4U96D

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB
total genus 53
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u96D00
5CEAA 3TWQA 5AN8A 1N0RA 4TUMA 5EYPF 5FIOA 1MYOA 1K1AA 5EN5D 2QC9A 1IKND 5HS0A 2L6BA 5CBNA 5AQAA 5BXOA 2XZTG 2FO1E 2ETAA 5CBOA 1BD8A 3UXGA 5AQ9A 3LJNA 3TWVA 3UTMA 1OY3D 3V2OA 2BKKB 3W9GA 1WDYA 1K1BA 4DUIA 2XENA 2A5EA 3ZU7B 4U8VD 1DCQA 1YMPA 3V2XA 1AP7A 4NIKA 4U96D 2HE0A 4J8YA 5AQ7A 5JA4D 3TWSA 4RLYA 3EU9A 2XZDG 4HI9A 2QYJA 4HNAD 4A63B 4DX6D 4K5CA 5ENOD 2ETBA 4HBDA 5AARA 2DZNA 3NOCD 1MJ0A 5ENSD 4ZHBA 4K5BA 2XEHA 5JMND 1N0QA 1WG0A 4HB5A 4G8KA 3V31A 1G3NB 4O1PA 5KNHD 4DRXE 2ZGDA 5ITZF 3J5QB 1MX6A 1YYHA 4ZFHA 1D9SA 3C5RA 3TWRA 4YDWA 4U8YD 2DVWA 1YCSB 2BKGA 3B95A 3EHQA 5ENRD 1SVXA 2V4HC 3AJIA 4HQDA 3SO8A 2KBXA 3DEOA 3NBNB 2RFAA 5ENPD 4DX5D 3TWUA 3NOGD 3ZKJA 1TR4A 1S70B 1MX2A 3Q9NC 4HRMB 4N5QA 3T8KA 4F1PA 3AAAC 2JABA 1MX4A 1N11A 4U95D 2DZOA 3TWWA 5CEDB 4O1OA 4QFVA 5BXUA 2VGEA 2KXPC 3HRAA 1OT8A 5KWDA 1BLXB 5ENQD 3ZNGA 1BI8B 3JXJA 3IXEA 1SW6A 2B0OE 4C48B 3UI2A 5HKPA 5HRYA 2F8XK 5EIBE 3T9KA 1NFIE 4GMRA 4BESA 2RFMA 1A5EA 4Z68A 5KNGA 2V5QC 3D9HA 1AWCB 4G8LA 2F8YA 2Y1LE 3DEPA 2MYOA 4LSZE 4QQIA 3W9FA 4O60A 1UOHA 5CECB 4UUCA 5ENTD 4BETA 4HI8A 2NYJA 3J5PA 2P2CP 4GPMA 2J8SD 4HRLA 3V30A 4HLLA 4F6RD 2XEEA 4LNUD 5FINA 3JUEA 4OAVB 5KBAA 4HRNA 3KEAA 1QYMA 5CERB 5AAOA 3JXIA 1DC2A 5D66A 4ATZD 2F37A 4BSZB 1BU9A 1BI7B 4DX7D 3B7BA 4DX2A 2AJAA 3Q9UC 2PNNA 3HG0D 4BERA 2ZGGA 5EILA 4YDYA 3ZUVB 5EIDA 1IHBA 1K3ZD 4LG6A 5AQBA 4OAUC 4B93B 1IXVA 3F6QA 4CZ2D 5EYLA 3V79K 4J7WA 2Y0BG 4K5AB 3TWTA 2DWZA 3TWXA 4CYMD 2ETCA 3EHRA 4DX1A 4JB8P 4BEPA
chains in the Genus database with same CATH superfamily
4XI9A 2KCVA 4TUMA 1MYOA 1H2UA 2IQCA 3EUVA 3PE3A 3FH5A 4GYOA 3FTSA 2IO2C 4H7YA 4DUIA 4LUNU 3S2AA 3V2XA 4DLQA 2IJGX 2J07A 5EX3A 1ELWA 3MKQB 5ENOD 4A55A 3Q75A 1HX8A 4WNFA 5DBKA 1KZOA 3CK9A 3APCA 3FUHA 5ITZF 3BEEA 4FULA 2DVWA 1SVXA 4HQDA 3NBNB 4L2LA 5M72A 3T8KA 4AY5A 3FUJA 2XPYA 4Q69A 2AVPA 5KWDA 3CVYA 3B7UX 1NA0A 3TGOA 2B0OE 4C48B 3MCXA 4KXKB 4PS7A 4AY6A 3TAXA 3D9HA 4R7LA 2BTDA 5KJLA 3J5PA 4LRZA 1KLXA 4CEMA 3FP3A 1HE8A 5CERB 3JXIA 4FP7A 1BI7B 3CK7A 3ML8A 2NSZA 2XGMA 2UWJG 4I2ZA 3ZUVB 1E8WA 4OAVB 3TWTA 3U9WA 4JB8P 3RRNB 4EBAG 3RU0A 3C3QA 3LEWA 3KEZA 4HOUA 2FBNA 4TV3A 2HR2A 2IONA 2WXFA 3W9GA 3ZU7B 2VGYA 2ETBA 3FY4A 3UPVA 3Q15A 4Y6CA 3ZXPA 2FO7A 3EIJA 3ABLE 4ILIA 3NAWA 2V4HC 3S7JA 5CCMA 1TR4A 4EZKA 1IQRA 3RRUA 4N5QA 1E7UA 4UI9J 3ULQA 5A7DB 4RG9A 4LERA 3R7RA 3AS5A 1N4SA 1PY1A 1HG2A 1U3DA 4LNGA 1HH8A 1HO8A 1LD7A 3G2TA 3NZUA 4J8SA 4OVVA 5FINA 3C3RA 1TN8A 3KEAA 4ME2A 2P9KG 3LCAA 3PEUB 4BFRA 4DX7D 2WVIA 2PNNA 2L6JA 3FEYA 1U2VG 1DC2A 3AS4A 2R2LA 1N54A 3U66A 1N4RA 2LAHA 4BEPA 3RO2A 5T8IA 2WXOA 2QFCA 3LY7A 2X38A 1TN7A 4C0MA 2ETAA 5B1AE 4U8VD 1TNBA 5ARGA 5KJMA 4HI9A 2XZDG 2NXPA 1OWMA 2XPIA 4ZFHA 4GZ6A 3CVQA 3S7BA 3EHQA 4CT4A 2HM8A 2WXIA 3NOGD 3ZKJA 3N71A 1TNOA 2PQRA 5KCMA 3O48A 3UX4A 2AXVA 2HO1A 4GMJA 3L9TA 5BXUA 4WWOA 4U0ZA 3CHSA 2XCBA 4GCNA 2AW6A 4HS2A 4BESA 1NFIE 2LO6A 3CVPA 3HXDA 4A3VA 3CHRA 2X3MA 2XRZA 2Q7FA 3NQPA 1FCHA 2WB2A 3DRAA 4HLLA 1SZAA 3AU4A 3B7BA 4ANUA 3B13A 2VGXB 1MZCA 2KATA 1IHBA 4BX8A 4N3BA 4U7EB 5AJDA 2Y0BG 3QNKA 3EHRA 4PUCA 4UI9C 2YNQA 3Q7AA 2RD0A 4E6HA 5CBNA 4GYYA 4KZ0A 5FZRA 5CCLA 3TXMA 3IHVA 3KAEA 1N9AA 3SFXA 2HE0A 3C3OA 1W3BA 4A63B 4G23A 1ELKA 3CIAA 3D9IA 3G2SA 4GMLA 5AARA 2CHXA 3URZA 4G8KA 1G3NB 3FUIA 3SFZA 4XKCA 5FZSA 3LVRE 4GPKA 1QQEA 4PH4B 4IN3B 4A1GA 3ZRHA 3UM2A 4U07A 4FADA 4XIFA 3CQCB 2WXLA 4I43A 3LKUA 3AG3E 5LP0A 3UIPC 2XPZA 1X5BA 2QY7A 2YHEA 4B94A 2DIWA 2RFMA 3HDXA 5KNGA 1AWCB 4QQIA 4B8CB 3ZXSA 2J8SD 2F0YA 4CDNA 4A3TA 3I5PA 5AIJA 3RK6A 3HXEA 4I9EA 5FQ6A 4FLBA 4G1TA 5LCWJ 4B93B 2J08A 3HVEA 4N2SA 4HOSA 3CQGB 4ILGA 2OOEA 4G11A 1K1AA 5EN5D 3QB2A 4J8EA 5AQAA 2XZTG 4JA9A 3UIOC 3PZ4A 1OY3D 3RO3A 1E90A 1JCQA 3L13A 5C1DA 3HXBA 2WQ7A 4OVUA 3QWPA 2FF4A 1NL4A 3DPDA 3SGHA 4TRQA 3PNLB 1S64A 2CHZA 5JMND 2VGXA 1N0QA 2Y4TA 3ASNE 1OWOA 2GRLA 4JA7A 2E2EA 5J90A 2XQ0A 1XGWA 5B3SE 3TG4A 5DIZA 4L2YA 3SO8A 3TWUA 2H6HA 1MQSA 3UT8A 4N5CA 1TYQG 5KJNA 3ZHEB 3PZ2A 3AG4E 2VGEA 3EHMA 2DBAA 2V0PA 4XI0A 5G04C 3DEPA 3BUAA 1QNFA 2EINE 1H6PA 5G2NA 3CHOA 1S0PA 1O5MA 2LSUA 2H6FA 4O6FA 5G04J 2UY1B 3EJNA 4FC8A 1TNYA 4FHKA 1K3ZD 3R9AB 1UN8A 4TXRA 3TL5A 3FEXA 5CEAA 5BNWA 1D8DA 4C0EA 3OXGA 3DSWA 2GRQB 4H7XA 1OWPA 2BKKB 2VSYA 1YA0A 1JCSA 3JQ1A 3FU3A 4HBDA 4JL0A 1H6OA 4K5BA 2WXPA 3ABME 4RVBA 3SY2A 3JCKC 3B95A 3VLDA 4PS3A 1P5QA 2GRRB 3FDHA 2YQ8A 2L0TB 3QK0A 4XZ4A 3EDTB 1MX4A 4KVOA 5HI7A 4ACKA 4DK5A 2Y3AA 2VQ2A 5CHEE 3FFLA 4IYPA 1FT1A 2IY0C 2MYOA 3Q73A 3L82A 1SQMA 2H6IA 2XS8A 5J08A 4Y6WA 1OXJA 3RKVA 3Q5MA 1O1TA 2DCPA 5KBAA 3FTVA 3QKYA 2MOWA 2RG8A 2B6CA 3CKBA 3G2UA 3ZHEA 3O4ZA 3PUKA 5AQBA 3R7QA 3FUDA 4CYMD 4XE0A 5D0QD 2BF0X 2JLBA 3TWQA 2R5SA 5BT1A 1KPSB 3AU5A 3D9PA 2L6BA 3UM3A 2WQHA 4U8HA 3LY9A 4GTOA 1TEZA 3TWVA 4PDXA 4F1SA 1LF8A 5C2YA 2WPVA 2XGOA 1S63A 3B7TA 3WG7E 4GTPA 1ZU2A 4K5CA 2C0LA 4TXPA 1Z6TA 4MS6A 2UY1A 3DSUA 4EQFA 5AJLA 4XKBA 3TWRA 1PC2A 3Q78A 2LXLA 2R05A 2KCKA 2A4ZA 4M7CA 2XRYA 3AAAC 3ZEFA 4U95D 3MV3B 3FH7A 4QFVA 3K9IA 2KXPC 1TNUA 1RZ4A 3R9MA 4WAFA 1ZB1A 3D3MA 3B7SA 5ENTD 3TG5A 2NYJA 3GZ2A 2P2CP 3KSQA 4L9PA 3AS8A 4HRLA 4GU5A 3Q79A 3DSXA 3RIBA 3CVWA 1IHGA 2VTBB 5AAOA 1N52A 2R17C 3QDNA 3UINC 2WXGA 4IULA 3SI5A 3HG0D 4KT6B 3VLEA 1SZ9A 3SHFA 2IF4A 4LG6A 3GZ1A 5JJ7A 4I1MA 4AIFA 1HS6A 3EIQC 3TWXA 3B7RL 4YVQC 3Q4AB 4L23A 1OCZE 3ZVVA 1N0RA 4AM9A 5FQ4A 4EPZA 2EQXA 3DXMG 2IOSA 2AWIA 1L5JA 3L16A 1AP7A 4U96D 4UWHA 2WXNA 1EPUA 4HNAD 4WNDA 2XS1A 2ZU6B 5EDSA 3P1UA 4M3OA 3JUIA 2I1KA 1N4PA 5ARFA 1UG3A 2IO3C 5G05C 1IQUA 4FU3A 3P2BA 3L6AA 3Q9NC 4HRMB 4F1PA 2P9IG 3D9JA 2V5FA 2I9CA 4BT8A 1BI8B 3LDZA 3HHMA 3RAUA 3PZ1A 1K8KG 2E0IA 5EX0A 3SNXA 2FI7A 3UUXA 2Y1LE 4EBAA 1FT2A 3ESLA 1O1SA 4HI8A 1BPOA 1HZ4A 2GGFA 3CV0A 2VJ8A 4I2WA 2VSXE 4LNUD 1OCCE 4OYSA 4HOTA 3ZGQA 4JC8A 3MGBA 2Y4UA 4DX2A 3SD5A 2ZGGA 5FJYA 3LVQE 4JHKA 3L08A 4KVMA 4ANXA 1IXVA 1JUQA 4UWGA 3F6QA 4K5AB 3ZIMA 1N4QA 4GTVA 3DSVA 3PVLA 5BV0A 3VTYA 5A23A 3T5VA 1H0AA 1QZ2A 2FULA 5HS0A 4TXQA 5CBOA 2P9NG 2VSOE 1E7VA 1YMPA 3D9KA 5CRUA 2ZIRA 3IV0A 1N95A 2BUGA 4KYOB 2WM9A 1XNFA 1VDYA 3MA5A 3EU9A 2H6GA 2QYJA 1D8EA 3EU5A 4A1SA 4ZHBA 3FTUA 2XHEA 4HORA 3OAWA 3ULEG 4DRXE 1KZPA 3CVXA 3Q49B 3DBSA 4JD2G 2I1JA 2KBXA 3DEOA 2RFAA 1JPLA 4DX5D 3SF4A 2EIME 3ASHA 3CHMA 3U4TA 3ASOE 3IKOB 4BX9A 2L0IA 3ZYLA 1WM5A 3OTNA 3JYSA 2I6HA 1Y8MA 2XCCA 4KMOA 2FEZA 3T9KA 4P29A 3UMVA 2ILRA 3HXFA 3SFYA 4G8LA 1NP7A 5HQ8A 4N3CA 5KJKA 2GRPB 4I1OB 2WMNA 5D66A 4JHJA 3ZN3A 5BPPA 3UT4A 1UW4B 4NQ0A 3Q9UC 4GA1A 3SZ7A 3PE4A 3D9LA 4EECA 4UWFA 3ZW3A 1EDUA 4Q96A 2J09A 4AOFA 3Q7FA 3GYZA 1H6KA 2IFUA 3E4BA 1DCQA 5AQ7A 2VSNA 2KC7A 5D0OD 1PAQA 2XEHA 1WG0A 4UQXA 4HFGA 1EYHA 1WAO1 3C5RA 4YDWA 3UT7A 2BKGA 4U04A 3FWVA 3APDA 1SA4A 3IEGA 5ENPD 5ANRA 2VYIA 3HYMB 3I4RB 3PUJA 2MHKA 1ZBPA 3NB2A 3QOUA 2DZOA 2DYRE 1E96B 4B0ZA 4EHMA 1OT8A 1BLXB 2XEVA 4U0UA 1E8XA 4NACA 3L22A 3FU5A 1A17A 2LAIA 4JPSA 4N3AA 5JJ6A 3APFA 5CECB 4GTSA 3DWLG 4FHJA 3AG1E 2PZIA 3BG0B 4JXTA 3FUNA 4ATZD 4UWKA 3JQ0A 3DSTA 4V3IA 2GW1A 3HVEB 4RG6A 3T8MA 5EYPF 4HVBA 4F7AA 3KSLA 1KT1A 2P9UG 1WDYA 2A5EA 4I6EA 4NIKA 2ONDA 4KBQA 1GW6A 2V4LA 4GB9A 3NF1A 2CHWA 4BY6A 4ANWA 1YYHA 1QBQA 3SBTB 4U8YD 1Q2ZA 1YCSB 2EILE 4CCAA 3QWWA 2I2OA 4DLOA 4J8FA 1MX2A 5LFAA 3FH8A 3FUMA 3MX3A 2JABA 4GZDA 5A6CA 5LCWC 4GTRA 4JEUA 3PZ3A 5ENQD 2KZTB 1SW6A 5HRYA 2F8XK 2RKKA 5B1BE 3WXXA 3CKCA 2LUHA 4GCOA 4LSZE 4UWLA 4LCTA 2R03A 4WNEA 3U64A 4F6RD 2CFZA 2OV8A 3DXKG 3FTWA 4ABNA 2HYZA 5ENNA 2WXRA 2J9QA 2GRMA 2A5UA 4ATGA 5LX8A 2ETCA 1FVHA 3FTZA 1D9SA 3UQ3A 2EIJE 1Y6IA 4WUYA 2LSVA 3IBEA 3E30A 2C0MA 4K03A 5FT9A 4G25A 3ASFA 3V2OA 3DSSA 1H2VC 3DPYA 3FUFA 2QZAA 3CVNA 4BTBA 4CRWA 5CMYA 1N94A 4RSYA 2AXZA 5LOZA 4AV7A 4O1PA 3RSEG 4W9RA 1HG5A 2XGSA 2KM4A 1Z5SC 2X6IA 1S70B 3MEKA 4JVSA 1H2TC 1B89A 3CSTA 3HIZA 4D10C 3TWWA 3IXEA 4FJZA 1DCEA 3UI2A 5IY5E 3U3WA 2R59A 3CEQA 3ZYKA 1HU3A 2F8YA 4C9BB 3V30A 1UJKA 3L54A 2XEEA 2OEWA 1JWFA 4YDOA 5BV1A 3VLFA 4B89A 4BSZB 1U3CA 2OCCE 1UN9A 1JWGA 1Z3YA 3GW4A 3GZSA 3AG2E 3QC1A 4GZ5A 3T5XA 5EIDA 3PRZA 3ESKA 3V79K 2KZTA 4L1BA 4Q94A 1DNPA 4FJYA 3E37A 1DVPA 3S7DA 2X6HA 4GYWA 5BXOA 2IEJA 3ONKA 4GZCA 4JHRA 3UXGA 5AQ9A 5CMWA 4WWNA 3KD7A 1K1BA 1KT0A 4YNDA 4UQYA 4J8YA 2X6JA 3TWSA 4RLYA 1OCOE 2WXQA 4F3VA 3C72A 4DX6D 3C98A 4GZ3A 3LY8A 2X6FA 1ELRA 4U63A 4EZJA 1FPPA 3LYAA 4UQZA 2CG2A 3G2WA 3RRMB 4ACLA 3ZYQA 1E8ZA 1WY6A 1NZNA 4APOA 1TNZA 1X81A 3NZSA 4O1OA 2MRIA 2M63A 5EKQD 3JXJA 4BTAA 3MKRA 4NRHB 1JCRA 1A5EA 4AXHA 4GTTA 2OVFA 1O1RA 4XEIG 5FQ7A 4GA2A 4X8QA 3FUKA 2P9PG 4BETA 2J4DA 4GPMA 4IRUA 3OXFA 5T3RA 5G55A 3CVLA 3I3NA 3FTXA 2VTBA 3ABKE 3E34A 4MRUA 3LJ3A 3FTYA 2F37A 4I17A 2P9LG 1NA3A 4G26A 4LNBA 5T4YA 2OEVA 3CVVA 2OVBA 2CG3A 3BG1B 5AENA 4J7WA 2DWZA 3LXUX 1FVFA 3ONLA 3ZYMA 5FIOA 1HF8A 4AP2A 4J8DA 3E32A 1MHQA 2PM6A 2YINA 3TXNA 1BD8A 1LTXA 3ASDA 3UTMA 3QJZA 5JHAA 4UI9K 4WNGA 4G24A 2BEDA 2V8SE 1H19A 5ANLA 1TN6A 2Y69E 3NOCD 5ENSD 5AYWD 5CRVA 3V31A 4HXIA 4B8AA 5KNHD 2ZGDA 1OCRE 4LEUA 2WQ6A 1OWLA 2C2LA 4BSXA 3CGHA 4J6IA 5FTPA 1NI1A 5BUZA 3AJIA 2J4BA 4I6JA 1N11A 1TJCA 3CVUA 4AVXA 3CSFA 4JEHA 5H7PA 4AEZC 4RQIA 2WXKA 4GMRA 4KZCA 4XX5A 2J49A 4URKA 1RW2A 3EHNA 4MBGA 3PDNA 2ZISA 2CFUA 4TUUA 4UUCA 2L9BA 3CLJA 3IHYA 3CHQA 3JUEA 4E85A 2GROB 3QWVA 3UM0A 3QAQA 4YDYA 3UKUG 3BQOA 3G2VA 4CZ2D 4MKTA 3OXLA 1INZA 2QYUA 4YDEA 4CDRA 4I6GA 3FULA 5AN8A 4N39A 2QC9A 4DJAA 3PZDA 2EIKE 3LJNA 2WMOA 4YVOA 4NURA 3CR3A 5JA4D 3SQVA 4ANVA 3ENEA 2NC9A 3PNTB 3VTXA 2ZXWE 3E33A 3L17A 1HFAA 2DYSE 2WXJA 4HB5A 2LNIA 3RJVA 4I9CA 5E75A 4CGWA 5ENRD 4AJWA 2IOLA 4HLEA 3ML9A 3PREA 3FU0A 1HXIA 4GAAA 4DI4A 3MV2B 4ILHB 3MJWA 2JEKA 4GTMA 5CEDB 3HRAA 3MYVA 4FA6A 1EF1C 5HKPA 4CGVA 5EIBE 3PS6A 1IYGA 4I1AA 5JHBA 2V5QC 4GA0A 4K0RA 1UOHA 3ULYA 2P58C 3UKRG 2IU1A 3S7FA 2P9SG 1LD8A 4HRNA 1QYMA 3BU8A 4GTQA 3ASGA 4JZYA 3CHPA 1V55E 3LPZA 4JW1A 3FU6A 4EZLA 2PL2A 5FQ8A 2LXMA 5BW8C 4U0SA 1IKND 3KS2A 2WXMA 3MZLB 3I4GA 4BT9A 2FO1E 2WXHA 3MKQA 2XENA 4HOQA 5FWQA 1OWNA 2X6KA 3D9MA 4CT0A 2DZNA 1MJ0A 3QARA 3ZFWA 3J5QB 1MX6A 5E76A 4WWPA 3Q47B 2KCLA 4G2VA 4BWRA 5D2MC 4CDMA 1TJFA 4PS8A 5G05J 4N2QA 3UM1A 3CK8A 5FZQA 3D9NA 3ZNGA 3PEVB 2PM7A 3PH0C 2GRNB 1V54E 3D9OA 4APFA 1SA5A 4Z68A 1OUVA 1Z3XA 3W9FA 3HXCA 4O60A 4FLHA 3ISMC 3FHEA 3SBSA 3LS8A 4F53A 3TJPA 2R02A 4J0UA 5JJTA 1BU9A 3X2QE 4DI3A 2AJAA 4BERA 5EILA 4DPRA 2PQNA 4MLPA 3ZPJA 4OAUC 1UJJA 2AXUA 3FUEA 5EYLA 4L7TA 4DX1A 1E8YA 2YHCA
chains in the Genus database with same CATH topology
5CEAA 3TWQA 5AN8A 1N0RA 4TUMA 5EYPF 5FIOA 1MYOA 1K1AA 5EN5D 2QC9A 1IKND 5HS0A 2L6BA 5CBNA 5AQAA 5BXOA 2XZTG 2FO1E 2ETAA 5CBOA 1BD8A 3UXGA 5AQ9A 3LJNA 3TWVA 3UTMA 1OY3D 3V2OA 2BKKB 3W9GA 1WDYA 1K1BA 4DUIA 2XENA 2A5EA 3ZU7B 4U8VD 1DCQA 1YMPA 3V2XA 1AP7A 4NIKA 4U96D 2HE0A 4J8YA 5AQ7A 5JA4D 3TWSA 4RLYA 3EU9A 2XZDG 4HI9A 2QYJA 4HNAD 4A63B 4DX6D 4K5CA 5ENOD 2ETBA 4HBDA 5AARA 2DZNA 3NOCD 1MJ0A 5ENSD 4ZHBA 4K5BA 2XEHA 5JMND 1N0QA 1WG0A 4HB5A 4G8KA 3V31A 1G3NB 4O1PA 5KNHD 4DRXE 2ZGDA 5ITZF 3J5QB 1MX6A 1YYHA 4ZFHA 1D9SA 3C5RA 3TWRA 4YDWA 4U8YD 2DVWA 1YCSB 2BKGA 3B95A 3EHQA 5ENRD 1SVXA 2V4HC 3AJIA 4HQDA 3SO8A 2KBXA 3DEOA 3NBNB 2RFAA 5ENPD 4DX5D 3TWUA 3NOGD 3ZKJA 1TR4A 1S70B 1MX2A 3Q9NC 4HRMB 4N5QA 3T8KA 4F1PA 3AAAC 2JABA 1MX4A 1N11A 4U95D 2DZOA 3TWWA 5CEDB 4O1OA 4QFVA 5BXUA 2VGEA 2KXPC 3HRAA 1OT8A 5KWDA 1BLXB 5ENQD 3ZNGA 1BI8B 3JXJA 3IXEA 1SW6A 2B0OE 4C48B 3UI2A 5HKPA 5HRYA 2F8XK 5EIBE 3T9KA 1NFIE 4GMRA 4BESA 2RFMA 1A5EA 4Z68A 5KNGA 2V5QC 3D9HA 1AWCB 4G8LA 2F8YA 2Y1LE 3DEPA 2MYOA 4LSZE 4QQIA 3W9FA 4O60A 1UOHA 5CECB 4UUCA 5ENTD 4BETA 4HI8A 2NYJA 3J5PA 2P2CP 4GPMA 2J8SD 4HRLA 3V30A 4HLLA 4F6RD 2XEEA 4LNUD 5FINA 3JUEA 4OAVB 5KBAA 4HRNA 3KEAA 1QYMA 5CERB 5AAOA 3JXIA 1DC2A 5D66A 4ATZD 2F37A 4BSZB 1BU9A 1BI7B 4DX7D 3B7BA 4DX2A 2AJAA 3Q9UC 2PNNA 3HG0D 4BERA 2ZGGA 5EILA 4YDYA 3ZUVB 5EIDA 1IHBA 1K3ZD 4LG6A 5AQBA 4OAUC 4B93B 1IXVA 3F6QA 4CZ2D 5EYLA 3V79K 4J7WA 2Y0BG 4K5AB 3TWTA 2DWZA 3TWXA 4CYMD 2ETCA 3EHRA 4DX1A 4JB8P 4BEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEA A;  3TWQ A;  5AN8 A;  1N0R A;  4TUM A;  5EYP F;  5FIO A;  1MYO A;  1K1A A;  5EN5 D;  2QC9 A;  1IKN D;  5HS0 A;  2L6B A;  5CBN A;  5AQA A;  5BXO A;  2XZT G;  2FO1 E;  2ETA A;  5CBO A;  1BD8 A;  3UXG A;  5AQ9 A;  3LJN A;  3TWV A;  3UTM A;  1OY3 D;  3V2O A;  2BKK B;  3W9G A;  1WDY A;  1K1B A;  4DUI A;  2XEN A;  2A5E A;  3ZU7 B;  4U8V D;  1DCQ A;  1YMP A;  3V2X A;  1AP7 A;  4NIK A;  4U96 D;  2HE0 A;  4J8Y A;  5AQ7 A;  5JA4 D;  3TWS A;  4RLY A;  3EU9 A;  2XZD G;  4HI9 A;  2QYJ A;  4HNA D;  4A63 B;  4DX6 D;  4K5C A;  5ENO D;  2ETB A;  4HBD A;  5AAR A;  2DZN A;  3NOC D;  1MJ0 A;  5ENS D;  4ZHB A;  4K5B A;  2XEH A;  5JMN D;  1N0Q A;  1WG0 A;  4HB5 A;  4G8K A;  3V31 A;  1G3N B;  4O1P A;  5KNH D;  4DRX E;  2ZGD A;  5ITZ F;  3J5Q B;  1MX6 A;  1YYH A;  4ZFH A;  1D9S A;  3C5R A;  3TWR A;  4YDW A;  4U8Y D;  2DVW A;  1YCS B;  2BKG A;  3B95 A;  3EHQ A;  5ENR D;  1SVX A;  2V4H C;  3AJI A;  4HQD A;  3SO8 A;  2KBX A;  3DEO A;  3NBN B;  2RFA A;  5ENP D;  4DX5 D;  3TWU A;  3NOG D;  3ZKJ A;  1TR4 A;  1S70 B;  1MX2 A;  3Q9N C;  4HRM B;  4N5Q A;  3T8K A;  4F1P A;  3AAA C;  2JAB A;  1MX4 A;  1N11 A;  4U95 D;  2DZO A;  3TWW A;  5CED B;  4O1O A;  4QFV A;  5BXU A;  2VGE A;  2KXP C;  3HRA A;  1OT8 A;  5KWD A;  1BLX B;  5ENQ D;  3ZNG A;  1BI8 B;  3JXJ A;  3IXE A;  1SW6 A;  2B0O E;  4C48 B;  3UI2 A;  5HKP A;  5HRY A;  2F8X K;  5EIB E;  3T9K A;  1NFI E;  4GMR A;  4BES A;  2RFM A;  1A5E A;  4Z68 A;  5KNG A;  2V5Q C;  3D9H A;  1AWC B;  4G8L A;  2F8Y A;  2Y1L E;  3DEP A;  2MYO A;  4LSZ E;  4QQI A;  3W9F A;  4O60 A;  1UOH A;  5CEC B;  4UUC A;  5ENT D;  4BET A;  4HI8 A;  2NYJ A;  3J5P A;  2P2C P;  4GPM A;  2J8S D;  4HRL A;  3V30 A;  4HLL A;  4F6R D;  2XEE A;  4LNU D;  5FIN A;  3JUE A;  4OAV B;  5KBA A;  4HRN A;  3KEA A;  1QYM A;  5CER B;  5AAO A;  3JXI A;  1DC2 A;  5D66 A;  4ATZ D;  2F37 A;  4BSZ B;  1BU9 A;  1BI7 B;  4DX7 D;  3B7B A;  4DX2 A;  2AJA A;  3Q9U C;  2PNN A;  3HG0 D;  4BER A;  2ZGG A;  5EIL A;  4YDY A;  3ZUV B;  5EID A;  1IHB A;  1K3Z D;  4LG6 A;  5AQB A;  4OAU C;  4B93 B;  1IXV A;  3F6Q A;  4CZ2 D;  5EYL A;  3V79 K;  4J7W A;  2Y0B G;  4K5A B;  3TWT A;  2DWZ A;  3TWX A;  4CYM D;  2ETC A;  3EHR A;  4DX1 A;  4JB8 P;  4BEP A; 
#chains in the Genus database with same CATH topology
 4XI9 A;  2KCV A;  4TUM A;  1MYO A;  1H2U A;  2IQC A;  3EUV A;  3PE3 A;  3FH5 A;  4GYO A;  3FTS A;  2IO2 C;  4H7Y A;  4DUI A;  4LUN U;  3S2A A;  3V2X A;  4DLQ A;  2IJG X;  2J07 A;  5EX3 A;  1ELW A;  3MKQ B;  5ENO D;  4A55 A;  3Q75 A;  1HX8 A;  4WNF A;  5DBK A;  1KZO A;  3CK9 A;  3APC A;  3FUH A;  5ITZ F;  3BEE A;  4FUL A;  2DVW A;  1SVX A;  4HQD A;  3NBN B;  4L2L A;  5M72 A;  3T8K A;  4AY5 A;  3FUJ A;  2XPY A;  4Q69 A;  2AVP A;  5KWD A;  3CVY A;  3B7U X;  1NA0 A;  3TGO A;  2B0O E;  4C48 B;  3MCX A;  4KXK B;  4PS7 A;  4AY6 A;  3TAX A;  3D9H A;  4R7L A;  2BTD A;  5KJL A;  3J5P A;  4LRZ A;  1KLX A;  4CEM A;  3FP3 A;  1HE8 A;  5CER B;  3JXI A;  4FP7 A;  1BI7 B;  3CK7 A;  3ML8 A;  2NSZ A;  2XGM A;  2UWJ G;  4I2Z A;  3ZUV B;  1E8W A;  4OAV B;  3TWT A;  3U9W A;  4JB8 P;  3RRN B;  4EBA G;  3RU0 A;  3C3Q A;  3LEW A;  3KEZ A;  4HOU A;  2FBN A;  4TV3 A;  2HR2 A;  2ION A;  2WXF A;  3W9G A;  3ZU7 B;  2VGY A;  2ETB A;  3FY4 A;  3UPV A;  3Q15 A;  4Y6C A;  3ZXP A;  2FO7 A;  3EIJ A;  3ABL E;  4ILI A;  3NAW A;  2V4H C;  3S7J A;  5CCM A;  1TR4 A;  4EZK A;  1IQR A;  3RRU A;  4N5Q A;  1E7U A;  4UI9 J;  3ULQ A;  5A7D B;  4RG9 A;  4LER A;  3R7R A;  3AS5 A;  1N4S A;  1PY1 A;  1HG2 A;  1U3D A;  4LNG A;  1HH8 A;  1HO8 A;  1LD7 A;  3G2T A;  3NZU A;  4J8S A;  4OVV A;  5FIN A;  3C3R A;  1TN8 A;  3KEA A;  4ME2 A;  2P9K G;  3LCA A;  3PEU B;  4BFR A;  4DX7 D;  2WVI A;  2PNN A;  2L6J A;  3FEY A;  1U2V G;  1DC2 A;  3AS4 A;  2R2L A;  1N54 A;  3U66 A;  1N4R A;  2LAH A;  4BEP A;  3RO2 A;  5T8I A;  2WXO A;  2QFC A;  3LY7 A;  2X38 A;  1TN7 A;  4C0M A;  2ETA A;  5B1A E;  4U8V D;  1TNB A;  5ARG A;  5KJM A;  4HI9 A;  2XZD G;  2NXP A;  1OWM A;  2XPI A;  4ZFH A;  4GZ6 A;  3CVQ A;  3S7B A;  3EHQ A;  4CT4 A;  2HM8 A;  2WXI A;  3NOG D;  3ZKJ A;  3N71 A;  1TNO A;  2PQR A;  5KCM A;  3O48 A;  3UX4 A;  2AXV A;  2HO1 A;  4GMJ A;  3L9T A;  5BXU A;  4WWO A;  4U0Z A;  3CHS A;  2XCB A;  4GCN A;  2AW6 A;  4HS2 A;  4BES A;  1NFI E;  2LO6 A;  3CVP A;  3HXD A;  4A3V A;  3CHR A;  2X3M A;  2XRZ A;  2Q7F A;  3NQP A;  1FCH A;  2WB2 A;  3DRA A;  4HLL A;  1SZA A;  3AU4 A;  3B7B A;  4ANU A;  3B13 A;  2VGX B;  1MZC A;  2KAT A;  1IHB A;  4BX8 A;  4N3B A;  4U7E B;  5AJD A;  2Y0B G;  3QNK A;  3EHR A;  4PUC A;  4UI9 C;  2YNQ A;  3Q7A A;  2RD0 A;  4E6H A;  5CBN A;  4GYY A;  4KZ0 A;  5FZR A;  5CCL A;  3TXM A;  3IHV A;  3KAE A;  1N9A A;  3SFX A;  2HE0 A;  3C3O A;  1W3B A;  4A63 B;  4G23 A;  1ELK A;  3CIA A;  3D9I A;  3G2S A;  4GML A;  5AAR A;  2CHX A;  3URZ A;  4G8K A;  1G3N B;  3FUI A;  3SFZ A;  4XKC A;  5FZS A;  3LVR E;  4GPK A;  1QQE A;  4PH4 B;  4IN3 B;  4A1G A;  3ZRH A;  3UM2 A;  4U07 A;  4FAD A;  4XIF A;  3CQC B;  2WXL A;  4I43 A;  3LKU A;  3AG3 E;  5LP0 A;  3UIP C;  2XPZ A;  1X5B A;  2QY7 A;  2YHE A;  4B94 A;  2DIW A;  2RFM A;  3HDX A;  5KNG A;  1AWC B;  4QQI A;  4B8C B;  3ZXS A;  2J8S D;  2F0Y A;  4CDN A;  4A3T A;  3I5P A;  5AIJ A;  3RK6 A;  3HXE A;  4I9E A;  5FQ6 A;  4FLB A;  4G1T A;  5LCW J;  4B93 B;  2J08 A;  3HVE A;  4N2S A;  4HOS A;  3CQG B;  4ILG A;  2OOE A;  4G11 A;  1K1A A;  5EN5 D;  3QB2 A;  4J8E A;  5AQA A;  2XZT G;  4JA9 A;  3UIO C;  3PZ4 A;  1OY3 D;  3RO3 A;  1E90 A;  1JCQ A;  3L13 A;  5C1D A;  3HXB A;  2WQ7 A;  4OVU A;  3QWP A;  2FF4 A;  1NL4 A;  3DPD A;  3SGH A;  4TRQ A;  3PNL B;  1S64 A;  2CHZ A;  5JMN D;  2VGX A;  1N0Q A;  2Y4T A;  3ASN E;  1OWO A;  2GRL A;  4JA7 A;  2E2E A;  5J90 A;  2XQ0 A;  1XGW A;  5B3S E;  3TG4 A;  5DIZ A;  4L2Y A;  3SO8 A;  3TWU A;  2H6H A;  1MQS A;  3UT8 A;  4N5C A;  1TYQ G;  5KJN A;  3ZHE B;  3PZ2 A;  3AG4 E;  2VGE A;  3EHM A;  2DBA A;  2V0P A;  4XI0 A;  5G04 C;  3DEP A;  3BUA A;  1QNF A;  2EIN E;  1H6P A;  5G2N A;  3CHO A;  1S0P A;  1O5M A;  2LSU A;  2H6F A;  4O6F A;  5G04 J;  2UY1 B;  3EJN A;  4FC8 A;  1TNY A;  4FHK A;  1K3Z D;  3R9A B;  1UN8 A;  4TXR A;  3TL5 A;  3FEX A;  5CEA A;  5BNW A;  1D8D A;  4C0E A;  3OXG A;  3DSW A;  2GRQ B;  4H7X A;  1OWP A;  2BKK B;  2VSY A;  1YA0 A;  1JCS A;  3JQ1 A;  3FU3 A;  4HBD A;  4JL0 A;  1H6O A;  4K5B A;  2WXP A;  3ABM E;  4RVB A;  3SY2 A;  3JCK C;  3B95 A;  3VLD A;  4PS3 A;  1P5Q A;  2GRR B;  3FDH A;  2YQ8 A;  2L0T B;  3QK0 A;  4XZ4 A;  3EDT B;  1MX4 A;  4KVO A;  5HI7 A;  4ACK A;  4DK5 A;  2Y3A A;  2VQ2 A;  5CHE E;  3FFL A;  4IYP A;  1FT1 A;  2IY0 C;  2MYO A;  3Q73 A;  3L82 A;  1SQM A;  2H6I A;  2XS8 A;  5J08 A;  4Y6W A;  1OXJ A;  3RKV A;  3Q5M A;  1O1T A;  2DCP A;  5KBA A;  3FTV A;  3QKY A;  2MOW A;  2RG8 A;  2B6C A;  3CKB A;  3G2U A;  3ZHE A;  3O4Z A;  3PUK A;  5AQB A;  3R7Q A;  3FUD A;  4CYM D;  4XE0 A;  5D0Q D;  2BF0 X;  2JLB A;  3TWQ A;  2R5S A;  5BT1 A;  1KPS B;  3AU5 A;  3D9P A;  2L6B A;  3UM3 A;  2WQH A;  4U8H A;  3LY9 A;  4GTO A;  1TEZ A;  3TWV A;  4PDX A;  4F1S A;  1LF8 A;  5C2Y A;  2WPV A;  2XGO A;  1S63 A;  3B7T A;  3WG7 E;  4GTP A;  1ZU2 A;  4K5C A;  2C0L A;  4TXP A;  1Z6T A;  4MS6 A;  2UY1 A;  3DSU A;  4EQF A;  5AJL A;  4XKB A;  3TWR A;  1PC2 A;  3Q78 A;  2LXL A;  2R05 A;  2KCK A;  2A4Z A;  4M7C A;  2XRY A;  3AAA C;  3ZEF A;  4U95 D;  3MV3 B;  3FH7 A;  4QFV A;  3K9I A;  2KXP C;  1TNU A;  1RZ4 A;  3R9M A;  4WAF A;  1ZB1 A;  3D3M A;  3B7S A;  5ENT D;  3TG5 A;  2NYJ A;  3GZ2 A;  2P2C P;  3KSQ A;  4L9P A;  3AS8 A;  4HRL A;  4GU5 A;  3Q79 A;  3DSX A;  3RIB A;  3CVW A;  1IHG A;  2VTB B;  5AAO A;  1N52 A;  2R17 C;  3QDN A;  3UIN C;  2WXG A;  4IUL A;  3SI5 A;  3HG0 D;  4KT6 B;  3VLE A;  1SZ9 A;  3SHF A;  2IF4 A;  4LG6 A;  3GZ1 A;  5JJ7 A;  4I1M A;  4AIF A;  1HS6 A;  3EIQ C;  3TWX A;  3B7R L;  4YVQ C;  3Q4A B;  4L23 A;  1OCZ E;  3ZVV A;  1N0R A;  4AM9 A;  5FQ4 A;  4EPZ A;  2EQX A;  3DXM G;  2IOS A;  2AWI A;  1L5J A;  3L16 A;  1AP7 A;  4U96 D;  4UWH A;  2WXN A;  1EPU A;  4HNA D;  4WND A;  2XS1 A;  2ZU6 B;  5EDS A;  3P1U A;  4M3O A;  3JUI A;  2I1K A;  1N4P A;  5ARF A;  1UG3 A;  2IO3 C;  5G05 C;  1IQU A;  4FU3 A;  3P2B A;  3L6A A;  3Q9N C;  4HRM B;  4F1P A;  2P9I G;  3D9J A;  2V5F A;  2I9C A;  4BT8 A;  1BI8 B;  3LDZ A;  3HHM A;  3RAU A;  3PZ1 A;  1K8K G;  2E0I A;  5EX0 A;  3SNX A;  2FI7 A;  3UUX A;  2Y1L E;  4EBA A;  1FT2 A;  3ESL A;  1O1S A;  4HI8 A;  1BPO A;  1HZ4 A;  2GGF A;  3CV0 A;  2VJ8 A;  4I2W A;  2VSX E;  4LNU D;  1OCC E;  4OYS A;  4HOT A;  3ZGQ A;  4JC8 A;  3MGB A;  2Y4U A;  4DX2 A;  3SD5 A;  2ZGG A;  5FJY A;  3LVQ E;  4JHK A;  3L08 A;  4KVM A;  4ANX A;  1IXV A;  1JUQ A;  4UWG A;  3F6Q A;  4K5A B;  3ZIM A;  1N4Q A;  4GTV A;  3DSV A;  3PVL A;  5BV0 A;  3VTY A;  5A23 A;  3T5V A;  1H0A A;  1QZ2 A;  2FUL A;  5HS0 A;  4TXQ A;  5CBO A;  2P9N G;  2VSO E;  1E7V A;  1YMP A;  3D9K A;  5CRU A;  2ZIR A;  3IV0 A;  1N95 A;  2BUG A;  4KYO B;  2WM9 A;  1XNF A;  1VDY A;  3MA5 A;  3EU9 A;  2H6G A;  2QYJ A;  1D8E A;  3EU5 A;  4A1S A;  4ZHB A;  3FTU A;  2XHE A;  4HOR A;  3OAW A;  3ULE G;  4DRX E;  1KZP A;  3CVX A;  3Q49 B;  3DBS A;  4JD2 G;  2I1J A;  2KBX A;  3DEO A;  2RFA A;  1JPL A;  4DX5 D;  3SF4 A;  2EIM E;  3ASH A;  3CHM A;  3U4T A;  3ASO E;  3IKO B;  4BX9 A;  2L0I A;  3ZYL A;  1WM5 A;  3OTN A;  3JYS A;  2I6H A;  1Y8M A;  2XCC A;  4KMO A;  2FEZ A;  3T9K A;  4P29 A;  3UMV A;  2ILR A;  3HXF A;  3SFY A;  4G8L A;  1NP7 A;  5HQ8 A;  4N3C A;  5KJK A;  2GRP B;  4I1O B;  2WMN A;  5D66 A;  4JHJ A;  3ZN3 A;  5BPP A;  3UT4 A;  1UW4 B;  4NQ0 A;  3Q9U C;  4GA1 A;  3SZ7 A;  3PE4 A;  3D9L A;  4EEC A;  4UWF A;  3ZW3 A;  1EDU A;  4Q96 A;  2J09 A;  4AOF A;  3Q7F A;  3GYZ A;  1H6K A;  2IFU A;  3E4B A;  1DCQ A;  5AQ7 A;  2VSN A;  2KC7 A;  5D0O D;  1PAQ A;  2XEH A;  1WG0 A;  4UQX A;  4HFG A;  1EYH A;  1WAO 1;  3C5R A;  4YDW A;  3UT7 A;  2BKG A;  4U04 A;  3FWV A;  3APD A;  1SA4 A;  3IEG A;  5ENP D;  5ANR A;  2VYI A;  3HYM B;  3I4R B;  3PUJ A;  2MHK A;  1ZBP A;  3NB2 A;  3QOU A;  2DZO A;  2DYR E;  1E96 B;  4B0Z A;  4EHM A;  1OT8 A;  1BLX B;  2XEV A;  4U0U A;  1E8X A;  4NAC A;  3L22 A;  3FU5 A;  1A17 A;  2LAI A;  4JPS A;  4N3A A;  5JJ6 A;  3APF A;  5CEC B;  4GTS A;  3DWL G;  4FHJ A;  3AG1 E;  2PZI A;  3BG0 B;  4JXT A;  3FUN A;  4ATZ D;  4UWK A;  3JQ0 A;  3DST A;  4V3I A;  2GW1 A;  3HVE B;  4RG6 A;  3T8M A;  5EYP F;  4HVB A;  4F7A A;  3KSL A;  1KT1 A;  2P9U G;  1WDY A;  2A5E A;  4I6E A;  4NIK A;  2OND A;  4KBQ A;  1GW6 A;  2V4L A;  4GB9 A;  3NF1 A;  2CHW A;  4BY6 A;  4ANW A;  1YYH A;  1QBQ A;  3SBT B;  4U8Y D;  1Q2Z A;  1YCS B;  2EIL E;  4CCA A;  3QWW A;  2I2O A;  4DLO A;  4J8F A;  1MX2 A;  5LFA A;  3FH8 A;  3FUM A;  3MX3 A;  2JAB A;  4GZD A;  5A6C A;  5LCW C;  4GTR A;  4JEU A;  3PZ3 A;  5ENQ D;  2KZT B;  1SW6 A;  5HRY A;  2F8X K;  2RKK A;  5B1B E;  3WXX A;  3CKC A;  2LUH A;  4GCO A;  4LSZ E;  4UWL A;  4LCT A;  2R03 A;  4WNE A;  3U64 A;  4F6R D;  2CFZ A;  2OV8 A;  3DXK G;  3FTW A;  4ABN A;  2HYZ A;  5ENN A;  2WXR A;  2J9Q A;  2GRM A;  2A5U A;  4ATG A;  5LX8 A;  2ETC A;  1FVH A;  3FTZ A;  1D9S A;  3UQ3 A;  2EIJ E;  1Y6I A;  4WUY A;  2LSV A;  3IBE A;  3E30 A;  2C0M A;  4K03 A;  5FT9 A;  4G25 A;  3ASF A;  3V2O A;  3DSS A;  1H2V C;  3DPY A;  3FUF A;  2QZA A;  3CVN A;  4BTB A;  4CRW A;  5CMY A;  1N94 A;  4RSY A;  2AXZ A;  5LOZ A;  4AV7 A;  4O1P A;  3RSE G;  4W9R A;  1HG5 A;  2XGS A;  2KM4 A;  1Z5S C;  2X6I A;  1S70 B;  3MEK A;  4JVS A;  1H2T C;  1B89 A;  3CST A;  3HIZ A;  4D10 C;  3TWW A;  3IXE A;  4FJZ A;  1DCE A;  3UI2 A;  5IY5 E;  3U3W A;  2R59 A;  3CEQ A;  3ZYK A;  1HU3 A;  2F8Y A;  4C9B B;  3V30 A;  1UJK A;  3L54 A;  2XEE A;  2OEW A;  1JWF A;  4YDO A;  5BV1 A;  3VLF A;  4B89 A;  4BSZ B;  1U3C A;  2OCC E;  1UN9 A;  1JWG A;  1Z3Y A;  3GW4 A;  3GZS A;  3AG2 E;  3QC1 A;  4GZ5 A;  3T5X A;  5EID A;  3PRZ A;  3ESK A;  3V79 K;  2KZT A;  4L1B A;  4Q94 A;  1DNP A;  4FJY A;  3E37 A;  1DVP A;  3S7D A;  2X6H A;  4GYW A;  5BXO A;  2IEJ A;  3ONK A;  4GZC A;  4JHR A;  3UXG A;  5AQ9 A;  5CMW A;  4WWN A;  3KD7 A;  1K1B A;  1KT0 A;  4YND A;  4UQY A;  4J8Y A;  2X6J A;  3TWS A;  4RLY A;  1OCO E;  2WXQ A;  4F3V A;  3C72 A;  4DX6 D;  3C98 A;  4GZ3 A;  3LY8 A;  2X6F A;  1ELR A;  4U63 A;  4EZJ A;  1FPP A;  3LYA A;  4UQZ A;  2CG2 A;  3G2W A;  3RRM B;  4ACL A;  3ZYQ A;  1E8Z A;  1WY6 A;  1NZN A;  4APO A;  1TNZ A;  1X81 A;  3NZS A;  4O1O A;  2MRI A;  2M63 A;  5EKQ D;  3JXJ A;  4BTA A;  3MKR A;  4NRH B;  1JCR A;  1A5E A;  4AXH A;  4GTT A;  2OVF A;  1O1R A;  4XEI G;  5FQ7 A;  4GA2 A;  4X8Q A;  3FUK A;  2P9P G;  4BET A;  2J4D A;  4GPM A;  4IRU A;  3OXF A;  5T3R A;  5G55 A;  3CVL A;  3I3N A;  3FTX A;  2VTB A;  3ABK E;  3E34 A;  4MRU A;  3LJ3 A;  3FTY A;  2F37 A;  4I17 A;  2P9L G;  1NA3 A;  4G26 A;  4LNB A;  5T4Y A;  2OEV A;  3CVV A;  2OVB A;  2CG3 A;  3BG1 B;  5AEN A;  4J7W A;  2DWZ A;  3LXU X;  1FVF A;  3ONL A;  3ZYM A;  5FIO A;  1HF8 A;  4AP2 A;  4J8D A;  3E32 A;  1MHQ A;  2PM6 A;  2YIN A;  3TXN A;  1BD8 A;  1LTX A;  3ASD A;  3UTM A;  3QJZ A;  5JHA A;  4UI9 K;  4WNG A;  4G24 A;  2BED A;  2V8S E;  1H19 A;  5ANL A;  1TN6 A;  2Y69 E;  3NOC D;  5ENS D;  5AYW D;  5CRV A;  3V31 A;  4HXI A;  4B8A A;  5KNH D;  2ZGD A;  1OCR E;  4LEU A;  2WQ6 A;  1OWL A;  2C2L A;  4BSX A;  3CGH A;  4J6I A;  5FTP A;  1NI1 A;  5BUZ A;  3AJI A;  2J4B A;  4I6J A;  1N11 A;  1TJC A;  3CVU A;  4AVX A;  3CSF A;  4JEH A;  5H7P A;  4AEZ C;  4RQI A;  2WXK A;  4GMR A;  4KZC A;  4XX5 A;  2J49 A;  4URK A;  1RW2 A;  3EHN A;  4MBG A;  3PDN A;  2ZIS A;  2CFU A;  4TUU A;  4UUC A;  2L9B A;  3CLJ A;  3IHY A;  3CHQ A;  3JUE A;  4E85 A;  2GRO B;  3QWV A;  3UM0 A;  3QAQ A;  4YDY A;  3UKU G;  3BQO A;  3G2V A;  4CZ2 D;  4MKT A;  3OXL A;  1INZ A;  2QYU A;  4YDE A;  4CDR A;  4I6G A;  3FUL A;  5AN8 A;  4N39 A;  2QC9 A;  4DJA A;  3PZD A;  2EIK E;  3LJN A;  2WMO A;  4YVO A;  4NUR A;  3CR3 A;  5JA4 D;  3SQV A;  4ANV A;  3ENE A;  2NC9 A;  3PNT B;  3VTX A;  2ZXW E;  3E33 A;  3L17 A;  1HFA A;  2DYS E;  2WXJ A;  4HB5 A;  2LNI A;  3RJV A;  4I9C A;  5E75 A;  4CGW A;  5ENR D;  4AJW A;  2IOL A;  4HLE A;  3ML9 A;  3PRE A;  3FU0 A;  1HXI A;  4GAA A;  4DI4 A;  3MV2 B;  4ILH B;  3MJW A;  2JEK A;  4GTM A;  5CED B;  3HRA A;  3MYV A;  4FA6 A;  1EF1 C;  5HKP A;  4CGV A;  5EIB E;  3PS6 A;  1IYG A;  4I1A A;  5JHB A;  2V5Q C;  4GA0 A;  4K0R A;  1UOH A;  3ULY A;  2P58 C;  3UKR G;  2IU1 A;  3S7F A;  2P9S G;  1LD8 A;  4HRN A;  1QYM A;  3BU8 A;  4GTQ A;  3ASG A;  4JZY A;  3CHP A;  1V55 E;  3LPZ A;  4JW1 A;  3FU6 A;  4EZL A;  2PL2 A;  5FQ8 A;  2LXM A;  5BW8 C;  4U0S A;  1IKN D;  3KS2 A;  2WXM A;  3MZL B;  3I4G A;  4BT9 A;  2FO1 E;  2WXH A;  3MKQ A;  2XEN A;  4HOQ A;  5FWQ A;  1OWN A;  2X6K A;  3D9M A;  4CT0 A;  2DZN A;  1MJ0 A;  3QAR A;  3ZFW A;  3J5Q B;  1MX6 A;  5E76 A;  4WWP A;  3Q47 B;  2KCL A;  4G2V A;  4BWR A;  5D2M C;  4CDM A;  1TJF A;  4PS8 A;  5G05 J;  4N2Q A;  3UM1 A;  3CK8 A;  5FZQ A;  3D9N A;  3ZNG A;  3PEV B;  2PM7 A;  3PH0 C;  2GRN B;  1V54 E;  3D9O A;  4APF A;  1SA5 A;  4Z68 A;  1OUV A;  1Z3X A;  3W9F A;  3HXC A;  4O60 A;  4FLH A;  3ISM C;  3FHE A;  3SBS A;  3LS8 A;  4F53 A;  3TJP A;  2R02 A;  4J0U A;  5JJT A;  1BU9 A;  3X2Q E;  4DI3 A;  2AJA A;  4BER A;  5EIL A;  4DPR A;  2PQN A;  4MLP A;  3ZPJ A;  4OAU C;  1UJJ A;  2AXU A;  3FUE A;  5EYL A;  4L7T A;  4DX1 A;  1E8Y A;  2YHC A; 
#chains in the Genus database with same CATH homology
 5CEA A;  3TWQ A;  5AN8 A;  1N0R A;  4TUM A;  5EYP F;  5FIO A;  1MYO A;  1K1A A;  5EN5 D;  2QC9 A;  1IKN D;  5HS0 A;  2L6B A;  5CBN A;  5AQA A;  5BXO A;  2XZT G;  2FO1 E;  2ETA A;  5CBO A;  1BD8 A;  3UXG A;  5AQ9 A;  3LJN A;  3TWV A;  3UTM A;  1OY3 D;  3V2O A;  2BKK B;  3W9G A;  1WDY A;  1K1B A;  4DUI A;  2XEN A;  2A5E A;  3ZU7 B;  4U8V D;  1DCQ A;  1YMP A;  3V2X A;  1AP7 A;  4NIK A;  4U96 D;  2HE0 A;  4J8Y A;  5AQ7 A;  5JA4 D;  3TWS A;  4RLY A;  3EU9 A;  2XZD G;  4HI9 A;  2QYJ A;  4HNA D;  4A63 B;  4DX6 D;  4K5C A;  5ENO D;  2ETB A;  4HBD A;  5AAR A;  2DZN A;  3NOC D;  1MJ0 A;  5ENS D;  4ZHB A;  4K5B A;  2XEH A;  5JMN D;  1N0Q A;  1WG0 A;  4HB5 A;  4G8K A;  3V31 A;  1G3N B;  4O1P A;  5KNH D;  4DRX E;  2ZGD A;  5ITZ F;  3J5Q B;  1MX6 A;  1YYH A;  4ZFH A;  1D9S A;  3C5R A;  3TWR A;  4YDW A;  4U8Y D;  2DVW A;  1YCS B;  2BKG A;  3B95 A;  3EHQ A;  5ENR D;  1SVX A;  2V4H C;  3AJI A;  4HQD A;  3SO8 A;  2KBX A;  3DEO A;  3NBN B;  2RFA A;  5ENP D;  4DX5 D;  3TWU A;  3NOG D;  3ZKJ A;  1TR4 A;  1S70 B;  1MX2 A;  3Q9N C;  4HRM B;  4N5Q A;  3T8K A;  4F1P A;  3AAA C;  2JAB A;  1MX4 A;  1N11 A;  4U95 D;  2DZO A;  3TWW A;  5CED B;  4O1O A;  4QFV A;  5BXU A;  2VGE A;  2KXP C;  3HRA A;  1OT8 A;  5KWD A;  1BLX B;  5ENQ D;  3ZNG A;  1BI8 B;  3JXJ A;  3IXE A;  1SW6 A;  2B0O E;  4C48 B;  3UI2 A;  5HKP A;  5HRY A;  2F8X K;  5EIB E;  3T9K A;  1NFI E;  4GMR A;  4BES A;  2RFM A;  1A5E A;  4Z68 A;  5KNG A;  2V5Q C;  3D9H A;  1AWC B;  4G8L A;  2F8Y A;  2Y1L E;  3DEP A;  2MYO A;  4LSZ E;  4QQI A;  3W9F A;  4O60 A;  1UOH A;  5CEC B;  4UUC A;  5ENT D;  4BET A;  4HI8 A;  2NYJ A;  3J5P A;  2P2C P;  4GPM A;  2J8S D;  4HRL A;  3V30 A;  4HLL A;  4F6R D;  2XEE A;  4LNU D;  5FIN A;  3JUE A;  4OAV B;  5KBA A;  4HRN A;  3KEA A;  1QYM A;  5CER B;  5AAO A;  3JXI A;  1DC2 A;  5D66 A;  4ATZ D;  2F37 A;  4BSZ B;  1BU9 A;  1BI7 B;  4DX7 D;  3B7B A;  4DX2 A;  2AJA A;  3Q9U C;  2PNN A;  3HG0 D;  4BER A;  2ZGG A;  5EIL A;  4YDY A;  3ZUV B;  5EID A;  1IHB A;  1K3Z D;  4LG6 A;  5AQB A;  4OAU C;  4B93 B;  1IXV A;  3F6Q A;  4CZ2 D;  5EYL A;  3V79 K;  4J7W A;  2Y0B G;  4K5A B;  3TWT A;  2DWZ A;  3TWX A;  4CYM D;  2ETC A;  3EHR A;  4DX1 A;  4JB8 P;  4BEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...