1NA3A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
b'GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed protein CTPR2
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 36
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na3A00
4WNFA 3Q4AB 3ZFWA 4U0UA 5DBKA 3CKBA 3PE3A 3ULQA 2E2EA 2YHCA 3ASFA 1ELRA 2C2LA 4YNDA 4G23A 4KYOB 3Q49B 4U0ZA 4J8DA 4ME2A 4AM9A 5FTPA 5BW8C 5G04C 4WNEA 4HORA 3QWPA 4IN3B 4G25A 3KD7A 2QFCA 3S7DA 4J8EA 5EX0A 2FBNA 5G05C 4WNGA 3ASGA 3KS2A 4XI9A 4LEUA 5HQ8A 3Q47B 3ZN3A 2XGMA 3S7JA 5EKQD 4I2ZA 3ESKA 5G04J 3CK9A 5FZSA 4G1TA 1IHGA 1QQEA 2I6HA 3AS4A 4HOUA 2FEZA 3TG5A 1E96B 1QZ2A 5G05J 3RKVA 3S7FA 4F3VA 4AY6A 3CK7A 3K9IA 3RO2A 3QDNA 4Y6CA 1W3BA 3RJVA 2WPVA 3HYMB 4GZ3A 5BNWA 4J8FA 4HOTA 2XPIA 3LPZA 4BWRA 3R9AB 3SF4A 4GYYA 1KLXA 2XGOA 2HR2A 5EX3A 2PL2A 4I2WA 3FFLA 5D0QD 4O6FA 5A7DB 5KJMA 4WUYA 4GPKA 4UQXA 2PZIA 2KCLA 2Q7FA 4GZ6A 3RO3A 3U4TA 3OXLA 3CV0A 4NQ0A 3PE4A 2OOEA 4GCOA 3MKRA 5FT9A 3VTYA 2Y4UA 3RU0A 1B89A 2KCKA 5CHEE 1IYGA 4YVOA 1HH8A 4CGVA 4WNDA 2J9QA 2L6JA 3RIBA 2VSNA 3GZ1A 2UWJG 4BT8A 2NC9A 5KJKA 5KJNA 4N2QA 1NA3A 3FP3A 2ONDA 1ZU2A 1Y8MA 4HOQA 5ARFA 3CVNA 4KBQA 2FO7A 2C0LA 4H7YA 2VYIA 5JJTA 2FI7A 1PC2A 4A1SA 1NA0A 4XI0A 4JA9A 2VGYA 4UQZA 3U3WA 1WAO1 5LCWC 2DBAA 4GA0A 5D0OD 2Y4TA 2VQ2A 4HOSA 4I1AA 1A17A 3GZ2A 4N3BA 4RG9A 4GYOA 4AIFA 2LNIA 4EQFA 1OUVA 4N2SA 5JJ6A 1P5QA 4XIFA 4W9RA 5A6CA 5HI7A 5LCWJ 3MV3B 3GW4A 4JL0A 3Q15A 3GYZA 4CGWA 4N5CA 3UQ3A 3JYSA 4N39A 5C1DA 3OXGA 4BT9A 2XEVA 3ZGQA 1HXIA 3QOUA 4G24A 4G2VA 4JA7A 3LKUA 4CDRA 2KCVA 1YA0A 3O48A 2WQHA 4UI9K 2VSYA 5FZQA 2XCBA 4AY5A 3TG4A 4ABNA 4J0UA 2LSUA 3LCAA 3QWWA 2IFUA 2V5FA 4BTAA 4KXKB 4GZ5A 4Y6WA 4APOA 2P58C 2PQNA 3URZA 3AS8A 3QWVA 3CKCA 4U0SA 3CVPA 2LSVA 3LY9A 4JHRA 2R5SA 3CEQA 2UY1A 1NZNA 2PQRA 4H7XA 3ZHEA 2FF4A 3MV2B 3VTXA 2AVPA 3CVLA 5FZRA 2YQ8A 2VGXA 1KT1A 2MHKA 4UI9C 3MEKA 2KATA 4U07A 4B94A 3LY7A 3UUXA 3SZ7A 4GCNA 3Q5MA 2HO1A 2BUGA 4U04A 3ZPJA 3PDNA 1TJCA 3NF1A 4BTBA 3ASDA 2C0MA 1WM5A 1ELWA 4NRHB 3KAEA 3QKYA 4UI9J 3IEGA 3EDTB 5M72A 5BT1A 4UQYA 4I9EA 5JJ7A 1XNFA 5FJYA 2GW1A 4I9CA 3ASHA 2UY1B 4I17A 3S7BA 3FWVA 4N3AA 4RG6A 2HYZA 3ZHEB 5AYWD 2XCCA 3TAXA 3WXXA 1HZ4A 3E4BA 5CCLA 2VGXB 2KC7A 1ZBPA 4GA1A 3MA5A 4GYWA 3LY8A 5CCMA 3AS5A 3N71A 3UPVA 4G26A 3BEEA 1KT0A 3OXFA 3CK8A 3CVQA 2IF4A 4YVQC 5ARGA 4GA2A 1FCHA 3LYAA 4N3CA 3TGOA 5KJLA 2XGSA 2JLBA 5DIZA
chains in the Genus database with same CATH superfamily
3CSFA 4WNFA 4EECA 3PZ1A 2XS1A 2X6KA 3PE3A 4J7WA 2E2EA 3ASFA 3LDZA 2DVWA 4URKA 5FWQA 4J8DA 5CMYA 3CSTA 2AXVA 5FTPA 5BW8C 3LJ3A 5ANRA 2RD0A 2MYOA 4HORA 4HXIA 3D3MA 3QWPA 1FT1A 4UWHA 1K1AA 2OV8A 4EZLA 5G05C 1E8WA 2XZDG 3ZN3A 2XGMA 2CG2A 3S7JA 4HLLA 1BI8B 3HXBA 2IU1A 3CQCB 1FVHA 4YDEA 2KZTA 3S7FA 3FY4A 4YDYA 3CK7A 5CEAA 2Y3AA 4UUCA 4FU3A 3RO2A 3QK0A 1X5BA 2VSOE 3BUAA 4GZ3A 4F1SA 4HOTA 3LPZA 2QC9A 3SF4A 2XGOA 3E30A 3ML9A 1TJFA 2F37A 3AAAC 3B13A 4GTPA 5EX3A 3FFLA 3T8KA 5CECB 1SA5A 5A7DB 2YINA 3P1UA 2WXIA 1S63A 3LVQE 3HHMA 1H2TC 3B7SA 3MZLB 4CT0A 3OXLA 2WXGA 3EHQA 2V4LA 4HRLA 1UN9A 4CRWA 2V0PA 3T5VA 2KZTB 2Y4UA 5AQ9A 4DUIA 4TRQA 3EIJA 5EN5D 3RU0A 3EIQC 1B89A 1OWMA 2KCKA 3G2WA 5CHEE 1H19A 4BSZB 2J9QA 2L0TB 5T8IA 2UWJG 2NC9A 1NA3A 4A3VA 2X6JA 4ATGA 1ZU2A 4HOQA 4GTTA 3W9GA 1N95A 2J4DA 1OCCE 2FO7A 4XX5A 5LOZA 5ENOD 2AWIA 4H7YA 4NACA 2VYIA 5JJTA 1NA0A 2AJAA 4L7TA 4XI0A 3PREA 1OY3D 3RK6A 1TN8A 3Q78A 2Y4TA 3ISMC 4LNUD 4N3BA 4RG9A 4OAVB 1OWPA 5C2YA 2WXKA 3PH0C 4HB5A 4EQFA 1OUVA 4ACKA 5JJ6A 4XIFA 4W9RA 4O1PA 4LRZA 3GW4A 4JL0A 4CEMA 4N5CA 1PAQA 2Y1LE 3SBTB 5KWDA 4JVSA 5ENNA 3KSQA 3R9MA 3EJNA 3OXGA 3C3RA 3ZRHA 2EIKE 3EHNA 4LG6A 3ZGQA 1HXIA 2R2LA 3CLJA 3ZEFA 2KM4A 3QOUA 2XPYA 3ZU7B 3L22A 3C3QA 1MX2A 3GZSA 3PEVB 2WQHA 4UI9K 4FADA 1FT2A 1MX6A 2EILE 3HG0D 4AY5A 1DC2A 2XEHA 3NOGD 3FHEA 4ABNA 2IFUA 1IHBA 1U3DA 3HXEA 2OVBA 1MYOA 3FUKA 4GZ5A 4RQIA 4EHMA 4RVBA 1N9AA 1INZA 2PQNA 2WB2A 3QWVA 2F8YA 1BU9A 3LY9A 4MRUA 3D9NA 5CRVA 4GTRA 3RRMB 3UM0A 5JMND 1OWNA 3MV2B 4GTVA 1KZOA 2BKGA 2YQ8A 5HS0A 1KT1A 2KATA 3NZUA 1KPSB 3Q5MA 4NIKA 4GU5A 3FDHA 4U04A 3PDNA 4U8VD 3FH5A 4BTBA 4WWOA 1E8YA 3TWRA 1ELWA 1NI1A 3PZ2A 3RRNB 4O1OA 3VLDA 2PNNA 3B7RL 2J07A 1S0PA 3EDTB 2A4ZA 5EILA 3EHRA 5BT1A 4L9PA 1RZ4A 1XNFA 4L23A 3G2VA 5LFAA 3S7BA 1YCSB 2AW6A 3TWSA 5BPPA 2WXOA 2XCCA 4O60A 4CDNA 3WXXA 3ONKA 2IEJA 5CCLA 4YDOA 4AXHA 5FQ4A 2IOSA 2NXPA 4Z68A 1SA4A 3TWVA 4AJWA 5CBOA 3IV0A 3FUDA 2R03A 3BEEA 4I6JA 4J8SA 1KT0A 4UWFA 2WXNA 1E90A 2IF4A 4YVQC 1O1SA 5ARGA 3B7UX 4K03A 3FUFA 5FQ8A 3Q9NC 5B3SE 4LNBA 3FH8A 2ZXWE 3UIOC 1HE8A 4HNAD 2H6IA 1Z6TA 1H2UA 5EDSA 3CKBA 2CHZA 3EU9A 3UIPC 3DSSA 2RKKA 3QJZA 4U96D 1V54E 2C2LA 4YNDA 3CHRA 3Q49B 4FHKA 3B95A 3PZ3A 5G04C 4WNEA 2VJ8A 1YYHA 5KBAA 4DRXE 4G25A 5CBNA 4J8EA 5EX0A 4U63A 3CHMA 3KS2A 4XI9A 4LEUA 2OEVA 4APFA 3ABKE 3FTVA 3FTSA 2XRYA 1AP7A 1O1RA 1QQEA 3FH7A 3ABLE 3DXMG 4G8LA 5D2MC 3AS4A 4HOUA 4KMOA 2P9NG 1DCQA 1H6OA 1QZ2A 2X3MA 5G05J 4F3VA 3CVWA 1TEZA 2IOLA 5EYPF 4WWNA 3QDNA 2V4HC 3RJVA 2AXZA 3MYVA 1HG2A 4GYYA 4F7AA 4F53A 3J5QB 2PL2A 5EIBE 1WDYA 4I2WA 1NFIE 3L13A 2J09A 1OXJA 5KJMA 3V2XA 4WUYA 4UQXA 4K5CA 1N4QA 4TXRA 4GTOA 1UJKA 4L2LA 3RO3A 1OWLA 3C3OA 1ZB1A 3PE4A 5ENPD 2OCCE 5KCMA 2J49A 3ASNE 5AJLA 3ONLA 4PUCA 3ZYQA 2ETBA 2P9KG 3FUHA 4HFGA 3ZIMA 3ASOE 3V31A 3DSXA 4WNDA 5BXUA 4B89A 3CR3A 3RIBA 4BX8A 4B0ZA 2L6BA 3DRAA 3D9LA 4BT8A 2WM9A 3TXNA 1L5JA 3ZNGA 1QBQA 3LJNA 2ONDA 3R7RA 1Y8MA 4ANXA 4CT4A 3IKOB 3CHQA 4KBQA 3UTMA 3G2UA 2C0LA 3B7TA 4AVXA 4G11A 1PC2A 2PM6A 3PNLB 4JA9A 4UQZA 1LD8A 1WAO1 3ENEA 3E32A 3D9JA 5D0OD 2I1KA 3AU5A 2VQ2A 1QNFA 4L1BA 5G55A 5D66A 2DYRE 4Q69A 3FTXA 3UI2A 4JEUA 3PUJA 4N2SA 2GRQB 3SNXA 5AN8A 1P5QA 1OWOA 3CVYA 4Q96A 5A6CA 3J5PA 2CHWA 1OCZE 3MV3B 3ULEG 1U2VG 5BUZA 1JWFA 3Q15A 3GYZA 4DK5A 5CEDB 4KZ0A 4JPSA 4DJAA 2J8SD 3CVXA 3W9FA 3HIZA 3D9PA 3AG2E 1O1TA 2QY7A 2CFUA 4D10C 3CGHA 1IQUA 2XEVA 4EBAG 3O4ZA 2XS8A 3ULYA 3NQPA 1H0AA 1S64A 3MCXA 4JA7A 4CDRA 5AENA 3DSVA 1YA0A 3WG7E 1Q2ZA 4HLEA 1Z3YA 5T3RA 2VSYA 5FZQA 3E33A 2XCBA 2X6IA 3TG4A 4JB8P 2VSXE 3X2QE 3SI5A 3APDA 4APOA 3RAUA 3AS8A 5CMWA 2BF0X 3UXGA 2R5SA 3CEQA 2UY1A 4DX1A 2R05A 4H7XA 4M7CA 3FUNA 1DNPA 2AXUA 3LS8A 2ZGGA 3ZHEA 4GTQA 1E7UA 3MKQA 4GAAA 1N0QA 4UI9C 4U07A 3UUXA 4OVVA 3SFYA 4GCNA 1HU3A 2BUGA 4HVBA 1BLXB 3TWWA 5B1BE 1TJCA 4TV3A 2P9SG 3NF1A 3FTWA 3JQ0A 3ASDA 3PZDA 3MX3A 1WM5A 1IKND 1AWCB 4HRNA 2WXPA 3JXIA 3S2AA 3JQ1A 2JEKA 2X6FA 2XEEA 3HXDA 5M72A 5CERB 1N52A 3ESLA 5E75A 2WXHA 2QYUA 2UY1B 4AEZC 4I17A 2ETCA 3FWVA 1ELKA 1LD7A 4DX6D 4N3AA 3ZHEB 3D9MA 1HZ4A 3MKQB 3TWXA 2KC7A 4GA1A 1TNZA 2ZIRA 3SBSA 4GYWA 2M63A 2WXQA 3LY8A 2DYSE 4GTMA 3DSUA 2I2OA 3FEYA 4G26A 4FP7A 3HRAA 3UT4A 3CK8A 4EZKA 5G2NA 1HX8A 3UKRG 4GA2A 1FCHA 3UINC 5JHBA 3SFXA 2VTBA 4X8QA 3QC1A 4N3CA 4KT6B 2VGEA 3ZUVB 4ACLA 4E85A 2JLBA 2OEWA 5DIZA 1GW6A 3Q73A 1N4PA 3Q4AB 4JXTA 3ZFWA 4JZYA 4U0UA 5DBKA 3AU4A 2YHCA 3AG3E 4G23A 4KYOB 2JABA 4MBGA 4U0ZA 4AM9A 4JHJA 4AV7A 4PH4B 4XKBA 3OAWA 2XRZA 4C9BB 4ATZD 4LCTA 4J6IA 2IJGX 3I5PA 3FUJA 1Z5SC 2FBNA 4FULA 3ASGA 4DX5D 1EYHA 3Q47B 2OVFA 3V2OA 3PVLA 3HXCA 5EKQD 4I2ZA 3ESKA 2P9LG 5G04J 1KZPA 1N0RA 4ZHBA 5FZSA 4G1TA 1NL4A 2WQ7A 4GMJA 4F6RD 3E37A 2I6HA 2FEZA 1FVFA 3TG5A 1E96B 2LAIA 4AY6A 3L08A 1E7VA 4BESA 2H6GA 4Y6CA 2WPVA 2GRMA 1HS6A 2LUHA 2XPZA 5EIDA 5AQAA 3FTUA 4BWRA 4FLBA 1S70B 3ABME 4OAUC 2HR2A 3DSTA 4U95D 1DCEA 4EBAA 2P2CP 4DX2A 4HQDA 5LX8A 3UM3A 4HI9A 4I6GA 1UOHA 5H7PA 1SZ9A 4GPKA 2I1JA 2LXLA 3IHYA 3U66A 4GZ6A 1IXVA 3CV0A 2X6HA 4NQ0A 2FULA 4GCOA 3MKRA 2HE0A 4BFRA 4CCAA 3VTYA 3ML8A 4A63B 2LAHA 2MRIA 4NURA 5BXOA 1OCRE 4CDMA 4UWLA 4YVOA 1HH8A 2BEDA 1BD8A 4CGVA 3APFA 1LF8A 2L6JA 3FU3A 2VSNA 3HDXA 2ZISA 5KJKA 5KNHD 1H2VC 3CVVA 4WAFA 3D9KA 4TUUA 1N94A 1DVPA 3QARA 3TXMA 4B8AA 2WXRA 4GMRA 4GZDA 4FC8A 3BG1B 3L6AA 3C72A 1UJJA 1V55E 2VGYA 3U3WA 2ZU6B 3FUMA 5LCWC 2P9UG 2YNQA 2DBAA 2GRRB 2IY0C 2EIME 3APCA 1JCSA 4ILIA 1MX4A 4HOSA 1A5EA 5B1AE 3U64A 4LNGA 3PRZA 4BEPA 3QNKA 4PS8A 2QYJA 4C0EA 4ILGA 5A23A 3Q75A 2IO3C 3DSWA 3ZYKA 1TNYA 3CVUA 3JCKC 4DPRA 2XENA 1D9SA 3TJPA 4N39A 1U3CA 4GMLA 4ANVA 4BT9A 4IYPA 1D8DA 4MKTA 1O5MA 4G24A 4G2VA 1WG0A 2KCVA 2CFZA 4TXQA 4A3TA 4I43A 5E76A 2PM7A 2IQCA 4FJYA 5FINA 3JUEA 3KEZA 4JD2G 3LCAA 3KSLA 3QWWA 3TWQA 2V5FA 4CYMD 4RLYA 4BTAA 4GTSA 4HBDA 3EHMA 4Y6WA 4JW1A 2P58C 1E8XA 3URZA 1EPUA 4RSYA 4QQIA 3PUKA 4U0SA 4XEIG 2LSVA 1VDYA 3LVRE 4ANUA 4UWKA 1NZNA 2PQRA 4G8KA 4K5BA 4QFVA 3VTXA 3CVLA 5J08A 1Y6IA 4TXPA 2VGXA 5ITZF 2L9BA 2KBXA 4MS6A 1JWGA 3MEKA 4B94A 3LY7A 3L54A 2RG8A 2HO1A 2LXMA 3DEPA 2Y0BG 1X81A 2R02A 4HI8A 3ZPJA 4KZCA 1UN8A 3U9WA 4OYSA 2FO1E 1G3NB 2EQXA 1YMPA 4NRHB 3TL5A 4UI9J 2HM8A 3IEGA 2RFAA 3OTNA 1JCQA 2P9PG 3FUIA 4I9CA 3ASHA 3G2TA 2NSZA 4RG6A 4BETA 4MLPA 1H6KA 5AARA 1TNUA 4XKCA 5JA4D 1UG3A 2VGXB 1D8EA 1ZBPA 3MA5A 2GRNB 3NBNB 4GB9A 5ENRD 4PDXA 2Y69E 3FTZA 4JEHA 3OXFA 3CVQA 4AOFA 1EF1C 1TR4A 3NOCD 4JHKA 2EINE 3TWTA 3ZKJA 3LYAA 4Q94A 4LSZE 3V79K 3TGOA 4JC8A 4XZ4A 3ZYLA 5KJLA 1N4SA 1JCRA 2GRLA 3CIAA 3PZ4A 2P9IG 2GGFA 3UM2A 5AQ7A 2J08A 3ZXPA 5T4YA 4FHJA 3KEAA 1MJ0A 4FJZA 3ULQA 4ILHB 1K1BA 5FQ7A 1ELRA 3CHPA 5JHAA 4ME2A 5ENSD 3FU0A 3L16A 4PS7A 1HO8A 4IRUA 4UWGA 3SD5A 1JPLA 1BI7B 4IN3B 3FEXA 1N54A 4J8YA 3KD7A 2QFCA 3S7DA 4IULA 4WNGA 5HQ8A 2F8XK 1RW2A 4I1OB 2XZTG 3QAQA 3MJWA 5BV1A 3DPDA 4DI3A 4DLQA 3DXKG 3CK9A 1MQSA 2CHXA 1IHGA 1K8KG 2B0OE 2EIJE 4U8YD 1OCOE 3RKVA 3QB2A 2H6HA 2BKKB 3K9IA 3NAWA 5HRYA 4V3IA 2X38A 1HF8A 4DLOA 3VLFA 1W3BA 3HYMB 3C98A 3ZYMA 5BNWA 4J8FA 2XPIA 3R9AB 1KLXA 3IHVA 2WMOA 2V8SE 4A1GA 3AG1E 5EYLA 4TUMA 3FULA 5D0QD 4BY6A 4O6FA 3I4GA 2DCPA 3DBSA 1SW6A 2DZNA 2PZIA 3NZSA 2KCLA 3DEOA 4ZFHA 2L0IA 2MOWA 1TNBA 3SFZA 3UKUG 1XGWA 1SQMA 4B8CB 2Q7FA 1N4RA 3V30A 3U4TA 3LXUX 3FU5A 2I9CA 2WMNA 2OOEA 1MHQA 2XHEA 5FT9A 4HRMB 2QZAA 3I3NA 2LO6A 3NB2A 2WXJA 3HVEA 3IBEA 4BERA 4C0MA 1IYGA 3ZVVA 2J4BA 3R7QA 2H6FA 3MGBA 3GZ1A 2XQ0A 3B7BA 5FQ6A 4DI4A 5KJNA 3JUIA 4N2QA 4U7EB 2WXFA 3FP3A 2DIWA 3UX4A 3D9IA 2KXPC 3Q7AA 5ARFA 2DWZA 3CVNA 1LTXA 4AP2A 2VTBB 1TYQG 4E6HA 4GPMA 3ZXSA 2FI7A 2ILRA 4HS2A 4A1SA 2WQ6A 3UMVA 3AG4E 3UM1A 3AJIA 5CRUA 3TWUA 1H6PA 4GA0A 3HVEB 4L2YA 1JUQA 3L82A 4XE0A 4ANWA 5IY5E 3SQVA 2V5QC 4I1AA 1A17A 3GZ2A 4N5QA 4OVUA 4GYOA 3T9KA 3ZW3A 4EPZA 4AIFA 2LNIA 5AIJA 3UT8A 3C5RA 3RRUA 4PS3A 2RFMA 5HI7A 5LCWJ 4KVOA 4YDWA 3T8MA 5ANLA 4WWPA 1N11A 4K5AB 1WY6A 4CGWA 5HKPA 3UQ3A 1E8ZA 3JYSA 4P29A 1FPPA 3SHFA 4FLHA 5C1DA 3BG0B 3I4RB 5LP0A 3P2BA 3LKUA 4U8HA 2WXMA 3O48A 1PY1A 4GZCA 5FIOA 2ZGDA 3CHSA 4C48B 2R59A 2ETAA 3G2SA 4BSXA 1UW4B 4J0UA 2LSUA 3CHOA 1TN7A 4KXKB 3BU8A 4CZ2D 2IONA 2IO2C 3F6QA 3E34A 1HG5A 1BPOA 3CKCA 3CVPA 4JHRA 3D9HA 2F0YA 3Q79A 2GROB 5ENQD 2FF4A 3L17A 1EDUA 4K0RA 4DX7D 5BV0A 2AVPA 5FZRA 2R17C 3EU5A 1HFAA 2MHKA 4A55A 2WXLA 3SZ7A 3RSEG 3Q7FA 5AQBA 2A5EA 1TNOA 3Q9UC 4I6EA 3CQGB 1NP7A 4FA6A 3SY2A 2C0MA 1K3ZD 3L9TA 5AJDA 2NYJA 3PS6A 3DWLG 3PNTB 3KAEA 3QKYA 1SVXA 3FTYA 3BQOA 4R7LA 3IXEA 4UQYA 4I9EA 1Z3XA 1QYMA 5JJ7A 3VLEA 3FUEA 1OT8A 5FJYA 2GW1A 3FU6A 2DZOA 4EZJA 2HYZA 3UT7A 2GRPB 2YHEA 4M3OA 5AYWD 3TAXA 4F1PA 2A5UA 3E4BA 3SGHA 3T5XA 2CG3A 1SZAA 3HXFA 4I1MA 3DPYA 5CCMA 2BTDA 5AAOA 3AS5A 3N71A 3JXJA 3SO8A 3UPVA 5J90A 1TN6A 1MZCA 4KVMA 3LEWA 5KNGA 2E0IA 3EUVA 4BX9A 2B6CA 2WVIA 1IQRA 3D9OA 4LUNU 2XGSA 3PEUB 4B93B 5ENTD 4LERA
chains in the Genus database with same CATH topology
3CSFA 1GW6A 4WNFA 2J08A 3Q4AB 5T4YA 4FHJA 4EECA 4JXTA 1Z6TA 3ZFWA 4FJZA 1H2UA 4JZYA 4U0UA 5EDSA 2X6KA 5DBKA 3CKBA 3AU4A 3PE3A 2CHZA 3ULQA 4ILHB 3QJZA 2E2EA 2YHCA 3ASFA 5FQ7A 1ELRA 2C2LA 3CHPA 4YNDA 4G23A 4KYOB 3CHRA 3LDZA 3Q49B 4FHKA 4U0ZA 4URKA 5FWQA 4J8DA 5CMYA 5JHAA 3CSTA 4ME2A 2AXVA 4AM9A 5FTPA 5BW8C 3LJ3A 5ANRA 5G04C 4JHJA 4AV7A 2RD0A 3FU0A 3L16A 4PS7A 1HO8A 4IRUA 2VJ8A 4UWGA 4PH4B 4WNEA 3OAWA 4XKBA 2XRZA 4HORA 4HXIA 3SD5A 3D3MA 4C9BB 3QWPA 1JPLA 4IN3B 3FEXA 4LCTA 1N54A 4G25A 4UWHA 2OV8A 4J6IA 4EZLA 2IJGX 3KD7A 2QFCA 3I5PA 3S7DA 3FUJA 4J8EA 5EX0A 2FBNA 4U63A 4FULA 5G05C 4IULA 4WNGA 3ASGA 3CHMA 3KS2A 4XI9A 4LEUA 5HQ8A 1E8WA 4APFA 1EYHA 3Q47B 4I1OB 2OVFA 3ZN3A 2XGMA 3PVLA 2CG2A 3S7JA 3QAQA 3FTVA 3MJWA 3FTSA 5EKQD 4I2ZA 2XRYA 5BV1A 3DPDA 4DI3A 2IU1A 3ESKA 4DLQA 5G04J 3CK9A 3CQCB 1MQSA 5FZSA 1FVHA 2CHXA 4G1TA 1IHGA 1QQEA 3FH7A 2WQ7A 4GMJA 2I6HA 3AS4A 4HOUA 4KMOA 2FEZA 1FVFA 3TG5A 1E96B 1QZ2A 2KZTA 2X3MA 5G05J 3RKVA 2LAIA 3QB2A 3S7FA 4F3VA 4AY6A 3L08A 3CVWA 3FY4A 1TEZA 2IOLA 1E7VA 3CK7A 2Y3AA 3K9IA 4FU3A 3RO2A 4V3IA 2X38A 1HF8A 3QK0A 4WWNA 4DLOA 3QDNA 1X5BA 3VLFA 4Y6CA 1W3BA 2VSOE 3RJVA 2AXZA 2GRMA 2WPVA 3HYMB 4GZ3A 1HS6A 2XPZA 3C98A 3ZYMA 4F1SA 5BNWA 4J8FA 4HOTA 3FTUA 2XPIA 2GGFA 3LPZA 4BWRA 3MYVA 3R9AB 4FLBA 3SF4A 1HG2A 4GYYA 1KLXA 2XGOA 4F7AA 3IHVA 3ML9A 2WMOA 2V8SE 4F53A 1TJFA 4A1GA 2HR2A 3B13A 5EX3A 2PL2A 3FULA 4EBAA 4I2WA 3FFLA 5D0QD 3L13A 4O6FA 4BY6A 2J09A 5A7DB 5KJMA 2YINA 4WUYA 5LX8A 3I4GA 4I6GA 1SZ9A 4GPKA 2DCPA 4UQXA 3DBSA 2I1JA 2PZIA 3P1UA 3NZSA 2WXIA 3LVQE 2KCLA 3HHMA 1H2TC 2L0IA 1UJKA 2MOWA 3SFZA 3B7SA 3IHYA 3U66A 1XGWA 1SQMA 3MZLB 4B8CB 2Q7FA 4GZ6A 4L2LA 3RO3A 3U4TA 3LXUX 4CT0A 1OWLA 3FU5A 3OXLA 2WXGA 2I9CA 3CV0A 2X6HA 4NQ0A 2FULA 3PE4A 2V4LA 2OOEA 2WMNA 4GCOA 1MHQA 2XHEA 1UN9A 3MKRA 4CRWA 2V0PA 4BFRA 5FT9A 4CCAA 5KCMA 2J49A 3T5VA 2KZTB 3I3NA 3ONLA 4PUCA 5AJLA 2LO6A 2Y4UA 3VTYA 3ZYQA 2WXJA 4TRQA 3HVEA 3IBEA 3EIJA 3ML8A 3FUHA 3RU0A 3EIQC 4HFGA 1B89A 1OWMA 2LAHA 2KCKA 2MRIA 4NURA 3G2WA 5CHEE 4CDMA 4C0MA 4UWLA 1IYGA 4YVOA 3ZIMA 1HH8A 1H19A 4CGVA 4WNDA 3APFA 3ZVVA 1LF8A 2J9QA 4B89A 2L6JA 3CR3A 3FU3A 2J4BA 3RIBA 4BX8A 2L0TB 2VSNA 5T8IA 4B0ZA 3HDXA 3R7QA 3MGBA 3GZ1A 2UWJG 3D9LA 2XQ0A 4BT8A 5FQ6A 4DI4A 2NC9A 2WM9A 5KJKA 5KJNA 3JUIA 3TXNA 1NA3A 4N2QA 1L5JA 1H2VC 2WXFA 3FP3A 2ONDA 2DIWA 2X6JA 3R7RA 4A3VA 4ATGA 1ZU2A 3UX4A 3CVVA 4WAFA 1Y8MA 3D9IA 4HOQA 4ANXA 4CT4A 3D9KA 5ARFA 4TUUA 3IKOB 3CVNA 3CHQA 2J4DA 4KBQA 1DVPA 2FO7A 4XX5A 5LOZA 3QARA 3G2UA 5DIZA 3TXMA 4AP2A 2C0LA 2AWIA 4B8AA 4H7YA 4NACA 2VTBB 2WXRA 3B7TA 4GZDA 4FC8A 3BG1B 4E6HA 2VYIA 3ZXSA 4AVXA 2FI7A 2ILRA 3L6AA 4G11A 4HS2A 1PC2A 4A1SA 3UMVA 1NA0A 2PM6A 2WQ6A 1UJJA 3PNLB 4L7TA 4XI0A 4JA9A 2VGYA 4UQZA 3U3WA 2ZU6B 3PREA 3FUMA 1WAO1 5LCWC 3ENEA 2YNQA 2DBAA 3D9JA 3RK6A 4GA0A 5D0OD 5JJTA 2I1KA 3HVEB 3APCA 4L2YA 2Y4TA 1JUQA 4ILIA 4XE0A 4ANWA 3AU5A 2VQ2A 4HOSA 4I1AA 1A17A 3GZ2A 4N3BA 1QNFA 3U64A 4L1BA 4RG9A 4OVUA 5G55A 3PRZA 1OWPA 4GYOA 4EPZA 3ZW3A 4AIFA 5C2YA 2LNIA 2WXKA 3PH0C 3FTXA 4Q69A 4EQFA 5AIJA 1OUVA 4JEUA 4ACKA 3PUJA 3QNKA 4N2SA 4PS8A 5JJ6A 3SNXA 1P5QA 1OWOA 4C0EA 3UT8A 3CVYA 4Q96A 4XIFA 4W9RA 4ILGA 4PS3A 3RRUA 5A23A 5HI7A 5A6CA 5LCWJ 4KVOA 2CHWA 4LRZA 3MV3B 3T8MA 3GW4A 3ZYKA 5ANLA 5BUZA 1JWFA 4JL0A 4CEMA 4WWPA 3Q15A 3GYZA 4DK5A 3CVUA 3JCKC 1WY6A 4CGWA 4KZ0A 1PAQA 4N5CA 4JPSA 4DJAA 3UQ3A 1E8ZA 3SBTB 4DPRA 4JVSA 5ENNA 3CVXA 3TJPA 3JYSA 3HIZA 3D9PA 4N39A 1U3CA 4P29A 4GMLA 4ANVA 3EJNA 2QY7A 2CFUA 3SHFA 4FLHA 3OXGA 5C1DA 3ZRHA 3BG0B 3I4RB 4BT9A 3EHNA 4D10C 5LP0A 3CGHA 1IQUA 2XEVA 4IYPA 4EBAG 3O4ZA 3ZGQA 1HXIA 3CLJA 3P2BA 4MKTA 3ZEFA 2KM4A 3NQPA 1H0AA 2XPYA 3QOUA 3L22A 3MCXA 4G2VA 3LKUA 4G24A 4JA7A 4CDRA 4U8HA 3GZSA 3PEVB 2KCVA 5AENA 2WXMA 2CFZA 4A3TA 1YA0A 3O48A 4I43A 2WQHA 4UI9K 1PY1A 5E76A 4FADA 4HLEA 4GZCA 2PM7A 1Z3YA 2IQCA 4FJYA 5T3RA 2VSYA 5FZQA 3CHSA 2XCBA 2X6IA 4AY5A 3TG4A 2R59A 3G2SA 4BSXA 3FHEA 3KEZA 4ABNA 1UW4B 4J0UA 2VSXE 2LSUA 3LCAA 3QWWA 2IFUA 2V5FA 3CHOA 4BTAA 1U3DA 4KXKB 3SI5A 2OVBA 3APDA 3FUKA 4GZ5A 3EHMA 4Y6WA 4JW1A 4APOA 2IONA 2P58C 4RVBA 1INZA 1E8XA 2PQNA 2WB2A 3URZA 3AS8A 3QWVA 5CMWA 1EPUA 4RSYA 3PUKA 1HG5A 1BPOA 3CKCA 2BF0X 4U0SA 3CVPA 2LSVA 1VDYA 3LVRE 3LY9A 4JHRA 4MRUA 2R5SA 4ANUA 3D9NA 3CEQA 2UY1A 4UWKA 3RRMB 1NZNA 2PQRA 4H7XA 3FUNA 1DNPA 2AXUA 3LS8A 3ZHEA 1OWNA 2FF4A 3L17A 3MV2B 1EDUA 4K0RA 4QFVA 1E7UA 3VTXA 5BV0A 2AVPA 3CVLA 3MKQA 5FZRA 5J08A 1Y6IA 2YQ8A 2R17C 2VGXA 1HFAA 2L9BA 4GAAA 1KT1A 4MS6A 1JWGA 2MHKA 4UI9C 3MEKA 4A55A 2KATA 2WXLA 4U07A 3LY7A 3UUXA 4B94A 4OVVA 3L54A 3NZUA 3SZ7A 4GCNA 1HU3A 2RG8A 3Q5MA 2HO1A 4GU5A 3FDHA 2BUGA 4HVBA 4U04A 3ZPJA 3PDNA 4KZCA 1UN8A 3U9WA 4I6EA 4OYSA 3CQGB 1TJCA 4TV3A 1NP7A 3FH5A 3NF1A 4BTBA 3FTWA 3JQ0A 3ASDA 4FA6A 2C0MA 3PZDA 2EQXA 3MX3A 4WWOA 1E8YA 1WM5A 1ELWA 5AJDA 3RRNB 3VLDA 3PS6A 4NRHB 2WXPA 3PNTB 3TL5A 3KAEA 3QKYA 3S2AA 3JQ1A 2JEKA 3B7RL 3FTYA 4UI9J 2J07A 1S0PA 2X6FA 2HM8A 3IEGA 4R7LA 3EDTB 5M72A 2A4ZA 5BT1A 1N52A 4UQYA 4I9EA 1Z3XA 3ESLA 5E75A 3OTNA 1XNFA 5JJ7A 3VLEA 3FUEA 5FJYA 2GW1A 2WXHA 3FUIA 4I9CA 3ASHA 4L23A 2UY1B 3FU6A 3G2TA 3G2VA 4I17A 3S7BA 4AEZC 5LFAA 3FWVA 1ELKA 4N3AA 4EZJA 2NSZA 4RG6A 2HYZA 3UT7A 3ZHEB 2YHEA 2AW6A 4M3OA 5AYWD 5BPPA 2WXOA 1H6KA 4MLPA 2XCCA 3D9MA 3TAXA 4CDNA 2A5UA 3WXXA 1HZ4A 3E4BA 3MKQB 4XKCA 3ONKA 5CCLA 1UG3A 2VGXB 3SGHA 2KC7A 3T5XA 4AXHA 1ZBPA 2CG3A 4GA1A 5FQ4A 3MA5A 2IOSA 1SZAA 4I1MA 3SBSA 4GYWA 2M63A 2NXPA 2WXQA 3LY8A 5CCMA 4GB9A 2BTDA 4AJWA 3IV0A 3AS5A 3N71A 4PDXA 3FUDA 3FTZA 3UPVA 2I2OA 3FEYA 4G26A 4JEHA 3BEEA 4I6JA 4FP7A 4J8SA 1KT0A 5J90A 4KVMA 4UWFA 3UT4A 2WXNA 3OXFA 3CK8A 3CVQA 3LEWA 1E90A 4AOFA 4EZKA 2IF4A 4YVQC 5ARGA 5G2NA 3B7UX 1HX8A 1EF1C 2E0IA 4JHKA 4GA2A 4K03A 3FUFA 5FQ8A 1FCHA 5JHBA 2VTBA 4BX9A 2WVIA 3LYAA 1IQRA 4Q94A 3QC1A 4N3CA 3FH8A 3TGOA 4JC8A 4KT6B 4XZ4A 3D9OA 4LUNU 2XGSA 3ZYLA 5KJLA 3PEUB 4ACLA 2GRLA 3CIAA 4E85A 2JLBA 1HE8A 4LERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNF A;  3Q4A B;  3ZFW A;  4U0U A;  5DBK A;  3CKB A;  3PE3 A;  3ULQ A;  2E2E A;  2YHC A;  3ASF A;  1ELR A;  2C2L A;  4YND A;  4G23 A;  4KYO B;  3Q49 B;  4U0Z A;  4J8D A;  4ME2 A;  4AM9 A;  5FTP A;  5BW8 C;  5G04 C;  4WNE A;  4HOR A;  3QWP A;  4IN3 B;  4G25 A;  3KD7 A;  2QFC A;  3S7D A;  4J8E A;  5EX0 A;  2FBN A;  5G05 C;  4WNG A;  3ASG A;  3KS2 A;  4XI9 A;  4LEU A;  5HQ8 A;  3Q47 B;  3ZN3 A;  2XGM A;  3S7J A;  5EKQ D;  4I2Z A;  3ESK A;  5G04 J;  3CK9 A;  5FZS A;  4G1T A;  1IHG A;  1QQE A;  2I6H A;  3AS4 A;  4HOU A;  2FEZ A;  3TG5 A;  1E96 B;  1QZ2 A;  5G05 J;  3RKV A;  3S7F A;  4F3V A;  4AY6 A;  3CK7 A;  3K9I A;  3RO2 A;  3QDN A;  4Y6C A;  1W3B A;  3RJV A;  2WPV A;  3HYM B;  4GZ3 A;  5BNW A;  4J8F A;  4HOT A;  2XPI A;  3LPZ A;  4BWR A;  3R9A B;  3SF4 A;  4GYY A;  1KLX A;  2XGO A;  2HR2 A;  5EX3 A;  2PL2 A;  4I2W A;  3FFL A;  5D0Q D;  4O6F A;  5A7D B;  5KJM A;  4WUY A;  4GPK A;  4UQX A;  2PZI A;  2KCL A;  2Q7F A;  4GZ6 A;  3RO3 A;  3U4T A;  3OXL A;  3CV0 A;  4NQ0 A;  3PE4 A;  2OOE A;  4GCO A;  3MKR A;  5FT9 A;  3VTY A;  2Y4U A;  3RU0 A;  1B89 A;  2KCK A;  5CHE E;  1IYG A;  4YVO A;  1HH8 A;  4CGV A;  4WND A;  2J9Q A;  2L6J A;  3RIB A;  2VSN A;  3GZ1 A;  2UWJ G;  4BT8 A;  2NC9 A;  5KJK A;  5KJN A;  4N2Q A;  1NA3 A;  3FP3 A;  2OND A;  1ZU2 A;  1Y8M A;  4HOQ A;  5ARF A;  3CVN A;  4KBQ A;  2FO7 A;  2C0L A;  4H7Y A;  2VYI A;  5JJT A;  2FI7 A;  1PC2 A;  4A1S A;  1NA0 A;  4XI0 A;  4JA9 A;  2VGY A;  4UQZ A;  3U3W A;  1WAO 1;  5LCW C;  2DBA A;  4GA0 A;  5D0O D;  2Y4T A;  2VQ2 A;  4HOS A;  4I1A A;  1A17 A;  3GZ2 A;  4N3B A;  4RG9 A;  4GYO A;  4AIF A;  2LNI A;  4EQF A;  1OUV A;  4N2S A;  5JJ6 A;  1P5Q A;  4XIF A;  4W9R A;  5A6C A;  5HI7 A;  5LCW J;  3MV3 B;  3GW4 A;  4JL0 A;  3Q15 A;  3GYZ A;  4CGW A;  4N5C A;  3UQ3 A;  3JYS A;  4N39 A;  5C1D A;  3OXG A;  4BT9 A;  2XEV A;  3ZGQ A;  1HXI A;  3QOU A;  4G24 A;  4G2V A;  4JA7 A;  3LKU A;  4CDR A;  2KCV A;  1YA0 A;  3O48 A;  2WQH A;  4UI9 K;  2VSY A;  5FZQ A;  2XCB A;  4AY5 A;  3TG4 A;  4ABN A;  4J0U A;  2LSU A;  3LCA A;  3QWW A;  2IFU A;  2V5F A;  4BTA A;  4KXK B;  4GZ5 A;  4Y6W A;  4APO A;  2P58 C;  2PQN A;  3URZ A;  3AS8 A;  3QWV A;  3CKC A;  4U0S A;  3CVP A;  2LSV A;  3LY9 A;  4JHR A;  2R5S A;  3CEQ A;  2UY1 A;  1NZN A;  2PQR A;  4H7X A;  3ZHE A;  2FF4 A;  3MV2 B;  3VTX A;  2AVP A;  3CVL A;  5FZR A;  2YQ8 A;  2VGX A;  1KT1 A;  2MHK A;  4UI9 C;  3MEK A;  2KAT A;  4U07 A;  4B94 A;  3LY7 A;  3UUX A;  3SZ7 A;  4GCN A;  3Q5M A;  2HO1 A;  2BUG A;  4U04 A;  3ZPJ A;  3PDN A;  1TJC A;  3NF1 A;  4BTB A;  3ASD A;  2C0M A;  1WM5 A;  1ELW A;  4NRH B;  3KAE A;  3QKY A;  4UI9 J;  3IEG A;  3EDT B;  5M72 A;  5BT1 A;  4UQY A;  4I9E A;  5JJ7 A;  1XNF A;  5FJY A;  2GW1 A;  4I9C A;  3ASH A;  2UY1 B;  4I17 A;  3S7B A;  3FWV A;  4N3A A;  4RG6 A;  2HYZ A;  3ZHE B;  5AYW D;  2XCC A;  3TAX A;  3WXX A;  1HZ4 A;  3E4B A;  5CCL A;  2VGX B;  2KC7 A;  1ZBP A;  4GA1 A;  3MA5 A;  4GYW A;  3LY8 A;  5CCM A;  3AS5 A;  3N71 A;  3UPV A;  4G26 A;  3BEE A;  1KT0 A;  3OXF A;  3CK8 A;  3CVQ A;  2IF4 A;  4YVQ C;  5ARG A;  4GA2 A;  1FCH A;  3LYA A;  4N3C A;  3TGO A;  5KJL A;  2XGS A;  2JLB A;  5DIZ A; 
#chains in the Genus database with same CATH topology
 3CSF A;  4WNF A;  4EEC A;  3PZ1 A;  2XS1 A;  2X6K A;  3PE3 A;  4J7W A;  2E2E A;  3ASF A;  3LDZ A;  2DVW A;  4URK A;  5FWQ A;  4J8D A;  5CMY A;  3CST A;  2AXV A;  5FTP A;  5BW8 C;  3LJ3 A;  5ANR A;  2RD0 A;  2MYO A;  4HOR A;  4HXI A;  3D3M A;  3QWP A;  1FT1 A;  4UWH A;  1K1A A;  2OV8 A;  4EZL A;  5G05 C;  1E8W A;  2XZD G;  3ZN3 A;  2XGM A;  2CG2 A;  3S7J A;  4HLL A;  1BI8 B;  3HXB A;  2IU1 A;  3CQC B;  1FVH A;  4YDE A;  2KZT A;  3S7F A;  3FY4 A;  4YDY A;  3CK7 A;  5CEA A;  2Y3A A;  4UUC A;  4FU3 A;  3RO2 A;  3QK0 A;  1X5B A;  2VSO E;  3BUA A;  4GZ3 A;  4F1S A;  4HOT A;  3LPZ A;  2QC9 A;  3SF4 A;  2XGO A;  3E30 A;  3ML9 A;  1TJF A;  2F37 A;  3AAA C;  3B13 A;  4GTP A;  5EX3 A;  3FFL A;  3T8K A;  5CEC B;  1SA5 A;  5A7D B;  2YIN A;  3P1U A;  2WXI A;  1S63 A;  3LVQ E;  3HHM A;  1H2T C;  3B7S A;  3MZL B;  4CT0 A;  3OXL A;  2WXG A;  3EHQ A;  2V4L A;  4HRL A;  1UN9 A;  4CRW A;  2V0P A;  3T5V A;  2KZT B;  2Y4U A;  5AQ9 A;  4DUI A;  4TRQ A;  3EIJ A;  5EN5 D;  3RU0 A;  3EIQ C;  1B89 A;  1OWM A;  2KCK A;  3G2W A;  5CHE E;  1H19 A;  4BSZ B;  2J9Q A;  2L0T B;  5T8I A;  2UWJ G;  2NC9 A;  1NA3 A;  4A3V A;  2X6J A;  4ATG A;  1ZU2 A;  4HOQ A;  4GTT A;  3W9G A;  1N95 A;  2J4D A;  1OCC E;  2FO7 A;  4XX5 A;  5LOZ A;  5ENO D;  2AWI A;  4H7Y A;  4NAC A;  2VYI A;  5JJT A;  1NA0 A;  2AJA A;  4L7T A;  4XI0 A;  3PRE A;  1OY3 D;  3RK6 A;  1TN8 A;  3Q78 A;  2Y4T A;  3ISM C;  4LNU D;  4N3B A;  4RG9 A;  4OAV B;  1OWP A;  5C2Y A;  2WXK A;  3PH0 C;  4HB5 A;  4EQF A;  1OUV A;  4ACK A;  5JJ6 A;  4XIF A;  4W9R A;  4O1P A;  4LRZ A;  3GW4 A;  4JL0 A;  4CEM A;  4N5C A;  1PAQ A;  2Y1L E;  3SBT B;  5KWD A;  4JVS A;  5ENN A;  3KSQ A;  3R9M A;  3EJN A;  3OXG A;  3C3R A;  3ZRH A;  2EIK E;  3EHN A;  4LG6 A;  3ZGQ A;  1HXI A;  2R2L A;  3CLJ A;  3ZEF A;  2KM4 A;  3QOU A;  2XPY A;  3ZU7 B;  3L22 A;  3C3Q A;  1MX2 A;  3GZS A;  3PEV B;  2WQH A;  4UI9 K;  4FAD A;  1FT2 A;  1MX6 A;  2EIL E;  3HG0 D;  4AY5 A;  1DC2 A;  2XEH A;  3NOG D;  3FHE A;  4ABN A;  2IFU A;  1IHB A;  1U3D A;  3HXE A;  2OVB A;  1MYO A;  3FUK A;  4GZ5 A;  4RQI A;  4EHM A;  4RVB A;  1N9A A;  1INZ A;  2PQN A;  2WB2 A;  3QWV A;  2F8Y A;  1BU9 A;  3LY9 A;  4MRU A;  3D9N A;  5CRV A;  4GTR A;  3RRM B;  3UM0 A;  5JMN D;  1OWN A;  3MV2 B;  4GTV A;  1KZO A;  2BKG A;  2YQ8 A;  5HS0 A;  1KT1 A;  2KAT A;  3NZU A;  1KPS B;  3Q5M A;  4NIK A;  4GU5 A;  3FDH A;  4U04 A;  3PDN A;  4U8V D;  3FH5 A;  4BTB A;  4WWO A;  1E8Y A;  3TWR A;  1ELW A;  1NI1 A;  3PZ2 A;  3RRN B;  4O1O A;  3VLD A;  2PNN A;  3B7R L;  2J07 A;  1S0P A;  3EDT B;  2A4Z A;  5EIL A;  3EHR A;  5BT1 A;  4L9P A;  1RZ4 A;  1XNF A;  4L23 A;  3G2V A;  5LFA A;  3S7B A;  1YCS B;  2AW6 A;  3TWS A;  5BPP A;  2WXO A;  2XCC A;  4O60 A;  4CDN A;  3WXX A;  3ONK A;  2IEJ A;  5CCL A;  4YDO A;  4AXH A;  5FQ4 A;  2IOS A;  2NXP A;  4Z68 A;  1SA4 A;  3TWV A;  4AJW A;  5CBO A;  3IV0 A;  3FUD A;  2R03 A;  3BEE A;  4I6J A;  4J8S A;  1KT0 A;  4UWF A;  2WXN A;  1E90 A;  2IF4 A;  4YVQ C;  1O1S A;  5ARG A;  3B7U X;  4K03 A;  3FUF A;  5FQ8 A;  3Q9N C;  5B3S E;  4LNB A;  3FH8 A;  2ZXW E;  3UIO C;  1HE8 A;  4HNA D;  2H6I A;  1Z6T A;  1H2U A;  5EDS A;  3CKB A;  2CHZ A;  3EU9 A;  3UIP C;  3DSS A;  2RKK A;  3QJZ A;  4U96 D;  1V54 E;  2C2L A;  4YND A;  3CHR A;  3Q49 B;  4FHK A;  3B95 A;  3PZ3 A;  5G04 C;  4WNE A;  2VJ8 A;  1YYH A;  5KBA A;  4DRX E;  4G25 A;  5CBN A;  4J8E A;  5EX0 A;  4U63 A;  3CHM A;  3KS2 A;  4XI9 A;  4LEU A;  2OEV A;  4APF A;  3ABK E;  3FTV A;  3FTS A;  2XRY A;  1AP7 A;  1O1R A;  1QQE A;  3FH7 A;  3ABL E;  3DXM G;  4G8L A;  5D2M C;  3AS4 A;  4HOU A;  4KMO A;  2P9N G;  1DCQ A;  1H6O A;  1QZ2 A;  2X3M A;  5G05 J;  4F3V A;  3CVW A;  1TEZ A;  2IOL A;  5EYP F;  4WWN A;  3QDN A;  2V4H C;  3RJV A;  2AXZ A;  3MYV A;  1HG2 A;  4GYY A;  4F7A A;  4F53 A;  3J5Q B;  2PL2 A;  5EIB E;  1WDY A;  4I2W A;  1NFI E;  3L13 A;  2J09 A;  1OXJ A;  5KJM A;  3V2X A;  4WUY A;  4UQX A;  4K5C A;  1N4Q A;  4TXR A;  4GTO A;  1UJK A;  4L2L A;  3RO3 A;  1OWL A;  3C3O A;  1ZB1 A;  3PE4 A;  5ENP D;  2OCC E;  5KCM A;  2J49 A;  3ASN E;  5AJL A;  3ONL A;  4PUC A;  3ZYQ A;  2ETB A;  2P9K G;  3FUH A;  4HFG A;  3ZIM A;  3ASO E;  3V31 A;  3DSX A;  4WND A;  5BXU A;  4B89 A;  3CR3 A;  3RIB A;  4BX8 A;  4B0Z A;  2L6B A;  3DRA A;  3D9L A;  4BT8 A;  2WM9 A;  3TXN A;  1L5J A;  3ZNG A;  1QBQ A;  3LJN A;  2OND A;  3R7R A;  1Y8M A;  4ANX A;  4CT4 A;  3IKO B;  3CHQ A;  4KBQ A;  3UTM A;  3G2U A;  2C0L A;  3B7T A;  4AVX A;  4G11 A;  1PC2 A;  2PM6 A;  3PNL B;  4JA9 A;  4UQZ A;  1LD8 A;  1WAO 1;  3ENE A;  3E32 A;  3D9J A;  5D0O D;  2I1K A;  3AU5 A;  2VQ2 A;  1QNF A;  4L1B A;  5G55 A;  5D66 A;  2DYR E;  4Q69 A;  3FTX A;  3UI2 A;  4JEU A;  3PUJ A;  4N2S A;  2GRQ B;  3SNX A;  5AN8 A;  1P5Q A;  1OWO A;  3CVY A;  4Q96 A;  5A6C A;  3J5P A;  2CHW A;  1OCZ E;  3MV3 B;  3ULE G;  1U2V G;  5BUZ A;  1JWF A;  3Q15 A;  3GYZ A;  4DK5 A;  5CED B;  4KZ0 A;  4JPS A;  4DJA A;  2J8S D;  3CVX A;  3W9F A;  3HIZ A;  3D9P A;  3AG2 E;  1O1T A;  2QY7 A;  2CFU A;  4D10 C;  3CGH A;  1IQU A;  2XEV A;  4EBA G;  3O4Z A;  2XS8 A;  3ULY A;  3NQP A;  1H0A A;  1S64 A;  3MCX A;  4JA7 A;  4CDR A;  5AEN A;  3DSV A;  1YA0 A;  3WG7 E;  1Q2Z A;  4HLE A;  1Z3Y A;  5T3R A;  2VSY A;  5FZQ A;  3E33 A;  2XCB A;  2X6I A;  3TG4 A;  4JB8 P;  2VSX E;  3X2Q E;  3SI5 A;  3APD A;  4APO A;  3RAU A;  3AS8 A;  5CMW A;  2BF0 X;  3UXG A;  2R5S A;  3CEQ A;  2UY1 A;  4DX1 A;  2R05 A;  4H7X A;  4M7C A;  3FUN A;  1DNP A;  2AXU A;  3LS8 A;  2ZGG A;  3ZHE A;  4GTQ A;  1E7U A;  3MKQ A;  4GAA A;  1N0Q A;  4UI9 C;  4U07 A;  3UUX A;  4OVV A;  3SFY A;  4GCN A;  1HU3 A;  2BUG A;  4HVB A;  1BLX B;  3TWW A;  5B1B E;  1TJC A;  4TV3 A;  2P9S G;  3NF1 A;  3FTW A;  3JQ0 A;  3ASD A;  3PZD A;  3MX3 A;  1WM5 A;  1IKN D;  1AWC B;  4HRN A;  2WXP A;  3JXI A;  3S2A A;  3JQ1 A;  2JEK A;  2X6F A;  2XEE A;  3HXD A;  5M72 A;  5CER B;  1N52 A;  3ESL A;  5E75 A;  2WXH A;  2QYU A;  2UY1 B;  4AEZ C;  4I17 A;  2ETC A;  3FWV A;  1ELK A;  1LD7 A;  4DX6 D;  4N3A A;  3ZHE B;  3D9M A;  1HZ4 A;  3MKQ B;  3TWX A;  2KC7 A;  4GA1 A;  1TNZ A;  2ZIR A;  3SBS A;  4GYW A;  2M63 A;  2WXQ A;  3LY8 A;  2DYS E;  4GTM A;  3DSU A;  2I2O A;  3FEY A;  4G26 A;  4FP7 A;  3HRA A;  3UT4 A;  3CK8 A;  4EZK A;  5G2N A;  1HX8 A;  3UKR G;  4GA2 A;  1FCH A;  3UIN C;  5JHB A;  3SFX A;  2VTB A;  4X8Q A;  3QC1 A;  4N3C A;  4KT6 B;  2VGE A;  3ZUV B;  4ACL A;  4E85 A;  2JLB A;  2OEW A;  5DIZ A;  1GW6 A;  3Q73 A;  1N4P A;  3Q4A B;  4JXT A;  3ZFW A;  4JZY A;  4U0U A;  5DBK A;  3AU4 A;  2YHC A;  3AG3 E;  4G23 A;  4KYO B;  2JAB A;  4MBG A;  4U0Z A;  4AM9 A;  4JHJ A;  4AV7 A;  4PH4 B;  4XKB A;  3OAW A;  2XRZ A;  4C9B B;  4ATZ D;  4LCT A;  4J6I A;  2IJG X;  3I5P A;  3FUJ A;  1Z5S C;  2FBN A;  4FUL A;  3ASG A;  4DX5 D;  1EYH A;  3Q47 B;  2OVF A;  3V2O A;  3PVL A;  3HXC A;  5EKQ D;  4I2Z A;  3ESK A;  2P9L G;  5G04 J;  1KZP A;  1N0R A;  4ZHB A;  5FZS A;  4G1T A;  1NL4 A;  2WQ7 A;  4GMJ A;  4F6R D;  3E37 A;  2I6H A;  2FEZ A;  1FVF A;  3TG5 A;  1E96 B;  2LAI A;  4AY6 A;  3L08 A;  1E7V A;  4BES A;  2H6G A;  4Y6C A;  2WPV A;  2GRM A;  1HS6 A;  2LUH A;  2XPZ A;  5EID A;  5AQA A;  3FTU A;  4BWR A;  4FLB A;  1S70 B;  3ABM E;  4OAU C;  2HR2 A;  3DST A;  4U95 D;  1DCE A;  4EBA A;  2P2C P;  4DX2 A;  4HQD A;  5LX8 A;  3UM3 A;  4HI9 A;  4I6G A;  1UOH A;  5H7P A;  1SZ9 A;  4GPK A;  2I1J A;  2LXL A;  3IHY A;  3U66 A;  4GZ6 A;  1IXV A;  3CV0 A;  2X6H A;  4NQ0 A;  2FUL A;  4GCO A;  3MKR A;  2HE0 A;  4BFR A;  4CCA A;  3VTY A;  3ML8 A;  4A63 B;  2LAH A;  2MRI A;  4NUR A;  5BXO A;  1OCR E;  4CDM A;  4UWL A;  4YVO A;  1HH8 A;  2BED A;  1BD8 A;  4CGV A;  3APF A;  1LF8 A;  2L6J A;  3FU3 A;  2VSN A;  3HDX A;  2ZIS A;  5KJK A;  5KNH D;  1H2V C;  3CVV A;  4WAF A;  3D9K A;  4TUU A;  1N94 A;  1DVP A;  3QAR A;  3TXM A;  4B8A A;  2WXR A;  4GMR A;  4GZD A;  4FC8 A;  3BG1 B;  3L6A A;  3C72 A;  1UJJ A;  1V55 E;  2VGY A;  3U3W A;  2ZU6 B;  3FUM A;  5LCW C;  2P9U G;  2YNQ A;  2DBA A;  2GRR B;  2IY0 C;  2EIM E;  3APC A;  1JCS A;  4ILI A;  1MX4 A;  4HOS A;  1A5E A;  5B1A E;  3U64 A;  4LNG A;  3PRZ A;  4BEP A;  3QNK A;  4PS8 A;  2QYJ A;  4C0E A;  4ILG A;  5A23 A;  3Q75 A;  2IO3 C;  3DSW A;  3ZYK A;  1TNY A;  3CVU A;  3JCK C;  4DPR A;  2XEN A;  1D9S A;  3TJP A;  4N39 A;  1U3C A;  4GML A;  4ANV A;  4BT9 A;  4IYP A;  1D8D A;  4MKT A;  1O5M A;  4G24 A;  4G2V A;  1WG0 A;  2KCV A;  2CFZ A;  4TXQ A;  4A3T A;  4I43 A;  5E76 A;  2PM7 A;  2IQC A;  4FJY A;  5FIN A;  3JUE A;  3KEZ A;  4JD2 G;  3LCA A;  3KSL A;  3QWW A;  3TWQ A;  2V5F A;  4CYM D;  4RLY A;  4BTA A;  4GTS A;  4HBD A;  3EHM A;  4Y6W A;  4JW1 A;  2P58 C;  1E8X A;  3URZ A;  1EPU A;  4RSY A;  4QQI A;  3PUK A;  4U0S A;  4XEI G;  2LSV A;  1VDY A;  3LVR E;  4ANU A;  4UWK A;  1NZN A;  2PQR A;  4G8K A;  4K5B A;  4QFV A;  3VTX A;  3CVL A;  5J08 A;  1Y6I A;  4TXP A;  2VGX A;  5ITZ F;  2L9B A;  2KBX A;  4MS6 A;  1JWG A;  3MEK A;  4B94 A;  3LY7 A;  3L54 A;  2RG8 A;  2HO1 A;  2LXM A;  3DEP A;  2Y0B G;  1X81 A;  2R02 A;  4HI8 A;  3ZPJ A;  4KZC A;  1UN8 A;  3U9W A;  4OYS A;  2FO1 E;  1G3N B;  2EQX A;  1YMP A;  4NRH B;  3TL5 A;  4UI9 J;  2HM8 A;  3IEG A;  2RFA A;  3OTN A;  1JCQ A;  2P9P G;  3FUI A;  4I9C A;  3ASH A;  3G2T A;  2NSZ A;  4RG6 A;  4BET A;  4MLP A;  1H6K A;  5AAR A;  1TNU A;  4XKC A;  5JA4 D;  1UG3 A;  2VGX B;  1D8E A;  1ZBP A;  3MA5 A;  2GRN B;  3NBN B;  4GB9 A;  5ENR D;  4PDX A;  2Y69 E;  3FTZ A;  4JEH A;  3OXF A;  3CVQ A;  4AOF A;  1EF1 C;  1TR4 A;  3NOC D;  4JHK A;  2EIN E;  3TWT A;  3ZKJ A;  3LYA A;  4Q94 A;  4LSZ E;  3V79 K;  3TGO A;  4JC8 A;  4XZ4 A;  3ZYL A;  5KJL A;  1N4S A;  1JCR A;  2GRL A;  3CIA A;  3PZ4 A;  2P9I G;  2GGF A;  3UM2 A;  5AQ7 A;  2J08 A;  3ZXP A;  5T4Y A;  4FHJ A;  3KEA A;  1MJ0 A;  4FJZ A;  3ULQ A;  4ILH B;  1K1B A;  5FQ7 A;  1ELR A;  3CHP A;  5JHA A;  4ME2 A;  5ENS D;  3FU0 A;  3L16 A;  4PS7 A;  1HO8 A;  4IRU A;  4UWG A;  3SD5 A;  1JPL A;  1BI7 B;  4IN3 B;  3FEX A;  1N54 A;  4J8Y A;  3KD7 A;  2QFC A;  3S7D A;  4IUL A;  4WNG A;  5HQ8 A;  2F8X K;  1RW2 A;  4I1O B;  2XZT G;  3QAQ A;  3MJW A;  5BV1 A;  3DPD A;  4DI3 A;  4DLQ A;  3DXK G;  3CK9 A;  1MQS A;  2CHX A;  1IHG A;  1K8K G;  2B0O E;  2EIJ E;  4U8Y D;  1OCO E;  3RKV A;  3QB2 A;  2H6H A;  2BKK B;  3K9I A;  3NAW A;  5HRY A;  4V3I A;  2X38 A;  1HF8 A;  4DLO A;  3VLF A;  1W3B A;  3HYM B;  3C98 A;  3ZYM A;  5BNW A;  4J8F A;  2XPI A;  3R9A B;  1KLX A;  3IHV A;  2WMO A;  2V8S E;  4A1G A;  3AG1 E;  5EYL A;  4TUM A;  3FUL A;  5D0Q D;  4BY6 A;  4O6F A;  3I4G A;  2DCP A;  3DBS A;  1SW6 A;  2DZN A;  2PZI A;  3NZS A;  2KCL A;  3DEO A;  4ZFH A;  2L0I A;  2MOW A;  1TNB A;  3SFZ A;  3UKU G;  1XGW A;  1SQM A;  4B8C B;  2Q7F A;  1N4R A;  3V30 A;  3U4T A;  3LXU X;  3FU5 A;  2I9C A;  2WMN A;  2OOE A;  1MHQ A;  2XHE A;  5FT9 A;  4HRM B;  2QZA A;  3I3N A;  2LO6 A;  3NB2 A;  2WXJ A;  3HVE A;  3IBE A;  4BER A;  4C0M A;  1IYG A;  3ZVV A;  2J4B A;  3R7Q A;  2H6F A;  3MGB A;  3GZ1 A;  2XQ0 A;  3B7B A;  5FQ6 A;  4DI4 A;  5KJN A;  3JUI A;  4N2Q A;  4U7E B;  2WXF A;  3FP3 A;  2DIW A;  3UX4 A;  3D9I A;  2KXP C;  3Q7A A;  5ARF A;  2DWZ A;  3CVN A;  1LTX A;  4AP2 A;  2VTB B;  1TYQ G;  4E6H A;  4GPM A;  3ZXS A;  2FI7 A;  2ILR A;  4HS2 A;  4A1S A;  2WQ6 A;  3UMV A;  3AG4 E;  3UM1 A;  3AJI A;  5CRU A;  3TWU A;  1H6P A;  4GA0 A;  3HVE B;  4L2Y A;  1JUQ A;  3L82 A;  4XE0 A;  4ANW A;  5IY5 E;  3SQV A;  2V5Q C;  4I1A A;  1A17 A;  3GZ2 A;  4N5Q A;  4OVU A;  4GYO A;  3T9K A;  3ZW3 A;  4EPZ A;  4AIF A;  2LNI A;  5AIJ A;  3UT8 A;  3C5R A;  3RRU A;  4PS3 A;  2RFM A;  5HI7 A;  5LCW J;  4KVO A;  4YDW A;  3T8M A;  5ANL A;  4WWP A;  1N11 A;  4K5A B;  1WY6 A;  4CGW A;  5HKP A;  3UQ3 A;  1E8Z A;  3JYS A;  4P29 A;  1FPP A;  3SHF A;  4FLH A;  5C1D A;  3BG0 B;  3I4R B;  5LP0 A;  3P2B A;  3LKU A;  4U8H A;  2WXM A;  3O48 A;  1PY1 A;  4GZC A;  5FIO A;  2ZGD A;  3CHS A;  4C48 B;  2R59 A;  2ETA A;  3G2S A;  4BSX A;  1UW4 B;  4J0U A;  2LSU A;  3CHO A;  1TN7 A;  4KXK B;  3BU8 A;  4CZ2 D;  2ION A;  2IO2 C;  3F6Q A;  3E34 A;  1HG5 A;  1BPO A;  3CKC A;  3CVP A;  4JHR A;  3D9H A;  2F0Y A;  3Q79 A;  2GRO B;  5ENQ D;  2FF4 A;  3L17 A;  1EDU A;  4K0R A;  4DX7 D;  5BV0 A;  2AVP A;  5FZR A;  2R17 C;  3EU5 A;  1HFA A;  2MHK A;  4A55 A;  2WXL A;  3SZ7 A;  3RSE G;  3Q7F A;  5AQB A;  2A5E A;  1TNO A;  3Q9U C;  4I6E A;  3CQG B;  1NP7 A;  4FA6 A;  3SY2 A;  2C0M A;  1K3Z D;  3L9T A;  5AJD A;  2NYJ A;  3PS6 A;  3DWL G;  3PNT B;  3KAE A;  3QKY A;  1SVX A;  3FTY A;  3BQO A;  4R7L A;  3IXE A;  4UQY A;  4I9E A;  1Z3X A;  1QYM A;  5JJ7 A;  3VLE A;  3FUE A;  1OT8 A;  5FJY A;  2GW1 A;  3FU6 A;  2DZO A;  4EZJ A;  2HYZ A;  3UT7 A;  2GRP B;  2YHE A;  4M3O A;  5AYW D;  3TAX A;  4F1P A;  2A5U A;  3E4B A;  3SGH A;  3T5X A;  2CG3 A;  1SZA A;  3HXF A;  4I1M A;  3DPY A;  5CCM A;  2BTD A;  5AAO A;  3AS5 A;  3N71 A;  3JXJ A;  3SO8 A;  3UPV A;  5J90 A;  1TN6 A;  1MZC A;  4KVM A;  3LEW A;  5KNG A;  2E0I A;  3EUV A;  4BX9 A;  2B6C A;  2WVI A;  1IQR A;  3D9O A;  4LUN U;  2XGS A;  3PEU B;  4B93 B;  5ENT D;  4LER A; 
#chains in the Genus database with same CATH homology
 3CSF A;  1GW6 A;  4WNF A;  2J08 A;  3Q4A B;  5T4Y A;  4FHJ A;  4EEC A;  4JXT A;  1Z6T A;  3ZFW A;  4FJZ A;  1H2U A;  4JZY A;  4U0U A;  5EDS A;  2X6K A;  5DBK A;  3CKB A;  3AU4 A;  3PE3 A;  2CHZ A;  3ULQ A;  4ILH B;  3QJZ A;  2E2E A;  2YHC A;  3ASF A;  5FQ7 A;  1ELR A;  2C2L A;  3CHP A;  4YND A;  4G23 A;  4KYO B;  3CHR A;  3LDZ A;  3Q49 B;  4FHK A;  4U0Z A;  4URK A;  5FWQ A;  4J8D A;  5CMY A;  5JHA A;  3CST A;  4ME2 A;  2AXV A;  4AM9 A;  5FTP A;  5BW8 C;  3LJ3 A;  5ANR A;  5G04 C;  4JHJ A;  4AV7 A;  2RD0 A;  3FU0 A;  3L16 A;  4PS7 A;  1HO8 A;  4IRU A;  2VJ8 A;  4UWG A;  4PH4 B;  4WNE A;  3OAW A;  4XKB A;  2XRZ A;  4HOR A;  4HXI A;  3SD5 A;  3D3M A;  4C9B B;  3QWP A;  1JPL A;  4IN3 B;  3FEX A;  4LCT A;  1N54 A;  4G25 A;  4UWH A;  2OV8 A;  4J6I A;  4EZL A;  2IJG X;  3KD7 A;  2QFC A;  3I5P A;  3S7D A;  3FUJ A;  4J8E A;  5EX0 A;  2FBN A;  4U63 A;  4FUL A;  5G05 C;  4IUL A;  4WNG A;  3ASG A;  3CHM A;  3KS2 A;  4XI9 A;  4LEU A;  5HQ8 A;  1E8W A;  4APF A;  1EYH A;  3Q47 B;  4I1O B;  2OVF A;  3ZN3 A;  2XGM A;  3PVL A;  2CG2 A;  3S7J A;  3QAQ A;  3FTV A;  3MJW A;  3FTS A;  5EKQ D;  4I2Z A;  2XRY A;  5BV1 A;  3DPD A;  4DI3 A;  2IU1 A;  3ESK A;  4DLQ A;  5G04 J;  3CK9 A;  3CQC B;  1MQS A;  5FZS A;  1FVH A;  2CHX A;  4G1T A;  1IHG A;  1QQE A;  3FH7 A;  2WQ7 A;  4GMJ A;  2I6H A;  3AS4 A;  4HOU A;  4KMO A;  2FEZ A;  1FVF A;  3TG5 A;  1E96 B;  1QZ2 A;  2KZT A;  2X3M A;  5G05 J;  3RKV A;  2LAI A;  3QB2 A;  3S7F A;  4F3V A;  4AY6 A;  3L08 A;  3CVW A;  3FY4 A;  1TEZ A;  2IOL A;  1E7V A;  3CK7 A;  2Y3A A;  3K9I A;  4FU3 A;  3RO2 A;  4V3I A;  2X38 A;  1HF8 A;  3QK0 A;  4WWN A;  4DLO A;  3QDN A;  1X5B A;  3VLF A;  4Y6C A;  1W3B A;  2VSO E;  3RJV A;  2AXZ A;  2GRM A;  2WPV A;  3HYM B;  4GZ3 A;  1HS6 A;  2XPZ A;  3C98 A;  3ZYM A;  4F1S A;  5BNW A;  4J8F A;  4HOT A;  3FTU A;  2XPI A;  2GGF A;  3LPZ A;  4BWR A;  3MYV A;  3R9A B;  4FLB A;  3SF4 A;  1HG2 A;  4GYY A;  1KLX A;  2XGO A;  4F7A A;  3IHV A;  3ML9 A;  2WMO A;  2V8S E;  4F53 A;  1TJF A;  4A1G A;  2HR2 A;  3B13 A;  5EX3 A;  2PL2 A;  3FUL A;  4EBA A;  4I2W A;  3FFL A;  5D0Q D;  3L13 A;  4O6F A;  4BY6 A;  2J09 A;  5A7D B;  5KJM A;  2YIN A;  4WUY A;  5LX8 A;  3I4G A;  4I6G A;  1SZ9 A;  4GPK A;  2DCP A;  4UQX A;  3DBS A;  2I1J A;  2PZI A;  3P1U A;  3NZS A;  2WXI A;  3LVQ E;  2KCL A;  3HHM A;  1H2T C;  2L0I A;  1UJK A;  2MOW A;  3SFZ A;  3B7S A;  3IHY A;  3U66 A;  1XGW A;  1SQM A;  3MZL B;  4B8C B;  2Q7F A;  4GZ6 A;  4L2L A;  3RO3 A;  3U4T A;  3LXU X;  4CT0 A;  1OWL A;  3FU5 A;  3OXL A;  2WXG A;  2I9C A;  3CV0 A;  2X6H A;  4NQ0 A;  2FUL A;  3PE4 A;  2V4L A;  2OOE A;  2WMN A;  4GCO A;  1MHQ A;  2XHE A;  1UN9 A;  3MKR A;  4CRW A;  2V0P A;  4BFR A;  5FT9 A;  4CCA A;  5KCM A;  2J49 A;  3T5V A;  2KZT B;  3I3N A;  3ONL A;  4PUC A;  5AJL A;  2LO6 A;  2Y4U A;  3VTY A;  3ZYQ A;  2WXJ A;  4TRQ A;  3HVE A;  3IBE A;  3EIJ A;  3ML8 A;  3FUH A;  3RU0 A;  3EIQ C;  4HFG A;  1B89 A;  1OWM A;  2LAH A;  2KCK A;  2MRI A;  4NUR A;  3G2W A;  5CHE E;  4CDM A;  4C0M A;  4UWL A;  1IYG A;  4YVO A;  3ZIM A;  1HH8 A;  1H19 A;  4CGV A;  4WND A;  3APF A;  3ZVV A;  1LF8 A;  2J9Q A;  4B89 A;  2L6J A;  3CR3 A;  3FU3 A;  2J4B A;  3RIB A;  4BX8 A;  2L0T B;  2VSN A;  5T8I A;  4B0Z A;  3HDX A;  3R7Q A;  3MGB A;  3GZ1 A;  2UWJ G;  3D9L A;  2XQ0 A;  4BT8 A;  5FQ6 A;  4DI4 A;  2NC9 A;  2WM9 A;  5KJK A;  5KJN A;  3JUI A;  3TXN A;  1NA3 A;  4N2Q A;  1L5J A;  1H2V C;  2WXF A;  3FP3 A;  2OND A;  2DIW A;  2X6J A;  3R7R A;  4A3V A;  4ATG A;  1ZU2 A;  3UX4 A;  3CVV A;  4WAF A;  1Y8M A;  3D9I A;  4HOQ A;  4ANX A;  4CT4 A;  3D9K A;  5ARF A;  4TUU A;  3IKO B;  3CVN A;  3CHQ A;  2J4D A;  4KBQ A;  1DVP A;  2FO7 A;  4XX5 A;  5LOZ A;  3QAR A;  3G2U A;  5DIZ A;  3TXM A;  4AP2 A;  2C0L A;  2AWI A;  4B8A A;  4H7Y A;  4NAC A;  2VTB B;  2WXR A;  3B7T A;  4GZD A;  4FC8 A;  3BG1 B;  4E6H A;  2VYI A;  3ZXS A;  4AVX A;  2FI7 A;  2ILR A;  3L6A A;  4G11 A;  4HS2 A;  1PC2 A;  4A1S A;  3UMV A;  1NA0 A;  2PM6 A;  2WQ6 A;  1UJJ A;  3PNL B;  4L7T A;  4XI0 A;  4JA9 A;  2VGY A;  4UQZ A;  3U3W A;  2ZU6 B;  3PRE A;  3FUM A;  1WAO 1;  5LCW C;  3ENE A;  2YNQ A;  2DBA A;  3D9J A;  3RK6 A;  4GA0 A;  5D0O D;  5JJT A;  2I1K A;  3HVE B;  3APC A;  4L2Y A;  2Y4T A;  1JUQ A;  4ILI A;  4XE0 A;  4ANW A;  3AU5 A;  2VQ2 A;  4HOS A;  4I1A A;  1A17 A;  3GZ2 A;  4N3B A;  1QNF A;  3U64 A;  4L1B A;  4RG9 A;  4OVU A;  5G55 A;  3PRZ A;  1OWP A;  4GYO A;  4EPZ A;  3ZW3 A;  4AIF A;  5C2Y A;  2LNI A;  2WXK A;  3PH0 C;  3FTX A;  4Q69 A;  4EQF A;  5AIJ A;  1OUV A;  4JEU A;  4ACK A;  3PUJ A;  3QNK A;  4N2S A;  4PS8 A;  5JJ6 A;  3SNX A;  1P5Q A;  1OWO A;  4C0E A;  3UT8 A;  3CVY A;  4Q96 A;  4XIF A;  4W9R A;  4ILG A;  4PS3 A;  3RRU A;  5A23 A;  5HI7 A;  5A6C A;  5LCW J;  4KVO A;  2CHW A;  4LRZ A;  3MV3 B;  3T8M A;  3GW4 A;  3ZYK A;  5ANL A;  5BUZ A;  1JWF A;  4JL0 A;  4CEM A;  4WWP A;  3Q15 A;  3GYZ A;  4DK5 A;  3CVU A;  3JCK C;  1WY6 A;  4CGW A;  4KZ0 A;  1PAQ A;  4N5C A;  4JPS A;  4DJA A;  3UQ3 A;  1E8Z A;  3SBT B;  4DPR A;  4JVS A;  5ENN A;  3CVX A;  3TJP A;  3JYS A;  3HIZ A;  3D9P A;  4N39 A;  1U3C A;  4P29 A;  4GML A;  4ANV A;  3EJN A;  2QY7 A;  2CFU A;  3SHF A;  4FLH A;  3OXG A;  5C1D A;  3ZRH A;  3BG0 B;  3I4R B;  4BT9 A;  3EHN A;  4D10 C;  5LP0 A;  3CGH A;  1IQU A;  2XEV A;  4IYP A;  4EBA G;  3O4Z A;  3ZGQ A;  1HXI A;  3CLJ A;  3P2B A;  4MKT A;  3ZEF A;  2KM4 A;  3NQP A;  1H0A A;  2XPY A;  3QOU A;  3L22 A;  3MCX A;  4G2V A;  3LKU A;  4G24 A;  4JA7 A;  4CDR A;  4U8H A;  3GZS A;  3PEV B;  2KCV A;  5AEN A;  2WXM A;  2CFZ A;  4A3T A;  1YA0 A;  3O48 A;  4I43 A;  2WQH A;  4UI9 K;  1PY1 A;  5E76 A;  4FAD A;  4HLE A;  4GZC A;  2PM7 A;  1Z3Y A;  2IQC A;  4FJY A;  5T3R A;  2VSY A;  5FZQ A;  3CHS A;  2XCB A;  2X6I A;  4AY5 A;  3TG4 A;  2R59 A;  3G2S A;  4BSX A;  3FHE A;  3KEZ A;  4ABN A;  1UW4 B;  4J0U A;  2VSX E;  2LSU A;  3LCA A;  3QWW A;  2IFU A;  2V5F A;  3CHO A;  4BTA A;  1U3D A;  4KXK B;  3SI5 A;  2OVB A;  3APD A;  3FUK A;  4GZ5 A;  3EHM A;  4Y6W A;  4JW1 A;  4APO A;  2ION A;  2P58 C;  4RVB A;  1INZ A;  1E8X A;  2PQN A;  2WB2 A;  3URZ A;  3AS8 A;  3QWV A;  5CMW A;  1EPU A;  4RSY A;  3PUK A;  1HG5 A;  1BPO A;  3CKC A;  2BF0 X;  4U0S A;  3CVP A;  2LSV A;  1VDY A;  3LVR E;  3LY9 A;  4JHR A;  4MRU A;  2R5S A;  4ANU A;  3D9N A;  3CEQ A;  2UY1 A;  4UWK A;  3RRM B;  1NZN A;  2PQR A;  4H7X A;  3FUN A;  1DNP A;  2AXU A;  3LS8 A;  3ZHE A;  1OWN A;  2FF4 A;  3L17 A;  3MV2 B;  1EDU A;  4K0R A;  4QFV A;  1E7U A;  3VTX A;  5BV0 A;  2AVP A;  3CVL A;  3MKQ A;  5FZR A;  5J08 A;  1Y6I A;  2YQ8 A;  2R17 C;  2VGX A;  1HFA A;  2L9B A;  4GAA A;  1KT1 A;  4MS6 A;  1JWG A;  2MHK A;  4UI9 C;  3MEK A;  4A55 A;  2KAT A;  2WXL A;  4U07 A;  3LY7 A;  3UUX A;  4B94 A;  4OVV A;  3L54 A;  3NZU A;  3SZ7 A;  4GCN A;  1HU3 A;  2RG8 A;  3Q5M A;  2HO1 A;  4GU5 A;  3FDH A;  2BUG A;  4HVB A;  4U04 A;  3ZPJ A;  3PDN A;  4KZC A;  1UN8 A;  3U9W A;  4I6E A;  4OYS A;  3CQG B;  1TJC A;  4TV3 A;  1NP7 A;  3FH5 A;  3NF1 A;  4BTB A;  3FTW A;  3JQ0 A;  3ASD A;  4FA6 A;  2C0M A;  3PZD A;  2EQX A;  3MX3 A;  4WWO A;  1E8Y A;  1WM5 A;  1ELW A;  5AJD A;  3RRN B;  3VLD A;  3PS6 A;  4NRH B;  2WXP A;  3PNT B;  3TL5 A;  3KAE A;  3QKY A;  3S2A A;  3JQ1 A;  2JEK A;  3B7R L;  3FTY A;  4UI9 J;  2J07 A;  1S0P A;  2X6F A;  2HM8 A;  3IEG A;  4R7L A;  3EDT B;  5M72 A;  2A4Z A;  5BT1 A;  1N52 A;  4UQY A;  4I9E A;  1Z3X A;  3ESL A;  5E75 A;  3OTN A;  1XNF A;  5JJ7 A;  3VLE A;  3FUE A;  5FJY A;  2GW1 A;  2WXH A;  3FUI A;  4I9C A;  3ASH A;  4L23 A;  2UY1 B;  3FU6 A;  3G2T A;  3G2V A;  4I17 A;  3S7B A;  4AEZ C;  5LFA A;  3FWV A;  1ELK A;  4N3A A;  4EZJ A;  2NSZ A;  4RG6 A;  2HYZ A;  3UT7 A;  3ZHE B;  2YHE A;  2AW6 A;  4M3O A;  5AYW D;  5BPP A;  2WXO A;  1H6K A;  4MLP A;  2XCC A;  3D9M A;  3TAX A;  4CDN A;  2A5U A;  3WXX A;  1HZ4 A;  3E4B A;  3MKQ B;  4XKC A;  3ONK A;  5CCL A;  1UG3 A;  2VGX B;  3SGH A;  2KC7 A;  3T5X A;  4AXH A;  1ZBP A;  2CG3 A;  4GA1 A;  5FQ4 A;  3MA5 A;  2IOS A;  1SZA A;  4I1M A;  3SBS A;  4GYW A;  2M63 A;  2NXP A;  2WXQ A;  3LY8 A;  5CCM A;  4GB9 A;  2BTD A;  4AJW A;  3IV0 A;  3AS5 A;  3N71 A;  4PDX A;  3FUD A;  3FTZ A;  3UPV A;  2I2O A;  3FEY A;  4G26 A;  4JEH A;  3BEE A;  4I6J A;  4FP7 A;  4J8S A;  1KT0 A;  5J90 A;  4KVM A;  4UWF A;  3UT4 A;  2WXN A;  3OXF A;  3CK8 A;  3CVQ A;  3LEW A;  1E90 A;  4AOF A;  4EZK A;  2IF4 A;  4YVQ C;  5ARG A;  5G2N A;  3B7U X;  1HX8 A;  1EF1 C;  2E0I A;  4JHK A;  4GA2 A;  4K03 A;  3FUF A;  5FQ8 A;  1FCH A;  5JHB A;  2VTB A;  4BX9 A;  2WVI A;  3LYA A;  1IQR A;  4Q94 A;  3QC1 A;  4N3C A;  3FH8 A;  3TGO A;  4JC8 A;  4KT6 B;  4XZ4 A;  3D9O A;  4LUN U;  2XGS A;  3ZYL A;  5KJL A;  3PEU B;  4ACL A;  2GRL A;  3CIA A;  4E85 A;  2JLB A;  1HE8 A;  4LER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...