1NA3A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
molecule keywords designed protein CTPR2
total genus 36
structure length 86
sequence length 86
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na3A00
1PC2A 5G04C 5LCWJ 2PL2A 4GYWA 2Y4UA 2UWJG 2XGSA 2Y4TA 1FCHA 4O6FA 4KBQA 4WNFA 2XEVA 4GA0A 2WPVA 5JJ6A 3OXGA 4Y6WA 3EDTB 3Q15A 1E96B 3KD7A 2IF4A 2VYIA 4AY5A 2PZIA 3AS5A 2VSYA 4G23A 4GYOA 3S7FA 1ELWA 3RU0A 1P5QA 4G25A 1ELRA 1YA0A 2DBAA 2P58C 4CGVA 4KXKB 3U3WA 2J9QA 4YVOA 2C0MA 3WXXA 3PE4A 4UI9C 5D0OD 4G26A 5EX3A 5EX0A 4HORA 4JA7A 4Y6CA 4BTAA 3S7JA 3TGOA 1ZU2A 5FZSA 5DIZA 4IN3B 3ASGA 2I6HA 3AS4A 3TAXA 3BEEA 5G04J 3GZ2A 2UY1B 5LCWC 3Q4AB 3CK8A 2XCBA 4GZ3A 2LSUA 4HOTA 5CCMA 1KT0A 4WUYA 3N71A 5G05J 1WM5A 1HZ4A 3ASFA 3ULQA 4BTBA 2YHCA 3QWVA 4JA9A 3ASHA 3VTXA 2OOEA 4I2WA 2HR2A 2KATA 3LCAA 1QQEA 5FT9A 3TG4A 3U4TA 3VTYA 3ZGQA 4BT9A 2VGXA 4N3AA 4I17A 2BUGA 2HYZA 1TJCA 3LPZA 5A6CA 2HO1A 2R5SA 4J8DA 4NRHB 4AIFA 5JJTA 2VGYA 5FJYA 4I9CA 2FF4A 3ZPJA 4JHRA 5JJ7A 1NA3A 2GW1A 4KYOB 1QZ2A 4B94A 4UQYA 2ONDA 3RO2A 1HXIA 4I9EA 4G1TA 5CCLA 4N5CA 3CK9A 1KT1A 3CEQA 1B89A 1NA0A 3MKRA 2Q7FA 3FWVA 2UY1A 3UUXA 2XCCA 2AVPA 4N3CA 4J8EA 4XI9A 4BT8A 4N2SA 1W3BA 4RG9A 3MV3B 4W9RA 5HQ8A 3ZN3A 3E4BA 4H7XA 5HI7A 3UPVA 4GCNA 3FFLA 3MV2B 1IYGA 3RJVA 4YNDA 3GW4A 3LY8A 4HOUA 5FZQA 3ESKA 3CKCA 4GCOA 3NF1A 4N3BA 5A7DB 1OUVA 2KC7A 2IFUA 3CVQA 3CVPA 2VQ2A 3QWPA 5DBKA 1WAO1 1KLXA 5FZRA 3RKVA 5KJMA 4BWRA 3HYMB 4U04A 4A1SA 4LEUA 4CGWA 4U07A 3FP3A 4I1AA 5BNWA 4J0UA 4U0SA 4G24A 1ZBPA 4YVQC 5ARFA 5KJKA 4EQFA 1HH8A 2NC9A 3AS8A 3GZ1A 3IEGA 3PE3A 3QWWA 4N39A 4WNGA 2KCVA 2C0LA 3RO3A 3URZA 4N2QA 2XGOA 3TG5A 4UQXA 4RG6A 2VSNA 5KJLA 2L6JA 4U0ZA 3RIBA 2VGXB 4XIFA 4WNDA 4GZ6A 3CK7A 3LYAA 4HOSA 3KS2A 5M72A 5BW8C 3K9IA 4GA1A 5EKQD 3QDNA 3ZHEA 5CHEE 3LY9A 3ZFWA 2JLBA 2XPIA 3Q47B 4GPKA 4J8FA 4ABNA 2YQ8A 1NZNA 1XNFA 5AYWD 2MHKA 5ARGA 3OXFA 4HOQA 4U0UA 4I2ZA 2E2EA 2V5FA 5FTPA 4UI9J 2QFCA 3SF4A 1Y8MA 3LY7A 3PDNA 2PQNA 5G05C 3GYZA 1IHGA 3KAEA 3OXLA 4GZ5A 4XI0A 3CVLA 3Q5MA 1A17A 2FBNA 3ASDA 4GA2A 4H7YA 3JYSA 4GYYA 3S7DA 3SZ7A 4APOA 3Q49B 5KJNA 3CVNA 4NQ0A 4CDRA 4F3VA 2KCKA 3QKYA 5C1DA 5BT1A 3ZHEB 4WNEA 4ME2A 4AY6A 2WQHA 2FEZA 2KCLA 2XGMA 3S7BA 2LSVA 3LKUA 4UQZA 2FI7A 2PQRA 4G2VA 2C2LA 2LNIA 4JL0A 4UI9K 3CKBA 3QOUA 3UQ3A 2FO7A 3MA5A 3MEKA 5D0QD 3O48A 3R9AB 4AM9A 3CV0A
chains in the Genus database with same CATH superfamily
5LCWJ 3PREA 1FCHA 1HX8A 2WXGA 5EIDA 1UN9A 4ANUA 3FTXA 3KD7A 4LCTA 4HI9A 1IQRA 3Q9NC 3D9LA 5JHBA 2HM8A 2DBAA 4CGVA 5J08A 1IKND 3UT7A 5EX3A 4XKCA 2WVIA 1Y6IA 3FU5A 3ULQA 4XZ4A 4K5AB 1HU3A 1QQEA 3F6QA 3FDHA 2DIWA 1TJCA 3B7SA 1NA3A 3D9NA 1SA5A 4HB5A 3CK9A 3FUFA 3AG4E 1OCRE 3QK0A 3UT4A 1JCQA 2WXJA 5KNHD 4DLQA 1WAO1 4BWRA 5BNWA 4YDOA 3Q73A 4YVQC 4WNGA 3C3OA 2KCVA 2OV8A 1MX2A 2B0OE 2XRZA 1OWLA 3ZIMA 5AQ7A 3L22A 3FTWA 4KZ0A 2X6KA 3SI5A 1XNFA 3HXBA 1D8EA 1N0RA 2VSXE 3GYZA 1UOHA 4LNGA 4ACLA 1N54A 3HDXA 2ILRA 5BPPA 4HXIA 4FJYA 2XS8A 1GW6A 2IU1A 1PC2A 2PL2A 2X6JA 3WG7E 4O6FA 2WXOA 3I3NA 5EYPF 2A5UA 3SBSA 2J08A 2PNNA 2PZIA 1X81A 4GU5A 3QB2A 3S7FA 3MX3A 2WXFA 3FH5A 3T8MA 5J90A 4YVOA 5D2MC 5ANRA 3EU5A 1QNFA 4HOTA 3NBNB 1WG0A 3G2SA 3TWUA 5LX8A 3ENEA 3TWVA 3CHQA 4I9CA 5JJ7A 4XE0A 4KYOB 3RK6A 5CCLA 3TWRA 3FUIA 3CVVA 2XCCA 1RW2A 5CRVA 4RG9A 5HI7A 4GCOA 4L1BA 2EIKE 5DBKA 3RRUA 3UMVA 4LEUA 4J0UA 4G24A 4KT6B 4ILIA 2ZISA 3CK7A 1JUQA 2IY0C 4GA1A 3FEYA 4HS2A 4J8FA 1NZNA 1H0AA 3SNXA 2PQNA 4BEPA 4XI0A 1JWGA 3R7RA 4CDRA 2DYRE 4ME2A 5AIJA 4I1MA 4K5BA 3S7BA 4JVSA 3UQ3A 3D9PA 3CKBA 3QOUA 3T9KA 1EPUA 3FUNA 4CEMA 3PEVB 4B89A 4KBQA 4EBAG 2IONA 1SQMA 4YDYA 4HI8A 1LF8A 3NZUA 2VYIA 4E85A 2J9QA 3PE4A 3C72A 2XS1A 4Y6CA 2JABA 3AG2E 3TGOA 3SQVA 2I6HA 3Q4AB 2CG2A 4J7WA 2R59A 1WM5A 2YHCA 5D66A 3AU5A 2VJ8A 3ZGQA 4HORA 3VTYA 1HE8A 2I2OA 2HYZA 5A6CA 2RFMA 4AP2A 2XPZA 1E8YA 3HVEB 2AWIA 5CERB 2Q7FA 5CMYA 5AQ9A 3UX4A 1W3BA 1S70B 2WXMA 3ABKE 3E4BA 4GCNA 3MV2B 1BD8A 2GROB 1E8XA 3U9WA 4YNDA 3ESKA 5A7DB 4DLOA 2KC7A 2LAIA 3HVEA 1E8WA 5JA4D 4JEHA 4RG6A 5KJLA 5M72A 3UIOC 1OCZE 3D9JA 2RKKA 1A5EA 2EIJE 1HF8A 4I43A 3MGBA 4R7LA 2GRRB 4C0MA 1HO8A 5BV0A 5HRYA 3MEKA 3V2XA 3CV0A 3FY4A 3PZ1A 2BTDA 3ZEFA 3D9HA 4Y6WA 3EJNA 3BUAA 1E96B 3FU6A 3PRZA 1P5QA 2E0IA 1TN6A 2X38A 5EX0A 5EIBE 5KNGA 3BEEA 5G04J 3TWQA 2J07A 4OAVB 3UM3A 1N4RA 2Y3AA 4DJAA 5FIOA 5FT9A 3IV0A 4GPKA 3DBSA 3DXKG 4N3AA 4JHRA 3EHMA 2GW1A 2R05A 2P9IG 3E33A 1TN8A 3V30A 5ANLA 3FTUA 1FVHA 2UY1A 4ANWA 4HRNA 1YCSB 2VTBB 3DXMG 2CHZA 3T5XA 3L9TA 1KPSB 3ZU7B 3AU4A 1MHQA 4HNAD 5B1BE 4K0RA 5ENSD 3AAAC 3SBTB 3FEXA 3LYAA 4B0ZA 3B7BA 3DSXA 3NZSA 3ZHEA 5LFAA 4GMLA 4F1SA 3BU8A 4U0UA 1N9AA 2QFCA 2LUHA 3DPDA 3ZFWA 4WWPA 4GZCA 4GTMA 2LXMA 2KCKA 4CT4A 5BT1A 3ZHEB 5T3RA 5FQ8A 3LKUA 2V5QC 2BF0X 1FPPA 2OEVA 5D0QD 4GZDA 3SFZA 4GYWA 2DZOA 2FO1E 4OYSA 4DX6D 4BERA 4L2LA 2Y1LE 4AY5A 5ENOD 4J6IA 4CCAA 3I4RB 4MS6A 2C0MA 1AWCB 4G26A 3SY2A 5AARA 5LCWC 1AP7A 2FULA 4I6JA 5A23A 4O1OA 3C3RA 3ZUVB 1TN7A 4TXQA 5B1AE 1K1BA 5JJTA 2IOSA 4ZHBA 3ZXPA 4UQYA 3I5PA 4N5CA 3LDZA 4XI9A 2AVPA 4F6RD 3ZN3A 3V2OA 4FC8A 2AXUA 2VQ2A 3HYMB 3B7RL 3FP3A 1ZBPA 4NURA 4CRWA 5LOZA 3URZA 2F37A 3RO3A 5ENNA 3CVUA 4GTQA 1S63A 1V54E 5AAOA 2V5FA 3O4ZA 3LY7A 3Q79A 4HQDA 5G05C 3Q5MA 4U95D 1MZCA 3APFA 1EF1C 2M63A 4JHJA 5C1DA 4GTTA 4F1PA 4PS3A 3L82A 2I1JA 1D9SA 2GRPB 3UM1A 4BSXA 2P9UG 3DSVA 1YMPA 4WNFA 3CVYA 1EDUA 3KSQA 2RFAA 2P9NG 3Q15A 5CRUA 3RRMB 3TWXA 3FTSA 3PH0C 2VSYA 3AJIA 4KXKB 1MX6A 2YINA 3U3WA 2QY7A 2ZU6B 3LJ3A 4RSYA 4Q69A 1SVXA 4GZ3A 3S2AA 3MZLB 4K5CA 2YNQA 2BUGA 4AIFA 2CFZA 3E34A 2F8YA 3CEQA 2VSOE 4OAUC 4ACKA 1OWMA 1UJKA 4U8YD 5FZQA 4TUMA 1OUVA 3PUJA 3E32A 4U0ZA 3HXDA 2NXPA 2ZXWE 2JLBA 3CHRA 4HRLA 1LTXA 3DEPA 2R2LA 1PY1A 3OXLA 3S7DA 2FBNA 2AW6A 3JQ0A 4PUCA 4AEZC 2KCLA 4UQZA 4G2VA 2P9SG 4ILGA 2DVWA 3DEOA 1N0QA 1MQSA 3CQCB 3TXNA 2LAHA 4MRUA 1JWFA 2DCPA 4FA6A 4DK5A 4PH4B 1IQUA 2XZTG 1TEZA 3CR3A 3KEAA 3PZDA 1FVFA 2ZGGA 2V4LA 2L9BA 3TXMA 5CCMA 1KT0A 2LO6A 3APDA 3TWTA 4GB9A 4I17A 1ELKA 5AENA 2V8SE 1OXJA 2QYJA 3L6AA 4YDWA 5E75A 1RZ4A 1BU9A 2IFUA 2WMOA 3L17A 3VLEA 4U04A 1HFAA 5E76A 4P29A 2C0LA 5FWQA 2VSNA 4U7EB 2WXHA 4MLPA 2BEDA 5BXUA 4CYMD 5C2YA 1H6OA 2ETCA 3SF4A 4UI9J 5AQBA 1MJ0A 3KAEA 1IHGA 2NYJA 3RSEG 3Q49B 2R17C 3DSWA 3ABME 4KVMA 4HLEA 1Q2ZA 2X6IA 2GRQB 4PDXA 2WXRA 4A63B 3R9AB 1H2VC 2P9KG 4EZKA 5G04C 4BSZB 2X6HA 3L54A 4LG6A 2IO3C 5JJ6A 4ATGA 4C0EA 2IF4A 4JXTA 4XEIG 1E90A 4Q94A 5EYLA 3FTYA 1E8ZA 4G25A 4PS8A 1TJFA 3ZYMA 3BG1B 3WXXA 2XEEA 4WAFA 1IXVA 3S7JA 1U2VG 2UY1B 3CK8A 2XCBA 4EHMA 1NL4A 4JA9A 2NSZA 5CEDB 4I2WA 3U4TA 3C3QA 3FHEA 4NRHB 3EHNA 3FTZA 4KMOA 1Z3XA 1Z5SC 3RO2A 3ZW3A 4KVOA 1NI1A 2WXPA 1N11A 3ML8A 4B8CB 4FADA 5KJMA 4F7AA 1VDYA 4ATZD 5CBNA 5AJLA 3VLFA 3AS8A 3QJZA 2MRIA 4QQIA 4UQXA 1BI8B 3I4GA 4ILHB 4XIFA 2IQCA 3C98A 5BW8C 2XRYA 3EHRA 3K9IA 5JMND 1O1SA 1MYOA 1SA4A 3FTVA 1TNZA 5FTPA 1Y8MA 5FQ7A 4N5QA 4M7CA 2R03A 3PVLA 1S64A 3UXGA 4G8KA 2FO7A 1S0PA 3ASNE 3UINC 3HG0D 5T8IA 4JPSA 3PZ3A 4E6HA 1N4QA 3CHPA 4U96D 4LERA 4IULA 5H7PA 4AXHA 4DX7D 1ELWA 2KBXA 2CHWA 3ESLA 2DZNA 3BG0B 4XKBA 2JEKA 4JA7A 3AS4A 2LSUA 3EIJA 4AOFA 3KEZA 3OAWA 3ASHA 3QAQA 4UWFA 2HR2A 4TV3A 3MKQA 5BUZA 4URKA 2Y0BG 3FUHA 2A4ZA 5FINA 4GPMA 2WXQA 2IJGX 1BLXB 5HQ8A 3ZYLA 1HG5A 3FFLA 1K8KG 1NP7A 5B3SE 3CKCA 4MKTA 4DI3A 3CVQA 1N4PA 4CZ2D 1N95A 1TNBA 4LNBA 5KJKA 3PUKA 3IEGA 1Z6TA 5HKPA 3TG5A 4B8AA 1N4SA 5CMWA 4HVBA 4L9PA 3QARA 2IOLA 2RG8A 4I6EA 3Q47B 4V3IA 4ABNA 2LXLA 1H6KA 1HS6A 4BESA 4UWHA 4LUNU 3CVLA 1A17A 4APOA 1N52A 2ZIRA 4BETA 3ML9A 4TRQA 3TWSA 3V31A 3HXCA 2F0YA 5KCMA 2XENA 2WQ7A 2AJAA 2PQRA 5AJDA 4UI9K 4A55A 4AJWA 1H6PA 5CEAA 1DC2A 1WY6A 3JUIA 4OVVA 4XX5A 3G2TA 1OWNA 4EZJA 4GYOA 4J8SA 3UKRG 3HIZA 4F53A 2OEWA 3ABLE 2IO2C 4GTSA 3ULYA 4O60A 3CSFA 1FT1A 4A3VA 3EUVA 3APCA 3JXJA 3B13A 2XEHA 4FLBA 2ETAA 3G2VA 3DSSA 3UT8A 1Z3YA 4EPZA 2RD0A 5AN8A 4BT8A 4J8EA 4W9RA 3MV3B 1IYGA 3ZNGA 3RJVA 4HOUA 4CDNA 3RKVA 4CGWA 2WQ6A 1QYMA 4U63A 4DUIA 3U66A 4HBDA 3L13A 4L7TA 1G3NB 3PEUB 2HE0A 2MHKA 4GTRA 3CVNA 4LRZA 1OCCE 2WXKA 4K03A 4GTVA 2FI7A 4JL0A 3PNTB 3O48A 2XGSA 2Y4TA 4GA0A 4JHKA 3UI2A 4RLYA 2P2CP 2WMNA 4ANVA 3RU0A 3ONKA 1YA0A 2XZDG 4RVBA 2PM6A 2WXLA 5FQ4A 1WDYA 5DIZA 4IN3B 3ASGA 2PM7A 3TJPA 3P1UA 4AV7A 2BKGA 3IKOB 3V79K 3TG4A 1O5MA 2L6BA 2HO1A 2VGYA 4KZCA 3P2BA 4I9EA 3MKRA 3FUKA 1NFIE 3UIPC 5KBAA 3FUMA 2OVBA 2CFUA 3QWPA 1KLXA 4JD2G 4U07A 3PE3A 3PZ4A 1O1TA 3SO8A 2J09A 4FHKA 1L5JA 3LY9A 2KZTB 5FQ6A 4WWNA 5AYWD 4FULA 3PDNA 1HG2A 2QZAA 4GYYA 5T4YA 2OCCE 3ULEG 2CG3A 1N94A 2VGEA 3RRNB 3ASOE 4JB8P 2QYUA 2WQHA 3CHOA 3W9GA 2LNIA 2WXIA 3IHVA 3FUJA 4I6GA 3DSTA 3W9FA 4M3OA 2DWZA 3EHQA 3ZXSA 3OTNA 3AS5A 4C48B 4UWLA 4EECA 3LS8A 4UI9C 3FH8A 3X2QE 3FUEA 4CDMA 2QC9A 4EBAA 3FUDA 3GZ2A 1E7UA 3MCXA 4GTPA 4U8HA 4A3TA 3ASFA 4D10C 1MX4A 3LPZA 4BX9A 3LEWA 2FF4A 2B6CA 1HXIA 3GZSA 3B95A 1B89A 1NA0A 3UUXA 2ETBA 1JCSA 2EQXA 3FULA 3ZYKA 1UW4B 3NF1A 4N3BA 2DYSE 5FZRA 4I1OB 5G55A 1JPLA 4DX1A 3FH7A 2V0PA 2L0IA 4GMRA 1H2UA 1SW6A 4J8YA 3RIBA 3UM0A 5EKQD 3C5RA 4ZFHA 3JCKC 3ISMC 4I2ZA 3VTXA 3SD5A 4O1PA 4TUUA 3ASDA 3CIAA 4UUCA 3L16A 1TR4A 1SZAA 3T5VA 3NOGD 3IBEA 2XGMA 3ONLA 2WM9A 3NB2A 1UN8A 4DI4A 3DSUA 1UJJA 2Y4UA 3SFXA 3OXGA 3EDTB 2AXVA 4MBGA 3LVRE 2EILE 4TXRA 5D0OD 4Z68A 3JQ1A 4Q96A 1V55E 1TNOA 3CSTA 3N71A 5G05J 4BTBA 3UTMA 3DPYA 3JUEA 3LCAA 4BT9A 2VGXA 1DVPA 3Q7AA 3AG1E 1QZ2A 4G1TA 3HXEA 4L2YA 2XHEA 5BXOA 3LJNA 3FU0A 2XQ0A 2L0TB 3NOCD 4LNUD 4NIKA 1INZA 4N39A 2F8XK 4B93B 3CQGB 2L6JA 3L08A 3NAWA 3MJWA 2EIME 2CHXA 3D9MA 1KZPA 1O1RA 1TNYA 3HXFA 3HHMA 4JW1A 2MOWA 5CECB 3Q7FA 5KJNA 4F3VA 2H6FA 2GRLA 4WNEA 4FJZA 2FEZA 2LSVA 3G2UA 3CHMA 2BKKB 4U8VD 3NQPA 4FHJA 5LP0A 1DNPA 2WPVA 4A1GA 3E30A 4IRUA 1XGWA 3ZKJA 3IXEA 2P58C 4CT0A 3BQOA 5ENTD 1ZU2A 5FZSA 5ENRD 1KZOA 2I1KA 3D9KA 3CVXA 1IHBA 4BX8A 1HZ4A 3MKQB 3QWVA 2OOEA 2J4BA 3Q9UC 1H19A 3SFYA 5FJYA 3TWWA 1TYQG 2ZGDA 1QBQA 4GMJA 3FWVA 5ENQD 3LY8A 2AXZA 2IEJA 3CVPA 4HLLA 3J5PA 4YDEA 4HFGA 4U0SA 1FT2A 4EQFA 2V4HC 4FU3A 2XGOA 3ZYQA 3PZ2A 1OCOE 2VGXB 3KS2A 3RAUA 4WWOA 1YYHA 2XPIA 1OWPA 2YQ8A 4UWKA 2A5EA 2E2EA 1ZB1A 5BV1A 4DPRA 2H6IA 1U3DA 5G2NA 2P9LG 2OVFA 3ZVVA 1OT8A 3QNKA 3UM2A 3MA5A 4HRMB 3D9IA 3SHFA 2GGFA 2YHEA 4AVXA 4JEUA 4G8LA 4APFA 4BFRA 3UKUG 4G23A 4BY6A 4IYPA 3MYVA 1U3CA 1DCQA 5EN5D 1LD8A 4DRXE 3JXIA 3KSLA 4G11A 2MYOA 2KZTA 4L23A 3B7TA 3TAXA 1OWOA 2R02A 4WUYA 3J5QB 1K1AA 3LVQE 5JHAA 3SGHA 5AQAA 3ZPJA 3ZRHA 1E7VA 3U64A 3CVWA 5IY5E 3UPVA 4H7XA 2GRNB 1BPOA 3GW4A 2Y69E 2VTBA 2I9CA 3Q75A 3D9OA 1SZ9A 4A1SA 2NC9A 5EILA 4TXPA 4N2QA 1JCRA 3R7QA 4GZ6A 3VLDA 4HOSA 1UG3A 4DX5D 3DRAA 3B7UX 5ARGA 4DX2A 5CBOA 4GZ5A 4GA2A 3SZ7A 4H7YA 2XPYA 3JYSA 4NQ0A 2H6HA 2KM4A 3CLJA 2J8SD 4EZLA 1D8DA 1OY3D 3E37A 2J49A 1BI7B 3AG3E 2UWJG 2XEVA 2WB2A 3LXUX 2X3MA 4LSZE 4PS7A 4C9BB 3CGHA 5KWDA 2H6GA 3D3MA 1ELRA 2WXNA 3PNLB 3T8KA 3EIQC 1K3ZD 4FP7A 4BTAA 4JC8A 3QC1A 4UWGA 4GTOA 3R9MA 4JZYA 3TL5A 2KATA 4NACA 2R5SA 2GRMA 4J8DA 1EYHA 2J4DA 4B94A 2ONDA 1KT1A 5ENPD 2EINE 4N3CA 3DWLG 4N2SA 4GAAA 3IHYA 5EDSA 3HRAA 4I1AA 5ARFA 4FLHA 4RQIA 1HH8A 3GZ1A 3QWWA 4WNDA 3CHSA 3G2WA 3QDNA 5CHEE 4QFVA 3OXFA 4HOQA 5ITZF 2P9PG 4OVUA 3FU3A 3Q78A 3EU9A 4X8QA 1TNUA 1H2TC 5HS0A 1PAQA 3QKYA 4AY6A 3PS6A 1X5BA 1DCEA 2C2LA 1LD7A 2KXPC 4AM9A 2X6FA 4ANXA
chains in the Genus database with same CATH topology
4GZDA 3SFZA 5LCWJ 1UJJA 3PREA 4GYWA 2Y4UA 1FCHA 1HX8A 2WXGA 4OYSA 3OXGA 3EDTB 4E6HA 3CHPA 1UN9A 2AXVA 3FTXA 4ANUA 3KD7A 4L2LA 4IULA 4LERA 1IQRA 4LCTA 4AY5A 4AXHA 3D9LA 5JHBA 2HM8A 1ELWA 3LVRE 2CHWA 4J6IA 4CCAA 2DBAA 4CGVA 5J08A 3ESLA 3I4RB 3BG0B 2C0MA 4MS6A 3UT7A 4XKBA 2JEKA 5D0OD 4G26A 5EX3A 3JQ1A 4JA7A 4Q96A 4XKCA 2WVIA 3AS4A 5LCWC 1Y6IA 2FULA 4I6JA 3FU5A 5A23A 2LSUA 3EIJA 3CSTA 4AOFA 3KEZA 3ULQA 3N71A 5G05J 4XZ4A 4BTBA 3OAWA 3ASHA 3QAQA 4UWFA 1HU3A 2HR2A 3LCAA 4TV3A 1QQEA 3FDHA 3MKQA 4BT9A 5BUZA 2VGXA 4URKA 2DIWA 1TJCA 3B7SA 5JJTA 3FUHA 1DVPA 2IOSA 1NA3A 2A4ZA 1QZ2A 4UQYA 2WXQA 3D9NA 3I5PA 4G1TA 4N5CA 3LDZA 3CK9A 3FUFA 4L2YA 2IJGX 2XHEA 4XI9A 2AVPA 3QK0A 3FU0A 3UT4A 5HQ8A 3ZYLA 3ZN3A 1HG5A 2WXJA 2XQ0A 3FFLA 2L0TB 1NP7A 4FC8A 3CKCA 4MKTA 4DLQA 4DI3A 3CVQA 2AXUA 2VQ2A 1WAO1 4BWRA 3HYMB 1INZA 3B7RL 3FP3A 5BNWA 4YVQC 1ZBPA 4NURA 4CRWA 5KJKA 5LOZA 3PUKA 3IEGA 4N39A 4WNGA 1Z6TA 3URZA 2KCVA 2OV8A 3RO3A 3TG5A 4B8AA 5CMWA 3CQGB 2L6JA 2XRZA 4HVBA 1OWLA 3L08A 3QARA 3MJWA 2IOLA 5ENNA 2RG8A 3ZIMA 2CHXA 3D9MA 3L22A 4I6EA 3CVUA 3FTWA 4KZ0A 3Q47B 4V3IA 2X6KA 3SI5A 4ABNA 1H6KA 1XNFA 1HS6A 2VSXE 2V5FA 4UWHA 3O4ZA 3LY7A 3HHMA 5G05C 3GYZA 4LUNU 4JW1A 2MOWA 3CVLA 3Q5MA 1A17A 4APOA 4DI4A 3APFA 4ACLA 1EF1C 2M63A 5KJNA 1N54A 1N52A 4JHJA 3ML9A 4F3VA 5C1DA 4TRQA 2GRLA 4WNEA 3HDXA 4PS3A 2ILRA 4FJZA 5KCMA 5BPPA 4HXIA 2FEZA 2WQ7A 2I1JA 2LSVA 3G2UA 4FJYA 2PQRA 5AJDA 4UI9K 1GW6A 4A55A 4AJWA 2IU1A 4BSXA 3CHMA 1PC2A 3NQPA 1WY6A 2PL2A 4FHJA 2X6JA 3JUIA 4O6FA 4WNFA 5LP0A 1DNPA 2WPVA 2WXOA 3I3NA 4OVVA 1EDUA 4A1GA 3CVYA 2A5UA 4XX5A 3SBSA 3Q15A 2J08A 3RRMB 3G2TA 4IRUA 1OWNA 1XGWA 2PZIA 4EZJA 3FTSA 4GU5A 3PH0C 2VSYA 3QB2A 4GYOA 3S7FA 3MX3A 2WXFA 3FH5A 4J8SA 2P58C 3T8MA 4KXKB 2YINA 5J90A 2QY7A 4YVOA 2ZU6B 3U3WA 4CT0A 3HIZA 3LJ3A 4RSYA 4F53A 1ZU2A 5ANRA 5FZSA 4Q69A 2I1KA 3D9KA 3CVXA 1QNFA 4GZ3A 4BX8A 3S2AA 4HOTA 3MZLB 1HZ4A 3MKQB 3CSFA 3QWVA 2OOEA 4A3VA 2J4BA 2YNQA 3G2SA 2BUGA 1H19A 3APCA 4AIFA 3ENEA 2CFZA 5LX8A 5FJYA 3CHQA 4I9CA 3B13A 5JJ7A 4XE0A 4FLBA 4KYOB 3RK6A 4GMJA 3G2VA 5CCLA 3UT8A 3CEQA 1Z3YA 2VSOE 3FUIA 4EPZA 3CVVA 2RD0A 3FWVA 2XCCA 4BT8A 4J8EA 4W9RA 4RG9A 3MV3B 5HI7A 4ACKA 1OWMA 1UJKA 1IYGA 3RJVA 3LY8A 4HOUA 5FZQA 2AXZA 4GCOA 4L1BA 1OUVA 5DBKA 3CVPA 4CDNA 3RRUA 3RKVA 3UMVA 3PUJA 4CGWA 4LEUA 4HFGA 4J0UA 4U0SA 4G24A 4EQFA 2WQ6A 4FU3A 2XGOA 4KT6B 3ZYQA 4U63A 4ILIA 4U0ZA 2VGXB 3U66A 3CK7A 3L13A 3KS2A 4L7TA 1JUQA 2NXPA 4GA1A 3FEYA 4WWOA 4HS2A 3PEUB 2JLBA 2XPIA 1OWPA 4J8FA 2YQ8A 3CHRA 1NZNA 1H0AA 2MHKA 3SNXA 4UWKA 2E2EA 2PQNA 1PY1A 3OXLA 5BV1A 4XI0A 4DPRA 3S7DA 2FBNA 1U3DA 2AW6A 1JWGA 5G2NA 3R7RA 3CVNA 2OVFA 4LRZA 4CDRA 3JQ0A 4PUCA 4ME2A 2WXKA 4K03A 4AEZC 3ZVVA 5AIJA 2KCLA 4I1MA 3S7BA 4UQZA 2FI7A 3QNKA 4G2VA 4JVSA 4JL0A 3D9PA 3CKBA 3PNTB 3QOUA 3UQ3A 3MA5A 1EPUA 3FUNA 3O48A 4ILGA 4CEMA 3D9IA 3SHFA 2GGFA 2XGSA 2Y4TA 3PEVB 4B89A 2YHEA 4KBQA 4EBAG 2IONA 4GA0A 4AVXA 1SQMA 4JEUA 1MQSA 4JHKA 4APFA 1LF8A 4BFRA 3NZUA 2VYIA 3CQCB 3TXNA 4G23A 4BY6A 2LAHA 4IYPA 4ANVA 2WMNA 3MYVA 1U3CA 3RU0A 3ONKA 1YA0A 4MRUA 4E85A 2J9QA 1JWFA 3PE4A 2DCPA 4G11A 4FA6A 2KZTA 4Y6CA 4PH4B 4RVBA 4DK5A 3TGOA 2PM6A 1IQUA 1TEZA 2WXLA 5FQ4A 3CR3A 5DIZA 4IN3B 3PZDA 3ASGA 4L23A 2I6HA 3B7TA 3TAXA 1FVFA 2V4LA 2L9BA 3TXMA 2PM7A 3Q4AB 3P1UA 3TJPA 4AV7A 1OWOA 2CG2A 5CCMA 1KT0A 2R59A 3IKOB 4WUYA 1WM5A 2LO6A 2YHCA 3AU5A 2VJ8A 3TG4A 3ZGQA 4HORA 3APDA 3VTYA 1HE8A 4GB9A 2I2OA 2HYZA 4I17A 3LVQE 5A6CA 2HO1A 5JHAA 3SGHA 2VGYA 4KZCA 3ZPJA 1ELKA 3P2BA 4AP2A 5AENA 2V8SE 3ZRHA 1E7VA 3U64A 2XPZA 1E8YA 4I9EA 3L6AA 3CVWA 3HVEB 2AWIA 3MKRA 3FUKA 2Q7FA 5CMYA 3UX4A 1W3BA 2WXMA 5E75A 3UPVA 3E4BA 3FUMA 1BPOA 4H7XA 4GCNA 3MV2B 3U9WA 1E8XA 2OVBA 4YNDA 3GW4A 3ESKA 2CFUA 2VTBA 5A7DB 4DLOA 2KC7A 2IFUA 2I9CA 3QWPA 2WMOA 2LAIA 3D9OA 3L17A 1KLXA 1SZ9A 3VLEA 4U04A 4A1SA 4U07A 1HFAA 3HVEA 5E76A 1E8WA 2NC9A 4P29A 3PE3A 4JEHA 2C0LA 5FWQA 4N2QA 2J09A 4RG6A 2VSNA 3R7QA 4FHKA 5KJLA 4GZ6A 3VLDA 4HOSA 5M72A 5T8IA 1UG3A 3D9JA 1L5JA 2WXHA 3LY9A 2KZTB 5FQ6A 4MLPA 4WWNA 5C2YA 5AYWD 3B7UX 5ARGA 3SF4A 4FULA 4UI9J 3PDNA 1HG2A 3KAEA 1IHGA 4GZ5A 4GA2A 3SZ7A 4H7YA 1HF8A 4GYYA 2XPYA 3JYSA 3Q49B 2R17C 4I43A 5T4YA 2CG3A 4NQ0A 3MGBA 4KVMA 3RRNB 4HLEA 2X6IA 2KM4A 4R7LA 3CLJA 4C0MA 2WQHA 3CHOA 4PDXA 1HO8A 5BV0A 4EZLA 2LNIA 2WXIA 2WXRA 3IHVA 3FUJA 3MEKA 3R9AB 1H2VC 4EZKA 4I6GA 3CV0A 3FY4A 2BTDA 2J49A 5G04C 3ZEFA 2X6HA 2UWJG 2XEVA 3L54A 5JJ6A 2WB2A 4Y6WA 3LXUX 4M3OA 3EJNA 4ATGA 3ZXSA 4C0EA 1E96B 2X3MA 4C9BB 2IF4A 3OTNA 4PS7A 4JXTA 1E90A 3AS5A 3CGHA 3FU6A 4Q94A 3FTYA 3PRZA 1E8ZA 3D3MA 1P5QA 4G25A 1TJFA 1ELRA 2WXNA 3PNLB 4PS8A 4UWLA 3LS8A 3ZYMA 3BG1B 2E0IA 4EECA 3WXXA 4UI9C 2X38A 4WAFA 5EX0A 3EIQC 3FH8A 4BTAA 4FP7A 3S7JA 3FUEA 4CDMA 4JC8A 3QC1A 4EBAA 3FUDA 4UWGA 3BEEA 5G04J 3GZ2A 2UY1B 1E7UA 3CK8A 2J07A 2XCBA 3MCXA 4JZYA 4U8HA 4A3TA 3ASFA 2Y3AA 4JA9A 2NSZA 3TL5A 4D10C 4DJAA 4I2WA 4GPKA 2KATA 3IV0A 5FT9A 3U4TA 3DBSA 4N3AA 3FHEA 3LPZA 4NACA 4BX9A 2R5SA 2GRMA 4J8DA 4NRHB 3EHNA 3FTZA 3LEWA 1EYHA 2FF4A 4JHRA 3EHMA 4KMOA 2J4DA 2GW1A 4B94A 1Z3XA 2ONDA 3RO2A 1HXIA 3GZSA 3ZW3A 4KVOA 1KT1A 5ANLA 1B89A 1NA0A 3FTUA 1FVHA 2UY1A 3UUXA 4N3CA 4N2SA 4ANWA 2WXPA 2EQXA 3FULA 3ZYKA 2VTBB 2CHZA 3T5XA 1UW4B 4GAAA 3IHYA 3ML8A 3NF1A 4N3BA 4B8CB 4FADA 5EDSA 5KJMA 5FZRA 4I1OB 3AU4A 4F7AA 1MHQA 1VDYA 5G55A 1JPLA 4I1AA 5AJLA 5ARFA 4FLHA 3VLFA 4K0RA 3FH7A 2V0PA 1HH8A 3AS8A 3GZ1A 3QJZA 3QWWA 2L0IA 1H2UA 2MRIA 3SBTB 4UQXA 3RIBA 3I4GA 4ILHB 4XIFA 4WNDA 2IQCA 3C98A 3FEXA 3LYAA 4B0ZA 3CHSA 5BW8C 2XRYA 3K9IA 3G2WA 5EKQD 3NZSA 3QDNA 3ZHEA 5CHEE 5LFAA 3JCKC 4QFVA 4GMLA 4F1SA 3FTVA 3OXFA 4HOQA 4U0UA 4I2ZA 4OVUA 5FTPA 3VTXA 3SD5A 2QFCA 1Y8MA 3FU3A 5FQ7A 3DPDA 4TUUA 3ZFWA 3ASDA 4WWPA 1H2TC 3CIAA 4GZCA 3L16A 3PVLA 1PAQA 1SZAA 2KCKA 3QKYA 4CT4A 5BT1A 3ZHEB 3T5VA 4AY6A 3PS6A 5T3RA 3IBEA 1X5BA 2XGMA 3ONLA 5FQ8A 3LKUA 2C2LA 2WM9A 2FO7A 2BF0X 1UN8A 5D0QD 1S0PA 4AM9A 4JPSA 2X6FA 4ANXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PC2 A;  5G04 C;  5LCW J;  2PL2 A;  4GYW A;  2Y4U A;  2UWJ G;  2XGS A;  2Y4T A;  1FCH A;  4O6F A;  4KBQ A;  4WNF A;  2XEV A;  4GA0 A;  2WPV A;  5JJ6 A;  3OXG A;  4Y6W A;  3EDT B;  3Q15 A;  1E96 B;  3KD7 A;  2IF4 A;  2VYI A;  4AY5 A;  2PZI A;  3AS5 A;  2VSY A;  4G23 A;  4GYO A;  3S7F A;  1ELW A;  3RU0 A;  1P5Q A;  4G25 A;  1ELR A;  1YA0 A;  2DBA A;  2P58 C;  4CGV A;  4KXK B;  3U3W A;  2J9Q A;  4YVO A;  2C0M A;  3WXX A;  3PE4 A;  4UI9 C;  5D0O D;  4G26 A;  5EX3 A;  5EX0 A;  4HOR A;  4JA7 A;  4Y6C A;  4BTA A;  3S7J A;  3TGO A;  1ZU2 A;  5FZS A;  5DIZ A;  4IN3 B;  3ASG A;  2I6H A;  3AS4 A;  3TAX A;  3BEE A;  5G04 J;  3GZ2 A;  2UY1 B;  5LCW C;  3Q4A B;  3CK8 A;  2XCB A;  4GZ3 A;  2LSU A;  4HOT A;  5CCM A;  1KT0 A;  4WUY A;  3N71 A;  5G05 J;  1WM5 A;  1HZ4 A;  3ASF A;  3ULQ A;  4BTB A;  2YHC A;  3QWV A;  4JA9 A;  3ASH A;  3VTX A;  2OOE A;  4I2W A;  2HR2 A;  2KAT A;  3LCA A;  1QQE A;  5FT9 A;  3TG4 A;  3U4T A;  3VTY A;  3ZGQ A;  4BT9 A;  2VGX A;  4N3A A;  4I17 A;  2BUG A;  2HYZ A;  1TJC A;  3LPZ A;  5A6C A;  2HO1 A;  2R5S A;  4J8D A;  4NRH B;  4AIF A;  5JJT A;  2VGY A;  5FJY A;  4I9C A;  2FF4 A;  3ZPJ A;  4JHR A;  5JJ7 A;  1NA3 A;  2GW1 A;  4KYO B;  1QZ2 A;  4B94 A;  4UQY A;  2OND A;  3RO2 A;  1HXI A;  4I9E A;  4G1T A;  5CCL A;  4N5C A;  3CK9 A;  1KT1 A;  3CEQ A;  1B89 A;  1NA0 A;  3MKR A;  2Q7F A;  3FWV A;  2UY1 A;  3UUX A;  2XCC A;  2AVP A;  4N3C A;  4J8E A;  4XI9 A;  4BT8 A;  4N2S A;  1W3B A;  4RG9 A;  3MV3 B;  4W9R A;  5HQ8 A;  3ZN3 A;  3E4B A;  4H7X A;  5HI7 A;  3UPV A;  4GCN A;  3FFL A;  3MV2 B;  1IYG A;  3RJV A;  4YND A;  3GW4 A;  3LY8 A;  4HOU A;  5FZQ A;  3ESK A;  3CKC A;  4GCO A;  3NF1 A;  4N3B A;  5A7D B;  1OUV A;  2KC7 A;  2IFU A;  3CVQ A;  3CVP A;  2VQ2 A;  3QWP A;  5DBK A;  1WAO 1;  1KLX A;  5FZR A;  3RKV A;  5KJM A;  4BWR A;  3HYM B;  4U04 A;  4A1S A;  4LEU A;  4CGW A;  4U07 A;  3FP3 A;  4I1A A;  5BNW A;  4J0U A;  4U0S A;  4G24 A;  1ZBP A;  4YVQ C;  5ARF A;  5KJK A;  4EQF A;  1HH8 A;  2NC9 A;  3AS8 A;  3GZ1 A;  3IEG A;  3PE3 A;  3QWW A;  4N39 A;  4WNG A;  2KCV A;  2C0L A;  3RO3 A;  3URZ A;  4N2Q A;  2XGO A;  3TG5 A;  4UQX A;  4RG6 A;  2VSN A;  5KJL A;  2L6J A;  4U0Z A;  3RIB A;  2VGX B;  4XIF A;  4WND A;  4GZ6 A;  3CK7 A;  3LYA A;  4HOS A;  3KS2 A;  5M72 A;  5BW8 C;  3K9I A;  4GA1 A;  5EKQ D;  3QDN A;  3ZHE A;  5CHE E;  3LY9 A;  3ZFW A;  2JLB A;  2XPI A;  3Q47 B;  4GPK A;  4J8F A;  4ABN A;  2YQ8 A;  1NZN A;  1XNF A;  5AYW D;  2MHK A;  5ARG A;  3OXF A;  4HOQ A;  4U0U A;  4I2Z A;  2E2E A;  2V5F A;  5FTP A;  4UI9 J;  2QFC A;  3SF4 A;  1Y8M A;  3LY7 A;  3PDN A;  2PQN A;  5G05 C;  3GYZ A;  1IHG A;  3KAE A;  3OXL A;  4GZ5 A;  4XI0 A;  3CVL A;  3Q5M A;  1A17 A;  2FBN A;  3ASD A;  4GA2 A;  4H7Y A;  3JYS A;  4GYY A;  3S7D A;  3SZ7 A;  4APO A;  3Q49 B;  5KJN A;  3CVN A;  4NQ0 A;  4CDR A;  4F3V A;  2KCK A;  3QKY A;  5C1D A;  5BT1 A;  3ZHE B;  4WNE A;  4ME2 A;  4AY6 A;  2WQH A;  2FEZ A;  2KCL A;  2XGM A;  3S7B A;  2LSV A;  3LKU A;  4UQZ A;  2FI7 A;  2PQR A;  4G2V A;  2C2L A;  2LNI A;  4JL0 A;  4UI9 K;  3CKB A;  3QOU A;  3UQ3 A;  2FO7 A;  3MA5 A;  3MEK A;  5D0Q D;  3O48 A;  3R9A B;  4AM9 A;  3CV0 A; 
#chains in the Genus database with same CATH topology
 5LCW J;  3PRE A;  1FCH A;  1HX8 A;  2WXG A;  5EID A;  1UN9 A;  4ANU A;  3FTX A;  3KD7 A;  4LCT A;  4HI9 A;  1IQR A;  3Q9N C;  3D9L A;  5JHB A;  2HM8 A;  2DBA A;  4CGV A;  5J08 A;  1IKN D;  3UT7 A;  5EX3 A;  4XKC A;  2WVI A;  1Y6I A;  3FU5 A;  3ULQ A;  4XZ4 A;  4K5A B;  1HU3 A;  1QQE A;  3F6Q A;  3FDH A;  2DIW A;  1TJC A;  3B7S A;  1NA3 A;  3D9N A;  1SA5 A;  4HB5 A;  3CK9 A;  3FUF A;  3AG4 E;  1OCR E;  3QK0 A;  3UT4 A;  1JCQ A;  2WXJ A;  5KNH D;  4DLQ A;  1WAO 1;  4BWR A;  5BNW A;  4YDO A;  3Q73 A;  4YVQ C;  4WNG A;  3C3O A;  2KCV A;  2OV8 A;  1MX2 A;  2B0O E;  2XRZ A;  1OWL A;  3ZIM A;  5AQ7 A;  3L22 A;  3FTW A;  4KZ0 A;  2X6K A;  3SI5 A;  1XNF A;  3HXB A;  1D8E A;  1N0R A;  2VSX E;  3GYZ A;  1UOH A;  4LNG A;  4ACL A;  1N54 A;  3HDX A;  2ILR A;  5BPP A;  4HXI A;  4FJY A;  2XS8 A;  1GW6 A;  2IU1 A;  1PC2 A;  2PL2 A;  2X6J A;  3WG7 E;  4O6F A;  2WXO A;  3I3N A;  5EYP F;  2A5U A;  3SBS A;  2J08 A;  2PNN A;  2PZI A;  1X81 A;  4GU5 A;  3QB2 A;  3S7F A;  3MX3 A;  2WXF A;  3FH5 A;  3T8M A;  5J90 A;  4YVO A;  5D2M C;  5ANR A;  3EU5 A;  1QNF A;  4HOT A;  3NBN B;  1WG0 A;  3G2S A;  3TWU A;  5LX8 A;  3ENE A;  3TWV A;  3CHQ A;  4I9C A;  5JJ7 A;  4XE0 A;  4KYO B;  3RK6 A;  5CCL A;  3TWR A;  3FUI A;  3CVV A;  2XCC A;  1RW2 A;  5CRV A;  4RG9 A;  5HI7 A;  4GCO A;  4L1B A;  2EIK E;  5DBK A;  3RRU A;  3UMV A;  4LEU A;  4J0U A;  4G24 A;  4KT6 B;  4ILI A;  2ZIS A;  3CK7 A;  1JUQ A;  2IY0 C;  4GA1 A;  3FEY A;  4HS2 A;  4J8F A;  1NZN A;  1H0A A;  3SNX A;  2PQN A;  4BEP A;  4XI0 A;  1JWG A;  3R7R A;  4CDR A;  2DYR E;  4ME2 A;  5AIJ A;  4I1M A;  4K5B A;  3S7B A;  4JVS A;  3UQ3 A;  3D9P A;  3CKB A;  3QOU A;  3T9K A;  1EPU A;  3FUN A;  4CEM A;  3PEV B;  4B89 A;  4KBQ A;  4EBA G;  2ION A;  1SQM A;  4YDY A;  4HI8 A;  1LF8 A;  3NZU A;  2VYI A;  4E85 A;  2J9Q A;  3PE4 A;  3C72 A;  2XS1 A;  4Y6C A;  2JAB A;  3AG2 E;  3TGO A;  3SQV A;  2I6H A;  3Q4A B;  2CG2 A;  4J7W A;  2R59 A;  1WM5 A;  2YHC A;  5D66 A;  3AU5 A;  2VJ8 A;  3ZGQ A;  4HOR A;  3VTY A;  1HE8 A;  2I2O A;  2HYZ A;  5A6C A;  2RFM A;  4AP2 A;  2XPZ A;  1E8Y A;  3HVE B;  2AWI A;  5CER B;  2Q7F A;  5CMY A;  5AQ9 A;  3UX4 A;  1W3B A;  1S70 B;  2WXM A;  3ABK E;  3E4B A;  4GCN A;  3MV2 B;  1BD8 A;  2GRO B;  1E8X A;  3U9W A;  4YND A;  3ESK A;  5A7D B;  4DLO A;  2KC7 A;  2LAI A;  3HVE A;  1E8W A;  5JA4 D;  4JEH A;  4RG6 A;  5KJL A;  5M72 A;  3UIO C;  1OCZ E;  3D9J A;  2RKK A;  1A5E A;  2EIJ E;  1HF8 A;  4I43 A;  3MGB A;  4R7L A;  2GRR B;  4C0M A;  1HO8 A;  5BV0 A;  5HRY A;  3MEK A;  3V2X A;  3CV0 A;  3FY4 A;  3PZ1 A;  2BTD A;  3ZEF A;  3D9H A;  4Y6W A;  3EJN A;  3BUA A;  1E96 B;  3FU6 A;  3PRZ A;  1P5Q A;  2E0I A;  1TN6 A;  2X38 A;  5EX0 A;  5EIB E;  5KNG A;  3BEE A;  5G04 J;  3TWQ A;  2J07 A;  4OAV B;  3UM3 A;  1N4R A;  2Y3A A;  4DJA A;  5FIO A;  5FT9 A;  3IV0 A;  4GPK A;  3DBS A;  3DXK G;  4N3A A;  4JHR A;  3EHM A;  2GW1 A;  2R05 A;  2P9I G;  3E33 A;  1TN8 A;  3V30 A;  5ANL A;  3FTU A;  1FVH A;  2UY1 A;  4ANW A;  4HRN A;  1YCS B;  2VTB B;  3DXM G;  2CHZ A;  3T5X A;  3L9T A;  1KPS B;  3ZU7 B;  3AU4 A;  1MHQ A;  4HNA D;  5B1B E;  4K0R A;  5ENS D;  3AAA C;  3SBT B;  3FEX A;  3LYA A;  4B0Z A;  3B7B A;  3DSX A;  3NZS A;  3ZHE A;  5LFA A;  4GML A;  4F1S A;  3BU8 A;  4U0U A;  1N9A A;  2QFC A;  2LUH A;  3DPD A;  3ZFW A;  4WWP A;  4GZC A;  4GTM A;  2LXM A;  2KCK A;  4CT4 A;  5BT1 A;  3ZHE B;  5T3R A;  5FQ8 A;  3LKU A;  2V5Q C;  2BF0 X;  1FPP A;  2OEV A;  5D0Q D;  4GZD A;  3SFZ A;  4GYW A;  2DZO A;  2FO1 E;  4OYS A;  4DX6 D;  4BER A;  4L2L A;  2Y1L E;  4AY5 A;  5ENO D;  4J6I A;  4CCA A;  3I4R B;  4MS6 A;  2C0M A;  1AWC B;  4G26 A;  3SY2 A;  5AAR A;  5LCW C;  1AP7 A;  2FUL A;  4I6J A;  5A23 A;  4O1O A;  3C3R A;  3ZUV B;  1TN7 A;  4TXQ A;  5B1A E;  1K1B A;  5JJT A;  2IOS A;  4ZHB A;  3ZXP A;  4UQY A;  3I5P A;  4N5C A;  3LDZ A;  4XI9 A;  2AVP A;  4F6R D;  3ZN3 A;  3V2O A;  4FC8 A;  2AXU A;  2VQ2 A;  3HYM B;  3B7R L;  3FP3 A;  1ZBP A;  4NUR A;  4CRW A;  5LOZ A;  3URZ A;  2F37 A;  3RO3 A;  5ENN A;  3CVU A;  4GTQ A;  1S63 A;  1V54 E;  5AAO A;  2V5F A;  3O4Z A;  3LY7 A;  3Q79 A;  4HQD A;  5G05 C;  3Q5M A;  4U95 D;  1MZC A;  3APF A;  1EF1 C;  2M63 A;  4JHJ A;  5C1D A;  4GTT A;  4F1P A;  4PS3 A;  3L82 A;  2I1J A;  1D9S A;  2GRP B;  3UM1 A;  4BSX A;  2P9U G;  3DSV A;  1YMP A;  4WNF A;  3CVY A;  1EDU A;  3KSQ A;  2RFA A;  2P9N G;  3Q15 A;  5CRU A;  3RRM B;  3TWX A;  3FTS A;  3PH0 C;  2VSY A;  3AJI A;  4KXK B;  1MX6 A;  2YIN A;  3U3W A;  2QY7 A;  2ZU6 B;  3LJ3 A;  4RSY A;  4Q69 A;  1SVX A;  4GZ3 A;  3S2A A;  3MZL B;  4K5C A;  2YNQ A;  2BUG A;  4AIF A;  2CFZ A;  3E34 A;  2F8Y A;  3CEQ A;  2VSO E;  4OAU C;  4ACK A;  1OWM A;  1UJK A;  4U8Y D;  5FZQ A;  4TUM A;  1OUV A;  3PUJ A;  3E32 A;  4U0Z A;  3HXD A;  2NXP A;  2ZXW E;  2JLB A;  3CHR A;  4HRL A;  1LTX A;  3DEP A;  2R2L A;  1PY1 A;  3OXL A;  3S7D A;  2FBN A;  2AW6 A;  3JQ0 A;  4PUC A;  4AEZ C;  2KCL A;  4UQZ A;  4G2V A;  2P9S G;  4ILG A;  2DVW A;  3DEO A;  1N0Q A;  1MQS A;  3CQC B;  3TXN A;  2LAH A;  4MRU A;  1JWF A;  2DCP A;  4FA6 A;  4DK5 A;  4PH4 B;  1IQU A;  2XZT G;  1TEZ A;  3CR3 A;  3KEA A;  3PZD A;  1FVF A;  2ZGG A;  2V4L A;  2L9B A;  3TXM A;  5CCM A;  1KT0 A;  2LO6 A;  3APD A;  3TWT A;  4GB9 A;  4I17 A;  1ELK A;  5AEN A;  2V8S E;  1OXJ A;  2QYJ A;  3L6A A;  4YDW A;  5E75 A;  1RZ4 A;  1BU9 A;  2IFU A;  2WMO A;  3L17 A;  3VLE A;  4U04 A;  1HFA A;  5E76 A;  4P29 A;  2C0L A;  5FWQ A;  2VSN A;  4U7E B;  2WXH A;  4MLP A;  2BED A;  5BXU A;  4CYM D;  5C2Y A;  1H6O A;  2ETC A;  3SF4 A;  4UI9 J;  5AQB A;  1MJ0 A;  3KAE A;  1IHG A;  2NYJ A;  3RSE G;  3Q49 B;  2R17 C;  3DSW A;  3ABM E;  4KVM A;  4HLE A;  1Q2Z A;  2X6I A;  2GRQ B;  4PDX A;  2WXR A;  4A63 B;  3R9A B;  1H2V C;  2P9K G;  4EZK A;  5G04 C;  4BSZ B;  2X6H A;  3L54 A;  4LG6 A;  2IO3 C;  5JJ6 A;  4ATG A;  4C0E A;  2IF4 A;  4JXT A;  4XEI G;  1E90 A;  4Q94 A;  5EYL A;  3FTY A;  1E8Z A;  4G25 A;  4PS8 A;  1TJF A;  3ZYM A;  3BG1 B;  3WXX A;  2XEE A;  4WAF A;  1IXV A;  3S7J A;  1U2V G;  2UY1 B;  3CK8 A;  2XCB A;  4EHM A;  1NL4 A;  4JA9 A;  2NSZ A;  5CED B;  4I2W A;  3U4T A;  3C3Q A;  3FHE A;  4NRH B;  3EHN A;  3FTZ A;  4KMO A;  1Z3X A;  1Z5S C;  3RO2 A;  3ZW3 A;  4KVO A;  1NI1 A;  2WXP A;  1N11 A;  3ML8 A;  4B8C B;  4FAD A;  5KJM A;  4F7A A;  1VDY A;  4ATZ D;  5CBN A;  5AJL A;  3VLF A;  3AS8 A;  3QJZ A;  2MRI A;  4QQI A;  4UQX A;  1BI8 B;  3I4G A;  4ILH B;  4XIF A;  2IQC A;  3C98 A;  5BW8 C;  2XRY A;  3EHR A;  3K9I A;  5JMN D;  1O1S A;  1MYO A;  1SA4 A;  3FTV A;  1TNZ A;  5FTP A;  1Y8M A;  5FQ7 A;  4N5Q A;  4M7C A;  2R03 A;  3PVL A;  1S64 A;  3UXG A;  4G8K A;  2FO7 A;  1S0P A;  3ASN E;  3UIN C;  3HG0 D;  5T8I A;  4JPS A;  3PZ3 A;  4E6H A;  1N4Q A;  3CHP A;  4U96 D;  4LER A;  4IUL A;  5H7P A;  4AXH A;  4DX7 D;  1ELW A;  2KBX A;  2CHW A;  3ESL A;  2DZN A;  3BG0 B;  4XKB A;  2JEK A;  4JA7 A;  3AS4 A;  2LSU A;  3EIJ A;  4AOF A;  3KEZ A;  3OAW A;  3ASH A;  3QAQ A;  4UWF A;  2HR2 A;  4TV3 A;  3MKQ A;  5BUZ A;  4URK A;  2Y0B G;  3FUH A;  2A4Z A;  5FIN A;  4GPM A;  2WXQ A;  2IJG X;  1BLX B;  5HQ8 A;  3ZYL A;  1HG5 A;  3FFL A;  1K8K G;  1NP7 A;  5B3S E;  3CKC A;  4MKT A;  4DI3 A;  3CVQ A;  1N4P A;  4CZ2 D;  1N95 A;  1TNB A;  4LNB A;  5KJK A;  3PUK A;  3IEG A;  1Z6T A;  5HKP A;  3TG5 A;  4B8A A;  1N4S A;  5CMW A;  4HVB A;  4L9P A;  3QAR A;  2IOL A;  2RG8 A;  4I6E A;  3Q47 B;  4V3I A;  4ABN A;  2LXL A;  1H6K A;  1HS6 A;  4BES A;  4UWH A;  4LUN U;  3CVL A;  1A17 A;  4APO A;  1N52 A;  2ZIR A;  4BET A;  3ML9 A;  4TRQ A;  3TWS A;  3V31 A;  3HXC A;  2F0Y A;  5KCM A;  2XEN A;  2WQ7 A;  2AJA A;  2PQR A;  5AJD A;  4UI9 K;  4A55 A;  4AJW A;  1H6P A;  5CEA A;  1DC2 A;  1WY6 A;  3JUI A;  4OVV A;  4XX5 A;  3G2T A;  1OWN A;  4EZJ A;  4GYO A;  4J8S A;  3UKR G;  3HIZ A;  4F53 A;  2OEW A;  3ABL E;  2IO2 C;  4GTS A;  3ULY A;  4O60 A;  3CSF A;  1FT1 A;  4A3V A;  3EUV A;  3APC A;  3JXJ A;  3B13 A;  2XEH A;  4FLB A;  2ETA A;  3G2V A;  3DSS A;  3UT8 A;  1Z3Y A;  4EPZ A;  2RD0 A;  5AN8 A;  4BT8 A;  4J8E A;  4W9R A;  3MV3 B;  1IYG A;  3ZNG A;  3RJV A;  4HOU A;  4CDN A;  3RKV A;  4CGW A;  2WQ6 A;  1QYM A;  4U63 A;  4DUI A;  3U66 A;  4HBD A;  3L13 A;  4L7T A;  1G3N B;  3PEU B;  2HE0 A;  2MHK A;  4GTR A;  3CVN A;  4LRZ A;  1OCC E;  2WXK A;  4K03 A;  4GTV A;  2FI7 A;  4JL0 A;  3PNT B;  3O48 A;  2XGS A;  2Y4T A;  4GA0 A;  4JHK A;  3UI2 A;  4RLY A;  2P2C P;  2WMN A;  4ANV A;  3RU0 A;  3ONK A;  1YA0 A;  2XZD G;  4RVB A;  2PM6 A;  2WXL A;  5FQ4 A;  1WDY A;  5DIZ A;  4IN3 B;  3ASG A;  2PM7 A;  3TJP A;  3P1U A;  4AV7 A;  2BKG A;  3IKO B;  3V79 K;  3TG4 A;  1O5M A;  2L6B A;  2HO1 A;  2VGY A;  4KZC A;  3P2B A;  4I9E A;  3MKR A;  3FUK A;  1NFI E;  3UIP C;  5KBA A;  3FUM A;  2OVB A;  2CFU A;  3QWP A;  1KLX A;  4JD2 G;  4U07 A;  3PE3 A;  3PZ4 A;  1O1T A;  3SO8 A;  2J09 A;  4FHK A;  1L5J A;  3LY9 A;  2KZT B;  5FQ6 A;  4WWN A;  5AYW D;  4FUL A;  3PDN A;  1HG2 A;  2QZA A;  4GYY A;  5T4Y A;  2OCC E;  3ULE G;  2CG3 A;  1N94 A;  2VGE A;  3RRN B;  3ASO E;  4JB8 P;  2QYU A;  2WQH A;  3CHO A;  3W9G A;  2LNI A;  2WXI A;  3IHV A;  3FUJ A;  4I6G A;  3DST A;  3W9F A;  4M3O A;  2DWZ A;  3EHQ A;  3ZXS A;  3OTN A;  3AS5 A;  4C48 B;  4UWL A;  4EEC A;  3LS8 A;  4UI9 C;  3FH8 A;  3X2Q E;  3FUE A;  4CDM A;  2QC9 A;  4EBA A;  3FUD A;  3GZ2 A;  1E7U A;  3MCX A;  4GTP A;  4U8H A;  4A3T A;  3ASF A;  4D10 C;  1MX4 A;  3LPZ A;  4BX9 A;  3LEW A;  2FF4 A;  2B6C A;  1HXI A;  3GZS A;  3B95 A;  1B89 A;  1NA0 A;  3UUX A;  2ETB A;  1JCS A;  2EQX A;  3FUL A;  3ZYK A;  1UW4 B;  3NF1 A;  4N3B A;  2DYS E;  5FZR A;  4I1O B;  5G55 A;  1JPL A;  4DX1 A;  3FH7 A;  2V0P A;  2L0I A;  4GMR A;  1H2U A;  1SW6 A;  4J8Y A;  3RIB A;  3UM0 A;  5EKQ D;  3C5R A;  4ZFH A;  3JCK C;  3ISM C;  4I2Z A;  3VTX A;  3SD5 A;  4O1P A;  4TUU A;  3ASD A;  3CIA A;  4UUC A;  3L16 A;  1TR4 A;  1SZA A;  3T5V A;  3NOG D;  3IBE A;  2XGM A;  3ONL A;  2WM9 A;  3NB2 A;  1UN8 A;  4DI4 A;  3DSU A;  1UJJ A;  2Y4U A;  3SFX A;  3OXG A;  3EDT B;  2AXV A;  4MBG A;  3LVR E;  2EIL E;  4TXR A;  5D0O D;  4Z68 A;  3JQ1 A;  4Q96 A;  1V55 E;  1TNO A;  3CST A;  3N71 A;  5G05 J;  4BTB A;  3UTM A;  3DPY A;  3JUE A;  3LCA A;  4BT9 A;  2VGX A;  1DVP A;  3Q7A A;  3AG1 E;  1QZ2 A;  4G1T A;  3HXE A;  4L2Y A;  2XHE A;  5BXO A;  3LJN A;  3FU0 A;  2XQ0 A;  2L0T B;  3NOC D;  4LNU D;  4NIK A;  1INZ A;  4N39 A;  2F8X K;  4B93 B;  3CQG B;  2L6J A;  3L08 A;  3NAW A;  3MJW A;  2EIM E;  2CHX A;  3D9M A;  1KZP A;  1O1R A;  1TNY A;  3HXF A;  3HHM A;  4JW1 A;  2MOW A;  5CEC B;  3Q7F A;  5KJN A;  4F3V A;  2H6F A;  2GRL A;  4WNE A;  4FJZ A;  2FEZ A;  2LSV A;  3G2U A;  3CHM A;  2BKK B;  4U8V D;  3NQP A;  4FHJ A;  5LP0 A;  1DNP A;  2WPV A;  4A1G A;  3E30 A;  4IRU A;  1XGW A;  3ZKJ A;  3IXE A;  2P58 C;  4CT0 A;  3BQO A;  5ENT D;  1ZU2 A;  5FZS A;  5ENR D;  1KZO A;  2I1K A;  3D9K A;  3CVX A;  1IHB A;  4BX8 A;  1HZ4 A;  3MKQ B;  3QWV A;  2OOE A;  2J4B A;  3Q9U C;  1H19 A;  3SFY A;  5FJY A;  3TWW A;  1TYQ G;  2ZGD A;  1QBQ A;  4GMJ A;  3FWV A;  5ENQ D;  3LY8 A;  2AXZ A;  2IEJ A;  3CVP A;  4HLL A;  3J5P A;  4YDE A;  4HFG A;  4U0S A;  1FT2 A;  4EQF A;  2V4H C;  4FU3 A;  2XGO A;  3ZYQ A;  3PZ2 A;  1OCO E;  2VGX B;  3KS2 A;  3RAU A;  4WWO A;  1YYH A;  2XPI A;  1OWP A;  2YQ8 A;  4UWK A;  2A5E A;  2E2E A;  1ZB1 A;  5BV1 A;  4DPR A;  2H6I A;  1U3D A;  5G2N A;  2P9L G;  2OVF A;  3ZVV A;  1OT8 A;  3QNK A;  3UM2 A;  3MA5 A;  4HRM B;  3D9I A;  3SHF A;  2GGF A;  2YHE A;  4AVX A;  4JEU A;  4G8L A;  4APF A;  4BFR A;  3UKU G;  4G23 A;  4BY6 A;  4IYP A;  3MYV A;  1U3C A;  1DCQ A;  5EN5 D;  1LD8 A;  4DRX E;  3JXI A;  3KSL A;  4G11 A;  2MYO A;  2KZT A;  4L23 A;  3B7T A;  3TAX A;  1OWO A;  2R02 A;  4WUY A;  3J5Q B;  1K1A A;  3LVQ E;  5JHA A;  3SGH A;  5AQA A;  3ZPJ A;  3ZRH A;  1E7V A;  3U64 A;  3CVW A;  5IY5 E;  3UPV A;  4H7X A;  2GRN B;  1BPO A;  3GW4 A;  2Y69 E;  2VTB A;  2I9C A;  3Q75 A;  3D9O A;  1SZ9 A;  4A1S A;  2NC9 A;  5EIL A;  4TXP A;  4N2Q A;  1JCR A;  3R7Q A;  4GZ6 A;  3VLD A;  4HOS A;  1UG3 A;  4DX5 D;  3DRA A;  3B7U X;  5ARG A;  4DX2 A;  5CBO A;  4GZ5 A;  4GA2 A;  3SZ7 A;  4H7Y A;  2XPY A;  3JYS A;  4NQ0 A;  2H6H A;  2KM4 A;  3CLJ A;  2J8S D;  4EZL A;  1D8D A;  1OY3 D;  3E37 A;  2J49 A;  1BI7 B;  3AG3 E;  2UWJ G;  2XEV A;  2WB2 A;  3LXU X;  2X3M A;  4LSZ E;  4PS7 A;  4C9B B;  3CGH A;  5KWD A;  2H6G A;  3D3M A;  1ELR A;  2WXN A;  3PNL B;  3T8K A;  3EIQ C;  1K3Z D;  4FP7 A;  4BTA A;  4JC8 A;  3QC1 A;  4UWG A;  4GTO A;  3R9M A;  4JZY A;  3TL5 A;  2KAT A;  4NAC A;  2R5S A;  2GRM A;  4J8D A;  1EYH A;  2J4D A;  4B94 A;  2OND A;  1KT1 A;  5ENP D;  2EIN E;  4N3C A;  3DWL G;  4N2S A;  4GAA A;  3IHY A;  5EDS A;  3HRA A;  4I1A A;  5ARF A;  4FLH A;  4RQI A;  1HH8 A;  3GZ1 A;  3QWW A;  4WND A;  3CHS A;  3G2W A;  3QDN A;  5CHE E;  4QFV A;  3OXF A;  4HOQ A;  5ITZ F;  2P9P G;  4OVU A;  3FU3 A;  3Q78 A;  3EU9 A;  4X8Q A;  1TNU A;  1H2T C;  5HS0 A;  1PAQ A;  3QKY A;  4AY6 A;  3PS6 A;  1X5B A;  1DCE A;  2C2L A;  1LD7 A;  2KXP C;  4AM9 A;  2X6F A;  4ANX A; 
#chains in the Genus database with same CATH homology
 4GZD A;  3SFZ A;  5LCW J;  1UJJ A;  3PRE A;  4GYW A;  2Y4U A;  1FCH A;  1HX8 A;  2WXG A;  4OYS A;  3OXG A;  3EDT B;  4E6H A;  3CHP A;  1UN9 A;  2AXV A;  3FTX A;  4ANU A;  3KD7 A;  4L2L A;  4IUL A;  4LER A;  1IQR A;  4LCT A;  4AY5 A;  4AXH A;  3D9L A;  5JHB A;  2HM8 A;  1ELW A;  3LVR E;  2CHW A;  4J6I A;  4CCA A;  2DBA A;  4CGV A;  5J08 A;  3ESL A;  3I4R B;  3BG0 B;  2C0M A;  4MS6 A;  3UT7 A;  4XKB A;  2JEK A;  5D0O D;  4G26 A;  5EX3 A;  3JQ1 A;  4JA7 A;  4Q96 A;  4XKC A;  2WVI A;  3AS4 A;  5LCW C;  1Y6I A;  2FUL A;  4I6J A;  3FU5 A;  5A23 A;  2LSU A;  3EIJ A;  3CST A;  4AOF A;  3KEZ A;  3ULQ A;  3N71 A;  5G05 J;  4XZ4 A;  4BTB A;  3OAW A;  3ASH A;  3QAQ A;  4UWF A;  1HU3 A;  2HR2 A;  3LCA A;  4TV3 A;  1QQE A;  3FDH A;  3MKQ A;  4BT9 A;  5BUZ A;  2VGX A;  4URK A;  2DIW A;  1TJC A;  3B7S A;  5JJT A;  3FUH A;  1DVP A;  2IOS A;  1NA3 A;  2A4Z A;  1QZ2 A;  4UQY A;  2WXQ A;  3D9N A;  3I5P A;  4G1T A;  4N5C A;  3LDZ A;  3CK9 A;  3FUF A;  4L2Y A;  2IJG X;  2XHE A;  4XI9 A;  2AVP A;  3QK0 A;  3FU0 A;  3UT4 A;  5HQ8 A;  3ZYL A;  3ZN3 A;  1HG5 A;  2WXJ A;  2XQ0 A;  3FFL A;  2L0T B;  1NP7 A;  4FC8 A;  3CKC A;  4MKT A;  4DLQ A;  4DI3 A;  3CVQ A;  2AXU A;  2VQ2 A;  1WAO 1;  4BWR A;  3HYM B;  1INZ A;  3B7R L;  3FP3 A;  5BNW A;  4YVQ C;  1ZBP A;  4NUR A;  4CRW A;  5KJK A;  5LOZ A;  3PUK A;  3IEG A;  4N39 A;  4WNG A;  1Z6T A;  3URZ A;  2KCV A;  2OV8 A;  3RO3 A;  3TG5 A;  4B8A A;  5CMW A;  3CQG B;  2L6J A;  2XRZ A;  4HVB A;  1OWL A;  3L08 A;  3QAR A;  3MJW A;  2IOL A;  5ENN A;  2RG8 A;  3ZIM A;  2CHX A;  3D9M A;  3L22 A;  4I6E A;  3CVU A;  3FTW A;  4KZ0 A;  3Q47 B;  4V3I A;  2X6K A;  3SI5 A;  4ABN A;  1H6K A;  1XNF A;  1HS6 A;  2VSX E;  2V5F A;  4UWH A;  3O4Z A;  3LY7 A;  3HHM A;  5G05 C;  3GYZ A;  4LUN U;  4JW1 A;  2MOW A;  3CVL A;  3Q5M A;  1A17 A;  4APO A;  4DI4 A;  3APF A;  4ACL A;  1EF1 C;  2M63 A;  5KJN A;  1N54 A;  1N52 A;  4JHJ A;  3ML9 A;  4F3V A;  5C1D A;  4TRQ A;  2GRL A;  4WNE A;  3HDX A;  4PS3 A;  2ILR A;  4FJZ A;  5KCM A;  5BPP A;  4HXI A;  2FEZ A;  2WQ7 A;  2I1J A;  2LSV A;  3G2U A;  4FJY A;  2PQR A;  5AJD A;  4UI9 K;  1GW6 A;  4A55 A;  4AJW A;  2IU1 A;  4BSX A;  3CHM A;  1PC2 A;  3NQP A;  1WY6 A;  2PL2 A;  4FHJ A;  2X6J A;  3JUI A;  4O6F A;  4WNF A;  5LP0 A;  1DNP A;  2WPV A;  2WXO A;  3I3N A;  4OVV A;  1EDU A;  4A1G A;  3CVY A;  2A5U A;  4XX5 A;  3SBS A;  3Q15 A;  2J08 A;  3RRM B;  3G2T A;  4IRU A;  1OWN A;  1XGW A;  2PZI A;  4EZJ A;  3FTS A;  4GU5 A;  3PH0 C;  2VSY A;  3QB2 A;  4GYO A;  3S7F A;  3MX3 A;  2WXF A;  3FH5 A;  4J8S A;  2P58 C;  3T8M A;  4KXK B;  2YIN A;  5J90 A;  2QY7 A;  4YVO A;  2ZU6 B;  3U3W A;  4CT0 A;  3HIZ A;  3LJ3 A;  4RSY A;  4F53 A;  1ZU2 A;  5ANR A;  5FZS A;  4Q69 A;  2I1K A;  3D9K A;  3CVX A;  1QNF A;  4GZ3 A;  4BX8 A;  3S2A A;  4HOT A;  3MZL B;  1HZ4 A;  3MKQ B;  3CSF A;  3QWV A;  2OOE A;  4A3V A;  2J4B A;  2YNQ A;  3G2S A;  2BUG A;  1H19 A;  3APC A;  4AIF A;  3ENE A;  2CFZ A;  5LX8 A;  5FJY A;  3CHQ A;  4I9C A;  3B13 A;  5JJ7 A;  4XE0 A;  4FLB A;  4KYO B;  3RK6 A;  4GMJ A;  3G2V A;  5CCL A;  3UT8 A;  3CEQ A;  1Z3Y A;  2VSO E;  3FUI A;  4EPZ A;  3CVV A;  2RD0 A;  3FWV A;  2XCC A;  4BT8 A;  4J8E A;  4W9R A;  4RG9 A;  3MV3 B;  5HI7 A;  4ACK A;  1OWM A;  1UJK A;  1IYG A;  3RJV A;  3LY8 A;  4HOU A;  5FZQ A;  2AXZ A;  4GCO A;  4L1B A;  1OUV A;  5DBK A;  3CVP A;  4CDN A;  3RRU A;  3RKV A;  3UMV A;  3PUJ A;  4CGW A;  4LEU A;  4HFG A;  4J0U A;  4U0S A;  4G24 A;  4EQF A;  2WQ6 A;  4FU3 A;  2XGO A;  4KT6 B;  3ZYQ A;  4U63 A;  4ILI A;  4U0Z A;  2VGX B;  3U66 A;  3CK7 A;  3L13 A;  3KS2 A;  4L7T A;  1JUQ A;  2NXP A;  4GA1 A;  3FEY A;  4WWO A;  4HS2 A;  3PEU B;  2JLB A;  2XPI A;  1OWP A;  4J8F A;  2YQ8 A;  3CHR A;  1NZN A;  1H0A A;  2MHK A;  3SNX A;  4UWK A;  2E2E A;  2PQN A;  1PY1 A;  3OXL A;  5BV1 A;  4XI0 A;  4DPR A;  3S7D A;  2FBN A;  1U3D A;  2AW6 A;  1JWG A;  5G2N A;  3R7R A;  3CVN A;  2OVF A;  4LRZ A;  4CDR A;  3JQ0 A;  4PUC A;  4ME2 A;  2WXK A;  4K03 A;  4AEZ C;  3ZVV A;  5AIJ A;  2KCL A;  4I1M A;  3S7B A;  4UQZ A;  2FI7 A;  3QNK A;  4G2V A;  4JVS A;  4JL0 A;  3D9P A;  3CKB A;  3PNT B;  3QOU A;  3UQ3 A;  3MA5 A;  1EPU A;  3FUN A;  3O48 A;  4ILG A;  4CEM A;  3D9I A;  3SHF A;  2GGF A;  2XGS A;  2Y4T A;  3PEV B;  4B89 A;  2YHE A;  4KBQ A;  4EBA G;  2ION A;  4GA0 A;  4AVX A;  1SQM A;  4JEU A;  1MQS A;  4JHK A;  4APF A;  1LF8 A;  4BFR A;  3NZU A;  2VYI A;  3CQC B;  3TXN A;  4G23 A;  4BY6 A;  2LAH A;  4IYP A;  4ANV A;  2WMN A;  3MYV A;  1U3C A;  3RU0 A;  3ONK A;  1YA0 A;  4MRU A;  4E85 A;  2J9Q A;  1JWF A;  3PE4 A;  2DCP A;  4G11 A;  4FA6 A;  2KZT A;  4Y6C A;  4PH4 B;  4RVB A;  4DK5 A;  3TGO A;  2PM6 A;  1IQU A;  1TEZ A;  2WXL A;  5FQ4 A;  3CR3 A;  5DIZ A;  4IN3 B;  3PZD A;  3ASG A;  4L23 A;  2I6H A;  3B7T A;  3TAX A;  1FVF A;  2V4L A;  2L9B A;  3TXM A;  2PM7 A;  3Q4A B;  3P1U A;  3TJP A;  4AV7 A;  1OWO A;  2CG2 A;  5CCM A;  1KT0 A;  2R59 A;  3IKO B;  4WUY A;  1WM5 A;  2LO6 A;  2YHC A;  3AU5 A;  2VJ8 A;  3TG4 A;  3ZGQ A;  4HOR A;  3APD A;  3VTY A;  1HE8 A;  4GB9 A;  2I2O A;  2HYZ A;  4I17 A;  3LVQ E;  5A6C A;  2HO1 A;  5JHA A;  3SGH A;  2VGY A;  4KZC A;  3ZPJ A;  1ELK A;  3P2B A;  4AP2 A;  5AEN A;  2V8S E;  3ZRH A;  1E7V A;  3U64 A;  2XPZ A;  1E8Y A;  4I9E A;  3L6A A;  3CVW A;  3HVE B;  2AWI A;  3MKR A;  3FUK A;  2Q7F A;  5CMY A;  3UX4 A;  1W3B A;  2WXM A;  5E75 A;  3UPV A;  3E4B A;  3FUM A;  1BPO A;  4H7X A;  4GCN A;  3MV2 B;  3U9W A;  1E8X A;  2OVB A;  4YND A;  3GW4 A;  3ESK A;  2CFU A;  2VTB A;  5A7D B;  4DLO A;  2KC7 A;  2IFU A;  2I9C A;  3QWP A;  2WMO A;  2LAI A;  3D9O A;  3L17 A;  1KLX A;  1SZ9 A;  3VLE A;  4U04 A;  4A1S A;  4U07 A;  1HFA A;  3HVE A;  5E76 A;  1E8W A;  2NC9 A;  4P29 A;  3PE3 A;  4JEH A;  2C0L A;  5FWQ A;  4N2Q A;  2J09 A;  4RG6 A;  2VSN A;  3R7Q A;  4FHK A;  5KJL A;  4GZ6 A;  3VLD A;  4HOS A;  5M72 A;  5T8I A;  1UG3 A;  3D9J A;  1L5J A;  2WXH A;  3LY9 A;  2KZT B;  5FQ6 A;  4MLP A;  4WWN A;  5C2Y A;  5AYW D;  3B7U X;  5ARG A;  3SF4 A;  4FUL A;  4UI9 J;  3PDN A;  1HG2 A;  3KAE A;  1IHG A;  4GZ5 A;  4GA2 A;  3SZ7 A;  4H7Y A;  1HF8 A;  4GYY A;  2XPY A;  3JYS A;  3Q49 B;  2R17 C;  4I43 A;  5T4Y A;  2CG3 A;  4NQ0 A;  3MGB A;  4KVM A;  3RRN B;  4HLE A;  2X6I A;  2KM4 A;  4R7L A;  3CLJ A;  4C0M A;  2WQH A;  3CHO A;  4PDX A;  1HO8 A;  5BV0 A;  4EZL A;  2LNI A;  2WXI A;  2WXR A;  3IHV A;  3FUJ A;  3MEK A;  3R9A B;  1H2V C;  4EZK A;  4I6G A;  3CV0 A;  3FY4 A;  2BTD A;  2J49 A;  5G04 C;  3ZEF A;  2X6H A;  2UWJ G;  2XEV A;  3L54 A;  5JJ6 A;  2WB2 A;  4Y6W A;  3LXU X;  4M3O A;  3EJN A;  4ATG A;  3ZXS A;  4C0E A;  1E96 B;  2X3M A;  4C9B B;  2IF4 A;  3OTN A;  4PS7 A;  4JXT A;  1E90 A;  3AS5 A;  3CGH A;  3FU6 A;  4Q94 A;  3FTY A;  3PRZ A;  1E8Z A;  3D3M A;  1P5Q A;  4G25 A;  1TJF A;  1ELR A;  2WXN A;  3PNL B;  4PS8 A;  4UWL A;  3LS8 A;  3ZYM A;  3BG1 B;  2E0I A;  4EEC A;  3WXX A;  4UI9 C;  2X38 A;  4WAF A;  5EX0 A;  3EIQ C;  3FH8 A;  4BTA A;  4FP7 A;  3S7J A;  3FUE A;  4CDM A;  4JC8 A;  3QC1 A;  4EBA A;  3FUD A;  4UWG A;  3BEE A;  5G04 J;  3GZ2 A;  2UY1 B;  1E7U A;  3CK8 A;  2J07 A;  2XCB A;  3MCX A;  4JZY A;  4U8H A;  4A3T A;  3ASF A;  2Y3A A;  4JA9 A;  2NSZ A;  3TL5 A;  4D10 C;  4DJA A;  4I2W A;  4GPK A;  2KAT A;  3IV0 A;  5FT9 A;  3U4T A;  3DBS A;  4N3A A;  3FHE A;  3LPZ A;  4NAC A;  4BX9 A;  2R5S A;  2GRM A;  4J8D A;  4NRH B;  3EHN A;  3FTZ A;  3LEW A;  1EYH A;  2FF4 A;  4JHR A;  3EHM A;  4KMO A;  2J4D A;  2GW1 A;  4B94 A;  1Z3X A;  2OND A;  3RO2 A;  1HXI A;  3GZS A;  3ZW3 A;  4KVO A;  1KT1 A;  5ANL A;  1B89 A;  1NA0 A;  3FTU A;  1FVH A;  2UY1 A;  3UUX A;  4N3C A;  4N2S A;  4ANW A;  2WXP A;  2EQX A;  3FUL A;  3ZYK A;  2VTB B;  2CHZ A;  3T5X A;  1UW4 B;  4GAA A;  3IHY A;  3ML8 A;  3NF1 A;  4N3B A;  4B8C B;  4FAD A;  5EDS A;  5KJM A;  5FZR A;  4I1O B;  3AU4 A;  4F7A A;  1MHQ A;  1VDY A;  5G55 A;  1JPL A;  4I1A A;  5AJL A;  5ARF A;  4FLH A;  3VLF A;  4K0R A;  3FH7 A;  2V0P A;  1HH8 A;  3AS8 A;  3GZ1 A;  3QJZ A;  3QWW A;  2L0I A;  1H2U A;  2MRI A;  3SBT B;  4UQX A;  3RIB A;  3I4G A;  4ILH B;  4XIF A;  4WND A;  2IQC A;  3C98 A;  3FEX A;  3LYA A;  4B0Z A;  3CHS A;  5BW8 C;  2XRY A;  3K9I A;  3G2W A;  5EKQ D;  3NZS A;  3QDN A;  3ZHE A;  5CHE E;  5LFA A;  3JCK C;  4QFV A;  4GML A;  4F1S A;  3FTV A;  3OXF A;  4HOQ A;  4U0U A;  4I2Z A;  4OVU A;  5FTP A;  3VTX A;  3SD5 A;  2QFC A;  1Y8M A;  3FU3 A;  5FQ7 A;  3DPD A;  4TUU A;  3ZFW A;  3ASD A;  4WWP A;  1H2T C;  3CIA A;  4GZC A;  3L16 A;  3PVL A;  1PAQ A;  1SZA A;  2KCK A;  3QKY A;  4CT4 A;  5BT1 A;  3ZHE B;  3T5V A;  4AY6 A;  3PS6 A;  5T3R A;  3IBE A;  1X5B A;  2XGM A;  3ONL A;  5FQ8 A;  3LKU A;  2C2L A;  2WM9 A;  2FO7 A;  2BF0 X;  1UN8 A;  5D0Q D;  1S0P A;  4AM9 A;  4JPS A;  2X6F A;  4ANX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...