1NA3A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed protein CTPR2
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 36
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na3A00
2KATA 5A7DB 5BT1A 3LKUA 4WNFA 1W3BA 3S7JA 3MEKA 3OXFA 4N2SA 5HI7A 2YQ8A 3IEGA 4J0UA 1XNFA 3Q5MA 2HO1A 3K9IA 2IF4A 4N3AA 2VSNA 3Q4AB 3O48A 2XEVA 4N3BA 4U0UA 3CV0A 4UQXA 1KLXA 4IN3B 2E2EA 2L6JA 5D0OD 4I2WA 4Y6WA 1IHGA 4UQYA 2J9QA 3Q49B 4BWRA 3BEEA 5DBKA 3LY8A 5BW8C 3S7BA 2QFCA 3CKCA 5A6CA 3QOUA 4I2ZA 4XI0A 2VSYA 2V5FA 1A17A 1KT1A 3R9AB 1HH8A 1YA0A 3E4BA 3VTYA 5JJ7A 2Q7FA 5G04J 3HYMB 4GZ3A 4HORA 3U3WA 1NA0A 1ZU2A 5KJNA 4GCOA 2KCLA 4JHRA 4GPKA 3AS4A 3RKVA 2PQNA 2HYZA 4I1AA 3ZHEB 4A1SA 5JJTA 2ONDA 4N39A 5CCLA 5AYWD 5FT9A 3GZ2A 3UUXA 3OXLA 3MV2B 5FTPA 5G05C 2MHKA 5ARGA 4JA9A 3MV3B 4BTAA 3GW4A 2JLBA 3AS8A 4NRHB 1FCHA 3ASHA 2R5SA 4CGVA 2Y4UA 5C1DA 5FZQA 3QWPA 2C2LA 3LY7A 5ARFA 4JA7A 4WNDA 5EX0A 3NF1A 4KBQA 4U0ZA 3GZ1A 3N71A 4ABNA 3JYSA 5LCWC 2LSUA 4AY6A 3RJVA 2KCKA 2FO7A 3KD7A 2Y4TA 3ASGA 1HZ4A 1B89A 3RU0A 4U07A 4G2VA 4AY5A 3QWWA 2IFUA 5DIZA 4GA2A 3UQ3A 5G05J 1OUVA 3ZPJA 2I6HA 3TGOA 3LYAA 4YVOA 4UI9C 3FP3A 2BUGA 4H7YA 3RO3A 4O6FA 4GZ6A 2OOEA 4N5CA 4NQ0A 5HQ8A 1ELRA 3GYZA 2KCVA 4G1TA 1HXIA 1Y8MA 2KC7A 4JL0A 4W9RA 4GA0A 4APOA 4G25A 3EDTB 4XI9A 5FZSA 4N2QA 4GYYA 4HOTA 2XGMA 3U4TA 1QZ2A 5KJKA 1QQEA 2VGXB 2VGXA 3RIBA 5JJ6A 4WUYA 3ZHEA 3WXXA 4HOUA 4J8DA 3PDNA 3SF4A 5EX3A 4I9EA 3RO2A 4WNEA 2PZIA 2HR2A 2DBAA 4ME2A 3ZN3A 2VYIA 2PL2A 4G24A 2UY1B 3FWVA 4F3VA 2UY1A 3MKRA 4RG6A 3KAEA 2XCBA 3CVPA 3Q47B 1WAO1 5EKQD 3S7DA 2FI7A 3CKBA 4GYWA 3CVLA 2XCCA 4HOQA 4GCNA 4EQFA 4UQZA 4RG9A 5CHEE 2XGOA 3LY9A 3CVQA 4XIFA 4GYOA 5FZRA 4H7XA 3Q15A 3PE3A 5KJLA 4BTBA 5G04C 1WM5A 3S7FA 4I17A 1PC2A 4U04A 4N3CA 4YNDA 3ASDA 4Y6CA 2NC9A 5CCMA 3CK8A 4I9CA 5BNWA 4LEUA 3CK7A 1KT0A 4WNGA 4J8FA 3QKYA 4AIFA 2P58C 3ZGQA 4BT8A 4AM9A 3UPVA 3VTXA 3TG5A 4HOSA 3TG4A 3ESKA 3LPZA 2FEZA 4YVQC 4CDRA 1IYGA 4KXKB 4U0SA 4BT9A 1ZBPA 2VGYA 3LCAA 5M72A 2FBNA 4CGWA 1E96B 2XPIA 1NZNA 4B94A 5LCWJ 3KS2A 2LNIA 3CEQA 4G23A 1TJCA 5FJYA 2LSVA 2WQHA 4J8EA 2PQRA 1ELWA 2C0MA 4KYOB 5KJMA 3OXGA 3ZFWA 2C0LA 2YHCA 5D0QD 1P5QA 3SZ7A 3FFLA 3QWVA 3URZA 2XGSA 2GW1A 3CK9A 4UI9J 4GZ5A 4G26A 3MA5A 2UWJG 3PE4A 3ASFA 2AVPA 3QDNA 3AS5A 2FF4A 3ULQA 4GA1A 2VQ2A 3TAXA 2WPVA 3CVNA 1NA3A 4UI9K
chains in the Genus database with same CATH superfamily
5H7PA 5BT1A 3UMVA 2XPYA 4FJZA 3DEPA 3VLFA 2L0IA 4L1BA 1FVHA 4U96D 1XNFA 3E33A 3Q5MA 5D2MC 2IF4A 2VSNA 1HG5A 3Q4AB 3E32A 3C3QA 4PH4B 4U0UA 4ANUA 2I9CA 1OXJA 4HRNA 1H0AA 3JUEA 4CEMA 2KBXA 4A3VA 1G3NB 1IHGA 3HVEB 1FT1A 2QC9A 1N9AA 4ATZD 2XS8A 3FHEA 1NFIE 4ANWA 3EIJA 5BW8C 4EZLA 2QFCA 2ETCA 2VSYA 3UM0A 3L08A 1PAQA 1KT1A 1PY1A 1TNZA 5JJ7A 5G04J 4YDYA 1N4PA 3AG2E 4PS8A 3DSXA 4B8AA 1NA0A 1ZU2A 3PRZA 3RK6A 4GCOA 3UI2A 4JHRA 4DK5A 5BXOA 3ZNGA 3NB2A 2ONDA 4EPZA 4N39A 1K1AA 3D9NA 4FP7A 1BLXB 3UUXA 5FTPA 2BF0X 3GW4A 2X6IA 1K8KG 4NRHB 4B89A 3APCA 4C9BB 3W9FA 5C1DA 2L9BA 5FZQA 1N4QA 4HBDA 1BI8B 3LY7A 5ARFA 3FH7A 4YDEA 4JA7A 3V30A 2DYSE 4GTPA 3NF1A 4HFGA 3GZ1A 3L6AA 1V55E 2Y1LE 3ZYKA 3L16A 2LSUA 4APFA 3UT7A 2GRPB 2XHEA 3KD7A 4DLOA 4L2LA 2IONA 3UM1A 1QYMA 3L22A 1IHBA 1OCZE 2J4DA 3DEOA 1E8YA 4F7AA 2YINA 2B0OE 3BUAA 2IFUA 3SI5A 2LUHA 3ASOE 5ENPD 4LNBA 4U95D 2J8SD 4DX7D 3Q75A 1MZCA 5B1AE 2BKGA 1OCCE 3UKRG 3BQOA 3G2WA 4JW1A 3RO3A 2M63A 5ANLA 3ZRHA 4N5CA 5EYPF 3JXIA 3D9MA 1BPOA 3AU4A 1HXIA 2LO6A 2DZOA 4JL0A 2WXOA 4W9RA 3EDTB 3C98A 4L2YA 4O1OA 2FULA 4PS3A 5AARA 4O60A 5CMWA 2DVWA 3CR3A 4TUMA 4HOTA 1OWMA 3U4TA 1INZA 3CIAA 4FHKA 4FHJA 3RIBA 4ILIA 2IJGX 1LD8A 3QJZA 3SBTB 3HXFA 4FA6A 3WXXA 2GRLA 3C3RA 1YCSB 3MGBA 3DXMG 3FH8A 3RO2A 1EF1C 4CRWA 3APDA 3B7UX 4HLLA 5ITZF 2A5EA 2RG8A 1OWPA 1SQMA 3EU9A 4J7WA 2WXHA 4FADA 2X38A 4CT0A 1HG2A 3CVYA 3KAEA 5EDSA 1TEZA 4LG6A 3HG0D 3EIQC 2XRZA 2RFAA 3CHSA 2XCCA 3CVLA 3E30A 4PUCA 5LP0A 3CSTA 2QYUA 4M7CA 3L17A 4BESA 4GYOA 5HRYA 5AQBA 1TN7A 5G04C 2WXGA 4HXIA 5JMND 3QNKA 3Q78A 4N3CA 2FO1E 4YNDA 3ASDA 3AG3E 4GMJA 5BNWA 4JD2G 3ONKA 3UT4A 4WNGA 3PS6A 4XKCA 4NIKA 2P9LG 2X6JA 3B7BA 3PNLB 2CG2A 4AIFA 2LXLA 2P58C 3IKOB 3ZGQA 4KZCA 1WDYA 4LERA 5B3SE 4GTVA 5AN8A 4FULA 4UWKA 3D9LA 4GTSA 4GMLA 3E34A 3ZVVA 3R7QA 3P2BA 2ZGDA 2FBNA 4E6HA 1YMPA 4CGWA 3G2VA 4UWGA 1KZOA 3KS2A 3AU5A 2LNIA 2XEEA 3FEXA 2WXPA 2WQHA 3PZ1A 5FQ7A 4BY6A 1NL4A 4DI4A 2HM8A 2C0LA 4Q94A 4DJAA 4A63B 3VLEA 3JCKC 4TUUA 5CRVA 1HF8A 4O1PA 1LTXA 2MYOA 3CK9A 3J5QB 4UI9J 3CVWA 3Q7AA 1H6OA 4K03A 5HKPA 1QNFA 2LXMA 2AVPA 3SFYA 2LAIA 2WXKA 4HS2A 1X5BA 3TAXA 1HE8A 1NP7A 4UI9K 4A55A 5A7DB 4XEIG 3LKUA 1W3BA 5JHBA 1UJKA 2ETBA 4N2SA 4OAUC 3K9IA 3VLDA 4TXRA 3AG4E 4L9PA 2MRIA 1WG0A 3B7SA 2XEVA 2WXFA 5G55A 2V4LA 4IN3B 3TWWA 3D9JA 4KZ0A 2R59A 3CQGB 2L6JA 3CHPA 4ANVA 1HO8A 1UN9A 3ZYMA 4WWOA 1Y6IA 4WWPA 5ENRD 3Q49B 4XZ4A 1S70B 1DNPA 3NQPA 1DVPA 3CHQA 1EDUA 3DXKG 4XI0A 2X6HA 2V5FA 1OCOE 3R9AB 1HH8A 5FQ4A 4GAAA 3E4BA 3VTYA 5CRUA 2WXNA 3FU0A 4HORA 1OWLA 2EQXA 2J09A 4TXQA 4FU3A 5KJNA 4GPKA 3CHRA 3V79K 3AS4A 2DWZA 2PQNA 2HYZA 5ENQD 4AJWA 3T5VA 2R2LA 5A23A 3TWQA 4I1AA 3V31A 4Q69A 3GZSA 1OCRE 2AW6A 3Q9NC 3GZ2A 4JEUA 1JUQA 1LF8A 4JA9A 3FU5A 2Y69E 3FTUA 4EZKA 4AVXA 4YDOA 4JZYA 3ASHA 3L54A 1TJFA 1UN8A 4BSZB 4GZDA 4KBQA 3V2XA 5AAOA 2BEDA 3CQCB 4U0ZA 1OT8A 3PEVB 1Z3YA 3QB2A 3FTSA 1QBQA 3F6QA 5BXUA 3CSFA 4AY6A 5KCMA 2Y4TA 4JHJA 4DX2A 3ASGA 4HI8A 3SNXA 1RZ4A 3HVEA 3ZU7B 5T3RA 4U07A 3QWWA 4AP2A 2CFZA 3UQ3A 5G05J 2ZGGA 3DPYA 3D9HA 4IULA 2J49A 4QQIA 4HLEA 2NSZA 4UI9C 3SO8A 1ELKA 4GZ6A 1N94A 2OOEA 2XZTG 3QARA 2WM9A 1ELRA 4N5QA 3LVQE 3PZ2A 3R7RA 2KCVA 1UOHA 2AXZA 5BUZA 3ENEA 2ZXWE 4UUCA 4BEPA 2V8SE 2Y0BG 5CBNA 4FJYA 1VDYA 3RRNB 5KJKA 2WXJA 4MKTA 1QQEA 5E75A 4Z68A 3AAAC 4CZ2D 4QFVA 2WXLA 2XRYA 2I1KA 1TNBA 3NBNB 3SF4A 2P9PG 4JEHA 4I9EA 1E90A 4PDXA 2IO3C 2L6BA 3FUFA 3U66A 2DBAA 2VSOE 1LD7A 3DRAA 3B13A 3ZN3A 3D9PA 3HXCA 3PZDA 4L23A 2UY1B 3O4ZA 3FWVA 1SZ9A 2UY1A 4F3VA 3FTVA 3ZYQA 3ZEFA 2XCBA 3CVPA 4WWNA 3Q47B 4C48B 5EKQD 2FI7A 3KEZA 4MS6A 3CKBA 3TWSA 4HOQA 4EQFA 4UQZA 3TWTA 5CHEE 2XGOA 3LY9A 3G2UA 1BD8A 5FQ8A 3I4GA 4DI3A 3I3NA 3NOGD 3LS8A 5KJLA 4BTBA 1E8ZA 3D9IA 4I43A 2XPZA 4HRLA 4CDNA 4Y6CA 3CK8A 3Q9UC 4I9CA 3PUKA 4E85A 3SFXA 4UWLA 3B7RL 3CK7A 3TJPA 3EHQA 1Z5SC 1SVXA 3ML9A 4J8FA 2KXPC 3EU5A 2AXVA 3QKYA 2AJAA 1N54A 5AQ7A 2H6FA 3KSQA 2OEVA 4HOSA 2ILRA 1GW6A 3LPZA 2FEZA 4C0MA 1IYGA 1O5MA 1MX6A 1IXVA 1HFAA 5J90A 4KMOA 3LXUX 2XPIA 4B94A 1A5EA 3U9WA 1HX8A 1H2UA 4G11A 3CEQA 4G23A 1TJCA 1D8DA 1UG3A 2OVFA 4CCAA 3UINC 3G2SA 4KYOB 5KJMA 1H19A 3CVXA 3OXGA 4GTTA 2GRRB 2YHCA 4B0ZA 5D0QD 1P5QA 3SZ7A 1AP7A 4FLHA 3FUJA 3URZA 3LDZA 1IKND 3PEUB 3PZ3A 4J6IA 4OYSA 2UWJG 3ASFA 5KNHD 4UWFA 3PH0C 1JCQA 3QDNA 1H6PA 3FEYA 3BU8A 3ULQA 4GA1A 2WPVA 3HHMA 1NA3A 3NZUA 4I1MA 1V54E 3NAWA 4KT6B 2KATA 2OCCE 3QAQA 5E76A 3MEKA 4J0UA 3BG1B 2EIME 4U8VD 2VJ8A 1U3CA 4N3AA 3O48A 3TL5A 3ML8A 3UT8A 3MCXA 1N0RA 2XEHA 3CV0A 3MX3A 3HIZA 3JXJA 1KLXA 3C5RA 3D9OA 4OVUA 4JPSA 4TV3A 4FLBA 5D0OD 5CMYA 4I2WA 4LNUD 4GPMA 5CEDB 5ENSD 4UQYA 3DSVA 1DCQA 2J9QA 4BWRA 1WY6A 3I4RB 3KSLA 2BKKB 3BEEA 3LY8A 2IY0C 3S7BA 3T5XA 3ZUVB 3RRUA 5ENTD 2CFUA 3FU3A 3HXDA 3UX4A 2IQCA 1UJJA 1YA0A 3UM2A 2Q7FA 4DRXE 3FUDA 5FINA 3SY2A 4GZ3A 3U3WA 2E0IA 3BG0B 5EIBE 2P9KG 3FULA 2HE0A 2I1JA 2V5QC 2GRMA 3LJ3A 1DC2A 3UXGA 5AENA 1TNYA 4F1PA 3EJNA 1H2TC 5J08A 2X3MA 3TWUA 4JC8A 3ZHEB 3SGHA 5AJLA 1OWNA 3I5PA 5D66A 2DIWA 4HI9A 2V0PA 5CCLA 1H2VC 4CT4A 2WMOA 3LEWA 4AEZC 5FT9A 4J8SA 3OXLA 5ARGA 4RSYA 2DZNA 3HDXA 5FWQA 2PM6A 2EIKE 3MV3B 1MQSA 3CVVA 2JLBA 3AS8A 2GRQB 1TR4A 4I1OB 2DYRE 2Y4UA 3HRAA 3QWPA 3P1UA 4LNGA 2X6KA 1FT2A 3MJWA 5EX0A 3CHOA 3ZYLA 4I6JA 4F1SA 3DSTA 4ABNA 1EPUA 4BX8A 1FVFA 3X2QE 3RJVA 2CHZA 2FO7A 4XE0A 3U64A 2GGFA 3FUMA 4K5CA 5KNGA 1HZ4A 5FIOA 4BFRA 3RU0A 3IXEA 1YYHA 2QY7A 4G2VA 4B93B 4AY5A 5DIZA 3E37A 3DSUA 2NYJA 1JWGA 2F0YA 1SA5A 3FP3A 2BUGA 4H7YA 2RD0A 2CHXA 4O6FA 5HQ8A 3GYZA 3C3OA 1BI7B 5LOZA 4U8YD 2CG3A 1JCSA 1Y8MA 2VTBB 2KC7A 4GA0A 4G25A 3CGHA 3IV0A 5BPPA 5FZSA 1MX2A 4N2QA 5EN5D 5ANRA 4F6RD 3L9TA 3L13A 4MBGA 3DSSA 2ETAA 2VGXB 2VGXA 4HRMB 4WUYA 5IY5E 2WQ6A 2R17C 1N95A 4HQDA 4C0EA 2ZIRA 4JXTA 1N4SA 4U63A 5EX3A 3LJNA 1S64A 2YHEA 4WNEA 2IU1A 4XX5A 2L0TB 4LRZA 4RVBA 2HR2A 4B8CB 1IQUA 4ME2A 2KZTB 1KPSB 2KZTA 2VYIA 1KZPA 3MKRA 3DBSA 1K3ZD 3ZIMA 3TXMA 1FPPA 4AXHA 1N52A 3FDHA 2WXRA 3ULEG 4RG9A 1E7UA 3UIOC 2RFMA 2EIJE 4XIFA 4H7XA 3PE3A 1AWCB 3FUIA 4D10C 4GTOA 4IRUA 4I17A 2VGEA 3EHMA 1HS6A 4ILGA 4A1GA 2H6IA 2A4ZA 2BTDA 4AV7A 2GRNB 5EIDA 5CCMA 3FU6A 1H6KA 1KT0A 1O1TA 3UPVA 1U2VG 3VTXA 3T8MA 3TG5A 5BV0A 3PREA 3FUNA 3ZXPA 3UM3A 4ATGA 5AIJA 4YVQC 4M3OA 2WXIA 5AJDA 1MJ0A 4U0SA 3T8KA 4TRQA 1D8EA 1ZBPA 4K5BA 4ZFHA 2QZAA 3RSEG 4IYPA 4PS7A 4RLYA 3FY4A 2OVBA 1OY3D 3FTZA 4P29A 3QK0A 5LCWJ 3UTMA 1Z3XA 5FJYA 4J8EA 1ELWA 2NXPA 1Q2ZA 4ZHBA 2MOWA 3ZFWA 3UIPC 3R9MA 3G2TA 4K0RA 3ISMC 2WQ7A 3OTNA 3FFLA 4MRUA 3QWVA 1D9SA 4JB8P 4R7LA 3ZXSA 2B6CA 4I6GA 3LVRE 4G26A 3ZW3A 3MA5A 3PE4A 4LSZE 2X6FA 2P9IG 3JQ0A 3AS5A 4HB5A 3QC1A 2FF4A 2I2OA 2VQ2A 2EILE 3FTXA 4GZCA 3SQVA 2F8XK 4WNFA 3S7JA 5G2NA 3OXFA 5HI7A 2YQ8A 2DCPA 3IEGA 2HO1A 1U3DA 5EILA 3UKUG 4DPRA 4N3BA 4OAVB 2RKKA 4KVOA 1EYHA 3IHVA 2H6GA 4UQXA 4URKA 3B95A 4X8QA 2E2EA 3JUIA 5T8IA 2IOLA 3RRMB 3HXBA 4G8KA 3KEAA 4OVVA 4Y6WA 5KBAA 1K1BA 1N4RA 1O1RA 4F53A 3MYVA 3DWLG 3NZSA 1BU9A 2R05A 1X81A 2XS1A 5DBKA 4NACA 3FUHA 3PZ4A 3CKCA 5A6CA 3QOUA 4I2ZA 3EHRA 2WXQA 1A17A 2H6HA 3FTWA 3FH5A 4GTMA 4RQIA 2CHWA 5BV1A 4KVMA 1N0QA 5ENOD 3L82A 4GMRA 3HYMB 4FC8A 4HVBA 3C72A 3RAUA 4CDMA 2KCLA 1DCEA 4EZJA 3SFZA 4EBAG 4HNAD 3ABKE 4DX5D 5JHAA 3RKVA 2ZISA 2GROB 2F37A 4A1SA 5JJTA 1E7VA 2QYJA 3MKQB 2ZU6B 3AJIA 2P9SG 3MKQA 3ULYA 4DX6D 4GTRA 5AYWD 3MV2B 1JWFA 3DSWA 5G05C 2MHKA 5EYLA 4UWHA 3ESLA 4BTAA 3APFA 1MX4A 1FCHA 3SBSA 3FTYA 2AXUA 2R5SA 3TWRA 4CGVA 1S0PA 4WAFA 3DPDA 4DX1A 1Z6TA 2C2LA 3EHNA 1JCRA 2F8YA 2J07A 4K5AB 5B1BE 4WNDA 4EBAA 1NI1A 1TNUA 5CECB 3HXEA 3N71A 2VSXE 1UW4B 1TNOA 2J08A 3JYSA 4ILHB 1XGWA 5LCWC 3SHFA 1TN6A 3Q79A 4BERA 2KCKA 3J5PA 5FQ6A 4LUNU 5LFAA 2PM7A 1N11A 2P9NG 1B89A 4ANXA 4MLPA 3PVLA 3PNTB 4GA2A 4U7EB 4ACLA 1OUVA 3TWXA 3ZPJA 2I6HA 4YDWA 3TGOA 3ASNE 3LYAA 4YVOA 1JPLA 1S63A 3FUKA 1E8XA 3IBEA 2IO2C 3V2OA 4NQ0A 2AWIA 2XZDG 4G1TA 2WVIA 1MYOA 5ENNA 4APOA 3WG7E 2WMNA 4XI9A 4GYYA 2XGMA 1QZ2A 4JHKA 2XQ0A 2WB2A 3TXNA 2R02A 4GU5A 5JJ6A 4AOFA 3ZHEA 3MZLB 4HOUA 4J8DA 3D3MA 5T4YA 3PDNA 1IQRA 2PZIA 3ABME 2OEWA 2OV8A 2YNQA 2LAHA 2PL2A 2R03A 4G24A 3Q7FA 1HU3A 4RG6A 5C2YA 4JVSA 3OAWA 2XENA 1WAO1 3JQ1A 3S7DA 4EECA 4GYWA 5CERB 4GCNA 3W9GA 5KWDA 3T9KA 3S2AA 3CVQA 2JEKA 2JABA 5FZRA 3AG1E 3Q15A 5CBOA 1WM5A 3S7FA 3ZKJA 1PC2A 4U04A 3NOCD 1OWOA 2NC9A 4DUIA 4ACKA 4GB9A 4LEUA 3TWVA 5JA4D 4L7TA 3ABLE 2EINE 3CVUA 5AQ9A 2V4HC 3Q73A 2Y3AA 4BT8A 4AM9A 1MHQA 3CHMA 4DLQA 3TG4A 3EUVA 3ESKA 1ZB1A 2IOSA 4V3IA 4BSXA 4I6EA 4CDRA 4NURA 4KXKB 4BT9A 3B7TA 1O1SA 1L5JA 2VGYA 3D9KA 2J4BA 3LCAA 2VTBA 5M72A 4LCTA 5CEAA 2IEJA 5LX8A 4U8HA 4XKBA 3FUEA 1E96B 4GTQA 1NZNA 1RW2A 3CLJA 2P9UG 2LSVA 2A5UA 2PQRA 1SZAA 3ONLA 3IHYA 2C0MA 4J8YA 4A3TA 4G8LA 3SD5A 5AQAA 4CYMD 2PNNA 2WXMA 2XGSA 2GW1A 4BX9A 2KM4A 1SW6A 1SA4A 4GZ5A 5HS0A 4Q96A 4EHMA 4BETA 1E8WA 4TXPA 2P2CP 1TN8A 3PUJA 3CVNA 1TYQG
chains in the Genus database with same CATH topology
4A55A 4KT6B 2KATA 5A7DB 3QAQA 3LKUA 5E76A 5BT1A 4WNFA 1W3BA 3UMVA 5JHBA 1UJKA 3S7JA 3MEKA 2XPYA 4FJZA 5G2NA 3OXFA 4N2SA 5HI7A 2YQ8A 2L0IA 2DCPA 4L1BA 3VLFA 3IEGA 1FVHA 4J0UA 1XNFA 3BG1B 3Q5MA 2HO1A 3K9IA 2IF4A 1U3DA 3VLDA 2VJ8A 1U3CA 4N3AA 2VSNA 1HG5A 3Q4AB 2MRIA 3O48A 3TL5A 3ML8A 4DPRA 3B7SA 3UT8A 2XEVA 3MCXA 4N3BA 2WXFA 5G55A 4PH4B 4U0UA 4ANUA 4KVOA 1EYHA 3IHVA 3CV0A 2I9CA 3MX3A 3HIZA 4UQXA 4URKA 2V4LA 1KLXA 3D9OA 4OVUA 4IN3B 2E2EA 3JUIA 5T8IA 1H0AA 2IOLA 3D9JA 4KZ0A 2R59A 3RRMB 4JPSA 3CQGB 2L6JA 4TV3A 3CHPA 4FLBA 5D0OD 4CEMA 5CMYA 4I2WA 4OVVA 4Y6WA 4A3VA 4ANVA 1HO8A 1UN9A 3ZYMA 4WWOA 1Y6IA 1IHGA 4UQYA 4F53A 3HVEB 4WWPA 3MYVA 3NZSA 2J9QA 3Q49B 1WY6A 3FHEA 4BWRA 4XZ4A 3I4RB 4ANWA 3EIJA 3BEEA 5DBKA 4NACA 3LY8A 1DNPA 3NQPA 5BW8C 3S7BA 4EZLA 3FUHA 3T5XA 2QFCA 3CKCA 1DVPA 5A6CA 3CHQA 3QOUA 4I2ZA 1EDUA 4XI0A 3RRUA 2VSYA 2X6HA 2WXQA 2V5FA 1A17A 3L08A 3FTWA 2CFUA 1PAQA 3FH5A 1KT1A 3R9AB 1PY1A 3FU3A 3UX4A 2IQCA 1HH8A 1UJJA 1YA0A 5FQ4A 2CHWA 5BV1A 4KVMA 4GAAA 3E4BA 3VTYA 5JJ7A 2WXNA 2Q7FA 3FUDA 5G04J 3FU0A 3HYMB 4FC8A 4GZ3A 4PS8A 4B8AA 3U3WA 1OWLA 2EQXA 4HVBA 1NA0A 1ZU2A 4HORA 2E0IA 3BG0B 2J09A 3PRZA 3RK6A 3FULA 4FU3A 4GCOA 4CDMA 2KCLA 5KJNA 2I1JA 4JHRA 4EZJA 3SFZA 2GRMA 3LJ3A 4GPKA 4EBAG 4DK5A 3CHRA 5AENA 3AS4A 3EJNA 5JHAA 1H2TC 5J08A 2PQNA 3RKVA 2HYZA 2X3MA 4AJWA 3T5VA 5A23A 4JC8A 4I1AA 3ZHEB 4A1SA 4Q69A 5JJTA 2ONDA 5AJLA 3SGHA 1OWNA 3I5PA 4EPZA 2DIWA 3GZSA 4N39A 1E7VA 2V0PA 5CCLA 1H2VC 3MKQB 3D9NA 2ZU6B 4CT4A 4FP7A 2AW6A 2WMOA 3LEWA 4AEZC 3MKQA 5AYWD 5FT9A 4J8SA 3GZ2A 3UUXA 3OXLA 3MV2B 4JEUA 1JWFA 5FTPA 5G05C 2MHKA 4RSYA 1JUQA 3HDXA 5ARGA 5FWQA 1LF8A 2BF0X 2PM6A 4JA9A 3MV3B 4UWHA 1MQSA 3CVVA 3ESLA 4BTAA 3GW4A 2JLBA 3FU5A 3FTUA 2X6IA 3APFA 3AS8A 4EZKA 4AVXA 4NRHB 1FCHA 3SBSA 4B89A 3FTYA 4JZYA 2AXUA 3ASHA 3L54A 2R5SA 3APCA 4I1OB 4CGVA 1S0PA 4C9BB 2Y4UA 1TJFA 5C1DA 4WAFA 3DPDA 2L9BA 5FZQA 3QWPA 3P1UA 1Z6TA 1UN8A 2C2LA 3EHNA 2X6KA 3LY7A 5ARFA 3FH7A 4JA7A 2J07A 3MJWA 4WNDA 4EBAA 5EX0A 3NF1A 3CHOA 4GZDA 3ZYLA 4KBQA 4HFGA 3CQCB 4U0ZA 3GZ1A 3L6AA 3N71A 4I6JA 2VSXE 4F1SA 3PEVB 1UW4B 4ABNA 1Z3YA 3QB2A 3FTSA 1EPUA 2J08A 3JYSA 4ILHB 3L16A 3ZYKA 1XGWA 4BX8A 5LCWC 1FVFA 3SHFA 2LSUA 4APFA 3UT7A 3CSFA 4AY6A 5KCMA 3RJVA 2XHEA 2KCKA 5FQ6A 2CHZA 2FO7A 3KD7A 4XE0A 4L2LA 2IONA 4DLOA 2Y4TA 4JHJA 3U64A 2GGFA 3FUMA 4LUNU 3L22A 5LFAA 2PM7A 3ASGA 2J4DA 1HZ4A 1E8YA 1B89A 4BFRA 3SNXA 3RU0A 4ANXA 4F7AA 2YINA 3HVEA 4MLPA 5T3RA 4U07A 4G2VA 2QY7A 4AY5A 3QWWA 3PVLA 4AP2A 3PNTB 2IFUA 3SI5A 5DIZA 4GA2A 2CFZA 3UQ3A 4ACLA 5G05J 1JWGA 1OUVA 3ZPJA 2I6HA 4IULA 3TGOA 2J49A 3LYAA 4YVOA 4HLEA 1JPLA 2NSZA 4UI9C 3FP3A 2BUGA 1ELKA 3G2WA 4JW1A 3FUKA 4H7YA 2RD0A 3RO3A 2CHXA 2M63A 1E8XA 3IBEA 4O6FA 5ANLA 3ZRHA 4GZ6A 2OOEA 4N5CA 4NQ0A 5HQ8A 3QARA 2AWIA 2WM9A 1ELRA 3GYZA 3D9MA 3LVQE 3R7RA 1BPOA 2KCVA 4G1TA 2AXZA 3AU4A 5LOZA 2CG3A 1HXIA 2WVIA 1Y8MA 2LO6A 2VTBB 2KC7A 5ENNA 5BUZA 4JL0A 2WXOA 4W9RA 3ENEA 4GA0A 4APOA 2WMNA 3CGHA 3EDTB 3C98A 3IV0A 4G25A 2V8SE 4XI9A 5BPPA 4L2YA 5FZSA 2FULA 4PS3A 5CMWA 4FJYA 4N2QA 3CR3A 4GYYA 5ANRA 4HOTA 1OWMA 1VDYA 2XGMA 3U4TA 1QZ2A 3L13A 4JHKA 2XQ0A 3CIAA 3RRNB 5KJKA 2WXJA 2WB2A 1INZA 4FHKA 3TXNA 4MKTA 4FHJA 1QQEA 2VGXB 4GU5A 2VGXA 3RIBA 4ILIA 2IJGX 5JJ6A 4WUYA 4AOFA 3QJZA 5E75A 2WQ6A 2R17C 3SBTB 4QFVA 4FA6A 2WXLA 2XRYA 2I1KA 3MZLB 3WXXA 3ZHEA 4HOUA 4J8DA 4C0EA 2GRLA 3D3MA 5T4YA 4JXTA 3PDNA 3SF4A 4U63A 3MGBA 5EX3A 4JEHA 4I9EA 1E90A 4PDXA 3FH8A 3RO2A 1EF1C 4CRWA 2YHEA 4WNEA 1IQRA 2IU1A 4XX5A 2PZIA 3APDA 2L0TB 3B7UX 4LRZA 4RVBA 3FUFA 2HR2A 3U66A 2DBAA 2VSOE 4B8CB 1IQUA 2RG8A 4ME2A 2KZTB 1OWPA 1SQMA 2OV8A 2YNQA 3B13A 2LAHA 3ZN3A 2KZTA 2VYIA 3D9PA 2WXHA 2PL2A 3PZDA 4L23A 4G24A 4FADA 2UY1B 3O4ZA 3FWVA 2X38A 4CT0A 1HU3A 1SZ9A 2UY1A 4F3VA 3FTVA 3ZYQA 1HG2A 3MKRA 3CVYA 3DBSA 4RG6A 3ZEFA 3KAEA 2XCBA 3CVPA 3ZIMA 5C2YA 5EDSA 4WWNA 1TEZA 4JVSA 3TXMA 3EIQC 3OAWA 3Q47B 1WAO1 3JQ1A 5EKQD 3S7DA 2XRZA 4EECA 2FI7A 3KEZA 4AXHA 4MS6A 3CKBA 4GYWA 3CHSA 3CVLA 1N52A 2XCCA 4PUCA 5LP0A 3FDHA 2WXRA 4HOQA 4GCNA 4EQFA 3CSTA 4RG9A 4UQZA 5CHEE 2XGOA 3LY9A 3G2UA 1E7UA 5FQ8A 3S2AA 3I4GA 4DI3A 3CVQA 2JEKA 3L17A 4XIFA 4GYOA 3I3NA 5FZRA 4H7XA 3Q15A 3LS8A 3PE3A 5KJLA 3FUIA 4BTBA 1E8ZA 5G04C 4D10C 4IRUA 3D9IA 1WM5A 4I43A 3S7FA 4I17A 2XPZA 2WXGA 3EHMA 4HXIA 1PC2A 1HS6A 3QNKA 4U04A 4ILGA 4N3CA 4A1GA 4YNDA 4CDNA 2A4ZA 3ASDA 1OWOA 2BTDA 4AV7A 4Y6CA 2NC9A 5CCMA 3CK8A 3FU6A 4GMJA 3PUKA 4I9CA 4ACKA 4E85A 4GB9A 4UWLA 5BNWA 4LEUA 3ONKA 3B7RL 1H6KA 3CK7A 3TJPA 4L7TA 3UT4A 1KT0A 4WNGA 3PS6A 4XKCA 3CVUA 3ML9A 2X6JA 4J8FA 2Y3AA 3PNLB 2CG2A 2AXVA 3QKYA 4AIFA 2P58C 3IKOB 1N54A 4I1MA 3ZGQA 4KZCA 4BT8A 4AM9A 3UPVA 1MHQA 3VTXA 3T8MA 3CHMA 3TG5A 4DLQA 4HOSA 5BV0A 3TG4A 3PREA 3ESKA 2ILRA 2IOSA 3FUNA 4LERA 4V3IA 4BSXA 1GW6A 3LPZA 2FEZA 4FULA 4UWKA 4ATGA 3D9LA 4C0MA 5AIJA 4I6EA 4YVQC 4M3OA 4CDRA 2WXIA 4NURA 1IYGA 5AJDA 4KXKB 4U0SA 4BT9A 4GMLA 3B7TA 4TRQA 1L5JA 1ZBPA 2VGYA 3ZVVA 3D9KA 3R7QA 1HFAA 2J4BA 3LCAA 5M72A 4LCTA 5J90A 2VTBA 4KMOA 3LXUX 5LX8A 4U8HA 3P2BA 4XKBA 3FUEA 4IYPA 4PS7A 2FBNA 4E6HA 4CGWA 3FY4A 1E96B 2OVBA 2XPIA 1NZNA 3CLJA 3G2VA 3FTZA 4B94A 4P29A 3QK0A 5LCWJ 1Z3XA 3U9WA 1HX8A 1H2UA 4UWGA 3KS2A 4G11A 3AU5A 2LNIA 3CEQA 3FEXA 4G23A 1TJCA 5FJYA 1UG3A 2LSVA 2OVFA 2WXPA 4CCAA 2A5UA 2WQHA 4J8EA 2PQRA 1ELWA 1SZAA 5FQ7A 3ONLA 4BY6A 3G2SA 3IHYA 2C0MA 2NXPA 4KYOB 5KJMA 4DI4A 2MOWA 1H19A 3CVXA 3OXGA 2HM8A 3ZFWA 2C0LA 4Q94A 3G2TA 4DJAA 4K0RA 2YHCA 4B0ZA 2WQ7A 3OTNA 3VLEA 3SD5A 4A3TA 5D0QD 1P5QA 3SZ7A 3JCKC 4TUUA 3FFLA 2WXMA 4FLHA 3QWVA 3FUJA 4MRUA 1HF8A 3URZA 3LDZA 2XGSA 4R7LA 2GW1A 4BX9A 3ZXSA 3PEUB 2KM4A 3CK9A 4I6GA 4UI9J 3LVRE 3CVWA 4J6IA 4GZ5A 4OYSA 4G26A 3ZW3A 3MA5A 4K03A 2UWJG 4Q96A 3PE4A 1QNFA 3ASFA 4UWFA 2X6FA 2AVPA 3PH0C 2LAIA 1E8WA 3JQ0A 3QDNA 3AS5A 2WXKA 3FEYA 3QC1A 2FF4A 4HS2A 3ULQA 4GA1A 2VQ2A 1X5BA 2I2OA 3PUJA 2WPVA 3TAXA 3CVNA 3HHMA 1HE8A 1NA3A 3FTXA 3NZUA 1NP7A 4UI9K 4GZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAT A;  5A7D B;  5BT1 A;  3LKU A;  4WNF A;  1W3B A;  3S7J A;  3MEK A;  3OXF A;  4N2S A;  5HI7 A;  2YQ8 A;  3IEG A;  4J0U A;  1XNF A;  3Q5M A;  2HO1 A;  3K9I A;  2IF4 A;  4N3A A;  2VSN A;  3Q4A B;  3O48 A;  2XEV A;  4N3B A;  4U0U A;  3CV0 A;  4UQX A;  1KLX A;  4IN3 B;  2E2E A;  2L6J A;  5D0O D;  4I2W A;  4Y6W A;  1IHG A;  4UQY A;  2J9Q A;  3Q49 B;  4BWR A;  3BEE A;  5DBK A;  3LY8 A;  5BW8 C;  3S7B A;  2QFC A;  3CKC A;  5A6C A;  3QOU A;  4I2Z A;  4XI0 A;  2VSY A;  2V5F A;  1A17 A;  1KT1 A;  3R9A B;  1HH8 A;  1YA0 A;  3E4B A;  3VTY A;  5JJ7 A;  2Q7F A;  5G04 J;  3HYM B;  4GZ3 A;  4HOR A;  3U3W A;  1NA0 A;  1ZU2 A;  5KJN A;  4GCO A;  2KCL A;  4JHR A;  4GPK A;  3AS4 A;  3RKV A;  2PQN A;  2HYZ A;  4I1A A;  3ZHE B;  4A1S A;  5JJT A;  2OND A;  4N39 A;  5CCL A;  5AYW D;  5FT9 A;  3GZ2 A;  3UUX A;  3OXL A;  3MV2 B;  5FTP A;  5G05 C;  2MHK A;  5ARG A;  4JA9 A;  3MV3 B;  4BTA A;  3GW4 A;  2JLB A;  3AS8 A;  4NRH B;  1FCH A;  3ASH A;  2R5S A;  4CGV A;  2Y4U A;  5C1D A;  5FZQ A;  3QWP A;  2C2L A;  3LY7 A;  5ARF A;  4JA7 A;  4WND A;  5EX0 A;  3NF1 A;  4KBQ A;  4U0Z A;  3GZ1 A;  3N71 A;  4ABN A;  3JYS A;  5LCW C;  2LSU A;  4AY6 A;  3RJV A;  2KCK A;  2FO7 A;  3KD7 A;  2Y4T A;  3ASG A;  1HZ4 A;  1B89 A;  3RU0 A;  4U07 A;  4G2V A;  4AY5 A;  3QWW A;  2IFU A;  5DIZ A;  4GA2 A;  3UQ3 A;  5G05 J;  1OUV A;  3ZPJ A;  2I6H A;  3TGO A;  3LYA A;  4YVO A;  4UI9 C;  3FP3 A;  2BUG A;  4H7Y A;  3RO3 A;  4O6F A;  4GZ6 A;  2OOE A;  4N5C A;  4NQ0 A;  5HQ8 A;  1ELR A;  3GYZ A;  2KCV A;  4G1T A;  1HXI A;  1Y8M A;  2KC7 A;  4JL0 A;  4W9R A;  4GA0 A;  4APO A;  4G25 A;  3EDT B;  4XI9 A;  5FZS A;  4N2Q A;  4GYY A;  4HOT A;  2XGM A;  3U4T A;  1QZ2 A;  5KJK A;  1QQE A;  2VGX B;  2VGX A;  3RIB A;  5JJ6 A;  4WUY A;  3ZHE A;  3WXX A;  4HOU A;  4J8D A;  3PDN A;  3SF4 A;  5EX3 A;  4I9E A;  3RO2 A;  4WNE A;  2PZI A;  2HR2 A;  2DBA A;  4ME2 A;  3ZN3 A;  2VYI A;  2PL2 A;  4G24 A;  2UY1 B;  3FWV A;  4F3V A;  2UY1 A;  3MKR A;  4RG6 A;  3KAE A;  2XCB A;  3CVP A;  3Q47 B;  1WAO 1;  5EKQ D;  3S7D A;  2FI7 A;  3CKB A;  4GYW A;  3CVL A;  2XCC A;  4HOQ A;  4GCN A;  4EQF A;  4UQZ A;  4RG9 A;  5CHE E;  2XGO A;  3LY9 A;  3CVQ A;  4XIF A;  4GYO A;  5FZR A;  4H7X A;  3Q15 A;  3PE3 A;  5KJL A;  4BTB A;  5G04 C;  1WM5 A;  3S7F A;  4I17 A;  1PC2 A;  4U04 A;  4N3C A;  4YND A;  3ASD A;  4Y6C A;  2NC9 A;  5CCM A;  3CK8 A;  4I9C A;  5BNW A;  4LEU A;  3CK7 A;  1KT0 A;  4WNG A;  4J8F A;  3QKY A;  4AIF A;  2P58 C;  3ZGQ A;  4BT8 A;  4AM9 A;  3UPV A;  3VTX A;  3TG5 A;  4HOS A;  3TG4 A;  3ESK A;  3LPZ A;  2FEZ A;  4YVQ C;  4CDR A;  1IYG A;  4KXK B;  4U0S A;  4BT9 A;  1ZBP A;  2VGY A;  3LCA A;  5M72 A;  2FBN A;  4CGW A;  1E96 B;  2XPI A;  1NZN A;  4B94 A;  5LCW J;  3KS2 A;  2LNI A;  3CEQ A;  4G23 A;  1TJC A;  5FJY A;  2LSV A;  2WQH A;  4J8E A;  2PQR A;  1ELW A;  2C0M A;  4KYO B;  5KJM A;  3OXG A;  3ZFW A;  2C0L A;  2YHC A;  5D0Q D;  1P5Q A;  3SZ7 A;  3FFL A;  3QWV A;  3URZ A;  2XGS A;  2GW1 A;  3CK9 A;  4UI9 J;  4GZ5 A;  4G26 A;  3MA5 A;  2UWJ G;  3PE4 A;  3ASF A;  2AVP A;  3QDN A;  3AS5 A;  2FF4 A;  3ULQ A;  4GA1 A;  2VQ2 A;  3TAX A;  2WPV A;  3CVN A;  1NA3 A;  4UI9 K; 
#chains in the Genus database with same CATH topology
 5H7P A;  5BT1 A;  3UMV A;  2XPY A;  4FJZ A;  3DEP A;  3VLF A;  2L0I A;  4L1B A;  1FVH A;  4U96 D;  1XNF A;  3E33 A;  3Q5M A;  5D2M C;  2IF4 A;  2VSN A;  1HG5 A;  3Q4A B;  3E32 A;  3C3Q A;  4PH4 B;  4U0U A;  4ANU A;  2I9C A;  1OXJ A;  4HRN A;  1H0A A;  3JUE A;  4CEM A;  2KBX A;  4A3V A;  1G3N B;  1IHG A;  3HVE B;  1FT1 A;  2QC9 A;  1N9A A;  4ATZ D;  2XS8 A;  3FHE A;  1NFI E;  4ANW A;  3EIJ A;  5BW8 C;  4EZL A;  2QFC A;  2ETC A;  2VSY A;  3UM0 A;  3L08 A;  1PAQ A;  1KT1 A;  1PY1 A;  1TNZ A;  5JJ7 A;  5G04 J;  4YDY A;  1N4P A;  3AG2 E;  4PS8 A;  3DSX A;  4B8A A;  1NA0 A;  1ZU2 A;  3PRZ A;  3RK6 A;  4GCO A;  3UI2 A;  4JHR A;  4DK5 A;  5BXO A;  3ZNG A;  3NB2 A;  2OND A;  4EPZ A;  4N39 A;  1K1A A;  3D9N A;  4FP7 A;  1BLX B;  3UUX A;  5FTP A;  2BF0 X;  3GW4 A;  2X6I A;  1K8K G;  4NRH B;  4B89 A;  3APC A;  4C9B B;  3W9F A;  5C1D A;  2L9B A;  5FZQ A;  1N4Q A;  4HBD A;  1BI8 B;  3LY7 A;  5ARF A;  3FH7 A;  4YDE A;  4JA7 A;  3V30 A;  2DYS E;  4GTP A;  3NF1 A;  4HFG A;  3GZ1 A;  3L6A A;  1V55 E;  2Y1L E;  3ZYK A;  3L16 A;  2LSU A;  4APF A;  3UT7 A;  2GRP B;  2XHE A;  3KD7 A;  4DLO A;  4L2L A;  2ION A;  3UM1 A;  1QYM A;  3L22 A;  1IHB A;  1OCZ E;  2J4D A;  3DEO A;  1E8Y A;  4F7A A;  2YIN A;  2B0O E;  3BUA A;  2IFU A;  3SI5 A;  2LUH A;  3ASO E;  5ENP D;  4LNB A;  4U95 D;  2J8S D;  4DX7 D;  3Q75 A;  1MZC A;  5B1A E;  2BKG A;  1OCC E;  3UKR G;  3BQO A;  3G2W A;  4JW1 A;  3RO3 A;  2M63 A;  5ANL A;  3ZRH A;  4N5C A;  5EYP F;  3JXI A;  3D9M A;  1BPO A;  3AU4 A;  1HXI A;  2LO6 A;  2DZO A;  4JL0 A;  2WXO A;  4W9R A;  3EDT B;  3C98 A;  4L2Y A;  4O1O A;  2FUL A;  4PS3 A;  5AAR A;  4O60 A;  5CMW A;  2DVW A;  3CR3 A;  4TUM A;  4HOT A;  1OWM A;  3U4T A;  1INZ A;  3CIA A;  4FHK A;  4FHJ A;  3RIB A;  4ILI A;  2IJG X;  1LD8 A;  3QJZ A;  3SBT B;  3HXF A;  4FA6 A;  3WXX A;  2GRL A;  3C3R A;  1YCS B;  3MGB A;  3DXM G;  3FH8 A;  3RO2 A;  1EF1 C;  4CRW A;  3APD A;  3B7U X;  4HLL A;  5ITZ F;  2A5E A;  2RG8 A;  1OWP A;  1SQM A;  3EU9 A;  4J7W A;  2WXH A;  4FAD A;  2X38 A;  4CT0 A;  1HG2 A;  3CVY A;  3KAE A;  5EDS A;  1TEZ A;  4LG6 A;  3HG0 D;  3EIQ C;  2XRZ A;  2RFA A;  3CHS A;  2XCC A;  3CVL A;  3E30 A;  4PUC A;  5LP0 A;  3CST A;  2QYU A;  4M7C A;  3L17 A;  4BES A;  4GYO A;  5HRY A;  5AQB A;  1TN7 A;  5G04 C;  2WXG A;  4HXI A;  5JMN D;  3QNK A;  3Q78 A;  4N3C A;  2FO1 E;  4YND A;  3ASD A;  3AG3 E;  4GMJ A;  5BNW A;  4JD2 G;  3ONK A;  3UT4 A;  4WNG A;  3PS6 A;  4XKC A;  4NIK A;  2P9L G;  2X6J A;  3B7B A;  3PNL B;  2CG2 A;  4AIF A;  2LXL A;  2P58 C;  3IKO B;  3ZGQ A;  4KZC A;  1WDY A;  4LER A;  5B3S E;  4GTV A;  5AN8 A;  4FUL A;  4UWK A;  3D9L A;  4GTS A;  4GML A;  3E34 A;  3ZVV A;  3R7Q A;  3P2B A;  2ZGD A;  2FBN A;  4E6H A;  1YMP A;  4CGW A;  3G2V A;  4UWG A;  1KZO A;  3KS2 A;  3AU5 A;  2LNI A;  2XEE A;  3FEX A;  2WXP A;  2WQH A;  3PZ1 A;  5FQ7 A;  4BY6 A;  1NL4 A;  4DI4 A;  2HM8 A;  2C0L A;  4Q94 A;  4DJA A;  4A63 B;  3VLE A;  3JCK C;  4TUU A;  5CRV A;  1HF8 A;  4O1P A;  1LTX A;  2MYO A;  3CK9 A;  3J5Q B;  4UI9 J;  3CVW A;  3Q7A A;  1H6O A;  4K03 A;  5HKP A;  1QNF A;  2LXM A;  2AVP A;  3SFY A;  2LAI A;  2WXK A;  4HS2 A;  1X5B A;  3TAX A;  1HE8 A;  1NP7 A;  4UI9 K;  4A55 A;  5A7D B;  4XEI G;  3LKU A;  1W3B A;  5JHB A;  1UJK A;  2ETB A;  4N2S A;  4OAU C;  3K9I A;  3VLD A;  4TXR A;  3AG4 E;  4L9P A;  2MRI A;  1WG0 A;  3B7S A;  2XEV A;  2WXF A;  5G55 A;  2V4L A;  4IN3 B;  3TWW A;  3D9J A;  4KZ0 A;  2R59 A;  3CQG B;  2L6J A;  3CHP A;  4ANV A;  1HO8 A;  1UN9 A;  3ZYM A;  4WWO A;  1Y6I A;  4WWP A;  5ENR D;  3Q49 B;  4XZ4 A;  1S70 B;  1DNP A;  3NQP A;  1DVP A;  3CHQ A;  1EDU A;  3DXK G;  4XI0 A;  2X6H A;  2V5F A;  1OCO E;  3R9A B;  1HH8 A;  5FQ4 A;  4GAA A;  3E4B A;  3VTY A;  5CRU A;  2WXN A;  3FU0 A;  4HOR A;  1OWL A;  2EQX A;  2J09 A;  4TXQ A;  4FU3 A;  5KJN A;  4GPK A;  3CHR A;  3V79 K;  3AS4 A;  2DWZ A;  2PQN A;  2HYZ A;  5ENQ D;  4AJW A;  3T5V A;  2R2L A;  5A23 A;  3TWQ A;  4I1A A;  3V31 A;  4Q69 A;  3GZS A;  1OCR E;  2AW6 A;  3Q9N C;  3GZ2 A;  4JEU A;  1JUQ A;  1LF8 A;  4JA9 A;  3FU5 A;  2Y69 E;  3FTU A;  4EZK A;  4AVX A;  4YDO A;  4JZY A;  3ASH A;  3L54 A;  1TJF A;  1UN8 A;  4BSZ B;  4GZD A;  4KBQ A;  3V2X A;  5AAO A;  2BED A;  3CQC B;  4U0Z A;  1OT8 A;  3PEV B;  1Z3Y A;  3QB2 A;  3FTS A;  1QBQ A;  3F6Q A;  5BXU A;  3CSF A;  4AY6 A;  5KCM A;  2Y4T A;  4JHJ A;  4DX2 A;  3ASG A;  4HI8 A;  3SNX A;  1RZ4 A;  3HVE A;  3ZU7 B;  5T3R A;  4U07 A;  3QWW A;  4AP2 A;  2CFZ A;  3UQ3 A;  5G05 J;  2ZGG A;  3DPY A;  3D9H A;  4IUL A;  2J49 A;  4QQI A;  4HLE A;  2NSZ A;  4UI9 C;  3SO8 A;  1ELK A;  4GZ6 A;  1N94 A;  2OOE A;  2XZT G;  3QAR A;  2WM9 A;  1ELR A;  4N5Q A;  3LVQ E;  3PZ2 A;  3R7R A;  2KCV A;  1UOH A;  2AXZ A;  5BUZ A;  3ENE A;  2ZXW E;  4UUC A;  4BEP A;  2V8S E;  2Y0B G;  5CBN A;  4FJY A;  1VDY A;  3RRN B;  5KJK A;  2WXJ A;  4MKT A;  1QQE A;  5E75 A;  4Z68 A;  3AAA C;  4CZ2 D;  4QFV A;  2WXL A;  2XRY A;  2I1K A;  1TNB A;  3NBN B;  3SF4 A;  2P9P G;  4JEH A;  4I9E A;  1E90 A;  4PDX A;  2IO3 C;  2L6B A;  3FUF A;  3U66 A;  2DBA A;  2VSO E;  1LD7 A;  3DRA A;  3B13 A;  3ZN3 A;  3D9P A;  3HXC A;  3PZD A;  4L23 A;  2UY1 B;  3O4Z A;  3FWV A;  1SZ9 A;  2UY1 A;  4F3V A;  3FTV A;  3ZYQ A;  3ZEF A;  2XCB A;  3CVP A;  4WWN A;  3Q47 B;  4C48 B;  5EKQ D;  2FI7 A;  3KEZ A;  4MS6 A;  3CKB A;  3TWS A;  4HOQ A;  4EQF A;  4UQZ A;  3TWT A;  5CHE E;  2XGO A;  3LY9 A;  3G2U A;  1BD8 A;  5FQ8 A;  3I4G A;  4DI3 A;  3I3N A;  3NOG D;  3LS8 A;  5KJL A;  4BTB A;  1E8Z A;  3D9I A;  4I43 A;  2XPZ A;  4HRL A;  4CDN A;  4Y6C A;  3CK8 A;  3Q9U C;  4I9C A;  3PUK A;  4E85 A;  3SFX A;  4UWL A;  3B7R L;  3CK7 A;  3TJP A;  3EHQ A;  1Z5S C;  1SVX A;  3ML9 A;  4J8F A;  2KXP C;  3EU5 A;  2AXV A;  3QKY A;  2AJA A;  1N54 A;  5AQ7 A;  2H6F A;  3KSQ A;  2OEV A;  4HOS A;  2ILR A;  1GW6 A;  3LPZ A;  2FEZ A;  4C0M A;  1IYG A;  1O5M A;  1MX6 A;  1IXV A;  1HFA A;  5J90 A;  4KMO A;  3LXU X;  2XPI A;  4B94 A;  1A5E A;  3U9W A;  1HX8 A;  1H2U A;  4G11 A;  3CEQ A;  4G23 A;  1TJC A;  1D8D A;  1UG3 A;  2OVF A;  4CCA A;  3UIN C;  3G2S A;  4KYO B;  5KJM A;  1H19 A;  3CVX A;  3OXG A;  4GTT A;  2GRR B;  2YHC A;  4B0Z A;  5D0Q D;  1P5Q A;  3SZ7 A;  1AP7 A;  4FLH A;  3FUJ A;  3URZ A;  3LDZ A;  1IKN D;  3PEU B;  3PZ3 A;  4J6I A;  4OYS A;  2UWJ G;  3ASF A;  5KNH D;  4UWF A;  3PH0 C;  1JCQ A;  3QDN A;  1H6P A;  3FEY A;  3BU8 A;  3ULQ A;  4GA1 A;  2WPV A;  3HHM A;  1NA3 A;  3NZU A;  4I1M A;  1V54 E;  3NAW A;  4KT6 B;  2KAT A;  2OCC E;  3QAQ A;  5E76 A;  3MEK A;  4J0U A;  3BG1 B;  2EIM E;  4U8V D;  2VJ8 A;  1U3C A;  4N3A A;  3O48 A;  3TL5 A;  3ML8 A;  3UT8 A;  3MCX A;  1N0R A;  2XEH A;  3CV0 A;  3MX3 A;  3HIZ A;  3JXJ A;  1KLX A;  3C5R A;  3D9O A;  4OVU A;  4JPS A;  4TV3 A;  4FLB A;  5D0O D;  5CMY A;  4I2W A;  4LNU D;  4GPM A;  5CED B;  5ENS D;  4UQY A;  3DSV A;  1DCQ A;  2J9Q A;  4BWR A;  1WY6 A;  3I4R B;  3KSL A;  2BKK B;  3BEE A;  3LY8 A;  2IY0 C;  3S7B A;  3T5X A;  3ZUV B;  3RRU A;  5ENT D;  2CFU A;  3FU3 A;  3HXD A;  3UX4 A;  2IQC A;  1UJJ A;  1YA0 A;  3UM2 A;  2Q7F A;  4DRX E;  3FUD A;  5FIN A;  3SY2 A;  4GZ3 A;  3U3W A;  2E0I A;  3BG0 B;  5EIB E;  2P9K G;  3FUL A;  2HE0 A;  2I1J A;  2V5Q C;  2GRM A;  3LJ3 A;  1DC2 A;  3UXG A;  5AEN A;  1TNY A;  4F1P A;  3EJN A;  1H2T C;  5J08 A;  2X3M A;  3TWU A;  4JC8 A;  3ZHE B;  3SGH A;  5AJL A;  1OWN A;  3I5P A;  5D66 A;  2DIW A;  4HI9 A;  2V0P A;  5CCL A;  1H2V C;  4CT4 A;  2WMO A;  3LEW A;  4AEZ C;  5FT9 A;  4J8S A;  3OXL A;  5ARG A;  4RSY A;  2DZN A;  3HDX A;  5FWQ A;  2PM6 A;  2EIK E;  3MV3 B;  1MQS A;  3CVV A;  2JLB A;  3AS8 A;  2GRQ B;  1TR4 A;  4I1O B;  2DYR E;  2Y4U A;  3HRA A;  3QWP A;  3P1U A;  4LNG A;  2X6K A;  1FT2 A;  3MJW A;  5EX0 A;  3CHO A;  3ZYL A;  4I6J A;  4F1S A;  3DST A;  4ABN A;  1EPU A;  4BX8 A;  1FVF A;  3X2Q E;  3RJV A;  2CHZ A;  2FO7 A;  4XE0 A;  3U64 A;  2GGF A;  3FUM A;  4K5C A;  5KNG A;  1HZ4 A;  5FIO A;  4BFR A;  3RU0 A;  3IXE A;  1YYH A;  2QY7 A;  4G2V A;  4B93 B;  4AY5 A;  5DIZ A;  3E37 A;  3DSU A;  2NYJ A;  1JWG A;  2F0Y A;  1SA5 A;  3FP3 A;  2BUG A;  4H7Y A;  2RD0 A;  2CHX A;  4O6F A;  5HQ8 A;  3GYZ A;  3C3O A;  1BI7 B;  5LOZ A;  4U8Y D;  2CG3 A;  1JCS A;  1Y8M A;  2VTB B;  2KC7 A;  4GA0 A;  4G25 A;  3CGH A;  3IV0 A;  5BPP A;  5FZS A;  1MX2 A;  4N2Q A;  5EN5 D;  5ANR A;  4F6R D;  3L9T A;  3L13 A;  4MBG A;  3DSS A;  2ETA A;  2VGX B;  2VGX A;  4HRM B;  4WUY A;  5IY5 E;  2WQ6 A;  2R17 C;  1N95 A;  4HQD A;  4C0E A;  2ZIR A;  4JXT A;  1N4S A;  4U63 A;  5EX3 A;  3LJN A;  1S64 A;  2YHE A;  4WNE A;  2IU1 A;  4XX5 A;  2L0T B;  4LRZ A;  4RVB A;  2HR2 A;  4B8C B;  1IQU A;  4ME2 A;  2KZT B;  1KPS B;  2KZT A;  2VYI A;  1KZP A;  3MKR A;  3DBS A;  1K3Z D;  3ZIM A;  3TXM A;  1FPP A;  4AXH A;  1N52 A;  3FDH A;  2WXR A;  3ULE G;  4RG9 A;  1E7U A;  3UIO C;  2RFM A;  2EIJ E;  4XIF A;  4H7X A;  3PE3 A;  1AWC B;  3FUI A;  4D10 C;  4GTO A;  4IRU A;  4I17 A;  2VGE A;  3EHM A;  1HS6 A;  4ILG A;  4A1G A;  2H6I A;  2A4Z A;  2BTD A;  4AV7 A;  2GRN B;  5EID A;  5CCM A;  3FU6 A;  1H6K A;  1KT0 A;  1O1T A;  3UPV A;  1U2V G;  3VTX A;  3T8M A;  3TG5 A;  5BV0 A;  3PRE A;  3FUN A;  3ZXP A;  3UM3 A;  4ATG A;  5AIJ A;  4YVQ C;  4M3O A;  2WXI A;  5AJD A;  1MJ0 A;  4U0S A;  3T8K A;  4TRQ A;  1D8E A;  1ZBP A;  4K5B A;  4ZFH A;  2QZA A;  3RSE G;  4IYP A;  4PS7 A;  4RLY A;  3FY4 A;  2OVB A;  1OY3 D;  3FTZ A;  4P29 A;  3QK0 A;  5LCW J;  3UTM A;  1Z3X A;  5FJY A;  4J8E A;  1ELW A;  2NXP A;  1Q2Z A;  4ZHB A;  2MOW A;  3ZFW A;  3UIP C;  3R9M A;  3G2T A;  4K0R A;  3ISM C;  2WQ7 A;  3OTN A;  3FFL A;  4MRU A;  3QWV A;  1D9S A;  4JB8 P;  4R7L A;  3ZXS A;  2B6C A;  4I6G A;  3LVR E;  4G26 A;  3ZW3 A;  3MA5 A;  3PE4 A;  4LSZ E;  2X6F A;  2P9I G;  3JQ0 A;  3AS5 A;  4HB5 A;  3QC1 A;  2FF4 A;  2I2O A;  2VQ2 A;  2EIL E;  3FTX A;  4GZC A;  3SQV A;  2F8X K;  4WNF A;  3S7J A;  5G2N A;  3OXF A;  5HI7 A;  2YQ8 A;  2DCP A;  3IEG A;  2HO1 A;  1U3D A;  5EIL A;  3UKU G;  4DPR A;  4N3B A;  4OAV B;  2RKK A;  4KVO A;  1EYH A;  3IHV A;  2H6G A;  4UQX A;  4URK A;  3B95 A;  4X8Q A;  2E2E A;  3JUI A;  5T8I A;  2IOL A;  3RRM B;  3HXB A;  4G8K A;  3KEA A;  4OVV A;  4Y6W A;  5KBA A;  1K1B A;  1N4R A;  1O1R A;  4F53 A;  3MYV A;  3DWL G;  3NZS A;  1BU9 A;  2R05 A;  1X81 A;  2XS1 A;  5DBK A;  4NAC A;  3FUH A;  3PZ4 A;  3CKC A;  5A6C A;  3QOU A;  4I2Z A;  3EHR A;  2WXQ A;  1A17 A;  2H6H A;  3FTW A;  3FH5 A;  4GTM A;  4RQI A;  2CHW A;  5BV1 A;  4KVM A;  1N0Q A;  5ENO D;  3L82 A;  4GMR A;  3HYM B;  4FC8 A;  4HVB A;  3C72 A;  3RAU A;  4CDM A;  2KCL A;  1DCE A;  4EZJ A;  3SFZ A;  4EBA G;  4HNA D;  3ABK E;  4DX5 D;  5JHA A;  3RKV A;  2ZIS A;  2GRO B;  2F37 A;  4A1S A;  5JJT A;  1E7V A;  2QYJ A;  3MKQ B;  2ZU6 B;  3AJI A;  2P9S G;  3MKQ A;  3ULY A;  4DX6 D;  4GTR A;  5AYW D;  3MV2 B;  1JWF A;  3DSW A;  5G05 C;  2MHK A;  5EYL A;  4UWH A;  3ESL A;  4BTA A;  3APF A;  1MX4 A;  1FCH A;  3SBS A;  3FTY A;  2AXU A;  2R5S A;  3TWR A;  4CGV A;  1S0P A;  4WAF A;  3DPD A;  4DX1 A;  1Z6T A;  2C2L A;  3EHN A;  1JCR A;  2F8Y A;  2J07 A;  4K5A B;  5B1B E;  4WND A;  4EBA A;  1NI1 A;  1TNU A;  5CEC B;  3HXE A;  3N71 A;  2VSX E;  1UW4 B;  1TNO A;  2J08 A;  3JYS A;  4ILH B;  1XGW A;  5LCW C;  3SHF A;  1TN6 A;  3Q79 A;  4BER A;  2KCK A;  3J5P A;  5FQ6 A;  4LUN U;  5LFA A;  2PM7 A;  1N11 A;  2P9N G;  1B89 A;  4ANX A;  4MLP A;  3PVL A;  3PNT B;  4GA2 A;  4U7E B;  4ACL A;  1OUV A;  3TWX A;  3ZPJ A;  2I6H A;  4YDW A;  3TGO A;  3ASN E;  3LYA A;  4YVO A;  1JPL A;  1S63 A;  3FUK A;  1E8X A;  3IBE A;  2IO2 C;  3V2O A;  4NQ0 A;  2AWI A;  2XZD G;  4G1T A;  2WVI A;  1MYO A;  5ENN A;  4APO A;  3WG7 E;  2WMN A;  4XI9 A;  4GYY A;  2XGM A;  1QZ2 A;  4JHK A;  2XQ0 A;  2WB2 A;  3TXN A;  2R02 A;  4GU5 A;  5JJ6 A;  4AOF A;  3ZHE A;  3MZL B;  4HOU A;  4J8D A;  3D3M A;  5T4Y A;  3PDN A;  1IQR A;  2PZI A;  3ABM E;  2OEW A;  2OV8 A;  2YNQ A;  2LAH A;  2PL2 A;  2R03 A;  4G24 A;  3Q7F A;  1HU3 A;  4RG6 A;  5C2Y A;  4JVS A;  3OAW A;  2XEN A;  1WAO 1;  3JQ1 A;  3S7D A;  4EEC A;  4GYW A;  5CER B;  4GCN A;  3W9G A;  5KWD A;  3T9K A;  3S2A A;  3CVQ A;  2JEK A;  2JAB A;  5FZR A;  3AG1 E;  3Q15 A;  5CBO A;  1WM5 A;  3S7F A;  3ZKJ A;  1PC2 A;  4U04 A;  3NOC D;  1OWO A;  2NC9 A;  4DUI A;  4ACK A;  4GB9 A;  4LEU A;  3TWV A;  5JA4 D;  4L7T A;  3ABL E;  2EIN E;  3CVU A;  5AQ9 A;  2V4H C;  3Q73 A;  2Y3A A;  4BT8 A;  4AM9 A;  1MHQ A;  3CHM A;  4DLQ A;  3TG4 A;  3EUV A;  3ESK A;  1ZB1 A;  2IOS A;  4V3I A;  4BSX A;  4I6E A;  4CDR A;  4NUR A;  4KXK B;  4BT9 A;  3B7T A;  1O1S A;  1L5J A;  2VGY A;  3D9K A;  2J4B A;  3LCA A;  2VTB A;  5M72 A;  4LCT A;  5CEA A;  2IEJ A;  5LX8 A;  4U8H A;  4XKB A;  3FUE A;  1E96 B;  4GTQ A;  1NZN A;  1RW2 A;  3CLJ A;  2P9U G;  2LSV A;  2A5U A;  2PQR A;  1SZA A;  3ONL A;  3IHY A;  2C0M A;  4J8Y A;  4A3T A;  4G8L A;  3SD5 A;  5AQA A;  4CYM D;  2PNN A;  2WXM A;  2XGS A;  2GW1 A;  4BX9 A;  2KM4 A;  1SW6 A;  1SA4 A;  4GZ5 A;  5HS0 A;  4Q96 A;  4EHM A;  4BET A;  1E8W A;  4TXP A;  2P2C P;  1TN8 A;  3PUJ A;  3CVN A;  1TYQ G; 
#chains in the Genus database with same CATH homology
 4A55 A;  4KT6 B;  2KAT A;  5A7D B;  3QAQ A;  3LKU A;  5E76 A;  5BT1 A;  4WNF A;  1W3B A;  3UMV A;  5JHB A;  1UJK A;  3S7J A;  3MEK A;  2XPY A;  4FJZ A;  5G2N A;  3OXF A;  4N2S A;  5HI7 A;  2YQ8 A;  2L0I A;  2DCP A;  4L1B A;  3VLF A;  3IEG A;  1FVH A;  4J0U A;  1XNF A;  3BG1 B;  3Q5M A;  2HO1 A;  3K9I A;  2IF4 A;  1U3D A;  3VLD A;  2VJ8 A;  1U3C A;  4N3A A;  2VSN A;  1HG5 A;  3Q4A B;  2MRI A;  3O48 A;  3TL5 A;  3ML8 A;  4DPR A;  3B7S A;  3UT8 A;  2XEV A;  3MCX A;  4N3B A;  2WXF A;  5G55 A;  4PH4 B;  4U0U A;  4ANU A;  4KVO A;  1EYH A;  3IHV A;  3CV0 A;  2I9C A;  3MX3 A;  3HIZ A;  4UQX A;  4URK A;  2V4L A;  1KLX A;  3D9O A;  4OVU A;  4IN3 B;  2E2E A;  3JUI A;  5T8I A;  1H0A A;  2IOL A;  3D9J A;  4KZ0 A;  2R59 A;  3RRM B;  4JPS A;  3CQG B;  2L6J A;  4TV3 A;  3CHP A;  4FLB A;  5D0O D;  4CEM A;  5CMY A;  4I2W A;  4OVV A;  4Y6W A;  4A3V A;  4ANV A;  1HO8 A;  1UN9 A;  3ZYM A;  4WWO A;  1Y6I A;  1IHG A;  4UQY A;  4F53 A;  3HVE B;  4WWP A;  3MYV A;  3NZS A;  2J9Q A;  3Q49 B;  1WY6 A;  3FHE A;  4BWR A;  4XZ4 A;  3I4R B;  4ANW A;  3EIJ A;  3BEE A;  5DBK A;  4NAC A;  3LY8 A;  1DNP A;  3NQP A;  5BW8 C;  3S7B A;  4EZL A;  3FUH A;  3T5X A;  2QFC A;  3CKC A;  1DVP A;  5A6C A;  3CHQ A;  3QOU A;  4I2Z A;  1EDU A;  4XI0 A;  3RRU A;  2VSY A;  2X6H A;  2WXQ A;  2V5F A;  1A17 A;  3L08 A;  3FTW A;  2CFU A;  1PAQ A;  3FH5 A;  1KT1 A;  3R9A B;  1PY1 A;  3FU3 A;  3UX4 A;  2IQC A;  1HH8 A;  1UJJ A;  1YA0 A;  5FQ4 A;  2CHW A;  5BV1 A;  4KVM A;  4GAA A;  3E4B A;  3VTY A;  5JJ7 A;  2WXN A;  2Q7F A;  3FUD A;  5G04 J;  3FU0 A;  3HYM B;  4FC8 A;  4GZ3 A;  4PS8 A;  4B8A A;  3U3W A;  1OWL A;  2EQX A;  4HVB A;  1NA0 A;  1ZU2 A;  4HOR A;  2E0I A;  3BG0 B;  2J09 A;  3PRZ A;  3RK6 A;  3FUL A;  4FU3 A;  4GCO A;  4CDM A;  2KCL A;  5KJN A;  2I1J A;  4JHR A;  4EZJ A;  3SFZ A;  2GRM A;  3LJ3 A;  4GPK A;  4EBA G;  4DK5 A;  3CHR A;  5AEN A;  3AS4 A;  3EJN A;  5JHA A;  1H2T C;  5J08 A;  2PQN A;  3RKV A;  2HYZ A;  2X3M A;  4AJW A;  3T5V A;  5A23 A;  4JC8 A;  4I1A A;  3ZHE B;  4A1S A;  4Q69 A;  5JJT A;  2OND A;  5AJL A;  3SGH A;  1OWN A;  3I5P A;  4EPZ A;  2DIW A;  3GZS A;  4N39 A;  1E7V A;  2V0P A;  5CCL A;  1H2V C;  3MKQ B;  3D9N A;  2ZU6 B;  4CT4 A;  4FP7 A;  2AW6 A;  2WMO A;  3LEW A;  4AEZ C;  3MKQ A;  5AYW D;  5FT9 A;  4J8S A;  3GZ2 A;  3UUX A;  3OXL A;  3MV2 B;  4JEU A;  1JWF A;  5FTP A;  5G05 C;  2MHK A;  4RSY A;  1JUQ A;  3HDX A;  5ARG A;  5FWQ A;  1LF8 A;  2BF0 X;  2PM6 A;  4JA9 A;  3MV3 B;  4UWH A;  1MQS A;  3CVV A;  3ESL A;  4BTA A;  3GW4 A;  2JLB A;  3FU5 A;  3FTU A;  2X6I A;  3APF A;  3AS8 A;  4EZK A;  4AVX A;  4NRH B;  1FCH A;  3SBS A;  4B89 A;  3FTY A;  4JZY A;  2AXU A;  3ASH A;  3L54 A;  2R5S A;  3APC A;  4I1O B;  4CGV A;  1S0P A;  4C9B B;  2Y4U A;  1TJF A;  5C1D A;  4WAF A;  3DPD A;  2L9B A;  5FZQ A;  3QWP A;  3P1U A;  1Z6T A;  1UN8 A;  2C2L A;  3EHN A;  2X6K A;  3LY7 A;  5ARF A;  3FH7 A;  4JA7 A;  2J07 A;  3MJW A;  4WND A;  4EBA A;  5EX0 A;  3NF1 A;  3CHO A;  4GZD A;  3ZYL A;  4KBQ A;  4HFG A;  3CQC B;  4U0Z A;  3GZ1 A;  3L6A A;  3N71 A;  4I6J A;  2VSX E;  4F1S A;  3PEV B;  1UW4 B;  4ABN A;  1Z3Y A;  3QB2 A;  3FTS A;  1EPU A;  2J08 A;  3JYS A;  4ILH B;  3L16 A;  3ZYK A;  1XGW A;  4BX8 A;  5LCW C;  1FVF A;  3SHF A;  2LSU A;  4APF A;  3UT7 A;  3CSF A;  4AY6 A;  5KCM A;  3RJV A;  2XHE A;  2KCK A;  5FQ6 A;  2CHZ A;  2FO7 A;  3KD7 A;  4XE0 A;  4L2L A;  2ION A;  4DLO A;  2Y4T A;  4JHJ A;  3U64 A;  2GGF A;  3FUM A;  4LUN U;  3L22 A;  5LFA A;  2PM7 A;  3ASG A;  2J4D A;  1HZ4 A;  1E8Y A;  1B89 A;  4BFR A;  3SNX A;  3RU0 A;  4ANX A;  4F7A A;  2YIN A;  3HVE A;  4MLP A;  5T3R A;  4U07 A;  4G2V A;  2QY7 A;  4AY5 A;  3QWW A;  3PVL A;  4AP2 A;  3PNT B;  2IFU A;  3SI5 A;  5DIZ A;  4GA2 A;  2CFZ A;  3UQ3 A;  4ACL A;  5G05 J;  1JWG A;  1OUV A;  3ZPJ A;  2I6H A;  4IUL A;  3TGO A;  2J49 A;  3LYA A;  4YVO A;  4HLE A;  1JPL A;  2NSZ A;  4UI9 C;  3FP3 A;  2BUG A;  1ELK A;  3G2W A;  4JW1 A;  3FUK A;  4H7Y A;  2RD0 A;  3RO3 A;  2CHX A;  2M63 A;  1E8X A;  3IBE A;  4O6F A;  5ANL A;  3ZRH A;  4GZ6 A;  2OOE A;  4N5C A;  4NQ0 A;  5HQ8 A;  3QAR A;  2AWI A;  2WM9 A;  1ELR A;  3GYZ A;  3D9M A;  3LVQ E;  3R7R A;  1BPO A;  2KCV A;  4G1T A;  2AXZ A;  3AU4 A;  5LOZ A;  2CG3 A;  1HXI A;  2WVI A;  1Y8M A;  2LO6 A;  2VTB B;  2KC7 A;  5ENN A;  5BUZ A;  4JL0 A;  2WXO A;  4W9R A;  3ENE A;  4GA0 A;  4APO A;  2WMN A;  3CGH A;  3EDT B;  3C98 A;  3IV0 A;  4G25 A;  2V8S E;  4XI9 A;  5BPP A;  4L2Y A;  5FZS A;  2FUL A;  4PS3 A;  5CMW A;  4FJY A;  4N2Q A;  3CR3 A;  4GYY A;  5ANR A;  4HOT A;  1OWM A;  1VDY A;  2XGM A;  3U4T A;  1QZ2 A;  3L13 A;  4JHK A;  2XQ0 A;  3CIA A;  3RRN B;  5KJK A;  2WXJ A;  2WB2 A;  1INZ A;  4FHK A;  3TXN A;  4MKT A;  4FHJ A;  1QQE A;  2VGX B;  4GU5 A;  2VGX A;  3RIB A;  4ILI A;  2IJG X;  5JJ6 A;  4WUY A;  4AOF A;  3QJZ A;  5E75 A;  2WQ6 A;  2R17 C;  3SBT B;  4QFV A;  4FA6 A;  2WXL A;  2XRY A;  2I1K A;  3MZL B;  3WXX A;  3ZHE A;  4HOU A;  4J8D A;  4C0E A;  2GRL A;  3D3M A;  5T4Y A;  4JXT A;  3PDN A;  3SF4 A;  4U63 A;  3MGB A;  5EX3 A;  4JEH A;  4I9E A;  1E90 A;  4PDX A;  3FH8 A;  3RO2 A;  1EF1 C;  4CRW A;  2YHE A;  4WNE A;  1IQR A;  2IU1 A;  4XX5 A;  2PZI A;  3APD A;  2L0T B;  3B7U X;  4LRZ A;  4RVB A;  3FUF A;  2HR2 A;  3U66 A;  2DBA A;  2VSO E;  4B8C B;  1IQU A;  2RG8 A;  4ME2 A;  2KZT B;  1OWP A;  1SQM A;  2OV8 A;  2YNQ A;  3B13 A;  2LAH A;  3ZN3 A;  2KZT A;  2VYI A;  3D9P A;  2WXH A;  2PL2 A;  3PZD A;  4L23 A;  4G24 A;  4FAD A;  2UY1 B;  3O4Z A;  3FWV A;  2X38 A;  4CT0 A;  1HU3 A;  1SZ9 A;  2UY1 A;  4F3V A;  3FTV A;  3ZYQ A;  1HG2 A;  3MKR A;  3CVY A;  3DBS A;  4RG6 A;  3ZEF A;  3KAE A;  2XCB A;  3CVP A;  3ZIM A;  5C2Y A;  5EDS A;  4WWN A;  1TEZ A;  4JVS A;  3TXM A;  3EIQ C;  3OAW A;  3Q47 B;  1WAO 1;  3JQ1 A;  5EKQ D;  3S7D A;  2XRZ A;  4EEC A;  2FI7 A;  3KEZ A;  4AXH A;  4MS6 A;  3CKB A;  4GYW A;  3CHS A;  3CVL A;  1N52 A;  2XCC A;  4PUC A;  5LP0 A;  3FDH A;  2WXR A;  4HOQ A;  4GCN A;  4EQF A;  3CST A;  4RG9 A;  4UQZ A;  5CHE E;  2XGO A;  3LY9 A;  3G2U A;  1E7U A;  5FQ8 A;  3S2A A;  3I4G A;  4DI3 A;  3CVQ A;  2JEK A;  3L17 A;  4XIF A;  4GYO A;  3I3N A;  5FZR A;  4H7X A;  3Q15 A;  3LS8 A;  3PE3 A;  5KJL A;  3FUI A;  4BTB A;  1E8Z A;  5G04 C;  4D10 C;  4IRU A;  3D9I A;  1WM5 A;  4I43 A;  3S7F A;  4I17 A;  2XPZ A;  2WXG A;  3EHM A;  4HXI A;  1PC2 A;  1HS6 A;  3QNK A;  4U04 A;  4ILG A;  4N3C A;  4A1G A;  4YND A;  4CDN A;  2A4Z A;  3ASD A;  1OWO A;  2BTD A;  4AV7 A;  4Y6C A;  2NC9 A;  5CCM A;  3CK8 A;  3FU6 A;  4GMJ A;  3PUK A;  4I9C A;  4ACK A;  4E85 A;  4GB9 A;  4UWL A;  5BNW A;  4LEU A;  3ONK A;  3B7R L;  1H6K A;  3CK7 A;  3TJP A;  4L7T A;  3UT4 A;  1KT0 A;  4WNG A;  3PS6 A;  4XKC A;  3CVU A;  3ML9 A;  2X6J A;  4J8F A;  2Y3A A;  3PNL B;  2CG2 A;  2AXV A;  3QKY A;  4AIF A;  2P58 C;  3IKO B;  1N54 A;  4I1M A;  3ZGQ A;  4KZC A;  4BT8 A;  4AM9 A;  3UPV A;  1MHQ A;  3VTX A;  3T8M A;  3CHM A;  3TG5 A;  4DLQ A;  4HOS A;  5BV0 A;  3TG4 A;  3PRE A;  3ESK A;  2ILR A;  2IOS A;  3FUN A;  4LER A;  4V3I A;  4BSX A;  1GW6 A;  3LPZ A;  2FEZ A;  4FUL A;  4UWK A;  4ATG A;  3D9L A;  4C0M A;  5AIJ A;  4I6E A;  4YVQ C;  4M3O A;  4CDR A;  2WXI A;  4NUR A;  1IYG A;  5AJD A;  4KXK B;  4U0S A;  4BT9 A;  4GML A;  3B7T A;  4TRQ A;  1L5J A;  1ZBP A;  2VGY A;  3ZVV A;  3D9K A;  3R7Q A;  1HFA A;  2J4B A;  3LCA A;  5M72 A;  4LCT A;  5J90 A;  2VTB A;  4KMO A;  3LXU X;  5LX8 A;  4U8H A;  3P2B A;  4XKB A;  3FUE A;  4IYP A;  4PS7 A;  2FBN A;  4E6H A;  4CGW A;  3FY4 A;  1E96 B;  2OVB A;  2XPI A;  1NZN A;  3CLJ A;  3G2V A;  3FTZ A;  4B94 A;  4P29 A;  3QK0 A;  5LCW J;  1Z3X A;  3U9W A;  1HX8 A;  1H2U A;  4UWG A;  3KS2 A;  4G11 A;  3AU5 A;  2LNI A;  3CEQ A;  3FEX A;  4G23 A;  1TJC A;  5FJY A;  1UG3 A;  2LSV A;  2OVF A;  2WXP A;  4CCA A;  2A5U A;  2WQH A;  4J8E A;  2PQR A;  1ELW A;  1SZA A;  5FQ7 A;  3ONL A;  4BY6 A;  3G2S A;  3IHY A;  2C0M A;  2NXP A;  4KYO B;  5KJM A;  4DI4 A;  2MOW A;  1H19 A;  3CVX A;  3OXG A;  2HM8 A;  3ZFW A;  2C0L A;  4Q94 A;  3G2T A;  4DJA A;  4K0R A;  2YHC A;  4B0Z A;  2WQ7 A;  3OTN A;  3VLE A;  3SD5 A;  4A3T A;  5D0Q D;  1P5Q A;  3SZ7 A;  3JCK C;  4TUU A;  3FFL A;  2WXM A;  4FLH A;  3QWV A;  3FUJ A;  4MRU A;  1HF8 A;  3URZ A;  3LDZ A;  2XGS A;  4R7L A;  2GW1 A;  4BX9 A;  3ZXS A;  3PEU B;  2KM4 A;  3CK9 A;  4I6G A;  4UI9 J;  3LVR E;  3CVW A;  4J6I A;  4GZ5 A;  4OYS A;  4G26 A;  3ZW3 A;  3MA5 A;  4K03 A;  2UWJ G;  4Q96 A;  3PE4 A;  1QNF A;  3ASF A;  4UWF A;  2X6F A;  2AVP A;  3PH0 C;  2LAI A;  1E8W A;  3JQ0 A;  3QDN A;  3AS5 A;  2WXK A;  3FEY A;  3QC1 A;  2FF4 A;  4HS2 A;  3ULQ A;  4GA1 A;  2VQ2 A;  1X5B A;  2I2O A;  3PUJ A;  2WPV A;  3TAX A;  3CVN A;  3HHM A;  1HE8 A;  1NA3 A;  3FTX A;  3NZU A;  1NP7 A;  4UI9 K;  4GZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...