4U96D

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB
total genus 53
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u96D00
4QQIA 2RFMA 3ZU7B 2XZDG 5BXOA 5EIDA 4QFVA 2HE0A 4RLYA 1N0QA 2MYOA 3C5RA 3EHQA 2F8XK 2QC9A 3AJIA 1G3NB 1YCSB 5EN5D 3TWXA 2KBXA 2DWZA 4NIKA 4K5AB 5D66A 4Z68A 5CBNA 3ZNGA 4DX7D 4HI8A 5CEAA 1AP7A 1SVXA 1N0RA 1WG0A 3JUEA 4DUIA 4ATZD 4B93B 3NOCD 1IKND 3TWRA 1BU9A 5CBOA 5ENOD 1NFIE 2QYJA 5AQ9A 4DRXE 1MX4A 1YMPA 4DX1A 4F1PA 3B95A 3Q9UC 1DC2A 4TUMA 3NBNB 3HG0D 4OAVB 3F6QA 5AQAA 1YYHA 2JABA 5JMND 4HB5A 2ZGDA 4HRNA 3W9FA 5AAOA 5AQBA 5KNGA 4J8YA 4CYMD 4HBDA 5EIBE 2KXPC 5HS0A 5KBAA 4J7WA 2DVWA 2V4HC 1AWCB 1MJ0A 4YDWA 3UTMA 3EU9A 1BD8A 1BI7B 4HNAD 4F6RD 5ENRD 3IXEA 3TWVA 3JXIA 3KEAA 3DEOA 4LG6A 4DX2A 2BKGA 5ENSD 1OY3D 5ENQD 2F8YA 4U96D 1SW6A 4JB8P 3B7BA 4DX5D 3UXGA 4K5BA 3T8KA 4A63B 4CZ2D 3SO8A 4K5CA 4UUCA 4DX6D 5AARA 4BEPA 4HI9A 3ZKJA 3D9HA 1K3ZD 2B0OE 3TWSA 2XENA 1OT8A 4U8YD 2RFAA 4LSZE 2A5EA 1MYOA 3AAAC 1QYMA 1S70B 5CEDB 1UOHA 2ETAA 4HQDA 1WDYA 4GPMA 2DZOA 2F37A 5KWDA 3UI2A 4BERA 5ENPD 2XEHA 5CERB 1TR4A 4N5QA 3J5PA 4LNUD 1IXVA 2Y1LE 4GMRA 3V2XA 3V2OA 2ZGGA 3TWTA 3TWWA 2BKKB 2Y0BG 4U8VD 5EILA 3TWQA 2VGEA 4O1OA 3V31A 1A5EA 4YDYA 5HKPA 2J8SD 4G8KA 5ENTD 1MX2A 1N11A 1IHBA 3T9KA 4U95D 5JA4D 2V5QC 2DZNA 2XEEA 5AN8A 2NYJA 5CECB 1BI8B 1K1AA 4O1PA 5ITZF 2XZTG 4ZFHA 3NOGD 2PNNA 4HRMB 3ZUVB 5EYPF 4C48B 5AQ7A 4ZHBA 3HRAA 3W9GA 3V79K 5KNHD 2AJAA 4BESA 3EHRA 1DCQA 1BLXB 2ETCA 5EYLA 3Q9NC 5FINA 4HLLA 4HRLA 3JXJA 4O60A 5FIOA 5HRYA 3V30A 3LJNA 3DEPA 1MX6A 3J5QB 1K1BA 4G8LA 2L6BA 3TWUA 2FO1E 4OAUC 2P2CP 1D9SA 2ETBA 4BETA 5BXUA 4BSZB
chains in the Genus database with same CATH superfamily
2OEVA 1E7VA 4EZLA 1HXIA 2X38A 4AXHA 3RRNB 2DBAA 2QC9A 4I2ZA 5EN5D 3TWXA 3QWPA 3FUMA 1AP7A 3ZHEA 3KSLA 3JQ0A 3MA5A 3EU5A 4J8FA 2XQ0A 3LXUX 2GRQB 2UY1A 1LD8A 3ZHEB 4ANWA 2QFCA 4HBDA 1OXJA 4Y6CA 2V4HC 1MJ0A 2B6CA 5ENRD 2R59A 2IY0C 2WXMA 5ENQD 2J07A 2P9IG 3RAUA 2JLBA 2GGFA 2C0LA 3ZKJA 4GTTA 1E7UA 4GA0A 1O1RA 2RD0A 5ENPD 2ZXWE 2IQCA 2PM6A 3FY4A 5DIZA 3ABKE 2EIKE 5HKPA 3U4TA 4GA2A 4U95D 4F1SA 4ACLA 2X6FA 4FC8A 3BG0B 3PEUB 3DRAA 3TL5A 3PZ1A 3MGBA 3ESKA 3JUIA 5JJ7A 2NXPA 4EHMA 3MKQB 3VTYA 1VDYA 3FU6A 3FUIA 1PC2A 4GMLA 4PH4B 3E30A 4EZJA 5T4YA 3ABME 3AG4E 2OVBA 2NSZA 3D3MA 4XX5A 4L2LA 4FU3A 4FJZA 3OTNA 2LAHA 3D9LA 2WXKA 5AQAA 3UIOC 4J8EA 3GW4A 3D9OA 2A5UA 4TXRA 4BTAA 5HS0A 1S64A 4Q96A 4G23A 4NURA 4DK5A 4JEHA 1H0AA 1IHGA 2CHWA 1OY3D 5CRVA 3DXKG 4LUNU 3CEQA 5BV1A 4K5CA 1UG3A 2HO1A 4F53A 2IEJA 2RFAA 1FT2A 1L5JA 4CCAA 3ZYMA 4GMJA 3AAAC 1KZPA 4AIFA 4B89A 3APCA 4YVQC 1TR4A 1HF8A 2ZGGA 3FTYA 1N11A 4BX9A 2DZNA 1IYGA 5AN8A 1E8ZA 5CCMA 5KJMA 4I1MA 2HM8A 3FHEA 4BESA 4G2VA 3EHRA 1H2UA 4C0MA 2DCPA 3LYAA 1MX6A 1N4QA 2RKKA 2P9SG 4IULA 3ASNE 1UW4B 4TXPA 2CFUA 4G24A 2GRRB 3AJIA 3QOUA 3U3WA 3CKBA 2XRYA 3LKUA 4I9EA 3EIQC 3Q73A 4KT6B 1HZ4A 2J49A 1QZ2A 2VGXA 2XEVA 2NC9A 2I2OA 3APDA 2L9BA 2PZIA 4HOUA 4AVXA 4HXIA 5A6CA 3RRMB 5FQ4A 2KXPC 1H2TC 3DSUA 4HVBA 5HQ8A 3D9JA 4F6RD 3RRUA 2BKGA 4IYPA 3FTVA 2F8YA 4U96D 1N4PA 3JQ1A 3ZYLA 4CGWA 4I43A 2IO3C 1S70B 2OEWA 3PUJA 4XKBA 4G26A 2H6HA 5BNWA 3V2OA 5FZRA 3ASOE 5JA4D 2XEEA 2IONA 2PNNA 3ZUVB 3W9GA 3APFA 4XI0A 2AJAA 3G2TA 2KZTA 4WNFA 3CK8A 3PDNA 4W9RA 3Q9NC 4ILGA 1K1BA 3SBTB 5G55A 1FVFA 3L9TA 4U0SA 2LSUA 4PUCA 5E76A 3I4RB 4UWLA 3ASGA 1Y8MA 4U07A 4NIKA 2GRLA 1A17A 4DX7D 1TNZA 1LD7A 4YNDA 1IKND 4KVOA 2BEDA 1KT0A 4DX1A 1E8YA 3HG0D 2C0MA 2DYSE 5KNGA 1H2VC 4JA9A 4GTRA 3CHSA 4H7XA 1ZU2A 2IU1A 2XS8A 5CMWA 5KBAA 3ZPJA 1BPOA 3D9KA 4KVMA 3MJWA 1DVPA 4MLPA 4HORA 2XGMA 3MX3A 3JCKC 3PUKA 2R03A 3IBEA 4I1OB 4WAFA 3KEZA 1RW2A 3HIZA 1JWFA 4O6FA 4HFGA 3E37A 4J0UA 3J5PA 4WWOA 2EQXA 1A5EA 2ONDA 1H6PA 1DCEA 3CV0A 4F3VA 4BT9A 4GZCA 1RZ4A 4ILHB 4HRMB 5FQ6A 2X6IA 4J6IA 1TYQG 4BT8A 3X2QE 5ARFA 2ZIRA 5LFAA 1ELKA 4HRLA 2IOLA 4RSYA 2R5SA 2ETBA 5BXOA 3CVPA 5EKQD 1HFAA 3TJPA 4EQFA 4YDOA 4URKA 3CVQA 3Q75A 3RK6A 3TAXA 3MV2B 3NOCD 3LCAA 1NFIE 4Q69A 4UWKA 3R9MA 1MX4A 4B8AA 4F1PA 4JPSA 3NBNB 3PRZA 2JABA 4GTVA 3FWVA 1OWLA 3HVEB 2AXUA 4UWFA 4LNBA 4JHKA 2I9CA 5BUZA 2VJ8A 1TNBA 2L0IA 1W3BA 4ATGA 5BW8C 4NQ0A 2DIWA 3T8KA 4BEPA 4X8QA 1NP7A 4E85A 2B0OE 4U0UA 4KZ0A 4R7LA 1O5MA 2E0IA 3E32A 2AXZA 1MZCA 3SNXA 3EHNA 1XGWA 3QJZA 3FP3A 2XPZA 4I6EA 2XPYA 2Y1LE 3FTSA 3L22A 1UJKA 3GZSA 3MYVA 3FH8A 4EBAG 3QK0A 4IRUA 4N39A 2R05A 4FULA 4JC8A 3VTXA 2CHXA 2J9QA 1HO8A 4HLLA 4GTQA 5AIJA 5JHBA 2WQ6A 4OAUC 4WWPA 3HXCA 3CSFA 3CK9A 3CK7A 3FEYA 1JWGA 4QFVA 4UQZA 5EX0A 3FU5A 4Y6WA 3FTUA 2WXNA 4N2QA 2XPIA 1ZBPA 4CDMA 1U2VG 4M3OA 4ANXA 3ASFA 2VSNA 2WXQA 4DUIA 3TWRA 3HVEA 5CBOA 5ENOD 4WUYA 3TGOA 2P9NG 3B95A 1OWNA 2BTDA 4WWNA 4OAVB 1YYHA 2V8SE 3PE4A 4RVBA 1E8WA 2P9LG 4A1SA 5B3SE 3FEXA 3HXFA 3BEEA 1IQRA 4CZ2D 4DX6D 5LCWJ 4GYYA 3QWWA 2Q7FA 1U3DA 4AEZC 1EPUA 2VTBA 2DZOA 2LSVA 3CIAA 3ULYA 3RJVA 4C0EA 3V31A 3PE3A 4EZKA 4M7CA 3VLFA 1OCOE 3HXEA 1TN8A 3DSVA 3KAEA 1OWMA 1QBQA 2J09A 3RO2A 3MKRA 4FA6A 2V0PA 5AJDA 3WG7E 2Y4UA 1JCQA 3E34A 2Y4TA 2J4BA 4WNDA 3BUAA 2P2CP 3L17A 5BXUA 3CVVA 3IV0A 2HE0A 5KJKA 1OUVA 4RLYA 3FTZA 2H6IA 2QZAA 3MCXA 3Q4AB 4XZ4A 2CG3A 5JHAA 2FF4A 1BU9A 2VYIA 1UN9A 4G11A 5JJTA 3F6QA 1IQUA 3D9NA 2VQ2A 3ONKA 4J8YA 1WAO1 1O1SA 2J4DA 3ASHA 1BD8A 4FLBA 1LF8A 3KD7A 2WXOA 3KEAA 3DEOA 1UJJA 3UT8A 2H6FA 3ZYQA 2VSYA 2XHEA 2AWIA 4JA7A 5AYWD 2R02A 2RG8A 1TN6A 2A5EA 4FLHA 2WXJA 3FULA 4G1TA 5CEDB 3GZ1A 3DXMG 3UI2A 3SFYA 3UX4A 4GTOA 1TNOA 2R2LA 5BPPA 4I6JA 2WXRA 1S0PA 2WXLA 1V55E 2Y0BG 1Z5SC 2YHCA 5LCWC 1KT1A 1TEZA 3NOGD 3D9MA 3S7BA 1N9AA 1N94A 1HE8A 2GROB 5ARGA 5KNHD 3B13A 4JZYA 2ETCA 3UT7A 4XKCA 3ZGQA 3HYMB 4HS2A 2FO1E 4GU5A 3WXXA 2RFMA 4UQYA 4GCOA 1N0QA 2MYOA 2LNIA 3PZDA 4UI9J 3MKQA 2VTBB 4DJAA 3ZNGA 2MRIA 4B93B 2CG2A 3S7DA 3FUEA 4AY6A 5IY5E 3B7UX 2QYJA 5AQ9A 1D8EA 3QWVA 3PZ2A 4CYMD 2C2LA 2DVWA 1AWCB 4WNGA 3SF4A 2WXHA 4DX2A 2UWJG 4JB8P 4DX5D 3OXFA 5EX3A 3ZXPA 3U66A 2I6HA 3TWSA 1WDYA 2P9UG 2FBNA 4N3CA 3AG3E 3L54A 2EIJE 3G2SA 1OWPA 3DSXA 4U8VD 5BT1A 4PS8A 5E75A 5ENTD 3G2VA 4APOA 2LAIA 3AS4A 2HYZA 5A23A 5ITZF 2IFUA 2PM7A 3ZIMA 4P29A 3ONLA 5EYPF 2AVPA 2JEKA 4DLOA 5T3RA 4LCTA 3CHPA 1MQSA 5BV0A 4A1GA 3FUJA 5FINA 3TXNA 2IO2C 3FTWA 3CHQA 3UQ3A 1WY6A 2L6BA 1FPPA 2WXIA 4BETA 1X5BA 3S2AA 1MHQA 2F8XK 4XEIG 4I6GA 3AG2E 5CEAA 1JPLA 3CVXA 3FU3A 1Z3YA 4K03A 4DRXE 4BFRA 2AXVA 5D0OD 4ACKA 2XCBA 4TUMA 3E4BA 4HRNA 3ZW3A 2XGOA 3QDNA 4RQIA 4MS6A 2L6JA 4HOSA 1TJFA 4JVSA 3LJ3A 2WXFA 4UQXA 4LERA 1HH8A 5FQ7A 3AU4A 3S7FA 3VLEA 4K5BA 3PH0C 5FQ8A 4HOQA 3FH5A 1MYOA 3FFLA 3KSQA 3SFXA 4MRUA 4FP7A 4HQDA 5ENNA 4BERA 2GRPB 3T5XA 5KJLA 3LVRE 4LNUD 1SZAA 4O1OA 3SQVA 3BG1B 3KS2A 2V5QC 4DPRA 4BX8A 5H7PA 1S63A 2EINE 1LTXA 1D8DA 2IOSA 3NF1A 2CHZA 3FU0A 1NZNA 1O1TA 4LNGA 5HRYA 3DEPA 3ABLE 2YQ8A 4AOFA 4QQIA 3ENEA 4ME2A 2P58C 5C1DA 3CVLA 1NL4A 4N2SA 3PZ3A 1GW6A 3DPYA 1OCZE 3Q5MA 2FULA 3SFZA 3ULQA 1YMPA 4U7EB 1ZB1A 4GB9A 3O4ZA 3W9FA 2XS1A 3ML8A 1WM5A 4A3TA 5JJ6A 2QYUA 3ZRHA 3OAWA 3G2WA 3E33A 2UY1B 1N4RA 1P5QA 4D10C 2OOEA 2ZISA 3L82A 3DBSA 5AARA 3PREA 3C3RA 4U8YD 4XI9A 5G05C 5KWDA 5CRUA 4JHRA 2XEHA 2A4ZA 3CGHA 5ANRA 5CECB 3P2BA 1K1AA 1HS6A 3TG5A 1N4SA 1NA3A 4ANUA 3MV3B 2LO6A 1BLXB 3CHRA 3FUFA 2GRNB 3JXJA 3LPZA 3LJNA 1PY1A 4G8LA 2Y3AA 3AU5A 3TWUA 3QAQA 2WB2A 3CVUA 3EUVA 5EIDA 4GTPA 4UI9C 3UMVA 2KBXA 3CVWA 3FUHA 3JUEA 3MEKA 3CVNA 4N3BA 2CFZA 3DSSA 4KYOB 2L0TB 2VSOE 3DWLG 5FZQA 1JCRA 2KZTB 2OVFA 4B94A 3L13A 3PS6A 5ENSD 5T8IA 1OWOA 5C2YA 1E96B 1K8KG 3L6AA 4BY6A 3CR3A 5J08A 1E90A 4JL0A 2DYRE 2F37A 4YDEA 1OCCE 4K0RA 4N5QA 1IXVA 2WVIA 1FCHA 4JW1A 2BKKB 3ISMC 2V5FA 2VGEA 4YDYA 3LY9A 1MX2A 3ZN3A 3L08A 3T9KA 3ZYKA 5M72A 4O1PA 3ZFWA 2FO7A 5AQ7A 3HRAA 2X6KA 4APFA 3UM1A 4U04A 1SA5A 2LXLA 4UI9K 2ZU6B 4ILIA 3CLJA 4GZ5A 1PAQA 1KLXA 1EDUA 1TJCA 4JXTA 5CCLA 5LX8A 3R7RA 2XZDG 1SZ9A 3RSEG 1HG5A 5LOZA 3PZ4A 4GYWA 2LUHA 5CMYA 3AS8A 4A3VA 2H6GA 4HI8A 3OXLA 1UN8A 5G05J 4GTSA 4MBGA 4CGVA 3SY2A 4LRZA 3Q49B 4L9PA 4ABNA 1NI1A 3Q7AA 3Q79A 3FH7A 2KC7A 4I2WA 3URZA 2V4LA 3SHFA 2X6JA 1OCRE 2J08A 4KZCA 4YDWA 3UT4A 3EDTB 4FHKA 4GTMA 1SW6A 1H6KA 1HG2A 4H7YA 4A63B 3UUXA 1XNFA 3UINC 3UM2A 3I3NA 3L16A 4TXQA 4BTBA 3C98A 4OVUA 4JEUA 4NRHB 1QYMA 1UOHA 2ETAA 5CERB 1JCSA 2OCCE 1JUQA 5EILA 3TWQA 3QB2A 4IN3B 4G8KA 3NAWA 3PEVB 3IEGA 2NYJA 1QQEA 3B7TA 3VLDA 4DI4A 2I1JA 2PQRA 3FDHA 1DCQA 4N3AA 4YVOA 3V30A 2VSXE 2Y69E 3AS5A 3DSWA 4BSZB 5EDSA 2HR2A 4N5CA 3C5RA 3UIPC 2VGXB 4E6HA 1G3NB 3SGHA 4DI3A 3HXBA 1KPSB 4Z68A 5D2MC 1SVXA 4ATZD 3FUKA 3T5VA 1DC2A 4V3IA 3SBSA 3Q7FA 4BSXA 2KM4A 1DNPA 1H19A 3Q15A 1HU3A 1TNYA 3FUDA 5FZSA 4BWRA 3NQPA 1Y6IA 3RKVA 1FT1A 3SI5A 4GZDA 2XENA 2GW1A 4U0ZA 3HHMA 3N71A 2BUGA 1FVHA 4J8SA 3B7RL 1H6OA 1IHBA 3IHYA 3SD5A 1X81A 5J90A 2VGYA 5FWQA 3NZSA 2WMNA 1INZA 3R9AB 3ULEG 3MZLB 3PNLB 4FHJA 4U8HA 1YA0A 1Z3XA 4I17A 2E2EA 3BQOA 3NZUA 4I1AA 5AJLA 1V54E 1TN7A 3RU0A 2M63A 2YNQA 3HDXA 3EHQA 3G2UA 3LS8A 4CT0A 3ML9A 3UPVA 3NB2A 2WMOA 4K5AB 1N0RA 4Q94A 4PDXA 4B0ZA 4TRQA 3BU8A 3Q9UC 4PS7A 4RG9A 4CT4A 1TNUA 4EPZA 4FJYA 4J7WA 2EIME 3UTMA 5G04C 4U63A 3IXEA 3JXIA 2GRMA 3EHMA 1SQMA 2MHKA 3P1UA 4UWHA 4UUCA 4CEMA 2XGSA 3IHVA 2AW6A 2YINA 1OT8A 4LSZE 2ILRA 3K9IA 5G2NA 4AM9A 3UM3A 4GA1A 3TXMA 4EBAA 3JYSA 4GMRA 3V2XA 3UKRG 4WNEA 3TWTA 3TWWA 3U9WA 3GZ2A 5FJYA 3D9PA 1EYHA 2LXMA 1N52A 3IKOB 4MKTA 3S7JA 3ZVVA 4AV7A 4C9BB 4C48B 2KCKA 4J8DA 3D9IA 2IJGX 3EIJA 3EJNA 3FTXA 2EILE 4ANVA 1Q2ZA 2BF0X 5FIOA 1E8XA 3QNKA 2F0YA 3LVQE 5B1AE 3ZU7B 3SZ7A 3C3OA 4AY5A 1QNFA 2FI7A 2P9PG 1YCSB 4L1BA 3PVLA 3LEWA 2DWZA 2WXPA 5D66A 5CBNA 1WG0A 4L2YA 3GYZA 3QARA 2X6HA 4F7AA 4HOTA 2XCCA 3CQGB 3LY7A 4GPKA 2WPVA 3LDZA 4I9CA 5AQBA 4CRWA 4B8CB 4G25A 3OXGA 3EU9A 1N54A 1BI7B 4HNAD 5KCMA 4HLEA 2FEZA 3RIBA 4LG6A 4TV3A 4OYSA 4OVVA 4L23A 3B7BA 3FUNA 3SO8A 4CDRA 4HI9A 3D9HA 1K3ZD 1ELWA 5DBKA 4AP2A 3HXDA 4L7TA 3ZEFA 3UKUG 2XRZA 4GPMA 3ESLA 5B1BE 4AJWA 3CHMA 2YHEA 4RG6A 2J8SD 1B89A 3DSTA 1BI8B 3CQCB 2XZTG 3V79K 4DLQA 4UWGA 3TG4A 1ELRA 5FTPA 4GZ3A 3I4GA 5KJNA 4NACA 2PL2A 3C3QA 5LP0A 4KBQA 4KXKB 3PNTB 3QKYA 4GCNA 2I1KA 5D0QD 3CVYA 4KMOA 2WXGA 1EF1C 2KCVA 3UM0A 5ANLA 3U64A 2PQNA 4FADA 2WM9A 4TUUA 5JMND 4HB5A 4JD2G 2ZGDA 5AAOA 5EIBE 2X3MA 4GAAA 3AG1E 5G04J 5AENA 4GZ6A 1SA4A 3CSTA 3TWVA 2IF4A 3QC1A 3UXGA 2WQ7A 4XIFA 1N95A 4XE0A 1NA0A 5FT9A 3O48A 4A55A 2KATA 3R7QA 3ZXSA 3I5PA 5HI7A 3CKCA 2MOWA 2OV8A 1Z6TA 3CHOA 4LEUA 3RO3A 2KCLA 3LY8A 2P9KG 3B7SA 2R17C 2QY7A 3T8MA 3ASDA 5CHEE 3DPDA 1KZOA 4CDNA 3C72A 4ZFHA 4ZHBA 4PS3A 4JHJA 1HX8A 2WQHA 5EYLA 5A7DB 1U3CA 3Q47B 3Q78A 4O60A 4GYOA 3J5QB 1D9SA 4EECA
chains in the Genus database with same CATH topology
4QQIA 2RFMA 3ZU7B 2XZDG 5BXOA 5EIDA 4QFVA 2HE0A 4RLYA 1N0QA 2MYOA 3C5RA 3EHQA 2F8XK 2QC9A 3AJIA 1G3NB 1YCSB 5EN5D 3TWXA 2KBXA 2DWZA 4NIKA 4K5AB 5D66A 4Z68A 5CBNA 3ZNGA 4DX7D 4HI8A 5CEAA 1AP7A 1SVXA 1N0RA 1WG0A 3JUEA 4DUIA 4ATZD 4B93B 3NOCD 1IKND 3TWRA 1BU9A 5CBOA 5ENOD 1NFIE 2QYJA 5AQ9A 4DRXE 1MX4A 1YMPA 4DX1A 4F1PA 3B95A 3Q9UC 1DC2A 4TUMA 3NBNB 3HG0D 4OAVB 3F6QA 5AQAA 1YYHA 2JABA 5JMND 4HB5A 2ZGDA 4HRNA 3W9FA 5AAOA 5AQBA 5KNGA 4J8YA 4CYMD 4HBDA 5EIBE 2KXPC 5HS0A 5KBAA 4J7WA 2DVWA 2V4HC 1AWCB 1MJ0A 4YDWA 3UTMA 3EU9A 1BD8A 1BI7B 4HNAD 4F6RD 5ENRD 3IXEA 3TWVA 3JXIA 3KEAA 3DEOA 4LG6A 4DX2A 2BKGA 5ENSD 1OY3D 5ENQD 2F8YA 4U96D 1SW6A 4JB8P 3B7BA 4DX5D 3UXGA 4K5BA 3T8KA 4A63B 4CZ2D 3SO8A 4K5CA 4UUCA 4DX6D 5AARA 4BEPA 4HI9A 3ZKJA 3D9HA 1K3ZD 2B0OE 3TWSA 2XENA 1OT8A 4U8YD 2RFAA 4LSZE 2A5EA 1MYOA 3AAAC 1QYMA 1S70B 5CEDB 1UOHA 2ETAA 4HQDA 1WDYA 4GPMA 2DZOA 2F37A 5KWDA 3UI2A 4BERA 5ENPD 2XEHA 5CERB 1TR4A 4N5QA 3J5PA 4LNUD 1IXVA 2Y1LE 4GMRA 3V2XA 3V2OA 2ZGGA 3TWTA 3TWWA 2BKKB 2Y0BG 4U8VD 5EILA 3TWQA 2VGEA 4O1OA 3V31A 1A5EA 4YDYA 5HKPA 2J8SD 4G8KA 5ENTD 1MX2A 1N11A 1IHBA 3T9KA 4U95D 5JA4D 2V5QC 2DZNA 2XEEA 5AN8A 2NYJA 5CECB 1BI8B 1K1AA 4O1PA 5ITZF 2XZTG 4ZFHA 3NOGD 2PNNA 4HRMB 3ZUVB 5EYPF 4C48B 5AQ7A 4ZHBA 3HRAA 3W9GA 3V79K 5KNHD 2AJAA 4BESA 3EHRA 1DCQA 1BLXB 2ETCA 5EYLA 3Q9NC 5FINA 4HLLA 4HRLA 3JXJA 4O60A 5FIOA 5HRYA 3V30A 3LJNA 3DEPA 1MX6A 3J5QB 1K1BA 4G8LA 2L6BA 3TWUA 2FO1E 4OAUC 2P2CP 1D9SA 2ETBA 4BETA 5BXUA 4BSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQI A;  2RFM A;  3ZU7 B;  2XZD G;  5BXO A;  5EID A;  4QFV A;  2HE0 A;  4RLY A;  1N0Q A;  2MYO A;  3C5R A;  3EHQ A;  2F8X K;  2QC9 A;  3AJI A;  1G3N B;  1YCS B;  5EN5 D;  3TWX A;  2KBX A;  2DWZ A;  4NIK A;  4K5A B;  5D66 A;  4Z68 A;  5CBN A;  3ZNG A;  4DX7 D;  4HI8 A;  5CEA A;  1AP7 A;  1SVX A;  1N0R A;  1WG0 A;  3JUE A;  4DUI A;  4ATZ D;  4B93 B;  3NOC D;  1IKN D;  3TWR A;  1BU9 A;  5CBO A;  5ENO D;  1NFI E;  2QYJ A;  5AQ9 A;  4DRX E;  1MX4 A;  1YMP A;  4DX1 A;  4F1P A;  3B95 A;  3Q9U C;  1DC2 A;  4TUM A;  3NBN B;  3HG0 D;  4OAV B;  3F6Q A;  5AQA A;  1YYH A;  2JAB A;  5JMN D;  4HB5 A;  2ZGD A;  4HRN A;  3W9F A;  5AAO A;  5AQB A;  5KNG A;  4J8Y A;  4CYM D;  4HBD A;  5EIB E;  2KXP C;  5HS0 A;  5KBA A;  4J7W A;  2DVW A;  2V4H C;  1AWC B;  1MJ0 A;  4YDW A;  3UTM A;  3EU9 A;  1BD8 A;  1BI7 B;  4HNA D;  4F6R D;  5ENR D;  3IXE A;  3TWV A;  3JXI A;  3KEA A;  3DEO A;  4LG6 A;  4DX2 A;  2BKG A;  5ENS D;  1OY3 D;  5ENQ D;  2F8Y A;  4U96 D;  1SW6 A;  4JB8 P;  3B7B A;  4DX5 D;  3UXG A;  4K5B A;  3T8K A;  4A63 B;  4CZ2 D;  3SO8 A;  4K5C A;  4UUC A;  4DX6 D;  5AAR A;  4BEP A;  4HI9 A;  3ZKJ A;  3D9H A;  1K3Z D;  2B0O E;  3TWS A;  2XEN A;  1OT8 A;  4U8Y D;  2RFA A;  4LSZ E;  2A5E A;  1MYO A;  3AAA C;  1QYM A;  1S70 B;  5CED B;  1UOH A;  2ETA A;  4HQD A;  1WDY A;  4GPM A;  2DZO A;  2F37 A;  5KWD A;  3UI2 A;  4BER A;  5ENP D;  2XEH A;  5CER B;  1TR4 A;  4N5Q A;  3J5P A;  4LNU D;  1IXV A;  2Y1L E;  4GMR A;  3V2X A;  3V2O A;  2ZGG A;  3TWT A;  3TWW A;  2BKK B;  2Y0B G;  4U8V D;  5EIL A;  3TWQ A;  2VGE A;  4O1O A;  3V31 A;  1A5E A;  4YDY A;  5HKP A;  2J8S D;  4G8K A;  5ENT D;  1MX2 A;  1N11 A;  1IHB A;  3T9K A;  4U95 D;  5JA4 D;  2V5Q C;  2DZN A;  2XEE A;  5AN8 A;  2NYJ A;  5CEC B;  1BI8 B;  1K1A A;  4O1P A;  5ITZ F;  2XZT G;  4ZFH A;  3NOG D;  2PNN A;  4HRM B;  3ZUV B;  5EYP F;  4C48 B;  5AQ7 A;  4ZHB A;  3HRA A;  3W9G A;  3V79 K;  5KNH D;  2AJA A;  4BES A;  3EHR A;  1DCQ A;  1BLX B;  2ETC A;  5EYL A;  3Q9N C;  5FIN A;  4HLL A;  4HRL A;  3JXJ A;  4O60 A;  5FIO A;  5HRY A;  3V30 A;  3LJN A;  3DEP A;  1MX6 A;  3J5Q B;  1K1B A;  4G8L A;  2L6B A;  3TWU A;  2FO1 E;  4OAU C;  2P2C P;  1D9S A;  2ETB A;  4BET A;  5BXU A;  4BSZ B; 
#chains in the Genus database with same CATH topology
 2OEV A;  1E7V A;  4EZL A;  1HXI A;  2X38 A;  4AXH A;  3RRN B;  2DBA A;  2QC9 A;  4I2Z A;  5EN5 D;  3TWX A;  3QWP A;  3FUM A;  1AP7 A;  3ZHE A;  3KSL A;  3JQ0 A;  3MA5 A;  3EU5 A;  4J8F A;  2XQ0 A;  3LXU X;  2GRQ B;  2UY1 A;  1LD8 A;  3ZHE B;  4ANW A;  2QFC A;  4HBD A;  1OXJ A;  4Y6C A;  2V4H C;  1MJ0 A;  2B6C A;  5ENR D;  2R59 A;  2IY0 C;  2WXM A;  5ENQ D;  2J07 A;  2P9I G;  3RAU A;  2JLB A;  2GGF A;  2C0L A;  3ZKJ A;  4GTT A;  1E7U A;  4GA0 A;  1O1R A;  2RD0 A;  5ENP D;  2ZXW E;  2IQC A;  2PM6 A;  3FY4 A;  5DIZ A;  3ABK E;  2EIK E;  5HKP A;  3U4T A;  4GA2 A;  4U95 D;  4F1S A;  4ACL A;  2X6F A;  4FC8 A;  3BG0 B;  3PEU B;  3DRA A;  3TL5 A;  3PZ1 A;  3MGB A;  3ESK A;  3JUI A;  5JJ7 A;  2NXP A;  4EHM A;  3MKQ B;  3VTY A;  1VDY A;  3FU6 A;  3FUI A;  1PC2 A;  4GML A;  4PH4 B;  3E30 A;  4EZJ A;  5T4Y A;  3ABM E;  3AG4 E;  2OVB A;  2NSZ A;  3D3M A;  4XX5 A;  4L2L A;  4FU3 A;  4FJZ A;  3OTN A;  2LAH A;  3D9L A;  2WXK A;  5AQA A;  3UIO C;  4J8E A;  3GW4 A;  3D9O A;  2A5U A;  4TXR A;  4BTA A;  5HS0 A;  1S64 A;  4Q96 A;  4G23 A;  4NUR A;  4DK5 A;  4JEH A;  1H0A A;  1IHG A;  2CHW A;  1OY3 D;  5CRV A;  3DXK G;  4LUN U;  3CEQ A;  5BV1 A;  4K5C A;  1UG3 A;  2HO1 A;  4F53 A;  2IEJ A;  2RFA A;  1FT2 A;  1L5J A;  4CCA A;  3ZYM A;  4GMJ A;  3AAA C;  1KZP A;  4AIF A;  4B89 A;  3APC A;  4YVQ C;  1TR4 A;  1HF8 A;  2ZGG A;  3FTY A;  1N11 A;  4BX9 A;  2DZN A;  1IYG A;  5AN8 A;  1E8Z A;  5CCM A;  5KJM A;  4I1M A;  2HM8 A;  3FHE A;  4BES A;  4G2V A;  3EHR A;  1H2U A;  4C0M A;  2DCP A;  3LYA A;  1MX6 A;  1N4Q A;  2RKK A;  2P9S G;  4IUL A;  3ASN E;  1UW4 B;  4TXP A;  2CFU A;  4G24 A;  2GRR B;  3AJI A;  3QOU A;  3U3W A;  3CKB A;  2XRY A;  3LKU A;  4I9E A;  3EIQ C;  3Q73 A;  4KT6 B;  1HZ4 A;  2J49 A;  1QZ2 A;  2VGX A;  2XEV A;  2NC9 A;  2I2O A;  3APD A;  2L9B A;  2PZI A;  4HOU A;  4AVX A;  4HXI A;  5A6C A;  3RRM B;  5FQ4 A;  2KXP C;  1H2T C;  3DSU A;  4HVB A;  5HQ8 A;  3D9J A;  4F6R D;  3RRU A;  2BKG A;  4IYP A;  3FTV A;  2F8Y A;  4U96 D;  1N4P A;  3JQ1 A;  3ZYL A;  4CGW A;  4I43 A;  2IO3 C;  1S70 B;  2OEW A;  3PUJ A;  4XKB A;  4G26 A;  2H6H A;  5BNW A;  3V2O A;  5FZR A;  3ASO E;  5JA4 D;  2XEE A;  2ION A;  2PNN A;  3ZUV B;  3W9G A;  3APF A;  4XI0 A;  2AJA A;  3G2T A;  2KZT A;  4WNF A;  3CK8 A;  3PDN A;  4W9R A;  3Q9N C;  4ILG A;  1K1B A;  3SBT B;  5G55 A;  1FVF A;  3L9T A;  4U0S A;  2LSU A;  4PUC A;  5E76 A;  3I4R B;  4UWL A;  3ASG A;  1Y8M A;  4U07 A;  4NIK A;  2GRL A;  1A17 A;  4DX7 D;  1TNZ A;  1LD7 A;  4YND A;  1IKN D;  4KVO A;  2BED A;  1KT0 A;  4DX1 A;  1E8Y A;  3HG0 D;  2C0M A;  2DYS E;  5KNG A;  1H2V C;  4JA9 A;  4GTR A;  3CHS A;  4H7X A;  1ZU2 A;  2IU1 A;  2XS8 A;  5CMW A;  5KBA A;  3ZPJ A;  1BPO A;  3D9K A;  4KVM A;  3MJW A;  1DVP A;  4MLP A;  4HOR A;  2XGM A;  3MX3 A;  3JCK C;  3PUK A;  2R03 A;  3IBE A;  4I1O B;  4WAF A;  3KEZ A;  1RW2 A;  3HIZ A;  1JWF A;  4O6F A;  4HFG A;  3E37 A;  4J0U A;  3J5P A;  4WWO A;  2EQX A;  1A5E A;  2OND A;  1H6P A;  1DCE A;  3CV0 A;  4F3V A;  4BT9 A;  4GZC A;  1RZ4 A;  4ILH B;  4HRM B;  5FQ6 A;  2X6I A;  4J6I A;  1TYQ G;  4BT8 A;  3X2Q E;  5ARF A;  2ZIR A;  5LFA A;  1ELK A;  4HRL A;  2IOL A;  4RSY A;  2R5S A;  2ETB A;  5BXO A;  3CVP A;  5EKQ D;  1HFA A;  3TJP A;  4EQF A;  4YDO A;  4URK A;  3CVQ A;  3Q75 A;  3RK6 A;  3TAX A;  3MV2 B;  3NOC D;  3LCA A;  1NFI E;  4Q69 A;  4UWK A;  3R9M A;  1MX4 A;  4B8A A;  4F1P A;  4JPS A;  3NBN B;  3PRZ A;  2JAB A;  4GTV A;  3FWV A;  1OWL A;  3HVE B;  2AXU A;  4UWF A;  4LNB A;  4JHK A;  2I9C A;  5BUZ A;  2VJ8 A;  1TNB A;  2L0I A;  1W3B A;  4ATG A;  5BW8 C;  4NQ0 A;  2DIW A;  3T8K A;  4BEP A;  4X8Q A;  1NP7 A;  4E85 A;  2B0O E;  4U0U A;  4KZ0 A;  4R7L A;  1O5M A;  2E0I A;  3E32 A;  2AXZ A;  1MZC A;  3SNX A;  3EHN A;  1XGW A;  3QJZ A;  3FP3 A;  2XPZ A;  4I6E A;  2XPY A;  2Y1L E;  3FTS A;  3L22 A;  1UJK A;  3GZS A;  3MYV A;  3FH8 A;  4EBA G;  3QK0 A;  4IRU A;  4N39 A;  2R05 A;  4FUL A;  4JC8 A;  3VTX A;  2CHX A;  2J9Q A;  1HO8 A;  4HLL A;  4GTQ A;  5AIJ A;  5JHB A;  2WQ6 A;  4OAU C;  4WWP A;  3HXC A;  3CSF A;  3CK9 A;  3CK7 A;  3FEY A;  1JWG A;  4QFV A;  4UQZ A;  5EX0 A;  3FU5 A;  4Y6W A;  3FTU A;  2WXN A;  4N2Q A;  2XPI A;  1ZBP A;  4CDM A;  1U2V G;  4M3O A;  4ANX A;  3ASF A;  2VSN A;  2WXQ A;  4DUI A;  3TWR A;  3HVE A;  5CBO A;  5ENO D;  4WUY A;  3TGO A;  2P9N G;  3B95 A;  1OWN A;  2BTD A;  4WWN A;  4OAV B;  1YYH A;  2V8S E;  3PE4 A;  4RVB A;  1E8W A;  2P9L G;  4A1S A;  5B3S E;  3FEX A;  3HXF A;  3BEE A;  1IQR A;  4CZ2 D;  4DX6 D;  5LCW J;  4GYY A;  3QWW A;  2Q7F A;  1U3D A;  4AEZ C;  1EPU A;  2VTB A;  2DZO A;  2LSV A;  3CIA A;  3ULY A;  3RJV A;  4C0E A;  3V31 A;  3PE3 A;  4EZK A;  4M7C A;  3VLF A;  1OCO E;  3HXE A;  1TN8 A;  3DSV A;  3KAE A;  1OWM A;  1QBQ A;  2J09 A;  3RO2 A;  3MKR A;  4FA6 A;  2V0P A;  5AJD A;  3WG7 E;  2Y4U A;  1JCQ A;  3E34 A;  2Y4T A;  2J4B A;  4WND A;  3BUA A;  2P2C P;  3L17 A;  5BXU A;  3CVV A;  3IV0 A;  2HE0 A;  5KJK A;  1OUV A;  4RLY A;  3FTZ A;  2H6I A;  2QZA A;  3MCX A;  3Q4A B;  4XZ4 A;  2CG3 A;  5JHA A;  2FF4 A;  1BU9 A;  2VYI A;  1UN9 A;  4G11 A;  5JJT A;  3F6Q A;  1IQU A;  3D9N A;  2VQ2 A;  3ONK A;  4J8Y A;  1WAO 1;  1O1S A;  2J4D A;  3ASH A;  1BD8 A;  4FLB A;  1LF8 A;  3KD7 A;  2WXO A;  3KEA A;  3DEO A;  1UJJ A;  3UT8 A;  2H6F A;  3ZYQ A;  2VSY A;  2XHE A;  2AWI A;  4JA7 A;  5AYW D;  2R02 A;  2RG8 A;  1TN6 A;  2A5E A;  4FLH A;  2WXJ A;  3FUL A;  4G1T A;  5CED B;  3GZ1 A;  3DXM G;  3UI2 A;  3SFY A;  3UX4 A;  4GTO A;  1TNO A;  2R2L A;  5BPP A;  4I6J A;  2WXR A;  1S0P A;  2WXL A;  1V55 E;  2Y0B G;  1Z5S C;  2YHC A;  5LCW C;  1KT1 A;  1TEZ A;  3NOG D;  3D9M A;  3S7B A;  1N9A A;  1N94 A;  1HE8 A;  2GRO B;  5ARG A;  5KNH D;  3B13 A;  4JZY A;  2ETC A;  3UT7 A;  4XKC A;  3ZGQ A;  3HYM B;  4HS2 A;  2FO1 E;  4GU5 A;  3WXX A;  2RFM A;  4UQY A;  4GCO A;  1N0Q A;  2MYO A;  2LNI A;  3PZD A;  4UI9 J;  3MKQ A;  2VTB B;  4DJA A;  3ZNG A;  2MRI A;  4B93 B;  2CG2 A;  3S7D A;  3FUE A;  4AY6 A;  5IY5 E;  3B7U X;  2QYJ A;  5AQ9 A;  1D8E A;  3QWV A;  3PZ2 A;  4CYM D;  2C2L A;  2DVW A;  1AWC B;  4WNG A;  3SF4 A;  2WXH A;  4DX2 A;  2UWJ G;  4JB8 P;  4DX5 D;  3OXF A;  5EX3 A;  3ZXP A;  3U66 A;  2I6H A;  3TWS A;  1WDY A;  2P9U G;  2FBN A;  4N3C A;  3AG3 E;  3L54 A;  2EIJ E;  3G2S A;  1OWP A;  3DSX A;  4U8V D;  5BT1 A;  4PS8 A;  5E75 A;  5ENT D;  3G2V A;  4APO A;  2LAI A;  3AS4 A;  2HYZ A;  5A23 A;  5ITZ F;  2IFU A;  2PM7 A;  3ZIM A;  4P29 A;  3ONL A;  5EYP F;  2AVP A;  2JEK A;  4DLO A;  5T3R A;  4LCT A;  3CHP A;  1MQS A;  5BV0 A;  4A1G A;  3FUJ A;  5FIN A;  3TXN A;  2IO2 C;  3FTW A;  3CHQ A;  3UQ3 A;  1WY6 A;  2L6B A;  1FPP A;  2WXI A;  4BET A;  1X5B A;  3S2A A;  1MHQ A;  2F8X K;  4XEI G;  4I6G A;  3AG2 E;  5CEA A;  1JPL A;  3CVX A;  3FU3 A;  1Z3Y A;  4K03 A;  4DRX E;  4BFR A;  2AXV A;  5D0O D;  4ACK A;  2XCB A;  4TUM A;  3E4B A;  4HRN A;  3ZW3 A;  2XGO A;  3QDN A;  4RQI A;  4MS6 A;  2L6J A;  4HOS A;  1TJF A;  4JVS A;  3LJ3 A;  2WXF A;  4UQX A;  4LER A;  1HH8 A;  5FQ7 A;  3AU4 A;  3S7F A;  3VLE A;  4K5B A;  3PH0 C;  5FQ8 A;  4HOQ A;  3FH5 A;  1MYO A;  3FFL A;  3KSQ A;  3SFX A;  4MRU A;  4FP7 A;  4HQD A;  5ENN A;  4BER A;  2GRP B;  3T5X A;  5KJL A;  3LVR E;  4LNU D;  1SZA A;  4O1O A;  3SQV A;  3BG1 B;  3KS2 A;  2V5Q C;  4DPR A;  4BX8 A;  5H7P A;  1S63 A;  2EIN E;  1LTX A;  1D8D A;  2IOS A;  3NF1 A;  2CHZ A;  3FU0 A;  1NZN A;  1O1T A;  4LNG A;  5HRY A;  3DEP A;  3ABL E;  2YQ8 A;  4AOF A;  4QQI A;  3ENE A;  4ME2 A;  2P58 C;  5C1D A;  3CVL A;  1NL4 A;  4N2S A;  3PZ3 A;  1GW6 A;  3DPY A;  1OCZ E;  3Q5M A;  2FUL A;  3SFZ A;  3ULQ A;  1YMP A;  4U7E B;  1ZB1 A;  4GB9 A;  3O4Z A;  3W9F A;  2XS1 A;  3ML8 A;  1WM5 A;  4A3T A;  5JJ6 A;  2QYU A;  3ZRH A;  3OAW A;  3G2W A;  3E33 A;  2UY1 B;  1N4R A;  1P5Q A;  4D10 C;  2OOE A;  2ZIS A;  3L82 A;  3DBS A;  5AAR A;  3PRE A;  3C3R A;  4U8Y D;  4XI9 A;  5G05 C;  5KWD A;  5CRU A;  4JHR A;  2XEH A;  2A4Z A;  3CGH A;  5ANR A;  5CEC B;  3P2B A;  1K1A A;  1HS6 A;  3TG5 A;  1N4S A;  1NA3 A;  4ANU A;  3MV3 B;  2LO6 A;  1BLX B;  3CHR A;  3FUF A;  2GRN B;  3JXJ A;  3LPZ A;  3LJN A;  1PY1 A;  4G8L A;  2Y3A A;  3AU5 A;  3TWU A;  3QAQ A;  2WB2 A;  3CVU A;  3EUV A;  5EID A;  4GTP A;  4UI9 C;  3UMV A;  2KBX A;  3CVW A;  3FUH A;  3JUE A;  3MEK A;  3CVN A;  4N3B A;  2CFZ A;  3DSS A;  4KYO B;  2L0T B;  2VSO E;  3DWL G;  5FZQ A;  1JCR A;  2KZT B;  2OVF A;  4B94 A;  3L13 A;  3PS6 A;  5ENS D;  5T8I A;  1OWO A;  5C2Y A;  1E96 B;  1K8K G;  3L6A A;  4BY6 A;  3CR3 A;  5J08 A;  1E90 A;  4JL0 A;  2DYR E;  2F37 A;  4YDE A;  1OCC E;  4K0R A;  4N5Q A;  1IXV A;  2WVI A;  1FCH A;  4JW1 A;  2BKK B;  3ISM C;  2V5F A;  2VGE A;  4YDY A;  3LY9 A;  1MX2 A;  3ZN3 A;  3L08 A;  3T9K A;  3ZYK A;  5M72 A;  4O1P A;  3ZFW A;  2FO7 A;  5AQ7 A;  3HRA A;  2X6K A;  4APF A;  3UM1 A;  4U04 A;  1SA5 A;  2LXL A;  4UI9 K;  2ZU6 B;  4ILI A;  3CLJ A;  4GZ5 A;  1PAQ A;  1KLX A;  1EDU A;  1TJC A;  4JXT A;  5CCL A;  5LX8 A;  3R7R A;  2XZD G;  1SZ9 A;  3RSE G;  1HG5 A;  5LOZ A;  3PZ4 A;  4GYW A;  2LUH A;  5CMY A;  3AS8 A;  4A3V A;  2H6G A;  4HI8 A;  3OXL A;  1UN8 A;  5G05 J;  4GTS A;  4MBG A;  4CGV A;  3SY2 A;  4LRZ A;  3Q49 B;  4L9P A;  4ABN A;  1NI1 A;  3Q7A A;  3Q79 A;  3FH7 A;  2KC7 A;  4I2W A;  3URZ A;  2V4L A;  3SHF A;  2X6J A;  1OCR E;  2J08 A;  4KZC A;  4YDW A;  3UT4 A;  3EDT B;  4FHK A;  4GTM A;  1SW6 A;  1H6K A;  1HG2 A;  4H7Y A;  4A63 B;  3UUX A;  1XNF A;  3UIN C;  3UM2 A;  3I3N A;  3L16 A;  4TXQ A;  4BTB A;  3C98 A;  4OVU A;  4JEU A;  4NRH B;  1QYM A;  1UOH A;  2ETA A;  5CER B;  1JCS A;  2OCC E;  1JUQ A;  5EIL A;  3TWQ A;  3QB2 A;  4IN3 B;  4G8K A;  3NAW A;  3PEV B;  3IEG A;  2NYJ A;  1QQE A;  3B7T A;  3VLD A;  4DI4 A;  2I1J A;  2PQR A;  3FDH A;  1DCQ A;  4N3A A;  4YVO A;  3V30 A;  2VSX E;  2Y69 E;  3AS5 A;  3DSW A;  4BSZ B;  5EDS A;  2HR2 A;  4N5C A;  3C5R A;  3UIP C;  2VGX B;  4E6H A;  1G3N B;  3SGH A;  4DI3 A;  3HXB A;  1KPS B;  4Z68 A;  5D2M C;  1SVX A;  4ATZ D;  3FUK A;  3T5V A;  1DC2 A;  4V3I A;  3SBS A;  3Q7F A;  4BSX A;  2KM4 A;  1DNP A;  1H19 A;  3Q15 A;  1HU3 A;  1TNY A;  3FUD A;  5FZS A;  4BWR A;  3NQP A;  1Y6I A;  3RKV A;  1FT1 A;  3SI5 A;  4GZD A;  2XEN A;  2GW1 A;  4U0Z A;  3HHM A;  3N71 A;  2BUG A;  1FVH A;  4J8S A;  3B7R L;  1H6O A;  1IHB A;  3IHY A;  3SD5 A;  1X81 A;  5J90 A;  2VGY A;  5FWQ A;  3NZS A;  2WMN A;  1INZ A;  3R9A B;  3ULE G;  3MZL B;  3PNL B;  4FHJ A;  4U8H A;  1YA0 A;  1Z3X A;  4I17 A;  2E2E A;  3BQO A;  3NZU A;  4I1A A;  5AJL A;  1V54 E;  1TN7 A;  3RU0 A;  2M63 A;  2YNQ A;  3HDX A;  3EHQ A;  3G2U A;  3LS8 A;  4CT0 A;  3ML9 A;  3UPV A;  3NB2 A;  2WMO A;  4K5A B;  1N0R A;  4Q94 A;  4PDX A;  4B0Z A;  4TRQ A;  3BU8 A;  3Q9U C;  4PS7 A;  4RG9 A;  4CT4 A;  1TNU A;  4EPZ A;  4FJY A;  4J7W A;  2EIM E;  3UTM A;  5G04 C;  4U63 A;  3IXE A;  3JXI A;  2GRM A;  3EHM A;  1SQM A;  2MHK A;  3P1U A;  4UWH A;  4UUC A;  4CEM A;  2XGS A;  3IHV A;  2AW6 A;  2YIN A;  1OT8 A;  4LSZ E;  2ILR A;  3K9I A;  5G2N A;  4AM9 A;  3UM3 A;  4GA1 A;  3TXM A;  4EBA A;  3JYS A;  4GMR A;  3V2X A;  3UKR G;  4WNE A;  3TWT A;  3TWW A;  3U9W A;  3GZ2 A;  5FJY A;  3D9P A;  1EYH A;  2LXM A;  1N52 A;  3IKO B;  4MKT A;  3S7J A;  3ZVV A;  4AV7 A;  4C9B B;  4C48 B;  2KCK A;  4J8D A;  3D9I A;  2IJG X;  3EIJ A;  3EJN A;  3FTX A;  2EIL E;  4ANV A;  1Q2Z A;  2BF0 X;  5FIO A;  1E8X A;  3QNK A;  2F0Y A;  3LVQ E;  5B1A E;  3ZU7 B;  3SZ7 A;  3C3O A;  4AY5 A;  1QNF A;  2FI7 A;  2P9P G;  1YCS B;  4L1B A;  3PVL A;  3LEW A;  2DWZ A;  2WXP A;  5D66 A;  5CBN A;  1WG0 A;  4L2Y A;  3GYZ A;  3QAR A;  2X6H A;  4F7A A;  4HOT A;  2XCC A;  3CQG B;  3LY7 A;  4GPK A;  2WPV A;  3LDZ A;  4I9C A;  5AQB A;  4CRW A;  4B8C B;  4G25 A;  3OXG A;  3EU9 A;  1N54 A;  1BI7 B;  4HNA D;  5KCM A;  4HLE A;  2FEZ A;  3RIB A;  4LG6 A;  4TV3 A;  4OYS A;  4OVV A;  4L23 A;  3B7B A;  3FUN A;  3SO8 A;  4CDR A;  4HI9 A;  3D9H A;  1K3Z D;  1ELW A;  5DBK A;  4AP2 A;  3HXD A;  4L7T A;  3ZEF A;  3UKU G;  2XRZ A;  4GPM A;  3ESL A;  5B1B E;  4AJW A;  3CHM A;  2YHE A;  4RG6 A;  2J8S D;  1B89 A;  3DST A;  1BI8 B;  3CQC B;  2XZT G;  3V79 K;  4DLQ A;  4UWG A;  3TG4 A;  1ELR A;  5FTP A;  4GZ3 A;  3I4G A;  5KJN A;  4NAC A;  2PL2 A;  3C3Q A;  5LP0 A;  4KBQ A;  4KXK B;  3PNT B;  3QKY A;  4GCN A;  2I1K A;  5D0Q D;  3CVY A;  4KMO A;  2WXG A;  1EF1 C;  2KCV A;  3UM0 A;  5ANL A;  3U64 A;  2PQN A;  4FAD A;  2WM9 A;  4TUU A;  5JMN D;  4HB5 A;  4JD2 G;  2ZGD A;  5AAO A;  5EIB E;  2X3M A;  4GAA A;  3AG1 E;  5G04 J;  5AEN A;  4GZ6 A;  1SA4 A;  3CST A;  3TWV A;  2IF4 A;  3QC1 A;  3UXG A;  2WQ7 A;  4XIF A;  1N95 A;  4XE0 A;  1NA0 A;  5FT9 A;  3O48 A;  4A55 A;  2KAT A;  3R7Q A;  3ZXS A;  3I5P A;  5HI7 A;  3CKC A;  2MOW A;  2OV8 A;  1Z6T A;  3CHO A;  4LEU A;  3RO3 A;  2KCL A;  3LY8 A;  2P9K G;  3B7S A;  2R17 C;  2QY7 A;  3T8M A;  3ASD A;  5CHE E;  3DPD A;  1KZO A;  4CDN A;  3C72 A;  4ZFH A;  4ZHB A;  4PS3 A;  4JHJ A;  1HX8 A;  2WQH A;  5EYL A;  5A7D B;  1U3C A;  3Q47 B;  3Q78 A;  4O60 A;  4GYO A;  3J5Q B;  1D9S A;  4EEC A; 
#chains in the Genus database with same CATH homology
 4QQI A;  2RFM A;  3ZU7 B;  2XZD G;  5BXO A;  5EID A;  4QFV A;  2HE0 A;  4RLY A;  1N0Q A;  2MYO A;  3C5R A;  3EHQ A;  2F8X K;  2QC9 A;  3AJI A;  1G3N B;  1YCS B;  5EN5 D;  3TWX A;  2KBX A;  2DWZ A;  4NIK A;  4K5A B;  5D66 A;  4Z68 A;  5CBN A;  3ZNG A;  4DX7 D;  4HI8 A;  5CEA A;  1AP7 A;  1SVX A;  1N0R A;  1WG0 A;  3JUE A;  4DUI A;  4ATZ D;  4B93 B;  3NOC D;  1IKN D;  3TWR A;  1BU9 A;  5CBO A;  5ENO D;  1NFI E;  2QYJ A;  5AQ9 A;  4DRX E;  1MX4 A;  1YMP A;  4DX1 A;  4F1P A;  3B95 A;  3Q9U C;  1DC2 A;  4TUM A;  3NBN B;  3HG0 D;  4OAV B;  3F6Q A;  5AQA A;  1YYH A;  2JAB A;  5JMN D;  4HB5 A;  2ZGD A;  4HRN A;  3W9F A;  5AAO A;  5AQB A;  5KNG A;  4J8Y A;  4CYM D;  4HBD A;  5EIB E;  2KXP C;  5HS0 A;  5KBA A;  4J7W A;  2DVW A;  2V4H C;  1AWC B;  1MJ0 A;  4YDW A;  3UTM A;  3EU9 A;  1BD8 A;  1BI7 B;  4HNA D;  4F6R D;  5ENR D;  3IXE A;  3TWV A;  3JXI A;  3KEA A;  3DEO A;  4LG6 A;  4DX2 A;  2BKG A;  5ENS D;  1OY3 D;  5ENQ D;  2F8Y A;  4U96 D;  1SW6 A;  4JB8 P;  3B7B A;  4DX5 D;  3UXG A;  4K5B A;  3T8K A;  4A63 B;  4CZ2 D;  3SO8 A;  4K5C A;  4UUC A;  4DX6 D;  5AAR A;  4BEP A;  4HI9 A;  3ZKJ A;  3D9H A;  1K3Z D;  2B0O E;  3TWS A;  2XEN A;  1OT8 A;  4U8Y D;  2RFA A;  4LSZ E;  2A5E A;  1MYO A;  3AAA C;  1QYM A;  1S70 B;  5CED B;  1UOH A;  2ETA A;  4HQD A;  1WDY A;  4GPM A;  2DZO A;  2F37 A;  5KWD A;  3UI2 A;  4BER A;  5ENP D;  2XEH A;  5CER B;  1TR4 A;  4N5Q A;  3J5P A;  4LNU D;  1IXV A;  2Y1L E;  4GMR A;  3V2X A;  3V2O A;  2ZGG A;  3TWT A;  3TWW A;  2BKK B;  2Y0B G;  4U8V D;  5EIL A;  3TWQ A;  2VGE A;  4O1O A;  3V31 A;  1A5E A;  4YDY A;  5HKP A;  2J8S D;  4G8K A;  5ENT D;  1MX2 A;  1N11 A;  1IHB A;  3T9K A;  4U95 D;  5JA4 D;  2V5Q C;  2DZN A;  2XEE A;  5AN8 A;  2NYJ A;  5CEC B;  1BI8 B;  1K1A A;  4O1P A;  5ITZ F;  2XZT G;  4ZFH A;  3NOG D;  2PNN A;  4HRM B;  3ZUV B;  5EYP F;  4C48 B;  5AQ7 A;  4ZHB A;  3HRA A;  3W9G A;  3V79 K;  5KNH D;  2AJA A;  4BES A;  3EHR A;  1DCQ A;  1BLX B;  2ETC A;  5EYL A;  3Q9N C;  5FIN A;  4HLL A;  4HRL A;  3JXJ A;  4O60 A;  5FIO A;  5HRY A;  3V30 A;  3LJN A;  3DEP A;  1MX6 A;  3J5Q B;  1K1B A;  4G8L A;  2L6B A;  3TWU A;  2FO1 E;  4OAU C;  2P2C P;  1D9S A;  2ETB A;  4BET A;  5BXU A;  4BSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...