4U96D

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u96D00
1TR4A 2DVWA 1N11A 4HBDA 1NFIE 2DWZA 3ZNGA 4G8LA 4GPMA 2DZNA 5AQAA 4DUIA 3AAAC 3UXGA 3AJIA 5JMND 1MYOA 4HRMB 5AQ7A 4HQDA 4UUCA 4GMRA 4NIKA 3NOGD 3UI2A 3TWUA 3D9HA 3B95A 1AWCB 4QFVA 4U96D 2KXPC 4O60A 1WG0A 4A63B 2XENA 2QC9A 5AQ9A 3C5RA 1MJ0A 2XEEA 4U8VD 5HS0A 5BXUA 1DCQA 5EIDA 2V5QC 3V31A 3J5QB 1MX6A 3TWTA 3NBNB 2AJAA 1BLXB 1A5EA 5EN5D 4HB5A 5EILA 2QYJA 2F8XK 5ITZF 4HI8A 4DX7D 5EIBE 1IKND 2A5EA 4BSZB 5CECB 4OAVB 5EYPF 1N0RA 1S70B 5D66A 2XEHA 2ZGGA 4O1OA 3J5PA 5ENTD 1WDYA 2MYOA 5AAOA 1DC2A 4ZHBA 2XZDG 2B0OE 3IXEA 4RLYA 4U95D 2KBXA 5AARA 4DX5D 1MX2A 3TWQA 2RFMA 4LNUD 5KWDA 1UOHA 1BI8B 4HRNA 2RFAA 4JB8P 4F6RD 3NOCD 5HRYA 3V2XA 3F6QA 3JXIA 2HE0A 5JA4D 5HKPA 3V79K 1D9SA 1K1AA 2ETBA 2V4HC 1K1BA 4N5QA 5KBAA 2ETCA 4F1PA 3Q9UC 2XZTG 1SVXA 5ENRD 3SO8A 5ENOD 2NYJA 1MX4A 4J8YA 1YCSB 4ATZD 3W9FA 1QYMA 4BEPA 3DEOA 4U8YD 4ZFHA 1K3ZD 2DZOA 4BERA 5ENQD 1BI7B 1IHBA 2VGEA 4G8KA 3W9GA 1OY3D 2ETAA 3V2OA 3V30A 5BXOA 4HLLA 4TUMA 2J8SD 1YYHA 2BKGA 5FINA 3TWXA 5CBOA 2P2CP 3LJNA 4BESA 2PNNA 1AP7A 1BD8A 3Q9NC 4Z68A 2JABA 3EHQA 4QQIA 1N0QA 1SW6A 3HG0D 4O1PA 4J7WA 4CYMD 4HRLA 4YDWA 3KEAA 5CERB 5AQBA 3TWSA 4CZ2D 1BU9A 5CEDB 1OT8A 2ZGDA 3JXJA 5ENPD 4C48B 3TWWA 3UTMA 1YMPA 5ENSD 4BETA 3DEPA 5KNGA 3B7BA 4K5BA 4LG6A 1IXVA 3JUEA 4LSZE 4DX6D 2FO1E 3ZUVB 4YDYA 3ZKJA 3EU9A 4B93B 3T8KA 5CBNA 4K5AB 4HNAD 4DX1A 3TWRA 5EYLA 1G3NB 2F37A 4DRXE 4K5CA 2BKKB 4HI9A 3ZU7B 2F8YA 5KNHD 3T9KA 4OAUC 3TWVA 3EHRA 5AN8A 4DX2A 3HRAA 2L6BA 5FIOA 5CEAA 2Y1LE 2Y0BG
chains in the Genus database with same CATH superfamily
2GRMA 2WXMA 2BEDA 1HZ4A 4JD2G 5B3SE 1OUVA 2CHXA 3MZLB 3FH8A 1PAQA 2AVPA 1JCRA 4GA1A 4HQDA 4OYSA 3TWUA 1ZBPA 4UQYA 4TRQA 3IHVA 2KXPC 1P5QA 4CT0A 4HOSA 1OWMA 1HS6A 2V0PA 3D9JA 5EILA 5D66A 4ANVA 2KCKA 3ASOE 2B0OE 3IXEA 3C3RA 2R59A 3C98A 5T3RA 1N54A 2WXHA 3G2TA 1H2VC 5ANRA 1N95A 1DCEA 1SVXA 2KCLA 2XPYA 2I9CA 3SFXA 5BW8C 1Z5SC 1WY6A 3OTNA 2H6HA 2OEWA 2P58C 5G55A 3RRNB 4GTTA 4Y6CA 2LAIA 1SW6A 2AXVA 1JWFA 3CEQA 4YDWA 2CFUA 1HX8A 1QZ2A 3D9PA 4U8HA 3B7RL 3TWWA 4DK5A 3ZYLA 2VQ2A 3CLJA 4HLEA 3T8KA 2CG2A 3TWRA 2XS8A 2GROB 4HS2A 4I1OB 1ELKA 4GTSA 4AV7A 4BT8A 4HOQA 3PEUB 5FZSA 2KATA 3CV0A 2PL2A 2R05A 3PEVB 4EHMA 4GMRA 5BV1A 5HI7A 4QFVA 2WXLA 3MKRA 4O60A 4YNDA 5FQ8A 1INZA 2WQHA 2AJAA 1BLXB 3G2VA 4XI0A 2H6GA 5FQ6A 5EYPF 1PY1A 4XE0A 4EZKA 4JB8P 4BTAA 3FUNA 5FJYA 3QK0A 4ILIA 1W3BA 2PM7A 3VLDA 3R9AB 2ILRA 3FUMA 3Q9NC 4I1MA 2WQ7A 3TXMA 4YVQC 3G2WA 3SY2A 3RJVA 2DYSE 4FLHA 5FWQA 4BETA 3AG3E 4CRWA 3L9TA 4E85A 3ZXSA 4HNAD 1IQRA 3CQGB 2X6IA 4ANUA 4K5CA 3ABLE 3Q75A 4RSYA 4OAUC 3TWVA 4APFA 3U3WA 4C0EA 4NURA 4WWOA 3QB2A 3BUAA 2WXGA 4HXIA 3UPVA 3B95A 3FUHA 5ARFA 3DSTA 4A63B 3HXFA 3HHMA 5AQ9A 3UX4A 4U8VD 3PZ4A 1HG2A 2L6JA 3Q78A 1QBQA 3PZ2A 2ZU6B 4MRUA 3D9MA 1U3DA 2LSVA 3FU6A 2F8XK 2VTBA 2OCCE 3UM1A 3MKQB 5AARA 3U64A 5A6CA 4L23A 2HE0A 3QOUA 1KT0A 4UWKA 4ME2A 1FCHA 1Z3YA 2ETCA 4IRUA 3OAWA 2CHZA 5AJDA 5EKQD 3FU0A 4UQXA 1K8KG 4EPZA 3CR3A 3QC1A 4G8KA 2QFCA 2P2CP 3PZDA 1FT2A 1N4SA 2FBNA 3LKUA 3Q47B 5FZQA 2IU1A 1N4QA 4PDXA 3O48A 4LNBA 4UWFA 5CRVA 2XGOA 3CVPA 5EYLA 2IQCA 3WXXA 2WMNA 1IHGA 2WVIA 3QWVA 1E7UA 1U2VG 2GRNB 1TJFA 3ZHEA 5KJLA 1ELRA 3CK7A 4ILGA 2I1KA 3LY8A 5CHEE 4G26A 4KYOB 3NOGD 4YDEA 1FPPA 4FJYA 4AJWA 2QC9A 3C5RA 3ASFA 4UWGA 4BSXA 3VTXA 3HXBA 3TWTA 1RW2A 2EIJE 2A5EA 3APCA 1S70B 4NACA 4KXKB 1WDYA 3ABME 4RLYA 3MX3A 1S0PA 4GTMA 4F53A 1MX2A 4EQFA 3N71A 3FFLA 2BUGA 3CHOA 5C1DA 2VSOE 3Q73A 4FADA 2XHEA 1OCZE 2P9LG 4I1AA 5KBAA 4KZCA 4GU5A 1HF8A 4BEPA 4ZFHA 2WXJA 2ZISA 3ZYMA 2ETAA 5KCMA 5BXOA 3KSLA 2J8SD 3DPDA 2BKGA 3TWXA 3FTYA 4NQ0A 1KPSB 4QQIA 2WMOA 3LXUX 4CYMD 2FI7A 3DPYA 3JQ0A 3FEYA 4LEUA 1YMPA 3TGOA 1SZ9A 1N94A 3ISMC 5CBNA 4F3VA 3AS5A 3E30A 3CSFA 5AN8A 5FIOA 3TXNA 3FP3A 1Q2ZA 3L82A 3KEZA 4DUIA 3UXGA 3ZRHA 4WUYA 4EBAA 2J07A 4U0ZA 2Y69E 2WXKA 4FHJA 4N2QA 4ACKA 3HVEB 5T4YA 3DXMG 1HU3A 3FH5A 2WXRA 2UY1A 3CHPA 1NA3A 3HXCA 2QYJA 2E2EA 5FQ7A 2VJ8A 2JEKA 2WXQA 3PREA 1E7VA 3FUDA 4CGVA 3ASNE 3IV0A 4Q69A 3Q15A 3SD5A 4RVBA 5AENA 5HRYA 3UIPC 5JA4D 4UI9J 3E34A 3HXDA 5BT1A 4APOA 1OXJA 2X6HA 3SO8A 4V3IA 2FO7A 2KM4A 3ULYA 2VGXB 4WNGA 2XPZA 3V30A 1UJKA 4TUMA 2R02A 5JJTA 3SFYA 5J90A 4U0UA 3EUVA 3GZ1A 3EDTB 4I9CA 3ASHA 2HO1A 4GB9A 4FLBA 1N4PA 4A3TA 2XGSA 3MA5A 4U04A 3CQCB 2YQ8A 1KLXA 3B7BA 5J08A 3QWWA 4R7LA 2J4BA 4GMLA 5D2MC 3RIBA 4HI9A 4N3BA 2H6FA 3Q7AA 2LXMA 1N4RA 4I6GA 2P9SG 4UI9C 5E76A 2X6JA 4BX8A 3SBSA 2MOWA 3D9IA 5A23A 2X3MA 4L7TA 5E75A 4BWRA 2LSUA 3FTVA 2XGMA 3V31A 4AP2A 4HOTA 4XIFA 5EN5D 4LNGA 4JW1A 5EIBE 2ZGGA 3B13A 3CHRA 2Y3AA 2XZDG 2RFAA 2L0TB 4MS6A 3GZSA 2XRZA 3CVVA 3V79K 2V4HC 1S63A 2MHKA 3RK6A 4JHRA 3ZN3A 4WWPA 3LJ3A 5CRUA 1UN8A 4HLLA 4URKA 2HYZA 2JABA 3ML8A 3UT8A 4GA2A 2X6KA 3TJPA 2C0LA 4DPRA 3CHMA 4LERA 3LVQE 1H2UA 1DVPA 3FTUA 3DXKG 2DBAA 2VSYA 5CMYA 3FWVA 4I43A 1TR4A 1N11A 4DI3A 2DWZA 3DRAA 3DWLG 1X81A 5FT9A 4M3OA 1UN9A 5KJNA 2I1JA 1KZOA 5AQ7A 3BU8A 3UI2A 3ASDA 3CVWA 1D8DA 3BG0B 2R17C 2WM9A 3JUIA 2AWIA 2OEVA 3FU3A 2C0MA 2KC7A 1OCRE 2P9UG 4DX7D 4OAVB 2XCCA 1H6KA 3ZFWA 3Q4AB 3CKCA 3SGHA 2KBXA 1QQEA 4HRNA 4F6RD 3NOCD 3KD7A 3CIAA 4H7YA 3S7JA 3IEGA 4I2ZA 3EHNA 1TYQG 4GTOA 4F1PA 3FTXA 4D10C 3OXGA 3PUKA 3DSUA 1H19A 2DZOA 5ENQD 3PE4A 1HXIA 2GGFA 3EJNA 2WXPA 3TL5A 4XI9A 5G05C 4JVSA 3FUEA 2PNNA 4F1SA 3NAWA 4IULA 1A17A 5JHAA 2AW6A 1HFAA 5CEDB 3S2AA 5ENPD 4RG6A 3ULQA 2FULA 3T5VA 1IXVA 2RD0A 3RO2A 4K5AB 1GW6A 2V5FA 4CCAA 4KZ0A 5ARGA 3QNKA 1TJCA 3QAQA 2RKKA 1NFIE 3B7SA 3L22A 4PUCA 3GZ2A 3AJIA 3R7RA 3AG2E 4HOUA 4WWNA 3FTWA 1LF8A 4N39A 3SNXA 2P9IG 1WM5A 2IOLA 1OCCE 5ENNA 3J5QB 4U07A 1UJJA 2EQXA 4KMOA 4DLOA 4HB5A 3HXEA 3U9WA 3LCAA 2XEHA 1N9AA 4ANXA 3DSWA 3SHFA 4A3VA 4ILHB 3MV2B 1MZCA 1IYGA 2JLBA 2BF0X 4J8YA 4W9RA 2WXOA 3FU5A 1JPLA 3VLFA 3ZPJA 4GTVA 2P9NG 4MBGA 5ANLA 4DJAA 3RRUA 3FY4A 2QZAA 5CERB 3UQ3A 2RG8A 3ONLA 5AQBA 3Q49B 4I6JA 1Y6IA 4LG6A 4LRZA 4X8QA 4DX6D 1UW4B 3ZKJA 3QKYA 4B94A 4GPKA 2Y4TA 3AS8A 3CGHA 1G3NB 2HR2A 4DRXE 3T9KA 5CEAA 2L6BA 3R7QA 3UKRG 3FHEA 5AJLA 1O5MA 1LD7A 4GPMA 2GW1A 4ANWA 5LOZA 3SFZA 4H7XA 4AOFA 3LY7A 3O4ZA 4N2SA 4B8CB 4UWLA 1SZAA 4TXPA 5EDSA 4ABNA 5CECB 4GCNA 1HE8A 2GRRB 3EU5A 4N3CA 3AG1E 3IHYA 1E8WA 4E6HA 2OVFA 1H0AA 5LP0A 1N52A 2WPVA 5LCWJ 3IKOB 3QARA 4EZLA 4J8EA 5ENRD 1MX4A 2FF4A 4CGWA 4BERA 1BI7B 3JQ1A 3W9GA 1OY3D 3AG4E 3CVQA 5B1BE 4XKBA 5CBOA 3D9LA 1FT1A 3EHQA 1HG5A 3C3QA 3CHSA 2GRQB 4G24A 2J9QA 3CSTA 3FUFA 3UTMA 2YINA 5KNGA 3JUEA 4YDYA 3JYSA 3CVXA 4WNEA 1YA0A 3UUXA 4NRHB 4BY6A 4Y6WA 4WAFA 4GYOA 5KNHD 3AU5A 3EHRA 4DX2A 3VTYA 3SQVA 1E8ZA 2DVWA 3ZW3A 2M63A 4GYYA 1H6PA 5LCWC 2VTBB 3Q5MA 3PUJA 5AIJA 2IJGX 4I9EA 4Q96A 3D9HA 4K0RA 4FP7A 3D3MA 4AY6A 3UKUG 2UWJG 1MX6A 3SBTB 1SQMA 1A5EA 5EX0A 5C2YA 2Q7FA 1TNYA 3S7BA 4ACLA 2XS1A 2CG3A 2NC9A 4O1OA 1E90A 4A1SA 3ZXPA 3TWQA 1LTXA 2AXUA 5AYWD 3VLEA 3MV3B 5HKPA 3RRMB 4L2YA 3FUJA 3D9OA 3FEXA 4JXTA 3Q9UC 4CT4A 5G2NA 3CVYA 5KJKA 4OVVA 3K9IA 3ABKE 3UT4A 2KZTA 3GYZA 1O1RA 3KEAA 3ZHEB 4GZCA 1BU9A 2ZGDA 4TXQA 4EZJA 1ELWA 1NL4A 3RSEG 4EBAG 1S64A 4XX5A 5B1AE 4OVUA 3T5XA 2R2LA 2VSNA 5EX3A 3ML9A 3EIQC 1O1TA 3HRAA 2Y1LE 3I4GA 3U66A 4K03A 2EIME 3EHMA 2XEVA 1FVHA 1SA4A 2E0IA 3KAEA 2R5SA 3D9KA 4WNDA 3PZ1A 2LUHA 2LXLA 5CMWA 2J09A 4I17A 2ZXWE 3TG5A 2HM8A 1NZNA 3P2BA 1JCQA 1OWLA 3T8MA 2LO6A 3D9NA 3J5PA 4XEIG 4ZHBA 1TN6A 5IY5E 4GAAA 4ATGA 1O1SA 3QDNA 4LNUD 1V54E 1BI8B 2YHCA 3F6QA 3R9MA 1TN8A 1E8YA 5LX8A 2NYJA 3BG1B 4ATZD 4GTQA 4GCOA 3C72A 4O6FA 1XNFA 4JA9A 3LDZA 5JHBA 4A55A 2WXNA 2WXIA 2IY0C 3UIOC 5BV0A 2XCBA 4JPSA 4O1PA 1SA5A 3IBEA 4CZ2D 3APFA 3APDA 1OCOE 4JHJA 2IO3C 2FO1E 2FEZA 1E8XA 4AM9A 2J4DA 3PRZA 3L13A 2LAHA 2YNQA 4KVMA 2B6CA 2GRPB 3B7TA 3S7DA 1FVFA 1ZB1A 4CEMA 2UY1B 4HBDA 1TN7A 4G8LA 4G25A 3ZVVA 2XPIA 4KVOA 4JEHA 4YDOA 4JHKA 2KZTB 4J8FA 2XENA 1JWGA 1WAO1 2VSXE 2XEEA 3ONKA 5BXUA 2WXFA 2NXPA 4GMJA 5LFAA 3U4TA 1EDUA 3ASGA 3NF1A 1KZPA 1JCSA 4BSZB 5G05J 3ZIMA 1E96B 2R03A 4LUNU 3DSXA 3LPZA 5AAOA 3Q79A 4DX5D 4C9BB 3PS6A 2RFMA 3CVUA 1KT1A 3JXIA 1K1AA 3MCXA 1K1BA 2ETBA 4GTPA 1NA0A 2ZIRA 3I4RB 5ENOD 3DEOA 4AEZC 2VGEA 4I2WA 3MKQA 4G1TA 3LJNA 2L0IA 2V8SE 4J7WA 4FC8A 2J08A 3ULEG 4G2VA 3PNLB 1OT8A 4MKTA 4C48B 1MQSA 5FQ4A 3ZGQA 4LSZE 4JC8A 3PE3A 3ZUVB 4AIFA 3OXFA 3G2UA 2C2LA 2GRLA 4J8DA 1D8EA 4JZYA 1NI1A 2I6HA 5M72A 2NSZA 5BUZA 2MYOA 3FUKA 4N3AA 5AQAA 1JUQA 5KJMA 3GW4A 4J6IA 4YVOA 4KBQA 4HRMB 3CK8A 4UUCA 2IF4A 3AU4A 1AWCB 1IQUA 4Q94A 4LCTA 4J8SA 2VYIA 1DCQA 3CKBA 1MHQA 3SZ7A 3PDNA 1IKND 3KS2A 4BT9A 3DSVA 3CHQA 4U95D 4CDMA 2IONA 4C0MA 3E4BA 4JEUA 3ESKA 1D9SA 5A7DB 1U3CA 3SF4A 1TNOA 2BTDA 4L2LA 3URZA 3UM2A 1L5JA 1EF1C 3UT7A 3V2OA 3HIZA 3L16A 4BFRA 4U7EB 4Z68A 3UMVA 5HQ8A 3FH7A 3DBSA 4GYWA 1EYHA 3EIJA 3PZ3A 3L17A 3TWSA 1PC2A 5FZRA 3JXJA 4TV3A 5ENSD 2OV8A 4J0UA 3WG7E 3L08A 3EU9A 4GZ5A 4DX1A 4BTBA 4GZDA 2VGYA 5BNWA 3ZU7B 2F8YA 3I3NA 2PM6A 3X2QE 3ZYQA 5G04J 4TXRA 3ZNGA 4XZ4A 2CHWA 4PS8A 3UINC 1OWOA 4MLPA 3RAUA 3MJWA 1VDYA 2XRYA 4RQIA 1BPOA 5EIDA 2YHEA 3LY9A 4I6EA 3PVLA 4AVXA 4GA0A 4FA6A 3UM0A 4CDRA 5JJ7A 2IO2C 4FHKA 3NB2A 4PS3A 2X38A 3CVLA 3TAXA 5KWDA 1UOHA 3V2XA 1OWNA 5FTPA 2IOSA 3LEWA 3TG4A 3RO3A 3HVEA 2WB2A 2XZTG 3QWPA 3MGBA 4BX9A 5G04C 2IEJA 4HORA 4AXHA 4UWHA 2F0YA 4B89A 1XGWA 1AP7A 1OWPA 3FDHA 3HG0D 3RU0A 5BPPA 4PH4B 5DIZA 1TEZA 2QY7A 3I5PA 2P9PG 1DNPA 1QNFA 3CVNA 3DEPA 4PS7A 5D0QD 4EECA 2DYRE 2VGXA 3MYVA 3QJZA 4U63A 2BKKB 4IN3B 1HO8A 2PQRA 2LNIA 2DZNA 3AAAC 1LD8A 3NQPA 4A1GA 1MYOA 3LS8A 3JCKC 3NZSA 3ESLA 3UM3A 3FTSA 3G2SA 2J49A 4U96D 2IFUA 1MJ0A 2AXZA 3HDXA 3LVRE 2X6FA 3NBNB 4RG9A 5ITZF 4HI8A 2H6IA 1Z3XA 1H6OA 3BEEA 4B8AA 4U0SA 2V4LA 2A5UA 1EPUA 4G11A 1QYMA 2L9BA 1X5BA 4U8YD 3ZYKA 1IHBA 3L54A 5T8IA 1YYHA 3PNTB 1BD8A 2PQNA 4B0ZA 4N5CA 1N0QA 2EILE 2EIKE 4HRLA 2PZIA 4UQZA 3S7FA 3FULA 4FJZA 3AS4A 2I2OA 1Y8MA 1H2TC 3RKVA 3OXLA 2DIWA 2KCVA 4HFGA 3L6AA 4GZ3A 3CK9A 2F37A 3P1UA 4G23A 5JJ6A 3MEKA 3KSQA 2QYUA 1B89A 1NP7A 2Y0BG 2XQ0A 3LYAA 4JL0A 5JMND 3SI5A 3ZEFA 4GZ6A 4WNFA 3ENEA 4NIKA 1Z6TA 4DLQA 5CCMA 1WG0A 5HS0A 2V5QC 4TUUA 4FULA 4CDNA 4DI4A 4UI9K 3HYMB 4F7AA 1TNUA 1N0RA 4P29A 4AY5A 1DC2A 4L1BA 5ENTD 4M7CA 3B7UX 3BQOA 2A4ZA 2DCPA 2EINE 2ONDA 4XKCA 2P9KG 5D0OD 2OVBA 2CFZA 4N5QA 2MRIA 5H7PA 1TNBA 1UG3A 4JA7A 3PH0C 1YCSB 3W9FA 1K3ZD 4GTRA 3E33A 2Y4UA 4IYPA 5FINA 4BESA 4HVBA 3NZUA 1TNZA 1ZU2A 2OOEA 3Q7FA 3DSSA 3E37A 3FUIA 5DBKA 1RZ4A 3FTZA 4K5BA 3C3OA 4FU3A 3E32A 4KT6B 4L9PA 5CCLA 4B93B 1V55E 2WQ6A 1HH8A
chains in the Genus database with same CATH topology
1TR4A 2DVWA 1N11A 4HBDA 1NFIE 2DWZA 3ZNGA 4G8LA 4GPMA 2DZNA 5AQAA 4DUIA 3AAAC 3UXGA 3AJIA 5JMND 1MYOA 4HRMB 5AQ7A 4HQDA 4UUCA 4GMRA 4NIKA 3NOGD 3UI2A 3TWUA 3D9HA 3B95A 1AWCB 4QFVA 4U96D 2KXPC 4O60A 1WG0A 4A63B 2XENA 2QC9A 5AQ9A 3C5RA 1MJ0A 2XEEA 4U8VD 5HS0A 5BXUA 1DCQA 5EIDA 2V5QC 3V31A 3J5QB 1MX6A 3TWTA 3NBNB 2AJAA 1BLXB 1A5EA 5EN5D 4HB5A 5EILA 2QYJA 2F8XK 5ITZF 4HI8A 4DX7D 5EIBE 1IKND 2A5EA 4BSZB 5CECB 4OAVB 5EYPF 1N0RA 1S70B 5D66A 2XEHA 2ZGGA 4O1OA 3J5PA 5ENTD 1WDYA 2MYOA 5AAOA 1DC2A 4ZHBA 2XZDG 2B0OE 3IXEA 4RLYA 4U95D 2KBXA 5AARA 4DX5D 1MX2A 3TWQA 2RFMA 4LNUD 5KWDA 1UOHA 1BI8B 4HRNA 2RFAA 4JB8P 4F6RD 3NOCD 5HRYA 3V2XA 3F6QA 3JXIA 2HE0A 5JA4D 5HKPA 3V79K 1D9SA 1K1AA 2ETBA 2V4HC 1K1BA 4N5QA 5KBAA 2ETCA 4F1PA 3Q9UC 2XZTG 1SVXA 5ENRD 3SO8A 5ENOD 2NYJA 1MX4A 4J8YA 1YCSB 4ATZD 3W9FA 1QYMA 4BEPA 3DEOA 4U8YD 4ZFHA 1K3ZD 2DZOA 4BERA 5ENQD 1BI7B 1IHBA 2VGEA 4G8KA 3W9GA 1OY3D 2ETAA 3V2OA 3V30A 5BXOA 4HLLA 4TUMA 2J8SD 1YYHA 2BKGA 5FINA 3TWXA 5CBOA 2P2CP 3LJNA 4BESA 2PNNA 1AP7A 1BD8A 3Q9NC 4Z68A 2JABA 3EHQA 4QQIA 1N0QA 1SW6A 3HG0D 4O1PA 4J7WA 4CYMD 4HRLA 4YDWA 3KEAA 5CERB 5AQBA 3TWSA 4CZ2D 1BU9A 5CEDB 1OT8A 2ZGDA 3JXJA 5ENPD 4C48B 3TWWA 3UTMA 1YMPA 5ENSD 4BETA 3DEPA 5KNGA 3B7BA 4K5BA 4LG6A 1IXVA 3JUEA 4LSZE 4DX6D 2FO1E 3ZUVB 4YDYA 3ZKJA 3EU9A 4B93B 3T8KA 5CBNA 4K5AB 4HNAD 4DX1A 3TWRA 5EYLA 1G3NB 2F37A 4DRXE 4K5CA 2BKKB 4HI9A 3ZU7B 2F8YA 5KNHD 3T9KA 4OAUC 3TWVA 3EHRA 5AN8A 4DX2A 3HRAA 2L6BA 5FIOA 5CEAA 2Y1LE 2Y0BG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR4 A;  2DVW A;  1N11 A;  4HBD A;  1NFI E;  2DWZ A;  3ZNG A;  4G8L A;  4GPM A;  2DZN A;  5AQA A;  4DUI A;  3AAA C;  3UXG A;  3AJI A;  5JMN D;  1MYO A;  4HRM B;  5AQ7 A;  4HQD A;  4UUC A;  4GMR A;  4NIK A;  3NOG D;  3UI2 A;  3TWU A;  3D9H A;  3B95 A;  1AWC B;  4QFV A;  4U96 D;  2KXP C;  4O60 A;  1WG0 A;  4A63 B;  2XEN A;  2QC9 A;  5AQ9 A;  3C5R A;  1MJ0 A;  2XEE A;  4U8V D;  5HS0 A;  5BXU A;  1DCQ A;  5EID A;  2V5Q C;  3V31 A;  3J5Q B;  1MX6 A;  3TWT A;  3NBN B;  2AJA A;  1BLX B;  1A5E A;  5EN5 D;  4HB5 A;  5EIL A;  2QYJ A;  2F8X K;  5ITZ F;  4HI8 A;  4DX7 D;  5EIB E;  1IKN D;  2A5E A;  4BSZ B;  5CEC B;  4OAV B;  5EYP F;  1N0R A;  1S70 B;  5D66 A;  2XEH A;  2ZGG A;  4O1O A;  3J5P A;  5ENT D;  1WDY A;  2MYO A;  5AAO A;  1DC2 A;  4ZHB A;  2XZD G;  2B0O E;  3IXE A;  4RLY A;  4U95 D;  2KBX A;  5AAR A;  4DX5 D;  1MX2 A;  3TWQ A;  2RFM A;  4LNU D;  5KWD A;  1UOH A;  1BI8 B;  4HRN A;  2RFA A;  4JB8 P;  4F6R D;  3NOC D;  5HRY A;  3V2X A;  3F6Q A;  3JXI A;  2HE0 A;  5JA4 D;  5HKP A;  3V79 K;  1D9S A;  1K1A A;  2ETB A;  2V4H C;  1K1B A;  4N5Q A;  5KBA A;  2ETC A;  4F1P A;  3Q9U C;  2XZT G;  1SVX A;  5ENR D;  3SO8 A;  5ENO D;  2NYJ A;  1MX4 A;  4J8Y A;  1YCS B;  4ATZ D;  3W9F A;  1QYM A;  4BEP A;  3DEO A;  4U8Y D;  4ZFH A;  1K3Z D;  2DZO A;  4BER A;  5ENQ D;  1BI7 B;  1IHB A;  2VGE A;  4G8K A;  3W9G A;  1OY3 D;  2ETA A;  3V2O A;  3V30 A;  5BXO A;  4HLL A;  4TUM A;  2J8S D;  1YYH A;  2BKG A;  5FIN A;  3TWX A;  5CBO A;  2P2C P;  3LJN A;  4BES A;  2PNN A;  1AP7 A;  1BD8 A;  3Q9N C;  4Z68 A;  2JAB A;  3EHQ A;  4QQI A;  1N0Q A;  1SW6 A;  3HG0 D;  4O1P A;  4J7W A;  4CYM D;  4HRL A;  4YDW A;  3KEA A;  5CER B;  5AQB A;  3TWS A;  4CZ2 D;  1BU9 A;  5CED B;  1OT8 A;  2ZGD A;  3JXJ A;  5ENP D;  4C48 B;  3TWW A;  3UTM A;  1YMP A;  5ENS D;  4BET A;  3DEP A;  5KNG A;  3B7B A;  4K5B A;  4LG6 A;  1IXV A;  3JUE A;  4LSZ E;  4DX6 D;  2FO1 E;  3ZUV B;  4YDY A;  3ZKJ A;  3EU9 A;  4B93 B;  3T8K A;  5CBN A;  4K5A B;  4HNA D;  4DX1 A;  3TWR A;  5EYL A;  1G3N B;  2F37 A;  4DRX E;  4K5C A;  2BKK B;  4HI9 A;  3ZU7 B;  2F8Y A;  5KNH D;  3T9K A;  4OAU C;  3TWV A;  3EHR A;  5AN8 A;  4DX2 A;  3HRA A;  2L6B A;  5FIO A;  5CEA A;  2Y1L E;  2Y0B G; 
#chains in the Genus database with same CATH topology
 2GRM A;  2WXM A;  2BED A;  1HZ4 A;  4JD2 G;  5B3S E;  1OUV A;  2CHX A;  3MZL B;  3FH8 A;  1PAQ A;  2AVP A;  1JCR A;  4GA1 A;  4HQD A;  4OYS A;  3TWU A;  1ZBP A;  4UQY A;  4TRQ A;  3IHV A;  2KXP C;  1P5Q A;  4CT0 A;  4HOS A;  1OWM A;  1HS6 A;  2V0P A;  3D9J A;  5EIL A;  5D66 A;  4ANV A;  2KCK A;  3ASO E;  2B0O E;  3IXE A;  3C3R A;  2R59 A;  3C98 A;  5T3R A;  1N54 A;  2WXH A;  3G2T A;  1H2V C;  5ANR A;  1N95 A;  1DCE A;  1SVX A;  2KCL A;  2XPY A;  2I9C A;  3SFX A;  5BW8 C;  1Z5S C;  1WY6 A;  3OTN A;  2H6H A;  2OEW A;  2P58 C;  5G55 A;  3RRN B;  4GTT A;  4Y6C A;  2LAI A;  1SW6 A;  2AXV A;  1JWF A;  3CEQ A;  4YDW A;  2CFU A;  1HX8 A;  1QZ2 A;  3D9P A;  4U8H A;  3B7R L;  3TWW A;  4DK5 A;  3ZYL A;  2VQ2 A;  3CLJ A;  4HLE A;  3T8K A;  2CG2 A;  3TWR A;  2XS8 A;  2GRO B;  4HS2 A;  4I1O B;  1ELK A;  4GTS A;  4AV7 A;  4BT8 A;  4HOQ A;  3PEU B;  5FZS A;  2KAT A;  3CV0 A;  2PL2 A;  2R05 A;  3PEV B;  4EHM A;  4GMR A;  5BV1 A;  5HI7 A;  4QFV A;  2WXL A;  3MKR A;  4O60 A;  4YND A;  5FQ8 A;  1INZ A;  2WQH A;  2AJA A;  1BLX B;  3G2V A;  4XI0 A;  2H6G A;  5FQ6 A;  5EYP F;  1PY1 A;  4XE0 A;  4EZK A;  4JB8 P;  4BTA A;  3FUN A;  5FJY A;  3QK0 A;  4ILI A;  1W3B A;  2PM7 A;  3VLD A;  3R9A B;  2ILR A;  3FUM A;  3Q9N C;  4I1M A;  2WQ7 A;  3TXM A;  4YVQ C;  3G2W A;  3SY2 A;  3RJV A;  2DYS E;  4FLH A;  5FWQ A;  4BET A;  3AG3 E;  4CRW A;  3L9T A;  4E85 A;  3ZXS A;  4HNA D;  1IQR A;  3CQG B;  2X6I A;  4ANU A;  4K5C A;  3ABL E;  3Q75 A;  4RSY A;  4OAU C;  3TWV A;  4APF A;  3U3W A;  4C0E A;  4NUR A;  4WWO A;  3QB2 A;  3BUA A;  2WXG A;  4HXI A;  3UPV A;  3B95 A;  3FUH A;  5ARF A;  3DST A;  4A63 B;  3HXF A;  3HHM A;  5AQ9 A;  3UX4 A;  4U8V D;  3PZ4 A;  1HG2 A;  2L6J A;  3Q78 A;  1QBQ A;  3PZ2 A;  2ZU6 B;  4MRU A;  3D9M A;  1U3D A;  2LSV A;  3FU6 A;  2F8X K;  2VTB A;  2OCC E;  3UM1 A;  3MKQ B;  5AAR A;  3U64 A;  5A6C A;  4L23 A;  2HE0 A;  3QOU A;  1KT0 A;  4UWK A;  4ME2 A;  1FCH A;  1Z3Y A;  2ETC A;  4IRU A;  3OAW A;  2CHZ A;  5AJD A;  5EKQ D;  3FU0 A;  4UQX A;  1K8K G;  4EPZ A;  3CR3 A;  3QC1 A;  4G8K A;  2QFC A;  2P2C P;  3PZD A;  1FT2 A;  1N4S A;  2FBN A;  3LKU A;  3Q47 B;  5FZQ A;  2IU1 A;  1N4Q A;  4PDX A;  3O48 A;  4LNB A;  4UWF A;  5CRV A;  2XGO A;  3CVP A;  5EYL A;  2IQC A;  3WXX A;  2WMN A;  1IHG A;  2WVI A;  3QWV A;  1E7U A;  1U2V G;  2GRN B;  1TJF A;  3ZHE A;  5KJL A;  1ELR A;  3CK7 A;  4ILG A;  2I1K A;  3LY8 A;  5CHE E;  4G26 A;  4KYO B;  3NOG D;  4YDE A;  1FPP A;  4FJY A;  4AJW A;  2QC9 A;  3C5R A;  3ASF A;  4UWG A;  4BSX A;  3VTX A;  3HXB A;  3TWT A;  1RW2 A;  2EIJ E;  2A5E A;  3APC A;  1S70 B;  4NAC A;  4KXK B;  1WDY A;  3ABM E;  4RLY A;  3MX3 A;  1S0P A;  4GTM A;  4F53 A;  1MX2 A;  4EQF A;  3N71 A;  3FFL A;  2BUG A;  3CHO A;  5C1D A;  2VSO E;  3Q73 A;  4FAD A;  2XHE A;  1OCZ E;  2P9L G;  4I1A A;  5KBA A;  4KZC A;  4GU5 A;  1HF8 A;  4BEP A;  4ZFH A;  2WXJ A;  2ZIS A;  3ZYM A;  2ETA A;  5KCM A;  5BXO A;  3KSL A;  2J8S D;  3DPD A;  2BKG A;  3TWX A;  3FTY A;  4NQ0 A;  1KPS B;  4QQI A;  2WMO A;  3LXU X;  4CYM D;  2FI7 A;  3DPY A;  3JQ0 A;  3FEY A;  4LEU A;  1YMP A;  3TGO A;  1SZ9 A;  1N94 A;  3ISM C;  5CBN A;  4F3V A;  3AS5 A;  3E30 A;  3CSF A;  5AN8 A;  5FIO A;  3TXN A;  3FP3 A;  1Q2Z A;  3L82 A;  3KEZ A;  4DUI A;  3UXG A;  3ZRH A;  4WUY A;  4EBA A;  2J07 A;  4U0Z A;  2Y69 E;  2WXK A;  4FHJ A;  4N2Q A;  4ACK A;  3HVE B;  5T4Y A;  3DXM G;  1HU3 A;  3FH5 A;  2WXR A;  2UY1 A;  3CHP A;  1NA3 A;  3HXC A;  2QYJ A;  2E2E A;  5FQ7 A;  2VJ8 A;  2JEK A;  2WXQ A;  3PRE A;  1E7V A;  3FUD A;  4CGV A;  3ASN E;  3IV0 A;  4Q69 A;  3Q15 A;  3SD5 A;  4RVB A;  5AEN A;  5HRY A;  3UIP C;  5JA4 D;  4UI9 J;  3E34 A;  3HXD A;  5BT1 A;  4APO A;  1OXJ A;  2X6H A;  3SO8 A;  4V3I A;  2FO7 A;  2KM4 A;  3ULY A;  2VGX B;  4WNG A;  2XPZ A;  3V30 A;  1UJK A;  4TUM A;  2R02 A;  5JJT A;  3SFY A;  5J90 A;  4U0U A;  3EUV A;  3GZ1 A;  3EDT B;  4I9C A;  3ASH A;  2HO1 A;  4GB9 A;  4FLB A;  1N4P A;  4A3T A;  2XGS A;  3MA5 A;  4U04 A;  3CQC B;  2YQ8 A;  1KLX A;  3B7B A;  5J08 A;  3QWW A;  4R7L A;  2J4B A;  4GML A;  5D2M C;  3RIB A;  4HI9 A;  4N3B A;  2H6F A;  3Q7A A;  2LXM A;  1N4R A;  4I6G A;  2P9S G;  4UI9 C;  5E76 A;  2X6J A;  4BX8 A;  3SBS A;  2MOW A;  3D9I A;  5A23 A;  2X3M A;  4L7T A;  5E75 A;  4BWR A;  2LSU A;  3FTV A;  2XGM A;  3V31 A;  4AP2 A;  4HOT A;  4XIF A;  5EN5 D;  4LNG A;  4JW1 A;  5EIB E;  2ZGG A;  3B13 A;  3CHR A;  2Y3A A;  2XZD G;  2RFA A;  2L0T B;  4MS6 A;  3GZS A;  2XRZ A;  3CVV A;  3V79 K;  2V4H C;  1S63 A;  2MHK A;  3RK6 A;  4JHR A;  3ZN3 A;  4WWP A;  3LJ3 A;  5CRU A;  1UN8 A;  4HLL A;  4URK A;  2HYZ A;  2JAB A;  3ML8 A;  3UT8 A;  4GA2 A;  2X6K A;  3TJP A;  2C0L A;  4DPR A;  3CHM A;  4LER A;  3LVQ E;  1H2U A;  1DVP A;  3FTU A;  3DXK G;  2DBA A;  2VSY A;  5CMY A;  3FWV A;  4I43 A;  1TR4 A;  1N11 A;  4DI3 A;  2DWZ A;  3DRA A;  3DWL G;  1X81 A;  5FT9 A;  4M3O A;  1UN9 A;  5KJN A;  2I1J A;  1KZO A;  5AQ7 A;  3BU8 A;  3UI2 A;  3ASD A;  3CVW A;  1D8D A;  3BG0 B;  2R17 C;  2WM9 A;  3JUI A;  2AWI A;  2OEV A;  3FU3 A;  2C0M A;  2KC7 A;  1OCR E;  2P9U G;  4DX7 D;  4OAV B;  2XCC A;  1H6K A;  3ZFW A;  3Q4A B;  3CKC A;  3SGH A;  2KBX A;  1QQE A;  4HRN A;  4F6R D;  3NOC D;  3KD7 A;  3CIA A;  4H7Y A;  3S7J A;  3IEG A;  4I2Z A;  3EHN A;  1TYQ G;  4GTO A;  4F1P A;  3FTX A;  4D10 C;  3OXG A;  3PUK A;  3DSU A;  1H19 A;  2DZO A;  5ENQ D;  3PE4 A;  1HXI A;  2GGF A;  3EJN A;  2WXP A;  3TL5 A;  4XI9 A;  5G05 C;  4JVS A;  3FUE A;  2PNN A;  4F1S A;  3NAW A;  4IUL A;  1A17 A;  5JHA A;  2AW6 A;  1HFA A;  5CED B;  3S2A A;  5ENP D;  4RG6 A;  3ULQ A;  2FUL A;  3T5V A;  1IXV A;  2RD0 A;  3RO2 A;  4K5A B;  1GW6 A;  2V5F A;  4CCA A;  4KZ0 A;  5ARG A;  3QNK A;  1TJC A;  3QAQ A;  2RKK A;  1NFI E;  3B7S A;  3L22 A;  4PUC A;  3GZ2 A;  3AJI A;  3R7R A;  3AG2 E;  4HOU A;  4WWN A;  3FTW A;  1LF8 A;  4N39 A;  3SNX A;  2P9I G;  1WM5 A;  2IOL A;  1OCC E;  5ENN A;  3J5Q B;  4U07 A;  1UJJ A;  2EQX A;  4KMO A;  4DLO A;  4HB5 A;  3HXE A;  3U9W A;  3LCA A;  2XEH A;  1N9A A;  4ANX A;  3DSW A;  3SHF A;  4A3V A;  4ILH B;  3MV2 B;  1MZC A;  1IYG A;  2JLB A;  2BF0 X;  4J8Y A;  4W9R A;  2WXO A;  3FU5 A;  1JPL A;  3VLF A;  3ZPJ A;  4GTV A;  2P9N G;  4MBG A;  5ANL A;  4DJA A;  3RRU A;  3FY4 A;  2QZA A;  5CER B;  3UQ3 A;  2RG8 A;  3ONL A;  5AQB A;  3Q49 B;  4I6J A;  1Y6I A;  4LG6 A;  4LRZ A;  4X8Q A;  4DX6 D;  1UW4 B;  3ZKJ A;  3QKY A;  4B94 A;  4GPK A;  2Y4T A;  3AS8 A;  3CGH A;  1G3N B;  2HR2 A;  4DRX E;  3T9K A;  5CEA A;  2L6B A;  3R7Q A;  3UKR G;  3FHE A;  5AJL A;  1O5M A;  1LD7 A;  4GPM A;  2GW1 A;  4ANW A;  5LOZ A;  3SFZ A;  4H7X A;  4AOF A;  3LY7 A;  3O4Z A;  4N2S A;  4B8C B;  4UWL A;  1SZA A;  4TXP A;  5EDS A;  4ABN A;  5CEC B;  4GCN A;  1HE8 A;  2GRR B;  3EU5 A;  4N3C A;  3AG1 E;  3IHY A;  1E8W A;  4E6H A;  2OVF A;  1H0A A;  5LP0 A;  1N52 A;  2WPV A;  5LCW J;  3IKO B;  3QAR A;  4EZL A;  4J8E A;  5ENR D;  1MX4 A;  2FF4 A;  4CGW A;  4BER A;  1BI7 B;  3JQ1 A;  3W9G A;  1OY3 D;  3AG4 E;  3CVQ A;  5B1B E;  4XKB A;  5CBO A;  3D9L A;  1FT1 A;  3EHQ A;  1HG5 A;  3C3Q A;  3CHS A;  2GRQ B;  4G24 A;  2J9Q A;  3CST A;  3FUF A;  3UTM A;  2YIN A;  5KNG A;  3JUE A;  4YDY A;  3JYS A;  3CVX A;  4WNE A;  1YA0 A;  3UUX A;  4NRH B;  4BY6 A;  4Y6W A;  4WAF A;  4GYO A;  5KNH D;  3AU5 A;  3EHR A;  4DX2 A;  3VTY A;  3SQV A;  1E8Z A;  2DVW A;  3ZW3 A;  2M63 A;  4GYY A;  1H6P A;  5LCW C;  2VTB B;  3Q5M A;  3PUJ A;  5AIJ A;  2IJG X;  4I9E A;  4Q96 A;  3D9H A;  4K0R A;  4FP7 A;  3D3M A;  4AY6 A;  3UKU G;  2UWJ G;  1MX6 A;  3SBT B;  1SQM A;  1A5E A;  5EX0 A;  5C2Y A;  2Q7F A;  1TNY A;  3S7B A;  4ACL A;  2XS1 A;  2CG3 A;  2NC9 A;  4O1O A;  1E90 A;  4A1S A;  3ZXP A;  3TWQ A;  1LTX A;  2AXU A;  5AYW D;  3VLE A;  3MV3 B;  5HKP A;  3RRM B;  4L2Y A;  3FUJ A;  3D9O A;  3FEX A;  4JXT A;  3Q9U C;  4CT4 A;  5G2N A;  3CVY A;  5KJK A;  4OVV A;  3K9I A;  3ABK E;  3UT4 A;  2KZT A;  3GYZ A;  1O1R A;  3KEA A;  3ZHE B;  4GZC A;  1BU9 A;  2ZGD A;  4TXQ A;  4EZJ A;  1ELW A;  1NL4 A;  3RSE G;  4EBA G;  1S64 A;  4XX5 A;  5B1A E;  4OVU A;  3T5X A;  2R2L A;  2VSN A;  5EX3 A;  3ML9 A;  3EIQ C;  1O1T A;  3HRA A;  2Y1L E;  3I4G A;  3U66 A;  4K03 A;  2EIM E;  3EHM A;  2XEV A;  1FVH A;  1SA4 A;  2E0I A;  3KAE A;  2R5S A;  3D9K A;  4WND A;  3PZ1 A;  2LUH A;  2LXL A;  5CMW A;  2J09 A;  4I17 A;  2ZXW E;  3TG5 A;  2HM8 A;  1NZN A;  3P2B A;  1JCQ A;  1OWL A;  3T8M A;  2LO6 A;  3D9N A;  3J5P A;  4XEI G;  4ZHB A;  1TN6 A;  5IY5 E;  4GAA A;  4ATG A;  1O1S A;  3QDN A;  4LNU D;  1V54 E;  1BI8 B;  2YHC A;  3F6Q A;  3R9M A;  1TN8 A;  1E8Y A;  5LX8 A;  2NYJ A;  3BG1 B;  4ATZ D;  4GTQ A;  4GCO A;  3C72 A;  4O6F A;  1XNF A;  4JA9 A;  3LDZ A;  5JHB A;  4A55 A;  2WXN A;  2WXI A;  2IY0 C;  3UIO C;  5BV0 A;  2XCB A;  4JPS A;  4O1P A;  1SA5 A;  3IBE A;  4CZ2 D;  3APF A;  3APD A;  1OCO E;  4JHJ A;  2IO3 C;  2FO1 E;  2FEZ A;  1E8X A;  4AM9 A;  2J4D A;  3PRZ A;  3L13 A;  2LAH A;  2YNQ A;  4KVM A;  2B6C A;  2GRP B;  3B7T A;  3S7D A;  1FVF A;  1ZB1 A;  4CEM A;  2UY1 B;  4HBD A;  1TN7 A;  4G8L A;  4G25 A;  3ZVV A;  2XPI A;  4KVO A;  4JEH A;  4YDO A;  4JHK A;  2KZT B;  4J8F A;  2XEN A;  1JWG A;  1WAO 1;  2VSX E;  2XEE A;  3ONK A;  5BXU A;  2WXF A;  2NXP A;  4GMJ A;  5LFA A;  3U4T A;  1EDU A;  3ASG A;  3NF1 A;  1KZP A;  1JCS A;  4BSZ B;  5G05 J;  3ZIM A;  1E96 B;  2R03 A;  4LUN U;  3DSX A;  3LPZ A;  5AAO A;  3Q79 A;  4DX5 D;  4C9B B;  3PS6 A;  2RFM A;  3CVU A;  1KT1 A;  3JXI A;  1K1A A;  3MCX A;  1K1B A;  2ETB A;  4GTP A;  1NA0 A;  2ZIR A;  3I4R B;  5ENO D;  3DEO A;  4AEZ C;  2VGE A;  4I2W A;  3MKQ A;  4G1T A;  3LJN A;  2L0I A;  2V8S E;  4J7W A;  4FC8 A;  2J08 A;  3ULE G;  4G2V A;  3PNL B;  1OT8 A;  4MKT A;  4C48 B;  1MQS A;  5FQ4 A;  3ZGQ A;  4LSZ E;  4JC8 A;  3PE3 A;  3ZUV B;  4AIF A;  3OXF A;  3G2U A;  2C2L A;  2GRL A;  4J8D A;  1D8E A;  4JZY A;  1NI1 A;  2I6H A;  5M72 A;  2NSZ A;  5BUZ A;  2MYO A;  3FUK A;  4N3A A;  5AQA A;  1JUQ A;  5KJM A;  3GW4 A;  4J6I A;  4YVO A;  4KBQ A;  4HRM B;  3CK8 A;  4UUC A;  2IF4 A;  3AU4 A;  1AWC B;  1IQU A;  4Q94 A;  4LCT A;  4J8S A;  2VYI A;  1DCQ A;  3CKB A;  1MHQ A;  3SZ7 A;  3PDN A;  1IKN D;  3KS2 A;  4BT9 A;  3DSV A;  3CHQ A;  4U95 D;  4CDM A;  2ION A;  4C0M A;  3E4B A;  4JEU A;  3ESK A;  1D9S A;  5A7D B;  1U3C A;  3SF4 A;  1TNO A;  2BTD A;  4L2L A;  3URZ A;  3UM2 A;  1L5J A;  1EF1 C;  3UT7 A;  3V2O A;  3HIZ A;  3L16 A;  4BFR A;  4U7E B;  4Z68 A;  3UMV A;  5HQ8 A;  3FH7 A;  3DBS A;  4GYW A;  1EYH A;  3EIJ A;  3PZ3 A;  3L17 A;  3TWS A;  1PC2 A;  5FZR A;  3JXJ A;  4TV3 A;  5ENS D;  2OV8 A;  4J0U A;  3WG7 E;  3L08 A;  3EU9 A;  4GZ5 A;  4DX1 A;  4BTB A;  4GZD A;  2VGY A;  5BNW A;  3ZU7 B;  2F8Y A;  3I3N A;  2PM6 A;  3X2Q E;  3ZYQ A;  5G04 J;  4TXR A;  3ZNG A;  4XZ4 A;  2CHW A;  4PS8 A;  3UIN C;  1OWO A;  4MLP A;  3RAU A;  3MJW A;  1VDY A;  2XRY A;  4RQI A;  1BPO A;  5EID A;  2YHE A;  3LY9 A;  4I6E A;  3PVL A;  4AVX A;  4GA0 A;  4FA6 A;  3UM0 A;  4CDR A;  5JJ7 A;  2IO2 C;  4FHK A;  3NB2 A;  4PS3 A;  2X38 A;  3CVL A;  3TAX A;  5KWD A;  1UOH A;  3V2X A;  1OWN A;  5FTP A;  2IOS A;  3LEW A;  3TG4 A;  3RO3 A;  3HVE A;  2WB2 A;  2XZT G;  3QWP A;  3MGB A;  4BX9 A;  5G04 C;  2IEJ A;  4HOR A;  4AXH A;  4UWH A;  2F0Y A;  4B89 A;  1XGW A;  1AP7 A;  1OWP A;  3FDH A;  3HG0 D;  3RU0 A;  5BPP A;  4PH4 B;  5DIZ A;  1TEZ A;  2QY7 A;  3I5P A;  2P9P G;  1DNP A;  1QNF A;  3CVN A;  3DEP A;  4PS7 A;  5D0Q D;  4EEC A;  2DYR E;  2VGX A;  3MYV A;  3QJZ A;  4U63 A;  2BKK B;  4IN3 B;  1HO8 A;  2PQR A;  2LNI A;  2DZN A;  3AAA C;  1LD8 A;  3NQP A;  4A1G A;  1MYO A;  3LS8 A;  3JCK C;  3NZS A;  3ESL A;  3UM3 A;  3FTS A;  3G2S A;  2J49 A;  4U96 D;  2IFU A;  1MJ0 A;  2AXZ A;  3HDX A;  3LVR E;  2X6F A;  3NBN B;  4RG9 A;  5ITZ F;  4HI8 A;  2H6I A;  1Z3X A;  1H6O A;  3BEE A;  4B8A A;  4U0S A;  2V4L A;  2A5U A;  1EPU A;  4G11 A;  1QYM A;  2L9B A;  1X5B A;  4U8Y D;  3ZYK A;  1IHB A;  3L54 A;  5T8I A;  1YYH A;  3PNT B;  1BD8 A;  2PQN A;  4B0Z A;  4N5C A;  1N0Q A;  2EIL E;  2EIK E;  4HRL A;  2PZI A;  4UQZ A;  3S7F A;  3FUL A;  4FJZ A;  3AS4 A;  2I2O A;  1Y8M A;  1H2T C;  3RKV A;  3OXL A;  2DIW A;  2KCV A;  4HFG A;  3L6A A;  4GZ3 A;  3CK9 A;  2F37 A;  3P1U A;  4G23 A;  5JJ6 A;  3MEK A;  3KSQ A;  2QYU A;  1B89 A;  1NP7 A;  2Y0B G;  2XQ0 A;  3LYA A;  4JL0 A;  5JMN D;  3SI5 A;  3ZEF A;  4GZ6 A;  4WNF A;  3ENE A;  4NIK A;  1Z6T A;  4DLQ A;  5CCM A;  1WG0 A;  5HS0 A;  2V5Q C;  4TUU A;  4FUL A;  4CDN A;  4DI4 A;  4UI9 K;  3HYM B;  4F7A A;  1TNU A;  1N0R A;  4P29 A;  4AY5 A;  1DC2 A;  4L1B A;  5ENT D;  4M7C A;  3B7U X;  3BQO A;  2A4Z A;  2DCP A;  2EIN E;  2OND A;  4XKC A;  2P9K G;  5D0O D;  2OVB A;  2CFZ A;  4N5Q A;  2MRI A;  5H7P A;  1TNB A;  1UG3 A;  4JA7 A;  3PH0 C;  1YCS B;  3W9F A;  1K3Z D;  4GTR A;  3E33 A;  2Y4U A;  4IYP A;  5FIN A;  4BES A;  4HVB A;  3NZU A;  1TNZ A;  1ZU2 A;  2OOE A;  3Q7F A;  3DSS A;  3E37 A;  3FUI A;  5DBK A;  1RZ4 A;  3FTZ A;  4K5B A;  3C3O A;  4FU3 A;  3E32 A;  4KT6 B;  4L9P A;  5CCL A;  4B93 B;  1V55 E;  2WQ6 A;  1HH8 A; 
#chains in the Genus database with same CATH homology
 1TR4 A;  2DVW A;  1N11 A;  4HBD A;  1NFI E;  2DWZ A;  3ZNG A;  4G8L A;  4GPM A;  2DZN A;  5AQA A;  4DUI A;  3AAA C;  3UXG A;  3AJI A;  5JMN D;  1MYO A;  4HRM B;  5AQ7 A;  4HQD A;  4UUC A;  4GMR A;  4NIK A;  3NOG D;  3UI2 A;  3TWU A;  3D9H A;  3B95 A;  1AWC B;  4QFV A;  4U96 D;  2KXP C;  4O60 A;  1WG0 A;  4A63 B;  2XEN A;  2QC9 A;  5AQ9 A;  3C5R A;  1MJ0 A;  2XEE A;  4U8V D;  5HS0 A;  5BXU A;  1DCQ A;  5EID A;  2V5Q C;  3V31 A;  3J5Q B;  1MX6 A;  3TWT A;  3NBN B;  2AJA A;  1BLX B;  1A5E A;  5EN5 D;  4HB5 A;  5EIL A;  2QYJ A;  2F8X K;  5ITZ F;  4HI8 A;  4DX7 D;  5EIB E;  1IKN D;  2A5E A;  4BSZ B;  5CEC B;  4OAV B;  5EYP F;  1N0R A;  1S70 B;  5D66 A;  2XEH A;  2ZGG A;  4O1O A;  3J5P A;  5ENT D;  1WDY A;  2MYO A;  5AAO A;  1DC2 A;  4ZHB A;  2XZD G;  2B0O E;  3IXE A;  4RLY A;  4U95 D;  2KBX A;  5AAR A;  4DX5 D;  1MX2 A;  3TWQ A;  2RFM A;  4LNU D;  5KWD A;  1UOH A;  1BI8 B;  4HRN A;  2RFA A;  4JB8 P;  4F6R D;  3NOC D;  5HRY A;  3V2X A;  3F6Q A;  3JXI A;  2HE0 A;  5JA4 D;  5HKP A;  3V79 K;  1D9S A;  1K1A A;  2ETB A;  2V4H C;  1K1B A;  4N5Q A;  5KBA A;  2ETC A;  4F1P A;  3Q9U C;  2XZT G;  1SVX A;  5ENR D;  3SO8 A;  5ENO D;  2NYJ A;  1MX4 A;  4J8Y A;  1YCS B;  4ATZ D;  3W9F A;  1QYM A;  4BEP A;  3DEO A;  4U8Y D;  4ZFH A;  1K3Z D;  2DZO A;  4BER A;  5ENQ D;  1BI7 B;  1IHB A;  2VGE A;  4G8K A;  3W9G A;  1OY3 D;  2ETA A;  3V2O A;  3V30 A;  5BXO A;  4HLL A;  4TUM A;  2J8S D;  1YYH A;  2BKG A;  5FIN A;  3TWX A;  5CBO A;  2P2C P;  3LJN A;  4BES A;  2PNN A;  1AP7 A;  1BD8 A;  3Q9N C;  4Z68 A;  2JAB A;  3EHQ A;  4QQI A;  1N0Q A;  1SW6 A;  3HG0 D;  4O1P A;  4J7W A;  4CYM D;  4HRL A;  4YDW A;  3KEA A;  5CER B;  5AQB A;  3TWS A;  4CZ2 D;  1BU9 A;  5CED B;  1OT8 A;  2ZGD A;  3JXJ A;  5ENP D;  4C48 B;  3TWW A;  3UTM A;  1YMP A;  5ENS D;  4BET A;  3DEP A;  5KNG A;  3B7B A;  4K5B A;  4LG6 A;  1IXV A;  3JUE A;  4LSZ E;  4DX6 D;  2FO1 E;  3ZUV B;  4YDY A;  3ZKJ A;  3EU9 A;  4B93 B;  3T8K A;  5CBN A;  4K5A B;  4HNA D;  4DX1 A;  3TWR A;  5EYL A;  1G3N B;  2F37 A;  4DRX E;  4K5C A;  2BKK B;  4HI9 A;  3ZU7 B;  2F8Y A;  5KNH D;  3T9K A;  4OAU C;  3TWV A;  3EHR A;  5AN8 A;  4DX2 A;  3HRA A;  2L6B A;  5FIO A;  5CEA A;  2Y1L E;  2Y0B G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...