1NA3A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
molecule keywords designed protein CTPR2
total genus 36
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na3A00
4GYWA 3ASGA 5ARGA 5KJNA 2VSYA 2PQNA 5JJ7A 4HOUA 4Y6WA 2JLBA 2ONDA 1ELRA 1QQEA 2PL2A 3QWPA 4I1AA 4I9EA 4N3BA 4U04A 4WNGA 4BTAA 1YA0A 3FFLA 3QWVA 4G25A 5M72A 3RIBA 4GZ3A 5DBKA 1HH8A 4XI9A 5BT1A 3KAEA 2PZIA 2Y4UA 3LKUA 4GZ5A 5LCWC 2XEVA 2Y4TA 4JHRA 4JA7A 4J0UA 3N71A 3CVQA 3RJVA 3VTXA 4I2WA 4N3AA 3QKYA 3AS8A 3QDNA 2BUGA 5EKQD 3BEEA 1NZNA 1KT0A 2LNIA 2OOEA 2VGYA 4I9CA 4NRHB 2I6HA 2MHKA 4G24A 4N5CA 2IF4A 4G1TA 5EX3A 5BNWA 2XCCA 2XGSA 2HR2A 3CK9A 4GYOA 4J8DA 3RO3A 5D0QD 3S7BA 4KYOB 4EQFA 2C0MA 5KJKA 2FEZA 3MV3B 3EDTB 3CVPA 3CVLA 4U0ZA 3GYZA 4W9RA 3HYMB 4J8EA 3SF4A 4UI9J 3UUXA 4F3VA 2YQ8A 4A1SA 4UQYA 2UWJG 4GYYA 3QOUA 4GCOA 5FTPA 3TG5A 2KATA 3RKVA 4GPKA 4Y6CA 3TGOA 2XPIA 1ELWA 4U0SA 5G04J 2C2LA 2DBAA 3PE3A 3S7JA 4CGVA 2C0LA 2FBNA 4HORA 4BT9A 4B94A 3FWVA 4HOQA 3ZFWA 4RG9A 3ZN3A 3CKBA 4APOA 1P5QA 1PC2A 4RG6A 4WNDA 3GZ1A 3Q15A 4GZ6A 4AM9A 3FP3A 3MA5A 3ESKA 4NQ0A 3S7FA 4BWRA 1FCHA 4XIFA 2XCBA 2GW1A 4H7YA 4N3CA 3R9AB 2J9QA 5JJTA 4CDRA 3MV2B 4JL0A 3S7DA 3LY8A 5A7DB 1HZ4A 1XNFA 2UY1B 3GZ2A 3MEKA 3URZA 4JA9A 2KCVA 4IN3B 2V5FA 3OXGA 4G26A 5BW8C 4J8FA 3RU0A 4HOSA 3LY7A 3AS5A 2P58C 3CEQA 3WXXA 5LCWJ 1A17A 4HOTA 4AY5A 3ULQA 3E4BA 3O48A 3U4TA 2FI7A 5FZRA 1IYGA 3ASFA 4UI9C 3KD7A 3ASHA 3CKCA 5FZSA 2KCKA 3JYSA 2VGXB 1ZU2A 3CK8A 3Q47B 5FJYA 3CK7A 4UI9K 2Q7FA 3LY9A 4WUYA 5ARFA 2R5SA 2VGXA 3LYAA 4GA0A 4U07A 4YNDA 5D0OD 5FT9A 3IEGA 5G04C 4UQXA 5EX0A 2XGMA 4U0UA 4KBQA 4BTBA 1KLXA 3ZGQA 3ZPJA 1E96B 4H7XA 2VQ2A 1NA3A 4YVQC 2XGOA 5CCMA 2VYIA 3ASDA 3UQ3A 3NF1A 3PDNA 3ZHEA 3VTYA 2L6JA 4GCNA 3OXFA 3Q49B 1ZBPA 4WNFA 5CCLA 4KXKB 3QWWA 2FF4A 2LSUA 2HYZA 2E2EA 4N39A 4GA1A 1W3BA 5AYWD 4I17A 1TJCA 5DIZA 2NC9A 2PQRA 3PE4A 5C1DA 4G2VA 3KS2A 2FO7A 3LPZA 3Q4AB 1WM5A 2VSNA 1KT1A 3OXLA 1HXIA 3LCAA 4ME2A 4LEUA 5HI7A 1Y8MA 3ZHEB 3CV0A 2YHCA 5CHEE 4BT8A 1B89A 4AIFA 3SZ7A 1QZ2A 3TG4A 4UQZA 1OUVA 4YVOA 5A6CA 5G05J 2KC7A 4ABNA 2UY1A 5HQ8A 3CVNA 3UPVA 3U3WA 4AY6A 2LSVA 3TAXA 2HO1A 1WAO1 2IFUA 3GW4A 2WQHA 4O6FA 5FZQA 3K9IA 4XI0A 2KCLA 1IHGA 3RO2A 5KJMA 5KJLA 2QFCA 4G23A 4N2QA 3Q5MA 4WNEA 5JJ6A 1NA0A 4CGWA 2AVPA 5G05C 3MKRA 2WPVA 4I2ZA 4GA2A 3AS4A 4N2SA
chains in the Genus database with same CATH superfamily
4ANWA 3ASGA 3UTMA 1H19A 4G25A 5DBKA 2LO6A 4DRXE 3AJIA 3CR3A 5ENTD 2R02A 4HQDA 3NBNB 3ASNE 3TWWA 4N5CA 3X2QE 3GZSA 3DRAA 4B93B 5LCWJ 4I1MA 5FIOA 1SZ9A 3PH0C 4FADA 3ONLA 2XS1A 1N0QA 4GCOA 1KZOA 4KMOA 1N9AA 4EZKA 1N4SA 2KZTB 4NQ0A 3HIZA 3RAUA 2RD0A 3CHPA 3S7FA 3ZW3A 2XCBA 2GW1A 4TV3A 3FU6A 2J9QA 3CIAA 5BV1A 4R7LA 3ZEFA 5FQ6A 3CEQA 3IV0A 4JEHA 5FQ4A 4HOTA 2YHEA 3PNTB 4GMRA 1MQSA 3KD7A 4A3TA 4U96D 3JYSA 1DC2A 1MX6A 3CVYA 4LERA 1JUQA 2FF4A 1WY6A 2V4HC 2CFZA 4JXTA 1KT1A 2AXVA 1MX4A 3DEOA 5KWDA 2J09A 3CLJA 3FUHA 1OXJA 4EECA 2WXLA 4UWGA 3SFXA 4PUCA 3RRMB 5BW8C 1GW6A 2PQNA 4GZDA 4JW1A 3RRNB 3QWVA 3SO8A 2IOSA 2WQ6A 4GZ5A 4CYMD 5J08A 1K1AA 3EHRA 3CK9A 4HRLA 3MCXA 3RK6A 4U8HA 4UI9J 3T8MA 4F3VA 3L6AA 2XPIA 3D9HA 4JD2G 3ZN3A 1EF1C 2Y69E 3R9AB 2BKGA 3HXFA 2J08A 3LY8A 3NAWA 3KSQA 4IN3B 4J8FA 2J4DA 2WXGA 3JUEA 2GRNB 4U63A 4WUYA 3CHMA 2LXLA 3D9LA 1BI7B 1E7UA 3BUAA 3LS8A 3Q49B 1K1BA 4F7AA 3FHEA 4I17A 3E37A 2IO3C 2M63A 3U4TA 3Q4AB 4GTMA 1WM5A 2OEVA 4MS6A 1HXIA 4WWOA 5BXOA 2B6CA 1S0PA 3UXGA 4YVOA 4KVMA 3CVNA 4U7EB 3FTWA 2R17C 5CBOA 5KJLA 4CGWA 2PL2A 2AWIA 1YA0A 2VSXE 4JHRA 3UMVA 3L17A 2WM9A 1JCQA 4GTSA 3U66A 5EX3A 1OCCE 2BF0X 4HFGA 1IXVA 4Q96A 1S63A 3FU5A 3CQGB 3CVPA 2LUHA 4U0ZA 4DUIA 5EYPF 2X6KA 3ABKE 3G2UA 2YINA 4U8YD 1FVHA 2GRMA 3P1UA 3MA5A 4UWLA 4LG6A 1HZ4A 4YDYA 3UIOC 3RU0A 1UJJA 3WXXA 4FJYA 1BLXB 3LY9A 3UINC 3E33A 4GA0A 1MX2A 4PS3A 4KBQA 4JHJA 3FEXA 4NIKA 3UM2A 2VQ2A 4YVQC 3PEUB 4YDWA 3NF1A 3CSTA 4CDNA 2HYZA 1SVXA 2E2EA 3KS2A 2LXMA 3MKQB 4G8KA 5ITZF 4ATGA 3MJWA 1YYHA 3DSVA 4KVOA 5AN8A 2DYSE 3CQCB 5LFAA 1KZPA 1BI8B 3SGHA 3ULEG 2WXKA 4HVBA 4IRUA 4WNGA 3PUJA 2ZU6B 4GZ3A 2Y4TA 4A1GA 4DI4A 4LNGA 1QNFA 3ZYQA 3DSUA 1H6PA 1V55E 4C9BB 3EHMA 4GYOA 1HFAA 2IOLA 1JPLA 4A55A 3CVLA 3FTSA 3UT8A 1QBQA 3PZ4A 4GTQA 3AG3E 1AP7A 3LVQE 4IULA 4HS2A 2FBNA 4RG9A 3Q15A 3ZXPA 3F6QA 4BWRA 1FCHA 2KZTA 2A4ZA 4UWHA 3LY7A 3BQOA 1HU3A 3ASFA 5FZSA 2J07A 1TYQG 2V5QC 3MYVA 4BTBA 3TWQA 4H7XA 2Y1LE 2VYIA 2P9NG 3B7RL 4BSXA 4DX6D 4KXKB 2HM8A 5AYWD 4ANUA 2WB2A 2VSNA 2DWZA 1QZ2A 1IQRA 5BXUA 1NP7A 4EHMA 1N11A 4ZFHA 1OT8A 2HO1A 3HHMA 3KEAA 3LVRE 3BG1B 1N95A 1SW6A 1TN6A 4I9EA 2ZGDA 2QY7A 4FA6A 3AU4A 4BTAA 2XS8A 5M72A 1H2UA 1ZB1A 3E30A 5BPPA 4CDMA 3Q9NC 2V8SE 3KAEA 1Z6TA 1DCEA 2ZIRA 4JA7A 1NZNA 2EINE 3G2TA 3RO3A 3EU9A 3MV3B 3SHFA 4C0EA 4JC8A 4TXRA 3JCKC 4UUCA 4GMLA 4FJZA 2P2CP 3QOUA 1ELWA 2DBAA 4QFVA 1TNOA 4BT9A 3CHRA 1H6OA 1LF8A 4N5QA 5IY5E 4AM9A 2KCVA 2MRIA 3HXBA 3UT4A 3HXDA 4TUUA 5FZRA 4BERA 2LAHA 1OWLA 1OCZE 2A5EA 2XENA 2R5SA 2J8SD 2CHWA 1X5BA 3ULYA 2H6HA 2BTDA 1NA3A 2CG3A 1JCRA 4EZJA 3ESLA 3L9TA 1W3BA 3L22A 1K8KG 3LCAA 1IHBA 4LEUA 4ME2A 4KZ0A 5CEDB 3FU0A 1N94A 2UY1A 3V2XA 3ZIMA 3FUNA 5JJ6A 2AVPA 3DSXA 2EIJE 4TUMA 5KJNA 4Y6WA 2JLBA 3C72A 3SNXA 3BU8A 1DNPA 3QKYA 4V3IA 3BEEA 2P9UG 1YCSB 1FT1A 3ASOE 1LD7A 3DSSA 1MHQA 4F1PA 2WXHA 2ETAA 3MX3A 5HKPA 3TGOA 5AJDA 5G04J 4UWKA 2X6IA 4HOQA 3PEVB 4RG6A 3NQPA 3FULA 2WXFA 3HVEA 1E90A 3PUKA 1OWOA 3W9FA 3Q7FA 1SQMA 1D9SA 3ZYMA 4J8SA 2KM4A 2Q7FA 1AWCB 2RG8A 4I6EA 1UJKA 1SA4A 5A23A 2OVFA 5BV0A 5JHAA 4ATZD 2L6JA 4O60A 1E8ZA 4GTPA 5C1DA 2EQXA 2FO7A 1Y8MA 1B89A 4WWPA 4XX5A 5AQAA 2CG2A 5G05J 3ZU7B 4ZHBA 2XRYA 4MBGA 4L1BA 3Q75A 4N2QA 4KT6B 2A5UA 4AJWA 3LJ3A 4YDEA 4GYWA 1Y6IA 5B1AE 3ABLE 4EBAG 4KZCA 2WXRA 2DZOA 3RJVA 2AW6A 2BUGA 5AENA 2LNIA 1N4QA 4AVXA 3JQ1A 4JB8P 4JEUA 3IHVA 1OWMA 3PZDA 3J5PA 1UN9A 3NOGD 2KATA 2NSZA 3S2AA 2AJAA 4APOA 5G2NA 4M7CA 1PC2A 2GROB 4BESA 3TWTA 5EN5D 5AQBA 2UY1B 3URZA 4JA9A 5T4YA 4ACKA 1XGWA 3P2BA 4LNBA 2P58C 1HF8A 2B0OE 2J49A 1ZU2A 2NYJA 4EQFA 3DSWA 3R7RA 4YNDA 2VJ8A 5EX0A 3T9KA 4GTOA 3TWSA 3UIPC 3U9WA 3FH5A 3DPDA 3UKUG 3JUIA 2LSUA 2X6HA 2PQRA 3V79K 3SY2A 4UQZA 2L9BA 4ABNA 4FC8A 2IFUA 4O6FA 3RO2A 4K0RA 2I2OA 2QFCA 5G05C 3MGBA 4I43A 4N2SA 5B1BE 4HOUA 4L9PA 4ACLA 3RIBA 1FVFA 3LKUA 2JEKA 3VTXA 1LTXA 3Q7AA 1KT0A 2VGYA 5CMWA 5KNHD 2I6HA 5KJKA 3EJNA 4GAAA 4YDOA 1N4RA 2P9KG 3DPYA 2F8XK 3C3RA 4A1SA 4UQYA 1IQUA 2XRZA 1QYMA 3S7JA 2DCPA 4Q94A 2IQCA 4GZ6A 3FP3A 3D9OA 4MRUA 1WG0A 4J6IA 3TJPA 3QC1A 2PM6A 2ETBA 4OVUA 4FULA 3ULQA 3ZKJA 3D9MA 3E34A 2L0IA 4K5BA 4MLPA 2XPYA 4WAFA 4ILGA 2XEHA 2WXMA 4B89A 5EIBE 3D3MA 1MJ0A 2GGFA 4N39A 5ANRA 4MKTA 5DIZA 3B13A 2ZXWE 3FDHA 1UOHA 1X81A 1Z3YA 4L2LA 3TAXA 5CMYA 4D10C 5FQ7A 3MKRA 1WDYA 2V0PA 3FUJA 4N3BA 2HE0A 3TXNA 3UX4A 5BT1A 5KCMA 5C2YA 2BEDA 2H6FA 5EYLA 4GPKA 4J0UA 3EIJA 1MYOA 3N71A 1UW4B 3MZLB 1JWFA 2XCCA 5D0QD 3ZNGA 1O1RA 2OEWA 4P29A 3EDTB 3VLDA 3MKQA 4BFRA 1HX8A 2KBXA 3UUXA 1EYHA 3C98A 1N54A 3ABME 3LJNA 2C2LA 3UM3A 3PE3A 2P9SG 3L54A 4ILIA 3CHSA 2P9PG 2WQ7A 4H7YA 4CDRA 4E85A 3PZ3A 1XNFA 4OYSA 5LP0A 3R9MA 4PS8A 4L23A 3UKRG 5B3SE 1Z3XA 4BEPA 3ASHA 3IHYA 4M3OA 5FJYA 4BY6A 5ARFA 2DYRE 3LYAA 3FUFA 3IEGA 3LDZA 4LCTA 3ZPJA 4JVSA 4EZLA 4LNUD 4BX9A 1ZBPA 3IKOB 5JHBA 3T5XA 1TJCA 3PE4A 4F1SA 2GRLA 2R03A 3T5VA 1D8EA 4AIFA 3SZ7A 4OAUC 3CVWA 2WXQA 2WVIA 3KEZA 2WXJA 5FZQA 2KCLA 1IHGA 3HVEB 5H7PA 4GTTA 4HXIA 1HG2A 3AS4A 4RLYA 4AOFA 3PZ2A 4U04A 4XKBA 1RW2A 2Y4UA 3SBTB 1TNZA 4A3VA 4CEMA 3QDNA 2AXUA 4FHKA 4I9CA 4G24A 4HBDA 3ZUVB 2F37A 4CCAA 1DVPA 5EILA 4IYPA 4B0ZA 2X3MA 3V2OA 1NFIE 2QZAA 3RRUA 4F53A 5EIDA 4QQIA 3TWXA 5ENRD 1U2VG 4XIFA 4E6HA 4B8AA 4RVBA 2IU1A 4I1OB 1E8YA 2QYJA 4ANXA 3APFA 3WG7E 3E4BA 3O48A 1YMPA 1O1TA 2ETCA 3V30A 4CT4A 1H2TC 4HLLA 3CHQA 3SFYA 3SQVA 3VLEA 5E75A 4DX5D 3PDNA 3OXFA 2P9LG 2KXPC 5ENNA 4G2VA 3LPZA 3IXEA 1G3NB 3I4GA 3QB2A 5LX8A 3AG4E 4DLOA 3U3WA 2WQHA 5ENSD 3TWRA 4DLQA 5JA4D 4I2ZA 3QJZA 2I9CA 5ENOD 4DX2A 2ONDA 3L08A 1HE8A 4XI9A 3UT7A 4I2WA 3KSLA 1TNYA 4DX7D 2QYUA 2MHKA 4OVVA 4XEIG 1UN8A 4APFA 4J8DA 1BPOA 1RZ4A 4W9RA 4J8EA 5FINA 4F6RD 3Q79A 3BG0B 2YQ8A 5FTPA 4GYYA 3SBSA 3NB2A 3FH7A 2VSOE 1N4PA 1SZAA 2L6BA 3CKBA 3GZ1A 5KBAA 3ESKA 3CHOA 1H6KA 5JJTA 3U64A 3MV2B 2IJGX 4JL0A 2H6IA 3S7DA 2RFAA 3GZ2A 4AV7A 5AARA 1O1SA 2WXIA 1OWPA 2Y0BG 3CKCA 2WXOA 3PZ1A 4UI9K 3CGHA 1N52A 3PRZA 2VGXA 4PDXA 2LAIA 3ISMC 4DX1A 3UQ3A 4JPSA 3VTYA 1LD8A 2WXNA 1TJFA 2CFUA 3QAQA 3B7UX 1MZCA 2NC9A 1NL4A 3G2VA 3PREA 2XPZA 2KC7A 1OY3D 1SA5A 3B7BA 2OV8A 4FU3A 3L82A 3VLFA 3EHNA 2H6GA 3QARA 1EPUA 4WNEA 1TEZA 2WPVA 2R05A 1KPSB 4EBAA 1OWNA 5HRYA 4I1AA 3RSEG 2X6JA 3HXCA 1VDYA 4GMJA 3OTNA 3TWUA 3O4ZA 4N3AA 3NZUA 4L7TA 4DJAA 2BKKB 3FTZA 1E7VA 3EHQA 1TN7A 4GPMA 4AXHA 4DPRA 1FT2A 4U0SA 2L0TB 4A63B 3APCA 3FU3A 4LRZA 2XZDG 4BETA 2V5FA 4G26A 1E8XA 3EUVA 2VTBA 1JCSA 1TR4A 2ILRA 5AJLA 4HB5A 5ENQD 1A17A 1IYGA 4UI9C 1L5JA 4AEZC 3Q47B 3HXEA 4ILHB 5D0OD 3T8KA 4PS7A 2XGOA 2DVWA 4RSYA 4XKCA 3HRAA 3ZHEA 1PY1A 5JMND 4EPZA 1JWGA 5CCLA 4FHJA 4FP7A 5KNGA 3L16A 2FULA 3CV0A 2YHCA 3FUEA 3TL5A 3TG4A 3B95A 3NOCD 2E0IA 2OVBA 2GRQB 4DK5A 3FTXA 5AIJA 2IY0C 1HH8A 2XEVA 1N0RA 2PNNA 4OAVB 5EKQD 4UWFA 3SI5A 2OOEA 4HI8A 1FPPA 4G1TA 2HR2A 3G2WA 3S7BA 3Q78A 2MYOA 2P9IG 1Q2ZA 1S64A 3ML9A 4NURA 3TG5A 3RKVA 4Y6CA 1H0AA 3QNKA 4K5AB 3FWVA 3ZFWA 4WNDA 3UM1A 4K03A 4ANVA 3FTYA 1BD8A 3FY4A 4WWNA 3AS5A 4G8LA 3SD5A 2AXZA 2VTBB 3LXUX 3UM0A 1HG5A 4AP2A 5FT9A 2PM7A 1U3CA 4U0UA 5CCMA 3JXIA 3ASDA 3DXMG 4HNAD 2EIME 4WNFA 2EIKE 2ZGGA 4GA1A 4J8YA 4HORA 5HI7A 4XE0A 5BUZA 2DIWA 4BT8A 4URKA 3AU5A 1Z5SC 5E76A 3SFZA 5A6CA 2JABA 5HQ8A 3B7TA 2WMNA 1OCRE 4J7WA 4JZYA 2V4LA 3APDA 4O1OA 4G23A 4K5CA 3FTUA 5G55A 5ARGA 2XEEA 5ANLA 2VSYA 1NI1A 3DBSA 3QWPA 3ONKA 4HLEA 2WMOA 4NACA 3W9GA 2PZIA 3FUIA 2ZISA 5HS0A 3AS8A 3CSFA 3ZXSA 3FH8A 2VGEA 2IF4A 3LEWA 1E8WA 3G2SA 2J4BA 2XGSA 5BNWA 4KYOB 3GYZA 3HYMB 1A5EA 3I3NA 2IONA 5FWQA 3TWVA 3PVLA 5KJMA 2YNQA 3ZYLA 5A7DB 3MEKA 4TXPA 2FI7A 3D9KA 3CVXA 2VGXB 3FEYA 4U07A 5JJ7A 3CVUA 1HO8A 2I1KA 4FLBA 1IKND 3PNLB 2NXPA 2DZNA 4GZCA 2FO1E 4O1PA 4GCNA 4BX8A 3QWWA 1K3ZD 2I1JA 2IO2C 3ZHEB 5CHEE 5CRUA 4I6GA 4Q69A 3JQ0A 1OUVA 1V54E 3UI2A 2LSVA 4HRNA 1WAO1 2X38A 4PH4B 1NA0A 5D2MC 1ELRA 4CT0A 4G11A 3E32A 4CZ2D 3L13A 3AG2E 2MOWA 4JHKA 4HOSA 2F8YA 1INZA 4NRHB 3D9NA 1OCOE 2RFMA 4LSZE 2C0MA 4Z68A 2FEZA 5EDSA 3D9IA 1DCQA 2XHEA 2R2LA 5CBNA 3HG0D 2Y3AA 3D9JA 1P5QA 4FLHA 1ELKA 4N3CA 5T3RA 3AG1E 3OXGA 1O5MA 3FUKA 2R59A 3Q73A 4GTRA 3EU5A 3Q9UC 4I6JA 4GTVA 3PS6A 3NZSA 3CK8A 3CK7A 4TRQA 3I4RB 4UQXA 2GRRB 2X6FA 1KLXA 1E96B 5CEAA 4BSZB 3DWLG 2CHZA 3C5RA 1S70B 2XQ0A 3FUDA 3OAWA 2F0YA 3OXLA 1H2VC 4U95D 1TN8A 5CERB 1UG3A 1EDUA 3UPVA 3FUMA 4AY5A 3K9IA 4XI0A 5J90A 1HS6A 4GA2A 3ZYKA 4CRWA 3C3OA 3ZRHA 1QQEA 3FFLA 5CRVA 3ENEA 3ZVVA 5LCWC 4L2YA 3CVQA 4HI9A 4X8QA 4C48B 2IEJA 3DXKG 1PAQA 3HDXA 1BU9A 5ENPD 4C0MA 3DSTA 2EILE 2RKKA 3SF4A 3JXJA 3QK0A 4DI3A 4B8CB 3DEPA 2UWJG 3TXMA 3FTVA 3R7QA 4CGVA 2C0LA 4B94A 4LUNU 4RQIA 1TNBA 3J5QB 4HRMB 1U3DA 3I5PA 4GB9A 5AQ9A 2CHXA 2GRPB 3AAAC 2KCKA 4TXQA 3EIQC 3IBEA 5G04C 2XGMA 4GU5A 3ZGQA 5T8IA 2XZTG 2WXPA 1TNUA 3CVVA 5AAOA 4U8VD 3B7SA 5D66A 5CECB 3D9PA 5LOZA 3V31A 5AQ7A 1D8DA 4AY6A 3ML8A 2OCCE 5FQ8A 3C3QA 3Q5MA 3GW4A 4XZ4A 2QC9A
chains in the Genus database with same CATH topology
2V0PA 3FTXA 3FUJA 2QY7A 3ASGA 4ANWA 4FA6A 4CDMA 1H19A 3AU4A 4I9EA 4N3BA 5AIJA 4BTAA 5M72A 1H2UA 4G25A 5BPPA 5DBKA 3TXNA 1HH8A 2V8SE 3UX4A 3KAEA 2LO6A 1Z6TA 5KCMA 5C2YA 5BT1A 2XEVA 4GPKA 4J0UA 4JA7A 3EIJA 3N71A 3CR3A 5EKQD 1NZNA 4UWFA 3SI5A 2OOEA 4N5CA 1UW4B 3MZLB 3GZSA 4G1TA 1JWFA 2XCCA 3G2TA 2HR2A 3G2WA 3RO3A 4I1MA 5LCWJ 5D0QD 3S7BA 1SZ9A 3PH0C 4P29A 3MV3B 3EDTB 3SHFA 3VLDA 4C0EA 4FADA 3MKQA 3ONLA 1HX8A 4BFRA 4JC8A 3UUXA 3JCKC 4GMLA 1EYHA 3C98A 1N54A 4FJZA 3ML9A 4NURA 3QOUA 4GCOA 3TG5A 3RKVA 4KMOA 4Y6CA 1H0AA 3QNKA 1ELWA 2C2LA 2DBAA 3PE3A 4EZKA 4QFVA 4BT9A 3CHRA 3FWVA 3ZFWA 4WNDA 2KZTB 3L54A 1LF8A 4NQ0A 4ILIA 3HIZA 4K03A 2RD0A 3CHSA 3CHPA 3S7FA 2XCBA 2GW1A 4H7YA 4TV3A 3FU6A 2J9QA 3CIAA 4CDRA 5BV1A 2WQ7A 4E85A 4R7LA 4AM9A 4OYSA 1XNFA 4ANVA 3FTYA 5LP0A 2KCVA 3ZEFA 4PS8A 3FY4A 2MRIA 4WWNA 4L23A 5FQ6A 3AS5A 3CEQA 3IV0A 4JEHA 5FQ4A 3SD5A 2YHEA 2AXZA 3PNTB 3UT4A 4TUUA 2VTBB 4HOTA 1MQSA 1Z3XA 5FZRA 3LXUX 3KD7A 3ASHA 4A3TA 2LAHA 3IHYA 3JYSA 1HG5A 4M3OA 1OWLA 5FJYA 4AP2A 4BY6A 5ARFA 2R5SA 3LYAA 5FT9A 2CHWA 1X5BA 3FUFA 2PM7A 3IEGA 1U3CA 4U0UA 3LDZA 4LCTA 3ZPJA 2BTDA 1NA3A 5CCMA 4JVSA 4EZLA 2CG3A 3ASDA 3CVYA 4EZJA 4LERA 4BX9A 1ZBPA 4WNFA 3IKOB 5JHBA 1JUQA 2FF4A 1WY6A 3ESLA 3T5XA 4GA1A 1W3BA 1TJCA 2CFZA 3L22A 3PE4A 4F1SA 4HORA 2GRLA 4JXTA 3T5VA 5HI7A 1KT1A 4XE0A 3LCAA 4ME2A 2AXVA 4LEUA 5BUZA 2DIWA 4KZ0A 4BT8A 4URKA 3AU5A 4AIFA 3SZ7A 3CVWA 2WXQA 5E76A 2J09A 3CLJA 3FU0A 3FUHA 3SFZA 2UY1A 2WVIA 3B7TA 5A6CA 5HQ8A 2WMNA 3KEZA 3ZIMA 2WXJA 4EECA 2WXLA 3FUNA 4JZYA 5FZQA 2V4LA 2KCLA 1IHGA 3HVEB 3APDA 4UWGA 4G23A 4PUCA 4HXIA 1HG2A 5JJ6A 2AVPA 3FTUA 3RRMB 5G55A 4TRQA 3AS4A 5BW8C 1GW6A 5ARGA 5ANLA 4AOFA 2VSYA 2PQNA 5KJNA 4GZDA 4Y6WA 2JLBA 3DBSA 3QWPA 4JW1A 4U04A 3RRNB 3ONKA 3SNXA 4HLEA 2WMOA 3QWVA 4NACA 4XKBA 1DNPA 2IOSA 2PZIA 2Y4UA 3SBTB 3FUIA 2WQ6A 4GZ5A 4A3VA 3QKYA 4V3IA 3AS8A 3CSFA 3ZXSA 3QDNA 2AXUA 3FH8A 3BEEA 4FHKA 4CEMA 5J08A 4I9CA 4G24A 2IF4A 3LEWA 1E8WA 3G2SA 2J4BA 2XGSA 5BNWA 3CK9A 4KYOB 3MCXA 1MHQA 4CCAA 1DVPA 2WXHA 3GYZA 3RK6A 4U8HA 3HYMB 4UI9J 3I3NA 3T8MA 4F3VA 4IYPA 3MX3A 2IONA 4B0ZA 2X3MA 5FWQA 3L6AA 3TGOA 2XPIA 5AJDA 5G04J 3RRUA 4F53A 4UWKA 2X6IA 4HOQA 3PEVB 3ZN3A 1EF1C 3PVLA 4RG6A 5KJMA 3NQPA 3FULA 4XIFA 3R9AB 4E6HA 2YNQA 4B8AA 2WXFA 4RVBA 3HVEA 2J08A 3LY8A 2IU1A 4I1OB 5A7DB 3MEKA 3ZYLA 1E90A 4IN3B 1E8YA 3PUKA 4J8FA 2J4DA 1OWOA 2WXGA 4ANXA 3APFA 3E4BA 3O48A 1SQMA 2FI7A 4U63A 3ZYMA 3D9KA 4J8SA 2KM4A 2VGXB 4CT4A 3CVXA 2Q7FA 4WUYA 1H2TC 3CHQA 3CHMA 3FEYA 4U07A 5JJ7A 2RG8A 3CVUA 1HO8A 4I6EA 3D9LA 1UJKA 2I1KA 4FLBA 5A23A 3VLEA 1E7UA 2OVFA 3PNLB 2NXPA 5BV0A 4GZCA 5E75A 5JHAA 3LS8A 3PDNA 2L6JA 4GCNA 3OXFA 3Q49B 4BX8A 4F7AA 3QWWA 3FHEA 1E8ZA 4I17A 2I1JA 5C1DA 4G2VA 2M63A 2EQXA 2FO7A 3LPZA 1WM5A 3Q4AB 4MS6A 5ENNA 1HXIA 3U4TA 1Y8MA 4WWOA 3ZHEB 5CHEE 4I6GA 3I4GA 1B89A 1S0PA 3JQ0A 3QB2A 4WWPA 4XX5A 4Q69A 4YVOA 1OUVA 4KVMA 2CG2A 5G05J 3CVNA 5LX8A 4DLOA 3U3WA 2XRYA 2LSVA 1WAO1 4L1BA 2WQHA 2X38A 3FTWA 2R17C 5KJLA 4N2QA 4DLQA 4KT6B 4PH4B 1NA0A 4CGWA 2A5UA 4AJWA 3LJ3A 4I2ZA 4GYWA 3QJZA 1Y6IA 2I9CA 2ONDA 1ELRA 2PL2A 4CT0A 2AWIA 4G11A 1YA0A 3L08A 3L13A 1HE8A 4XI9A 4EBAG 4KZCA 2WXRA 2MOWA 2VSXE 3UT7A 4JHKA 4HOSA 4JHRA 3RJVA 3UMVA 3L17A 2AW6A 4I2WA 2WM9A 2BUGA 5AENA 2LNIA 1INZA 4NRHB 2MHKA 4OVVA 4AVXA 3D9NA 3JQ1A 5EX3A 3U66A 1UN8A 4APFA 4JEUA 4J8DA 3IHVA 2BF0X 2C0MA 1OWMA 4HFGA 4Q96A 2FEZA 1BPOA 3CQGB 3FU5A 3CVPA 4U0ZA 3PZDA 4W9RA 4J8EA 5EDSA 2X6KA 3BG0B 2YQ8A 1UN9A 3D9IA 5FTPA 4GYYA 3SBSA 2KATA 3G2UA 2XHEA 3FH7A 2VSOE 2NSZA 3S2AA 1SZAA 2YINA 4APOA 5G2NA 2Y3AA 3CKBA 3D9JA 1P5QA 1FVHA 1PC2A 3GZ1A 2GRMA 3P1UA 3MA5A 3ESKA 3CHOA 4FLHA 4UWLA 1ELKA 1H6KA 4N3CA 5JJTA 3U64A 3MV2B 2IJGX 4JL0A 3S7DA 1HZ4A 3GZ2A 2UY1B 5T3RA 3URZA 4JA9A 5T4YA 3OXGA 4AV7A 4ACKA 1XGWA 3RU0A 3FUKA 3P2BA 2R59A 1UJJA 3WXXA 2P58C 1HF8A 4I6JA 2WXIA 1OWPA 3CKCA 3PS6A 2J49A 1ZU2A 3CK8A 2WXOA 3NZSA 4FJYA 3CK7A 4UI9K 4EQFA 3LY9A 3CGHA 1N52A 3PRZA 2VGXA 4GA0A 4PDXA 2LAIA 4PS3A 2VJ8A 4YNDA 3R7RA 3I4RB 4UQXA 5EX0A 2X6FA 4KBQA 4JHJA 3FEXA 1KLXA 1E96B 2VQ2A 4YVQC 3PEUB 3UQ3A 2CHZA 3NF1A 3CSTA 4JPSA 4CDNA 3VTYA 3U9WA 3FH5A 3DPDA 2XQ0A 3JUIA 3FUDA 2WXNA 1TJFA 2CFUA 2LSUA 2X6HA 2HYZA 2E2EA 3OAWA 3QAQA 3B7UX 2NC9A 2PQRA 3KS2A 3G2VA 1H2VC 3OXLA 3PREA 3MKQB 1UG3A 2XPZA 4ATGA 3MJWA 4UQZA 2L9BA 1EDUA 4ABNA 2KC7A 3UPVA 3FUMA 4KVOA 4FC8A 2IFUA 4O6FA 4AY5A 3RO2A 3K9IA 4K0RA 4XI0A 5J90A 2OV8A 4FU3A 3VLFA 2I2OA 2QFCA 3CQCB 3EHNA 3QARA 1EPUA 4WNEA 1TEZA 1HS6A 5G05C 2WPVA 3MGBA 4GA2A 4I43A 5LFAA 4N2SA 3SGHA 4EBAA 3ZYKA 4CRWA 1OWNA 4HOUA 3ZRHA 2WXKA 1QQEA 4I1AA 4HVBA 4IRUA 4WNGA 2X6JA 3FFLA 2ZU6B 3PUJA 3ENEA 1VDYA 4GMJA 4ACLA 3ZVVA 3RIBA 4GZ3A 3OTNA 1FVFA 3LKUA 5LCWC 3O4ZA 2Y4TA 4L2YA 4A1GA 3CVQA 2JEKA 3VTXA 4DI4A 1QNFA 4N3AA 3ZYQA 3NZUA 4L7TA 1KT0A 2VGYA 5CMWA 2I6HA 4C9BB 4DJAA 3EHMA 4GYOA 3FTZA 5KJKA 1HFAA 1PAQA 3EJNA 3HDXA 2IOLA 4GAAA 4C0MA 1JPLA 1E7VA 4A55A 3CVLA 3FTSA 3UT8A 3SF4A 3QK0A 4DI3A 4A1SA 4B8CB 4UQYA 2UWJG 4AXHA 1IQUA 2XRZA 4DPRA 3TXMA 3LVQE 3FTVA 3R7QA 4U0SA 4IULA 3S7JA 4CGVA 2C0LA 2FBNA 4HS2A 2L0TB 4B94A 2DCPA 4LUNU 4RG9A 4Q94A 2IQCA 3APCA 3FU3A 3Q15A 4GZ6A 4LRZA 3FP3A 3D9OA 4BWRA 1FCHA 2KZTA 4MRUA 4J6IA 1U3DA 3TJPA 3QC1A 2PM6A 2A4ZA 2V5FA 4G26A 3I5PA 4GB9A 1E8XA 4OVUA 4UWHA 3LY7A 2VTBA 4FULA 2ILRA 5AJLA 1A17A 2CHXA 3ULQA 1HU3A 1IYGA 3D9MA 3ASFA 4UI9C 1L5JA 2L0IA 4MLPA 5FZSA 4AEZC 2J07A 2KCKA 2XPYA 3ZW3A 3Q47B 3MYVA 3EIQC 3IBEA 4WAFA 5G04C 4ILHB 5D0OD 4BTBA 4ILGA 4PS7A 2XGMA 4GU5A 2WXMA 3ZGQA 4B89A 4H7XA 5T8IA 2XGOA 3D3MA 2WXPA 4RSYA 4XKCA 2VYIA 3CVVA 3ZHEA 1PY1A 3B7RL 4BSXA 4EPZA 1JWGA 5CCLA 4KXKB 2HM8A 3B7SA 2GGFA 4N39A 5ANRA 4MKTA 4FHJA 5AYWD 4ANUA 4FP7A 5DIZA 3D9PA 2WB2A 5LOZA 3B13A 2VSNA 3L16A 2FULA 3CV0A 2YHCA 3FUEA 3TL5A 1QZ2A 1IQRA 3TG4A 3FDHA 1NP7A 1Z3YA 4L2LA 4AY6A 2E0IA 2OVBA 3TAXA 3ML8A 2HO1A 3HHMA 3LVRE 5CMYA 3BG1B 4D10C 5FQ8A 5FQ7A 4DK5A 3Q5MA 3MKRA 3GW4A 4XZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYW A;  3ASG A;  5ARG A;  5KJN A;  2VSY A;  2PQN A;  5JJ7 A;  4HOU A;  4Y6W A;  2JLB A;  2OND A;  1ELR A;  1QQE A;  2PL2 A;  3QWP A;  4I1A A;  4I9E A;  4N3B A;  4U04 A;  4WNG A;  4BTA A;  1YA0 A;  3FFL A;  3QWV A;  4G25 A;  5M72 A;  3RIB A;  4GZ3 A;  5DBK A;  1HH8 A;  4XI9 A;  5BT1 A;  3KAE A;  2PZI A;  2Y4U A;  3LKU A;  4GZ5 A;  5LCW C;  2XEV A;  2Y4T A;  4JHR A;  4JA7 A;  4J0U A;  3N71 A;  3CVQ A;  3RJV A;  3VTX A;  4I2W A;  4N3A A;  3QKY A;  3AS8 A;  3QDN A;  2BUG A;  5EKQ D;  3BEE A;  1NZN A;  1KT0 A;  2LNI A;  2OOE A;  2VGY A;  4I9C A;  4NRH B;  2I6H A;  2MHK A;  4G24 A;  4N5C A;  2IF4 A;  4G1T A;  5EX3 A;  5BNW A;  2XCC A;  2XGS A;  2HR2 A;  3CK9 A;  4GYO A;  4J8D A;  3RO3 A;  5D0Q D;  3S7B A;  4KYO B;  4EQF A;  2C0M A;  5KJK A;  2FEZ A;  3MV3 B;  3EDT B;  3CVP A;  3CVL A;  4U0Z A;  3GYZ A;  4W9R A;  3HYM B;  4J8E A;  3SF4 A;  4UI9 J;  3UUX A;  4F3V A;  2YQ8 A;  4A1S A;  4UQY A;  2UWJ G;  4GYY A;  3QOU A;  4GCO A;  5FTP A;  3TG5 A;  2KAT A;  3RKV A;  4GPK A;  4Y6C A;  3TGO A;  2XPI A;  1ELW A;  4U0S A;  5G04 J;  2C2L A;  2DBA A;  3PE3 A;  3S7J A;  4CGV A;  2C0L A;  2FBN A;  4HOR A;  4BT9 A;  4B94 A;  3FWV A;  4HOQ A;  3ZFW A;  4RG9 A;  3ZN3 A;  3CKB A;  4APO A;  1P5Q A;  1PC2 A;  4RG6 A;  4WND A;  3GZ1 A;  3Q15 A;  4GZ6 A;  4AM9 A;  3FP3 A;  3MA5 A;  3ESK A;  4NQ0 A;  3S7F A;  4BWR A;  1FCH A;  4XIF A;  2XCB A;  2GW1 A;  4H7Y A;  4N3C A;  3R9A B;  2J9Q A;  5JJT A;  4CDR A;  3MV2 B;  4JL0 A;  3S7D A;  3LY8 A;  5A7D B;  1HZ4 A;  1XNF A;  2UY1 B;  3GZ2 A;  3MEK A;  3URZ A;  4JA9 A;  2KCV A;  4IN3 B;  2V5F A;  3OXG A;  4G26 A;  5BW8 C;  4J8F A;  3RU0 A;  4HOS A;  3LY7 A;  3AS5 A;  2P58 C;  3CEQ A;  3WXX A;  5LCW J;  1A17 A;  4HOT A;  4AY5 A;  3ULQ A;  3E4B A;  3O48 A;  3U4T A;  2FI7 A;  5FZR A;  1IYG A;  3ASF A;  4UI9 C;  3KD7 A;  3ASH A;  3CKC A;  5FZS A;  2KCK A;  3JYS A;  2VGX B;  1ZU2 A;  3CK8 A;  3Q47 B;  5FJY A;  3CK7 A;  4UI9 K;  2Q7F A;  3LY9 A;  4WUY A;  5ARF A;  2R5S A;  2VGX A;  3LYA A;  4GA0 A;  4U07 A;  4YND A;  5D0O D;  5FT9 A;  3IEG A;  5G04 C;  4UQX A;  5EX0 A;  2XGM A;  4U0U A;  4KBQ A;  4BTB A;  1KLX A;  3ZGQ A;  3ZPJ A;  1E96 B;  4H7X A;  2VQ2 A;  1NA3 A;  4YVQ C;  2XGO A;  5CCM A;  2VYI A;  3ASD A;  3UQ3 A;  3NF1 A;  3PDN A;  3ZHE A;  3VTY A;  2L6J A;  4GCN A;  3OXF A;  3Q49 B;  1ZBP A;  4WNF A;  5CCL A;  4KXK B;  3QWW A;  2FF4 A;  2LSU A;  2HYZ A;  2E2E A;  4N39 A;  4GA1 A;  1W3B A;  5AYW D;  4I17 A;  1TJC A;  5DIZ A;  2NC9 A;  2PQR A;  3PE4 A;  5C1D A;  4G2V A;  3KS2 A;  2FO7 A;  3LPZ A;  3Q4A B;  1WM5 A;  2VSN A;  1KT1 A;  3OXL A;  1HXI A;  3LCA A;  4ME2 A;  4LEU A;  5HI7 A;  1Y8M A;  3ZHE B;  3CV0 A;  2YHC A;  5CHE E;  4BT8 A;  1B89 A;  4AIF A;  3SZ7 A;  1QZ2 A;  3TG4 A;  4UQZ A;  1OUV A;  4YVO A;  5A6C A;  5G05 J;  2KC7 A;  4ABN A;  2UY1 A;  5HQ8 A;  3CVN A;  3UPV A;  3U3W A;  4AY6 A;  2LSV A;  3TAX A;  2HO1 A;  1WAO 1;  2IFU A;  3GW4 A;  2WQH A;  4O6F A;  5FZQ A;  3K9I A;  4XI0 A;  2KCL A;  1IHG A;  3RO2 A;  5KJM A;  5KJL A;  2QFC A;  4G23 A;  4N2Q A;  3Q5M A;  4WNE A;  5JJ6 A;  1NA0 A;  4CGW A;  2AVP A;  5G05 C;  3MKR A;  2WPV A;  4I2Z A;  4GA2 A;  3AS4 A;  4N2S A; 
#chains in the Genus database with same CATH topology
 4ANW A;  3ASG A;  3UTM A;  1H19 A;  4G25 A;  5DBK A;  2LO6 A;  4DRX E;  3AJI A;  3CR3 A;  5ENT D;  2R02 A;  4HQD A;  3NBN B;  3ASN E;  3TWW A;  4N5C A;  3X2Q E;  3GZS A;  3DRA A;  4B93 B;  5LCW J;  4I1M A;  5FIO A;  1SZ9 A;  3PH0 C;  4FAD A;  3ONL A;  2XS1 A;  1N0Q A;  4GCO A;  1KZO A;  4KMO A;  1N9A A;  4EZK A;  1N4S A;  2KZT B;  4NQ0 A;  3HIZ A;  3RAU A;  2RD0 A;  3CHP A;  3S7F A;  3ZW3 A;  2XCB A;  2GW1 A;  4TV3 A;  3FU6 A;  2J9Q A;  3CIA A;  5BV1 A;  4R7L A;  3ZEF A;  5FQ6 A;  3CEQ A;  3IV0 A;  4JEH A;  5FQ4 A;  4HOT A;  2YHE A;  3PNT B;  4GMR A;  1MQS A;  3KD7 A;  4A3T A;  4U96 D;  3JYS A;  1DC2 A;  1MX6 A;  3CVY A;  4LER A;  1JUQ A;  2FF4 A;  1WY6 A;  2V4H C;  2CFZ A;  4JXT A;  1KT1 A;  2AXV A;  1MX4 A;  3DEO A;  5KWD A;  2J09 A;  3CLJ A;  3FUH A;  1OXJ A;  4EEC A;  2WXL A;  4UWG A;  3SFX A;  4PUC A;  3RRM B;  5BW8 C;  1GW6 A;  2PQN A;  4GZD A;  4JW1 A;  3RRN B;  3QWV A;  3SO8 A;  2IOS A;  2WQ6 A;  4GZ5 A;  4CYM D;  5J08 A;  1K1A A;  3EHR A;  3CK9 A;  4HRL A;  3MCX A;  3RK6 A;  4U8H A;  4UI9 J;  3T8M A;  4F3V A;  3L6A A;  2XPI A;  3D9H A;  4JD2 G;  3ZN3 A;  1EF1 C;  2Y69 E;  3R9A B;  2BKG A;  3HXF A;  2J08 A;  3LY8 A;  3NAW A;  3KSQ A;  4IN3 B;  4J8F A;  2J4D A;  2WXG A;  3JUE A;  2GRN B;  4U63 A;  4WUY A;  3CHM A;  2LXL A;  3D9L A;  1BI7 B;  1E7U A;  3BUA A;  3LS8 A;  3Q49 B;  1K1B A;  4F7A A;  3FHE A;  4I17 A;  3E37 A;  2IO3 C;  2M63 A;  3U4T A;  3Q4A B;  4GTM A;  1WM5 A;  2OEV A;  4MS6 A;  1HXI A;  4WWO A;  5BXO A;  2B6C A;  1S0P A;  3UXG A;  4YVO A;  4KVM A;  3CVN A;  4U7E B;  3FTW A;  2R17 C;  5CBO A;  5KJL A;  4CGW A;  2PL2 A;  2AWI A;  1YA0 A;  2VSX E;  4JHR A;  3UMV A;  3L17 A;  2WM9 A;  1JCQ A;  4GTS A;  3U66 A;  5EX3 A;  1OCC E;  2BF0 X;  4HFG A;  1IXV A;  4Q96 A;  1S63 A;  3FU5 A;  3CQG B;  3CVP A;  2LUH A;  4U0Z A;  4DUI A;  5EYP F;  2X6K A;  3ABK E;  3G2U A;  2YIN A;  4U8Y D;  1FVH A;  2GRM A;  3P1U A;  3MA5 A;  4UWL A;  4LG6 A;  1HZ4 A;  4YDY A;  3UIO C;  3RU0 A;  1UJJ A;  3WXX A;  4FJY A;  1BLX B;  3LY9 A;  3UIN C;  3E33 A;  4GA0 A;  1MX2 A;  4PS3 A;  4KBQ A;  4JHJ A;  3FEX A;  4NIK A;  3UM2 A;  2VQ2 A;  4YVQ C;  3PEU B;  4YDW A;  3NF1 A;  3CST A;  4CDN A;  2HYZ A;  1SVX A;  2E2E A;  3KS2 A;  2LXM A;  3MKQ B;  4G8K A;  5ITZ F;  4ATG A;  3MJW A;  1YYH A;  3DSV A;  4KVO A;  5AN8 A;  2DYS E;  3CQC B;  5LFA A;  1KZP A;  1BI8 B;  3SGH A;  3ULE G;  2WXK A;  4HVB A;  4IRU A;  4WNG A;  3PUJ A;  2ZU6 B;  4GZ3 A;  2Y4T A;  4A1G A;  4DI4 A;  4LNG A;  1QNF A;  3ZYQ A;  3DSU A;  1H6P A;  1V55 E;  4C9B B;  3EHM A;  4GYO A;  1HFA A;  2IOL A;  1JPL A;  4A55 A;  3CVL A;  3FTS A;  3UT8 A;  1QBQ A;  3PZ4 A;  4GTQ A;  3AG3 E;  1AP7 A;  3LVQ E;  4IUL A;  4HS2 A;  2FBN A;  4RG9 A;  3Q15 A;  3ZXP A;  3F6Q A;  4BWR A;  1FCH A;  2KZT A;  2A4Z A;  4UWH A;  3LY7 A;  3BQO A;  1HU3 A;  3ASF A;  5FZS A;  2J07 A;  1TYQ G;  2V5Q C;  3MYV A;  4BTB A;  3TWQ A;  4H7X A;  2Y1L E;  2VYI A;  2P9N G;  3B7R L;  4BSX A;  4DX6 D;  4KXK B;  2HM8 A;  5AYW D;  4ANU A;  2WB2 A;  2VSN A;  2DWZ A;  1QZ2 A;  1IQR A;  5BXU A;  1NP7 A;  4EHM A;  1N11 A;  4ZFH A;  1OT8 A;  2HO1 A;  3HHM A;  3KEA A;  3LVR E;  3BG1 B;  1N95 A;  1SW6 A;  1TN6 A;  4I9E A;  2ZGD A;  2QY7 A;  4FA6 A;  3AU4 A;  4BTA A;  2XS8 A;  5M72 A;  1H2U A;  1ZB1 A;  3E30 A;  5BPP A;  4CDM A;  3Q9N C;  2V8S E;  3KAE A;  1Z6T A;  1DCE A;  2ZIR A;  4JA7 A;  1NZN A;  2EIN E;  3G2T A;  3RO3 A;  3EU9 A;  3MV3 B;  3SHF A;  4C0E A;  4JC8 A;  4TXR A;  3JCK C;  4UUC A;  4GML A;  4FJZ A;  2P2C P;  3QOU A;  1ELW A;  2DBA A;  4QFV A;  1TNO A;  4BT9 A;  3CHR A;  1H6O A;  1LF8 A;  4N5Q A;  5IY5 E;  4AM9 A;  2KCV A;  2MRI A;  3HXB A;  3UT4 A;  3HXD A;  4TUU A;  5FZR A;  4BER A;  2LAH A;  1OWL A;  1OCZ E;  2A5E A;  2XEN A;  2R5S A;  2J8S D;  2CHW A;  1X5B A;  3ULY A;  2H6H A;  2BTD A;  1NA3 A;  2CG3 A;  1JCR A;  4EZJ A;  3ESL A;  3L9T A;  1W3B A;  3L22 A;  1K8K G;  3LCA A;  1IHB A;  4LEU A;  4ME2 A;  4KZ0 A;  5CED B;  3FU0 A;  1N94 A;  2UY1 A;  3V2X A;  3ZIM A;  3FUN A;  5JJ6 A;  2AVP A;  3DSX A;  2EIJ E;  4TUM A;  5KJN A;  4Y6W A;  2JLB A;  3C72 A;  3SNX A;  3BU8 A;  1DNP A;  3QKY A;  4V3I A;  3BEE A;  2P9U G;  1YCS B;  1FT1 A;  3ASO E;  1LD7 A;  3DSS A;  1MHQ A;  4F1P A;  2WXH A;  2ETA A;  3MX3 A;  5HKP A;  3TGO A;  5AJD A;  5G04 J;  4UWK A;  2X6I A;  4HOQ A;  3PEV B;  4RG6 A;  3NQP A;  3FUL A;  2WXF A;  3HVE A;  1E90 A;  3PUK A;  1OWO A;  3W9F A;  3Q7F A;  1SQM A;  1D9S A;  3ZYM A;  4J8S A;  2KM4 A;  2Q7F A;  1AWC B;  2RG8 A;  4I6E A;  1UJK A;  1SA4 A;  5A23 A;  2OVF A;  5BV0 A;  5JHA A;  4ATZ D;  2L6J A;  4O60 A;  1E8Z A;  4GTP A;  5C1D A;  2EQX A;  2FO7 A;  1Y8M A;  1B89 A;  4WWP A;  4XX5 A;  5AQA A;  2CG2 A;  5G05 J;  3ZU7 B;  4ZHB A;  2XRY A;  4MBG A;  4L1B A;  3Q75 A;  4N2Q A;  4KT6 B;  2A5U A;  4AJW A;  3LJ3 A;  4YDE A;  4GYW A;  1Y6I A;  5B1A E;  3ABL E;  4EBA G;  4KZC A;  2WXR A;  2DZO A;  3RJV A;  2AW6 A;  2BUG A;  5AEN A;  2LNI A;  1N4Q A;  4AVX A;  3JQ1 A;  4JB8 P;  4JEU A;  3IHV A;  1OWM A;  3PZD A;  3J5P A;  1UN9 A;  3NOG D;  2KAT A;  2NSZ A;  3S2A A;  2AJA A;  4APO A;  5G2N A;  4M7C A;  1PC2 A;  2GRO B;  4BES A;  3TWT A;  5EN5 D;  5AQB A;  2UY1 B;  3URZ A;  4JA9 A;  5T4Y A;  4ACK A;  1XGW A;  3P2B A;  4LNB A;  2P58 C;  1HF8 A;  2B0O E;  2J49 A;  1ZU2 A;  2NYJ A;  4EQF A;  3DSW A;  3R7R A;  4YND A;  2VJ8 A;  5EX0 A;  3T9K A;  4GTO A;  3TWS A;  3UIP C;  3U9W A;  3FH5 A;  3DPD A;  3UKU G;  3JUI A;  2LSU A;  2X6H A;  2PQR A;  3V79 K;  3SY2 A;  4UQZ A;  2L9B A;  4ABN A;  4FC8 A;  2IFU A;  4O6F A;  3RO2 A;  4K0R A;  2I2O A;  2QFC A;  5G05 C;  3MGB A;  4I43 A;  4N2S A;  5B1B E;  4HOU A;  4L9P A;  4ACL A;  3RIB A;  1FVF A;  3LKU A;  2JEK A;  3VTX A;  1LTX A;  3Q7A A;  1KT0 A;  2VGY A;  5CMW A;  5KNH D;  2I6H A;  5KJK A;  3EJN A;  4GAA A;  4YDO A;  1N4R A;  2P9K G;  3DPY A;  2F8X K;  3C3R A;  4A1S A;  4UQY A;  1IQU A;  2XRZ A;  1QYM A;  3S7J A;  2DCP A;  4Q94 A;  2IQC A;  4GZ6 A;  3FP3 A;  3D9O A;  4MRU A;  1WG0 A;  4J6I A;  3TJP A;  3QC1 A;  2PM6 A;  2ETB A;  4OVU A;  4FUL A;  3ULQ A;  3ZKJ A;  3D9M A;  3E34 A;  2L0I A;  4K5B A;  4MLP A;  2XPY A;  4WAF A;  4ILG A;  2XEH A;  2WXM A;  4B89 A;  5EIB E;  3D3M A;  1MJ0 A;  2GGF A;  4N39 A;  5ANR A;  4MKT A;  5DIZ A;  3B13 A;  2ZXW E;  3FDH A;  1UOH A;  1X81 A;  1Z3Y A;  4L2L A;  3TAX A;  5CMY A;  4D10 C;  5FQ7 A;  3MKR A;  1WDY A;  2V0P A;  3FUJ A;  4N3B A;  2HE0 A;  3TXN A;  3UX4 A;  5BT1 A;  5KCM A;  5C2Y A;  2BED A;  2H6F A;  5EYL A;  4GPK A;  4J0U A;  3EIJ A;  1MYO A;  3N71 A;  1UW4 B;  3MZL B;  1JWF A;  2XCC A;  5D0Q D;  3ZNG A;  1O1R A;  2OEW A;  4P29 A;  3EDT B;  3VLD A;  3MKQ A;  4BFR A;  1HX8 A;  2KBX A;  3UUX A;  1EYH A;  3C98 A;  1N54 A;  3ABM E;  3LJN A;  2C2L A;  3UM3 A;  3PE3 A;  2P9S G;  3L54 A;  4ILI A;  3CHS A;  2P9P G;  2WQ7 A;  4H7Y A;  4CDR A;  4E85 A;  3PZ3 A;  1XNF A;  4OYS A;  5LP0 A;  3R9M A;  4PS8 A;  4L23 A;  3UKR G;  5B3S E;  1Z3X A;  4BEP A;  3ASH A;  3IHY A;  4M3O A;  5FJY A;  4BY6 A;  5ARF A;  2DYR E;  3LYA A;  3FUF A;  3IEG A;  3LDZ A;  4LCT A;  3ZPJ A;  4JVS A;  4EZL A;  4LNU D;  4BX9 A;  1ZBP A;  3IKO B;  5JHB A;  3T5X A;  1TJC A;  3PE4 A;  4F1S A;  2GRL A;  2R03 A;  3T5V A;  1D8E A;  4AIF A;  3SZ7 A;  4OAU C;  3CVW A;  2WXQ A;  2WVI A;  3KEZ A;  2WXJ A;  5FZQ A;  2KCL A;  1IHG A;  3HVE B;  5H7P A;  4GTT A;  4HXI A;  1HG2 A;  3AS4 A;  4RLY A;  4AOF A;  3PZ2 A;  4U04 A;  4XKB A;  1RW2 A;  2Y4U A;  3SBT B;  1TNZ A;  4A3V A;  4CEM A;  3QDN A;  2AXU A;  4FHK A;  4I9C A;  4G24 A;  4HBD A;  3ZUV B;  2F37 A;  4CCA A;  1DVP A;  5EIL A;  4IYP A;  4B0Z A;  2X3M A;  3V2O A;  1NFI E;  2QZA A;  3RRU A;  4F53 A;  5EID A;  4QQI A;  3TWX A;  5ENR D;  1U2V G;  4XIF A;  4E6H A;  4B8A A;  4RVB A;  2IU1 A;  4I1O B;  1E8Y A;  2QYJ A;  4ANX A;  3APF A;  3WG7 E;  3E4B A;  3O48 A;  1YMP A;  1O1T A;  2ETC A;  3V30 A;  4CT4 A;  1H2T C;  4HLL A;  3CHQ A;  3SFY A;  3SQV A;  3VLE A;  5E75 A;  4DX5 D;  3PDN A;  3OXF A;  2P9L G;  2KXP C;  5ENN A;  4G2V A;  3LPZ A;  3IXE A;  1G3N B;  3I4G A;  3QB2 A;  5LX8 A;  3AG4 E;  4DLO A;  3U3W A;  2WQH A;  5ENS D;  3TWR A;  4DLQ A;  5JA4 D;  4I2Z A;  3QJZ A;  2I9C A;  5ENO D;  4DX2 A;  2OND A;  3L08 A;  1HE8 A;  4XI9 A;  3UT7 A;  4I2W A;  3KSL A;  1TNY A;  4DX7 D;  2QYU A;  2MHK A;  4OVV A;  4XEI G;  1UN8 A;  4APF A;  4J8D A;  1BPO A;  1RZ4 A;  4W9R A;  4J8E A;  5FIN A;  4F6R D;  3Q79 A;  3BG0 B;  2YQ8 A;  5FTP A;  4GYY A;  3SBS A;  3NB2 A;  3FH7 A;  2VSO E;  1N4P A;  1SZA A;  2L6B A;  3CKB A;  3GZ1 A;  5KBA A;  3ESK A;  3CHO A;  1H6K A;  5JJT A;  3U64 A;  3MV2 B;  2IJG X;  4JL0 A;  2H6I A;  3S7D A;  2RFA A;  3GZ2 A;  4AV7 A;  5AAR A;  1O1S A;  2WXI A;  1OWP A;  2Y0B G;  3CKC A;  2WXO A;  3PZ1 A;  4UI9 K;  3CGH A;  1N52 A;  3PRZ A;  2VGX A;  4PDX A;  2LAI A;  3ISM C;  4DX1 A;  3UQ3 A;  4JPS A;  3VTY A;  1LD8 A;  2WXN A;  1TJF A;  2CFU A;  3QAQ A;  3B7U X;  1MZC A;  2NC9 A;  1NL4 A;  3G2V A;  3PRE A;  2XPZ A;  2KC7 A;  1OY3 D;  1SA5 A;  3B7B A;  2OV8 A;  4FU3 A;  3L82 A;  3VLF A;  3EHN A;  2H6G A;  3QAR A;  1EPU A;  4WNE A;  1TEZ A;  2WPV A;  2R05 A;  1KPS B;  4EBA A;  1OWN A;  5HRY A;  4I1A A;  3RSE G;  2X6J A;  3HXC A;  1VDY A;  4GMJ A;  3OTN A;  3TWU A;  3O4Z A;  4N3A A;  3NZU A;  4L7T A;  4DJA A;  2BKK B;  3FTZ A;  1E7V A;  3EHQ A;  1TN7 A;  4GPM A;  4AXH A;  4DPR A;  1FT2 A;  4U0S A;  2L0T B;  4A63 B;  3APC A;  3FU3 A;  4LRZ A;  2XZD G;  4BET A;  2V5F A;  4G26 A;  1E8X A;  3EUV A;  2VTB A;  1JCS A;  1TR4 A;  2ILR A;  5AJL A;  4HB5 A;  5ENQ D;  1A17 A;  1IYG A;  4UI9 C;  1L5J A;  4AEZ C;  3Q47 B;  3HXE A;  4ILH B;  5D0O D;  3T8K A;  4PS7 A;  2XGO A;  2DVW A;  4RSY A;  4XKC A;  3HRA A;  3ZHE A;  1PY1 A;  5JMN D;  4EPZ A;  1JWG A;  5CCL A;  4FHJ A;  4FP7 A;  5KNG A;  3L16 A;  2FUL A;  3CV0 A;  2YHC A;  3FUE A;  3TL5 A;  3TG4 A;  3B95 A;  3NOC D;  2E0I A;  2OVB A;  2GRQ B;  4DK5 A;  3FTX A;  5AIJ A;  2IY0 C;  1HH8 A;  2XEV A;  1N0R A;  2PNN A;  4OAV B;  5EKQ D;  4UWF A;  3SI5 A;  2OOE A;  4HI8 A;  1FPP A;  4G1T A;  2HR2 A;  3G2W A;  3S7B A;  3Q78 A;  2MYO A;  2P9I G;  1Q2Z A;  1S64 A;  3ML9 A;  4NUR A;  3TG5 A;  3RKV A;  4Y6C A;  1H0A A;  3QNK A;  4K5A B;  3FWV A;  3ZFW A;  4WND A;  3UM1 A;  4K03 A;  4ANV A;  3FTY A;  1BD8 A;  3FY4 A;  4WWN A;  3AS5 A;  4G8L A;  3SD5 A;  2AXZ A;  2VTB B;  3LXU X;  3UM0 A;  1HG5 A;  4AP2 A;  5FT9 A;  2PM7 A;  1U3C A;  4U0U A;  5CCM A;  3JXI A;  3ASD A;  3DXM G;  4HNA D;  2EIM E;  4WNF A;  2EIK E;  2ZGG A;  4GA1 A;  4J8Y A;  4HOR A;  5HI7 A;  4XE0 A;  5BUZ A;  2DIW A;  4BT8 A;  4URK A;  3AU5 A;  1Z5S C;  5E76 A;  3SFZ A;  5A6C A;  2JAB A;  5HQ8 A;  3B7T A;  2WMN A;  1OCR E;  4J7W A;  4JZY A;  2V4L A;  3APD A;  4O1O A;  4G23 A;  4K5C A;  3FTU A;  5G55 A;  5ARG A;  2XEE A;  5ANL A;  2VSY A;  1NI1 A;  3DBS A;  3QWP A;  3ONK A;  4HLE A;  2WMO A;  4NAC A;  3W9G A;  2PZI A;  3FUI A;  2ZIS A;  5HS0 A;  3AS8 A;  3CSF A;  3ZXS A;  3FH8 A;  2VGE A;  2IF4 A;  3LEW A;  1E8W A;  3G2S A;  2J4B A;  2XGS A;  5BNW A;  4KYO B;  3GYZ A;  3HYM B;  1A5E A;  3I3N A;  2ION A;  5FWQ A;  3TWV A;  3PVL A;  5KJM A;  2YNQ A;  3ZYL A;  5A7D B;  3MEK A;  4TXP A;  2FI7 A;  3D9K A;  3CVX A;  2VGX B;  3FEY A;  4U07 A;  5JJ7 A;  3CVU A;  1HO8 A;  2I1K A;  4FLB A;  1IKN D;  3PNL B;  2NXP A;  2DZN A;  4GZC A;  2FO1 E;  4O1P A;  4GCN A;  4BX8 A;  3QWW A;  1K3Z D;  2I1J A;  2IO2 C;  3ZHE B;  5CHE E;  5CRU A;  4I6G A;  4Q69 A;  3JQ0 A;  1OUV A;  1V54 E;  3UI2 A;  2LSV A;  4HRN A;  1WAO 1;  2X38 A;  4PH4 B;  1NA0 A;  5D2M C;  1ELR A;  4CT0 A;  4G11 A;  3E32 A;  4CZ2 D;  3L13 A;  3AG2 E;  2MOW A;  4JHK A;  4HOS A;  2F8Y A;  1INZ A;  4NRH B;  3D9N A;  1OCO E;  2RFM A;  4LSZ E;  2C0M A;  4Z68 A;  2FEZ A;  5EDS A;  3D9I A;  1DCQ A;  2XHE A;  2R2L A;  5CBN A;  3HG0 D;  2Y3A A;  3D9J A;  1P5Q A;  4FLH A;  1ELK A;  4N3C A;  5T3R A;  3AG1 E;  3OXG A;  1O5M A;  3FUK A;  2R59 A;  3Q73 A;  4GTR A;  3EU5 A;  3Q9U C;  4I6J A;  4GTV A;  3PS6 A;  3NZS A;  3CK8 A;  3CK7 A;  4TRQ A;  3I4R B;  4UQX A;  2GRR B;  2X6F A;  1KLX A;  1E96 B;  5CEA A;  4BSZ B;  3DWL G;  2CHZ A;  3C5R A;  1S70 B;  2XQ0 A;  3FUD A;  3OAW A;  2F0Y A;  3OXL A;  1H2V C;  4U95 D;  1TN8 A;  5CER B;  1UG3 A;  1EDU A;  3UPV A;  3FUM A;  4AY5 A;  3K9I A;  4XI0 A;  5J90 A;  1HS6 A;  4GA2 A;  3ZYK A;  4CRW A;  3C3O A;  3ZRH A;  1QQE A;  3FFL A;  5CRV A;  3ENE A;  3ZVV A;  5LCW C;  4L2Y A;  3CVQ A;  4HI9 A;  4X8Q A;  4C48 B;  2IEJ A;  3DXK G;  1PAQ A;  3HDX A;  1BU9 A;  5ENP D;  4C0M A;  3DST A;  2EIL E;  2RKK A;  3SF4 A;  3JXJ A;  3QK0 A;  4DI3 A;  4B8C B;  3DEP A;  2UWJ G;  3TXM A;  3FTV A;  3R7Q A;  4CGV A;  2C0L A;  4B94 A;  4LUN U;  4RQI A;  1TNB A;  3J5Q B;  4HRM B;  1U3D A;  3I5P A;  4GB9 A;  5AQ9 A;  2CHX A;  2GRP B;  3AAA C;  2KCK A;  4TXQ A;  3EIQ C;  3IBE A;  5G04 C;  2XGM A;  4GU5 A;  3ZGQ A;  5T8I A;  2XZT G;  2WXP A;  1TNU A;  3CVV A;  5AAO A;  4U8V D;  3B7S A;  5D66 A;  5CEC B;  3D9P A;  5LOZ A;  3V31 A;  5AQ7 A;  1D8D A;  4AY6 A;  3ML8 A;  2OCC E;  5FQ8 A;  3C3Q A;  3Q5M A;  3GW4 A;  4XZ4 A;  2QC9 A; 
#chains in the Genus database with same CATH homology
 2V0P A;  3FTX A;  3FUJ A;  2QY7 A;  3ASG A;  4ANW A;  4FA6 A;  4CDM A;  1H19 A;  3AU4 A;  4I9E A;  4N3B A;  5AIJ A;  4BTA A;  5M72 A;  1H2U A;  4G25 A;  5BPP A;  5DBK A;  3TXN A;  1HH8 A;  2V8S E;  3UX4 A;  3KAE A;  2LO6 A;  1Z6T A;  5KCM A;  5C2Y A;  5BT1 A;  2XEV A;  4GPK A;  4J0U A;  4JA7 A;  3EIJ A;  3N71 A;  3CR3 A;  5EKQ D;  1NZN A;  4UWF A;  3SI5 A;  2OOE A;  4N5C A;  1UW4 B;  3MZL B;  3GZS A;  4G1T A;  1JWF A;  2XCC A;  3G2T A;  2HR2 A;  3G2W A;  3RO3 A;  4I1M A;  5LCW J;  5D0Q D;  3S7B A;  1SZ9 A;  3PH0 C;  4P29 A;  3MV3 B;  3EDT B;  3SHF A;  3VLD A;  4C0E A;  4FAD A;  3MKQ A;  3ONL A;  1HX8 A;  4BFR A;  4JC8 A;  3UUX A;  3JCK C;  4GML A;  1EYH A;  3C98 A;  1N54 A;  4FJZ A;  3ML9 A;  4NUR A;  3QOU A;  4GCO A;  3TG5 A;  3RKV A;  4KMO A;  4Y6C A;  1H0A A;  3QNK A;  1ELW A;  2C2L A;  2DBA A;  3PE3 A;  4EZK A;  4QFV A;  4BT9 A;  3CHR A;  3FWV A;  3ZFW A;  4WND A;  2KZT B;  3L54 A;  1LF8 A;  4NQ0 A;  4ILI A;  3HIZ A;  4K03 A;  2RD0 A;  3CHS A;  3CHP A;  3S7F A;  2XCB A;  2GW1 A;  4H7Y A;  4TV3 A;  3FU6 A;  2J9Q A;  3CIA A;  4CDR A;  5BV1 A;  2WQ7 A;  4E85 A;  4R7L A;  4AM9 A;  4OYS A;  1XNF A;  4ANV A;  3FTY A;  5LP0 A;  2KCV A;  3ZEF A;  4PS8 A;  3FY4 A;  2MRI A;  4WWN A;  4L23 A;  5FQ6 A;  3AS5 A;  3CEQ A;  3IV0 A;  4JEH A;  5FQ4 A;  3SD5 A;  2YHE A;  2AXZ A;  3PNT B;  3UT4 A;  4TUU A;  2VTB B;  4HOT A;  1MQS A;  1Z3X A;  5FZR A;  3LXU X;  3KD7 A;  3ASH A;  4A3T A;  2LAH A;  3IHY A;  3JYS A;  1HG5 A;  4M3O A;  1OWL A;  5FJY A;  4AP2 A;  4BY6 A;  5ARF A;  2R5S A;  3LYA A;  5FT9 A;  2CHW A;  1X5B A;  3FUF A;  2PM7 A;  3IEG A;  1U3C A;  4U0U A;  3LDZ A;  4LCT A;  3ZPJ A;  2BTD A;  1NA3 A;  5CCM A;  4JVS A;  4EZL A;  2CG3 A;  3ASD A;  3CVY A;  4EZJ A;  4LER A;  4BX9 A;  1ZBP A;  4WNF A;  3IKO B;  5JHB A;  1JUQ A;  2FF4 A;  1WY6 A;  3ESL A;  3T5X A;  4GA1 A;  1W3B A;  1TJC A;  2CFZ A;  3L22 A;  3PE4 A;  4F1S A;  4HOR A;  2GRL A;  4JXT A;  3T5V A;  5HI7 A;  1KT1 A;  4XE0 A;  3LCA A;  4ME2 A;  2AXV A;  4LEU A;  5BUZ A;  2DIW A;  4KZ0 A;  4BT8 A;  4URK A;  3AU5 A;  4AIF A;  3SZ7 A;  3CVW A;  2WXQ A;  5E76 A;  2J09 A;  3CLJ A;  3FU0 A;  3FUH A;  3SFZ A;  2UY1 A;  2WVI A;  3B7T A;  5A6C A;  5HQ8 A;  2WMN A;  3KEZ A;  3ZIM A;  2WXJ A;  4EEC A;  2WXL A;  3FUN A;  4JZY A;  5FZQ A;  2V4L A;  2KCL A;  1IHG A;  3HVE B;  3APD A;  4UWG A;  4G23 A;  4PUC A;  4HXI A;  1HG2 A;  5JJ6 A;  2AVP A;  3FTU A;  3RRM B;  5G55 A;  4TRQ A;  3AS4 A;  5BW8 C;  1GW6 A;  5ARG A;  5ANL A;  4AOF A;  2VSY A;  2PQN A;  5KJN A;  4GZD A;  4Y6W A;  2JLB A;  3DBS A;  3QWP A;  4JW1 A;  4U04 A;  3RRN B;  3ONK A;  3SNX A;  4HLE A;  2WMO A;  3QWV A;  4NAC A;  4XKB A;  1DNP A;  2IOS A;  2PZI A;  2Y4U A;  3SBT B;  3FUI A;  2WQ6 A;  4GZ5 A;  4A3V A;  3QKY A;  4V3I A;  3AS8 A;  3CSF A;  3ZXS A;  3QDN A;  2AXU A;  3FH8 A;  3BEE A;  4FHK A;  4CEM A;  5J08 A;  4I9C A;  4G24 A;  2IF4 A;  3LEW A;  1E8W A;  3G2S A;  2J4B A;  2XGS A;  5BNW A;  3CK9 A;  4KYO B;  3MCX A;  1MHQ A;  4CCA A;  1DVP A;  2WXH A;  3GYZ A;  3RK6 A;  4U8H A;  3HYM B;  4UI9 J;  3I3N A;  3T8M A;  4F3V A;  4IYP A;  3MX3 A;  2ION A;  4B0Z A;  2X3M A;  5FWQ A;  3L6A A;  3TGO A;  2XPI A;  5AJD A;  5G04 J;  3RRU A;  4F53 A;  4UWK A;  2X6I A;  4HOQ A;  3PEV B;  3ZN3 A;  1EF1 C;  3PVL A;  4RG6 A;  5KJM A;  3NQP A;  3FUL A;  4XIF A;  3R9A B;  4E6H A;  2YNQ A;  4B8A A;  2WXF A;  4RVB A;  3HVE A;  2J08 A;  3LY8 A;  2IU1 A;  4I1O B;  5A7D B;  3MEK A;  3ZYL A;  1E90 A;  4IN3 B;  1E8Y A;  3PUK A;  4J8F A;  2J4D A;  1OWO A;  2WXG A;  4ANX A;  3APF A;  3E4B A;  3O48 A;  1SQM A;  2FI7 A;  4U63 A;  3ZYM A;  3D9K A;  4J8S A;  2KM4 A;  2VGX B;  4CT4 A;  3CVX A;  2Q7F A;  4WUY A;  1H2T C;  3CHQ A;  3CHM A;  3FEY A;  4U07 A;  5JJ7 A;  2RG8 A;  3CVU A;  1HO8 A;  4I6E A;  3D9L A;  1UJK A;  2I1K A;  4FLB A;  5A23 A;  3VLE A;  1E7U A;  2OVF A;  3PNL B;  2NXP A;  5BV0 A;  4GZC A;  5E75 A;  5JHA A;  3LS8 A;  3PDN A;  2L6J A;  4GCN A;  3OXF A;  3Q49 B;  4BX8 A;  4F7A A;  3QWW A;  3FHE A;  1E8Z A;  4I17 A;  2I1J A;  5C1D A;  4G2V A;  2M63 A;  2EQX A;  2FO7 A;  3LPZ A;  1WM5 A;  3Q4A B;  4MS6 A;  5ENN A;  1HXI A;  3U4T A;  1Y8M A;  4WWO A;  3ZHE B;  5CHE E;  4I6G A;  3I4G A;  1B89 A;  1S0P A;  3JQ0 A;  3QB2 A;  4WWP A;  4XX5 A;  4Q69 A;  4YVO A;  1OUV A;  4KVM A;  2CG2 A;  5G05 J;  3CVN A;  5LX8 A;  4DLO A;  3U3W A;  2XRY A;  2LSV A;  1WAO 1;  4L1B A;  2WQH A;  2X38 A;  3FTW A;  2R17 C;  5KJL A;  4N2Q A;  4DLQ A;  4KT6 B;  4PH4 B;  1NA0 A;  4CGW A;  2A5U A;  4AJW A;  3LJ3 A;  4I2Z A;  4GYW A;  3QJZ A;  1Y6I A;  2I9C A;  2OND A;  1ELR A;  2PL2 A;  4CT0 A;  2AWI A;  4G11 A;  1YA0 A;  3L08 A;  3L13 A;  1HE8 A;  4XI9 A;  4EBA G;  4KZC A;  2WXR A;  2MOW A;  2VSX E;  3UT7 A;  4JHK A;  4HOS A;  4JHR A;  3RJV A;  3UMV A;  3L17 A;  2AW6 A;  4I2W A;  2WM9 A;  2BUG A;  5AEN A;  2LNI A;  1INZ A;  4NRH B;  2MHK A;  4OVV A;  4AVX A;  3D9N A;  3JQ1 A;  5EX3 A;  3U66 A;  1UN8 A;  4APF A;  4JEU A;  4J8D A;  3IHV A;  2BF0 X;  2C0M A;  1OWM A;  4HFG A;  4Q96 A;  2FEZ A;  1BPO A;  3CQG B;  3FU5 A;  3CVP A;  4U0Z A;  3PZD A;  4W9R A;  4J8E A;  5EDS A;  2X6K A;  3BG0 B;  2YQ8 A;  1UN9 A;  3D9I A;  5FTP A;  4GYY A;  3SBS A;  2KAT A;  3G2U A;  2XHE A;  3FH7 A;  2VSO E;  2NSZ A;  3S2A A;  1SZA A;  2YIN A;  4APO A;  5G2N A;  2Y3A A;  3CKB A;  3D9J A;  1P5Q A;  1FVH A;  1PC2 A;  3GZ1 A;  2GRM A;  3P1U A;  3MA5 A;  3ESK A;  3CHO A;  4FLH A;  4UWL A;  1ELK A;  1H6K A;  4N3C A;  5JJT A;  3U64 A;  3MV2 B;  2IJG X;  4JL0 A;  3S7D A;  1HZ4 A;  3GZ2 A;  2UY1 B;  5T3R A;  3URZ A;  4JA9 A;  5T4Y A;  3OXG A;  4AV7 A;  4ACK A;  1XGW A;  3RU0 A;  3FUK A;  3P2B A;  2R59 A;  1UJJ A;  3WXX A;  2P58 C;  1HF8 A;  4I6J A;  2WXI A;  1OWP A;  3CKC A;  3PS6 A;  2J49 A;  1ZU2 A;  3CK8 A;  2WXO A;  3NZS A;  4FJY A;  3CK7 A;  4UI9 K;  4EQF A;  3LY9 A;  3CGH A;  1N52 A;  3PRZ A;  2VGX A;  4GA0 A;  4PDX A;  2LAI A;  4PS3 A;  2VJ8 A;  4YND A;  3R7R A;  3I4R B;  4UQX A;  5EX0 A;  2X6F A;  4KBQ A;  4JHJ A;  3FEX A;  1KLX A;  1E96 B;  2VQ2 A;  4YVQ C;  3PEU B;  3UQ3 A;  2CHZ A;  3NF1 A;  3CST A;  4JPS A;  4CDN A;  3VTY A;  3U9W A;  3FH5 A;  3DPD A;  2XQ0 A;  3JUI A;  3FUD A;  2WXN A;  1TJF A;  2CFU A;  2LSU A;  2X6H A;  2HYZ A;  2E2E A;  3OAW A;  3QAQ A;  3B7U X;  2NC9 A;  2PQR A;  3KS2 A;  3G2V A;  1H2V C;  3OXL A;  3PRE A;  3MKQ B;  1UG3 A;  2XPZ A;  4ATG A;  3MJW A;  4UQZ A;  2L9B A;  1EDU A;  4ABN A;  2KC7 A;  3UPV A;  3FUM A;  4KVO A;  4FC8 A;  2IFU A;  4O6F A;  4AY5 A;  3RO2 A;  3K9I A;  4K0R A;  4XI0 A;  5J90 A;  2OV8 A;  4FU3 A;  3VLF A;  2I2O A;  2QFC A;  3CQC B;  3EHN A;  3QAR A;  1EPU A;  4WNE A;  1TEZ A;  1HS6 A;  5G05 C;  2WPV A;  3MGB A;  4GA2 A;  4I43 A;  5LFA A;  4N2S A;  3SGH A;  4EBA A;  3ZYK A;  4CRW A;  1OWN A;  4HOU A;  3ZRH A;  2WXK A;  1QQE A;  4I1A A;  4HVB A;  4IRU A;  4WNG A;  2X6J A;  3FFL A;  2ZU6 B;  3PUJ A;  3ENE A;  1VDY A;  4GMJ A;  4ACL A;  3ZVV A;  3RIB A;  4GZ3 A;  3OTN A;  1FVF A;  3LKU A;  5LCW C;  3O4Z A;  2Y4T A;  4L2Y A;  4A1G A;  3CVQ A;  2JEK A;  3VTX A;  4DI4 A;  1QNF A;  4N3A A;  3ZYQ A;  3NZU A;  4L7T A;  1KT0 A;  2VGY A;  5CMW A;  2I6H A;  4C9B B;  4DJA A;  3EHM A;  4GYO A;  3FTZ A;  5KJK A;  1HFA A;  1PAQ A;  3EJN A;  3HDX A;  2IOL A;  4GAA A;  4C0M A;  1JPL A;  1E7V A;  4A55 A;  3CVL A;  3FTS A;  3UT8 A;  3SF4 A;  3QK0 A;  4DI3 A;  4A1S A;  4B8C B;  4UQY A;  2UWJ G;  4AXH A;  1IQU A;  2XRZ A;  4DPR A;  3TXM A;  3LVQ E;  3FTV A;  3R7Q A;  4U0S A;  4IUL A;  3S7J A;  4CGV A;  2C0L A;  2FBN A;  4HS2 A;  2L0T B;  4B94 A;  2DCP A;  4LUN U;  4RG9 A;  4Q94 A;  2IQC A;  3APC A;  3FU3 A;  3Q15 A;  4GZ6 A;  4LRZ A;  3FP3 A;  3D9O A;  4BWR A;  1FCH A;  2KZT A;  4MRU A;  4J6I A;  1U3D A;  3TJP A;  3QC1 A;  2PM6 A;  2A4Z A;  2V5F A;  4G26 A;  3I5P A;  4GB9 A;  1E8X A;  4OVU A;  4UWH A;  3LY7 A;  2VTB A;  4FUL A;  2ILR A;  5AJL A;  1A17 A;  2CHX A;  3ULQ A;  1HU3 A;  1IYG A;  3D9M A;  3ASF A;  4UI9 C;  1L5J A;  2L0I A;  4MLP A;  5FZS A;  4AEZ C;  2J07 A;  2KCK A;  2XPY A;  3ZW3 A;  3Q47 B;  3MYV A;  3EIQ C;  3IBE A;  4WAF A;  5G04 C;  4ILH B;  5D0O D;  4BTB A;  4ILG A;  4PS7 A;  2XGM A;  4GU5 A;  2WXM A;  3ZGQ A;  4B89 A;  4H7X A;  5T8I A;  2XGO A;  3D3M A;  2WXP A;  4RSY A;  4XKC A;  2VYI A;  3CVV A;  3ZHE A;  1PY1 A;  3B7R L;  4BSX A;  4EPZ A;  1JWG A;  5CCL A;  4KXK B;  2HM8 A;  3B7S A;  2GGF A;  4N39 A;  5ANR A;  4MKT A;  4FHJ A;  5AYW D;  4ANU A;  4FP7 A;  5DIZ A;  3D9P A;  2WB2 A;  5LOZ A;  3B13 A;  2VSN A;  3L16 A;  2FUL A;  3CV0 A;  2YHC A;  3FUE A;  3TL5 A;  1QZ2 A;  1IQR A;  3TG4 A;  3FDH A;  1NP7 A;  1Z3Y A;  4L2L A;  4AY6 A;  2E0I A;  2OVB A;  3TAX A;  3ML8 A;  2HO1 A;  3HHM A;  3LVR E;  5CMY A;  3BG1 B;  4D10 C;  5FQ8 A;  5FQ7 A;  4DK5 A;  3Q5M A;  3MKR A;  3GW4 A;  4XZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...