1NA3A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
b'GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed protein CTPR2
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 36
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na3A00
4GA1A 2L6JA 3KS2A 5HI7A 4YVOA 4G2VA 1IYGA 2FO7A 4J0UA 4EQFA 1WM5A 3K9IA 3ASGA 3ZPJA 2YHCA 2PQRA 3GYZA 2KATA 5FZSA 3MV3B 5D0OD 1Y8MA 3TG5A 4JA7A 4ME2A 4J8EA 4J8FA 5G04J 3OXFA 4JA9A 2JLBA 4GCNA 1ZU2A 1KT1A 3ZN3A 2C0MA 4N3CA 3S7JA 4YNDA 3QKYA 3LY8A 2VQ2A 5JJTA 2HYZA 3Q49B 5DIZA 2E2EA 1ZBPA 1IHGA 4W9RA 3CEQA 5AYWD 2P58C 5A6CA 3RU0A 3EDTB 4UI9K 3CVPA 4XI9A 4BWRA 4GA2A 4J8DA 2VGXA 5FJYA 2KC7A 4HOUA 4ABNA 3UQ3A 4I2ZA 3CK7A 2VYIA 2FI7A 3ZGQA 1ELWA 5G04C 4BT9A 4UI9J 2VSYA 4A1SA 3ESKA 1KT0A 2LSUA 3MA5A 4GPKA 2V5FA 3U3WA 2XGSA 4APOA 2KCVA 3OXGA 3LPZA 3FFLA 2KCLA 1NZNA 1PC2A 3HYMB 5FZRA 4BTBA 4NQ0A 4O6FA 4HOTA 1ELRA 4N3BA 4GYOA 5DBKA 3QWWA 2UY1A 3LKUA 2UWJG 3RO3A 5FZQA 4CDRA 4HOQA 1P5QA 4WNGA 5M72A 3MKRA 4UI9C 3MV2B 3ZHEB 4GYWA 3PE3A 2NC9A 2VSNA 1FCHA 3CK9A 4GCOA 2LNIA 5EX3A 4RG6A 3S7DA 2FF4A 4I1AA 3S7BA 4KBQA 3PDNA 3U4TA 4Y6CA 5CHEE 3AS4A 3VTYA 5LCWC 2OOEA 3LCAA 5JJ7A 5FT9A 4N39A 2R5SA 4JL0A 5EKQD 3GZ2A 2AVPA 1NA0A 3RKVA 3S7FA 2XCBA 3OXLA 3GZ1A 4GZ6A 3JYSA 3TG4A 2GW1A 2Y4UA 5G05J 3LY9A 3CVNA 4RG9A 1HXIA 3CVLA 4GYYA 4N5CA 3O48A 2FEZA 3TGOA 3CVQA 4WNEA 4BT8A 3SZ7A 4AY5A 4WUYA 3CKBA 5KJKA 3QOUA 4GZ5A 3QDNA 4JHRA 3AS5A 4UQYA 2FBNA 3LY7A 4N2QA 5ARFA 5ARGA 4AY6A 3IEGA 5BNWA 4U0SA 2WQHA 4Y6WA 5G05C 3UPVA 5FTPA 2VGYA 5KJMA 4AM9A 4N2SA 2KCKA 1QZ2A 5LCWJ 4KYOB 5CCMA 2MHKA 3R9AB 1TJCA 2C0LA 3WXXA 4H7YA 4YVQC 2XGMA 4H7XA 5C1DA 4XIFA 4CGWA 4U07A 4I9CA 1HZ4A 4I17A 4G1TA 2HO1A 3Q5MA 4UQXA 3ULQA 3Q47B 5D0QD 3QWVA 3FWVA 4N3AA 3BEEA 4I2WA 4XI0A 3RO2A 2WPVA 4F3VA 3ZFWA 3N71A 2PQNA 4BTAA 3UUXA 3ASHA 4U0UA 2XPIA 4HOSA 4AIFA 2ONDA 4GA0A 3FP3A 4G25A 2J9QA 3CKCA 4U0ZA 2IFUA 3RIBA 3CK8A 2XEVA 5KJNA 3LYAA 1WAO1 3E4BA 3KD7A 3SF4A 4B94A 1KLXA 3NF1A 2XGOA 4GZ3A 4I9EA 1B89A 1QQEA 1HH8A 1E96B 3ASFA 5JJ6A 2QFCA 4U04A 3AS8A 2YQ8A 2VGXB 1YA0A 4KXKB 1A17A 4IN3B 4UQZA 4WNFA 4NRHB 1OUVA 5CCLA 3Q4AB 4WNDA 2IF4A 2I6HA 3MEKA 5KJLA 3URZA 3GW4A 2PZIA 3VTXA 2XCCA 3CV0A 2Y4TA 2HR2A 4G26A 5BW8C 4HORA 3RJVA 3Q15A 2PL2A 1W3BA 1XNFA 1NA3A 2BUGA 4CGVA 4G24A 5BT1A 5EX0A 3ZHEA 3KAEA 2C2LA 3TAXA 3ASDA 2UY1B 5HQ8A 2DBAA 2LSVA 5A7DB 4LEUA 3QWPA 4G23A 2Q7FA 3PE4A
chains in the Genus database with same CATH superfamily
2ZU6B 4GA1A 2P9SG 3FU5A 4CYMD 3U9WA 4DI3A 3ONKA 3G2UA 1TN8A 4FA6A 4GB9A 3K9IA 3ZPJA 2Y0BG 4F7AA 2KATA 4ANUA 2XS8A 3B7RL 3BUAA 4BSZB 5D0OD 5KBAA 4FC8A 1Y8MA 2CHZA 3FTVA 4XZ4A 4G11A 3V2XA 5CECB 2P2CP 4JA7A 3W9GA 5G55A 1OXJA 2CG3A 1NL4A 2F0YA 1ZU2A 1BLXB 1KT1A 3S7JA 1H19A 1PAQA 2R17C 3VLDA 4A3VA 5JJTA 2HYZA 2OVBA 4F1SA 5JHAA 3L54A 2B6CA 1TNYA 2ZGDA 2ZGGA 2X6HA 2P58C 3ML8A 1E8YA 3JQ1A 3EDTB 4UI9K 3E37A 3CVPA 4XI9A 4GA2A 3CVXA 1QBQA 4LRZA 2XPYA 4I2ZA 2VYIA 3EUVA 2FI7A 4B8CB 3B7SA 4K03A 2J4BA 1LF8A 2V8SE 4L2LA 4YDEA 2LSUA 4EHMA 2L0TB 3CVVA 2AXVA 2XGSA 3L82A 4FHJA 3FFLA 3IHVA 1U3CA 1PC2A 5FZRA 5CRVA 3UM1A 4NQ0A 4O6FA 1JCRA 2X3MA 4N3BA 3NQPA 1MJ0A 3QWWA 4L9PA 3LKUA 2UWJG 3RO3A 3PZ3A 4CDRA 5AQBA 3MKRA 4F1PA 1RZ4A 4GYWA 3PE3A 2NC9A 4FU3A 2LNIA 4UWHA 4RG6A 3WG7E 4EPZA 3S7BA 4QFVA 1UJJA 3ISMC 2FULA 3VTYA 3D9LA 5LCWC 1FT2A 3LCAA 5JJ7A 3UT7A 1N4QA 5FT9A 4V3IA 2R5SA 4JL0A 1HFAA 2VTBB 4LERA 4MBGA 2H6FA 1Z3YA 2WXMA 2L9BA 3RKVA 2LXMA 3C98A 3SI5A 3SHFA 5G05J 4I6JA 3CQGB 3EHQA 3V79K 4HI8A 3PNLB 3FTYA 2FEZA 3UM3A 2EIME 4WNEA 5FQ6A 1XGWA 1N0RA 1JCSA 2AWIA 2QYJA 5J90A 3VLEA 1JUQA 5EYPF 2FBNA 3TWTA 3CHSA 4AY6A 5BNWA 5ENTD 2BKGA 2IY0C 3NZUA 4GTOA 5EDSA 2GRLA 4AM9A 3D9JA 4OAVB 1IKND 2CFUA 2MHKA 2EIKE 1TJCA 4YVQC 1Q2ZA 3CLJA 3UTMA 3FULA 4CGWA 4B8AA 4UWGA 3OTNA 1HZ4A 2HO1A 3Q5MA 4HRNA 3FWVA 2AXZA 4I2WA 4FULA 2DZNA 4F3VA 2WXOA 2PQNA 3UUXA 2WMOA 2WB2A 4PS8A 4U0UA 2XPIA 2XS1A 4AIFA 3HIZA 4AVXA 3UI2A 3FP3A 4C0EA 3T5VA 2DYRE 3LXUX 5CBNA 4DRXE 2J9QA 3SFYA 5B1BE 3VLFA 5CERB 3JXJA 3UKUG 2NSZA 3AG1E 5A23A 3E34A 5BUZA 2RG8A 3I3NA 4XKCA 2I1KA 2XGOA 4FP7A 4GZ3A 3ZU7B 3FH8A 2VSOE 5BV0A 2DCPA 3ASFA 4GMRA 1O1TA 3AS8A 4U04A 3DPYA 2YQ8A 2VGXB 4KXKB 5T8IA 3DSTA 1A17A 4IN3B 3DXMG 2DZOA 1S64A 1H2TC 3L08A 3C3QA 4UUCA 5CCLA 3CVUA 3APDA 3Q4AB 4WNDA 1YCSB 4YDYA 5KJLA 3D9IA 1HG5A 5EYLA 2QY7A 3LVRE 1BU9A 2RKKA 1HF8A 2P9PG 2HR2A 3NBNB 4G26A 4L1BA 3RJVA 3Q15A 2PL2A 5CBOA 2OVFA 3HRAA 4TV3A 2BUGA 3DWLG 4JZYA 5BT1A 3HVEA 4L7TA 2WXIA 2LSVA 2Q7FA 1INZA 4D10C 4WAFA 1TNBA 4BETA 2L6JA 4JD2G 2XRZA 5ENRD 4AEZC 3CHQA 3KS2A 4YVOA 3FUNA 1FVHA 3PUKA 1QYMA 1WM5A 2F8XK 2ETBA 5H7PA 3SFXA 3ZKJA 2WMNA 3TG5A 3IHYA 5CEAA 4URKA 1DCQA 1X81A 4ME2A 1OWMA 4J8FA 4J7WA 2AJAA 1S0PA 5G04J 2JLBA 4GCNA 2R05A 4I43A 2C0MA 4N3CA 3MKQB 3FUHA 3LY8A 3NAWA 2MYOA 3UM2A 1ZBPA 3CIAA 3CEQA 2WXJA 3QNKA 3UX4A 3MGBA 3HXDA 5A6CA 4HRMB 3ZUVB 3L22A 3MCXA 5AENA 4A55A 4KT6B 2VGXA 4Q96A 1N4SA 2I2OA 3L16A 4HOUA 2X6JA 4C9BB 3ABME 4LNGA 4YDWA 3ZEFA 2QC9A 2IEJA 3ZGQA 1ELWA 3ASOE 2VSYA 1MQSA 1OCCE 1N0QA 5HKPA 4GPKA 3ZYLA 3IKOB 3CVYA 5JHBA 3ZYKA 1TNUA 2KCVA 1S70B 3D9PA 2F8YA 2KCLA 4CDMA 3RAUA 2M63A 3ZIMA 2V5QC 2WQ7A 4GTRA 4BTBA 2IQCA 1ELRA 2ILRA 4U8HA 1MX4A 4GYOA 5AQAA 4CT4A 4RLYA 1N4PA 3IV0A 2WM9A 4M7CA 1DVPA 5AJLA 2BTDA 4HOQA 1P5QA 4WNGA 4J8SA 4UI9C 3ZHEB 3L13A 2CHWA 3CK9A 1UOHA 2JEKA 2A5EA 5ENNA 4A63B 1HO8A 3EHMA 4I1AA 4GAAA 3SO8A 3KEZA 1OCRE 5LP0A 3PDNA 4JEUA 4Y6CA 1TNOA 3I4RB 1A5EA 2DIWA 3PUJA 2OOEA 3E30A 4BY6A 2XEEA 4N39A 3W9FA 1E8WA 3FUEA 1BI7B 3PH0C 3Q79A 1JWFA 1H6KA 3GZ2A 2B0OE 2CFZA 4J6IA 3NOGD 2PNNA 5T3RA 3NOCD 3Q7FA 2XCBA 2L6BA 1HE8A 3JYSA 3PEVB 3TG4A 2P9LG 5ITZF 1VDYA 4CT0A 3ABKE 2OCCE 3MX3A 2ZXWE 4CRWA 2YNQA 2AXUA 4NIKA 5EN5D 4XKBA 4C48B 2P9KG 4HVBA 3TL5A 4N5CA 1EF1C 3TGOA 5BXUA 3CVQA 3ZXPA 3FH5A 3QB2A 4DLOA 1EDUA 4WUYA 3QOUA 3QDNA 2IJGX 4UQYA 1N95A 4N2QA 2BF0X 4Y6WA 3UPVA 2VGYA 5KJMA 4N2SA 2C0LA 4GTMA 3WXXA 4PDXA 3ESLA 4O1OA 4CDNA 1H6PA 3GZSA 4KVMA 4OVUA 4TXRA 4XIFA 3AG3E 4U07A 3ONLA 3PZ1A 1SZAA 4JB8P 4O60A 4ZHBA 3PZDA 4UQXA 3ULQA 3T9KA 3QWVA 2PM7A 4I1MA 4N3AA 4BSXA 3CSFA 3B13A 3LS8A 1N54A 4U95D 2HM8A 2WPVA 3ZFWA 1TNZA 4TUMA 3N71A 4PUCA 4BTAA 1HG2A 1MX2A 1O5MA 3D3MA 4DX7D 1OWLA 1HU3A 4HOSA 3FU6A 1E8ZA 4HI9A 2X38A 3PREA 4BX8A 4KZCA 2ONDA 4GA0A 3EU9A 3SD5A 1N9AA 3UKRG 5LX8A 1K3ZD 3CKCA 4HS2A 3TWRA 3Q78A 4XEIG 5AQ7A 1IQUA 3EU5A 3EJNA 2R03A 3SF4A 2P9NG 3QK0A 1ZB1A 4HRLA 3NF1A 4K5CA 3ZRHA 3FTUA 4AOFA 1HH8A 4LNBA 4I6EA 5JJ6A 5ENPD 3SGHA 2ETAA 1TEZA 4HB5A 2VJ8A 1PY1A 5E75A 4BFRA 1DCEA 3JXIA 1OUVA 1JPLA 4X8QA 2IF4A 4LG6A 3MEKA 4TRQA 4K5BA 4C0MA 3LEWA 3HG0D 1O1RA 3EHNA 1S63A 2DWZA 3P2BA 3CV0A 2H6IA 1D8DA 2WXQA 2IOLA 3ABLE 1N4RA 1W3BA 3TWUA 1XNFA 3PZ4A 5T4YA 3TXMA 1SZ9A 4HQDA 2X6KA 4EZJA 3L6AA 1O1SA 5JMND 4GMJA 4GTTA 2UY1B 2DYSE 5A7DB 2RD0A 3BG0B 4OVVA 1H0AA 3CGHA 2KBXA 3QARA 1BD8A 2FO1E 4MRUA 3LJNA 4G2VA 3R9MA 4ACLA 4ATGA 2FO7A 4HNAD 4EQFA 3Q9NC 2VTBA 3UIPC 2R02A 4DPRA 2YHCA 3CHRA 2LO6A 3AU5A 4PH4B 2QZAA 3HXFA 2LAIA 3MV3B 4MLPA 1AP7A 3DPDA 4GZCA 5CMYA 3OXFA 1N11A 1E7UA 4UWKA 3ZN3A 2IU1A 4YNDA 3Q9UC 4LSZE 2VQ2A 4JVSA 4N5QA 3JUEA 2E2EA 1IHGA 4E6HA 4W9RA 2BEDA 5AYWD 4L2YA 3HXCA 4RVBA 4I1OB 3HXBA 4JHJA 3HDXA 2WXFA 5KNGA 4J8DA 2WXGA 5KWDA 4DX2A 5FINA 2KC7A 5EIBE 3KSLA 4ABNA 3UQ3A 2R59A 3CK7A 5B3SE 2WXHA 3V31A 1UW4B 4AP2A 3FUDA 1RW2A 3ESKA 4IYPA 3UIOC 4GTVA 1KT0A 2LAHA 3S2AA 3U3WA 3D9KA 3TWSA 3OAWA 2P9IG 2GRRB 3UT8A 3HYMB 4DX6D 5BXOA 2LXLA 3CR3A 4XE0A 4LNUD 2I9CA 5CRUA 3IBEA 4FJYA 2UY1A 1Z6TA 3KSQA 2PM6A 5FZQA 4B89A 5FWQA 2ETCA 5M72A 1FCHA 3LJ3A 1IQRA 4WWOA 3JUIA 1FVFA 3MZLB 4WWPA 1OWPA 1OY3D 2IO2C 2FF4A 3B7UX 4KBQA 2OEWA 2MOWA 4RQIA 1NP7A 3U4TA 3DSWA 5CHEE 2KM4A 1YYHA 3F6QA 2V4HC 2F37A 4FJZA 4FLBA 5C2YA 4HFGA 1KPSB 4BESA 4U96D 2GRQB 4HBDA 2YHEA 4OYSA 3ZW3A 3DSSA 4M3OA 3AU4A 5D2MC 4ATZD 3B7BA 3D9OA 1UN9A 4ANVA 3OXLA 3GZ1A 4GZ6A 3LY9A 3SQVA 1KZOA 3CVNA 4MKTA 4A3TA 5IY5E 5AIJA 3CHMA 4RG9A 1HXIA 3R7RA 3CVLA 4GYYA 2RFMA 2XQ0A 3SY2A 2WXLA 1OCOE 3O48A 2EILE 1H2VC 2GROB 3ZYMA 5KJKA 3TWWA 3Q73A 1GW6A 2NXPA 2V4LA 1K8KG 1E90A 1TN7A 3U64A 4FLHA 5ARGA 3IEGA 5E76A 2WQHA 1TJFA 5G05C 4O1PA 4FHKA 4K5AB 1DNPA 3FH7A 5CCMA 3R9AB 4KMOA 1Z3XA 4H7YA 4DX1A 2DVWA 2J07A 4H7XA 4APFA 4ILHB 4NACA 1L5JA 5C1DA 1MHQA 2WXRA 3G2TA 4HLEA 4I9CA 4JPSA 4GPMA 4I17A 4PS3A 5CMWA 4G1TA 3R7QA 3APFA 3G2VA 2Y69E 5CEDB 5D0QD 2MRIA 3UT4A 2WXPA 5J08A 3BEEA 1N94A 4MS6A 3FUMA 4L23A 2GGFA 3RO2A 4A1GA 3LDZA 4HLLA 4EBAG 3DSUA 3FU0A 2CHXA 2EIJE 3APCA 2WXKA 3AG2E 4UWLA 4JW1A 3FEXA 5LFAA 4JHKA 1N52A 1H2UA 2I1JA 5AQ9A 4G25A 4FADA 1SA5A 3MKQA 4PS7A 2IFUA 3C72A 1YMPA 3BU8A 2XEVA 4HXIA 4U8VD 1TN6A 3LYAA 3RRMB 3E33A 1HS6A 3KD7A 1G3NB 2IOSA 2J09A 1DC2A 1KLXA 2KXPC 2WXNA 2AW6A 5ANLA 4Z68A 4EZKA 2Y3AA 4I9EA 1B89A 1QQEA 1Z5SC 1E96B 2QFCA 3RSEG 4WWNA 1WG0A 2V0PA 2XENA 3EHRA 2WQ6A 4GU5A 4NRHB 5FQ8A 3KEAA 3NZSA 1K1AA 5HRYA 3URZA 3GW4A 2PZIA 3C3RA 3X2QE 4U8YD 2XCCA 3UXGA 2KZTB 1LD7A 2P9UG 3QAQA 2Y4TA 5BW8C 3DRAA 4GTSA 1UJKA 4TXQA 3FDHA 3L9TA 1NA3A 3T8MA 4CGVA 4K0RA 3ZHEA 2BKKB 2XZDG 4IULA 3TAXA 4JXTA 3ASDA 3ULYA 4JC8A 3EIQC 2DBAA 3QWPA 4G23A 3ML9A 3JQ0A 3T5XA 3AAAC 4DUIA 2E0IA 5LOZA 1TYQG 4DJAA 3I4GA 4CZ2D 5HI7A 3ULEG 1AWCB 1IYGA 3FUKA 5FIOA 4J0UA 3D9NA 3AG4E 3ASGA 3UINC 2PQRA 2GRNB 3GYZA 4YDOA 1WDYA 3ZXSA 5FZSA 1SVXA 3J5QB 5BV1A 1WY6A 2A4ZA 4J8EA 3PZ2A 2IO3C 4JA9A 2WVIA 3CQCB 4UWFA 2VGEA 3QKYA 3G2WA 4IRUA 3BQOA 3P1UA 4AJWA 3Q49B 5DIZA 4GZDA 5JA4D 1X5BA 2HE0A 2J8SD 4U7EB 4QQIA 5FQ7A 3RU0A 3Q75A 4BWRA 1JWGA 3SBTB 1JCQA 1ELKA 5FJYA 3FU3A 3FTSA 3B7TA 1U2VG 4AV7A 1D8EA 2QYUA 1U3DA 5G04C 4BT9A 4UI9J 3FUJA 4TXPA 4A1SA 1K1BA 4G8KA 3MA5A 2KZTA 2V5FA 2CG2A 5KNHD 4APOA 3FY4A 4Q69A 3OXGA 3CHOA 3LPZA 2H6HA 1NZNA 1OWOA 4ZFHA 1UG3A 4HOTA 1IHBA 1FT1A 3FUIA 3I5PA 5DBKA 1FPPA 1BI8B 3DEOA 3DEPA 3TJPA 4DX5D 3V30A 1OT8A 2EINE 4DI4A 3J5PA 3MYVA 3HVEB 3MV2B 2VSNA 4TUUA 4GMLA 5B1AE 3CHPA 4GCOA 3SFZA 5EX3A 5EIDA 3S7DA 4BEPA 5HS0A 4ACKA 3C3OA 3SBSA 3AS4A 3EIJA 4ANXA 3MJWA 2X6FA 5EKQD 3D9HA 4B93B 2NYJA 4B0ZA 3C5RA 4OAUC 2OV8A 3O4ZA 2AVPA 1H6OA 5AN8A 2R2LA 4KZ0A 1NA0A 3PNTB 4LUNU 1D9SA 3S7FA 2RFAA 1SA4A 2GW1A 2Y4UA 3DXKG 5BPPA 3ZNGA 3IXEA 4LCTA 1V54E 3E32A 5KCMA 3FEYA 4EBAA 3PS6A 3D9MA 4RSYA 3Q7AA 4EZLA 4R7LA 1QNFA 2X6IA 2VSXE 4BT8A 3TXNA 3U66A 4ILIA 3JCKC 3SZ7A 3RRUA 4AY5A 3CVWA 3CKBA 1LTXA 3RRNB 4GZ5A 4JHRA 4DK5A 3AS5A 1NI1A 3HXEA 3TWQA 3LY7A 4Q94A 5ENOD 5ARFA 3UMVA 2XEHA 4GTPA 2GRPB 1HX8A 1NFIE 1KZPA 4U0SA 2L0IA 2A5UA 2ZIRA 5FTPA 2KCKA 1OCZE 1QZ2A 3G2SA 1TR4A 3L17A 1EYHA 4KYOB 5LCWJ 2XHEA 2XGMA 3ASNE 4J8YA 1EPUA 3DBSA 1E7VA 2JABA 5ANRA 3AJIA 1IXVA 2OEVA 2IONA 3Q47B 3FTWA 1LD8A 4XI0A 1MX6A 1BPOA 5AARA 4XX5A 3DSVA 5AAOA 3PEUB 3NB2A 4AXHA 3ASHA 4P29A 3T8KA 5FQ4A 3FTZA 2H6GA 3B95A 3FTXA 3LVQE 2LUHA 4U0ZA 3RIBA 3CK8A 3ZYQA 4EECA 5KJNA 3UM0A 2GRMA 1WAO1 3SNXA 4CEMA 3E4BA 4B94A 3QJZA 3BG1B 2EQXA 4ILGA 1SW6A 3ZVVA 4DLQA 4U63A 3QC1A 4G8LA 3RK6A 4F53A 3PVLA 1MYOA 3DSXA 3HHMA 4CCAA 3FUFA 2ZISA 5ENSD 1V55E 3V2OA 4E85A 4ANWA 1YA0A 5G2NA 2YINA 2J4DA 4UQZA 4WNFA 3TWXA 4BX9A 3CSTA 4I6GA 2I6HA 2XRYA 3ENEA 3VTXA 4KVOA 5AJDA 5D66A 4HORA 1E8XA 5ENQD 2XZTG 1SQMA 3FHEA 1MZCA 4NURA 4BERA 1UN8A 4G24A 4F6RD 1OWNA 2XPZA 5EX0A 3PRZA 3KAEA 4GTQA 2C2LA 1Y6IA 4JEHA 2Y1LE 2J08A 5EILA 3TWVA 2J49A 5HQ8A 4LEUA 3PE4A
chains in the Genus database with same CATH topology
4WAFA 2ZU6B 2RD0A 3BG0B 4GA1A 3JQ0A 3FU5A 2L6JA 4OVVA 2XRZA 3T5XA 1H0AA 3U9WA 3CGHA 4DI3A 2E0IA 3QARA 5LOZA 4AEZC 4DJAA 3CHQA 3I4GA 3KS2A 3ONKA 5HI7A 4YVOA 4MRUA 3G2UA 4G2VA 4ACLA 3FUNA 1FVHA 4ATGA 1IYGA 3FUKA 2FO7A 3PUKA 4FA6A 4J0UA 4EQFA 4GB9A 1WM5A 2VTBA 3D9NA 3K9IA 3ASGA 3ZPJA 4DPRA 2YHCA 3CHRA 2LO6A 2PQRA 3AU5A 4F7AA 3GYZA 2KATA 4PH4B 4ANUA 3B7RL 3ZXSA 2LAIA 5FZSA 3MV3B 5D0OD 4FC8A 1Y8MA 2CHZA 2WMNA 3FTVA 4XZ4A 4G11A 4MLPA 3DPDA 4GZCA 3TG5A 4JA7A 1WY6A 3IHYA 5BV1A 4URKA 5CMYA 2A4ZA 4J8EA 4ME2A 1OWMA 4J8FA 5G55A 2CG3A 1S0PA 3OXFA 4JA9A 5G04J 2JLBA 4GCNA 2WVIA 3CQCB 1E7UA 1ZU2A 1KT1A 4UWKA 4UWFA 4I43A 2C0MA 4N3CA 3S7JA 1H19A 1PAQA 2IU1A 2R17C 3MKQB 3FUHA 4YNDA 3QKYA 3VLDA 3LY8A 3G2WA 4IRUA 4A3VA 3P1UA 2VQ2A 4JVSA 5JJTA 2HYZA 2OVBA 3Q49B 5DIZA 4AJWA 4GZDA 2E2EA 1ZBPA 1IHGA 4F1SA 3CIAA 5JHAA 3L54A 4W9RA 4E6HA 3CEQA 2WXJA 1X5BA 5AYWD 2X6HA 2P58C 4L2YA 3ML8A 4RVBA 3QNKA 3UX4A 5FQ7A 1E8YA 3JQ1A 3MGBA 5A6CA 4I1OB 3RU0A 3EDTB 4UI9K 3L22A 3MCXA 3CVPA 4JHJA 4XI9A 4BWRA 5AENA 4GA2A 4A55A 3CVXA 1JWGA 3HDXA 4KT6B 2WXFA 3SBTB 4J8DA 2VGXA 1ELKA 4Q96A 2WXGA 5FJYA 3FU3A 3FTSA 2KC7A 2I2OA 4LRZA 2XPYA 3L16A 3B7TA 4HOUA 4ABNA 2X6JA 3UQ3A 4C9BB 2R59A 4I2ZA 3CK7A 2VYIA 3ZEFA 2FI7A 4B8CB 3B7SA 4AV7A 2WXHA 3ZGQA 1UW4B 4AP2A 1ELWA 3FUDA 2J4BA 4K03A 1U3DA 5G04C 1LF8A 2V8SE 4BT9A 4UI9J 2VSYA 3FUJA 4A1SA 3ESKA 4IYPA 1MQSA 4L2LA 1KT0A 2LSUA 2LAHA 3MA5A 4GPKA 3ZYLA 2L0TB 2KZTA 3IKOB 3CVYA 2V5FA 2CG2A 2AXVA 3S2AA 2XGSA 3D9KA 5JHBA 3ZYKA 3CVVA 3U3WA 4APOA 3FY4A 4Q69A 2KCVA 3OXGA 3CHOA 4FHJA 3D9PA 3OAWA 3LPZA 3FFLA 2KCLA 3IHVA 1U3CA 4CDMA 1NZNA 1OWOA 1INZA 3UT8A 2M63A 3ZIMA 1PC2A 2WQ7A 3HYMB 5FZRA 1UG3A 4BTBA 4NQ0A 4O6FA 2IQCA 4HOTA 1ELRA 2ILRA 2X3MA 3CR3A 4N3BA 4U8HA 4XE0A 4GYOA 3FUIA 3I5PA 4CT4A 2I9CA 5DBKA 3NQPA 3IBEA 3IV0A 4FJYA 2WM9A 3QWWA 2UY1A 3LKUA 1Z6TA 2UWJG 1DVPA 3RO3A 2PM6A 5FZQA 3TJPA 4CDRA 5AJLA 2BTDA 4HOQA 4B89A 4DI4A 1P5QA 4WNGA 3MYVA 5FWQA 4J8SA 5M72A 3MKRA 4UI9C 3HVEB 3L13A 2CHWA 3MV2B 3PE3A 4GYWA 3ZHEB 2NC9A 2VSNA 4TUUA 4GMLA 4FU3A 1FCHA 3CK9A 3CHPA 4GCOA 3LJ3A 2JEKA 5ENNA 1IQRA 2LNIA 5EX3A 3SFZA 4UWHA 4WWOA 1HO8A 4RG6A 3JUIA 1FVFA 3MZLB 4WWPA 3S7DA 3EHMA 4EPZA 1OWPA 2FF4A 3B7UX 4GAAA 4I1AA 3S7BA 4KBQA 4QFVA 1UJJA 2MOWA 3KEZA 5LP0A 4ACKA 3PDNA 4JEUA 1NP7A 3U4TA 4Y6CA 3SBSA 5CHEE 3AS4A 3VTYA 2FULA 3I4RB 3D9LA 2DIWA 3EIJA 2KM4A 5LCWC 4FJZA 4FLBA 5C2YA 4HFGA 3PUJA 2OOEA 3LCAA 4ANXA 5JJ7A 3UT7A 4BY6A 5FT9A 3MJWA 4N39A 4V3IA 2R5SA 4JL0A 1E8WA 3FUEA 2X6FA 5EKQD 1HFAA 2YHEA 3PH0C 4OYSA 2VTBB 4LERA 1JWFA 1H6KA 4B0ZA 3GZ2A 2OV8A 3ZW3A 3O4ZA 2AVPA 2CFZA 4M3OA 4KZ0A 1NA0A 3AU4A 1Z3YA 3D9OA 3PNTB 4J6IA 1UN9A 2L9BA 2WXMA 4LUNU 4ANVA 3RKVA 3S7FA 5T3RA 2XCBA 3OXLA 3GZ1A 3C98A 4GZ6A 1HE8A 3JYSA 3SI5A 3PEVB 3SHFA 3TG4A 2GW1A 1VDYA 2Y4UA 5G05J 5BPPA 3LY9A 4I6JA 3CQGB 4LCTA 3CVNA 4CT0A 4MKTA 4A3TA 5AIJA 5KCMA 3CHMA 3FEYA 4RG9A 1HXIA 3MX3A 3R7RA 4CRWA 2YNQA 3CVLA 4GYYA 2AXUA 2XQ0A 4EBAA 4XKBA 3PS6A 2WXLA 3PNLB 3D9MA 4RSYA 3TL5A 4N5CA 4HVBA 1EF1C 3FTYA 3O48A 2FEZA 4EZLA 4R7LA 1QNFA 3TGOA 2X6IA 3CVQA 3FH5A 2VSXE 4WNEA 4BT8A 3TXNA 3U66A 5FQ6A 4ILIA 1H2VC 3JCKC 3QB2A 3SZ7A 3RRUA 4AY5A 1EDUA 4DLOA 4WUYA 3CKBA 1XGWA 3CVWA 3RRNB 3ZYMA 5KJKA 2AWIA 3QOUA 4GZ5A 3QDNA 4JHRA 5J90A 3VLEA 4DK5A 1JUQA 3AS5A 2IJGX 1GW6A 2NXPA 2V4LA 4UQYA 2FBNA 1E90A 3CHSA 3LY7A 4Q94A 4N2QA 3U64A 4FLHA 5ARGA 5ARFA 3UMVA 4AY6A 3IEGA 5E76A 5BNWA 4U0SA 1HX8A 2WQHA 1TJFA 2BF0X 2L0IA 3NZUA 2A5UA 4Y6WA 5G05C 3UPVA 5EDSA 5FTPA 2GRLA 2VGYA 4FHKA 4AM9A 5KJMA 3D9JA 4N2SA 1DNPA 2KCKA 1QZ2A 3FH7A 3G2SA 4KYOB 3L17A 1EYHA 5LCWJ 5CCMA 2CFUA 2MHKA 3R9AB 4KMOA 1TJCA 2C0LA 3WXXA 1Z3XA 3ESLA 4H7YA 4PDXA 4CDNA 2XHEA 3GZSA 4KVMA 4YVQC 2XGMA 3CLJA 4OVUA 1EPUA 2J07A 3DBSA 4H7XA 4APFA 4ILHB 4NACA 1L5JA 1E7VA 5C1DA 3FULA 4XIFA 4B8AA 4CGWA 1MHQA 4UWGA 2WXRA 4U07A 3ONLA 3G2TA 4HLEA 3OTNA 4I9CA 1SZAA 4JPSA 1HZ4A 5ANRA 4I17A 4PS3A 5CMWA 3PZDA 2IONA 4G1TA 3R7QA 3APFA 2HO1A 3G2VA 3Q5MA 4UQXA 3ULQA 3Q47B 5D0QD 2MRIA 3UT4A 3QWVA 2PM7A 3FWVA 3FTWA 2AXZA 4I1MA 2WXPA 4N3AA 3BEEA 4BSXA 5J08A 4MS6A 4I2WA 3FUMA 4FULA 3CSFA 3B13A 4L23A 2GGFA 4XI0A 3LS8A 3RO2A 1N54A 4A1GA 1BPOA 2HM8A 2WPVA 4XX5A 4F3VA 3ZFWA 3N71A 2WXOA 2PQNA 4PUCA 4BTAA 3LDZA 3PEUB 4AXHA 1HG2A 4EBAG 3UUXA 3FU0A 2WMOA 3ASHA 3D3MA 2WB2A 2CHXA 4PS8A 4P29A 3APCA 4U0UA 1OWLA 1HU3A 2XPIA 4HOSA 5FQ4A 3FTZA 2WXKA 3FU6A 1E8ZA 3FTXA 2X38A 3HIZA 3PREA 4AIFA 4UWLA 4AVXA 4BX8A 4KZCA 4JW1A 3FEXA 2ONDA 4GA0A 4JHKA 1N52A 5LFAA 3FP3A 1H2UA 4C0EA 2I1JA 3T5VA 3LXUX 3SD5A 4G25A 3LVQE 4FADA 2J9QA 5LX8A 3MKQA 4PS7A 3CKCA 4HS2A 4U0ZA 2IFUA 3RIBA 3CK8A 3VLFA 3ZYQA 2XEVA 1IQUA 4EECA 5KJNA 4HXIA 2GRMA 3LYAA 3EJNA 1WAO1 3RRMB 1HS6A 3SNXA 4CEMA 3E4BA 3KD7A 3SF4A 2IOSA 2J09A 4B94A 2NSZA 5A23A 3QJZA 3BG1B 1KLXA 3QK0A 2WXNA 3ZN3A 5BUZA 2EQXA 2RG8A 4ILGA 3I3NA 2AW6A 5ANLA 4XKCA 3ZVVA 4DLQA 3NF1A 2I1KA 4U63A 2XGOA 3FTUA 3QC1A 3ZRHA 4FP7A 3RK6A 4GZ3A 4AOFA 4EZKA 2Y3AA 3FH8A 2VSOE 4I9EA 1B89A 1QQEA 4F53A 5BV0A 3PVLA 1HH8A 2DCPA 1E96B 3ASFA 3HHMA 4I6EA 5JJ6A 3SGHA 4CCAA 2QFCA 3FUFA 4WWNA 4U04A 3AS8A 1TEZA 2YQ8A 2V0PA 2VJ8A 4E85A 1PY1A 2VGXB 4ANWA 1YA0A 4KXKB 5T8IA 5G2NA 1A17A 2YINA 4IN3B 5E75A 2J4DA 4BFRA 2WQ6A 1H2TC 4UQZA 3L08A 4WNFA 4GU5A 4NRHB 5FQ8A 1OUVA 3CVUA 5CCLA 4BX9A 3APDA 3Q4AB 3CSTA 4I6GA 1JPLA 4WNDA 3NZSA 2IF4A 2I6HA 4TRQA 3MEKA 5KJLA 2XRYA 3URZA 4C0MA 3GW4A 2PZIA 3ENEA 3LEWA 3VTXA 3D9IA 1HG5A 3EHNA 2QY7A 3LVRE 4KVOA 2XCCA 5AJDA 3P2BA 2KZTB 3CV0A 1HF8A 3QAQA 2Y4TA 2HR2A 4G26A 5BW8C 4HORA 4L1BA 3RJVA 1E8XA 2WXQA 3Q15A 2PL2A 2IOLA 2OVFA 1UJKA 4TV3A 1W3BA 3FDHA 3ML9A 1SQMA 1XNFA 1NA3A 3FHEA 4NURA 2BUGA 3T8MA 4CGVA 1UN8A 4G24A 1OWNA 2XPZA 4K0RA 5T4YA 3TXMA 1SZ9A 4JZYA 5EX0A 5BT1A 3PRZA 3HVEA 3ZHEA 2X6KA 3KAEA 4EZJA 2C2LA 1Y6IA 3L6AA 4IULA 3TAXA 4JEHA 4L7TA 2J08A 2WXIA 4JXTA 3ASDA 4GMJA 2UY1B 2J49A 4JC8A 3EIQC 2DBAA 2LSVA 5HQ8A 5A7DB 4LEUA 3QWPA 4G23A 2Q7FA 4D10C 3PE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GA1 A;  2L6J A;  3KS2 A;  5HI7 A;  4YVO A;  4G2V A;  1IYG A;  2FO7 A;  4J0U A;  4EQF A;  1WM5 A;  3K9I A;  3ASG A;  3ZPJ A;  2YHC A;  2PQR A;  3GYZ A;  2KAT A;  5FZS A;  3MV3 B;  5D0O D;  1Y8M A;  3TG5 A;  4JA7 A;  4ME2 A;  4J8E A;  4J8F A;  5G04 J;  3OXF A;  4JA9 A;  2JLB A;  4GCN A;  1ZU2 A;  1KT1 A;  3ZN3 A;  2C0M A;  4N3C A;  3S7J A;  4YND A;  3QKY A;  3LY8 A;  2VQ2 A;  5JJT A;  2HYZ A;  3Q49 B;  5DIZ A;  2E2E A;  1ZBP A;  1IHG A;  4W9R A;  3CEQ A;  5AYW D;  2P58 C;  5A6C A;  3RU0 A;  3EDT B;  4UI9 K;  3CVP A;  4XI9 A;  4BWR A;  4GA2 A;  4J8D A;  2VGX A;  5FJY A;  2KC7 A;  4HOU A;  4ABN A;  3UQ3 A;  4I2Z A;  3CK7 A;  2VYI A;  2FI7 A;  3ZGQ A;  1ELW A;  5G04 C;  4BT9 A;  4UI9 J;  2VSY A;  4A1S A;  3ESK A;  1KT0 A;  2LSU A;  3MA5 A;  4GPK A;  2V5F A;  3U3W A;  2XGS A;  4APO A;  2KCV A;  3OXG A;  3LPZ A;  3FFL A;  2KCL A;  1NZN A;  1PC2 A;  3HYM B;  5FZR A;  4BTB A;  4NQ0 A;  4O6F A;  4HOT A;  1ELR A;  4N3B A;  4GYO A;  5DBK A;  3QWW A;  2UY1 A;  3LKU A;  2UWJ G;  3RO3 A;  5FZQ A;  4CDR A;  4HOQ A;  1P5Q A;  4WNG A;  5M72 A;  3MKR A;  4UI9 C;  3MV2 B;  3ZHE B;  4GYW A;  3PE3 A;  2NC9 A;  2VSN A;  1FCH A;  3CK9 A;  4GCO A;  2LNI A;  5EX3 A;  4RG6 A;  3S7D A;  2FF4 A;  4I1A A;  3S7B A;  4KBQ A;  3PDN A;  3U4T A;  4Y6C A;  5CHE E;  3AS4 A;  3VTY A;  5LCW C;  2OOE A;  3LCA A;  5JJ7 A;  5FT9 A;  4N39 A;  2R5S A;  4JL0 A;  5EKQ D;  3GZ2 A;  2AVP A;  1NA0 A;  3RKV A;  3S7F A;  2XCB A;  3OXL A;  3GZ1 A;  4GZ6 A;  3JYS A;  3TG4 A;  2GW1 A;  2Y4U A;  5G05 J;  3LY9 A;  3CVN A;  4RG9 A;  1HXI A;  3CVL A;  4GYY A;  4N5C A;  3O48 A;  2FEZ A;  3TGO A;  3CVQ A;  4WNE A;  4BT8 A;  3SZ7 A;  4AY5 A;  4WUY A;  3CKB A;  5KJK A;  3QOU A;  4GZ5 A;  3QDN A;  4JHR A;  3AS5 A;  4UQY A;  2FBN A;  3LY7 A;  4N2Q A;  5ARF A;  5ARG A;  4AY6 A;  3IEG A;  5BNW A;  4U0S A;  2WQH A;  4Y6W A;  5G05 C;  3UPV A;  5FTP A;  2VGY A;  5KJM A;  4AM9 A;  4N2S A;  2KCK A;  1QZ2 A;  5LCW J;  4KYO B;  5CCM A;  2MHK A;  3R9A B;  1TJC A;  2C0L A;  3WXX A;  4H7Y A;  4YVQ C;  2XGM A;  4H7X A;  5C1D A;  4XIF A;  4CGW A;  4U07 A;  4I9C A;  1HZ4 A;  4I17 A;  4G1T A;  2HO1 A;  3Q5M A;  4UQX A;  3ULQ A;  3Q47 B;  5D0Q D;  3QWV A;  3FWV A;  4N3A A;  3BEE A;  4I2W A;  4XI0 A;  3RO2 A;  2WPV A;  4F3V A;  3ZFW A;  3N71 A;  2PQN A;  4BTA A;  3UUX A;  3ASH A;  4U0U A;  2XPI A;  4HOS A;  4AIF A;  2OND A;  4GA0 A;  3FP3 A;  4G25 A;  2J9Q A;  3CKC A;  4U0Z A;  2IFU A;  3RIB A;  3CK8 A;  2XEV A;  5KJN A;  3LYA A;  1WAO 1;  3E4B A;  3KD7 A;  3SF4 A;  4B94 A;  1KLX A;  3NF1 A;  2XGO A;  4GZ3 A;  4I9E A;  1B89 A;  1QQE A;  1HH8 A;  1E96 B;  3ASF A;  5JJ6 A;  2QFC A;  4U04 A;  3AS8 A;  2YQ8 A;  2VGX B;  1YA0 A;  4KXK B;  1A17 A;  4IN3 B;  4UQZ A;  4WNF A;  4NRH B;  1OUV A;  5CCL A;  3Q4A B;  4WND A;  2IF4 A;  2I6H A;  3MEK A;  5KJL A;  3URZ A;  3GW4 A;  2PZI A;  3VTX A;  2XCC A;  3CV0 A;  2Y4T A;  2HR2 A;  4G26 A;  5BW8 C;  4HOR A;  3RJV A;  3Q15 A;  2PL2 A;  1W3B A;  1XNF A;  1NA3 A;  2BUG A;  4CGV A;  4G24 A;  5BT1 A;  5EX0 A;  3ZHE A;  3KAE A;  2C2L A;  3TAX A;  3ASD A;  2UY1 B;  5HQ8 A;  2DBA A;  2LSV A;  5A7D B;  4LEU A;  3QWP A;  4G23 A;  2Q7F A;  3PE4 A; 
#chains in the Genus database with same CATH topology
 2ZU6 B;  4GA1 A;  2P9S G;  3FU5 A;  4CYM D;  3U9W A;  4DI3 A;  3ONK A;  3G2U A;  1TN8 A;  4FA6 A;  4GB9 A;  3K9I A;  3ZPJ A;  2Y0B G;  4F7A A;  2KAT A;  4ANU A;  2XS8 A;  3B7R L;  3BUA A;  4BSZ B;  5D0O D;  5KBA A;  4FC8 A;  1Y8M A;  2CHZ A;  3FTV A;  4XZ4 A;  4G11 A;  3V2X A;  5CEC B;  2P2C P;  4JA7 A;  3W9G A;  5G55 A;  1OXJ A;  2CG3 A;  1NL4 A;  2F0Y A;  1ZU2 A;  1BLX B;  1KT1 A;  3S7J A;  1H19 A;  1PAQ A;  2R17 C;  3VLD A;  4A3V A;  5JJT A;  2HYZ A;  2OVB A;  4F1S A;  5JHA A;  3L54 A;  2B6C A;  1TNY A;  2ZGD A;  2ZGG A;  2X6H A;  2P58 C;  3ML8 A;  1E8Y A;  3JQ1 A;  3EDT B;  4UI9 K;  3E37 A;  3CVP A;  4XI9 A;  4GA2 A;  3CVX A;  1QBQ A;  4LRZ A;  2XPY A;  4I2Z A;  2VYI A;  3EUV A;  2FI7 A;  4B8C B;  3B7S A;  4K03 A;  2J4B A;  1LF8 A;  2V8S E;  4L2L A;  4YDE A;  2LSU A;  4EHM A;  2L0T B;  3CVV A;  2AXV A;  2XGS A;  3L82 A;  4FHJ A;  3FFL A;  3IHV A;  1U3C A;  1PC2 A;  5FZR A;  5CRV A;  3UM1 A;  4NQ0 A;  4O6F A;  1JCR A;  2X3M A;  4N3B A;  3NQP A;  1MJ0 A;  3QWW A;  4L9P A;  3LKU A;  2UWJ G;  3RO3 A;  3PZ3 A;  4CDR A;  5AQB A;  3MKR A;  4F1P A;  1RZ4 A;  4GYW A;  3PE3 A;  2NC9 A;  4FU3 A;  2LNI A;  4UWH A;  4RG6 A;  3WG7 E;  4EPZ A;  3S7B A;  4QFV A;  1UJJ A;  3ISM C;  2FUL A;  3VTY A;  3D9L A;  5LCW C;  1FT2 A;  3LCA A;  5JJ7 A;  3UT7 A;  1N4Q A;  5FT9 A;  4V3I A;  2R5S A;  4JL0 A;  1HFA A;  2VTB B;  4LER A;  4MBG A;  2H6F A;  1Z3Y A;  2WXM A;  2L9B A;  3RKV A;  2LXM A;  3C98 A;  3SI5 A;  3SHF A;  5G05 J;  4I6J A;  3CQG B;  3EHQ A;  3V79 K;  4HI8 A;  3PNL B;  3FTY A;  2FEZ A;  3UM3 A;  2EIM E;  4WNE A;  5FQ6 A;  1XGW A;  1N0R A;  1JCS A;  2AWI A;  2QYJ A;  5J90 A;  3VLE A;  1JUQ A;  5EYP F;  2FBN A;  3TWT A;  3CHS A;  4AY6 A;  5BNW A;  5ENT D;  2BKG A;  2IY0 C;  3NZU A;  4GTO A;  5EDS A;  2GRL A;  4AM9 A;  3D9J A;  4OAV B;  1IKN D;  2CFU A;  2MHK A;  2EIK E;  1TJC A;  4YVQ C;  1Q2Z A;  3CLJ A;  3UTM A;  3FUL A;  4CGW A;  4B8A A;  4UWG A;  3OTN A;  1HZ4 A;  2HO1 A;  3Q5M A;  4HRN A;  3FWV A;  2AXZ A;  4I2W A;  4FUL A;  2DZN A;  4F3V A;  2WXO A;  2PQN A;  3UUX A;  2WMO A;  2WB2 A;  4PS8 A;  4U0U A;  2XPI A;  2XS1 A;  4AIF A;  3HIZ A;  4AVX A;  3UI2 A;  3FP3 A;  4C0E A;  3T5V A;  2DYR E;  3LXU X;  5CBN A;  4DRX E;  2J9Q A;  3SFY A;  5B1B E;  3VLF A;  5CER B;  3JXJ A;  3UKU G;  2NSZ A;  3AG1 E;  5A23 A;  3E34 A;  5BUZ A;  2RG8 A;  3I3N A;  4XKC A;  2I1K A;  2XGO A;  4FP7 A;  4GZ3 A;  3ZU7 B;  3FH8 A;  2VSO E;  5BV0 A;  2DCP A;  3ASF A;  4GMR A;  1O1T A;  3AS8 A;  4U04 A;  3DPY A;  2YQ8 A;  2VGX B;  4KXK B;  5T8I A;  3DST A;  1A17 A;  4IN3 B;  3DXM G;  2DZO A;  1S64 A;  1H2T C;  3L08 A;  3C3Q A;  4UUC A;  5CCL A;  3CVU A;  3APD A;  3Q4A B;  4WND A;  1YCS B;  4YDY A;  5KJL A;  3D9I A;  1HG5 A;  5EYL A;  2QY7 A;  3LVR E;  1BU9 A;  2RKK A;  1HF8 A;  2P9P G;  2HR2 A;  3NBN B;  4G26 A;  4L1B A;  3RJV A;  3Q15 A;  2PL2 A;  5CBO A;  2OVF A;  3HRA A;  4TV3 A;  2BUG A;  3DWL G;  4JZY A;  5BT1 A;  3HVE A;  4L7T A;  2WXI A;  2LSV A;  2Q7F A;  1INZ A;  4D10 C;  4WAF A;  1TNB A;  4BET A;  2L6J A;  4JD2 G;  2XRZ A;  5ENR D;  4AEZ C;  3CHQ A;  3KS2 A;  4YVO A;  3FUN A;  1FVH A;  3PUK A;  1QYM A;  1WM5 A;  2F8X K;  2ETB A;  5H7P A;  3SFX A;  3ZKJ A;  2WMN A;  3TG5 A;  3IHY A;  5CEA A;  4URK A;  1DCQ A;  1X81 A;  4ME2 A;  1OWM A;  4J8F A;  4J7W A;  2AJA A;  1S0P A;  5G04 J;  2JLB A;  4GCN A;  2R05 A;  4I43 A;  2C0M A;  4N3C A;  3MKQ B;  3FUH A;  3LY8 A;  3NAW A;  2MYO A;  3UM2 A;  1ZBP A;  3CIA A;  3CEQ A;  2WXJ A;  3QNK A;  3UX4 A;  3MGB A;  3HXD A;  5A6C A;  4HRM B;  3ZUV B;  3L22 A;  3MCX A;  5AEN A;  4A55 A;  4KT6 B;  2VGX A;  4Q96 A;  1N4S A;  2I2O A;  3L16 A;  4HOU A;  2X6J A;  4C9B B;  3ABM E;  4LNG A;  4YDW A;  3ZEF A;  2QC9 A;  2IEJ A;  3ZGQ A;  1ELW A;  3ASO E;  2VSY A;  1MQS A;  1OCC E;  1N0Q A;  5HKP A;  4GPK A;  3ZYL A;  3IKO B;  3CVY A;  5JHB A;  3ZYK A;  1TNU A;  2KCV A;  1S70 B;  3D9P A;  2F8Y A;  2KCL A;  4CDM A;  3RAU A;  2M63 A;  3ZIM A;  2V5Q C;  2WQ7 A;  4GTR A;  4BTB A;  2IQC A;  1ELR A;  2ILR A;  4U8H A;  1MX4 A;  4GYO A;  5AQA A;  4CT4 A;  4RLY A;  1N4P A;  3IV0 A;  2WM9 A;  4M7C A;  1DVP A;  5AJL A;  2BTD A;  4HOQ A;  1P5Q A;  4WNG A;  4J8S A;  4UI9 C;  3ZHE B;  3L13 A;  2CHW A;  3CK9 A;  1UOH A;  2JEK A;  2A5E A;  5ENN A;  4A63 B;  1HO8 A;  3EHM A;  4I1A A;  4GAA A;  3SO8 A;  3KEZ A;  1OCR E;  5LP0 A;  3PDN A;  4JEU A;  4Y6C A;  1TNO A;  3I4R B;  1A5E A;  2DIW A;  3PUJ A;  2OOE A;  3E30 A;  4BY6 A;  2XEE A;  4N39 A;  3W9F A;  1E8W A;  3FUE A;  1BI7 B;  3PH0 C;  3Q79 A;  1JWF A;  1H6K A;  3GZ2 A;  2B0O E;  2CFZ A;  4J6I A;  3NOG D;  2PNN A;  5T3R A;  3NOC D;  3Q7F A;  2XCB A;  2L6B A;  1HE8 A;  3JYS A;  3PEV B;  3TG4 A;  2P9L G;  5ITZ F;  1VDY A;  4CT0 A;  3ABK E;  2OCC E;  3MX3 A;  2ZXW E;  4CRW A;  2YNQ A;  2AXU A;  4NIK A;  5EN5 D;  4XKB A;  4C48 B;  2P9K G;  4HVB A;  3TL5 A;  4N5C A;  1EF1 C;  3TGO A;  5BXU A;  3CVQ A;  3ZXP A;  3FH5 A;  3QB2 A;  4DLO A;  1EDU A;  4WUY A;  3QOU A;  3QDN A;  2IJG X;  4UQY A;  1N95 A;  4N2Q A;  2BF0 X;  4Y6W A;  3UPV A;  2VGY A;  5KJM A;  4N2S A;  2C0L A;  4GTM A;  3WXX A;  4PDX A;  3ESL A;  4O1O A;  4CDN A;  1H6P A;  3GZS A;  4KVM A;  4OVU A;  4TXR A;  4XIF A;  3AG3 E;  4U07 A;  3ONL A;  3PZ1 A;  1SZA A;  4JB8 P;  4O60 A;  4ZHB A;  3PZD A;  4UQX A;  3ULQ A;  3T9K A;  3QWV A;  2PM7 A;  4I1M A;  4N3A A;  4BSX A;  3CSF A;  3B13 A;  3LS8 A;  1N54 A;  4U95 D;  2HM8 A;  2WPV A;  3ZFW A;  1TNZ A;  4TUM A;  3N71 A;  4PUC A;  4BTA A;  1HG2 A;  1MX2 A;  1O5M A;  3D3M A;  4DX7 D;  1OWL A;  1HU3 A;  4HOS A;  3FU6 A;  1E8Z A;  4HI9 A;  2X38 A;  3PRE A;  4BX8 A;  4KZC A;  2OND A;  4GA0 A;  3EU9 A;  3SD5 A;  1N9A A;  3UKR G;  5LX8 A;  1K3Z D;  3CKC A;  4HS2 A;  3TWR A;  3Q78 A;  4XEI G;  5AQ7 A;  1IQU A;  3EU5 A;  3EJN A;  2R03 A;  3SF4 A;  2P9N G;  3QK0 A;  1ZB1 A;  4HRL A;  3NF1 A;  4K5C A;  3ZRH A;  3FTU A;  4AOF A;  1HH8 A;  4LNB A;  4I6E A;  5JJ6 A;  5ENP D;  3SGH A;  2ETA A;  1TEZ A;  4HB5 A;  2VJ8 A;  1PY1 A;  5E75 A;  4BFR A;  1DCE A;  3JXI A;  1OUV A;  1JPL A;  4X8Q A;  2IF4 A;  4LG6 A;  3MEK A;  4TRQ A;  4K5B A;  4C0M A;  3LEW A;  3HG0 D;  1O1R A;  3EHN A;  1S63 A;  2DWZ A;  3P2B A;  3CV0 A;  2H6I A;  1D8D A;  2WXQ A;  2IOL A;  3ABL E;  1N4R A;  1W3B A;  3TWU A;  1XNF A;  3PZ4 A;  5T4Y A;  3TXM A;  1SZ9 A;  4HQD A;  2X6K A;  4EZJ A;  3L6A A;  1O1S A;  5JMN D;  4GMJ A;  4GTT A;  2UY1 B;  2DYS E;  5A7D B;  2RD0 A;  3BG0 B;  4OVV A;  1H0A A;  3CGH A;  2KBX A;  3QAR A;  1BD8 A;  2FO1 E;  4MRU A;  3LJN A;  4G2V A;  3R9M A;  4ACL A;  4ATG A;  2FO7 A;  4HNA D;  4EQF A;  3Q9N C;  2VTB A;  3UIP C;  2R02 A;  4DPR A;  2YHC A;  3CHR A;  2LO6 A;  3AU5 A;  4PH4 B;  2QZA A;  3HXF A;  2LAI A;  3MV3 B;  4MLP A;  1AP7 A;  3DPD A;  4GZC A;  5CMY A;  3OXF A;  1N11 A;  1E7U A;  4UWK A;  3ZN3 A;  2IU1 A;  4YND A;  3Q9U C;  4LSZ E;  2VQ2 A;  4JVS A;  4N5Q A;  3JUE A;  2E2E A;  1IHG A;  4E6H A;  4W9R A;  2BED A;  5AYW D;  4L2Y A;  3HXC A;  4RVB A;  4I1O B;  3HXB A;  4JHJ A;  3HDX A;  2WXF A;  5KNG A;  4J8D A;  2WXG A;  5KWD A;  4DX2 A;  5FIN A;  2KC7 A;  5EIB E;  3KSL A;  4ABN A;  3UQ3 A;  2R59 A;  3CK7 A;  5B3S E;  2WXH A;  3V31 A;  1UW4 B;  4AP2 A;  3FUD A;  1RW2 A;  3ESK A;  4IYP A;  3UIO C;  4GTV A;  1KT0 A;  2LAH A;  3S2A A;  3U3W A;  3D9K A;  3TWS A;  3OAW A;  2P9I G;  2GRR B;  3UT8 A;  3HYM B;  4DX6 D;  5BXO A;  2LXL A;  3CR3 A;  4XE0 A;  4LNU D;  2I9C A;  5CRU A;  3IBE A;  4FJY A;  2UY1 A;  1Z6T A;  3KSQ A;  2PM6 A;  5FZQ A;  4B89 A;  5FWQ A;  2ETC A;  5M72 A;  1FCH A;  3LJ3 A;  1IQR A;  4WWO A;  3JUI A;  1FVF A;  3MZL B;  4WWP A;  1OWP A;  1OY3 D;  2IO2 C;  2FF4 A;  3B7U X;  4KBQ A;  2OEW A;  2MOW A;  4RQI A;  1NP7 A;  3U4T A;  3DSW A;  5CHE E;  2KM4 A;  1YYH A;  3F6Q A;  2V4H C;  2F37 A;  4FJZ A;  4FLB A;  5C2Y A;  4HFG A;  1KPS B;  4BES A;  4U96 D;  2GRQ B;  4HBD A;  2YHE A;  4OYS A;  3ZW3 A;  3DSS A;  4M3O A;  3AU4 A;  5D2M C;  4ATZ D;  3B7B A;  3D9O A;  1UN9 A;  4ANV A;  3OXL A;  3GZ1 A;  4GZ6 A;  3LY9 A;  3SQV A;  1KZO A;  3CVN A;  4MKT A;  4A3T A;  5IY5 E;  5AIJ A;  3CHM A;  4RG9 A;  1HXI A;  3R7R A;  3CVL A;  4GYY A;  2RFM A;  2XQ0 A;  3SY2 A;  2WXL A;  1OCO E;  3O48 A;  2EIL E;  1H2V C;  2GRO B;  3ZYM A;  5KJK A;  3TWW A;  3Q73 A;  1GW6 A;  2NXP A;  2V4L A;  1K8K G;  1E90 A;  1TN7 A;  3U64 A;  4FLH A;  5ARG A;  3IEG A;  5E76 A;  2WQH A;  1TJF A;  5G05 C;  4O1P A;  4FHK A;  4K5A B;  1DNP A;  3FH7 A;  5CCM A;  3R9A B;  4KMO A;  1Z3X A;  4H7Y A;  4DX1 A;  2DVW A;  2J07 A;  4H7X A;  4APF A;  4ILH B;  4NAC A;  1L5J A;  5C1D A;  1MHQ A;  2WXR A;  3G2T A;  4HLE A;  4I9C A;  4JPS A;  4GPM A;  4I17 A;  4PS3 A;  5CMW A;  4G1T A;  3R7Q A;  3APF A;  3G2V A;  2Y69 E;  5CED B;  5D0Q D;  2MRI A;  3UT4 A;  2WXP A;  5J08 A;  3BEE A;  1N94 A;  4MS6 A;  3FUM A;  4L23 A;  2GGF A;  3RO2 A;  4A1G A;  3LDZ A;  4HLL A;  4EBA G;  3DSU A;  3FU0 A;  2CHX A;  2EIJ E;  3APC A;  2WXK A;  3AG2 E;  4UWL A;  4JW1 A;  3FEX A;  5LFA A;  4JHK A;  1N52 A;  1H2U A;  2I1J A;  5AQ9 A;  4G25 A;  4FAD A;  1SA5 A;  3MKQ A;  4PS7 A;  2IFU A;  3C72 A;  1YMP A;  3BU8 A;  2XEV A;  4HXI A;  4U8V D;  1TN6 A;  3LYA A;  3RRM B;  3E33 A;  1HS6 A;  3KD7 A;  1G3N B;  2IOS A;  2J09 A;  1DC2 A;  1KLX A;  2KXP C;  2WXN A;  2AW6 A;  5ANL A;  4Z68 A;  4EZK A;  2Y3A A;  4I9E A;  1B89 A;  1QQE A;  1Z5S C;  1E96 B;  2QFC A;  3RSE G;  4WWN A;  1WG0 A;  2V0P A;  2XEN A;  3EHR A;  2WQ6 A;  4GU5 A;  4NRH B;  5FQ8 A;  3KEA A;  3NZS A;  1K1A A;  5HRY A;  3URZ A;  3GW4 A;  2PZI A;  3C3R A;  3X2Q E;  4U8Y D;  2XCC A;  3UXG A;  2KZT B;  1LD7 A;  2P9U G;  3QAQ A;  2Y4T A;  5BW8 C;  3DRA A;  4GTS A;  1UJK A;  4TXQ A;  3FDH A;  3L9T A;  1NA3 A;  3T8M A;  4CGV A;  4K0R A;  3ZHE A;  2BKK B;  2XZD G;  4IUL A;  3TAX A;  4JXT A;  3ASD A;  3ULY A;  4JC8 A;  3EIQ C;  2DBA A;  3QWP A;  4G23 A;  3ML9 A;  3JQ0 A;  3T5X A;  3AAA C;  4DUI A;  2E0I A;  5LOZ A;  1TYQ G;  4DJA A;  3I4G A;  4CZ2 D;  5HI7 A;  3ULE G;  1AWC B;  1IYG A;  3FUK A;  5FIO A;  4J0U A;  3D9N A;  3AG4 E;  3ASG A;  3UIN C;  2PQR A;  2GRN B;  3GYZ A;  4YDO A;  1WDY A;  3ZXS A;  5FZS A;  1SVX A;  3J5Q B;  5BV1 A;  1WY6 A;  2A4Z A;  4J8E A;  3PZ2 A;  2IO3 C;  4JA9 A;  2WVI A;  3CQC B;  4UWF A;  2VGE A;  3QKY A;  3G2W A;  4IRU A;  3BQO A;  3P1U A;  4AJW A;  3Q49 B;  5DIZ A;  4GZD A;  5JA4 D;  1X5B A;  2HE0 A;  2J8S D;  4U7E B;  4QQI A;  5FQ7 A;  3RU0 A;  3Q75 A;  4BWR A;  1JWG A;  3SBT B;  1JCQ A;  1ELK A;  5FJY A;  3FU3 A;  3FTS A;  3B7T A;  1U2V G;  4AV7 A;  1D8E A;  2QYU A;  1U3D A;  5G04 C;  4BT9 A;  4UI9 J;  3FUJ A;  4TXP A;  4A1S A;  1K1B A;  4G8K A;  3MA5 A;  2KZT A;  2V5F A;  2CG2 A;  5KNH D;  4APO A;  3FY4 A;  4Q69 A;  3OXG A;  3CHO A;  3LPZ A;  2H6H A;  1NZN A;  1OWO A;  4ZFH A;  1UG3 A;  4HOT A;  1IHB A;  1FT1 A;  3FUI A;  3I5P A;  5DBK A;  1FPP A;  1BI8 B;  3DEO A;  3DEP A;  3TJP A;  4DX5 D;  3V30 A;  1OT8 A;  2EIN E;  4DI4 A;  3J5P A;  3MYV A;  3HVE B;  3MV2 B;  2VSN A;  4TUU A;  4GML A;  5B1A E;  3CHP A;  4GCO A;  3SFZ A;  5EX3 A;  5EID A;  3S7D A;  4BEP A;  5HS0 A;  4ACK A;  3C3O A;  3SBS A;  3AS4 A;  3EIJ A;  4ANX A;  3MJW A;  2X6F A;  5EKQ D;  3D9H A;  4B93 B;  2NYJ A;  4B0Z A;  3C5R A;  4OAU C;  2OV8 A;  3O4Z A;  2AVP A;  1H6O A;  5AN8 A;  2R2L A;  4KZ0 A;  1NA0 A;  3PNT B;  4LUN U;  1D9S A;  3S7F A;  2RFA A;  1SA4 A;  2GW1 A;  2Y4U A;  3DXK G;  5BPP A;  3ZNG A;  3IXE A;  4LCT A;  1V54 E;  3E32 A;  5KCM A;  3FEY A;  4EBA A;  3PS6 A;  3D9M A;  4RSY A;  3Q7A A;  4EZL A;  4R7L A;  1QNF A;  2X6I A;  2VSX E;  4BT8 A;  3TXN A;  3U66 A;  4ILI A;  3JCK C;  3SZ7 A;  3RRU A;  4AY5 A;  3CVW A;  3CKB A;  1LTX A;  3RRN B;  4GZ5 A;  4JHR A;  4DK5 A;  3AS5 A;  1NI1 A;  3HXE A;  3TWQ A;  3LY7 A;  4Q94 A;  5ENO D;  5ARF A;  3UMV A;  2XEH A;  4GTP A;  2GRP B;  1HX8 A;  1NFI E;  1KZP A;  4U0S A;  2L0I A;  2A5U A;  2ZIR A;  5FTP A;  2KCK A;  1OCZ E;  1QZ2 A;  3G2S A;  1TR4 A;  3L17 A;  1EYH A;  4KYO B;  5LCW J;  2XHE A;  2XGM A;  3ASN E;  4J8Y A;  1EPU A;  3DBS A;  1E7V A;  2JAB A;  5ANR A;  3AJI A;  1IXV A;  2OEV A;  2ION A;  3Q47 B;  3FTW A;  1LD8 A;  4XI0 A;  1MX6 A;  1BPO A;  5AAR A;  4XX5 A;  3DSV A;  5AAO A;  3PEU B;  3NB2 A;  4AXH A;  3ASH A;  4P29 A;  3T8K A;  5FQ4 A;  3FTZ A;  2H6G A;  3B95 A;  3FTX A;  3LVQ E;  2LUH A;  4U0Z A;  3RIB A;  3CK8 A;  3ZYQ A;  4EEC A;  5KJN A;  3UM0 A;  2GRM A;  1WAO 1;  3SNX A;  4CEM A;  3E4B A;  4B94 A;  3QJZ A;  3BG1 B;  2EQX A;  4ILG A;  1SW6 A;  3ZVV A;  4DLQ A;  4U63 A;  3QC1 A;  4G8L A;  3RK6 A;  4F53 A;  3PVL A;  1MYO A;  3DSX A;  3HHM A;  4CCA A;  3FUF A;  2ZIS A;  5ENS D;  1V55 E;  3V2O A;  4E85 A;  4ANW A;  1YA0 A;  5G2N A;  2YIN A;  2J4D A;  4UQZ A;  4WNF A;  3TWX A;  4BX9 A;  3CST A;  4I6G A;  2I6H A;  2XRY A;  3ENE A;  3VTX A;  4KVO A;  5AJD A;  5D66 A;  4HOR A;  1E8X A;  5ENQ D;  2XZT G;  1SQM A;  3FHE A;  1MZC A;  4NUR A;  4BER A;  1UN8 A;  4G24 A;  4F6R D;  1OWN A;  2XPZ A;  5EX0 A;  3PRZ A;  3KAE A;  4GTQ A;  2C2L A;  1Y6I A;  4JEH A;  2Y1L E;  2J08 A;  5EIL A;  3TWV A;  2J49 A;  5HQ8 A;  4LEU A;  3PE4 A; 
#chains in the Genus database with same CATH homology
 4WAF A;  2ZU6 B;  2RD0 A;  3BG0 B;  4GA1 A;  3JQ0 A;  3FU5 A;  2L6J A;  4OVV A;  2XRZ A;  3T5X A;  1H0A A;  3U9W A;  3CGH A;  4DI3 A;  2E0I A;  3QAR A;  5LOZ A;  4AEZ C;  4DJA A;  3CHQ A;  3I4G A;  3KS2 A;  3ONK A;  5HI7 A;  4YVO A;  4MRU A;  3G2U A;  4G2V A;  4ACL A;  3FUN A;  1FVH A;  4ATG A;  1IYG A;  3FUK A;  2FO7 A;  3PUK A;  4FA6 A;  4J0U A;  4EQF A;  4GB9 A;  1WM5 A;  2VTB A;  3D9N A;  3K9I A;  3ASG A;  3ZPJ A;  4DPR A;  2YHC A;  3CHR A;  2LO6 A;  2PQR A;  3AU5 A;  4F7A A;  3GYZ A;  2KAT A;  4PH4 B;  4ANU A;  3B7R L;  3ZXS A;  2LAI A;  5FZS A;  3MV3 B;  5D0O D;  4FC8 A;  1Y8M A;  2CHZ A;  2WMN A;  3FTV A;  4XZ4 A;  4G11 A;  4MLP A;  3DPD A;  4GZC A;  3TG5 A;  4JA7 A;  1WY6 A;  3IHY A;  5BV1 A;  4URK A;  5CMY A;  2A4Z A;  4J8E A;  4ME2 A;  1OWM A;  4J8F A;  5G55 A;  2CG3 A;  1S0P A;  3OXF A;  4JA9 A;  5G04 J;  2JLB A;  4GCN A;  2WVI A;  3CQC B;  1E7U A;  1ZU2 A;  1KT1 A;  4UWK A;  4UWF A;  4I43 A;  2C0M A;  4N3C A;  3S7J A;  1H19 A;  1PAQ A;  2IU1 A;  2R17 C;  3MKQ B;  3FUH A;  4YND A;  3QKY A;  3VLD A;  3LY8 A;  3G2W A;  4IRU A;  4A3V A;  3P1U A;  2VQ2 A;  4JVS A;  5JJT A;  2HYZ A;  2OVB A;  3Q49 B;  5DIZ A;  4AJW A;  4GZD A;  2E2E A;  1ZBP A;  1IHG A;  4F1S A;  3CIA A;  5JHA A;  3L54 A;  4W9R A;  4E6H A;  3CEQ A;  2WXJ A;  1X5B A;  5AYW D;  2X6H A;  2P58 C;  4L2Y A;  3ML8 A;  4RVB A;  3QNK A;  3UX4 A;  5FQ7 A;  1E8Y A;  3JQ1 A;  3MGB A;  5A6C A;  4I1O B;  3RU0 A;  3EDT B;  4UI9 K;  3L22 A;  3MCX A;  3CVP A;  4JHJ A;  4XI9 A;  4BWR A;  5AEN A;  4GA2 A;  4A55 A;  3CVX A;  1JWG A;  3HDX A;  4KT6 B;  2WXF A;  3SBT B;  4J8D A;  2VGX A;  1ELK A;  4Q96 A;  2WXG A;  5FJY A;  3FU3 A;  3FTS A;  2KC7 A;  2I2O A;  4LRZ A;  2XPY A;  3L16 A;  3B7T A;  4HOU A;  4ABN A;  2X6J A;  3UQ3 A;  4C9B B;  2R59 A;  4I2Z A;  3CK7 A;  2VYI A;  3ZEF A;  2FI7 A;  4B8C B;  3B7S A;  4AV7 A;  2WXH A;  3ZGQ A;  1UW4 B;  4AP2 A;  1ELW A;  3FUD A;  2J4B A;  4K03 A;  1U3D A;  5G04 C;  1LF8 A;  2V8S E;  4BT9 A;  4UI9 J;  2VSY A;  3FUJ A;  4A1S A;  3ESK A;  4IYP A;  1MQS A;  4L2L A;  1KT0 A;  2LSU A;  2LAH A;  3MA5 A;  4GPK A;  3ZYL A;  2L0T B;  2KZT A;  3IKO B;  3CVY A;  2V5F A;  2CG2 A;  2AXV A;  3S2A A;  2XGS A;  3D9K A;  5JHB A;  3ZYK A;  3CVV A;  3U3W A;  4APO A;  3FY4 A;  4Q69 A;  2KCV A;  3OXG A;  3CHO A;  4FHJ A;  3D9P A;  3OAW A;  3LPZ A;  3FFL A;  2KCL A;  3IHV A;  1U3C A;  4CDM A;  1NZN A;  1OWO A;  1INZ A;  3UT8 A;  2M63 A;  3ZIM A;  1PC2 A;  2WQ7 A;  3HYM B;  5FZR A;  1UG3 A;  4BTB A;  4NQ0 A;  4O6F A;  2IQC A;  4HOT A;  1ELR A;  2ILR A;  2X3M A;  3CR3 A;  4N3B A;  4U8H A;  4XE0 A;  4GYO A;  3FUI A;  3I5P A;  4CT4 A;  2I9C A;  5DBK A;  3NQP A;  3IBE A;  3IV0 A;  4FJY A;  2WM9 A;  3QWW A;  2UY1 A;  3LKU A;  1Z6T A;  2UWJ G;  1DVP A;  3RO3 A;  2PM6 A;  5FZQ A;  3TJP A;  4CDR A;  5AJL A;  2BTD A;  4HOQ A;  4B89 A;  4DI4 A;  1P5Q A;  4WNG A;  3MYV A;  5FWQ A;  4J8S A;  5M72 A;  3MKR A;  4UI9 C;  3HVE B;  3L13 A;  2CHW A;  3MV2 B;  3PE3 A;  4GYW A;  3ZHE B;  2NC9 A;  2VSN A;  4TUU A;  4GML A;  4FU3 A;  1FCH A;  3CK9 A;  3CHP A;  4GCO A;  3LJ3 A;  2JEK A;  5ENN A;  1IQR A;  2LNI A;  5EX3 A;  3SFZ A;  4UWH A;  4WWO A;  1HO8 A;  4RG6 A;  3JUI A;  1FVF A;  3MZL B;  4WWP A;  3S7D A;  3EHM A;  4EPZ A;  1OWP A;  2FF4 A;  3B7U X;  4GAA A;  4I1A A;  3S7B A;  4KBQ A;  4QFV A;  1UJJ A;  2MOW A;  3KEZ A;  5LP0 A;  4ACK A;  3PDN A;  4JEU A;  1NP7 A;  3U4T A;  4Y6C A;  3SBS A;  5CHE E;  3AS4 A;  3VTY A;  2FUL A;  3I4R B;  3D9L A;  2DIW A;  3EIJ A;  2KM4 A;  5LCW C;  4FJZ A;  4FLB A;  5C2Y A;  4HFG A;  3PUJ A;  2OOE A;  3LCA A;  4ANX A;  5JJ7 A;  3UT7 A;  4BY6 A;  5FT9 A;  3MJW A;  4N39 A;  4V3I A;  2R5S A;  4JL0 A;  1E8W A;  3FUE A;  2X6F A;  5EKQ D;  1HFA A;  2YHE A;  3PH0 C;  4OYS A;  2VTB B;  4LER A;  1JWF A;  1H6K A;  4B0Z A;  3GZ2 A;  2OV8 A;  3ZW3 A;  3O4Z A;  2AVP A;  2CFZ A;  4M3O A;  4KZ0 A;  1NA0 A;  3AU4 A;  1Z3Y A;  3D9O A;  3PNT B;  4J6I A;  1UN9 A;  2L9B A;  2WXM A;  4LUN U;  4ANV A;  3RKV A;  3S7F A;  5T3R A;  2XCB A;  3OXL A;  3GZ1 A;  3C98 A;  4GZ6 A;  1HE8 A;  3JYS A;  3SI5 A;  3PEV B;  3SHF A;  3TG4 A;  2GW1 A;  1VDY A;  2Y4U A;  5G05 J;  5BPP A;  3LY9 A;  4I6J A;  3CQG B;  4LCT A;  3CVN A;  4CT0 A;  4MKT A;  4A3T A;  5AIJ A;  5KCM A;  3CHM A;  3FEY A;  4RG9 A;  1HXI A;  3MX3 A;  3R7R A;  4CRW A;  2YNQ A;  3CVL A;  4GYY A;  2AXU A;  2XQ0 A;  4EBA A;  4XKB A;  3PS6 A;  2WXL A;  3PNL B;  3D9M A;  4RSY A;  3TL5 A;  4N5C A;  4HVB A;  1EF1 C;  3FTY A;  3O48 A;  2FEZ A;  4EZL A;  4R7L A;  1QNF A;  3TGO A;  2X6I A;  3CVQ A;  3FH5 A;  2VSX E;  4WNE A;  4BT8 A;  3TXN A;  3U66 A;  5FQ6 A;  4ILI A;  1H2V C;  3JCK C;  3QB2 A;  3SZ7 A;  3RRU A;  4AY5 A;  1EDU A;  4DLO A;  4WUY A;  3CKB A;  1XGW A;  3CVW A;  3RRN B;  3ZYM A;  5KJK A;  2AWI A;  3QOU A;  4GZ5 A;  3QDN A;  4JHR A;  5J90 A;  3VLE A;  4DK5 A;  1JUQ A;  3AS5 A;  2IJG X;  1GW6 A;  2NXP A;  2V4L A;  4UQY A;  2FBN A;  1E90 A;  3CHS A;  3LY7 A;  4Q94 A;  4N2Q A;  3U64 A;  4FLH A;  5ARG A;  5ARF A;  3UMV A;  4AY6 A;  3IEG A;  5E76 A;  5BNW A;  4U0S A;  1HX8 A;  2WQH A;  1TJF A;  2BF0 X;  2L0I A;  3NZU A;  2A5U A;  4Y6W A;  5G05 C;  3UPV A;  5EDS A;  5FTP A;  2GRL A;  2VGY A;  4FHK A;  4AM9 A;  5KJM A;  3D9J A;  4N2S A;  1DNP A;  2KCK A;  1QZ2 A;  3FH7 A;  3G2S A;  4KYO B;  3L17 A;  1EYH A;  5LCW J;  5CCM A;  2CFU A;  2MHK A;  3R9A B;  4KMO A;  1TJC A;  2C0L A;  3WXX A;  1Z3X A;  3ESL A;  4H7Y A;  4PDX A;  4CDN A;  2XHE A;  3GZS A;  4KVM A;  4YVQ C;  2XGM A;  3CLJ A;  4OVU A;  1EPU A;  2J07 A;  3DBS A;  4H7X A;  4APF A;  4ILH B;  4NAC A;  1L5J A;  1E7V A;  5C1D A;  3FUL A;  4XIF A;  4B8A A;  4CGW A;  1MHQ A;  4UWG A;  2WXR A;  4U07 A;  3ONL A;  3G2T A;  4HLE A;  3OTN A;  4I9C A;  1SZA A;  4JPS A;  1HZ4 A;  5ANR A;  4I17 A;  4PS3 A;  5CMW A;  3PZD A;  2ION A;  4G1T A;  3R7Q A;  3APF A;  2HO1 A;  3G2V A;  3Q5M A;  4UQX A;  3ULQ A;  3Q47 B;  5D0Q D;  2MRI A;  3UT4 A;  3QWV A;  2PM7 A;  3FWV A;  3FTW A;  2AXZ A;  4I1M A;  2WXP A;  4N3A A;  3BEE A;  4BSX A;  5J08 A;  4MS6 A;  4I2W A;  3FUM A;  4FUL A;  3CSF A;  3B13 A;  4L23 A;  2GGF A;  4XI0 A;  3LS8 A;  3RO2 A;  1N54 A;  4A1G A;  1BPO A;  2HM8 A;  2WPV A;  4XX5 A;  4F3V A;  3ZFW A;  3N71 A;  2WXO A;  2PQN A;  4PUC A;  4BTA A;  3LDZ A;  3PEU B;  4AXH A;  1HG2 A;  4EBA G;  3UUX A;  3FU0 A;  2WMO A;  3ASH A;  3D3M A;  2WB2 A;  2CHX A;  4PS8 A;  4P29 A;  3APC A;  4U0U A;  1OWL A;  1HU3 A;  2XPI A;  4HOS A;  5FQ4 A;  3FTZ A;  2WXK A;  3FU6 A;  1E8Z A;  3FTX A;  2X38 A;  3HIZ A;  3PRE A;  4AIF A;  4UWL A;  4AVX A;  4BX8 A;  4KZC A;  4JW1 A;  3FEX A;  2OND A;  4GA0 A;  4JHK A;  1N52 A;  5LFA A;  3FP3 A;  1H2U A;  4C0E A;  2I1J A;  3T5V A;  3LXU X;  3SD5 A;  4G25 A;  3LVQ E;  4FAD A;  2J9Q A;  5LX8 A;  3MKQ A;  4PS7 A;  3CKC A;  4HS2 A;  4U0Z A;  2IFU A;  3RIB A;  3CK8 A;  3VLF A;  3ZYQ A;  2XEV A;  1IQU A;  4EEC A;  5KJN A;  4HXI A;  2GRM A;  3LYA A;  3EJN A;  1WAO 1;  3RRM B;  1HS6 A;  3SNX A;  4CEM A;  3E4B A;  3KD7 A;  3SF4 A;  2IOS A;  2J09 A;  4B94 A;  2NSZ A;  5A23 A;  3QJZ A;  3BG1 B;  1KLX A;  3QK0 A;  2WXN A;  3ZN3 A;  5BUZ A;  2EQX A;  2RG8 A;  4ILG A;  3I3N A;  2AW6 A;  5ANL A;  4XKC A;  3ZVV A;  4DLQ A;  3NF1 A;  2I1K A;  4U63 A;  2XGO A;  3FTU A;  3QC1 A;  3ZRH A;  4FP7 A;  3RK6 A;  4GZ3 A;  4AOF A;  4EZK A;  2Y3A A;  3FH8 A;  2VSO E;  4I9E A;  1B89 A;  1QQE A;  4F53 A;  5BV0 A;  3PVL A;  1HH8 A;  2DCP A;  1E96 B;  3ASF A;  3HHM A;  4I6E A;  5JJ6 A;  3SGH A;  4CCA A;  2QFC A;  3FUF A;  4WWN A;  4U04 A;  3AS8 A;  1TEZ A;  2YQ8 A;  2V0P A;  2VJ8 A;  4E85 A;  1PY1 A;  2VGX B;  4ANW A;  1YA0 A;  4KXK B;  5T8I A;  5G2N A;  1A17 A;  2YIN A;  4IN3 B;  5E75 A;  2J4D A;  4BFR A;  2WQ6 A;  1H2T C;  4UQZ A;  3L08 A;  4WNF A;  4GU5 A;  4NRH B;  5FQ8 A;  1OUV A;  3CVU A;  5CCL A;  4BX9 A;  3APD A;  3Q4A B;  3CST A;  4I6G A;  1JPL A;  4WND A;  3NZS A;  2IF4 A;  2I6H A;  4TRQ A;  3MEK A;  5KJL A;  2XRY A;  3URZ A;  4C0M A;  3GW4 A;  2PZI A;  3ENE A;  3LEW A;  3VTX A;  3D9I A;  1HG5 A;  3EHN A;  2QY7 A;  3LVR E;  4KVO A;  2XCC A;  5AJD A;  3P2B A;  2KZT B;  3CV0 A;  1HF8 A;  3QAQ A;  2Y4T A;  2HR2 A;  4G26 A;  5BW8 C;  4HOR A;  4L1B A;  3RJV A;  1E8X A;  2WXQ A;  3Q15 A;  2PL2 A;  2IOL A;  2OVF A;  1UJK A;  4TV3 A;  1W3B A;  3FDH A;  3ML9 A;  1SQM A;  1XNF A;  1NA3 A;  3FHE A;  4NUR A;  2BUG A;  3T8M A;  4CGV A;  1UN8 A;  4G24 A;  1OWN A;  2XPZ A;  4K0R A;  5T4Y A;  3TXM A;  1SZ9 A;  4JZY A;  5EX0 A;  5BT1 A;  3PRZ A;  3HVE A;  3ZHE A;  2X6K A;  3KAE A;  4EZJ A;  2C2L A;  1Y6I A;  3L6A A;  4IUL A;  3TAX A;  4JEH A;  4L7T A;  2J08 A;  2WXI A;  4JXT A;  3ASD A;  4GMJ A;  2UY1 B;  2J49 A;  4JC8 A;  3EIQ C;  2DBA A;  2LSV A;  5HQ8 A;  5A7D B;  4LEU A;  3QWP A;  4G23 A;  2Q7F A;  4D10 C;  3PE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...