4RG9A

Crystal structure of apc3-apc16 complex (selenomethionine derivative)
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
497
structure length
471
Chain Sequence
EPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cell division cycle protein 27 homolog
publication title Structure of an APC3-APC16 Complex: Insights into Assembly of the Anaphase-Promoting Complex/Cyclosome.
pubmed doi rcsb
source organism Homo sapiens
total genus 156
structure length 471
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg9A01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg9A03
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg9A04
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4rg9A02
1WAO1 2Y4TA 4XIFA 4G25A 3U3WA 2YQ8A 2BUGA 4GPKA 4RG6A 4YVOA 4UI9C 3QDNA 5JJ6A 5FJYA 4UI9K 3AS8A 4KYOB 3CKBA 3TAXA 3RKVA 4BT8A 5KJLA 2XGOA 3VTYA 2I6HA 4CGWA 1KT0A 2LSUA 3UQ3A 3OXFA 2PZIA 2WQHA 3MEKA 3ASDA 3MKRA 4U0UA 5G04C 3UPVA 5A7DB 4I9EA 2KCVA 5EX0A 3Q47B 4G26A 4J8DA 3OXGA 5DBKA 2XPIA 5EX3A 4CDRA 1P5QA 4I9CA 2VQ2A 2XCCA 2WPVA 3N71A 3ZPJA 2P58C 3GZ1A 2DBAA 3TG5A 4U0ZA 3LKUA 1A17A 5M72A 4B94A 4RG9A 5AYWD 2C0LA 3BEEA 5CHEE 4HOTA 4N2QA 4HOQA 5FZRA 2OOEA 4Y6WA 5CCMA 2AVPA 1FCHA 4UI9J 1KT1A 3S7JA 3EDTB 3MV3B 4Y6CA 2YHCA 3Q4AB 2LNIA 1ELWA 3OXLA 2VSNA 2E2EA 1E96B 5KJNA 4I1AA 2NC9A 1HZ4A 1WM5A 4JA7A 3UUXA 3KS2A 5ARFA 2XGMA 2J9QA 5G04J 4CGVA 1ZU2A 1NZNA 4ME2A 3E4BA 3ZN3A 2Y4UA 3ASGA 4AM9A 1HXIA 3CV0A 3RO3A 4BWRA 3LYAA 4U07A 4HOUA 3CVNA 2GW1A 4I2WA 3GZ2A 2Q7FA 3S7FA 5BT1A 4J8EA 4UQYA 2LSVA 3Q5MA 2KCLA 4J0UA 4G2VA 4WNDA 3WXXA 1ZBPA 4GZ6A 4H7XA 3CVQA 5FTPA 3TGOA 4AY5A 2FEZA 3URZA 2C0MA 4A1SA 1OUVA 3ASFA 3LY9A 5C1DA 2XGSA 2KATA 4I17A 3RJVA 2KCKA 4N3AA 2C2LA 3FFLA 3LY8A 4N3CA 3MA5A 4JL0A 2VGYA 1IYGA 4BT9A 1HH8A 3FWVA 4AY6A 4XI9A 5BNWA 1NA0A 3GYZA 5ARGA 2PL2A 1PC2A 5HI7A 2FO7A 2PQNA 3FP3A 1Y8MA 5G05C 4JHRA 3ULQA 1YA0A 3TG4A 2IF4A 2KC7A 3S7BA 4G1TA 4GA2A 2XEVA 4U04A 4H7YA 4AIFA 4U0SA 4WNFA 4G23A 2ONDA 3CEQA 3HYMB 4O6FA 3U4TA 3ZHEB 2FI7A 2FBNA 5LCWC 3Q49B 4HORA 1TJCA 5BW8C 4WUYA 3GW4A 3CVPA 4N39A 4APOA 2UWJG 4GZ5A 4W9RA 3QWPA 4NQ0A 1QZ2A 3KD7A 4G24A 4GA0A 4UQZA 4GYWA 4GZ3A 4YVQC 5KJMA 4KXKB 3QOUA 5D0OD 2JLBA 5KJKA 2UY1B 3Q15A 4ABNA 2VGXB 5HQ8A 3JYSA 3PDNA 3CKCA 2R5SA 2VYIA 2HR2A 3MV2B 3KAEA 1IHGA 3ZHEA 3SF4A 1KLXA 3AS4A 3AS5A 3LCAA 4F3VA 3K9IA 5G05J 1XNFA 5FZSA 2HYZA 3ZGQA 4GYYA 3CK8A 3QKYA 2PQRA 4GCNA 2FF4A 4N3BA 2HO1A 4GCOA 2QFCA 3QWVA 3VTXA 4N5CA 2L6JA 5LCWJ 1B89A 2IFUA 2UY1A 4EQFA 2VGXA 4GA1A 4UQXA 4WNEA 3CK9A 3CVLA 2XCBA 4IN3B 5JJTA 1W3BA 5A6CA 3RU0A 3IEGA 5D0QD 4YNDA 5JJ7A 4XI0A 3PE3A 1QQEA 4LEUA 4WNGA 2VSYA 3O48A 2V5FA 5EKQD 5FT9A 3RIBA 3QWWA 3NF1A 3S7DA 1NA3A 3CK7A 1ELRA 4KBQA 4BTBA 5CCLA 4N2SA 4BTAA 3PE4A 3R9AB 3LPZA 4J8FA 3RO2A 4HOSA 3SZ7A 3ZFWA 2MHKA 4NRHB 4I2ZA 3LY7A 4JA9A 3ASHA 5DIZA 3ESKA 5FZQA 4GYOA
chains in the Genus database with same CATH superfamily
4GPKA 3UT7A 2RG8A 3NOGD 4N5QA 2CG3A 3PZ1A 2CHXA 3UM3A 3TWTA 4FHKA 4WAFA 3WG7E 3U9WA 2LAHA 2XGOA 4DUIA 1MX2A 1QBQA 3NZSA 3UTMA 2V0PA 2XENA 4CT4A 1HG5A 5BXUA 5ENSD 3AG3E 3E32A 5A7DB 4D10C 1N11A 3OXGA 4DPRA 1P5QA 2XHEA 2NSZA 1NP7A 1TNZA 2WPVA 3PNTB 4DX1A 2IO3C 3AU5A 2P58C 1LTXA 3CVVA 4HRMB 2RFAA 4U0ZA 3ML8A 5HKPA 3G2TA 3PEVB 5M72A 2XRYA 2R2LA 5ENOD 3CVWA 1H6OA 5AQ7A 1N54A 2C0LA 3FTSA 2ZXWE 3RSEG 3MKQB 3DSVA 5FZRA 4DX2A 5HRYA 4O1PA 4XKCA 1FCHA 3B7TA 2X6HA 2ETBA 2GRQB 5JHAA 1JPLA 4BESA 3D9PA 1Z6TA 3EIQC 5AARA 5A23A 2V5QC 3L22A 4GTSA 3QJZA 2P9IG 1MHQA 4ILHB 1WM5A 5EYPF 2J9QA 5G04J 1NZNA 3ABLE 4DLQA 4UWGA 5CEAA 3UM2A 1GW6A 4AM9A 3CV0A 3D9LA 1TN6A 1OCOE 3S7FA 4JPSA 4J8EA 2WXPA 4J0UA 5AQBA 4G2VA 3AG4E 3IHVA 3D3MA 3CVQA 3ML9A 5FTPA 1SZAA 2H6FA 3T8MA 3CLJA 2C0MA 2I9CA 1OUVA 4L23A 4A1GA 3C5RA 5C1DA 2RD0A 2XGSA 2IU1A 3B7BA 3LJNA 4I17A 2AW6A 2WMNA 2GRPB 3BQOA 3D9KA 3APDA 3FFLA 3UT8A 3FUHA 5EILA 2MOWA 3T5VA 2VGYA 4BT9A 4KVMA 1HH8A 1OT8A 1BI8B 4B8AA 1SA4A 3AAAC 1NA0A 3B7SA 2YNQA 2J09A 5ARGA 3HXCA 3C3OA 3FTZA 4EBAA 3APFA 4MS6A 1Y8MA 2WQ7A 1MYOA 4IRUA 1TN7A 1TYQG 2KC7A 3S7BA 2AXUA 3TWRA 4U04A 4AIFA 3PZDA 4G23A 4ANXA 4O6FA 4K5BA 3U4TA 4XKBA 3VLDA 2IJGX 3O4ZA 5J08A 1TJCA 4WUYA 3GW4A 3CVPA 2UWJG 4GZ5A 1UW4B 4W9RA 1ELKA 3QWPA 5CRUA 2CFZA 4MKTA 4NQ0A 1RW2A 2I1JA 3DSTA 1Y6IA 3R7QA 3QOUA 2KZTB 3QK0A 2EIJE 4U96D 3Q15A 3SY2A 3CQGB 2I2OA 3JYSA 1H19A 4ACKA 3CKCA 1N4QA 2RFMA 3PUJA 4B0ZA 4LCTA 3KAEA 1Q2ZA 2GRRB 4K5AB 3HXDA 3CHRA 4F3VA 2WXNA 1UN8A 3CR3A 2A4ZA 5FZSA 2LXMA 3I3NA 3CGHA 4GYYA 1QYMA 2ZGDA 3UX4A 4N3BA 3KEZA 2WXGA 2HO1A 3DWLG 4C0MA 4DI3A 3SBTB 4GCOA 3ONKA 3JXJA 3ABKE 3HG0D 4N5CA 2MRIA 4FLBA 2GRMA 4F7AA 2VGXA 1K1BA 3D9IA 2IOSA 3FTUA 3RU0A 4GAAA 3HDXA 4GTQA 1A5EA 3PNLB 3U66A 4YNDA 1NFIE 2ZU6B 4GMLA 1L5JA 5JJ7A 2GGFA 4JEUA 3MYVA 3PE3A 1QQEA 3CVUA 4WNGA 2VSYA 2DCPA 5EKQD 4F1PA 2B6CA 3S7DA 1NA3A 2XPYA 4KBQA 2VGEA 1N94A 4HFGA 5CCLA 4N2SA 3PE4A 3LPZA 3ASNE 4URKA 2F37A 3FTVA 2MHKA 3IV0A 4I43A 3JQ0A 3VLEA 3ASHA 4ACLA 1D8DA 2PM7A 4WWPA 5BV1A 2BUGA 4UI9C 3QDNA 5JJ6A 5FJYA 4L2LA 5LFAA 4X8QA 4UI9K 3AS8A 5KWDA 1BU9A 4KYOB 4CDNA 3HVEA 3AG1E 1H2VC 1YYHA 1JWGA 3C72A 5KJLA 5AN8A 1K3ZD 2LXLA 4LRZA 1O1RA 1JCQA 3DEPA 1KT0A 2LSUA 3UQ3A 3OXFA 4EZKA 2WQHA 2Y69E 3ULEG 3ASDA 4OAVB 4U0UA 2IOLA 5T3RA 4XE0A 3SFXA 3UPVA 2R03A 4I9EA 5EX0A 5DBKA 3L08A 2XPIA 5EX3A 4CYMD 5ENTD 3V79K 1UJKA 2DZNA 2MYOA 4DJAA 4RLYA 1UOHA 3AJIA 3S2AA 1H2UA 1H6KA 3D9HA 2AXZA 2R17C 5KBAA 2OVBA 3IHYA 3BEEA 5AQ9A 4TUUA 4RSYA 2OOEA 5EN5D 3BG0B 1U3CA 3B7UX 3EIJA 2DZOA 4U7EB 3FULA 3OAWA 3S7JA 3EDTB 4Y6CA 4GTPA 1D8EA 2P9NG 2LNIA 3P1UA 3SFYA 2GROB 3L9TA 4FJZA 2L0TB 4JHJA 2YHEA 1TEZA 1ELWA 4O1OA 3OXLA 3SGHA 2VSNA 1E96B 4TXPA 3L16A 2LO6A 2BTDA 2KXPC 5ARFA 4FU3A 1E7VA 4I6JA 4GZCA 3SQVA 3E4BA 3SFZA 1G3NB 3ZN3A 3V2XA 3TWVA 3RO3A 3EJNA 4DX5D 4G11A 4GPMA 3FUDA 4I2WA 2R02A 2XQ0A 4HNAD 3FUMA 3B95A 3UT4A 2WXLA 3Q5MA 2KCLA 3L82A 3WXXA 2PNNA 1N4SA 4EBAG 3MJWA 4H7XA 4I6EA 4YDYA 4HI8A 4AVXA 3TGOA 3CHMA 3NQPA 3VLFA 4LSZE 2XEHA 3G2SA 1OWMA 5EIBE 1O1SA 2R05A 3T9KA 1OWPA 2QZAA 2BF0X 4L2YA 4ANWA 2KCKA 4ATGA 4BFRA 4OYSA 3TWWA 4U8VD 4BSXA 1HG2A 3ZRHA 3D9NA 5LOZA 4ILGA 5FQ8A 3FUFA 3RAUA 3EUVA 2X38A 4I6GA 4AP2A 1IYGA 4AXHA 4AY6A 4HB5A 5BNWA 1TJFA 4GB9A 2L9BA 4DX6D 1SQMA 2ILRA 3FU0A 3PZ3A 3RRUA 1PC2A 4J8SA 1OCZE 2PQNA 1Z5SC 1BI7B 4JHRA 3ENEA 1HE8A 4OVVA 1X5BA 4G1TA 4GA2A 1MZCA 2XEVA 1MQSA 5AQAA 3UM0A 4AEZC 4U8HA 4ZFHA 1TNYA 2KBXA 5ENPD 1E8WA 3CEQA 1N52A 3C3RA 2P9UG 5AJDA 3RRMB 3FHEA 1VDYA 3B13A 5EYLA 2FBNA 3QARA 3Q49B 2L6BA 3I5PA 3CSFA 4QFVA 4N39A 1BLXB 4B93B 1K8KG 3KSQA 4TUMA 1XGWA 4KZ0A 4TRQA 3TWSA 2AWIA 4A63B 4UQZA 4JC8A 3EU5A 3RK6A 2P9SG 4GZ3A 1PAQA 5B1AE 1FT2A 1JWFA 3TWXA 4KXKB 4JVSA 4PS8A 4HQDA 5H7PA 3Q73A 1H2TC 3FUKA 5KJKA 5AJLA 4GTRA 1SZ9A 1LF8A 5C2YA 2VGXB 4ABNA 5HQ8A 1HX8A 3PDNA 2VYIA 1TNBA 2HR2A 5KCMA 1SVXA 1IHGA 2ETCA 4UWFA 3SF4A 1KLXA 1S64A 3D9MA 3L54A 1N0QA 3DSXA 4EPZA 3K9IA 3BU8A 2JEKA 3FU6A 2J07A 2WM9A 3QKYA 1X81A 2PQRA 3ZW3A 1HS6A 3HXFA 2FF4A 3PZ2A 4CZ2D 4A55A 3HRAA 4HXIA 1E7UA 3D9OA 1IKND 5D2MC 1H6PA 2BKKB 2ZGGA 1UN9A 2QC9A 2IFUA 2YINA 5E76A 4EZLA 1E8YA 3Q7FA 3G2VA 3CK9A 2LUHA 3LVQE 1W3BA 5A6CA 3FY4A 5CMYA 4QQIA 2P9LG 4XI0A 4EHMA 1FVHA 4B8CB 4E6HA 3ZXSA 4UUCA 1OCRE 3RIBA 3SHFA 4U95D 3CVXA 4A3VA 3EHRA 4BTAA 4J8FA 3T5XA 2EQXA 3SZ7A 3ZFWA 4NRHB 3LJ3A 2EILE 3J5QB 4JA9A 3R7RA 1N0RA 4XX5A 2ZIRA 5DIZA 2EINE 4HBDA 4WWOA 1HU3A 4PS7A 4FC8A 1WAO1 2Y4TA 4XIFA 4G25A 3HXBA 4YVOA 3ZU7B 1E8XA 2QY7A 3IKOB 3EHQA 4ILIA 3ZEFA 4PS3A 3W9FA 5AIJA 1JUQA 4GZDA 2I6HA 2WQ6A 5B3SE 4CGWA 1MJ0A 2X6FA 2PZIA 1JCSA 2WXOA 4YDWA 4V3IA 2VSOE 2KCVA 3DEOA 4M7CA 3ZYQA 4I9CA 4MLPA 2XCCA 2WXIA 3N71A 3DRAA 3I4GA 3UXGA 4FADA 3C98A 4FJYA 5CRVA 5KNGA 2CFUA 3ZNGA 2DBAA 3HIZA 3LKUA 3Q7AA 3MX3A 1N4RA 4O60A 4B94A 5AYWD 4EECA 4HLEA 1SA5A 2DYSE 4HOTA 3DPYA 4N2QA 2A5UA 4Y6WA 5CCMA 3LEWA 4UI9J 4GTMA 3DXMG 3Q9NC 3P2BA 1N9AA 5CBNA 1LD8A 5J90A 1NI1A 2BKGA 5G2NA 4FA6A 3MV3B 2OEVA 1UG3A 3Q4AB 3MZLB 4GMJA 3JUEA 1V55E 1IQUA 4JXTA 4NACA 5ENNA 5IY5E 3CHQA 2E2EA 4DX7D 4HRLA 1N95A 2EIME 2NC9A 2BEDA 3CHPA 3E30A 3KS2A 4JD2G 3G2WA 1V54E 4CGVA 4YDOA 3SD5A 3L13A 4F1SA 3Q78A 5KNHD 2IQCA 2Y4UA 3ASGA 2HM8A 1HXIA 3UM1A 2X6KA 3EHMA 3LYAA 4BWRA 3CVNA 2GW1A 3CHSA 2OEWA 2VJ8A 3V2OA 3FTWA 4HI9A 1D9SA 2Q7FA 4ANVA 4U63A 4BSZB 2LSVA 1ZBPA 4APFA 3FDHA 3SNXA 3PS6A 2JABA 4GZ6A 2DIWA 2DWZA 4AJWA 2B0OE 3NBNB 3TXNA 4AY5A 4R7LA 3SO8A 4I1MA 3ASFA 3CIAA 3PEUB 2KATA 5ITZF 4UWHA 3DXKG 3RJVA 4FULA 5ANRA 4L9PA 3TL5A 1AWCB 3JXIA 3LY8A 4ATZD 2VSXE 2IO2C 1MX6A 2P9PG 3MA5A 4DK5A 4JL0A 1N4PA 5B1BE 3ASOE 4MBGA 3ZYMA 3FWVA 4XI9A 3NOCD 3GYZA 4M3OA 5EDSA 3ZXPA 1MX4A 2XZTG 2CHWA 2WMOA 3DSSA 3FUEA 5HI7A 3JUIA 4MRUA 3FP3A 2H6GA 5G05C 1OWLA 3NZUA 1OXJA 1YA0A 3TG4A 2H6HA 3FEXA 2LAIA 4H7YA 4LUNU 3PUKA 3ZKJA 4WNFA 1YCSB 4RVBA 3FH7A 1H0AA 3TWQA 2F0YA 3HYMB 2M63A 2FI7A 1FPPA 5LCWC 3E37A 1OY3D 1AP7A 4APOA 5CEDB 1IQRA 1Z3YA 1QZ2A 4G24A 4GA0A 3JQ1A 3FU3A 3L17A 4GYWA 4YVQC 1LD7A 4BEPA 5BXOA 2H6IA 1EYHA 3RRNB 4AOFA 3CQCB 2JLBA 4ANUA 2WXFA 1KPSB 4AV7A 3IBEA 1S0PA 3PREA 3QC1A 2KM4A 5FQ6A 1U2VG 3ZHEA 2GRNB 5HS0A 5EIDA 3AS4A 3LCAA 2AJAA 5JMND 4I1OB 1S63A 2HYZA 5AENA 4BETA 1EDUA 3CK8A 3F6QA 3ONLA 1QNFA 1DCEA 2WB2A 3MGBA 4TXRA 5CERB 3SI5A 2PM6A 2QFCA 3QWVA 3PZ4A 3FUIA 2L6JA 1UJJA 3E33A 1B89A 3FUJA 4EQFA 2UY1A 3FUNA 3ZVVA 4GA1A 2L0IA 2X3MA 3UINC 4UQXA 3B7RL 2WXQA 3Q75A 4K0RA 4WNEA 4PDXA 3LDZA 3CVLA 1RZ4A 3GZSA 4OAUC 5CECB 5D0QD 1YMPA 3LVRE 3E34A 3O48A 1IXVA 3J5PA 3QWWA 3NF1A 3CK7A 3NB2A 1ELRA 3C3QA 2WVIA 2FO1E 3R9AB 3FEYA 2WXMA 5T4YA 1TNUA 4I2ZA 4JW1A 3LY7A 5CMWA 4FHJA 3V30A 4CRWA 3SBSA 2P9KG 3OTNA 3ESKA 2VTBA 5AAOA 1E90A 5LX8A 2FULA 3U3WA 2YQ8A 4RG6A 2WXHA 4L7TA 4Q69A 2J8SD 3FU5A 3EHNA 3CKBA 4A3TA 3TAXA 3RKVA 4BT8A 4GTTA 3L6AA 3VTYA 2V4LA 4WWNA 2EIKE 1PY1A 4BX9A 3MEKA 4GTOA 4GU5A 3PH0C 3MKRA 4KVOA 5G04C 2XS1A 3Q47B 4G26A 4J8DA 4JB8P 4CDRA 3BG1B 3DPDA 1EF1C 3KEAA 1OWOA 3UKRG 5BUZA 2VQ2A 1INZA 3ZPJA 3LS8A 2V8SE 3GZ1A 2CG2A 4KT6B 3TG5A 1HF8A 2P2CP 5FIOA 2XPZA 4JHKA 1A17A 4PH4B 3BUAA 3UMVA 4GMRA 4RG9A 4BY6A 1WDYA 3ISMC 3QB2A 5CHEE 4HRNA 4HOQA 2OV8A 3HVEB 4IULA 2AVPA 4J7WA 3APCA 2WXJA 3JCKC 4CDMA 1KT1A 3UIPC 1NL4A 3TWUA 3CSTA 2J08A 2YHCA 3ULYA 5FWQA 1TNOA 1O5MA 1WY6A 4E85A 3DSWA 3AG2E 2R59A 3IXEA 3ZUVB 4UWKA 5KJNA 2NXPA 4I1AA 3Q9UC 1HZ4A 4JA7A 3UUXA 3D9JA 2XGMA 1ZU2A 4LNBA 4ME2A 4K03A 3ESLA 5T8IA 2I1KA 3MKQA 3MCXA 4JZYA 2HE0A 3ABME 4U07A 4Q94A 4XEIG 4HOUA 4L1BA 4JEHA 3U64A 4G8LA 3GZ2A 5G55A 5BT1A 1K1AA 4UQYA 3FH8A 4WNDA 1IHBA 4LG6A 2FEZA 3URZA 1FT1A 3ZYKA 4A1SA 4F6RD 3DSUA 5JHBA 4LNUD 4XZ4A 3LY9A 2DYRE 2AXVA 1EPUA 5D66A 4BX8A 1OCCE 1TR4A 2F8XK 5FQ4A 4FLHA 4N3AA 3PRZA 2C2LA 2NYJA 3NAWA 5ENRD 1Z3XA 4N3CA 4OVUA 4C48B 5E75A 1FVFA 3HHMA 4B89A 4LERA 2J4BA 3EU9A 5BV0A 4KZCA 4LNGA 3PVLA 3FH5A 4KMOA 2WXRA 2PL2A 2FO7A 3ZYLA 1KZOA 4CCAA 1O1TA 4GTVA 3ULQA 3I4RB 3QAQA 4YDEA 2IF4A 2Y1LE 1DC2A 4ZHBA 3CVYA 1SW6A 4NIKA 2A5EA 2WXKA 4U0SA 4RQIA 3UIOC 3G2UA 2ONDA 3QNKA 2QYUA 4FP7A 2XS8A 3T8KA 3ZIMA 4HVBA 1JCRA 1U3DA 3AU4A 4CT0A 3ZHEB 2X6IA 1TN8A 1BPOA 4UWLA 3X2QE 4HORA 2J49A 5BW8C 3CHOA 3R9MA 4DI4A 4F53A 4NURA 1HO8A 2XRZA 4K5CA 3KD7A 1DCQA 5KJMA 4P29A 3KSLA 4C0EA 3UKUG 1DNPA 2E0IA 1ZB1A 4EZJA 5D0OD 5ENQD 2GRLA 2UY1B 3DBSA 1S70B 4G8KA 2OCCE 3HXEA 2Y3AA 2R5SA 3MV2B 4TXQA 2V4HC 4PUCA 5LP0A 2Y0BG 4Z68A 3Q79A 3AS5A 2ETAA 5G05J 5JA4D 4U8YD 2X6JA 1XNFA 2XEEA 3ZGQA 1KZPA 4J6IA 3FTXA 5ANLA 4GCNA 2F8YA 5FQ7A 3TJPA 3VTXA 2IY0C 1BD8A 2KZTA 2QYJA 5LCWJ 4HLLA 2RKKA 4Q96A 4DLOA 2IONA 2VTBB 3V31A 3UI2A 2CHZA 2XCBA 4IN3B 5JJTA 4CEMA 3IEGA 2IEJA 1WG0A 3TXMA 3FTYA 2ZISA 5BPPA 4LEUA 1HFAA 2V5FA 5FT9A 5CBOA 3LXUX 4HS2A 3W9GA 4DRXE 4BTBA 1DVPA 1E8ZA 4BERA 2OVFA 3RO2A 4HOSA 4J8YA 1OWNA 2DVWA 2J4DA 4IYPA 5FINA 2XZDG 5FZQA 4C9BB 4GYOA 4TV3A
chains in the Genus database with same CATH topology
4FC8A 2FULA 1WAO1 2Y4TA 4XIFA 4G25A 3U3WA 2YQ8A 2BUGA 4GPKA 4RG6A 4YVOA 4UI9C 1E8XA 2QY7A 2WXHA 3QDNA 4L7TA 5JJ6A 3UT7A 5FJYA 4L2LA 4Q69A 5LFAA 3FU5A 3AS8A 4UI9K 3IKOB 2RG8A 4KYOB 4CDNA 3HVEA 2CG3A 1H2VC 3EHNA 4ILIA 1JWGA 3CKBA 3ZEFA 4A3TA 2CHXA 4PS3A 5AIJA 1JUQA 4FHKA 4WAFA 4GZDA 3RKVA 3TAXA 4BT8A 3U9WA 5KJLA 2LAHA 4LRZA 2XGOA 3NZSA 3L6AA 3VTYA 2I6HA 2V4LA 2WQ6A 4WWNA 4CGWA 1KT0A 1PY1A 2LSUA 4BX9A 3UQ3A 2X6FA 2V0PA 3OXFA 4EZKA 2PZIA 2WQHA 3MEKA 4CT4A 1HG5A 4GU5A 2WXOA 3PH0C 3ASDA 3MKRA 4KVOA 4V3IA 4U0UA 2IOLA 5G04C 5T3RA 4XE0A 3UPVA 5A7DB 4I9EA 4D10C 2VSOE 2KCVA 5EX0A 3Q47B 4G26A 4J8DA 3OXGA 5DBKA 3L08A 2XPIA 5EX3A 4DPRA 4CDRA 3BG1B 1P5QA 2XHEA 2NSZA 3ZYQA 1UJKA 3DPDA 1EF1C 1OWOA 1NP7A 4I9CA 5BUZA 4MLPA 4DJAA 2VQ2A 2XCCA 1INZA 2WXIA 2WPVA 3N71A 3PNTB 3ZPJA 3I4GA 4FADA 3C98A 3LS8A 3AU5A 4FJYA 2P58C 2V8SE 2CFUA 3GZ1A 3CVVA 2DBAA 2CG2A 4KT6B 3S2AA 3TG5A 1HF8A 4U0ZA 3HIZA 2XPZA 3ML8A 3G2TA 3LKUA 3PEVB 1H2UA 1H6KA 4JHKA 1A17A 4PH4B 5M72A 2XRYA 3MX3A 2AXZA 2R17C 3CVWA 3UMVA 2OVBA 3IHYA 4RG9A 5AYWD 4B94A 4BY6A 4EECA 4HLEA 1N54A 2C0LA 3BEEA 3FTSA 3QB2A 5CHEE 4HOTA 3MKQB 4TUUA 4N2QA 4HOQA 5FZRA 4RSYA 2A5UA 2OV8A 2OOEA 4Y6WA 5CCMA 3HVEB 4IULA 2AVPA 4XKCA 1FCHA 3BG0B 3B7TA 3APCA 1U3CA 3LEWA 4UI9J 2X6HA 3B7UX 2WXJA 3EIJA 3JCKC 3P2BA 4CDMA 1KT1A 3FULA 5J90A 3OAWA 3S7JA 3EDTB 3CSTA 5G2NA 4FA6A 2J08A 3MV3B 4Y6CA 2YHCA 1UG3A 3P1UA 2LNIA 3Q4AB 5JHAA 3MZLB 4GMJA 1JPLA 5CMWA 3D9PA 1IQUA 1Z6TA 4JXTA 5FWQA 3EIQC 4FJZA 4NACA 2L0TB 4JHJA 2YHEA 1WY6A 4E85A 5ENNA 5A23A 1ELWA 1TEZA 3CHQA 2R59A 3OXLA 3L22A 3SGHA 3QJZA 2VSNA 2E2EA 1E96B 4UWKA 5KJNA 2NXPA 4I1AA 1MHQA 2NC9A 4ILHB 1HZ4A 3CHPA 3L16A 1WM5A 4JA7A 2LO6A 3UUXA 2BTDA 3KS2A 3D9JA 5ARFA 2XGMA 3G2WA 1E7VA 2J9QA 4FU3A 5G04J 4CGVA 1ZU2A 3L13A 1NZNA 4I6JA 3SD5A 4F1SA 4GZCA 4DLQA 4ME2A 3E4BA 3ESLA 4K03A 4UWGA 5T8IA 3SFZA 3ZN3A 2IQCA 2Y4UA 2I1KA 3ASGA 3MCXA 1GW6A 3MKQA 4JZYA 2HM8A 4AM9A 1HXIA 3CV0A 3RO3A 2X6KA 3D9LA 3EHMA 3EJNA 3LYAA 4BWRA 4U07A 4Q94A 4HOUA 4G11A 3CVNA 4L1BA 4JEHA 2GW1A 3U64A 3CHSA 3FUDA 2VJ8A 4I2WA 3FTWA 2XQ0A 3GZ2A 5G55A 2Q7FA 3S7FA 4ANVA 3FUMA 5BT1A 4JPSA 4J8EA 4UQYA 4U63A 3UT4A 2LSVA 2WXLA 3Q5MA 2KCLA 2WXPA 3FH8A 4J0UA 4G2VA 4WNDA 3WXXA 1ZBPA 4APFA 3FDHA 3SNXA 4EBAG 3IHVA 3D3MA 3MJWA 3PS6A 4GZ6A 2DIWA 4H7XA 4I6EA 3CVQA 3ML9A 4AVXA 4AJWA 5FTPA 1SZAA 3TGOA 3TXNA 4AY5A 2FEZA 3T8MA 3CLJA 3CHMA 3URZA 3NQPA 2C0MA 4R7LA 3ZYKA 4A1SA 3VLFA 2I9CA 1OUVA 4L23A 4I1MA 5JHBA 3ASFA 3G2SA 1OWMA 4A1GA 4XZ4A 3LY9A 5C1DA 2RD0A 2AXVA 1EPUA 3CIAA 2XGSA 3PEUB 4BX8A 2IU1A 2KATA 1OWPA 4UWHA 2BF0X 4I17A 2AW6A 4L2YA 2WMNA 5FQ4A 3RJVA 4ANWA 2KCKA 4FLHA 4N3AA 4ATGA 3PRZA 3D9KA 4FULA 5ANRA 2C2LA 3APDA 3FFLA 3TL5A 4BFRA 3LY8A 1Z3XA 4OYSA 2VSXE 3UT8A 4BSXA 1HG2A 3ZRHA 3D9NA 5LOZA 4N3CA 4GYOA 3MA5A 4ILGA 3FUHA 4JL0A 4OVUA 5E75A 5FQ8A 2MOWA 3FUFA 1FVFA 3HHMA 4B89A 3T5VA 2VGYA 4LERA 2X38A 4I6GA 4AP2A 4BT9A 4KVMA 1IYGA 1HH8A 4AXHA 3ZYMA 3FWVA 4AY6A 4B8AA 2J4BA 4DK5A 4XI9A 5BV0A 5BNWA 4KZCA 1TJFA 4GB9A 2L9BA 3PVLA 1NA0A 3B7SA 2YNQA 3GYZA 1SQMA 3FH5A 4M3OA 2J09A 5EDSA 2ILRA 4KMOA 2WXRA 5ARGA 2PL2A 3FU0A 2CHWA 3RRUA 1PC2A 4J8SA 2WMOA 3FUEA 5HI7A 3JUIA 3FTZA 4MRUA 2FO7A 2PQNA 3FP3A 3ZYLA 4CCAA 4EBAA 3APFA 4MS6A 1Y8MA 5G05C 1OWLA 4JHRA 3ENEA 3ULQA 1HE8A 3NZUA 4OVVA 2WQ7A 3I4RB 4IRUA 3QAQA 1YA0A 3TG4A 2IF4A 1X5BA 2KC7A 3S7BA 4G1TA 4GA2A 2AXUA 2XEVA 3CVYA 3FEXA 4U04A 2LAIA 2WXKA 4H7YA 1MQSA 4AIFA 4LUNU 3PUKA 3PZDA 4AEZC 4U0SA 4U8HA 4RVBA 4WNFA 3FH7A 1H0AA 4G23A 3G2UA 2ONDA 3QNKA 1E8WA 3CEQA 3HYMB 4ANXA 4FP7A 4O6FA 1N52A 4HVBA 3ZIMA 2M63A 1U3DA 3AU4A 4TV3A 5AJDA 3RRMB 3U4TA 4CT0A 3FHEA 4XKBA 1VDYA 3B13A 3ZHEB 3VLDA 2IJGX 2FI7A 2FBNA 5LCWC 3QARA 3O4ZA 2X6IA 5J08A 3Q49B 3I5PA 1BPOA 4UWLA 3CSFA 4QFVA 4HORA 2J49A 1TJCA 5BW8C 3CHOA 4WUYA 3GW4A 3CVPA 4N39A 4DI4A 4APOA 2UWJG 4GZ5A 1UW4B 4W9RA 4NURA 4F53A 1ELKA 1HO8A 1IQRA 1XGWA 2CFZA 1Z3YA 3QWPA 4KZ0A 4TRQA 2XRZA 2AWIA 4MKTA 4NQ0A 1QZ2A 2I1JA 3KD7A 4G24A 4GA0A 4UQZA 3JQ1A 4JC8A 3FU3A 3L17A 1Y6IA 4GYWA 3RK6A 4GZ3A 1PAQA 4YVQC 1JWFA 5KJMA 4P29A 4C0EA 4KXKB 1DNPA 4JVSA 2E0IA 4PS8A 3R7QA 1EYHA 4EZJA 3QOUA 5D0OD 3RRNB 2KZTB 4AOFA 3CQCB 2JLBA 3QK0A 1H2TC 3FUKA 2GRLA 2UY1B 3DBSA 5KJKA 4ANUA 3Q15A 2WXFA 5AJLA 1SZ9A 3CQGB 4AV7A 2I2OA 1LF8A 5C2YA 2VGXB 4ABNA 5HQ8A 3JYSA 1HX8A 1H19A 3PDNA 3IBEA 3CKCA 4ACKA 2Y3AA 1S0PA 2R5SA 2VYIA 3PREA 2HR2A 3QC1A 2KM4A 3MV2B 3PUJA 5FQ6A 4LCTA 5KCMA 4B0ZA 3KAEA 1IHGA 4PUCA 5LP0A 3ZHEA 4UWFA 3SF4A 1KLXA 3D9MA 3L54A 3AS4A 3CHRA 3AS5A 3LCAA 4F3VA 4EPZA 3K9IA 5G05J 2WXNA 2X6JA 1UN8A 2JEKA 4I1OB 3CR3A 1XNFA 3FU6A 2A4ZA 2HYZA 5FZSA 3ZGQA 3I3NA 5AENA 3CGHA 1EDUA 2J07A 3CK8A 3ONLA 2WM9A 3QKYA 4GYYA 4J6IA 2PQRA 1QNFA 3FTXA 1HS6A 5ANLA 3ZW3A 4GCNA 2FF4A 3UX4A 4N3BA 2WB2A 3MGBA 3KEZA 2WXGA 2HO1A 5FQ7A 4C0MA 4A55A 4DI3A 3SBTB 3SI5A 4HXIA 1E7UA 4GCOA 3D9OA 2PM6A 3ONKA 2QFCA 3TJPA 3QWVA 3VTXA 3FUIA 2KZTA 4N5CA 2L6JA 2MRIA 4FLBA 1UJJA 2GRMA 5LCWJ 1UN9A 1B89A 3FUJA 4F7AA 2IFUA 2UY1A 3FUNA 4EQFA 4Q96A 3ZVVA 4DLOA 2YINA 2VGXA 2IONA 2L0IA 2X3MA 4GA1A 5E76A 4UQXA 3B7RL 4EZLA 2WXQA 4K0RA 1E8YA 2VTBB 3G2VA 4WNEA 4PDXA 2CHZA 3D9IA 3CK9A 3LDZA 3CVLA 2XCBA 4IN3B 5JJTA 2IOSA 4CEMA 3LVQE 1W3BA 3GZSA 3FTUA 5A6CA 3RU0A 3IEGA 5D0QD 4GAAA 3HDXA 3PNLB 3U66A 4YNDA 3FY4A 2ZU6B 5CMYA 4GMLA 1L5JA 5JJ7A 3TXMA 3FTYA 2GGFA 4JEUA 4XI0A 3LVRE 1FVHA 3MYVA 4B8CB 3PE3A 4E6HA 5BPPA 1QQEA 3ZXSA 3CVUA 4LEUA 4WNGA 1HFAA 2VSYA 3O48A 2DCPA 2V5FA 5EKQD 5FT9A 3RIBA 3QWWA 3LXUX 3NF1A 3S7DA 1NA3A 3CK7A 4HS2A 1ELRA 2XPYA 2WVIA 3SHFA 4KBQA 4BTBA 1DVPA 1E8ZA 3CVXA 4A3VA 5CCLA 4HFGA 4N2SA 2OVFA 4BTAA 3PE4A 3R9AB 3LPZA 4J8FA 3RO2A 3T5XA 3FEYA 4URKA 4HOSA 2WXMA 5T4YA 2EQXA 3FTVA 3SZ7A 3ZFWA 2MHKA 4NRHB 3LJ3A 1OWNA 4I2ZA 4JW1A 3IV0A 3LY7A 4I43A 2J4DA 3JQ0A 4FHJA 4IYPA 4JA9A 3R7RA 3VLEA 4XX5A 3ASHA 5DIZA 4CRWA 4ACLA 3SBSA 2PM7A 3OTNA 4WWPA 4WWOA 1HU3A 3ESKA 5FZQA 5BV1A 2VTBA 4C9BB 1E90A 4PS7A 5LX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAO 1;  2Y4T A;  4XIF A;  4G25 A;  3U3W A;  2YQ8 A;  2BUG A;  4GPK A;  4RG6 A;  4YVO A;  4UI9 C;  3QDN A;  5JJ6 A;  5FJY A;  4UI9 K;  3AS8 A;  4KYO B;  3CKB A;  3TAX A;  3RKV A;  4BT8 A;  5KJL A;  2XGO A;  3VTY A;  2I6H A;  4CGW A;  1KT0 A;  2LSU A;  3UQ3 A;  3OXF A;  2PZI A;  2WQH A;  3MEK A;  3ASD A;  3MKR A;  4U0U A;  5G04 C;  3UPV A;  5A7D B;  4I9E A;  2KCV A;  5EX0 A;  3Q47 B;  4G26 A;  4J8D A;  3OXG A;  5DBK A;  2XPI A;  5EX3 A;  4CDR A;  1P5Q A;  4I9C A;  2VQ2 A;  2XCC A;  2WPV A;  3N71 A;  3ZPJ A;  2P58 C;  3GZ1 A;  2DBA A;  3TG5 A;  4U0Z A;  3LKU A;  1A17 A;  5M72 A;  4B94 A;  4RG9 A;  5AYW D;  2C0L A;  3BEE A;  5CHE E;  4HOT A;  4N2Q A;  4HOQ A;  5FZR A;  2OOE A;  4Y6W A;  5CCM A;  2AVP A;  1FCH A;  4UI9 J;  1KT1 A;  3S7J A;  3EDT B;  3MV3 B;  4Y6C A;  2YHC A;  3Q4A B;  2LNI A;  1ELW A;  3OXL A;  2VSN A;  2E2E A;  1E96 B;  5KJN A;  4I1A A;  2NC9 A;  1HZ4 A;  1WM5 A;  4JA7 A;  3UUX A;  3KS2 A;  5ARF A;  2XGM A;  2J9Q A;  5G04 J;  4CGV A;  1ZU2 A;  1NZN A;  4ME2 A;  3E4B A;  3ZN3 A;  2Y4U A;  3ASG A;  4AM9 A;  1HXI A;  3CV0 A;  3RO3 A;  4BWR A;  3LYA A;  4U07 A;  4HOU A;  3CVN A;  2GW1 A;  4I2W A;  3GZ2 A;  2Q7F A;  3S7F A;  5BT1 A;  4J8E A;  4UQY A;  2LSV A;  3Q5M A;  2KCL A;  4J0U A;  4G2V A;  4WND A;  3WXX A;  1ZBP A;  4GZ6 A;  4H7X A;  3CVQ A;  5FTP A;  3TGO A;  4AY5 A;  2FEZ A;  3URZ A;  2C0M A;  4A1S A;  1OUV A;  3ASF A;  3LY9 A;  5C1D A;  2XGS A;  2KAT A;  4I17 A;  3RJV A;  2KCK A;  4N3A A;  2C2L A;  3FFL A;  3LY8 A;  4N3C A;  3MA5 A;  4JL0 A;  2VGY A;  1IYG A;  4BT9 A;  1HH8 A;  3FWV A;  4AY6 A;  4XI9 A;  5BNW A;  1NA0 A;  3GYZ A;  5ARG A;  2PL2 A;  1PC2 A;  5HI7 A;  2FO7 A;  2PQN A;  3FP3 A;  1Y8M A;  5G05 C;  4JHR A;  3ULQ A;  1YA0 A;  3TG4 A;  2IF4 A;  2KC7 A;  3S7B A;  4G1T A;  4GA2 A;  2XEV A;  4U04 A;  4H7Y A;  4AIF A;  4U0S A;  4WNF A;  4G23 A;  2OND A;  3CEQ A;  3HYM B;  4O6F A;  3U4T A;  3ZHE B;  2FI7 A;  2FBN A;  5LCW C;  3Q49 B;  4HOR A;  1TJC A;  5BW8 C;  4WUY A;  3GW4 A;  3CVP A;  4N39 A;  4APO A;  2UWJ G;  4GZ5 A;  4W9R A;  3QWP A;  4NQ0 A;  1QZ2 A;  3KD7 A;  4G24 A;  4GA0 A;  4UQZ A;  4GYW A;  4GZ3 A;  4YVQ C;  5KJM A;  4KXK B;  3QOU A;  5D0O D;  2JLB A;  5KJK A;  2UY1 B;  3Q15 A;  4ABN A;  2VGX B;  5HQ8 A;  3JYS A;  3PDN A;  3CKC A;  2R5S A;  2VYI A;  2HR2 A;  3MV2 B;  3KAE A;  1IHG A;  3ZHE A;  3SF4 A;  1KLX A;  3AS4 A;  3AS5 A;  3LCA A;  4F3V A;  3K9I A;  5G05 J;  1XNF A;  5FZS A;  2HYZ A;  3ZGQ A;  4GYY A;  3CK8 A;  3QKY A;  2PQR A;  4GCN A;  2FF4 A;  4N3B A;  2HO1 A;  4GCO A;  2QFC A;  3QWV A;  3VTX A;  4N5C A;  2L6J A;  5LCW J;  1B89 A;  2IFU A;  2UY1 A;  4EQF A;  2VGX A;  4GA1 A;  4UQX A;  4WNE A;  3CK9 A;  3CVL A;  2XCB A;  4IN3 B;  5JJT A;  1W3B A;  5A6C A;  3RU0 A;  3IEG A;  5D0Q D;  4YND A;  5JJ7 A;  4XI0 A;  3PE3 A;  1QQE A;  4LEU A;  4WNG A;  2VSY A;  3O48 A;  2V5F A;  5EKQ D;  5FT9 A;  3RIB A;  3QWW A;  3NF1 A;  3S7D A;  1NA3 A;  3CK7 A;  1ELR A;  4KBQ A;  4BTB A;  5CCL A;  4N2S A;  4BTA A;  3PE4 A;  3R9A B;  3LPZ A;  4J8F A;  3RO2 A;  4HOS A;  3SZ7 A;  3ZFW A;  2MHK A;  4NRH B;  4I2Z A;  3LY7 A;  4JA9 A;  3ASH A;  5DIZ A;  3ESK A;  5FZQ A;  4GYO A; 
#chains in the Genus database with same CATH topology
 4GPK A;  3UT7 A;  2RG8 A;  3NOG D;  4N5Q A;  2CG3 A;  3PZ1 A;  2CHX A;  3UM3 A;  3TWT A;  4FHK A;  4WAF A;  3WG7 E;  3U9W A;  2LAH A;  2XGO A;  4DUI A;  1MX2 A;  1QBQ A;  3NZS A;  3UTM A;  2V0P A;  2XEN A;  4CT4 A;  1HG5 A;  5BXU A;  5ENS D;  3AG3 E;  3E32 A;  5A7D B;  4D10 C;  1N11 A;  3OXG A;  4DPR A;  1P5Q A;  2XHE A;  2NSZ A;  1NP7 A;  1TNZ A;  2WPV A;  3PNT B;  4DX1 A;  2IO3 C;  3AU5 A;  2P58 C;  1LTX A;  3CVV A;  4HRM B;  2RFA A;  4U0Z A;  3ML8 A;  5HKP A;  3G2T A;  3PEV B;  5M72 A;  2XRY A;  2R2L A;  5ENO D;  3CVW A;  1H6O A;  5AQ7 A;  1N54 A;  2C0L A;  3FTS A;  2ZXW E;  3RSE G;  3MKQ B;  3DSV A;  5FZR A;  4DX2 A;  5HRY A;  4O1P A;  4XKC A;  1FCH A;  3B7T A;  2X6H A;  2ETB A;  2GRQ B;  5JHA A;  1JPL A;  4BES A;  3D9P A;  1Z6T A;  3EIQ C;  5AAR A;  5A23 A;  2V5Q C;  3L22 A;  4GTS A;  3QJZ A;  2P9I G;  1MHQ A;  4ILH B;  1WM5 A;  5EYP F;  2J9Q A;  5G04 J;  1NZN A;  3ABL E;  4DLQ A;  4UWG A;  5CEA A;  3UM2 A;  1GW6 A;  4AM9 A;  3CV0 A;  3D9L A;  1TN6 A;  1OCO E;  3S7F A;  4JPS A;  4J8E A;  2WXP A;  4J0U A;  5AQB A;  4G2V A;  3AG4 E;  3IHV A;  3D3M A;  3CVQ A;  3ML9 A;  5FTP A;  1SZA A;  2H6F A;  3T8M A;  3CLJ A;  2C0M A;  2I9C A;  1OUV A;  4L23 A;  4A1G A;  3C5R A;  5C1D A;  2RD0 A;  2XGS A;  2IU1 A;  3B7B A;  3LJN A;  4I17 A;  2AW6 A;  2WMN A;  2GRP B;  3BQO A;  3D9K A;  3APD A;  3FFL A;  3UT8 A;  3FUH A;  5EIL A;  2MOW A;  3T5V A;  2VGY A;  4BT9 A;  4KVM A;  1HH8 A;  1OT8 A;  1BI8 B;  4B8A A;  1SA4 A;  3AAA C;  1NA0 A;  3B7S A;  2YNQ A;  2J09 A;  5ARG A;  3HXC A;  3C3O A;  3FTZ A;  4EBA A;  3APF A;  4MS6 A;  1Y8M A;  2WQ7 A;  1MYO A;  4IRU A;  1TN7 A;  1TYQ G;  2KC7 A;  3S7B A;  2AXU A;  3TWR A;  4U04 A;  4AIF A;  3PZD A;  4G23 A;  4ANX A;  4O6F A;  4K5B A;  3U4T A;  4XKB A;  3VLD A;  2IJG X;  3O4Z A;  5J08 A;  1TJC A;  4WUY A;  3GW4 A;  3CVP A;  2UWJ G;  4GZ5 A;  1UW4 B;  4W9R A;  1ELK A;  3QWP A;  5CRU A;  2CFZ A;  4MKT A;  4NQ0 A;  1RW2 A;  2I1J A;  3DST A;  1Y6I A;  3R7Q A;  3QOU A;  2KZT B;  3QK0 A;  2EIJ E;  4U96 D;  3Q15 A;  3SY2 A;  3CQG B;  2I2O A;  3JYS A;  1H19 A;  4ACK A;  3CKC A;  1N4Q A;  2RFM A;  3PUJ A;  4B0Z A;  4LCT A;  3KAE A;  1Q2Z A;  2GRR B;  4K5A B;  3HXD A;  3CHR A;  4F3V A;  2WXN A;  1UN8 A;  3CR3 A;  2A4Z A;  5FZS A;  2LXM A;  3I3N A;  3CGH A;  4GYY A;  1QYM A;  2ZGD A;  3UX4 A;  4N3B A;  3KEZ A;  2WXG A;  2HO1 A;  3DWL G;  4C0M A;  4DI3 A;  3SBT B;  4GCO A;  3ONK A;  3JXJ A;  3ABK E;  3HG0 D;  4N5C A;  2MRI A;  4FLB A;  2GRM A;  4F7A A;  2VGX A;  1K1B A;  3D9I A;  2IOS A;  3FTU A;  3RU0 A;  4GAA A;  3HDX A;  4GTQ A;  1A5E A;  3PNL B;  3U66 A;  4YND A;  1NFI E;  2ZU6 B;  4GML A;  1L5J A;  5JJ7 A;  2GGF A;  4JEU A;  3MYV A;  3PE3 A;  1QQE A;  3CVU A;  4WNG A;  2VSY A;  2DCP A;  5EKQ D;  4F1P A;  2B6C A;  3S7D A;  1NA3 A;  2XPY A;  4KBQ A;  2VGE A;  1N94 A;  4HFG A;  5CCL A;  4N2S A;  3PE4 A;  3LPZ A;  3ASN E;  4URK A;  2F37 A;  3FTV A;  2MHK A;  3IV0 A;  4I43 A;  3JQ0 A;  3VLE A;  3ASH A;  4ACL A;  1D8D A;  2PM7 A;  4WWP A;  5BV1 A;  2BUG A;  4UI9 C;  3QDN A;  5JJ6 A;  5FJY A;  4L2L A;  5LFA A;  4X8Q A;  4UI9 K;  3AS8 A;  5KWD A;  1BU9 A;  4KYO B;  4CDN A;  3HVE A;  3AG1 E;  1H2V C;  1YYH A;  1JWG A;  3C72 A;  5KJL A;  5AN8 A;  1K3Z D;  2LXL A;  4LRZ A;  1O1R A;  1JCQ A;  3DEP A;  1KT0 A;  2LSU A;  3UQ3 A;  3OXF A;  4EZK A;  2WQH A;  2Y69 E;  3ULE G;  3ASD A;  4OAV B;  4U0U A;  2IOL A;  5T3R A;  4XE0 A;  3SFX A;  3UPV A;  2R03 A;  4I9E A;  5EX0 A;  5DBK A;  3L08 A;  2XPI A;  5EX3 A;  4CYM D;  5ENT D;  3V79 K;  1UJK A;  2DZN A;  2MYO A;  4DJA A;  4RLY A;  1UOH A;  3AJI A;  3S2A A;  1H2U A;  1H6K A;  3D9H A;  2AXZ A;  2R17 C;  5KBA A;  2OVB A;  3IHY A;  3BEE A;  5AQ9 A;  4TUU A;  4RSY A;  2OOE A;  5EN5 D;  3BG0 B;  1U3C A;  3B7U X;  3EIJ A;  2DZO A;  4U7E B;  3FUL A;  3OAW A;  3S7J A;  3EDT B;  4Y6C A;  4GTP A;  1D8E A;  2P9N G;  2LNI A;  3P1U A;  3SFY A;  2GRO B;  3L9T A;  4FJZ A;  2L0T B;  4JHJ A;  2YHE A;  1TEZ A;  1ELW A;  4O1O A;  3OXL A;  3SGH A;  2VSN A;  1E96 B;  4TXP A;  3L16 A;  2LO6 A;  2BTD A;  2KXP C;  5ARF A;  4FU3 A;  1E7V A;  4I6J A;  4GZC A;  3SQV A;  3E4B A;  3SFZ A;  1G3N B;  3ZN3 A;  3V2X A;  3TWV A;  3RO3 A;  3EJN A;  4DX5 D;  4G11 A;  4GPM A;  3FUD A;  4I2W A;  2R02 A;  2XQ0 A;  4HNA D;  3FUM A;  3B95 A;  3UT4 A;  2WXL A;  3Q5M A;  2KCL A;  3L82 A;  3WXX A;  2PNN A;  1N4S A;  4EBA G;  3MJW A;  4H7X A;  4I6E A;  4YDY A;  4HI8 A;  4AVX A;  3TGO A;  3CHM A;  3NQP A;  3VLF A;  4LSZ E;  2XEH A;  3G2S A;  1OWM A;  5EIB E;  1O1S A;  2R05 A;  3T9K A;  1OWP A;  2QZA A;  2BF0 X;  4L2Y A;  4ANW A;  2KCK A;  4ATG A;  4BFR A;  4OYS A;  3TWW A;  4U8V D;  4BSX A;  1HG2 A;  3ZRH A;  3D9N A;  5LOZ A;  4ILG A;  5FQ8 A;  3FUF A;  3RAU A;  3EUV A;  2X38 A;  4I6G A;  4AP2 A;  1IYG A;  4AXH A;  4AY6 A;  4HB5 A;  5BNW A;  1TJF A;  4GB9 A;  2L9B A;  4DX6 D;  1SQM A;  2ILR A;  3FU0 A;  3PZ3 A;  3RRU A;  1PC2 A;  4J8S A;  1OCZ E;  2PQN A;  1Z5S C;  1BI7 B;  4JHR A;  3ENE A;  1HE8 A;  4OVV A;  1X5B A;  4G1T A;  4GA2 A;  1MZC A;  2XEV A;  1MQS A;  5AQA A;  3UM0 A;  4AEZ C;  4U8H A;  4ZFH A;  1TNY A;  2KBX A;  5ENP D;  1E8W A;  3CEQ A;  1N52 A;  3C3R A;  2P9U G;  5AJD A;  3RRM B;  3FHE A;  1VDY A;  3B13 A;  5EYL A;  2FBN A;  3QAR A;  3Q49 B;  2L6B A;  3I5P A;  3CSF A;  4QFV A;  4N39 A;  1BLX B;  4B93 B;  1K8K G;  3KSQ A;  4TUM A;  1XGW A;  4KZ0 A;  4TRQ A;  3TWS A;  2AWI A;  4A63 B;  4UQZ A;  4JC8 A;  3EU5 A;  3RK6 A;  2P9S G;  4GZ3 A;  1PAQ A;  5B1A E;  1FT2 A;  1JWF A;  3TWX A;  4KXK B;  4JVS A;  4PS8 A;  4HQD A;  5H7P A;  3Q73 A;  1H2T C;  3FUK A;  5KJK A;  5AJL A;  4GTR A;  1SZ9 A;  1LF8 A;  5C2Y A;  2VGX B;  4ABN A;  5HQ8 A;  1HX8 A;  3PDN A;  2VYI A;  1TNB A;  2HR2 A;  5KCM A;  1SVX A;  1IHG A;  2ETC A;  4UWF A;  3SF4 A;  1KLX A;  1S64 A;  3D9M A;  3L54 A;  1N0Q A;  3DSX A;  4EPZ A;  3K9I A;  3BU8 A;  2JEK A;  3FU6 A;  2J07 A;  2WM9 A;  3QKY A;  1X81 A;  2PQR A;  3ZW3 A;  1HS6 A;  3HXF A;  2FF4 A;  3PZ2 A;  4CZ2 D;  4A55 A;  3HRA A;  4HXI A;  1E7U A;  3D9O A;  1IKN D;  5D2M C;  1H6P A;  2BKK B;  2ZGG A;  1UN9 A;  2QC9 A;  2IFU A;  2YIN A;  5E76 A;  4EZL A;  1E8Y A;  3Q7F A;  3G2V A;  3CK9 A;  2LUH A;  3LVQ E;  1W3B A;  5A6C A;  3FY4 A;  5CMY A;  4QQI A;  2P9L G;  4XI0 A;  4EHM A;  1FVH A;  4B8C B;  4E6H A;  3ZXS A;  4UUC A;  1OCR E;  3RIB A;  3SHF A;  4U95 D;  3CVX A;  4A3V A;  3EHR A;  4BTA A;  4J8F A;  3T5X A;  2EQX A;  3SZ7 A;  3ZFW A;  4NRH B;  3LJ3 A;  2EIL E;  3J5Q B;  4JA9 A;  3R7R A;  1N0R A;  4XX5 A;  2ZIR A;  5DIZ A;  2EIN E;  4HBD A;  4WWO A;  1HU3 A;  4PS7 A;  4FC8 A;  1WAO 1;  2Y4T A;  4XIF A;  4G25 A;  3HXB A;  4YVO A;  3ZU7 B;  1E8X A;  2QY7 A;  3IKO B;  3EHQ A;  4ILI A;  3ZEF A;  4PS3 A;  3W9F A;  5AIJ A;  1JUQ A;  4GZD A;  2I6H A;  2WQ6 A;  5B3S E;  4CGW A;  1MJ0 A;  2X6F A;  2PZI A;  1JCS A;  2WXO A;  4YDW A;  4V3I A;  2VSO E;  2KCV A;  3DEO A;  4M7C A;  3ZYQ A;  4I9C A;  4MLP A;  2XCC A;  2WXI A;  3N71 A;  3DRA A;  3I4G A;  3UXG A;  4FAD A;  3C98 A;  4FJY A;  5CRV A;  5KNG A;  2CFU A;  3ZNG A;  2DBA A;  3HIZ A;  3LKU A;  3Q7A A;  3MX3 A;  1N4R A;  4O60 A;  4B94 A;  5AYW D;  4EEC A;  4HLE A;  1SA5 A;  2DYS E;  4HOT A;  3DPY A;  4N2Q A;  2A5U A;  4Y6W A;  5CCM A;  3LEW A;  4UI9 J;  4GTM A;  3DXM G;  3Q9N C;  3P2B A;  1N9A A;  5CBN A;  1LD8 A;  5J90 A;  1NI1 A;  2BKG A;  5G2N A;  4FA6 A;  3MV3 B;  2OEV A;  1UG3 A;  3Q4A B;  3MZL B;  4GMJ A;  3JUE A;  1V55 E;  1IQU A;  4JXT A;  4NAC A;  5ENN A;  5IY5 E;  3CHQ A;  2E2E A;  4DX7 D;  4HRL A;  1N95 A;  2EIM E;  2NC9 A;  2BED A;  3CHP A;  3E30 A;  3KS2 A;  4JD2 G;  3G2W A;  1V54 E;  4CGV A;  4YDO A;  3SD5 A;  3L13 A;  4F1S A;  3Q78 A;  5KNH D;  2IQC A;  2Y4U A;  3ASG A;  2HM8 A;  1HXI A;  3UM1 A;  2X6K A;  3EHM A;  3LYA A;  4BWR A;  3CVN A;  2GW1 A;  3CHS A;  2OEW A;  2VJ8 A;  3V2O A;  3FTW A;  4HI9 A;  1D9S A;  2Q7F A;  4ANV A;  4U63 A;  4BSZ B;  2LSV A;  1ZBP A;  4APF A;  3FDH A;  3SNX A;  3PS6 A;  2JAB A;  4GZ6 A;  2DIW A;  2DWZ A;  4AJW A;  2B0O E;  3NBN B;  3TXN A;  4AY5 A;  4R7L A;  3SO8 A;  4I1M A;  3ASF A;  3CIA A;  3PEU B;  2KAT A;  5ITZ F;  4UWH A;  3DXK G;  3RJV A;  4FUL A;  5ANR A;  4L9P A;  3TL5 A;  1AWC B;  3JXI A;  3LY8 A;  4ATZ D;  2VSX E;  2IO2 C;  1MX6 A;  2P9P G;  3MA5 A;  4DK5 A;  4JL0 A;  1N4P A;  5B1B E;  3ASO E;  4MBG A;  3ZYM A;  3FWV A;  4XI9 A;  3NOC D;  3GYZ A;  4M3O A;  5EDS A;  3ZXP A;  1MX4 A;  2XZT G;  2CHW A;  2WMO A;  3DSS A;  3FUE A;  5HI7 A;  3JUI A;  4MRU A;  3FP3 A;  2H6G A;  5G05 C;  1OWL A;  3NZU A;  1OXJ A;  1YA0 A;  3TG4 A;  2H6H A;  3FEX A;  2LAI A;  4H7Y A;  4LUN U;  3PUK A;  3ZKJ A;  4WNF A;  1YCS B;  4RVB A;  3FH7 A;  1H0A A;  3TWQ A;  2F0Y A;  3HYM B;  2M63 A;  2FI7 A;  1FPP A;  5LCW C;  3E37 A;  1OY3 D;  1AP7 A;  4APO A;  5CED B;  1IQR A;  1Z3Y A;  1QZ2 A;  4G24 A;  4GA0 A;  3JQ1 A;  3FU3 A;  3L17 A;  4GYW A;  4YVQ C;  1LD7 A;  4BEP A;  5BXO A;  2H6I A;  1EYH A;  3RRN B;  4AOF A;  3CQC B;  2JLB A;  4ANU A;  2WXF A;  1KPS B;  4AV7 A;  3IBE A;  1S0P A;  3PRE A;  3QC1 A;  2KM4 A;  5FQ6 A;  1U2V G;  3ZHE A;  2GRN B;  5HS0 A;  5EID A;  3AS4 A;  3LCA A;  2AJA A;  5JMN D;  4I1O B;  1S63 A;  2HYZ A;  5AEN A;  4BET A;  1EDU A;  3CK8 A;  3F6Q A;  3ONL A;  1QNF A;  1DCE A;  2WB2 A;  3MGB A;  4TXR A;  5CER B;  3SI5 A;  2PM6 A;  2QFC A;  3QWV A;  3PZ4 A;  3FUI A;  2L6J A;  1UJJ A;  3E33 A;  1B89 A;  3FUJ A;  4EQF A;  2UY1 A;  3FUN A;  3ZVV A;  4GA1 A;  2L0I A;  2X3M A;  3UIN C;  4UQX A;  3B7R L;  2WXQ A;  3Q75 A;  4K0R A;  4WNE A;  4PDX A;  3LDZ A;  3CVL A;  1RZ4 A;  3GZS A;  4OAU C;  5CEC B;  5D0Q D;  1YMP A;  3LVR E;  3E34 A;  3O48 A;  1IXV A;  3J5P A;  3QWW A;  3NF1 A;  3CK7 A;  3NB2 A;  1ELR A;  3C3Q A;  2WVI A;  2FO1 E;  3R9A B;  3FEY A;  2WXM A;  5T4Y A;  1TNU A;  4I2Z A;  4JW1 A;  3LY7 A;  5CMW A;  4FHJ A;  3V30 A;  4CRW A;  3SBS A;  2P9K G;  3OTN A;  3ESK A;  2VTB A;  5AAO A;  1E90 A;  5LX8 A;  2FUL A;  3U3W A;  2YQ8 A;  4RG6 A;  2WXH A;  4L7T A;  4Q69 A;  2J8S D;  3FU5 A;  3EHN A;  3CKB A;  4A3T A;  3TAX A;  3RKV A;  4BT8 A;  4GTT A;  3L6A A;  3VTY A;  2V4L A;  4WWN A;  2EIK E;  1PY1 A;  4BX9 A;  3MEK A;  4GTO A;  4GU5 A;  3PH0 C;  3MKR A;  4KVO A;  5G04 C;  2XS1 A;  3Q47 B;  4G26 A;  4J8D A;  4JB8 P;  4CDR A;  3BG1 B;  3DPD A;  1EF1 C;  3KEA A;  1OWO A;  3UKR G;  5BUZ A;  2VQ2 A;  1INZ A;  3ZPJ A;  3LS8 A;  2V8S E;  3GZ1 A;  2CG2 A;  4KT6 B;  3TG5 A;  1HF8 A;  2P2C P;  5FIO A;  2XPZ A;  4JHK A;  1A17 A;  4PH4 B;  3BUA A;  3UMV A;  4GMR A;  4RG9 A;  4BY6 A;  1WDY A;  3ISM C;  3QB2 A;  5CHE E;  4HRN A;  4HOQ A;  2OV8 A;  3HVE B;  4IUL A;  2AVP A;  4J7W A;  3APC A;  2WXJ A;  3JCK C;  4CDM A;  1KT1 A;  3UIP C;  1NL4 A;  3TWU A;  3CST A;  2J08 A;  2YHC A;  3ULY A;  5FWQ A;  1TNO A;  1O5M A;  1WY6 A;  4E85 A;  3DSW A;  3AG2 E;  2R59 A;  3IXE A;  3ZUV B;  4UWK A;  5KJN A;  2NXP A;  4I1A A;  3Q9U C;  1HZ4 A;  4JA7 A;  3UUX A;  3D9J A;  2XGM A;  1ZU2 A;  4LNB A;  4ME2 A;  4K03 A;  3ESL A;  5T8I A;  2I1K A;  3MKQ A;  3MCX A;  4JZY A;  2HE0 A;  3ABM E;  4U07 A;  4Q94 A;  4XEI G;  4HOU A;  4L1B A;  4JEH A;  3U64 A;  4G8L A;  3GZ2 A;  5G55 A;  5BT1 A;  1K1A A;  4UQY A;  3FH8 A;  4WND A;  1IHB A;  4LG6 A;  2FEZ A;  3URZ A;  1FT1 A;  3ZYK A;  4A1S A;  4F6R D;  3DSU A;  5JHB A;  4LNU D;  4XZ4 A;  3LY9 A;  2DYR E;  2AXV A;  1EPU A;  5D66 A;  4BX8 A;  1OCC E;  1TR4 A;  2F8X K;  5FQ4 A;  4FLH A;  4N3A A;  3PRZ A;  2C2L A;  2NYJ A;  3NAW A;  5ENR D;  1Z3X A;  4N3C A;  4OVU A;  4C48 B;  5E75 A;  1FVF A;  3HHM A;  4B89 A;  4LER A;  2J4B A;  3EU9 A;  5BV0 A;  4KZC A;  4LNG A;  3PVL A;  3FH5 A;  4KMO A;  2WXR A;  2PL2 A;  2FO7 A;  3ZYL A;  1KZO A;  4CCA A;  1O1T A;  4GTV A;  3ULQ A;  3I4R B;  3QAQ A;  4YDE A;  2IF4 A;  2Y1L E;  1DC2 A;  4ZHB A;  3CVY A;  1SW6 A;  4NIK A;  2A5E A;  2WXK A;  4U0S A;  4RQI A;  3UIO C;  3G2U A;  2OND A;  3QNK A;  2QYU A;  4FP7 A;  2XS8 A;  3T8K A;  3ZIM A;  4HVB A;  1JCR A;  1U3D A;  3AU4 A;  4CT0 A;  3ZHE B;  2X6I A;  1TN8 A;  1BPO A;  4UWL A;  3X2Q E;  4HOR A;  2J49 A;  5BW8 C;  3CHO A;  3R9M A;  4DI4 A;  4F53 A;  4NUR A;  1HO8 A;  2XRZ A;  4K5C A;  3KD7 A;  1DCQ A;  5KJM A;  4P29 A;  3KSL A;  4C0E A;  3UKU G;  1DNP A;  2E0I A;  1ZB1 A;  4EZJ A;  5D0O D;  5ENQ D;  2GRL A;  2UY1 B;  3DBS A;  1S70 B;  4G8K A;  2OCC E;  3HXE A;  2Y3A A;  2R5S A;  3MV2 B;  4TXQ A;  2V4H C;  4PUC A;  5LP0 A;  2Y0B G;  4Z68 A;  3Q79 A;  3AS5 A;  2ETA A;  5G05 J;  5JA4 D;  4U8Y D;  2X6J A;  1XNF A;  2XEE A;  3ZGQ A;  1KZP A;  4J6I A;  3FTX A;  5ANL A;  4GCN A;  2F8Y A;  5FQ7 A;  3TJP A;  3VTX A;  2IY0 C;  1BD8 A;  2KZT A;  2QYJ A;  5LCW J;  4HLL A;  2RKK A;  4Q96 A;  4DLO A;  2ION A;  2VTB B;  3V31 A;  3UI2 A;  2CHZ A;  2XCB A;  4IN3 B;  5JJT A;  4CEM A;  3IEG A;  2IEJ A;  1WG0 A;  3TXM A;  3FTY A;  2ZIS A;  5BPP A;  4LEU A;  1HFA A;  2V5F A;  5FT9 A;  5CBO A;  3LXU X;  4HS2 A;  3W9G A;  4DRX E;  4BTB A;  1DVP A;  1E8Z A;  4BER A;  2OVF A;  3RO2 A;  4HOS A;  4J8Y A;  1OWN A;  2DVW A;  2J4D A;  4IYP A;  5FIN A;  2XZD G;  5FZQ A;  4C9B B;  4GYO A;  4TV3 A; 
#chains in the Genus database with same CATH homology
 4FC8 A;  2FUL A;  1WAO 1;  2Y4T A;  4XIF A;  4G25 A;  3U3W A;  2YQ8 A;  2BUG A;  4GPK A;  4RG6 A;  4YVO A;  4UI9 C;  1E8X A;  2QY7 A;  2WXH A;  3QDN A;  4L7T A;  5JJ6 A;  3UT7 A;  5FJY A;  4L2L A;  4Q69 A;  5LFA A;  3FU5 A;  3AS8 A;  4UI9 K;  3IKO B;  2RG8 A;  4KYO B;  4CDN A;  3HVE A;  2CG3 A;  1H2V C;  3EHN A;  4ILI A;  1JWG A;  3CKB A;  3ZEF A;  4A3T A;  2CHX A;  4PS3 A;  5AIJ A;  1JUQ A;  4FHK A;  4WAF A;  4GZD A;  3RKV A;  3TAX A;  4BT8 A;  3U9W A;  5KJL A;  2LAH A;  4LRZ A;  2XGO A;  3NZS A;  3L6A A;  3VTY A;  2I6H A;  2V4L A;  2WQ6 A;  4WWN A;  4CGW A;  1KT0 A;  1PY1 A;  2LSU A;  4BX9 A;  3UQ3 A;  2X6F A;  2V0P A;  3OXF A;  4EZK A;  2PZI A;  2WQH A;  3MEK A;  4CT4 A;  1HG5 A;  4GU5 A;  2WXO A;  3PH0 C;  3ASD A;  3MKR A;  4KVO A;  4V3I A;  4U0U A;  2IOL A;  5G04 C;  5T3R A;  4XE0 A;  3UPV A;  5A7D B;  4I9E A;  4D10 C;  2VSO E;  2KCV A;  5EX0 A;  3Q47 B;  4G26 A;  4J8D A;  3OXG A;  5DBK A;  3L08 A;  2XPI A;  5EX3 A;  4DPR A;  4CDR A;  3BG1 B;  1P5Q A;  2XHE A;  2NSZ A;  3ZYQ A;  1UJK A;  3DPD A;  1EF1 C;  1OWO A;  1NP7 A;  4I9C A;  5BUZ A;  4MLP A;  4DJA A;  2VQ2 A;  2XCC A;  1INZ A;  2WXI A;  2WPV A;  3N71 A;  3PNT B;  3ZPJ A;  3I4G A;  4FAD A;  3C98 A;  3LS8 A;  3AU5 A;  4FJY A;  2P58 C;  2V8S E;  2CFU A;  3GZ1 A;  3CVV A;  2DBA A;  2CG2 A;  4KT6 B;  3S2A A;  3TG5 A;  1HF8 A;  4U0Z A;  3HIZ A;  2XPZ A;  3ML8 A;  3G2T A;  3LKU A;  3PEV B;  1H2U A;  1H6K A;  4JHK A;  1A17 A;  4PH4 B;  5M72 A;  2XRY A;  3MX3 A;  2AXZ A;  2R17 C;  3CVW A;  3UMV A;  2OVB A;  3IHY A;  4RG9 A;  5AYW D;  4B94 A;  4BY6 A;  4EEC A;  4HLE A;  1N54 A;  2C0L A;  3BEE A;  3FTS A;  3QB2 A;  5CHE E;  4HOT A;  3MKQ B;  4TUU A;  4N2Q A;  4HOQ A;  5FZR A;  4RSY A;  2A5U A;  2OV8 A;  2OOE A;  4Y6W A;  5CCM A;  3HVE B;  4IUL A;  2AVP A;  4XKC A;  1FCH A;  3BG0 B;  3B7T A;  3APC A;  1U3C A;  3LEW A;  4UI9 J;  2X6H A;  3B7U X;  2WXJ A;  3EIJ A;  3JCK C;  3P2B A;  4CDM A;  1KT1 A;  3FUL A;  5J90 A;  3OAW A;  3S7J A;  3EDT B;  3CST A;  5G2N A;  4FA6 A;  2J08 A;  3MV3 B;  4Y6C A;  2YHC A;  1UG3 A;  3P1U A;  2LNI A;  3Q4A B;  5JHA A;  3MZL B;  4GMJ A;  1JPL A;  5CMW A;  3D9P A;  1IQU A;  1Z6T A;  4JXT A;  5FWQ A;  3EIQ C;  4FJZ A;  4NAC A;  2L0T B;  4JHJ A;  2YHE A;  1WY6 A;  4E85 A;  5ENN A;  5A23 A;  1ELW A;  1TEZ A;  3CHQ A;  2R59 A;  3OXL A;  3L22 A;  3SGH A;  3QJZ A;  2VSN A;  2E2E A;  1E96 B;  4UWK A;  5KJN A;  2NXP A;  4I1A A;  1MHQ A;  2NC9 A;  4ILH B;  1HZ4 A;  3CHP A;  3L16 A;  1WM5 A;  4JA7 A;  2LO6 A;  3UUX A;  2BTD A;  3KS2 A;  3D9J A;  5ARF A;  2XGM A;  3G2W A;  1E7V A;  2J9Q A;  4FU3 A;  5G04 J;  4CGV A;  1ZU2 A;  3L13 A;  1NZN A;  4I6J A;  3SD5 A;  4F1S A;  4GZC A;  4DLQ A;  4ME2 A;  3E4B A;  3ESL A;  4K03 A;  4UWG A;  5T8I A;  3SFZ A;  3ZN3 A;  2IQC A;  2Y4U A;  2I1K A;  3ASG A;  3MCX A;  1GW6 A;  3MKQ A;  4JZY A;  2HM8 A;  4AM9 A;  1HXI A;  3CV0 A;  3RO3 A;  2X6K A;  3D9L A;  3EHM A;  3EJN A;  3LYA A;  4BWR A;  4U07 A;  4Q94 A;  4HOU A;  4G11 A;  3CVN A;  4L1B A;  4JEH A;  2GW1 A;  3U64 A;  3CHS A;  3FUD A;  2VJ8 A;  4I2W A;  3FTW A;  2XQ0 A;  3GZ2 A;  5G55 A;  2Q7F A;  3S7F A;  4ANV A;  3FUM A;  5BT1 A;  4JPS A;  4J8E A;  4UQY A;  4U63 A;  3UT4 A;  2LSV A;  2WXL A;  3Q5M A;  2KCL A;  2WXP A;  3FH8 A;  4J0U A;  4G2V A;  4WND A;  3WXX A;  1ZBP A;  4APF A;  3FDH A;  3SNX A;  4EBA G;  3IHV A;  3D3M A;  3MJW A;  3PS6 A;  4GZ6 A;  2DIW A;  4H7X A;  4I6E A;  3CVQ A;  3ML9 A;  4AVX A;  4AJW A;  5FTP A;  1SZA A;  3TGO A;  3TXN A;  4AY5 A;  2FEZ A;  3T8M A;  3CLJ A;  3CHM A;  3URZ A;  3NQP A;  2C0M A;  4R7L A;  3ZYK A;  4A1S A;  3VLF A;  2I9C A;  1OUV A;  4L23 A;  4I1M A;  5JHB A;  3ASF A;  3G2S A;  1OWM A;  4A1G A;  4XZ4 A;  3LY9 A;  5C1D A;  2RD0 A;  2AXV A;  1EPU A;  3CIA A;  2XGS A;  3PEU B;  4BX8 A;  2IU1 A;  2KAT A;  1OWP A;  4UWH A;  2BF0 X;  4I17 A;  2AW6 A;  4L2Y A;  2WMN A;  5FQ4 A;  3RJV A;  4ANW A;  2KCK A;  4FLH A;  4N3A A;  4ATG A;  3PRZ A;  3D9K A;  4FUL A;  5ANR A;  2C2L A;  3APD A;  3FFL A;  3TL5 A;  4BFR A;  3LY8 A;  1Z3X A;  4OYS A;  2VSX E;  3UT8 A;  4BSX A;  1HG2 A;  3ZRH A;  3D9N A;  5LOZ A;  4N3C A;  4GYO A;  3MA5 A;  4ILG A;  3FUH A;  4JL0 A;  4OVU A;  5E75 A;  5FQ8 A;  2MOW A;  3FUF A;  1FVF A;  3HHM A;  4B89 A;  3T5V A;  2VGY A;  4LER A;  2X38 A;  4I6G A;  4AP2 A;  4BT9 A;  4KVM A;  1IYG A;  1HH8 A;  4AXH A;  3ZYM A;  3FWV A;  4AY6 A;  4B8A A;  2J4B A;  4DK5 A;  4XI9 A;  5BV0 A;  5BNW A;  4KZC A;  1TJF A;  4GB9 A;  2L9B A;  3PVL A;  1NA0 A;  3B7S A;  2YNQ A;  3GYZ A;  1SQM A;  3FH5 A;  4M3O A;  2J09 A;  5EDS A;  2ILR A;  4KMO A;  2WXR A;  5ARG A;  2PL2 A;  3FU0 A;  2CHW A;  3RRU A;  1PC2 A;  4J8S A;  2WMO A;  3FUE A;  5HI7 A;  3JUI A;  3FTZ A;  4MRU A;  2FO7 A;  2PQN A;  3FP3 A;  3ZYL A;  4CCA A;  4EBA A;  3APF A;  4MS6 A;  1Y8M A;  5G05 C;  1OWL A;  4JHR A;  3ENE A;  3ULQ A;  1HE8 A;  3NZU A;  4OVV A;  2WQ7 A;  3I4R B;  4IRU A;  3QAQ A;  1YA0 A;  3TG4 A;  2IF4 A;  1X5B A;  2KC7 A;  3S7B A;  4G1T A;  4GA2 A;  2AXU A;  2XEV A;  3CVY A;  3FEX A;  4U04 A;  2LAI A;  2WXK A;  4H7Y A;  1MQS A;  4AIF A;  4LUN U;  3PUK A;  3PZD A;  4AEZ C;  4U0S A;  4U8H A;  4RVB A;  4WNF A;  3FH7 A;  1H0A A;  4G23 A;  3G2U A;  2OND A;  3QNK A;  1E8W A;  3CEQ A;  3HYM B;  4ANX A;  4FP7 A;  4O6F A;  1N52 A;  4HVB A;  3ZIM A;  2M63 A;  1U3D A;  3AU4 A;  4TV3 A;  5AJD A;  3RRM B;  3U4T A;  4CT0 A;  3FHE A;  4XKB A;  1VDY A;  3B13 A;  3ZHE B;  3VLD A;  2IJG X;  2FI7 A;  2FBN A;  5LCW C;  3QAR A;  3O4Z A;  2X6I A;  5J08 A;  3Q49 B;  3I5P A;  1BPO A;  4UWL A;  3CSF A;  4QFV A;  4HOR A;  2J49 A;  1TJC A;  5BW8 C;  3CHO A;  4WUY A;  3GW4 A;  3CVP A;  4N39 A;  4DI4 A;  4APO A;  2UWJ G;  4GZ5 A;  1UW4 B;  4W9R A;  4NUR A;  4F53 A;  1ELK A;  1HO8 A;  1IQR A;  1XGW A;  2CFZ A;  1Z3Y A;  3QWP A;  4KZ0 A;  4TRQ A;  2XRZ A;  2AWI A;  4MKT A;  4NQ0 A;  1QZ2 A;  2I1J A;  3KD7 A;  4G24 A;  4GA0 A;  4UQZ A;  3JQ1 A;  4JC8 A;  3FU3 A;  3L17 A;  1Y6I A;  4GYW A;  3RK6 A;  4GZ3 A;  1PAQ A;  4YVQ C;  1JWF A;  5KJM A;  4P29 A;  4C0E A;  4KXK B;  1DNP A;  4JVS A;  2E0I A;  4PS8 A;  3R7Q A;  1EYH A;  4EZJ A;  3QOU A;  5D0O D;  3RRN B;  2KZT B;  4AOF A;  3CQC B;  2JLB A;  3QK0 A;  1H2T C;  3FUK A;  2GRL A;  2UY1 B;  3DBS A;  5KJK A;  4ANU A;  3Q15 A;  2WXF A;  5AJL A;  1SZ9 A;  3CQG B;  4AV7 A;  2I2O A;  1LF8 A;  5C2Y A;  2VGX B;  4ABN A;  5HQ8 A;  3JYS A;  1HX8 A;  1H19 A;  3PDN A;  3IBE A;  3CKC A;  4ACK A;  2Y3A A;  1S0P A;  2R5S A;  2VYI A;  3PRE A;  2HR2 A;  3QC1 A;  2KM4 A;  3MV2 B;  3PUJ A;  5FQ6 A;  4LCT A;  5KCM A;  4B0Z A;  3KAE A;  1IHG A;  4PUC A;  5LP0 A;  3ZHE A;  4UWF A;  3SF4 A;  1KLX A;  3D9M A;  3L54 A;  3AS4 A;  3CHR A;  3AS5 A;  3LCA A;  4F3V A;  4EPZ A;  3K9I A;  5G05 J;  2WXN A;  2X6J A;  1UN8 A;  2JEK A;  4I1O B;  3CR3 A;  1XNF A;  3FU6 A;  2A4Z A;  2HYZ A;  5FZS A;  3ZGQ A;  3I3N A;  5AEN A;  3CGH A;  1EDU A;  2J07 A;  3CK8 A;  3ONL A;  2WM9 A;  3QKY A;  4GYY A;  4J6I A;  2PQR A;  1QNF A;  3FTX A;  1HS6 A;  5ANL A;  3ZW3 A;  4GCN A;  2FF4 A;  3UX4 A;  4N3B A;  2WB2 A;  3MGB A;  3KEZ A;  2WXG A;  2HO1 A;  5FQ7 A;  4C0M A;  4A55 A;  4DI3 A;  3SBT B;  3SI5 A;  4HXI A;  1E7U A;  4GCO A;  3D9O A;  2PM6 A;  3ONK A;  2QFC A;  3TJP A;  3QWV A;  3VTX A;  3FUI A;  2KZT A;  4N5C A;  2L6J A;  2MRI A;  4FLB A;  1UJJ A;  2GRM A;  5LCW J;  1UN9 A;  1B89 A;  3FUJ A;  4F7A A;  2IFU A;  2UY1 A;  3FUN A;  4EQF A;  4Q96 A;  3ZVV A;  4DLO A;  2YIN A;  2VGX A;  2ION A;  2L0I A;  2X3M A;  4GA1 A;  5E76 A;  4UQX A;  3B7R L;  4EZL A;  2WXQ A;  4K0R A;  1E8Y A;  2VTB B;  3G2V A;  4WNE A;  4PDX A;  2CHZ A;  3D9I A;  3CK9 A;  3LDZ A;  3CVL A;  2XCB A;  4IN3 B;  5JJT A;  2IOS A;  4CEM A;  3LVQ E;  1W3B A;  3GZS A;  3FTU A;  5A6C A;  3RU0 A;  3IEG A;  5D0Q D;  4GAA A;  3HDX A;  3PNL B;  3U66 A;  4YND A;  3FY4 A;  2ZU6 B;  5CMY A;  4GML A;  1L5J A;  5JJ7 A;  3TXM A;  3FTY A;  2GGF A;  4JEU A;  4XI0 A;  3LVR E;  1FVH A;  3MYV A;  4B8C B;  3PE3 A;  4E6H A;  5BPP A;  1QQE A;  3ZXS A;  3CVU A;  4LEU A;  4WNG A;  1HFA A;  2VSY A;  3O48 A;  2DCP A;  2V5F A;  5EKQ D;  5FT9 A;  3RIB A;  3QWW A;  3LXU X;  3NF1 A;  3S7D A;  1NA3 A;  3CK7 A;  4HS2 A;  1ELR A;  2XPY A;  2WVI A;  3SHF A;  4KBQ A;  4BTB A;  1DVP A;  1E8Z A;  3CVX A;  4A3V A;  5CCL A;  4HFG A;  4N2S A;  2OVF A;  4BTA A;  3PE4 A;  3R9A B;  3LPZ A;  4J8F A;  3RO2 A;  3T5X A;  3FEY A;  4URK A;  4HOS A;  2WXM A;  5T4Y A;  2EQX A;  3FTV A;  3SZ7 A;  3ZFW A;  2MHK A;  4NRH B;  3LJ3 A;  1OWN A;  4I2Z A;  4JW1 A;  3IV0 A;  3LY7 A;  4I43 A;  2J4D A;  3JQ0 A;  4FHJ A;  4IYP A;  4JA9 A;  3R7R A;  3VLE A;  4XX5 A;  3ASH A;  5DIZ A;  4CRW A;  4ACL A;  3SBS A;  2PM7 A;  3OTN A;  4WWP A;  4WWO A;  1HU3 A;  3ESK A;  5FZQ A;  5BV1 A;  2VTB A;  4C9B B;  1E90 A;  4PS7 A;  5LX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...