  4AIF A;  2VQ2 A;  5ENP D;  1MQS A;  1G3N B;  4A55 A;  3FUI A;  3AU5 A;  3OXF A;  4GYO A;  2ZXW E;  4BSZ B;  4J0U A;  2WXI A;  2OVF A;  4HNA D;  4CDN A;  3MA5 A;  5JJ6 A;  1Q2Z A;  2X6K A;  1D9S A;  4TXR A;  3U64 A;  5EID A;  3C3Q A;  1UJK A;  4C9B B;  2QY7 A;  3L17 A;  2YHE A;  3FTX A;  4WND A;  5FZR A;  4BTA A;  3HG0 D;  5JHA A;  4ANW A;  1TN7 A;  3HXC A;  2XS8 A;  4APO A;  1BLX B;  1P5Q A;  3AG1 E;  4F6R D;  5ANL A;  4PS7 A;  4YDE A;  3D3M A;  3ZIM A;  3OXG A;  2VSY A;  3SBS A;  2XEH A;  1E7U A;  2L6J A;  3IBE A;  3MX3 A;  3UT4 A;  1SW6 A;  3RSE G;  2H6F A;  3SNX A;  4WWO A;  1KLX A;  2XZT G;  3Q7A A;  2B0O E;  3L22 A;  3SO8 A;  2VSN A;  1IQR A;  1IKN D;  3RAU A;  4V3I A;  4UQY A;  4CGV A;  3WG7 E;  5G05 J;  3FUD A;  3FUH A;  2UWJ G;  5KNH D;  3ZYQ A;  4HFG A;  2VGE A;  3LEW A;  1N52 A;  3I3N A;  3SFY A;  4E85 A;  3D9N A;  3U4T A;  1NA0 A;  4CYM D;  4PS8 A;  3SFX A;  4YVQ C;  1SZ9 A;  3FP3 A;  3UQ3 A;  4IYP A;  5KCM A;  5KJM A;  3PZ3 A;  4E6H A;  4AV7 A;  2GRO B;  3CVW A;  3FH8 A;  3HXF A;  4O1O A;  2QC9 A;  3OTN A;  1OCO E;  3ESK A;  1K8K G;  2VGX A;  5EYP F;  4DX6 D;  3APF A;  3S7J A;  3U3W A;  5J08 A;  4D10 C;  5LX8 A;  4MLP A;  4BEP A;  1N4R A;  5BW8 C;  4M7C A;  2DYR E;  4JHJ A;  2VYI A;  3ZN3 A;  4N5Q A;  5B1B E;  5FTP A;  3MKQ A;  4EZL A;  3AJI A;  5T4Y A;  2CHZ A;  3J5P A;  3EIQ C;  3FEX A;  5CRU A;  3AS5 A;  2IOL A;  5AIJ A;  4AY5 A;  3ABL E;  5CED B;  2P2C P;  2QYU A;  5FZQ A;  1K1B A;  5A23 A;  3P2B A;  2C0L A;  4DX7 D;  3S7F A;  1V55 E;  2LAH A;  4DI4 A;  1HE8 A;  3VTY A;  3S7D A;  4F53 A;  3FUN A;  1NFI E;  3CVQ A;  3IV0 A;  2AWI A;  2E0I A;  5FJY A;  2A5E A;  2FO1 E;  2DCP A;  1HH8 A;  5HI7 A;  5EX0 A;  2VGX B;  3C72 A;  4GTQ A;  2MOW A;  1EDU A;  1TJF A;  2LUH A;  3DSV A;  2H6G A;  2ETB A;  4GTO A;  1QBQ A;  5AAO A;  5BV1 A;  4J8D A;  3SFZ A;  3UIP C;  2WM9 A;  3Q4A B;  2MHK A;  4YVO A;  3NOC D;  3MKQ B;  2HO1 A;  2CG2 A;  1HS6 A;  3FTV A;  1MHQ A;  3NOG D;  3ZKJ A;  5AAR A;  3CKB A;  3CLJ A;  3B7T A;  1WG0 A;  3ISM C;  3DXK G;  3P1U A;  3SF4 A;  2EIM E;  4DX2 A;  5ENS D;  2AJA A;  5BXO A;  1JCS A;  2XZD G;  3CVL A;  4WWP A;  3PUK A;  2WXL A;  2P9N G;  3HDX A;  2H6H A;  2IQC A;  4XI0 A;  3S7B A;  3PNL B;  5AQA A;  1TN8 A;  2J49 A;  3FWV A;  3CVV A;  3G2T A;  4GZ5 A;  1QNF A;  1SA5 A;  1HG5 A;  3CGH A;  3TL5 A;  3ML8 A;  3PZ2 A;  4GML A;  4MRU A;  4K5B A;  1BI8 B;  2J4B A;  4I2W A;  4L7T A;  4CGW A;  4HLL A;  4XEI G;  4B0Z A;  3FTZ A;  1RZ4 A;  4U0Z A;  4PDX A;  4J8S A;  3TG5 A;  4DX1 A;  3UIN C;  3FH7 A;  5EYL A;  3PZ1 A;  2J4D A;  5ENO D;  3B13 A;  4JA7 A;  1UW4 B;  3B95 A;  2JEK A;  3ZYK A;  4J8F A;  5EN5 D;  2F8X K;  1N4Q A;  4BER A;  4UWL A;  4KVO A;  3LY7 A;  2XEV A;  3MV3 B;  1ELR A;  1E8W A;  4ME2 A;  2GW1 A;  3PNT B;  3SHF A;  4WWN A;  2BTD A;  2MRI A;  3PE3 A;  1N4P A;  3L16 A;  3UMV A;  1N9A A;  4B8C B;  3WXX A;  4GMJ A;  3SZ7 A;  4FHJ A;  2GGF A;  1OUV A;  4YND A;  5LCW C;  1TNY A;  2CHX A;  4XIF A;  2P9K G;  5FIN A;  4UUC A;  1O1T A;  2WPV A;  4JW1 A;  1KPS B;  3LVQ E;  4Q94 A;  3LKU A;  4G8L A;  1LTX A;  3LVR E;  2KC7 A;  4UWG A;  1H6O A;  5AJD A;  2LSV A;  4B93 B;  1NI1 A;  2NC9 A;  4K0R A;  3PRE A;  5LFA A;  2H6I A;  3BU8 A;  3APC A;  1ELK A;  1TN6 A;  4K03 A;  1HXI A;  3MCX A;  5D2M C;  3NF1 A;  3J5Q B;  1LD8 A;  3ENE A;  2WXR A;  4GB9 A;  3ASD A;  1JWF A;  3JUI A;  2X38 A;  2KXP C;  2IY0 C;  1WM5 A;  2R17 C;  1E90 A;  3B7S A;  3CIA A;  1MYO A;  2J09 A;  4FLH A;  4EEC A;  1ZBP A;  2WXH A;  4UWH A;  3E4B A;  1TNO A;  3G2V A;  4ACL A;  1E8X A;  4L2L A;  1WY6 A;  3EHM A;  5B3S E;  2DYS E;  2WB2 A;  3ZGQ A;  3EHR A;  3TWU A;  2WXM A;  1QQE A;  2F0Y A;  3JYS A;  4GTP A;  2XEE A;  2WXG A;  3L82 A;  4KZ0 A;  4AXH A;  1PAQ A;  2XGS A;  3FDH A;  1H19 A;  3GZ2 A;  3KEA A;  2QYJ A;  2AXZ A;  2VJ8 A;  3TGO A;  5ANR A;  3D9H A;  3D9K A;  1NA3 A;  4I43 A;  4U96 D;  4AP2 A;  4CZ2 D;  1LD7 A;  1RW2 A;  4JZY A;  3FTY A;  4HRN A;  3ABM E;  2L6B A;  2V8S E;  4Z68 A;  3K9I A;  2ILR A;  3G2U A;  2I6H A;  3Q9N C;  1H6K A;  4UI9 C;  4HI8 A;  3AG4 E;  3QKY A;  4H7Y A;  4GZ6 A;  3TAX A;  1YA0 A;  3TWR A;  3TWT A;  5BT1 A;  2E2E A;  4N3A A;  3CEQ A;  2VTB B;  4YDY A;  4I1A A;  1E7V A;  3GZ1 A;  4G24 A;  5ITZ F;  5IY5 E;  1Z3Y A;  3PZD A;  3QAQ A;  3CST A;  4PH4 B;  1A5E A;  4U0U A;  3IXE A;  4N2Q A;  3B7R L;  3CHQ A;  4DUI A;  3BEE A;  3TWS A;  4FA6 A;  2DIW A;  2IU1 A;  5FQ4 A;  3GZS A;  1O1R A;  2KCL A;  4WAF A;  2XS1 A;  5T3R A;  5M72 A;  3PS6 A;  3CHS A;  3QDN A;  3NAW A;  4KMO A;  4JB8 P;  4TUM A;  1OXJ A;  2FUL A;  2PZI A;  3VLD A;  4UQZ A;  4DPR A;  4TUU A;  5G04 J;  1K3Z D;  4NUR A;  5AEN A;  4WUY A;  4GTT A;  2RFM A;  3R7R A;  4AY6 A;  3T8M A;  3FFL A;  5FZS A;  1IHB A;  4IRU A;  4CCA A;  3AU4 A;  4DRX E;  3TG4 A;  4R7L A;  1A17 A;  4ACK A;  2RKK A;  2WXF A;  3JUE A;  4Q69 A;  4OVU A;  5CEC B;  2J07 A;  4MS6 A;  4CT4 A;  5D66 A;  4U07 A;  4Y6C A;  4DLQ A;  4URK A;  4HS2 A;  4LRZ A;  4JXT A;  4M3O A;  1IQU A;  4U95 D;  4XZ4 A;  1MJ0 A;  2Y4T A;  1DC2 A;  2M63 A;  3JQ1 A;  2V5F A;  1S64 A;  2XPZ A;  4Y6W A;  3T5V A;  3RRM B;  4JA9 A;  3DBS A;  3JXI A;  4HVB A;  2WXP A;  3O4Z A;  2IO3 C;  3D9J A;  3D9M A;  1H2V C;  3Q47 B;  4JEH A;  4ABN A;  3SGH A;  3N71 A;  4BTB A;  3KSQ A;  3E37 A;  4JL0 A;  4KZC A;  1OCR E;  4KYO B;  2EIJ E;  3RU0 A;  4GA2 A;  4GAA A;  2NSZ A;  4U7E B;  1HG2 A;  4JC8 A;  1H2T C;  3FUF A;  3ONL A;  5ENT D;  4G26 A;  2R2L A;  3T5X A;  3EU5 A;  3SI5 A;  4U8Y D;  3EHQ A;  4RG6 A;  4EHM A;  3VTX A;  3RRU A;  2I1K A;  3HHM A;  2R05 A;  3W9F A;  1ZU2 A;  2YIN A;  3B7B A;  4BY6 A;  2AVP A;  2IFU A;  1MX6 A;  3EIJ A;  1OWO A;  3KD7 A;  2OOE A;  3FY4 A;  5CCM A;  3B7U X;  2X6J A;  4KVM A;  3Q73 A;  3PEV B;  5HQ8 A;  4JEU A;  3UT7 A;  3UX4 A;  1ZB1 A;  3BQO A;  2ZIR A;  3FEY A;  2VGY A;  4OAU C;  2BED A;  5CBO A;  2LXL A;  1ELW A;  5KWD A;  4Q96 A;  3QC1 A;  5AN8 A;  1O5M A;  1B89 A;  3DWL G;  2KCV A;  1VDY A;  3RK6 A;  5G05 C;  1H2U A;  3ASH A;  4L2Y A;  4B94 A;  1U3D A;  5ENR D;  4X8Q A;  3SD5 A;  3SQV A;  4K5A B;  5E75 A;  2WXK A;  1UG3 A;  2QFC A;  3SY2 A;  3T9K A;  3UM2 A;  5EIB E;  2ION A;  3FUE A;  1WDY A;  2PQN A;  4APF A;  4HOQ A;  4RLY A;  5ENQ D;  2A4Z A;  1FVH A;  2FF4 A;  4TV3 A;  3ZW3 A;  1IXV A;  4FU3 A;  2ETC A;  3FTS A;  4U8V D;  4FJY A;  3CVP A;  3EJN A;  3ZU7 B;  3ZPJ A;  5A7D B;  3AS8 A;  3CHR A;  5JMN D;  5EIL A;  3UM1 A;  2PQR A;  2YNQ A;  4GMR A;  5JJ7 A;  4FAD A;  3HXD A;  1BU9 A;  1N0Q A;  3RJV A;  5EX3 A;  4L23 A;  3MEK A;  4J7W A;  3PUJ A;  3QB2 A;  3UKU G;  1SZA A;  2EIL E;  1K1A A;  2IJG X;  3FUK A;  4RSY A;  4F1S A;  3DSW A;  5FQ8 A;  2J08 A;  2WVI A;  3ASG A;  5C1D A;  3DPY A;  4CEM A;  2XGO A;  2GRL A;  1TR4 A;  2BKK B;  3AG3 E;  5KBA A;  1IHG A;  3D9I A;  4DK5 A;  3R9M A;  4G2V A;  4I6E A;  4HOR A;  4UQX A;  3MGB A;  5KNG A;  3OXL A;  3AAA C;  4LUN U;  4XKB A;  2C0M A;  3L13 A;  5A6C A;  4GU5 A;  1E8Z A;  3CHO A;  4ANX A;  2IOS A;  1YCS B;  4BES A;  1QZ2 A;  4GZC A;  3NBN B;  4JD2 G;  4JHR A;  4GA0 A;  2YQ8 A;  4KT6 B;  2V0P A;  1PY1 A;  2HM8 A;  3NZS A;  3GW4 A;  3PH0 C;  1PC2 A;  4XE0 A;  3UM3 A;  5CEA A;  4C0E A;  1DCE A;  2R59 A;  5CER B;  3CV0 A;  3DEO A;  1X5B A;  4AVX A;  2L0T B;  1KT0 A;  1UN8 A;  3LPZ A;  3FUJ A;  1TNU A;  5B1A E;  3X2Q E;  2AW6 A;  2LSU A;  4HI9 A;  4JHK A;  5EKQ D;  3LXU X;  2LXM A;  3CK8 A;  1AP7 A;  2ZU6 B;  3AG2 E;  3ZXS A;  4YDW A;  3D9P A;  3PEU B;  4EQF A;  5HS0 A;  4BX8 A;  3ULQ A;  3UKR G;  2EQX A;  3EUV A;  3V79 K;  2R03 A;  3ZNG A;  4HRM B;  2UY1 A;  5FQ7 A;  1YYH A;  3UXG A;  1H0A A;  3E33 A;  2BUG A;  3E34 A;  1BPO A;  3Q75 A;  4HXI A;  4L1B A;  3QAR A;  4GTR A;  2J9Q A;  5FQ6 A;  1OT8 A;  2F8Y A;  3HRA A;  4G11 A;  3HXB A;  4HOS A;  2GRM A;  5AQB A;  1TNB A;  4G23 A;  2DBA A;  4TXQ A;  3FTU A;  3FH5 A;  2WQ6 A;  4LER A;  5CBN A;  4QFV A;  1MZC A;  4ANV A;  2R5S A;  3I4R B;  3FU3 A;  4O6F A;  1JUQ A;  2KM4 A;  1XNF A;  2WXJ A;  1U2V G;  3FUM A;  4DJA A;  4UI9 K;  3CK7 A;  4GTS A;  4ZFH A;  3ULY A;  4N39 A;  3PDN A;  1HF8 A;  4DLO A;  3C5R A;  2J8S D;  4FLB A;  1SQM A;  1N54 A;  2Y0B G;  4N3C A;  4RG9 A;  4EZJ A;  4ATZ D;  2Q7F A;  2FEZ A;  2HYZ A;  2KAT A;  3KAE A;  3NQP A;  4GYW A;  1LF8 A;  2CFU A;  4U0S A;  3ZUV B;  4LEU A;  1JPL A;  3RRN B;  2QZA A;  2XGM A;  4N3B A;  4NAC A;  2XEN A;  4XI9 A;  1KZO A;  2ZIS A;  2KZT A;  4I1M A;  1D8D A;  3ZXP A;  3KS2 A;  4J8E A;  1E8Y A;  3G2W A;  5H7P A;  4NIK A;  3UT8 A;  4TXP A;  4HLE A;  2I9C A;  4QQI A;  1FCH A;  4HQD A;  5HKP A;  4O1P A;  3UTM A;  3EHN A;  3LCA A;  2GRQ B;  2OEW A;  1EPU A;  3CR3 A;  2XCC A;  3IEG A;  5D0Q D;  2Y69 E;  2FO7 A;  4C48 B;  3MZL B;  4EBA G;  3E32 A;  2ETA A;  1N0R A;  4GA1 A;  1W3B A;  1E96 B;  4MBG A;  5T8I A;  4J6I A;  4HOU A;  4RQI A;  4F1P A;  3FTW A;  4HBD A;  4GPK A;  4DI3 A;  5AJL A;  3UM0 A;  3ONK A;  4GCN A;  3CHM A;  3ZVV A;  2OCC E;  4ILG A;  2L9B A;  4BET A;  5ARG A;  2HE0 A;  2XRZ A;  4XKC A;  4A63 B;  2XHE A;  1V54 E;  4WNG A;  1S70 B;  1NP7 A;  4N2S A;  4U04 A;  3IKO B;  3ABK E;  2AXU A;  3QK0 A;  3CQC B;  3RKV A;  5D0O D;  1JWG A;  2C2L A;  4B89 A;  4J8Y A;  1N11 A;  4CT0 A;  2KZT B;  3E30 A;  3I4G A;  3TJP A;  2GRN B;  3ASO E;  5AQ9 A;  4A1S A;  3V2O A;  3RIB A;  4WNF A;  3Q15 A;  3SBT B;  3V2X A;  4N5C A;  5CRV A;  1Z5S C;  3PVL A;  1MX2 A;  4OVV A;  1TNZ A;  2KCK A;  3D9O A;  3FHE A;  1NL4 A;  5DIZ A;  4I9E A;  1FVF A;  4ANU A;  4GTM A;  5LP0 A;  3FU0 A;  2P9U G;  1N4S A;  4LSZ E;  3ASN E;  4H7X A;  3G2S A;  2WQ7 A;  3T8K A;  3GYZ A;  3CKC A;  3AS4 A;  1AWC B;  3FUL A;  2PM7 A;  4AEZ C;  4BT9 A;  2WMO A;  3UI2 A;  3JXJ A;  1HFA A;  1UN9 A;  1HX8 A;  4ATG A;  3QOU A;  5JJT A;  3MKR A;  4GZD A;  3NB2 A;  3C3O A;  2CFZ A;  3PE4 A;  4HRL A;  1FT2 A;  4EPZ A;  3LYA A;  3MJW A;  3TWX A;  5HRY A;  4GPM A;  3DSS A;  1L5J A;  3O48 A;  4I6J A;  1HZ4 A;  3DSU A;  3FU5 A;  4ILH B;  4ZHB A;  4XX5 A;  3I5P A;  4UWF A;  3ZYL A;  4YDO A;  4OAV B;  4KXK B;  1X81 A;  1HO8 A;  4GCO A;  3L9T A;  3LY9 A;  1U3C A;  4OYS A;  3LJ3 A;  4P29 A;  3HVE A;  3UIO C;  4BFR A;  4FHK A;  1DCQ A;  4FUL A;  5G04 C;  2P9I G;  1S0P A;  4I9C A;  4U8H A;  2P9S G;  4C0M A;  2BKG A;  4GTV A;  3D9L A;  2L0I A;  4FP7 A;  4UWK A;  1OWN A;  2RFA A;  4IUL A;  2VSX E;  5FIO A;  2P9P G;  4WNE A;  3L08 A;  2CHW A;  3LJN A;  1MX4 A;  3Q5M A;  1Z3X A;  4FC8 A;  5BNW A;  2R02 A;  1N95 A;  1OCC E;  5CMW A;  1OCZ E;  2GRP B;  2DWZ A;  1KZP A;  3Q9U C;  3V31 A;  3ZEF A;  3F6Q A;  5LCW J;  4FJZ A;  2XQ0 A;  1D8E A;  3LS8 A;  3ULE G;  4PS3 A;  3L6A A;  3PRZ A;  4BX9 A;  3OAW A;  3JQ0 A;  2OND A;  4G1T A;  3VLF A;  2WXO A;  3DST A;  4PUC A;  3BUA A;  4AOF A;  1FT1 A;  2WXQ A;  2A5U A;  3LY8 A;  1O1S A;  2VSO E;  1Y6I A;  1DNP A;  4O60 A;  4I6G A;  5CCL A;  4I2Z A;  2V4H C;  3S2A A;  4GZ3 A;  2ZGD A;  3DSX A;  3DPD A;  4KBQ A;  2WMN A;  4LCT A;  3CHP A;  2CG3 A;  5ARF A;  3HVE B;  4LNU D;  3V30 A;  3TXM A;  5KJL A;  1JCR A;  4K5C A;  2P9L G;  1TEZ A;  3TWQ A;  3APD A;  2X3M A;  1TYQ G;  4NRH B;  1FPP A;  4I17 A;  2ZGG A;  3HXE A;  5CHE E;  3DRA A;  3EDT B;  3QNK A;  3IHV A;  3Q49 B;  5EDS A;  1OWP A;  1HU3 A;  2Y1L E;  4GYY A;  2P58 C;  4A3V A;  3TXN A;  3KEZ A;  1KT1 A;  2V5Q C;  2OVB A;  1S63 A;  4L9P A;  3PZ4 A;  3HIZ A;  1Y8M A;  3ZRH A;  3CK9 A;  4HB5 A;  1XGW A;  5LOZ A;  3CQG B;  3BG0 B;  3C3R A;  2EIK E;  5G55 A; 
#chains in the Genus database with same CATH homology
 4ACK A;  3CVQ A;  3FUM A;  3IV0 A;  2AWI A;  2WXF A;  4DJA A;  5JHB A;  2E0I A;  4G25 A;  3CVY A;  4UI9 K;  5FJY A;  3CK7 A;  4A3T A;  2DCP A;  4Q69 A;  4OVU A;  2BF0 X;  4IN3 B;  2J07 A;  4BWR A;  2PL2 A;  4MS6 A;  1HH8 A;  4CT4 A;  4U07 A;  4Y6C A;  4DLQ A;  5HI7 A;  3U9W A;  4HS2 A;  4N39 A;  3PDN A;  4URK A;  4LRZ A;  1HF8 A;  4DLO A;  4UI9 J;  4JXT A;  4M3O A;  5EX0 A;  1IQU A;  2VGX B;  1UJJ A;  4FLB A;  4AM9 A;  1SQM A;  4XZ4 A;  1N54 A;  2Y4T A;  4N3C A;  4RG9 A;  4EZJ A;  1Z6T A;  2M63 A;  3JQ1 A;  2Q7F A;  2FEZ A;  2MOW A;  1EDU A;  1TJF A;  2HYZ A;  2V5F A;  3R7Q A;  5G2N A;  2KAT A;  3KAE A;  3NQP A;  2XPZ A;  4GYW A;  1LF8 A;  2OV8 A;  4Y6W A;  4EZK A;  2CFU A;  3T5V A;  3RRM B;  5ENN A;  2NXP A;  3CSF A;  4U0S A;  5BV1 A;  4JA9 A;  1OWL A;  4J8D A;  5C2Y A;  4MKT A;  3SFZ A;  5BPP A;  4LEU A;  2WM9 A;  3DBS A;  3Q4A B;  4HVB A;  2MHK A;  1JPL A;  2WXP A;  5CMY A;  4YVO A;  5FT9 A;  3O4Z A;  3MKQ B;  2HO1 A;  2CG2 A;  2IF4 A;  2I1J A;  3RRN B;  1HS6 A;  3MV2 B;  3D9J A;  3FTV A;  1MHQ A;  3D9M A;  2XGM A;  4AJW A;  4N3B A;  3CKB A;  4NAC A;  3CLJ A;  2LO6 A;  3B7T A;  1H2V C;  3Q47 B;  4XI9 A;  4JEH A;  3CVX A;  2KZT A;  4ABN A;  2LAI A;  4I1M A;  3SGH A;  4F7A A;  3N71 A;  4BTB A;  3VLE A;  3P1U A;  4JL0 A;  3KS2 A;  4KZC A;  3SF4 A;  4J8E A;  4KYO B;  1E8Y A;  3G2W A;  3RU0 A;  3UT8 A;  4GA2 A;  4GAA A;  2NSZ A;  2I9C A;  2RD0 A;  3CVL A;  4JPS A;  4HLE A;  5J90 A;  1HG2 A;  4JC8 A;  1H2T C;  2XCB A;  4F3V A;  4WWP A;  1OWM A;  3L54 A;  3FUF A;  2WXL A;  3PUK A;  5DBK A;  1FCH A;  3ONL A;  3RO2 A;  3HDX A;  2IQC A;  4G26 A;  2I2O A;  4XI0 A;  3S7B A;  3T5X A;  3PNL B;  3SI5 A;  4BT8 A;  3EHN A;  2J49 A;  3FWV A;  4RG6 A;  3QWP A;  3CVV A;  3LCA A;  3VTX A;  4A1G A;  3G2T A;  3RRU A;  4GZ5 A;  1QNF A;  3CVN A;  3QJZ A;  1EPU A;  3ZHE A;  3CR3 A;  2I1K A;  3HHM A;  2XCC A;  2VTB A;  1ZU2 A;  2YIN A;  1HG5 A;  3CGH A;  3TL5 A;  3IEG A;  3ML8 A;  2JLB A;  5D0Q D;  4GML A;  4MRU A;  3IHY A;  4I1O B;  2FO7 A;  4BY6 A;  1EF1 C;  2AVP A;  4TRQ A;  2IFU A;  3CVU A;  3MZL B;  4CRW A;  3EIJ A;  4EBA G;  2J4B A;  1OWO A;  4GA1 A;  1W3B A;  4I2W A;  2V4L A;  1E96 B;  4L7T A;  5T8I A;  3KD7 A;  4J6I A;  2X6I A;  2OOE A;  2HR2 A;  3FY4 A;  4CDM A;  4CGW A;  4HOU A;  2FBN A;  4B0Z A;  3FTZ A;  2AXV A;  3FTW A;  5E76 A;  5CCM A;  4U0Z A;  4PDX A;  2XPI A;  4GPK A;  3B7U X;  2X6J A;  2Y4U A;  4DI3 A;  5AJL A;  4J8S A;  3TG5 A;  3ONK A;  4GCN A;  3CHM A;  4KVM A;  3ZVV A;  4ILG A;  1NZN A;  2L9B A;  3FH7 A;  3MYV A;  5ARG A;  2J4D A;  3ZFW A;  3FU6 A;  2XRZ A;  3PEV B;  3HYM B;  4XKC A;  2XHE A;  5HQ8 A;  4JEU A;  3B13 A;  4JA7 A;  1UW4 B;  2XRY A;  4R7L A;  2JEK A;  3UT7 A;  3UX4 A;  3ZYK A;  2Y3A A;  4WNG A;  1NP7 A;  4J8F A;  4N2S A;  4U04 A;  5BV0 A;  3IKO B;  1GW6 A;  2AXU A;  5FWQ A;  3QK0 A;  3FEY A;  4B8A A;  3ASF A;  3CQC B;  2VGY A;  4UWL A;  3LDZ A;  4KVO A;  3RKV A;  3LY7 A;  5D0O D;  2XEV A;  3MV3 B;  1ELR A;  1E8W A;  4ME2 A;  4RVB A;  1JWG A;  2C2L A;  2GW1 A;  3PNT B;  3BG1 B;  3R9A B;  3SHF A;  2YHC A;  4B89 A;  4WWN A;  2BTD A;  4CT0 A;  3ESL A;  2MRI A;  2RG8 A;  3PE3 A;  3ML9 A;  2KZT B;  1ELW A;  3I4G A;  1IYG A;  4Q96 A;  3TJP A;  3QC1 A;  3L16 A;  4A1S A;  3UMV A;  5KJN A;  4B8C B;  3RIB A;  3WXX A;  4GMJ A;  3Q15 A;  4WNF A;  4FHJ A;  2GGF A;  3SZ7 A;  1INZ A;  3SBT B;  1OUV A;  4N5C A;  1B89 A;  2KCV A;  1VDY A;  4YND A;  4BSX A;  3RK6 A;  3QWW A;  5G05 C;  2XPY A;  5LCW C;  3PVL A;  2CHX A;  3NZU A;  1WAO 1;  1H2U A;  4OVV A;  3ASH A;  4XIF A;  4EBA A;  2KCK A;  4L2Y A;  4CDR A;  2X6F A;  3ZYM A;  1TJC A;  5AYW D;  4B94 A;  2LNI A;  1U3D A;  1DVP A;  3D9O A;  2WPV A;  3C98 A;  2WQH A;  3FHE A;  5DIZ A;  4I9E A;  4JVS A;  3SD5 A;  1FVF A;  4JW1 A;  5E75 A;  4ANU A;  3LVQ E;  4Q94 A;  2WXK A;  3LKU A;  1UG3 A;  5BUZ A;  2UY1 B;  2PM6 A;  5LP0 A;  3FU0 A;  2X6H A;  3ZHE B;  3LVR E;  2QFC A;  1EYH A;  4H7X A;  2KC7 A;  4UWG A;  3UUX A;  3G2S A;  5AJD A;  2WQ7 A;  2LSV A;  3RO3 A;  3GYZ A;  2ION A;  3AS4 A;  3CKC A;  3FUE A;  2NC9 A;  3JCK C;  3UPV A;  4K0R A;  3PRE A;  3FUL A;  5KJK A;  2PM7 A;  4ILI A;  2PQN A;  4AEZ C;  4BT9 A;  2WMO A;  4APF A;  2WXN A;  5LFA A;  4HOQ A;  1HFA A;  1UN9 A;  4NQ0 A;  4W9R A;  4U63 A;  3U66 A;  2A4Z A;  3APC A;  2FI7 A;  1ELK A;  4HOT A;  1FVH A;  1HX8 A;  3URZ A;  4ATG A;  2FF4 A;  4K03 A;  3QWV A;  1HXI A;  3MCX A;  3QOU A;  4TV3 A;  4AIF A;  3ZW3 A;  4FU3 A;  2VQ2 A;  3FTS A;  5JJT A;  3MKR A;  4FJY A;  1MQS A;  3NF1 A;  4GZD A;  2CFZ A;  3PE4 A;  4A55 A;  3CVP A;  3EJN A;  3ENE A;  4EPZ A;  2WXR A;  3AU5 A;  3FUI A;  3OXF A;  4GB9 A;  4GYO A;  3ZPJ A;  3LYA A;  5A7D B;  3MJW A;  3AS8 A;  3ASD A;  3CHR A;  1JWF A;  4J0U A;  2WXI A;  1L5J A;  3JUI A;  2OVF A;  3O48 A;  2PQR A;  4I6J A;  4CDN A;  2X38 A;  2YNQ A;  1HZ4 A;  3FU5 A;  3MA5 A;  5JJ6 A;  1WM5 A;  2R17 C;  1E90 A;  2X6K A;  3B7S A;  3CIA A;  5JJ7 A;  2J09 A;  3U64 A;  4FLH A;  1UJK A;  4FAD A;  4C9B B;  1ZBP A;  2QY7 A;  2WXH A;  3L17 A;  4EEC A;  4UWH A;  3E4B A;  4ILH B;  3G2V A;  4ACL A;  1E8X A;  4L2L A;  4XX5 A;  3I5P A;  1WY6 A;  3EHM A;  4UWF A;  3RJV A;  5EX3 A;  2YHE A;  2WB2 A;  4L23 A;  3ZGQ A;  3ZYL A;  3MEK A;  3FTX A;  3PUJ A;  4WND A;  5FZR A;  4KXK B;  3QB2 A;  1HO8 A;  4GCO A;  2WXM A;  1SZA A;  1QQE A;  3JYS A;  3LY9 A;  2IJG X;  4BTA A;  1U3C A;  2WXG A;  4OYS A;  3FUK A;  3LJ3 A;  4KZ0 A;  4RSY A;  4F1S A;  4P29 A;  3HVE A;  4AXH A;  5JHA A;  4ANW A;  4BFR A;  1PAQ A;  4FHK A;  2XGS A;  3FDH A;  5FQ8 A;  4FUL A;  5G04 C;  4APO A;  1H19 A;  3GZ2 A;  1P5Q A;  3FUN A;  1S0P A;  2J08 A;  4I9C A;  4U8H A;  2WVI A;  5ANL A;  4PS7 A;  4C0M A;  3ASG A;  5C1D A;  2AXZ A;  3D3M A;  3D9L A;  2VJ8 A;  2L0I A;  3TGO A;  4FP7 A;  2XGO A;  3ZIM A;  4CEM A;  2GRL A;  3OXG A;  4UWK A;  2VSY A;  5ANR A;  3SBS A;  1OWN A;  1E7U A;  2L6J A;  3IBE A;  3MX3 A;  4IUL A;  2VSX E;  3D9K A;  1IHG A;  3D9I A;  3UT4 A;  1NA3 A;  4I43 A;  3SNX A;  4DK5 A;  4G2V A;  4WWO A;  4I6E A;  4HOR A;  4UQX A;  4AP2 A;  3MGB A;  3OXL A;  4LUN U;  2C0M A;  1KLX A;  3L13 A;  3L08 A;  4WNE A;  4XKB A;  2CHW A;  4JZY A;  3FTY A;  3Q5M A;  5A6C A;  4GU5 A;  1Z3X A;  4FC8 A;  5BNW A;  3L22 A;  1E8Z A;  3CHO A;  2VSN A;  1IQR A;  2V8S E;  4ANX A;  5CMW A;  3K9I A;  2IOS A;  2ILR A;  3G2U A;  4V3I A;  2I6H A;  4UQY A;  4CGV A;  1H6K A;  3ZEF A;  1QZ2 A;  5G05 J;  3FUD A;  5LCW J;  4FJZ A;  2XQ0 A;  4UI9 C;  3FUH A;  2UWJ G;  3QKY A;  3LS8 A;  4H7Y A;  4HFG A;  3ZYQ A;  4GZ6 A;  3TAX A;  4PS3 A;  4GZC A;  3L6A A;  3LEW A;  3PRZ A;  4BX9 A;  3OAW A;  4JHR A;  3JQ0 A;  2YQ8 A;  1YA0 A;  4GA0 A;  1N52 A;  2V0P A;  4KT6 B;  1PY1 A;  3I3N A;  2OND A;  4G1T A;  2HM8 A;  3NZS A;  5BT1 A;  3VLF A;  2E2E A;  2WXO A;  4N3A A;  4E85 A;  3GW4 A;  3PH0 C;  3CEQ A;  3D9N A;  2VTB B;  1PC2 A;  4PUC A;  4XE0 A;  3U4T A;  1NA0 A;  4I1A A;  4PS8 A;  4AOF A;  4C0E A;  2WXQ A;  2A5U A;  3LY8 A;  4YVQ C;  2R59 A;  2VSO E;  1E7V A;  3CV0 A;  1X5B A;  1Y6I A;  1DNP A;  1SZ9 A;  3FP3 A;  3UQ3 A;  4AVX A;  3GZ1 A;  2L0T B;  4IYP A;  5KCM A;  1KT0 A;  5KJM A;  4G24 A;  4I6G A;  4E6H A;  4AV7 A;  5CCL A;  1UN8 A;  4I2Z A;  3S2A A;  4GZ3 A;  3LPZ A;  3FUJ A;  3FH8 A;  3CVW A;  1Z3Y A;  3PZD A;  3DPD A;  3QAQ A;  3CST A;  4KBQ A;  4PH4 B;  2WMN A;  3OTN A;  2AW6 A;  2LSU A;  3ESK A;  4JHK A;  5EKQ D;  4U0U A;  4LCT A;  2VGX A;  3LXU X;  3CHP A;  2CG3 A;  5ARF A;  4N2Q A;  3B7R L;  3CK8 A;  3CHQ A;  3BEE A;  3HVE B;  3APF A;  3S7J A;  2ZU6 B;  3U3W A;  5J08 A;  3ZXS A;  4D10 C;  3TXM A;  5KJL A;  5LX8 A;  3D9P A;  3PEU B;  4MLP A;  4EQF A;  5BW8 C;  4FA6 A;  2DIW A;  2IU1 A;  5FQ4 A;  3GZS A;  4BX8 A;  2KCL A;  4JHJ A;  3APD A;  4WAF A;  2VYI A;  3ZN3 A;  2X3M A;  4NRH B;  1TEZ A;  3ULQ A;  4I17 A;  5T3R A;  5FTP A;  2EQX A;  5M72 A;  3MKQ A;  3PS6 A;  4EZL A;  2UY1 A;  3CHS A;  5FQ7 A;  1H0A A;  5CHE E;  5T4Y A;  2CHZ A;  3EDT B;  2BUG A;  3QDN A;  3QNK A;  1BPO A;  3EIQ C;  4HXI A;  3FEX A;  4L1B A;  3IHV A;  3QAR A;  2J9Q A;  4KMO A;  5FQ6 A;  3Q49 B;  5EDS A;  1OWP A;  2FUL A;  3AS5 A;  4G11 A;  2IOL A;  1HU3 A;  2PZI A;  3VLD A;  4GYY A;  2P58 C;  4UQZ A;  4A3V A;  4HOS A;  5AIJ A;  4AY5 A;  2GRM A;  3TXN A;  4DPR A;  4G23 A;  2DBA A;  3KEZ A;  4TUU A;  1KT1 A;  5FZQ A;  5G04 J;  3FTU A;  3FH5 A;  5A23 A;  4NUR A;  2WQ6 A;  3P2B A;  4LER A;  5AEN A;  2OVB A;  4WUY A;  2C0L A;  3S7F A;  4QFV A;  3R7R A;  3HIZ A;  1Y8M A;  3ZRH A;  4AY6 A;  3CK9 A;  4ANV A;  3T8M A;  3FFL A;  2R5S A;  2LAH A;  1XGW A;  1HE8 A;  3I4R B;  5FZS A;  3FU3 A;  5LOZ A;  3S7D A;  3VTY A;  4DI4 A;  4O6F A;  1JUQ A;  3CQG B;  2KM4 A;  3BG0 B;  4IRU A;  5G55 A;  4CCA A;  4F53 A;  3AU4 A;  1XNF A;  3TG4 A;  2WXJ A;  1A17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...