1NA3A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords designed protein CTPR2
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
total genus 36
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na3A00
2LSUA 3OXLA 3OXFA 4H7XA 4U0UA 1HZ4A 1KT1A 4IN3B 3FFLA 3PDNA 2VGYA 2VGXB 2PL2A 3S7DA 4AY6A 5ARFA 2UY1A 3CVQA 3U4TA 2PQRA 2XCBA 4N39A 2FO7A 5EX0A 1B89A 3RJVA 4JL0A 4YNDA 2UY1B 4ME2A 4I1AA 3MKRA 4JHRA 1NA0A 4AY5A 3U3WA 5KJMA 5DIZA 1HXIA 2XGSA 4XI9A 1ELWA 2WQHA 3MEKA 4N3CA 3ESKA 4GZ6A 4LEUA 3WXXA 2BUGA 5LCWJ 5JJTA 5G04C 4J8EA 4G25A 3MV3B 1Y8MA 1ZU2A 3HYMB 3TAXA 2Y4UA 4NQ0A 3LYAA 3CVPA 3QOUA 1WAO1 5LCWC 3ULQA 3QWVA 3RIBA 4U0ZA 3O48A 4GCNA 4AIFA 1TJCA 2WPVA 2V5FA 4U07A 2GW1A 3Q5MA 4EQFA 4KXKB 4N5CA 3RKVA 1ELRA 3ZFWA 2XGMA 3N71A 2JLBA 3NF1A 4RG6A 3KS2A 4ABNA 3PE4A 3LY8A 5FT9A 4CDRA 4WNFA 2VGXA 3GZ1A 5BNWA 2ONDA 5JJ7A 4GA1A 5FZRA 2KATA 1KT0A 4HOUA 4BTAA 3ZPJA 2KCKA 4G24A 5BW8C 3QKYA 5EKQD 4GYYA 5JJ6A 3Q4AB 1A17A 5FZQA 3CK8A 3ASHA 4BWRA 2XPIA 3QWPA 5C1DA 3UUXA 2FEZA 4GPKA 1HH8A 1PC2A 5AYWD 4XI0A 3BEEA 5KJKA 3S7FA 1W3BA 4GCOA 3OXGA 2XEVA 5A7DB 4U04A 4WNGA 3VTYA 4GYWA 3CKCA 4KYOB 3K9IA 4J8FA 4U0SA 2PQNA 4HOSA 4BT9A 2IFUA 3ASFA 2XCCA 3UPVA 3S7BA 5FJYA 5FTPA 1IYGA 3FWVA 5D0OD 3ZGQA 4A1SA 2LNIA 4UI9K 4HOQA 4N2SA 3LCAA 5KJNA 4WUYA 1QZ2A 2YHCA 4O6FA 2YQ8A 3EDTB 3LKUA 3GZ2A 4HORA 3MV2B 4UQZA 3RO3A 1YA0A 4N3BA 1IHGA 4UI9J 5CCLA 2C0LA 2Y4TA 2L6JA 2C0MA 3GW4A 1OUVA 2HR2A 2Q7FA 4N3AA 4BT8A 4YVOA 3KAEA 4UI9C 3TG4A 4XIFA 5KJLA 3LY9A 4RG9A 3LY7A 2VYIA 5D0QD 1FCHA 2KCVA 3SF4A 4GA0A 3TGOA 3CVNA 3Q49B 5EX3A 3Q47B 2J9QA 4I2ZA 3SZ7A 4W9RA 4WNDA 4WNEA 2IF4A 3UQ3A 5HI7A 2I6HA 3QDNA 4JA7A 4NRHB 5HQ8A 3ASDA 2MHKA 3LPZA 4G2VA 2FI7A 3ZHEB 4G23A 4G1TA 3VTXA 1NZNA 4J0UA 3CKBA 4J8DA 2DBAA 2XGOA 4KBQA 2KC7A 3CVLA 3ZN3A 4APOA 1KLXA 5G05J 3E4BA 2R5SA 3KD7A 3R9AB 5A6CA 1WM5A 2QFCA 5DBKA 4GZ3A 4H7YA 3TG5A 3Q15A 5G04J 3CV0A 2P58C 3QWWA 1QQEA 2VSYA 4G26A 4F3VA 5G05C 2C2LA 3JYSA 2NC9A 3RO2A 3URZA 4Y6WA 3AS8A 3IEGA 4I17A 4Y6CA 4GA2A 4HOTA 4I9EA 4I9CA 2VQ2A 2PZIA 5BT1A 3MA5A 3GYZA 4JA9A 4GYOA 2HYZA 2LSVA 3ASGA 3CEQA 4BTBA 5CCMA 2E2EA 4B94A 3PE3A 3S7JA 4AM9A 4YVQC 1E96B 2OOEA 1ZBPA 5FZSA 4GZ5A 4CGVA 2HO1A 2VSNA 1P5QA 4N2QA 3RU0A 1XNFA 2UWJG 2FBNA 1NA3A 4UQXA 3CK7A 2KCLA 3AS4A 3AS5A 4CGWA 4UQYA 2AVPA 3CK9A 5CHEE 4I2WA 3FP3A 2FF4A 5ARGA 3ZHEA 5M72A
chains in the Genus database with same CATH superfamily
4LCTA 1INZA 3OXFA 4IN3B 3ASOE 1JCQA 5JA4D 4TUUA 2A5EA 1IQRA 2PL2A 3S7DA 5ARFA 3FUIA 1JPLA 2CFZA 3FY4A 1HS6A 4CCAA 3U4TA 3PVLA 4PUCA 2FO7A 5EX0A 4GTSA 1DCEA 3KSLA 3PH0C 3E33A 4EPZA 3FTXA 2UY1B 3LXUX 2GGFA 1LTXA 2QY7A 3ABKE 3EUVA 3OAWA 4PDXA 3ZEFA 3MKRA 3U9WA 3EIJA 4AY5A 2WVIA 1N0RA 3IHVA 2V5QC 5KNHD 2R2LA 1BLXB 4N3CA 2WXLA 4LEUA 5LCWJ 3T9KA 5JJTA 2P9PG 3UI2A 3PZ1A 4J8EA 1H19A 3PEVB 1ZU2A 3HYMB 2I9CA 4NURA 1FPPA 3V2OA 1WAO1 5ENTD 3AJIA 5CRUA 3ULQA 2J4DA 3QWVA 5ENPD 3RIBA 4UWGA 1N52A 4AIFA 4F53A 3Q5MA 4U8HA 1WG0A 3FUEA 4HI8A 2Y3AA 4N5CA 1ELRA 5BUZA 4ILIA 3N71A 3KS2A 4GTRA 4ABNA 1S0PA 4B93B 2WXNA 5FT9A 4CDRA 3CR3A 1QBQA 3FU0A 3MX3A 5LP0A 5AIJA 3EU5A 2KZTB 3GZ1A 2ONDA 1ZB1A 3CVWA 2CG3A 5JJ7A 5FZRA 5BXUA 2KATA 2X38A 4B8AA 5EKQD 2Y0BG 3AG3E 5ANLA 2JEKA 3CVYA 3T5VA 3CHMA 4HB5A 1PC2A 5KJKA 3V79K 1OCZE 1VDYA 3D9KA 3PUJA 4U04A 4WNGA 4MBGA 2IQCA 3QAQA 4A63B 3K9IA 4J8FA 1Y6IA 2KXPC 5T8IA 4BT9A 4E6HA 2DIWA 4BEPA 3ASFA 4GPMA 2XCCA 3ZU7B 4WWPA 4AV7A 3S2AA 2BF0X 2J49A 3EHRA 4KVMA 1UOHA 4BESA 3L08A 3ZIMA 4DI4A 4DI3A 5G55A 2FO1E 4I6GA 5BV1A 1QZ2A 3HHMA 2AJAA 4O6FA 4B89A 4BX8A 3ZXSA 1MZCA 3LKUA 1DC2A 2F8YA 2XS8A 4TXPA 4MLPA 4BY6A 3VLFA 3RO3A 2IO3C 4O1OA 1G3NB 4N3BA 5AN8A 3T8KA 4ILGA 4UI9J 3D9PA 3UM0A 2L9BA 2Y4TA 2L6JA 2C0MA 4UUCA 1HFAA 3G2TA 2Q7FA 3FUHA 4N3AA 4FA6A 5CMWA 2DYSE 4BT8A 1FT2A 2WXJA 1JUQA 3TG4A 2XPZA 4EECA 1FCHA 2KCVA 3F6QA 4MRUA 2OEVA 4CT0A 3TGOA 3CVNA 3Q49B 1FVHA 3CSTA 3U66A 2J9QA 4RLYA 4GTVA 3FHEA 4LRZA 3UQ3A 4JA7A 4V3IA 3ASDA 3LPZA 3D9HA 4O60A 4D10C 2NYJA 3TXNA 4J0UA 4BETA 4A1GA 3CKBA 3QB2A 3FU5A 2LXMA 2KC7A 2VTBB 2IEJA 2AXZA 4U8VD 5CBOA 5G05J 3E4BA 2R5SA 1HU3A 2EQXA 5B1AE 2X6JA 3AU5A 4RQIA 4G8KA 2VGEA 3KEAA 4H7YA 3Q15A 5G04J 2P58C 1SVXA 1QQEA 2OV8A 3APCA 3FDHA 1BI8B 4F3VA 2C2LA 1E8ZA 3FUNA 3TWUA 2NC9A 3ULYA 2XEEA 4HNAD 3AS8A 3G2VA 4Y6CA 3Q78A 3DWLG 3D3MA 2PM6A 4I9CA 3TWQA 2VQ2A 4JB8P 2YNQA 4WWOA 3ZUVB 1EF1C 4GU5A 1NL4A 4JA9A 3FULA 2HE0A 1OWMA 3CEQA 4HS2A 3HXFA 3PE3A 3B13A 2XPYA 3LEWA 5G2NA 3U64A 4GZCA 4HRNA 5ENRD 3RRNB 3APFA 4CDMA 5BV0A 2A5UA 5ENQD 3LVRE 3ML9A 4N2QA 3RU0A 1TEZA 4JC8A 1YCSB 5T3RA 4Q94A 4FADA 4K5AB 3AS4A 4CGWA 4JVSA 3I5PA 3CK9A 3BQOA 2EILE 4F1SA 3BG0B 3HG0D 1H2VC 1OT8A 3FP3A 2MRIA 3FEXA 1UG3A 2X6KA 3LJ3A 1LF8A 1UJKA 5H7PA 3TWVA 3FFLA 4PS7A 4UWKA 3E30A 1HF8A 2ZGGA 4KVOA 2VGXB 2H6GA 3IHYA 5FQ8A 4FC8A 3FEYA 3HXBA 5AAOA 3ZVVA 2AXVA 2V0PA 3CVQA 4QFVA 1S70B 3FU3A 2J4BA 2EIKE 3SO8A 4ME2A 2L0TB 4I1AA 1RW2A 2AW6A 2Y69E 3FUKA 3ASNE 4WAFA 5AJLA 3X2QE 1SZAA 2P9KG 1ELWA 2WQHA 3D9NA 3R7RA 4TXQA 3ZYLA 5CEAA 2H6IA 2BUGA 3D9MA 3B7TA 3T8MA 4NQ0A 1KZOA 3IBEA 4CRWA 5LCWC 2P9IG 3V30A 1N95A 1UN9A 4U0ZA 1X5BA 3RRUA 1H6KA 1DCQA 1DNPA 4U7EB 1GW6A 3D9JA 4EQFA 3NQPA 3T5XA 4PS3A 3MYVA 2M63A 2JLBA 3SD5A 2I1JA 3DPYA 4F6RD 2VSXE 3LY8A 4OAUC 1JWGA 2E0IA 2VGXA 1SA4A 3ONLA 2J07A 1KT0A 4LNBA 4HOUA 4BTAA 2KCKA 4FJZA 4G24A 2R05A 3ISMC 3LDZA 3QKYA 4GTQA 1NP7A 2WMOA 4GYYA 5JJ6A 2OVFA 4BWRA 4G8LA 3QWPA 1FT1A 4DLQA 5AQBA 4DX2A 2WB2A 3SGHA 5AYWD 4XI0A 1UJJA 3VLDA 3ABME 4YDYA 3BU8A 1W3BA 5A7DB 3PZ2A 2XRZA 4GYWA 4KYOB 5CERB 4BSZB 4RSYA 4CT4A 4XE0A 2PQNA 4HOSA 2CHZA 3ML8A 3D9OA 4JZYA 4GTTA 5J08A 3CHOA 5FJYA 5FTPA 3UT7A 3FWVA 4GZDA 2RKKA 3DSVA 5EIDA 5D0OD 2LNIA 3HDXA 3L16A 4UI9K 1H6OA 4Q96A 4HOQA 2IU1A 1MHQA 2YHCA 1SA5A 2QC9A 4OVVA 1LD8A 3FH8A 3EDTB 1E90A 3LJNA 3R9MA 4LNUD 1IHBA 4HORA 2XQ0A 3AG1E 3HRAA 4EZJA 1YA0A 3JXJA 1IHGA 1TN6A 1HX8A 2C0LA 4BSXA 3GW4A 4DLOA 2WXHA 3JUEA 4GTMA 4DX1A 4ACLA 4LG6A 4MS6A 1TYQG 3PREA 3UKUG 3LVQE 4YVOA 3KAEA 4UI9C 2FULA 1OCRE 4HI9A 1Z6TA 1D8EA 4EBAG 3LY7A 3TWWA 1V54E 1U2VG 2XZDG 3SFYA 1OWOA 4K03A 3IXEA 2WXIA 3SZ7A 4WNDA 2JABA 4BFRA 2IF4A 5HI7A 2I6HA 3G2UA 3DPDA 4NRHB 2MHKA 4G2VA 4ACKA 3ENEA 4I1OB 4RVBA 3Q7FA 3NZUA 4U63A 1N94A 4G23A 1NZNA 1MYOA 2CG2A 3FUJA 3EHNA 3UIPC 4J8DA 2XGOA 2ZISA 4KBQA 4UWLA 5FIOA 1D9SA 4APOA 1KLXA 3V2XA 3DEOA 5KBAA 2VJ8A 3R9AB 2QFCA 5DBKA 1BD8A 4GZ3A 1TNYA 3RSEG 3TG5A 3FTUA 3DEPA 4GMRA 2WXMA 4M3OA 4PH4B 2EIJE 3EHQA 3DRAA 1YMPA 3NB2A 5G05C 2DYRE 4A55A 2OCCE 3RO2A 5JHAA 3W9FA 3CSFA 3FTYA 4CZ2D 2V4HC 2LAIA 5D66A 1H6PA 2WXQA 3DSXA 1XGWA 2EINE 4CEMA 3C5RA 3V31A 3UXGA 3GYZA 4I1MA 2F37A 5KCMA 2ETCA 1E8WA 1SW6A 3I3NA 2HYZA 3JCKC 1YYHA 4HLLA 2WXKA 3UKRG 5CCMA 4B94A 4AM9A 5ITZF 1TNZA 2OOEA 1ZBPA 2R02A 3R7QA 1QNFA 2NSZA 5EN5D 4GZ5A 2HO1A 4BERA 1K1BA 4OVUA 2P9LG 3OTNA 3B7BA 3O4ZA 3WG7E 1S64A 3L54A 4UQYA 4OYSA 2OVBA 2AVPA 4AVXA 1K8KG 3MZLB 1JCRA 3ZXPA 2FF4A 3DBSA 4OAVB 1E8XA 5ENSD 1K1AA 1HG2A 2PM7A 3DXMG 3OXLA 1MJ0A 4U0UA 1HZ4A 2X3MA 3P2BA 3PDNA 1MQSA 3HXDA 2XEHA 4AY6A 2GROB 2GRPB 4I43A 2ZGDA 2PQRA 4N39A 1SQMA 4JL0A 4MKTA 3CGHA 4JEHA 3MGBA 1WY6A 4JHJA 4JHRA 5LOZA 4DPRA 4U96D 5EDSA 4LERA 3U3WA 1EDUA 5CEDB 1A5EA 5KJMA 5DIZA 1U3CA 4M7CA 1H0AA 4PS8A 3NOCD 5ENOD 4NIKA 2DWZA 4XI9A 5BXOA 3G2SA 4XZ4A 3ESKA 1O5MA 3WXXA 3FTZA 3ZKJA 2BEDA 2LAHA 4B8CB 1Y8MA 1PAQA 2CFUA 3CVPA 3LYAA 2MOWA 3QOUA 4KT6B 4DRXE 5J90A 4DX7D 3O48A 5ANRA 2WPVA 2V5FA 3CHSA 3GZSA 4AJWA 1RZ4A 4IULA 4B0ZA 5A23A 4KXKB 2P9SG 2IO2C 3ZFWA 4RG6A 1TN8A 3PE4A 3B7RL 4L9PA 3CQGB 2YINA 1PY1A 1N4RA 4WNFA 3Q75A 4JD2G 3Q9NC 2X6IA 3UMVA 2GRNB 4GA1A 5HS0A 3FH7A 5IY5E 3B7SA 1H2UA 4HVBA 2WXRA 4L2YA 3C3RA 5BW8C 4FLHA 3FUFA 4AP2A 1A17A 2KM4A 2XPIA 1WDYA 5C1DA 2WXGA 4P29A 2FEZA 4JXTA 5D2MC 3Q7AA 1FVFA 3UT4A 4GCOA 4C9BB 5JHBA 2XEVA 1TJFA 3UM3A 2GRMA 5FWQA 3CIAA 4HXIA 4UWHA 4HQDA 5KWDA 4A3VA 5T4YA 4IRUA 4DJAA 2IFUA 3UPVA 4XKCA 2X6HA 2NXPA 1O1TA 3UINC 3HXCA 4HBDA 1IYGA 4DX6D 3ZGQA 4A1SA 4FP7A 1N4SA 5EIBE 2ILRA 3NOGD 3LCAA 2ZU6B 5LX8A 4YDEA 3DSSA 4F1PA 1TNBA 2YQ8A 1N4PA 3FU6A 2ZXWE 4UQZA 4JHKA 2V4LA 5CCLA 1D8DA 3PZ3A 2P9UG 2EIME 2VSOE 3SHFA 4LSZE 5FINA 1Z3XA 4WWNA 4AEZC 3EJNA 3G2WA 2IJGX 3KSQA 5KJLA 3BUAA 2VYIA 4HFGA 4X8QA 2MYOA 4GA0A 1N4QA 3L9TA 5EX3A 3HVEB 3Q47B 4TV3A 1N0QA 4W9RA 4UWFA 4ZHBA 4WNEA 4TRQA 3DSUA 3QDNA 5HQ8A 2FI7A 4LNGA 3ZHEB 4EHMA 3PNLB 3C3OA 1ELKA 2L0IA 1MX6A 4G1TA 3TWTA 3MKQA 2PNNA 4ANVA 4KZCA 2B0OE 2DVWA 4K5BA 1IQUA 4GTOA 3ZYMA 4BX9A 4Z68A 1TR4A 3CHQA 1BI7B 3CV0A 3PZDA 1OCCE 4K5CA 5CMYA 5CECB 3QWWA 4G26A 3JYSA 4Y6WA 5AQAA 4U8YD 3IEGA 4GA2A 4HOTA 2H6HA 2PZIA 3TL5A 2RG8A 5C2YA 2XHEA 1MX2A 2OEWA 4Q69A 1QYMA 2E2EA 4NACA 3NBNB 4CYMD 4KZ0A 4YVQC 1E96B 1EYHA 3SBTB 5FZSA 3AAAC 1OWPA 4FHKA 2V8SE 1NI1A 3I4RB 4AXHA 4CGVA 3ZW3A 4DK5A 5AENA 3HVEA 1NA3A 3CLJA 3JQ1A 4JEUA 2P2CP 2GRRB 3CK7A 4ZFHA 2KCLA 2IOSA 3E32A 4GMLA 4J8YA 5CHEE 3ZNGA 3ULEG 4I2WA 1AWCB 5ARGA 3ZHEA 3QK0A 2LSUA 2WQ7A 4H7XA 1SZ9A 1KT1A 5B1BE 3C98A 4GMJA 4ATGA 2VGYA 3ONKA 4J7WA 2J08A 3P1UA 3L82A 4TUMA 2UY1A 3D9LA 4FJYA 2QZAA 1DVPA 1S63A 2R59A 2XCBA 2WM9A 1B89A 3QC1A 3RJVA 5EYLA 4YNDA 1LD7A 3JQ0A 3DXKG 1NA0A 5EYPF 1AP7A 5ENNA 4DUIA 1HXIA 2KBXA 2XGSA 4L7TA 1NFIE 1OXJA 3FH5A 2YHEA 4GAAA 3FTVA 3SI5A 1HE8A 3MEKA 3NZSA 3UM2A 3J5PA 4GZ6A 3C72A 3SQVA 5B3SE 5G04C 4G25A 3FUMA 3MV3B 1TNUA 3PS6A 5KNGA 5LFAA 3TAXA 3E34A 2Y4UA 3SY2A 2QYUA 2L6BA 1OWNA 1H2TC 4GCNA 1O1SA 4YDOA 4CDNA 1TJCA 3JUIA 3SFXA 4U07A 2GRQB 1N11A 2GW1A 4URKA 3CVUA 3ZYQA 5AARA 3L6AA 3QJZA 3RRMB 4O1PA 3RKVA 2XGMA 2BKKB 3NF1A 2KZTA 2RFMA 1Z3YA 1TN7A 4FHJA 4EZLA 2IONA 5AQ7A 3HXEA 2WXFA 5BNWA 4G11A 4ANWA 3IKOB 4ANXA 3JXIA 1TNOA 4U95D 3ZPJA 3ZRHA 4QQIA 3C3QA 4J6IA 4L1BA 3Q4AB 4K0RA 5FZQA 3CK8A 3ASHA 1OWLA 3UUXA 5CBNA 4GPKA 1HH8A 3MJWA 1UW4B 2J8SD 1MX4A 4APFA 3E37A 3BEEA 5FQ7A 3S7FA 4ATZD 3UTMA 3TWRA 2WQ6A 1KPSB 4ANUA 4GB9A 3OXGA 3EIQC 3I4GA 3VTYA 2IY0C 1IXVA 3CKCA 4DX5D 4ILHB 4GTPA 3FTSA 4JW1A 4EZKA 4U0SA 3Q79A 1N54A 3CVVA 4IYPA 3CQCB 3L13A 3S7BA 4FU3A 1JCSA 5AJDA 3TWXA 1BPOA 4XX5A 5E75A 4J8SA 4C0MA 3LS8A 2BKGA 3APDA 1L5JA 4N2SA 1E7UA 5KJNA 2F0YA 1U3DA 3QARA 4WUYA 2WMNA 3AG4E 2XS1A 1HO8A 3SNXA 2R03A 5AQ9A 2LO6A 3ABLE 5FQ4A 1V55E 4HRLA 4L23A 3KEZA 4FULA 3AU4A 3UM1A 1BU9A 3GZ2A 4HRMB 3MV2B 2LUHA 2A4ZA 2XRYA 4TXRA 2DZOA 3PUKA 1O1RA 3RAUA 1HG5A 4KMOA 4I6JA 1OUVA 2HR2A 4R7LA 3TWSA 2RFAA 3B7UX 5EILA 2LXLA 2WXPA 3TJPA 3CHRA 4XIFA 2Y1LE 1N9AA 3LY9A 4RG9A 2ETAA 4L2LA 3QNKA 5D0QD 3SF4A 2XZTG 4XEIG 1X81A 2I2OA 1IKND 2CHXA 3AG2E 2AXUA 4I2ZA 4AOFA 2DZNA 2ZIRA 3PRZA 1JWFA 3MCXA 3ZYKA 3CHPA 5JMND 4A3TA 5FQ6A 4I6EA 3ESLA 2VTBA 3W9GA 1OY3D 4XKBA 3VTXA 1K3ZD 2ETBA 1E7VA 3EHMA 4F7AA 2BTDA 3BG1B 1Q2ZA 2DBAA 2J09A 3CVLA 3ZN3A 2P9NG 2IOLA 2HM8A 3MKQB 3KD7A 4LUNU 5A6CA 3HIZA 1WM5A 4C0EA 2AWIA 2CHWA 5HRYA 1KZPA 2VSYA 2DCPA 5BPPA 1E8YA 3Q73A 4N5QA 3Q9UC 3URZA 3TXMA 3B95A 2WXOA 4EBAA 2X6FA 4JPSA 4I17A 3RK6A 2QYJA 3EU9A 4I9EA 3PNTB 3UT8A 5E76A 2F8XK 3PEUB 5BT1A 3DSWA 3MA5A 5CRVA 3UIOC 3PZ4A 3FUDA 4GYOA 2LSVA 3ASGA 3CVXA 3NAWA 3VLEA 2RD0A 4BTBA 3D9IA 3S7JA 3L22A 4YDWA 4C48B 3DSTA 1UN8A 2VSNA 1P5QA 2B6CA 2R17C 1XNFA 4FLBA 2H6FA 2UWJG 2FBNA 3SFZA 1Z5SC 5HKPA 4UQXA 3UX4A 3SBSA 4E85A 4HLEA 3AS5A 2XENA 2GRLA 3J5QB 1EPUA 3FTWA 1OCOE 3IV0A 3L17A 5M72A 2I1KA
chains in the Genus database with same CATH topology
2X6KA 1E8XA 2LSUA 3LJ3A 1LF8A 4LCTA 2WQ7A 1INZA 1HG2A 1UJKA 2PM7A 3OXLA 3OXFA 4H7XA 1SZ9A 4U0UA 1HZ4A 1KT1A 4IN3B 2X3MA 3P2BA 3FFLA 4PS7A 3C98A 4UWKA 4TUUA 4GMJA 3PDNA 4ATGA 1HF8A 2VGYA 4KVOA 3ONKA 1IQRA 2VGXB 2PL2A 2J08A 3IHYA 4FC8A 5FQ8A 3FEYA 3P1UA 1MQSA 3S7DA 3ZVVA 5ARFA 4AY6A 2AXVA 2UY1A 3FUIA 3D9LA 1JPLA 2CFZA 2V0PA 3CVQA 3FY4A 4FJYA 1HS6A 4I43A 4QFVA 4CCAA 3U4TA 1DVPA 2PQRA 3PVLA 2R59A 2J4BA 2XCBA 2FO7A 3FU3A 4N39A 4PUCA 2WM9A 5EX0A 1SQMA 1B89A 3QC1A 4JL0A 4MKTA 3CGHA 3RJVA 3PH0C 4JEHA 4EPZA 3FTXA 4YNDA 2UY1B 3LXUX 3MGBA 3JQ0A 2GGFA 1WY6A 2QY7A 4JHJA 4PDXA 4ME2A 2L0TB 3OAWA 4I1AA 3ZEFA 3MKRA 2AW6A 4JHRA 1NA0A 3EIJA 5LOZA 3U9WA 4AY5A 4LERA 4DPRA 1EDUA 5EDSA 3U3WA 2WVIA 5M72A 3FUKA 5DIZA 1U3CA 5ENNA 5KJMA 4WAFA 1HXIA 1H0AA 5AJLA 2XGSA 3IHVA 4PS8A 4L7TA 1SZAA 3FH5A 2YHEA 4GAAA 3FTVA 3SI5A 4XI9A 1ELWA 2WQHA 3D9NA 1HE8A 3MEKA 3NZSA 4N3CA 3G2SA 3R7RA 4XZ4A 2WXLA 3ESKA 3ZYLA 4GZ6A 4LEUA 3WXXA 2BUGA 5LCWJ 3FTZA 5JJTA 5G04C 4J8EA 4G25A 2LAHA 4B8CB 3FUMA 1H19A 3MV3B 1Y8MA 3D9MA 3PEVB 3B7TA 1ZU2A 3PS6A 3T8MA 5LFAA 3HYMB 3TAXA 2Y4UA 2I9CA 4NQ0A 1PAQA 2CFUA 3CVPA 3LYAA 4NURA 2MOWA 3QOUA 1WAO1 4KT6B 3IBEA 4CRWA 5LCWC 3ULQA 5J90A 2J4DA 3QWVA 1UN9A 4UWGA 3RIBA 1OWNA 4U0ZA 1H2TC 1X5BA 1N52A 3RRUA 3O48A 4GCNA 4AIFA 4CDNA 1TJCA 2WPVA 5ANRA 1H6KA 2V5FA 3CHSA 3GZSA 3JUIA 4F53A 4U07A 1DNPA 4AJWA 2GW1A 4URKA 4IULA 3Q5MA 3CVUA 1GW6A 4U8HA 4B0ZA 3FUEA 3ZYQA 5A23A 3D9JA 4EQFA 3NQPA 3L6AA 3T5XA 3QJZA 4PS3A 4KXKB 2Y3AA 3RRMB 3MYVA 4N5CA 3RKVA 1ELRA 2M63A 3ZFWA 5BUZA 2XGMA 4ILIA 3N71A 2JLBA 3NF1A 4RG6A 3SD5A 2I1JA 2KZTA 3KS2A 4ABNA 3PE4A 1S0PA 3B7RL 1Z3YA 2VSXE 2WXNA 3LY8A 4FHJA 5FT9A 3CQGB 4CDRA 3CR3A 2IONA 4EZLA 1JWGA 3FU0A 2YINA 1PY1A 3MX3A 2E0IA 4WNFA 5JHBA 2VGXA 2WXFA 5LP0A 5AIJA 3GZ1A 2KZTB 5BNWA 4G11A 3QK0A 4ANWA 2ONDA 2X6IA 3UMVA 3IKOB 4ANXA 3CVWA 2CG3A 5JJ7A 4GA1A 3ONLA 5FZRA 2KATA 3FH7A 2J07A 3B7SA 1H2UA 1KT0A 4HOUA 4BTAA 3ZPJA 2KCKA 3ZRHA 4FJZA 4G24A 2WXRA 2X38A 4L2YA 4HVBA 4B8AA 5BW8C 4FLHA 3LDZA 3QKYA 3FUFA 1NP7A 4J6IA 5EKQD 2WMOA 4GYYA 5JJ6A 4L1BA 3Q4AB 1A17A 4K0RA 4AP2A 5FZQA 3CK8A 3ASHA 2OVFA 4BWRA 2KM4A 1OWLA 2XPIA 3QWPA 5ANLA 5C1DA 3UUXA 2JEKA 2WXGA 3CVYA 4DLQA 3T5VA 4P29A 3CHMA 2FEZA 4GPKA 1HH8A 3MJWA 1UW4B 2WB2A 1PC2A 3SGHA 5AYWD 4JXTA 1UJJA 4XI0A 3VLDA 4APFA 3BEEA 5FQ7A 5KJKA 3S7FA 2WQ6A 1VDYA 1FVFA 3D9KA 3UT4A 1W3BA 4GCOA 4GB9A 4ANUA 3OXGA 3EIQC 2XEVA 1TJFA 4C9BB 2GRMA 5FWQA 3I4GA 3PUJA 4U04A 4WNGA 5A7DB 3CIAA 3VTYA 2XRZA 4GYWA 3CKCA 4HXIA 4KYOB 4UWHA 4ILHB 2IQCA 3QAQA 3FTSA 4JW1A 3K9IA 4RSYA 4J8FA 1Y6IA 4EZKA 4CT4A 4U0SA 4XE0A 5T8IA 4A3VA 2PQNA 5T4YA 4IRUA 1N54A 4HOSA 3CVVA 4BT9A 4IYPA 2CHZA 2IFUA 3ML8A 4DJAA 4E6HA 2DIWA 3CQCB 3D9OA 3L13A 3ASFA 2XCCA 4JZYA 3UPVA 4XKCA 2X6HA 3S7BA 5J08A 2NXPA 3CHOA 4FU3A 5AJDA 4WWPA 1BPOA 4XX5A 5E75A 5FJYA 5FTPA 3UT7A 3S2AA 4AV7A 1IYGA 4J8SA 3FWVA 4GZDA 4C0MA 2BF0X 2J49A 5D0OD 3ZGQA 4A1SA 2LNIA 4FP7A 4KVMA 3HDXA 3L16A 4UI9K 2ILRA 4Q96A 4HOQA 3LS8A 3L08A 3APDA 1L5JA 3ZIMA 4N2SA 3LCAA 4DI4A 1E7UA 2ZU6B 5KJNA 4DI3A 1U3DA 3QARA 4WUYA 2IU1A 2WMNA 5G55A 4I6GA 5LX8A 5BV1A 1HO8A 3SNXA 1QZ2A 3HHMA 2LO6A 1MHQA 2YHCA 4O6FA 4B89A 5FQ4A 4BX8A 2YQ8A 3ZXSA 4OVVA 3FH8A 3EDTB 4L23A 3KEZA 1E90A 3LKUA 4FULA 3AU4A 3FU6A 3GZ2A 4MLPA 4BY6A 3VLFA 4HORA 2XQ0A 3MV2B 4UQZA 3RO3A 4JHKA 4EZJA 1YA0A 2A4ZA 2V4LA 2XRYA 4N3BA 1IHGA 4ILGA 4UI9J 5CCLA 3D9PA 1HX8A 3PUKA 2C0LA 2L9BA 1HG5A 2Y4TA 2L6JA 4BSXA 2C0MA 4KMOA 3GW4A 2VSOE 1OUVA 4I6JA 1HFAA 2WXHA 4DLOA 3G2TA 2HR2A 3SHFA 4R7LA 2Q7FA 3FUHA 4N3AA 4FA6A 5CMWA 4BT8A 1Z3XA 4WWNA 4ACLA 2WXJA 3B7UX 4MS6A 4AEZC 3EJNA 3PREA 3LVQE 3G2WA 4YVOA 3KAEA 4UI9C 1JUQA 2FULA 2IJGX 2WXPA 3TJPA 3CHRA 3TG4A 1Z6TA 4XIFA 5KJLA 3LY9A 2XPZA 4EBAG 4RG9A 3LY7A 2VYIA 4EECA 4L2LA 3QNKA 4HFGA 5D0QD 1FCHA 2KCVA 4MRUA 3SF4A 4CT0A 4GA0A 3TGOA 2I2OA 3CVNA 3Q49B 1OWOA 5EX3A 3HVEB 3Q47B 4K03A 2CHXA 1FVHA 3CSTA 4TV3A 3U66A 2J9QA 2WXIA 2AXUA 4I2ZA 3SZ7A 3FHEA 4W9RA 4AOFA 4UWFA 4WNDA 4BFRA 4LRZA 4WNEA 2IF4A 3UQ3A 5HI7A 4TRQA 2I6HA 3G2UA 3QDNA 3PRZA 3DPDA 4JA7A 4NRHB 5HQ8A 4V3IA 1JWFA 2MHKA 3ASDA 3LPZA 3MCXA 4G2VA 3CHPA 2FI7A 3ENEA 3ZYKA 4ACKA 4I1OB 4RVBA 3ZHEB 4A3TA 3NZUA 3PNLB 4U63A 5FQ6A 4I6EA 1ELKA 3ESLA 4G23A 4D10C 2VTBA 2L0IA 4XKBA 4G1TA 3VTXA 1NZNA 3TXNA 4J0UA 1E7VA 2CG2A 3FUJA 3EHMA 3MKQA 3EHNA 3CKBA 4A1GA 4F7AA 2BTDA 3BG1B 4J8DA 3QB2A 4ANVA 3FU5A 2DBAA 4KZCA 2XGOA 2J09A 4KBQA 2KC7A 3CVLA 3ZN3A 2VTBB 4UWLA 1IQUA 2AXZA 4APOA 1KLXA 2IOLA 2HM8A 3MKQB 5G05J 3E4BA 2R5SA 3KD7A 1HU3A 3ZYMA 4BX9A 4LUNU 2VJ8A 2EQXA 2X6JA 3AU5A 3R9AB 3HIZA 3CHQA 5A6CA 1WM5A 2QFCA 5DBKA 4C0EA 4GZ3A 2AWIA 2CHWA 4H7YA 3TG5A 3FTUA 3Q15A 5G04J 3CV0A 3PZDA 2WXMA 5CMYA 2P58C 4M3OA 4PH4B 3QWWA 1QQEA 2OV8A 2VSYA 4G26A 3APCA 3FDHA 4F3VA 2DCPA 5G05C 2C2LA 1E8ZA 1E8YA 3FUNA 5BPPA 3JYSA 4A55A 2NC9A 3RO2A 3URZA 3TXMA 4Y6WA 5JHAA 2WXOA 3CSFA 4EBAA 2X6FA 3FTYA 3AS8A 4JPSA 3G2VA 2LAIA 3IEGA 4I17A 4Y6CA 3RK6A 4GA2A 2WXQA 1XGWA 2PM6A 3D3MA 4I9CA 4I9EA 4CEMA 4HOTA 3PNTB 2VQ2A 2PZIA 3UT8A 5E76A 2YNQA 3TL5A 3PEUB 5BT1A 4WWOA 3MA5A 2RG8A 1EF1C 3GYZA 4GU5A 4I1MA 4JA9A 3FULA 3FUDA 5KCMA 5C2YA 1E8WA 3I3NA 2HYZA 2XHEA 4GYOA 2LSVA 3JCKC 3ASGA 3CVXA 4Q69A 1OWMA 3VLEA 3CEQA 2WXKA 2RD0A 4BTBA 4HS2A 5CCMA 2E2EA 4NACA 4KZ0A 3PE3A 4B94A 3B13A 2XPYA 3D9IA 3S7JA 4YVQC 4AM9A 1E96B 1EYHA 2OOEA 3LEWA 5G2NA 1ZBPA 5FZSA 3SBTB 3L22A 4GZCA 3U64A 3R7QA 1OWPA 1QNFA 4FHKA 2V8SE 3I4RB 3RRNB 2NSZA 4AXHA 1UN8A 4GZ5A 4CGVA 3APFA 2HO1A 3ZW3A 4CDMA 2A5UA 5BV0A 2VSNA 3LVRE 4DK5A 1P5QA 3ML9A 4N2QA 2R17C 3RU0A 1XNFA 4OVUA 5AENA 4FLBA 2UWJG 3OTNA 1TEZA 3HVEA 2FBNA 1NA3A 3CLJA 3JQ1A 4JEUA 3SFZA 4UQXA 3UX4A 4JC8A 5T3RA 3O4ZA 4Q94A 4FADA 3CK7A 3L54A 3SBSA 2KCLA 3AS4A 4E85A 2IOSA 4HLEA 3AS5A 4CGWA 4JVSA 4UQYA 2GRLA 3I5PA 2OVBA 4GMLA 1EPUA 2AVPA 4OYSA 3CK9A 4AVXA 5CHEE 3FTWA 3MZLB 4F1SA 4I2WA 3BG0B 1H2VC 3FP3A 2FF4A 3DBSA 3IV0A 2MRIA 3FEXA 3L17A 5ARGA 3ZHEA 1UG3A 2I1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSU A;  3OXL A;  3OXF A;  4H7X A;  4U0U A;  1HZ4 A;  1KT1 A;  4IN3 B;  3FFL A;  3PDN A;  2VGY A;  2VGX B;  2PL2 A;  3S7D A;  4AY6 A;  5ARF A;  2UY1 A;  3CVQ A;  3U4T A;  2PQR A;  2XCB A;  4N39 A;  2FO7 A;  5EX0 A;  1B89 A;  3RJV A;  4JL0 A;  4YND A;  2UY1 B;  4ME2 A;  4I1A A;  3MKR A;  4JHR A;  1NA0 A;  4AY5 A;  3U3W A;  5KJM A;  5DIZ A;  1HXI A;  2XGS A;  4XI9 A;  1ELW A;  2WQH A;  3MEK A;  4N3C A;  3ESK A;  4GZ6 A;  4LEU A;  3WXX A;  2BUG A;  5LCW J;  5JJT A;  5G04 C;  4J8E A;  4G25 A;  3MV3 B;  1Y8M A;  1ZU2 A;  3HYM B;  3TAX A;  2Y4U A;  4NQ0 A;  3LYA A;  3CVP A;  3QOU A;  1WAO 1;  5LCW C;  3ULQ A;  3QWV A;  3RIB A;  4U0Z A;  3O48 A;  4GCN A;  4AIF A;  1TJC A;  2WPV A;  2V5F A;  4U07 A;  2GW1 A;  3Q5M A;  4EQF A;  4KXK B;  4N5C A;  3RKV A;  1ELR A;  3ZFW A;  2XGM A;  3N71 A;  2JLB A;  3NF1 A;  4RG6 A;  3KS2 A;  4ABN A;  3PE4 A;  3LY8 A;  5FT9 A;  4CDR A;  4WNF A;  2VGX A;  3GZ1 A;  5BNW A;  2OND A;  5JJ7 A;  4GA1 A;  5FZR A;  2KAT A;  1KT0 A;  4HOU A;  4BTA A;  3ZPJ A;  2KCK A;  4G24 A;  5BW8 C;  3QKY A;  5EKQ D;  4GYY A;  5JJ6 A;  3Q4A B;  1A17 A;  5FZQ A;  3CK8 A;  3ASH A;  4BWR A;  2XPI A;  3QWP A;  5C1D A;  3UUX A;  2FEZ A;  4GPK A;  1HH8 A;  1PC2 A;  5AYW D;  4XI0 A;  3BEE A;  5KJK A;  3S7F A;  1W3B A;  4GCO A;  3OXG A;  2XEV A;  5A7D B;  4U04 A;  4WNG A;  3VTY A;  4GYW A;  3CKC A;  4KYO B;  3K9I A;  4J8F A;  4U0S A;  2PQN A;  4HOS A;  4BT9 A;  2IFU A;  3ASF A;  2XCC A;  3UPV A;  3S7B A;  5FJY A;  5FTP A;  1IYG A;  3FWV A;  5D0O D;  3ZGQ A;  4A1S A;  2LNI A;  4UI9 K;  4HOQ A;  4N2S A;  3LCA A;  5KJN A;  4WUY A;  1QZ2 A;  2YHC A;  4O6F A;  2YQ8 A;  3EDT B;  3LKU A;  3GZ2 A;  4HOR A;  3MV2 B;  4UQZ A;  3RO3 A;  1YA0 A;  4N3B A;  1IHG A;  4UI9 J;  5CCL A;  2C0L A;  2Y4T A;  2L6J A;  2C0M A;  3GW4 A;  1OUV A;  2HR2 A;  2Q7F A;  4N3A A;  4BT8 A;  4YVO A;  3KAE A;  4UI9 C;  3TG4 A;  4XIF A;  5KJL A;  3LY9 A;  4RG9 A;  3LY7 A;  2VYI A;  5D0Q D;  1FCH A;  2KCV A;  3SF4 A;  4GA0 A;  3TGO A;  3CVN A;  3Q49 B;  5EX3 A;  3Q47 B;  2J9Q A;  4I2Z A;  3SZ7 A;  4W9R A;  4WND A;  4WNE A;  2IF4 A;  3UQ3 A;  5HI7 A;  2I6H A;  3QDN A;  4JA7 A;  4NRH B;  5HQ8 A;  3ASD A;  2MHK A;  3LPZ A;  4G2V A;  2FI7 A;  3ZHE B;  4G23 A;  4G1T A;  3VTX A;  1NZN A;  4J0U A;  3CKB A;  4J8D A;  2DBA A;  2XGO A;  4KBQ A;  2KC7 A;  3CVL A;  3ZN3 A;  4APO A;  1KLX A;  5G05 J;  3E4B A;  2R5S A;  3KD7 A;  3R9A B;  5A6C A;  1WM5 A;  2QFC A;  5DBK A;  4GZ3 A;  4H7Y A;  3TG5 A;  3Q15 A;  5G04 J;  3CV0 A;  2P58 C;  3QWW A;  1QQE A;  2VSY A;  4G26 A;  4F3V A;  5G05 C;  2C2L A;  3JYS A;  2NC9 A;  3RO2 A;  3URZ A;  4Y6W A;  3AS8 A;  3IEG A;  4I17 A;  4Y6C A;  4GA2 A;  4HOT A;  4I9E A;  4I9C A;  2VQ2 A;  2PZI A;  5BT1 A;  3MA5 A;  3GYZ A;  4JA9 A;  4GYO A;  2HYZ A;  2LSV A;  3ASG A;  3CEQ A;  4BTB A;  5CCM A;  2E2E A;  4B94 A;  3PE3 A;  3S7J A;  4AM9 A;  4YVQ C;  1E96 B;  2OOE A;  1ZBP A;  5FZS A;  4GZ5 A;  4CGV A;  2HO1 A;  2VSN A;  1P5Q A;  4N2Q A;  3RU0 A;  1XNF A;  2UWJ G;  2FBN A;  1NA3 A;  4UQX A;  3CK7 A;  2KCL A;  3AS4 A;  3AS5 A;  4CGW A;  4UQY A;  2AVP A;  3CK9 A;  5CHE E;  4I2W A;  3FP3 A;  2FF4 A;  5ARG A;  3ZHE A;  5M72 A; 
#chains in the Genus database with same CATH topology
 4LCT A;  1INZ A;  3OXF A;  4IN3 B;  3ASO E;  1JCQ A;  5JA4 D;  4TUU A;  2A5E A;  1IQR A;  2PL2 A;  3S7D A;  5ARF A;  3FUI A;  1JPL A;  2CFZ A;  3FY4 A;  1HS6 A;  4CCA A;  3U4T A;  3PVL A;  4PUC A;  2FO7 A;  5EX0 A;  4GTS A;  1DCE A;  3KSL A;  3PH0 C;  3E33 A;  4EPZ A;  3FTX A;  2UY1 B;  3LXU X;  2GGF A;  1LTX A;  2QY7 A;  3ABK E;  3EUV A;  3OAW A;  4PDX A;  3ZEF A;  3MKR A;  3U9W A;  3EIJ A;  4AY5 A;  2WVI A;  1N0R A;  3IHV A;  2V5Q C;  5KNH D;  2R2L A;  1BLX B;  4N3C A;  2WXL A;  4LEU A;  5LCW J;  3T9K A;  5JJT A;  2P9P G;  3UI2 A;  3PZ1 A;  4J8E A;  1H19 A;  3PEV B;  1ZU2 A;  3HYM B;  2I9C A;  4NUR A;  1FPP A;  3V2O A;  1WAO 1;  5ENT D;  3AJI A;  5CRU A;  3ULQ A;  2J4D A;  3QWV A;  5ENP D;  3RIB A;  4UWG A;  1N52 A;  4AIF A;  4F53 A;  3Q5M A;  4U8H A;  1WG0 A;  3FUE A;  4HI8 A;  2Y3A A;  4N5C A;  1ELR A;  5BUZ A;  4ILI A;  3N71 A;  3KS2 A;  4GTR A;  4ABN A;  1S0P A;  4B93 B;  2WXN A;  5FT9 A;  4CDR A;  3CR3 A;  1QBQ A;  3FU0 A;  3MX3 A;  5LP0 A;  5AIJ A;  3EU5 A;  2KZT B;  3GZ1 A;  2OND A;  1ZB1 A;  3CVW A;  2CG3 A;  5JJ7 A;  5FZR A;  5BXU A;  2KAT A;  2X38 A;  4B8A A;  5EKQ D;  2Y0B G;  3AG3 E;  5ANL A;  2JEK A;  3CVY A;  3T5V A;  3CHM A;  4HB5 A;  1PC2 A;  5KJK A;  3V79 K;  1OCZ E;  1VDY A;  3D9K A;  3PUJ A;  4U04 A;  4WNG A;  4MBG A;  2IQC A;  3QAQ A;  4A63 B;  3K9I A;  4J8F A;  1Y6I A;  2KXP C;  5T8I A;  4BT9 A;  4E6H A;  2DIW A;  4BEP A;  3ASF A;  4GPM A;  2XCC A;  3ZU7 B;  4WWP A;  4AV7 A;  3S2A A;  2BF0 X;  2J49 A;  3EHR A;  4KVM A;  1UOH A;  4BES A;  3L08 A;  3ZIM A;  4DI4 A;  4DI3 A;  5G55 A;  2FO1 E;  4I6G A;  5BV1 A;  1QZ2 A;  3HHM A;  2AJA A;  4O6F A;  4B89 A;  4BX8 A;  3ZXS A;  1MZC A;  3LKU A;  1DC2 A;  2F8Y A;  2XS8 A;  4TXP A;  4MLP A;  4BY6 A;  3VLF A;  3RO3 A;  2IO3 C;  4O1O A;  1G3N B;  4N3B A;  5AN8 A;  3T8K A;  4ILG A;  4UI9 J;  3D9P A;  3UM0 A;  2L9B A;  2Y4T A;  2L6J A;  2C0M A;  4UUC A;  1HFA A;  3G2T A;  2Q7F A;  3FUH A;  4N3A A;  4FA6 A;  5CMW A;  2DYS E;  4BT8 A;  1FT2 A;  2WXJ A;  1JUQ A;  3TG4 A;  2XPZ A;  4EEC A;  1FCH A;  2KCV A;  3F6Q A;  4MRU A;  2OEV A;  4CT0 A;  3TGO A;  3CVN A;  3Q49 B;  1FVH A;  3CST A;  3U66 A;  2J9Q A;  4RLY A;  4GTV A;  3FHE A;  4LRZ A;  3UQ3 A;  4JA7 A;  4V3I A;  3ASD A;  3LPZ A;  3D9H A;  4O60 A;  4D10 C;  2NYJ A;  3TXN A;  4J0U A;  4BET A;  4A1G A;  3CKB A;  3QB2 A;  3FU5 A;  2LXM A;  2KC7 A;  2VTB B;  2IEJ A;  2AXZ A;  4U8V D;  5CBO A;  5G05 J;  3E4B A;  2R5S A;  1HU3 A;  2EQX A;  5B1A E;  2X6J A;  3AU5 A;  4RQI A;  4G8K A;  2VGE A;  3KEA A;  4H7Y A;  3Q15 A;  5G04 J;  2P58 C;  1SVX A;  1QQE A;  2OV8 A;  3APC A;  3FDH A;  1BI8 B;  4F3V A;  2C2L A;  1E8Z A;  3FUN A;  3TWU A;  2NC9 A;  3ULY A;  2XEE A;  4HNA D;  3AS8 A;  3G2V A;  4Y6C A;  3Q78 A;  3DWL G;  3D3M A;  2PM6 A;  4I9C A;  3TWQ A;  2VQ2 A;  4JB8 P;  2YNQ A;  4WWO A;  3ZUV B;  1EF1 C;  4GU5 A;  1NL4 A;  4JA9 A;  3FUL A;  2HE0 A;  1OWM A;  3CEQ A;  4HS2 A;  3HXF A;  3PE3 A;  3B13 A;  2XPY A;  3LEW A;  5G2N A;  3U64 A;  4GZC A;  4HRN A;  5ENR D;  3RRN B;  3APF A;  4CDM A;  5BV0 A;  2A5U A;  5ENQ D;  3LVR E;  3ML9 A;  4N2Q A;  3RU0 A;  1TEZ A;  4JC8 A;  1YCS B;  5T3R A;  4Q94 A;  4FAD A;  4K5A B;  3AS4 A;  4CGW A;  4JVS A;  3I5P A;  3CK9 A;  3BQO A;  2EIL E;  4F1S A;  3BG0 B;  3HG0 D;  1H2V C;  1OT8 A;  3FP3 A;  2MRI A;  3FEX A;  1UG3 A;  2X6K A;  3LJ3 A;  1LF8 A;  1UJK A;  5H7P A;  3TWV A;  3FFL A;  4PS7 A;  4UWK A;  3E30 A;  1HF8 A;  2ZGG A;  4KVO A;  2VGX B;  2H6G A;  3IHY A;  5FQ8 A;  4FC8 A;  3FEY A;  3HXB A;  5AAO A;  3ZVV A;  2AXV A;  2V0P A;  3CVQ A;  4QFV A;  1S70 B;  3FU3 A;  2J4B A;  2EIK E;  3SO8 A;  4ME2 A;  2L0T B;  4I1A A;  1RW2 A;  2AW6 A;  2Y69 E;  3FUK A;  3ASN E;  4WAF A;  5AJL A;  3X2Q E;  1SZA A;  2P9K G;  1ELW A;  2WQH A;  3D9N A;  3R7R A;  4TXQ A;  3ZYL A;  5CEA A;  2H6I A;  2BUG A;  3D9M A;  3B7T A;  3T8M A;  4NQ0 A;  1KZO A;  3IBE A;  4CRW A;  5LCW C;  2P9I G;  3V30 A;  1N95 A;  1UN9 A;  4U0Z A;  1X5B A;  3RRU A;  1H6K A;  1DCQ A;  1DNP A;  4U7E B;  1GW6 A;  3D9J A;  4EQF A;  3NQP A;  3T5X A;  4PS3 A;  3MYV A;  2M63 A;  2JLB A;  3SD5 A;  2I1J A;  3DPY A;  4F6R D;  2VSX E;  3LY8 A;  4OAU C;  1JWG A;  2E0I A;  2VGX A;  1SA4 A;  3ONL A;  2J07 A;  1KT0 A;  4LNB A;  4HOU A;  4BTA A;  2KCK A;  4FJZ A;  4G24 A;  2R05 A;  3ISM C;  3LDZ A;  3QKY A;  4GTQ A;  1NP7 A;  2WMO A;  4GYY A;  5JJ6 A;  2OVF A;  4BWR A;  4G8L A;  3QWP A;  1FT1 A;  4DLQ A;  5AQB A;  4DX2 A;  2WB2 A;  3SGH A;  5AYW D;  4XI0 A;  1UJJ A;  3VLD A;  3ABM E;  4YDY A;  3BU8 A;  1W3B A;  5A7D B;  3PZ2 A;  2XRZ A;  4GYW A;  4KYO B;  5CER B;  4BSZ B;  4RSY A;  4CT4 A;  4XE0 A;  2PQN A;  4HOS A;  2CHZ A;  3ML8 A;  3D9O A;  4JZY A;  4GTT A;  5J08 A;  3CHO A;  5FJY A;  5FTP A;  3UT7 A;  3FWV A;  4GZD A;  2RKK A;  3DSV A;  5EID A;  5D0O D;  2LNI A;  3HDX A;  3L16 A;  4UI9 K;  1H6O A;  4Q96 A;  4HOQ A;  2IU1 A;  1MHQ A;  2YHC A;  1SA5 A;  2QC9 A;  4OVV A;  1LD8 A;  3FH8 A;  3EDT B;  1E90 A;  3LJN A;  3R9M A;  4LNU D;  1IHB A;  4HOR A;  2XQ0 A;  3AG1 E;  3HRA A;  4EZJ A;  1YA0 A;  3JXJ A;  1IHG A;  1TN6 A;  1HX8 A;  2C0L A;  4BSX A;  3GW4 A;  4DLO A;  2WXH A;  3JUE A;  4GTM A;  4DX1 A;  4ACL A;  4LG6 A;  4MS6 A;  1TYQ G;  3PRE A;  3UKU G;  3LVQ E;  4YVO A;  3KAE A;  4UI9 C;  2FUL A;  1OCR E;  4HI9 A;  1Z6T A;  1D8E A;  4EBA G;  3LY7 A;  3TWW A;  1V54 E;  1U2V G;  2XZD G;  3SFY A;  1OWO A;  4K03 A;  3IXE A;  2WXI A;  3SZ7 A;  4WND A;  2JAB A;  4BFR A;  2IF4 A;  5HI7 A;  2I6H A;  3G2U A;  3DPD A;  4NRH B;  2MHK A;  4G2V A;  4ACK A;  3ENE A;  4I1O B;  4RVB A;  3Q7F A;  3NZU A;  4U63 A;  1N94 A;  4G23 A;  1NZN A;  1MYO A;  2CG2 A;  3FUJ A;  3EHN A;  3UIP C;  4J8D A;  2XGO A;  2ZIS A;  4KBQ A;  4UWL A;  5FIO A;  1D9S A;  4APO A;  1KLX A;  3V2X A;  3DEO A;  5KBA A;  2VJ8 A;  3R9A B;  2QFC A;  5DBK A;  1BD8 A;  4GZ3 A;  1TNY A;  3RSE G;  3TG5 A;  3FTU A;  3DEP A;  4GMR A;  2WXM A;  4M3O A;  4PH4 B;  2EIJ E;  3EHQ A;  3DRA A;  1YMP A;  3NB2 A;  5G05 C;  2DYR E;  4A55 A;  2OCC E;  3RO2 A;  5JHA A;  3W9F A;  3CSF A;  3FTY A;  4CZ2 D;  2V4H C;  2LAI A;  5D66 A;  1H6P A;  2WXQ A;  3DSX A;  1XGW A;  2EIN E;  4CEM A;  3C5R A;  3V31 A;  3UXG A;  3GYZ A;  4I1M A;  2F37 A;  5KCM A;  2ETC A;  1E8W A;  1SW6 A;  3I3N A;  2HYZ A;  3JCK C;  1YYH A;  4HLL A;  2WXK A;  3UKR G;  5CCM A;  4B94 A;  4AM9 A;  5ITZ F;  1TNZ A;  2OOE A;  1ZBP A;  2R02 A;  3R7Q A;  1QNF A;  2NSZ A;  5EN5 D;  4GZ5 A;  2HO1 A;  4BER A;  1K1B A;  4OVU A;  2P9L G;  3OTN A;  3B7B A;  3O4Z A;  3WG7 E;  1S64 A;  3L54 A;  4UQY A;  4OYS A;  2OVB A;  2AVP A;  4AVX A;  1K8K G;  3MZL B;  1JCR A;  3ZXP A;  2FF4 A;  3DBS A;  4OAV B;  1E8X A;  5ENS D;  1K1A A;  1HG2 A;  2PM7 A;  3DXM G;  3OXL A;  1MJ0 A;  4U0U A;  1HZ4 A;  2X3M A;  3P2B A;  3PDN A;  1MQS A;  3HXD A;  2XEH A;  4AY6 A;  2GRO B;  2GRP B;  4I43 A;  2ZGD A;  2PQR A;  4N39 A;  1SQM A;  4JL0 A;  4MKT A;  3CGH A;  4JEH A;  3MGB A;  1WY6 A;  4JHJ A;  4JHR A;  5LOZ A;  4DPR A;  4U96 D;  5EDS A;  4LER A;  3U3W A;  1EDU A;  5CED B;  1A5E A;  5KJM A;  5DIZ A;  1U3C A;  4M7C A;  1H0A A;  4PS8 A;  3NOC D;  5ENO D;  4NIK A;  2DWZ A;  4XI9 A;  5BXO A;  3G2S A;  4XZ4 A;  3ESK A;  1O5M A;  3WXX A;  3FTZ A;  3ZKJ A;  2BED A;  2LAH A;  4B8C B;  1Y8M A;  1PAQ A;  2CFU A;  3CVP A;  3LYA A;  2MOW A;  3QOU A;  4KT6 B;  4DRX E;  5J90 A;  4DX7 D;  3O48 A;  5ANR A;  2WPV A;  2V5F A;  3CHS A;  3GZS A;  4AJW A;  1RZ4 A;  4IUL A;  4B0Z A;  5A23 A;  4KXK B;  2P9S G;  2IO2 C;  3ZFW A;  4RG6 A;  1TN8 A;  3PE4 A;  3B7R L;  4L9P A;  3CQG B;  2YIN A;  1PY1 A;  1N4R A;  4WNF A;  3Q75 A;  4JD2 G;  3Q9N C;  2X6I A;  3UMV A;  2GRN B;  4GA1 A;  5HS0 A;  3FH7 A;  5IY5 E;  3B7S A;  1H2U A;  4HVB A;  2WXR A;  4L2Y A;  3C3R A;  5BW8 C;  4FLH A;  3FUF A;  4AP2 A;  1A17 A;  2KM4 A;  2XPI A;  1WDY A;  5C1D A;  2WXG A;  4P29 A;  2FEZ A;  4JXT A;  5D2M C;  3Q7A A;  1FVF A;  3UT4 A;  4GCO A;  4C9B B;  5JHB A;  2XEV A;  1TJF A;  3UM3 A;  2GRM A;  5FWQ A;  3CIA A;  4HXI A;  4UWH A;  4HQD A;  5KWD A;  4A3V A;  5T4Y A;  4IRU A;  4DJA A;  2IFU A;  3UPV A;  4XKC A;  2X6H A;  2NXP A;  1O1T A;  3UIN C;  3HXC A;  4HBD A;  1IYG A;  4DX6 D;  3ZGQ A;  4A1S A;  4FP7 A;  1N4S A;  5EIB E;  2ILR A;  3NOG D;  3LCA A;  2ZU6 B;  5LX8 A;  4YDE A;  3DSS A;  4F1P A;  1TNB A;  2YQ8 A;  1N4P A;  3FU6 A;  2ZXW E;  4UQZ A;  4JHK A;  2V4L A;  5CCL A;  1D8D A;  3PZ3 A;  2P9U G;  2EIM E;  2VSO E;  3SHF A;  4LSZ E;  5FIN A;  1Z3X A;  4WWN A;  4AEZ C;  3EJN A;  3G2W A;  2IJG X;  3KSQ A;  5KJL A;  3BUA A;  2VYI A;  4HFG A;  4X8Q A;  2MYO A;  4GA0 A;  1N4Q A;  3L9T A;  5EX3 A;  3HVE B;  3Q47 B;  4TV3 A;  1N0Q A;  4W9R A;  4UWF A;  4ZHB A;  4WNE A;  4TRQ A;  3DSU A;  3QDN A;  5HQ8 A;  2FI7 A;  4LNG A;  3ZHE B;  4EHM A;  3PNL B;  3C3O A;  1ELK A;  2L0I A;  1MX6 A;  4G1T A;  3TWT A;  3MKQ A;  2PNN A;  4ANV A;  4KZC A;  2B0O E;  2DVW A;  4K5B A;  1IQU A;  4GTO A;  3ZYM A;  4BX9 A;  4Z68 A;  1TR4 A;  3CHQ A;  1BI7 B;  3CV0 A;  3PZD A;  1OCC E;  4K5C A;  5CMY A;  5CEC B;  3QWW A;  4G26 A;  3JYS A;  4Y6W A;  5AQA A;  4U8Y D;  3IEG A;  4GA2 A;  4HOT A;  2H6H A;  2PZI A;  3TL5 A;  2RG8 A;  5C2Y A;  2XHE A;  1MX2 A;  2OEW A;  4Q69 A;  1QYM A;  2E2E A;  4NAC A;  3NBN B;  4CYM D;  4KZ0 A;  4YVQ C;  1E96 B;  1EYH A;  3SBT B;  5FZS A;  3AAA C;  1OWP A;  4FHK A;  2V8S E;  1NI1 A;  3I4R B;  4AXH A;  4CGV A;  3ZW3 A;  4DK5 A;  5AEN A;  3HVE A;  1NA3 A;  3CLJ A;  3JQ1 A;  4JEU A;  2P2C P;  2GRR B;  3CK7 A;  4ZFH A;  2KCL A;  2IOS A;  3E32 A;  4GML A;  4J8Y A;  5CHE E;  3ZNG A;  3ULE G;  4I2W A;  1AWC B;  5ARG A;  3ZHE A;  3QK0 A;  2LSU A;  2WQ7 A;  4H7X A;  1SZ9 A;  1KT1 A;  5B1B E;  3C98 A;  4GMJ A;  4ATG A;  2VGY A;  3ONK A;  4J7W A;  2J08 A;  3P1U A;  3L82 A;  4TUM A;  2UY1 A;  3D9L A;  4FJY A;  2QZA A;  1DVP A;  1S63 A;  2R59 A;  2XCB A;  2WM9 A;  1B89 A;  3QC1 A;  3RJV A;  5EYL A;  4YND A;  1LD7 A;  3JQ0 A;  3DXK G;  1NA0 A;  5EYP F;  1AP7 A;  5ENN A;  4DUI A;  1HXI A;  2KBX A;  2XGS A;  4L7T A;  1NFI E;  1OXJ A;  3FH5 A;  2YHE A;  4GAA A;  3FTV A;  3SI5 A;  1HE8 A;  3MEK A;  3NZS A;  3UM2 A;  3J5P A;  4GZ6 A;  3C72 A;  3SQV A;  5B3S E;  5G04 C;  4G25 A;  3FUM A;  3MV3 B;  1TNU A;  3PS6 A;  5KNG A;  5LFA A;  3TAX A;  3E34 A;  2Y4U A;  3SY2 A;  2QYU A;  2L6B A;  1OWN A;  1H2T C;  4GCN A;  1O1S A;  4YDO A;  4CDN A;  1TJC A;  3JUI A;  3SFX A;  4U07 A;  2GRQ B;  1N11 A;  2GW1 A;  4URK A;  3CVU A;  3ZYQ A;  5AAR A;  3L6A A;  3QJZ A;  3RRM B;  4O1P A;  3RKV A;  2XGM A;  2BKK B;  3NF1 A;  2KZT A;  2RFM A;  1Z3Y A;  1TN7 A;  4FHJ A;  4EZL A;  2ION A;  5AQ7 A;  3HXE A;  2WXF A;  5BNW A;  4G11 A;  4ANW A;  3IKO B;  4ANX A;  3JXI A;  1TNO A;  4U95 D;  3ZPJ A;  3ZRH A;  4QQI A;  3C3Q A;  4J6I A;  4L1B A;  3Q4A B;  4K0R A;  5FZQ A;  3CK8 A;  3ASH A;  1OWL A;  3UUX A;  5CBN A;  4GPK A;  1HH8 A;  3MJW A;  1UW4 B;  2J8S D;  1MX4 A;  4APF A;  3E37 A;  3BEE A;  5FQ7 A;  3S7F A;  4ATZ D;  3UTM A;  3TWR A;  2WQ6 A;  1KPS B;  4ANU A;  4GB9 A;  3OXG A;  3EIQ C;  3I4G A;  3VTY A;  2IY0 C;  1IXV A;  3CKC A;  4DX5 D;  4ILH B;  4GTP A;  3FTS A;  4JW1 A;  4EZK A;  4U0S A;  3Q79 A;  1N54 A;  3CVV A;  4IYP A;  3CQC B;  3L13 A;  3S7B A;  4FU3 A;  1JCS A;  5AJD A;  3TWX A;  1BPO A;  4XX5 A;  5E75 A;  4J8S A;  4C0M A;  3LS8 A;  2BKG A;  3APD A;  1L5J A;  4N2S A;  1E7U A;  5KJN A;  2F0Y A;  1U3D A;  3QAR A;  4WUY A;  2WMN A;  3AG4 E;  2XS1 A;  1HO8 A;  3SNX A;  2R03 A;  5AQ9 A;  2LO6 A;  3ABL E;  5FQ4 A;  1V55 E;  4HRL A;  4L23 A;  3KEZ A;  4FUL A;  3AU4 A;  3UM1 A;  1BU9 A;  3GZ2 A;  4HRM B;  3MV2 B;  2LUH A;  2A4Z A;  2XRY A;  4TXR A;  2DZO A;  3PUK A;  1O1R A;  3RAU A;  1HG5 A;  4KMO A;  4I6J A;  1OUV A;  2HR2 A;  4R7L A;  3TWS A;  2RFA A;  3B7U X;  5EIL A;  2LXL A;  2WXP A;  3TJP A;  3CHR A;  4XIF A;  2Y1L E;  1N9A A;  3LY9 A;  4RG9 A;  2ETA A;  4L2L A;  3QNK A;  5D0Q D;  3SF4 A;  2XZT G;  4XEI G;  1X81 A;  2I2O A;  1IKN D;  2CHX A;  3AG2 E;  2AXU A;  4I2Z A;  4AOF A;  2DZN A;  2ZIR A;  3PRZ A;  1JWF A;  3MCX A;  3ZYK A;  3CHP A;  5JMN D;  4A3T A;  5FQ6 A;  4I6E A;  3ESL A;  2VTB A;  3W9G A;  1OY3 D;  4XKB A;  3VTX A;  1K3Z D;  2ETB A;  1E7V A;  3EHM A;  4F7A A;  2BTD A;  3BG1 B;  1Q2Z A;  2DBA A;  2J09 A;  3CVL A;  3ZN3 A;  2P9N G;  2IOL A;  2HM8 A;  3MKQ B;  3KD7 A;  4LUN U;  5A6C A;  3HIZ A;  1WM5 A;  4C0E A;  2AWI A;  2CHW A;  5HRY A;  1KZP A;  2VSY A;  2DCP A;  5BPP A;  1E8Y A;  3Q73 A;  4N5Q A;  3Q9U C;  3URZ A;  3TXM A;  3B95 A;  2WXO A;  4EBA A;  2X6F A;  4JPS A;  4I17 A;  3RK6 A;  2QYJ A;  3EU9 A;  4I9E A;  3PNT B;  3UT8 A;  5E76 A;  2F8X K;  3PEU B;  5BT1 A;  3DSW A;  3MA5 A;  5CRV A;  3UIO C;  3PZ4 A;  3FUD A;  4GYO A;  2LSV A;  3ASG A;  3CVX A;  3NAW A;  3VLE A;  2RD0 A;  4BTB A;  3D9I A;  3S7J A;  3L22 A;  4YDW A;  4C48 B;  3DST A;  1UN8 A;  2VSN A;  1P5Q A;  2B6C A;  2R17 C;  1XNF A;  4FLB A;  2H6F A;  2UWJ G;  2FBN A;  3SFZ A;  1Z5S C;  5HKP A;  4UQX A;  3UX4 A;  3SBS A;  4E85 A;  4HLE A;  3AS5 A;  2XEN A;  2GRL A;  3J5Q B;  1EPU A;  3FTW A;  1OCO E;  3IV0 A;  3L17 A;  5M72 A;  2I1K A; 
#chains in the Genus database with same CATH homology
 2X6K A;  1E8X A;  2LSU A;  3LJ3 A;  1LF8 A;  4LCT A;  2WQ7 A;  1INZ A;  1HG2 A;  1UJK A;  2PM7 A;  3OXL A;  3OXF A;  4H7X A;  1SZ9 A;  4U0U A;  1HZ4 A;  1KT1 A;  4IN3 B;  2X3M A;  3P2B A;  3FFL A;  4PS7 A;  3C98 A;  4UWK A;  4TUU A;  4GMJ A;  3PDN A;  4ATG A;  1HF8 A;  2VGY A;  4KVO A;  3ONK A;  1IQR A;  2VGX B;  2PL2 A;  2J08 A;  3IHY A;  4FC8 A;  5FQ8 A;  3FEY A;  3P1U A;  1MQS A;  3S7D A;  3ZVV A;  5ARF A;  4AY6 A;  2AXV A;  2UY1 A;  3FUI A;  3D9L A;  1JPL A;  2CFZ A;  2V0P A;  3CVQ A;  3FY4 A;  4FJY A;  1HS6 A;  4I43 A;  4QFV A;  4CCA A;  3U4T A;  1DVP A;  2PQR A;  3PVL A;  2R59 A;  2J4B A;  2XCB A;  2FO7 A;  3FU3 A;  4N39 A;  4PUC A;  2WM9 A;  5EX0 A;  1SQM A;  1B89 A;  3QC1 A;  4JL0 A;  4MKT A;  3CGH A;  3RJV A;  3PH0 C;  4JEH A;  4EPZ A;  3FTX A;  4YND A;  2UY1 B;  3LXU X;  3MGB A;  3JQ0 A;  2GGF A;  1WY6 A;  2QY7 A;  4JHJ A;  4PDX A;  4ME2 A;  2L0T B;  3OAW A;  4I1A A;  3ZEF A;  3MKR A;  2AW6 A;  4JHR A;  1NA0 A;  3EIJ A;  5LOZ A;  3U9W A;  4AY5 A;  4LER A;  4DPR A;  1EDU A;  5EDS A;  3U3W A;  2WVI A;  5M72 A;  3FUK A;  5DIZ A;  1U3C A;  5ENN A;  5KJM A;  4WAF A;  1HXI A;  1H0A A;  5AJL A;  2XGS A;  3IHV A;  4PS8 A;  4L7T A;  1SZA A;  3FH5 A;  2YHE A;  4GAA A;  3FTV A;  3SI5 A;  4XI9 A;  1ELW A;  2WQH A;  3D9N A;  1HE8 A;  3MEK A;  3NZS A;  4N3C A;  3G2S A;  3R7R A;  4XZ4 A;  2WXL A;  3ESK A;  3ZYL A;  4GZ6 A;  4LEU A;  3WXX A;  2BUG A;  5LCW J;  3FTZ A;  5JJT A;  5G04 C;  4J8E A;  4G25 A;  2LAH A;  4B8C B;  3FUM A;  1H19 A;  3MV3 B;  1Y8M A;  3D9M A;  3PEV B;  3B7T A;  1ZU2 A;  3PS6 A;  3T8M A;  5LFA A;  3HYM B;  3TAX A;  2Y4U A;  2I9C A;  4NQ0 A;  1PAQ A;  2CFU A;  3CVP A;  3LYA A;  4NUR A;  2MOW A;  3QOU A;  1WAO 1;  4KT6 B;  3IBE A;  4CRW A;  5LCW C;  3ULQ A;  5J90 A;  2J4D A;  3QWV A;  1UN9 A;  4UWG A;  3RIB A;  1OWN A;  4U0Z A;  1H2T C;  1X5B A;  1N52 A;  3RRU A;  3O48 A;  4GCN A;  4AIF A;  4CDN A;  1TJC A;  2WPV A;  5ANR A;  1H6K A;  2V5F A;  3CHS A;  3GZS A;  3JUI A;  4F53 A;  4U07 A;  1DNP A;  4AJW A;  2GW1 A;  4URK A;  4IUL A;  3Q5M A;  3CVU A;  1GW6 A;  4U8H A;  4B0Z A;  3FUE A;  3ZYQ A;  5A23 A;  3D9J A;  4EQF A;  3NQP A;  3L6A A;  3T5X A;  3QJZ A;  4PS3 A;  4KXK B;  2Y3A A;  3RRM B;  3MYV A;  4N5C A;  3RKV A;  1ELR A;  2M63 A;  3ZFW A;  5BUZ A;  2XGM A;  4ILI A;  3N71 A;  2JLB A;  3NF1 A;  4RG6 A;  3SD5 A;  2I1J A;  2KZT A;  3KS2 A;  4ABN A;  3PE4 A;  1S0P A;  3B7R L;  1Z3Y A;  2VSX E;  2WXN A;  3LY8 A;  4FHJ A;  5FT9 A;  3CQG B;  4CDR A;  3CR3 A;  2ION A;  4EZL A;  1JWG A;  3FU0 A;  2YIN A;  1PY1 A;  3MX3 A;  2E0I A;  4WNF A;  5JHB A;  2VGX A;  2WXF A;  5LP0 A;  5AIJ A;  3GZ1 A;  2KZT B;  5BNW A;  4G11 A;  3QK0 A;  4ANW A;  2OND A;  2X6I A;  3UMV A;  3IKO B;  4ANX A;  3CVW A;  2CG3 A;  5JJ7 A;  4GA1 A;  3ONL A;  5FZR A;  2KAT A;  3FH7 A;  2J07 A;  3B7S A;  1H2U A;  1KT0 A;  4HOU A;  4BTA A;  3ZPJ A;  2KCK A;  3ZRH A;  4FJZ A;  4G24 A;  2WXR A;  2X38 A;  4L2Y A;  4HVB A;  4B8A A;  5BW8 C;  4FLH A;  3LDZ A;  3QKY A;  3FUF A;  1NP7 A;  4J6I A;  5EKQ D;  2WMO A;  4GYY A;  5JJ6 A;  4L1B A;  3Q4A B;  1A17 A;  4K0R A;  4AP2 A;  5FZQ A;  3CK8 A;  3ASH A;  2OVF A;  4BWR A;  2KM4 A;  1OWL A;  2XPI A;  3QWP A;  5ANL A;  5C1D A;  3UUX A;  2JEK A;  2WXG A;  3CVY A;  4DLQ A;  3T5V A;  4P29 A;  3CHM A;  2FEZ A;  4GPK A;  1HH8 A;  3MJW A;  1UW4 B;  2WB2 A;  1PC2 A;  3SGH A;  5AYW D;  4JXT A;  1UJJ A;  4XI0 A;  3VLD A;  4APF A;  3BEE A;  5FQ7 A;  5KJK A;  3S7F A;  2WQ6 A;  1VDY A;  1FVF A;  3D9K A;  3UT4 A;  1W3B A;  4GCO A;  4GB9 A;  4ANU A;  3OXG A;  3EIQ C;  2XEV A;  1TJF A;  4C9B B;  2GRM A;  5FWQ A;  3I4G A;  3PUJ A;  4U04 A;  4WNG A;  5A7D B;  3CIA A;  3VTY A;  2XRZ A;  4GYW A;  3CKC A;  4HXI A;  4KYO B;  4UWH A;  4ILH B;  2IQC A;  3QAQ A;  3FTS A;  4JW1 A;  3K9I A;  4RSY A;  4J8F A;  1Y6I A;  4EZK A;  4CT4 A;  4U0S A;  4XE0 A;  5T8I A;  4A3V A;  2PQN A;  5T4Y A;  4IRU A;  1N54 A;  4HOS A;  3CVV A;  4BT9 A;  4IYP A;  2CHZ A;  2IFU A;  3ML8 A;  4DJA A;  4E6H A;  2DIW A;  3CQC B;  3D9O A;  3L13 A;  3ASF A;  2XCC A;  4JZY A;  3UPV A;  4XKC A;  2X6H A;  3S7B A;  5J08 A;  2NXP A;  3CHO A;  4FU3 A;  5AJD A;  4WWP A;  1BPO A;  4XX5 A;  5E75 A;  5FJY A;  5FTP A;  3UT7 A;  3S2A A;  4AV7 A;  1IYG A;  4J8S A;  3FWV A;  4GZD A;  4C0M A;  2BF0 X;  2J49 A;  5D0O D;  3ZGQ A;  4A1S A;  2LNI A;  4FP7 A;  4KVM A;  3HDX A;  3L16 A;  4UI9 K;  2ILR A;  4Q96 A;  4HOQ A;  3LS8 A;  3L08 A;  3APD A;  1L5J A;  3ZIM A;  4N2S A;  3LCA A;  4DI4 A;  1E7U A;  2ZU6 B;  5KJN A;  4DI3 A;  1U3D A;  3QAR A;  4WUY A;  2IU1 A;  2WMN A;  5G55 A;  4I6G A;  5LX8 A;  5BV1 A;  1HO8 A;  3SNX A;  1QZ2 A;  3HHM A;  2LO6 A;  1MHQ A;  2YHC A;  4O6F A;  4B89 A;  5FQ4 A;  4BX8 A;  2YQ8 A;  3ZXS A;  4OVV A;  3FH8 A;  3EDT B;  4L23 A;  3KEZ A;  1E90 A;  3LKU A;  4FUL A;  3AU4 A;  3FU6 A;  3GZ2 A;  4MLP A;  4BY6 A;  3VLF A;  4HOR A;  2XQ0 A;  3MV2 B;  4UQZ A;  3RO3 A;  4JHK A;  4EZJ A;  1YA0 A;  2A4Z A;  2V4L A;  2XRY A;  4N3B A;  1IHG A;  4ILG A;  4UI9 J;  5CCL A;  3D9P A;  1HX8 A;  3PUK A;  2C0L A;  2L9B A;  1HG5 A;  2Y4T A;  2L6J A;  4BSX A;  2C0M A;  4KMO A;  3GW4 A;  2VSO E;  1OUV A;  4I6J A;  1HFA A;  2WXH A;  4DLO A;  3G2T A;  2HR2 A;  3SHF A;  4R7L A;  2Q7F A;  3FUH A;  4N3A A;  4FA6 A;  5CMW A;  4BT8 A;  1Z3X A;  4WWN A;  4ACL A;  2WXJ A;  3B7U X;  4MS6 A;  4AEZ C;  3EJN A;  3PRE A;  3LVQ E;  3G2W A;  4YVO A;  3KAE A;  4UI9 C;  1JUQ A;  2FUL A;  2IJG X;  2WXP A;  3TJP A;  3CHR A;  3TG4 A;  1Z6T A;  4XIF A;  5KJL A;  3LY9 A;  2XPZ A;  4EBA G;  4RG9 A;  3LY7 A;  2VYI A;  4EEC A;  4L2L A;  3QNK A;  4HFG A;  5D0Q D;  1FCH A;  2KCV A;  4MRU A;  3SF4 A;  4CT0 A;  4GA0 A;  3TGO A;  2I2O A;  3CVN A;  3Q49 B;  1OWO A;  5EX3 A;  3HVE B;  3Q47 B;  4K03 A;  2CHX A;  1FVH A;  3CST A;  4TV3 A;  3U66 A;  2J9Q A;  2WXI A;  2AXU A;  4I2Z A;  3SZ7 A;  3FHE A;  4W9R A;  4AOF A;  4UWF A;  4WND A;  4BFR A;  4LRZ A;  4WNE A;  2IF4 A;  3UQ3 A;  5HI7 A;  4TRQ A;  2I6H A;  3G2U A;  3QDN A;  3PRZ A;  3DPD A;  4JA7 A;  4NRH B;  5HQ8 A;  4V3I A;  1JWF A;  2MHK A;  3ASD A;  3LPZ A;  3MCX A;  4G2V A;  3CHP A;  2FI7 A;  3ENE A;  3ZYK A;  4ACK A;  4I1O B;  4RVB A;  3ZHE B;  4A3T A;  3NZU A;  3PNL B;  4U63 A;  5FQ6 A;  4I6E A;  1ELK A;  3ESL A;  4G23 A;  4D10 C;  2VTB A;  2L0I A;  4XKB A;  4G1T A;  3VTX A;  1NZN A;  3TXN A;  4J0U A;  1E7V A;  2CG2 A;  3FUJ A;  3EHM A;  3MKQ A;  3EHN A;  3CKB A;  4A1G A;  4F7A A;  2BTD A;  3BG1 B;  4J8D A;  3QB2 A;  4ANV A;  3FU5 A;  2DBA A;  4KZC A;  2XGO A;  2J09 A;  4KBQ A;  2KC7 A;  3CVL A;  3ZN3 A;  2VTB B;  4UWL A;  1IQU A;  2AXZ A;  4APO A;  1KLX A;  2IOL A;  2HM8 A;  3MKQ B;  5G05 J;  3E4B A;  2R5S A;  3KD7 A;  1HU3 A;  3ZYM A;  4BX9 A;  4LUN U;  2VJ8 A;  2EQX A;  2X6J A;  3AU5 A;  3R9A B;  3HIZ A;  3CHQ A;  5A6C A;  1WM5 A;  2QFC A;  5DBK A;  4C0E A;  4GZ3 A;  2AWI A;  2CHW A;  4H7Y A;  3TG5 A;  3FTU A;  3Q15 A;  5G04 J;  3CV0 A;  3PZD A;  2WXM A;  5CMY A;  2P58 C;  4M3O A;  4PH4 B;  3QWW A;  1QQE A;  2OV8 A;  2VSY A;  4G26 A;  3APC A;  3FDH A;  4F3V A;  2DCP A;  5G05 C;  2C2L A;  1E8Z A;  1E8Y A;  3FUN A;  5BPP A;  3JYS A;  4A55 A;  2NC9 A;  3RO2 A;  3URZ A;  3TXM A;  4Y6W A;  5JHA A;  2WXO A;  3CSF A;  4EBA A;  2X6F A;  3FTY A;  3AS8 A;  4JPS A;  3G2V A;  2LAI A;  3IEG A;  4I17 A;  4Y6C A;  3RK6 A;  4GA2 A;  2WXQ A;  1XGW A;  2PM6 A;  3D3M A;  4I9C A;  4I9E A;  4CEM A;  4HOT A;  3PNT B;  2VQ2 A;  2PZI A;  3UT8 A;  5E76 A;  2YNQ A;  3TL5 A;  3PEU B;  5BT1 A;  4WWO A;  3MA5 A;  2RG8 A;  1EF1 C;  3GYZ A;  4GU5 A;  4I1M A;  4JA9 A;  3FUL A;  3FUD A;  5KCM A;  5C2Y A;  1E8W A;  3I3N A;  2HYZ A;  2XHE A;  4GYO A;  2LSV A;  3JCK C;  3ASG A;  3CVX A;  4Q69 A;  1OWM A;  3VLE A;  3CEQ A;  2WXK A;  2RD0 A;  4BTB A;  4HS2 A;  5CCM A;  2E2E A;  4NAC A;  4KZ0 A;  3PE3 A;  4B94 A;  3B13 A;  2XPY A;  3D9I A;  3S7J A;  4YVQ C;  4AM9 A;  1E96 B;  1EYH A;  2OOE A;  3LEW A;  5G2N A;  1ZBP A;  5FZS A;  3SBT B;  3L22 A;  4GZC A;  3U64 A;  3R7Q A;  1OWP A;  1QNF A;  4FHK A;  2V8S E;  3I4R B;  3RRN B;  2NSZ A;  4AXH A;  1UN8 A;  4GZ5 A;  4CGV A;  3APF A;  2HO1 A;  3ZW3 A;  4CDM A;  2A5U A;  5BV0 A;  2VSN A;  3LVR E;  4DK5 A;  1P5Q A;  3ML9 A;  4N2Q A;  2R17 C;  3RU0 A;  1XNF A;  4OVU A;  5AEN A;  4FLB A;  2UWJ G;  3OTN A;  1TEZ A;  3HVE A;  2FBN A;  1NA3 A;  3CLJ A;  3JQ1 A;  4JEU A;  3SFZ A;  4UQX A;  3UX4 A;  4JC8 A;  5T3R A;  3O4Z A;  4Q94 A;  4FAD A;  3CK7 A;  3L54 A;  3SBS A;  2KCL A;  3AS4 A;  4E85 A;  2IOS A;  4HLE A;  3AS5 A;  4CGW A;  4JVS A;  4UQY A;  2GRL A;  3I5P A;  2OVB A;  4GML A;  1EPU A;  2AVP A;  4OYS A;  3CK9 A;  4AVX A;  5CHE E;  3FTW A;  3MZL B;  4F1S A;  4I2W A;  3BG0 B;  1H2V C;  3FP3 A;  2FF4 A;  3DBS A;  3IV0 A;  2MRI A;  3FEX A;  3L17 A;  5ARG A;  3ZHE A;  1UG3 A;  2I1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...