2IOSA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form 3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
124
Chain Sequence
PVNHLVKEIDMLLKEYLLSGDISEAEHLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antitumor protein
molecule keywords Programmed Cell Death 4, Pdcd4
total genus 50
structure length 124
sequence length 126
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iosA00
4JHJA 4JHKA 3FEYA 4GMLA 3JUIA 4GMJA 4B8AA 2IOLA 1PAQA 3FEXA 2GGFA 2IOSA 1H2TC 2HM8A 4B89A 1H6KA 2FULA 1N54A 1UW4B 1N52A 3EIQC 3EIJA 4CT4A 4B8CB 4CRWA 4C9BB 2RG8A 1H2VC 2I2OA 2VSXE 4IULA 3L6AA 2ZU6B 2KZTA 2KZTB 2VSOE 3D3MA 1UG3A 2IU1A 2NSZA 2IONA 5ANRA 1HU3A 4CEMA 1H2UA 3RK6A 4LUNU
chains in the Genus database with same CATH superfamily
2CFZA 3JQ1A 5KJNA 2I6HA 3ZW3A 4G11A 4GMJA 2GRMA 4N3BA 3MKRA 1HFAA 2GRQB 1YMPA 4F1SA 1MX2A 3EDTB 4JA7A 2EIJE 4FHKA 2HE0A 3ZNGA 2LXLA 1PAQA 2F8XK 2ZXWE 3ASGA 4OVUA 3TG4A 3V2OA 4N3CA 3FDHA 3D9HA 5AN8A 2IU1A 2M63A 1MX4A 1HU3A 3ZU7B 4BSZB 5AARA 3TXMA 4PS7A 2J4DA 2P9NG 4K5AB 3MCXA 1N0RA 5FQ4A 1TJFA 3PEUB 1NL4A 2LSUA 4C0MA 2ETAA 3APFA 3SGHA 1H2UA 3UKUG 2UWJG 2J08A 4HI8A 4HRLA 2X6FA 3FU0A 1S0PA 2E0IA 3QOUA 4HOSA 3E30A 4HVBA 4DX1A 3PDNA 3ZN3A 4PUCA 3CVQA 3V2XA 2I9CA 3DXKG 4ACKA 4G8LA 3MGBA 1Z3XA 1NA0A 4YVQC 2RG8A 4ATZD 1ZU2A 4IULA 3CGHA 4J8EA 2F37A 3ASNE 5M72A 2GROB 2FEZA 3ONKA 1N0QA 4Q69A 3L22A 4BTBA 3ZGQA 3CQCB 3ML9A 1N9AA 1HF8A 3TWUA 3D3MA 5BW8C 5EX0A 1WM5A 3TWTA 5FQ6A 2PM7A 4AP2A 3D9KA 2Q7FA 4GA2A 2XZDG 3L6AA 3PZ4A 4H7XA 2KZTB 2I1JA 3RO2A 1E8ZA 1ZBPA 5JJ6A 1AWCB 3AS5A 4HRNA 4B8AA 2IFUA 3LY8A 3TWXA 4DK5A 2GRNB 2PL2A 1UJKA 4JEHA 2XEVA 1KT0A 1V55E 3NZUA 3R9MA 3G2SA 3KSLA 5G55A 2R5SA 2VGEA 4E85A 2VYIA 3PZDA 3QNKA 5D2MC 3CVVA 3NOGD 4JB8P 2CHZA 3JXJA 5FT9A 3AAAC 3T5VA 1Y8MA 3E37A 2KM4A 2WXKA 4TXQA 4NACA 5AENA 4JA9A 3T5XA 5DBKA 4FJZA 4G2VA 5E76A 2KZTA 4ACLA 3PUJA 2PQNA 4BERA 3CIAA 5LCWJ 3DXMG 3Q73A 1BD8A 2OV8A 2X38A 4F6RD 5KBAA 5E75A 2P58C 3FUHA 3GZ2A 4PS8A 4K5CA 3KEZA 4CGWA 1TNBA 4FU3A 2BEDA 1HXIA 2XRZA 2NYJA 3BU8A 1XNFA 3CVUA 5FZQA 3ZXPA 3Q79A 4XE0A 4IN3B 3C5RA 3EIQC 3LDZA 4U95D 2H6FA 3E33A 5T3RA 3SD5A 1RW2A 1Z6TA 2QZAA 3FUFA 3ZYMA 1E90A 4HS2A 3AU5A 3CK8A 1DVPA 2WXOA 1PC2A 3FUMA 2DZNA 4R7LA 4GCNA 2OVFA 2QC9A 2FF4A 3FTZA 2J9QA 3HHMA 2X3MA 3UUXA 5G04C 5KJMA 4GTOA 3RJVA 2ZGGA 3AU4A 3HVEB 2VTBA 3FP3A 2OOEA 5CMYA 5FINA 1QYMA 2MRIA 3ENEA 3I3NA 3CVYA 1MJ0A 1A5EA 3SNXA 4F1PA 4B94A 2VQ2A 1ZB1A 3UIPC 4WUYA 5CCLA 4RG9A 4B8CB 4D10C 3LEWA 3FUNA 1JWFA 3KSQA 1JWGA 4HRMB 1OCRE 3AG4E 1OWOA 4ATGA 4HQDA 3HXFA 3UT4A 3EU5A 4YDOA 2BKGA 2R2LA 2OVBA 4JC8A 3HG0D 1TN8A 3HVEA 2VTBB 2GRRB 4WWNA 5B1BE 3UIOC 2DCPA 3TJPA 5AIJA 4F3VA 3RIBA 2NSZA 2YHEA 4HI9A 1OXJA 1KLXA 4KZCA 4OYSA 4BSXA 3FU3A 4Y6WA 3UTMA 4HOTA 5A7DB 2X6HA 3LVRE 1U3CA 3DEPA 2ONDA 2YQ8A 2QY7A 2LXMA 4GZ6A 4RSYA 4DX7D 4F53A 2DYSE 3EJNA 3EHMA 4UWLA 3IBEA 3B7TA 3ZKJA 4YNDA 3BEEA 1O5MA 4L2YA 3PS6A 4XIFA 3FWVA 1UG3A 4HORA 3ZYLA 3RAUA 4I1OB 1UOHA 1X81A 4CDRA 3UM0A 4O1PA 1N95A 2LSVA 5EILA 4DI3A 1UN9A 2VGXA 3ASFA 5CEAA 4GCOA 1EPUA 4JW1A 4APOA 4G8KA 1UW4B 3DBSA 3QK0A 3QAQA 4ILGA 2HR2A 3FTWA 4J8YA 2VJ8A 3D9JA 5J08A 3RK6A 3LCAA 3G2UA 3UI2A 3SO8A 2CHWA 2GRPB 3PE3A 4I1MA 1S64A 3L08A 1A17A 3VLEA 2DBAA 1NFIE 1MYOA 2BKKB 2VGYA 3BG1B 4N5CA 5EDSA 4ZFHA 5IY5E 3C3OA 4BX8A 2WXPA 1H0AA 4DJAA 1V54E 4KVOA 4CT4A 3U66A 2A5EA 3FUIA 4M7CA 1WG0A 4L1BA 2KATA 1YCSB 2IO3C 1L5JA 2Y3AA 3ZPJA 5KWDA 5AJDA 4JHKA 3ABLE 1S70B 3UM3A 4WNFA 4L2LA 3CK9A 5KNHD 3UT7A 1O1SA 1KPSB 3LVQE 1N94A 2WPVA 4ANVA 4AVXA 2C0MA 3CVLA 1JPLA 5JHAA 4RQIA 1YYHA 3C3RA 2IOSA 1FT1A 3J5PA 2OCCE 3HRAA 3X2QE 3MYVA 5CEDB 3NQPA 4M3OA 1K1BA 2P9KG 3Q78A 5A23A 1E8WA 4DLOA 2KC7A 4GTMA 5HI7A 4UQZA 3SF4A 5AQ7A 5LP0A 3QJZA 4PH4B 5JA4D 3QWWA 4J8DA 4MS6A 3FTSA 3HXEA 4I6JA 1S63A 4GZDA 1H6OA 3ASDA 4URKA 4U0SA 5H7PA 3ABKE 2IJGX 2ETBA 3CKBA 3TWWA 4BEPA 1KZPA 4DI4A 3CVPA 2J09A 1D8EA 2I1KA 4EBAG 3GZ1A 3MJWA 4GTPA 3TL5A 2EINE 5ARGA 5ANLA 3V30A 3IEGA 1E8YA 4I2WA 3FTVA 5D0QD 3ULQA 2DYRE 5D0OD 3TXNA 5JJ7A 3I5PA 2R59A 2J8SD 3SFZA 4I9EA 5BV0A 5B3SE 4ILIA 4X8QA 4E6HA 3RRUA 4TV3A 2AJAA 2X6JA 2ETCA 4WWPA 1U2VG 4DUIA 1FT2A 3AS8A 4HXIA 1TEZA 3D9PA 1O1TA 3Q9NC 1NP7A 3MX3A 2BUGA 3ZFWA 3WXXA 1NI1A 3NOCD 2WXGA 3PH0C 1N4QA 2UY1A 4CGVA 3DPDA 3W9FA 3RO3A 4A55A 3ISMC 3CHMA 2IF4A 2DWZA 5A6CA 4ILHB 1FPPA 1IXVA 3I4RB 3CKCA 3NB2A 1OWPA 4J8SA 4BT8A 4LG6A 2ILRA 4G26A 3FTYA 3LPZA 1INZA 3CHRA 2B0OE 4KT6B 4GZ3A 4GTRA 2KCKA 4W9RA 2XENA 4GA1A 3S7BA 3P1UA 4ABNA 3APDA 1Z3YA 3CV0A 4G23A 4WAFA 5JJTA 2WB2A 1FVHA 2A5UA 1KZOA 4N39A 2MOWA 2WXNA 3ASOE 3E4BA 3KAEA 3CVXA 2XQ0A 5BT1A 2L9BA 2UY1B 4MLPA 4FLHA 3PUKA 3S7DA 3S7JA 3W9GA 3B7BA 4EZLA 4KXKB 4CEMA 3CHPA 3FUKA 3OXFA 4QFVA 1G3NB 1TNYA 3EUVA 3L16A 3ZYKA 1IQUA 3QB2A 5CECB 5EYLA 3JQ0A 4BESA 2WXRA 1ELKA 2V8SE 3V79K 3PEVB 1K1AA 3DEOA 5CMWA 1EYHA 1O1RA 1XGWA 4CZ2D 4JPSA 5CCMA 3HIZA 2WQ7A 4MKTA 3ZRHA 2PQRA 5CBNA 3NZSA 2Y4TA 3HYMB 4GZCA 3B7SA 3CR3A 3UINC 2ZIRA 4HBDA 3JXIA 3RSEG 4KMOA 1OCZE 3NAWA 2L6JA 2AW6A 3U4TA 2JLBA 3B7UX 5LFAA 1EF1C 3MA5A 3JUEA 1QBQA 1TR4A 2VGXB 3CK7A 3U3WA 1N54A 4JEUA 1WDYA 4RVBA 4HLLA 4UI9J 3QWPA 4NRHB 3IXEA 3HXCA 4DX2A 3U9WA 3D9OA 1LD7A 4LUNU 2AWIA 4JHJA 5C1DA 3ML8A 1TNUA 3SHFA 4XKCA 1H6PA 3HXBA 2EQXA 5HS0A 1FVFA 3VTYA 5FQ8A 1HZ4A 4J6IA 2DZOA 3LS8A 2BF0X 4ME2A 2XRYA 3ULYA 3QKYA 1X5BA 3CLJA 2IQCA 4HNAD 5ITZF 2V0PA 2JEKA 4P29A 4O1OA 3DSVA 4YVOA 3SI5A 1BI8B 4J8FA 4U96D 5BXUA 1Z5SC 4Y6CA 4GU5A 1QZ2A 3QC1A 5D66A 4BT9A 5T8IA 5JMND 3URZA 3P2BA 1SA5A 1D9SA 1SA4A 5BNWA 3HXDA 2J4BA 3F6QA 2B6CA 1H2TC 3LYAA 4NURA 4J7WA 3OXLA 3FU5A 2LAIA 3UM2A 2H6HA 2AXVA 2VSXE 5ENNA 4K03A 5B1AE 1N11A 3U64A 1SQMA 3UT8A 4U8YD 3BUAA 4HLEA 4ZHBA 2X6KA 1IHBA 2EIME 3SBSA 2CG2A 4FJYA 5KJLA 3CQGB 4LCTA 2RD0A 4F7AA 1OCOE 5ENTD 5ENSD 2WXMA 2L0TB 2CFUA 2QYJA 4FC8A 3CSFA 3OXGA 3ZUVB 2Y4UA 4K0RA 1BPOA 2WQHA 4IYPA 1WAO1 2FI7A 2DIWA 2AXZA 3D9LA 4H7YA 3L54A 3ZIMA 4AY6A 1WY6A 4AOFA 4Q96A 3UMVA 4NQ0A 3TWQA 2VSYA 5HQ8A 3D9IA 3B7RL 5C2YA 5EKQD 2MYOA 1QQEA 3MZLB 2XS8A 2IO2C 2XEEA 2H6IA 2VSOE 1E96B 1SW6A 4EPZA 4FP7A 4HB5A 5CRVA 3SQVA 4LRZA 4B93B 4KZ0A 1ELWA 4YDWA 1UJJA 1H19A 1Y6IA 3KEAA 2KBXA 1N52A 3QDNA 2XCBA 4I43A 1JUQA 1N4PA 4KYOB 4I17A 1OWNA 3DSSA 4BFRA 4GZ5A 2P9PG 3Q5MA 2XGOA 2CG3A 3CVWA 4UWFA 5FIOA 4I2ZA 4N3AA 3IKOB 4N2QA 4WNEA 3ULEG 3NBNB 3E32A 1LF8A 4GTTA 3APCA 4UI9K 3TGOA 5G05C 3PREA 2E2EA 4FLBA 3S7FA 5KCMA 1K3ZD 4PS3A 3O48A 1BLXB 4ANXA 2XPYA 1HG2A 4ANWA 3JYSA 1MHQA 2GRLA 4AEZC 2XEHA 4LNBA 4IRUA 3VLDA 2C2LA 2LNIA 1E7UA 1RZ4A 5AQAA 3R9AB 3VLFA 4HFGA 3JUIA 4GTQA 4TXPA 1H6KA 3AS4A 4XEIG 3Q75A 3B95A 5FZSA 4CRWA 3LJ3A 4FADA 4HOQA 3PZ3A 4YDEA 3MEKA 1LTXA 1P5QA 1BU9A 4GB9A 5G04J 2P9LG 3N71A 1VDYA 5EIBE 2XHEA 2IEJA 3CSTA 3QARA 5EIDA 1TJCA 3ZYQA 5G05J 3CHQA 2VSNA 5LOZA 3PZ1A 1GW6A 4CDMA 4DRXE 1FCHA 4U8HA 1HX8A 3TWRA 5BUZA 1N4RA 4L23A 3FH7A 2WM9A 1W3BA 2J49A 5CHEE 2GGFA 3FUEA 1JCRA 2XPIA 2Y0BG 5AAOA 2EILE 4GA0A 4A63B 2P9IG 4DLQA 5ENQD 3TG5A 3ZEFA 4UWGA 2PZIA 3C3QA 3SBTB 5T4YA 5CERB 2WMOA 1OY3D 4GMLA 3MV2B 5CRUA 3TAXA 1DC2A 3FTXA 5JHBA 4U0ZA 4GYOA 3E34A 4U07A 3PNLB 5BXOA 5AQ9A 1DNPA 5AQBA 4TRQA 4CT0A 3R7QA 4WWOA 3UXGA 3V31A 3ZXSA 4J0UA 5LCWC 3RU0A 4OAUC 3TWSA 1EDUA 1OCCE 3G2WA 3LY7A 1E8XA 4XZ4A 2OEWA 1MX6A 4OVVA 4LSZE 3O4ZA 3NF1A 4BWRA 2NXPA 4U63A 4A3VA 2WQ6A 2BTDA 1AP7A 4JZYA 2IONA 3PRZA 3CEQA 4L7TA 2WXFA 2HYZA 5ARFA 3Q7AA 1HE8A 3T8MA 2FULA 3Q7FA 4G1TA 4UQYA 3WG7E 1LD8A 3TWVA 4RG6A 1K8KG 2LUHA 4TUMA 3JCKC 5BPPA 2WXLA 4I1AA 3FULA 1SZAA 5HRYA 4UI9C 2X6IA 1OUVA 2NC9A 4A1GA 4MRUA 4EZKA 3G2TA 4WNDA 3QWVA 4AIFA 2XGSA 3J5QB 1TNOA 3LXUX 4U8VD 5DIZA 2PNNA 4DPRA 4QQIA 3UKRG 3FU6A 1DCEA 3DSTA 3IHYA 2ZGDA 3PZ2A 4JD2G 3RRMB 3RKVA 4JL0A 5J90A 1JCQA 2OEVA 4JVSA 1Q2ZA 2DVWA 1HH8A 2J07A 5ENRD 1E7VA 1SZ9A 4EECA 4MBGA 3C98A 5EYPF 2A4ZA 2KXPC 2RFMA 3GW4A 3R7RA 4NIKA 4V3IA 4C0EA 4EQFA 2GW1A 4EBAA 4PDXA 3GYZA 3AG1E 3FHEA 2HM8A 4B89A 3AJIA 4RLYA 2KCVA 1JCSA 2WXJA 1OWLA 3G2VA 5FJYA 4AV7A 4LNUD 3MV3B 3DWLG 5EN5D 3EHRA 1IHGA 1DCQA 4HOUA 4XKBA 2QYUA 2JABA 3FEXA 3ZVVA 1IYGA 3Q47B 3FY4A 3BQOA 4LEUA 3FFLA 4AJWA 2LO6A 4BTAA 2P2CP 2P9SG 2V4LA 3ABME 2RFAA 4UWKA 3EU9A 3Q9UC 1MZCA 1OT8A 4GTVA 2IOLA 3SFXA 3ZHEB 3L13A 4AXHA 2QFCA 5G2NA 4DX5D 4GYWA 3AG2E 1TN7A 3UPVA 3BG0B 1D8DA 3Q49B 4ANUA 3MKQA 4LNGA 4UQXA 5ANRA 3EHQA 5FWQA 3KD7A 2L0IA 2V5FA 2WXHA 2WVIA 4AY5A 5KJKA 1ELRA 4KBQA 4K5BA 2RKKA 2KCLA 2PM6A 4CCAA 5FQ7A 3VTXA 2ZU6B 1TNZA 3B13A 3Q4AB 3DSUA 1PY1A 4O6FA 4FA6A 2XS1A 4CDNA 4GPMA 1YA0A 3ZHEA 4N5QA 3OAWA 4TUUA 2EIKE 1HS6A 5AYWD 4L9PA 4I9CA 4WNGA 1KT1A 3FUJA 3MKQB 2YHCA 3FH8A 2XCCA 3S2AA 2MHKA 3L17A 4AM9A 2FO7A 3CHSA 4FHJA 4BY6A 3RRNB 4BETA 5FTPA 4UWHA 2YNQA 3UM1A 2I2OA 1NZNA 4XI0A 1N4SA 4GAAA 1BI7B 4GMRA 2AXUA 3ESKA 4KVMA 3T8KA 2F8YA 2AVPA 3K9IA 4A1SA 1MQSA 5KNGA 2XZTG 4C48B 3T9KA 4UUCA 5EX3A 3ASHA 4XX5A 1QNFA 2R03A 3SFYA 1H2VC 4EZJA 4O60A 4JXTA 3ESLA 4DX6D 5AJLA 5ENPD 3LKUA 2F0YA 1SVXA 3ONLA 5LX8A 3FTUA 1TYQG 1UN8A 3SZ7A 4Q94A 3DRAA 3D9MA 2L6BA 4APFA 4Z68A 3PVLA 1NA3A 4CYMD 2FO1E 4BX9A 4I6GA 4GTSA 2YINA 3LY9A 2XGMA 4OAVB 5ENOD 3GZSA 3IV0A 3KS2A 4U0UA 1IKND 3I4GA 1TN6A 3FH5A 3FUDA 3L9TA 4TXRA 3UX4A 4I6EA 1IQRA 5FZRA 4G24A 3LJNA 3FEYA 3UQ3A 4JHRA 2WMNA 3PE4A 4G25A 3EHNA 3C72A 2R17C 1U3DA 4U7EB 3DSXA 5HKPA 1HO8A 2LAHA 4N2SA 4EHMA 1HG5A 2V5QC 2HO1A 4YDYA 2IY0C 4GPKA 3IHVA 1B89A 3HDXA 2C0LA 3DSWA 4GYYA 3OTNA 3SY2A 1OWMA 2P9UG 3AG3E 2XPZA 4XI9A 4A3TA 2WXQA 3EIJA 2R02A 4C9BB 3L82A 2CHXA 4FULA 2V4HC 4LERA 3CVNA 3CHOA 3PNTB 2FBNA 4U04A 3Q15A 2H6GA 3DPYA 5CBOA 2ZISA 4B0ZA 2WXIA 2Y69E 3D9NA 5BV1A 2Y1LE 2R05A
chains in the Genus database with same CATH topology
2AWIA 4JHJA 5C1DA 2CFZA 3ML8A 3JQ1A 5KJNA 3B7TA 3SHFA 4XKCA 4YNDA 2I6HA 3BEEA 4G11A 4GMJA 3ZW3A 4L2YA 2GRMA 4N3BA 4UI9C 2EQXA 1FVFA 3MKRA 1HFAA 2X6IA 1OUVA 3VTYA 2NC9A 5FQ8A 4A1GA 3PS6A 4MRUA 4XIFA 4EZKA 1HZ4A 4J6IA 3G2TA 4F1SA 3FWVA 4WNDA 3LS8A 2BF0X 4ME2A 2XRYA 3EDTB 3QKYA 1X5BA 4JA7A 1UG3A 4HORA 3CLJA 3ZYLA 3QWVA 2IQCA 4I1OB 4AIFA 4CDRA 2V0PA 2XGSA 4FHKA 2JEKA 4P29A 3LXUX 2LSVA 4DI3A 1PAQA 4YVOA 1UN9A 2VGXA 5DIZA 3ASFA 4DPRA 3SI5A 3FU6A 4GCOA 1EPUA 4J8FA 4JW1A 4APOA 1UW4B 3IHYA 3ASGA 4OVUA 3DBSA 3QK0A 4Y6CA 3TG4A 4GU5A 1QZ2A 3RRMB 3QC1A 4N3CA 3QAQA 3FDHA 4BT9A 4ILGA 5T8IA 2HR2A 2IU1A 3RKVA 4JL0A 2M63A 3FTWA 3URZA 3P2BA 5J90A 1HU3A 2VJ8A 3D9JA 5BNWA 5J08A 3RK6A 3LCAA 3TXMA 3G2UA 4PS7A 2J4BA 2CHWA 4JVSA 2J4DA 3PE3A 4I1MA 1H2TC 1HH8A 3LYAA 3MCXA 3L08A 1A17A 2J07A 4NURA 2DBAA 3OXLA 3FU5A 4UWLA 3VLEA 1E7VA 2LAIA 1SZ9A 4EECA 2AXVA 2VSXE 3C98A 5ENNA 4K03A 2VGYA 5FQ4A 3BG1B 4N5CA 3U64A 5EDSA 2A4ZA 1SQMA 1TJFA 3UT8A 3PEUB 2LSUA 4C0MA 3GW4A 3R7RA 4V3IA 3APFA 4C0EA 3SGHA 4EQFA 1H2UA 4BX8A 4HLEA 2GW1A 2X6KA 4EBAA 2UWJG 4PDXA 2J08A 2WXPA 3SBSA 1H0AA 3GYZA 2CG2A 4FJYA 5KJLA 3CQGB 3FHEA 4LCTA 2HM8A 4B89A 2KCVA 2X6FA 4DJAA 3FU0A 2RD0A 2WXJA 1OWLA 3G2VA 4KVOA 1S0PA 4CT4A 5FJYA 2E0IA 3U66A 4AV7A 3QOUA 4F7AA 3FUIA 3MV3B 4HOSA 4L1BA 2KATA 2WXMA 4HVBA 2L0TB 1IHGA 1L5JA 3PDNA 2Y3AA 3ZPJA 2CFUA 5AJDA 4HOUA 3ZN3A 4FC8A 4PUCA 4JHKA 3CVQA 2I9CA 4XKBA 3CSFA 3OXGA 4ACKA 4WNFA 3FEXA 2Y4UA 4K0RA 4L2LA 3CK9A 3ZVVA 1IYGA 3MGBA 1Z3XA 3UT7A 1NA0A 3Q47B 1BPOA 2WQHA 4IYPA 3LVQE 3FY4A 1WAO1 2RG8A 4YVQC 1ZU2A 4IULA 3CGHA 2FI7A 4LEUA 3FFLA 2DIWA 2WPVA 4J8EA 4AJWA 2AXZA 3D9LA 4H7YA 3L54A 3ZIMA 4ANVA 4AVXA 2C0MA 2LO6A 4BTAA 4AY6A 1WY6A 5M72A 2FEZA 2V4LA 4AOFA 4UWKA 3CVLA 4Q96A 1JPLA 3ONKA 5JHAA 3UMVA 4NQ0A 2IOLA 3ZHEB 4Q69A 3L13A 3L22A 2IOSA 4AXHA 2VSYA 4BTBA 5HQ8A 3D9IA 2QFCA 3ZGQA 5G2NA 3CQCB 3ML9A 3B7RL 5C2YA 4GYWA 5EKQD 1QQEA 3MZLB 3UPVA 1HF8A 3BG0B 3MYVA 3Q49B 2VSOE 1E96B 3D3MA 3NQPA 4ANUA 4M3OA 3MKQA 5BW8C 4UQXA 5ANRA 5EX0A 4EPZA 5FWQA 3KD7A 2L0IA 4FP7A 1WM5A 2V5FA 2WXHA 2WVIA 5FQ6A 4AY5A 2PM7A 5A23A 1E8WA 5KJKA 4DLOA 1ELRA 4LRZA 4KZ0A 1ELWA 2KC7A 4KBQA 1UJJA 5HI7A 4AP2A 1H19A 1Y6IA 2KCLA 2PM6A 1N52A 4UQZA 3SF4A 3D9KA 3QDNA 4CCAA 5FQ7A 2Q7FA 3VTXA 5LP0A 2XCBA 3QJZA 4I43A 4GA2A 4PH4B 3L6AA 1JUQA 2ZU6B 3QWWA 4J8DA 4H7XA 2KZTB 3B13A 4MS6A 2I1JA 3FTSA 3Q4AB 3RO2A 1E8ZA 4KYOB 1ZBPA 4I6JA 1PY1A 4I17A 4O6FA 1OWNA 4FA6A 5JJ6A 4GZDA 3AS5A 4CDNA 4BFRA 3ASDA 4GZ5A 4B8AA 1YA0A 3ZHEA 2IFUA 3Q5MA 3LY8A 4URKA 4U0SA 3OAWA 2XGOA 2CG3A 2IJGX 1HS6A 3CKBA 2PL2A 1UJKA 4TUUA 4DK5A 3CVWA 5AYWD 4UWFA 4DI4A 4JEHA 2XEVA 4I2ZA 1KT0A 3CVPA 3NZUA 4I9CA 4WNGA 1KT1A 2J09A 3FUJA 3G2SA 4N3AA 5G55A 3MKQB 3IKOB 4N2QA 2R5SA 2I1KA 4EBAG 3GZ1A 4E85A 2YHCA 2VYIA 3MJWA 3PZDA 3FH8A 3QNKA 3TL5A 4WNEA 3CVVA 2CHZA 2XCCA 5FT9A 3S2AA 2MHKA 3L17A 5ARGA 4AM9A 2FO7A 3CHSA 4FHJA 1Y8MA 5ANLA 2KM4A 4BY6A 3T5VA 3RRNB 3IEGA 1E8YA 4I2WA 1LF8A 5FTPA 3APCA 2WXKA 4UI9K 4UWHA 3FTVA 4NACA 5AENA 4JA9A 2YNQA 3T5XA 5G05C 3TGOA 5D0QD 3ULQA 2I2OA 5DBKA 1NZNA 3PREA 2E2EA 4FJZA 4XI0A 4G2VA 5D0OD 3TXNA 4GAAA 5JJ7A 3I5PA 5E76A 2KZTA 4ACLA 2R59A 3PUJA 4FLBA 2PQNA 3S7FA 5KCMA 4PS3A 3O48A 2AXUA 4ANXA 3ESKA 3CIAA 4KVMA 4LUNU 2XPYA 1HG2A 2AVPA 5LCWJ 3K9IA 4ANWA 2OV8A 3SFZA 2X38A 4A1SA 3JYSA 4I9EA 5BV0A 1MQSA 1MHQA 5E75A 4ILIA 2GRLA 2P58C 5EX3A 4AEZC 3ASHA 3FUHA 3GZ2A 1QNFA 4IRUA 4XX5A 2C2LA 3VLDA 4PS8A 1H2VC 4E6HA 3KEZA 2LNIA 4EZJA 4CGWA 3RRUA 4TV3A 2X6JA 4FU3A 4WWPA 1HXIA 4JXTA 2XRZA 3ESLA 1E7UA 5AJLA 1XNFA 3AS8A 4HXIA 1TEZA 3D9PA 3R9AB 3VLFA 4HFGA 3LKUA 3CVUA 1NP7A 3JUIA 3MX3A 2BUGA 5FZQA 3ZFWA 3WXXA 3ONLA 5LX8A 3FTUA 4XE0A 4IN3B 1H6KA 3AS4A 1UN8A 3SZ7A 3EIQC 3LDZA 4Q94A 5FZSA 2WXGA 3PH0C 4CRWA 2UY1A 4CGVA 3D9MA 3LJ3A 4APFA 4HOQA 4FADA 3DPDA 3MEKA 3PVLA 3RO3A 4A55A 5T3RA 3SD5A 3CHMA 1NA3A 1P5QA 2IF4A 4GB9A 4BX9A 1Z6TA 4ILHB 5A6CA 5G04J 3I4RB 3CKCA 1OWPA 4I6GA 4J8SA 4BT8A 3N71A 2YINA 3FUFA 3LY9A 1VDYA 2ILRA 2XGMA 2XHEA 4G26A 3ZYMA 1E90A 3CSTA 3FTYA 3FULA 3LPZA 4HS2A 3GZSA 3IV0A 3CHRA 3AU5A 3KS2A 3CK8A 3QARA 1DVPA 2WXOA 4U0UA 1INZA 1TJCA 1PC2A 3ZYQA 3FUMA 5G05J 3I4GA 4KT6B 3CHQA 2VSNA 3FH5A 3FUDA 4GZ3A 4R7LA 5LOZA 1GW6A 4GCNA 4CDMA 2KCKA 4W9RA 2OVFA 4GA1A 1FCHA 4U8HA 1HX8A 3S7BA 5BUZA 3P1UA 3UX4A 4I6EA 1IQRA 2FF4A 3FTZA 5FZRA 4ABNA 2J9QA 3APDA 3HHMA 1Z3YA 2X3MA 2WM9A 3CV0A 3FH7A 3FEYA 4G24A 1W3BA 4G23A 5G04C 4WAFA 2J49A 5KJMA 5JJTA 5CHEE 3UQ3A 4JHRA 2WMNA 1FVHA 2A5UA 2WB2A 2GGFA 3FUEA 4N39A 2XPIA 3PE4A 3RJVA 3AU4A 3HVEB 2MOWA 2WXNA 4G25A 2VTBA 3E4BA 3EHNA 3KAEA 3CVXA 4GA0A 3FP3A 2R17C 2XQ0A 2OOEA 4DLQA 5BT1A 5CMYA 2L9BA 2UY1B 1U3DA 4MLPA 3TG5A 4FLHA 3ZEFA 3PUKA 3S7DA 1HO8A 2LAHA 4UWGA 2PZIA 3S7JA 4N2SA 4EZLA 4KXKB 2MRIA 1HG5A 3ENEA 3I3NA 4CEMA 3CVYA 3CHPA 3FUKA 3SBTB 5T4YA 3OXFA 2HO1A 4QFVA 3SNXA 2WMOA 4GMLA 3MV2B 4B94A 2VQ2A 3TAXA 3L16A 3ZYKA 4GPKA 1IQUA 3QB2A 4WUYA 3FTXA 3JQ0A 5JHBA 2WXRA 3IHVA 4U0ZA 4GYOA 4U07A 1ELKA 1B89A 3HDXA 3PNLB 5CCLA 2V8SE 4RG9A 1DNPA 3PEVB 4B8CB 4D10C 2C0LA 4GYYA 4TRQA 3LEWA 3R7QA 3OTNA 3FUNA 4CT0A 1OWMA 1JWFA 1JWGA 5CMWA 1EYHA 4WWOA 1XGWA 1OWOA 4ATGA 3UT4A 3ZXSA 4J0UA 4JPSA 2XPZA 5LCWC 4XI9A 2OVBA 5CCMA 3RU0A 3HIZA 4JC8A 4A3TA 2WXQA 2WQ7A 4MKTA 3ZRHA 2PQRA 1EDUA 3G2WA 3NZSA 2Y4TA 3HVEA 3HYMB 3LY7A 1E8XA 4GZCA 4XZ4A 2VTBB 3B7SA 3CR3A 3EIJA 4WWNA 4OVVA 4C9BB 3UUXA 3O4ZA 3NF1A 2CHXA 4KMOA 2DCPA 3TJPA 2NXPA 4U63A 4A3VA 4BWRA 4F3VA 4FULA 3RIBA 2BTDA 5AIJA 2L6JA 2WQ6A 2AW6A 2NSZA 3U4TA 4JZYA 2IONA 2JLBA 2YHEA 3B7UX 3PRZA 1KLXA 4KZCA 5LFAA 1EF1C 3MA5A 3CEQA 4LERA 4OYSA 3CVNA 3CHOA 4L7TA 2WXFA 4BSXA 3FU3A 4Y6WA 3PNTB 2HYZA 5ARFA 4HOTA 2FBNA 5A7DB 2VGXB 2X6HA 4U04A 3LVRE 3CK7A 3Q15A 1U3CA 1HE8A 3T8MA 3U3WA 2FULA 1N54A 4JEUA 2ONDA 4G1TA 4L23A 2YQ8A 4RVBA 4UQYA 2QY7A 4UI9J 4RG6A 3QWPA 4NRHB 4GZ6A 4B0ZA 2WXIA 3D9NA 4RSYA 3U9WA 4F53A 5BV1A 3JCKC 5BPPA 2WXLA 4I1AA 3EJNA 3EHMA 3D9OA 3IBEA 1SZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHJ A;  4JHK A;  3FEY A;  4GML A;  3JUI A;  4GMJ A;  4B8A A;  2IOL A;  1PAQ A;  3FEX A;  2GGF A;  2IOS A;  1H2T C;  2HM8 A;  4B89 A;  1H6K A;  2FUL A;  1N54 A;  1UW4 B;  1N52 A;  3EIQ C;  3EIJ A;  4CT4 A;  4B8C B;  4CRW A;  4C9B B;  2RG8 A;  1H2V C;  2I2O A;  2VSX E;  4IUL A;  3L6A A;  2ZU6 B;  2KZT A;  2KZT B;  2VSO E;  3D3M A;  1UG3 A;  2IU1 A;  2NSZ A;  2ION A;  5ANR A;  1HU3 A;  4CEM A;  1H2U A;  3RK6 A;  4LUN U; 
#chains in the Genus database with same CATH topology
 2CFZ A;  3JQ1 A;  5KJN A;  2I6H A;  3ZW3 A;  4G11 A;  4GMJ A;  2GRM A;  4N3B A;  3MKR A;  1HFA A;  2GRQ B;  1YMP A;  4F1S A;  1MX2 A;  3EDT B;  4JA7 A;  2EIJ E;  4FHK A;  2HE0 A;  3ZNG A;  2LXL A;  1PAQ A;  2F8X K;  2ZXW E;  3ASG A;  4OVU A;  3TG4 A;  3V2O A;  4N3C A;  3FDH A;  3D9H A;  5AN8 A;  2IU1 A;  2M63 A;  1MX4 A;  1HU3 A;  3ZU7 B;  4BSZ B;  5AAR A;  3TXM A;  4PS7 A;  2J4D A;  2P9N G;  4K5A B;  3MCX A;  1N0R A;  5FQ4 A;  1TJF A;  3PEU B;  1NL4 A;  2LSU A;  4C0M A;  2ETA A;  3APF A;  3SGH A;  1H2U A;  3UKU G;  2UWJ G;  2J08 A;  4HI8 A;  4HRL A;  2X6F A;  3FU0 A;  1S0P A;  2E0I A;  3QOU A;  4HOS A;  3E30 A;  4HVB A;  4DX1 A;  3PDN A;  3ZN3 A;  4PUC A;  3CVQ A;  3V2X A;  2I9C A;  3DXK G;  4ACK A;  4G8L A;  3MGB A;  1Z3X A;  1NA0 A;  4YVQ C;  2RG8 A;  4ATZ D;  1ZU2 A;  4IUL A;  3CGH A;  4J8E A;  2F37 A;  3ASN E;  5M72 A;  2GRO B;  2FEZ A;  3ONK A;  1N0Q A;  4Q69 A;  3L22 A;  4BTB A;  3ZGQ A;  3CQC B;  3ML9 A;  1N9A A;  1HF8 A;  3TWU A;  3D3M A;  5BW8 C;  5EX0 A;  1WM5 A;  3TWT A;  5FQ6 A;  2PM7 A;  4AP2 A;  3D9K A;  2Q7F A;  4GA2 A;  2XZD G;  3L6A A;  3PZ4 A;  4H7X A;  2KZT B;  2I1J A;  3RO2 A;  1E8Z A;  1ZBP A;  5JJ6 A;  1AWC B;  3AS5 A;  4HRN A;  4B8A A;  2IFU A;  3LY8 A;  3TWX A;  4DK5 A;  2GRN B;  2PL2 A;  1UJK A;  4JEH A;  2XEV A;  1KT0 A;  1V55 E;  3NZU A;  3R9M A;  3G2S A;  3KSL A;  5G55 A;  2R5S A;  2VGE A;  4E85 A;  2VYI A;  3PZD A;  3QNK A;  5D2M C;  3CVV A;  3NOG D;  4JB8 P;  2CHZ A;  3JXJ A;  5FT9 A;  3AAA C;  3T5V A;  1Y8M A;  3E37 A;  2KM4 A;  2WXK A;  4TXQ A;  4NAC A;  5AEN A;  4JA9 A;  3T5X A;  5DBK A;  4FJZ A;  4G2V A;  5E76 A;  2KZT A;  4ACL A;  3PUJ A;  2PQN A;  4BER A;  3CIA A;  5LCW J;  3DXM G;  3Q73 A;  1BD8 A;  2OV8 A;  2X38 A;  4F6R D;  5KBA A;  5E75 A;  2P58 C;  3FUH A;  3GZ2 A;  4PS8 A;  4K5C A;  3KEZ A;  4CGW A;  1TNB A;  4FU3 A;  2BED A;  1HXI A;  2XRZ A;  2NYJ A;  3BU8 A;  1XNF A;  3CVU A;  5FZQ A;  3ZXP A;  3Q79 A;  4XE0 A;  4IN3 B;  3C5R A;  3EIQ C;  3LDZ A;  4U95 D;  2H6F A;  3E33 A;  5T3R A;  3SD5 A;  1RW2 A;  1Z6T A;  2QZA A;  3FUF A;  3ZYM A;  1E90 A;  4HS2 A;  3AU5 A;  3CK8 A;  1DVP A;  2WXO A;  1PC2 A;  3FUM A;  2DZN A;  4R7L A;  4GCN A;  2OVF A;  2QC9 A;  2FF4 A;  3FTZ A;  2J9Q A;  3HHM A;  2X3M A;  3UUX A;  5G04 C;  5KJM A;  4GTO A;  3RJV A;  2ZGG A;  3AU4 A;  3HVE B;  2VTB A;  3FP3 A;  2OOE A;  5CMY A;  5FIN A;  1QYM A;  2MRI A;  3ENE A;  3I3N A;  3CVY A;  1MJ0 A;  1A5E A;  3SNX A;  4F1P A;  4B94 A;  2VQ2 A;  1ZB1 A;  3UIP C;  4WUY A;  5CCL A;  4RG9 A;  4B8C B;  4D10 C;  3LEW A;  3FUN A;  1JWF A;  3KSQ A;  1JWG A;  4HRM B;  1OCR E;  3AG4 E;  1OWO A;  4ATG A;  4HQD A;  3HXF A;  3UT4 A;  3EU5 A;  4YDO A;  2BKG A;  2R2L A;  2OVB A;  4JC8 A;  3HG0 D;  1TN8 A;  3HVE A;  2VTB B;  2GRR B;  4WWN A;  5B1B E;  3UIO C;  2DCP A;  3TJP A;  5AIJ A;  4F3V A;  3RIB A;  2NSZ A;  2YHE A;  4HI9 A;  1OXJ A;  1KLX A;  4KZC A;  4OYS A;  4BSX A;  3FU3 A;  4Y6W A;  3UTM A;  4HOT A;  5A7D B;  2X6H A;  3LVR E;  1U3C A;  3DEP A;  2OND A;  2YQ8 A;  2QY7 A;  2LXM A;  4GZ6 A;  4RSY A;  4DX7 D;  4F53 A;  2DYS E;  3EJN A;  3EHM A;  4UWL A;  3IBE A;  3B7T A;  3ZKJ A;  4YND A;  3BEE A;  1O5M A;  4L2Y A;  3PS6 A;  4XIF A;  3FWV A;  1UG3 A;  4HOR A;  3ZYL A;  3RAU A;  4I1O B;  1UOH A;  1X81 A;  4CDR A;  3UM0 A;  4O1P A;  1N95 A;  2LSV A;  5EIL A;  4DI3 A;  1UN9 A;  2VGX A;  3ASF A;  5CEA A;  4GCO A;  1EPU A;  4JW1 A;  4APO A;  4G8K A;  1UW4 B;  3DBS A;  3QK0 A;  3QAQ A;  4ILG A;  2HR2 A;  3FTW A;  4J8Y A;  2VJ8 A;  3D9J A;  5J08 A;  3RK6 A;  3LCA A;  3G2U A;  3UI2 A;  3SO8 A;  2CHW A;  2GRP B;  3PE3 A;  4I1M A;  1S64 A;  3L08 A;  1A17 A;  3VLE A;  2DBA A;  1NFI E;  1MYO A;  2BKK B;  2VGY A;  3BG1 B;  4N5C A;  5EDS A;  4ZFH A;  5IY5 E;  3C3O A;  4BX8 A;  2WXP A;  1H0A A;  4DJA A;  1V54 E;  4KVO A;  4CT4 A;  3U66 A;  2A5E A;  3FUI A;  4M7C A;  1WG0 A;  4L1B A;  2KAT A;  1YCS B;  2IO3 C;  1L5J A;  2Y3A A;  3ZPJ A;  5KWD A;  5AJD A;  4JHK A;  3ABL E;  1S70 B;  3UM3 A;  4WNF A;  4L2L A;  3CK9 A;  5KNH D;  3UT7 A;  1O1S A;  1KPS B;  3LVQ E;  1N94 A;  2WPV A;  4ANV A;  4AVX A;  2C0M A;  3CVL A;  1JPL A;  5JHA A;  4RQI A;  1YYH A;  3C3R A;  2IOS A;  1FT1 A;  3J5P A;  2OCC E;  3HRA A;  3X2Q E;  3MYV A;  5CED B;  3NQP A;  4M3O A;  1K1B A;  2P9K G;  3Q78 A;  5A23 A;  1E8W A;  4DLO A;  2KC7 A;  4GTM A;  5HI7 A;  4UQZ A;  3SF4 A;  5AQ7 A;  5LP0 A;  3QJZ A;  4PH4 B;  5JA4 D;  3QWW A;  4J8D A;  4MS6 A;  3FTS A;  3HXE A;  4I6J A;  1S63 A;  4GZD A;  1H6O A;  3ASD A;  4URK A;  4U0S A;  5H7P A;  3ABK E;  2IJG X;  2ETB A;  3CKB A;  3TWW A;  4BEP A;  1KZP A;  4DI4 A;  3CVP A;  2J09 A;  1D8E A;  2I1K A;  4EBA G;  3GZ1 A;  3MJW A;  4GTP A;  3TL5 A;  2EIN E;  5ARG A;  5ANL A;  3V30 A;  3IEG A;  1E8Y A;  4I2W A;  3FTV A;  5D0Q D;  3ULQ A;  2DYR E;  5D0O D;  3TXN A;  5JJ7 A;  3I5P A;  2R59 A;  2J8S D;  3SFZ A;  4I9E A;  5BV0 A;  5B3S E;  4ILI A;  4X8Q A;  4E6H A;  3RRU A;  4TV3 A;  2AJA A;  2X6J A;  2ETC A;  4WWP A;  1U2V G;  4DUI A;  1FT2 A;  3AS8 A;  4HXI A;  1TEZ A;  3D9P A;  1O1T A;  3Q9N C;  1NP7 A;  3MX3 A;  2BUG A;  3ZFW A;  3WXX A;  1NI1 A;  3NOC D;  2WXG A;  3PH0 C;  1N4Q A;  2UY1 A;  4CGV A;  3DPD A;  3W9F A;  3RO3 A;  4A55 A;  3ISM C;  3CHM A;  2IF4 A;  2DWZ A;  5A6C A;  4ILH B;  1FPP A;  1IXV A;  3I4R B;  3CKC A;  3NB2 A;  1OWP A;  4J8S A;  4BT8 A;  4LG6 A;  2ILR A;  4G26 A;  3FTY A;  3LPZ A;  1INZ A;  3CHR A;  2B0O E;  4KT6 B;  4GZ3 A;  4GTR A;  2KCK A;  4W9R A;  2XEN A;  4GA1 A;  3S7B A;  3P1U A;  4ABN A;  3APD A;  1Z3Y A;  3CV0 A;  4G23 A;  4WAF A;  5JJT A;  2WB2 A;  1FVH A;  2A5U A;  1KZO A;  4N39 A;  2MOW A;  2WXN A;  3ASO E;  3E4B A;  3KAE A;  3CVX A;  2XQ0 A;  5BT1 A;  2L9B A;  2UY1 B;  4MLP A;  4FLH A;  3PUK A;  3S7D A;  3S7J A;  3W9G A;  3B7B A;  4EZL A;  4KXK B;  4CEM A;  3CHP A;  3FUK A;  3OXF A;  4QFV A;  1G3N B;  1TNY A;  3EUV A;  3L16 A;  3ZYK A;  1IQU A;  3QB2 A;  5CEC B;  5EYL A;  3JQ0 A;  4BES A;  2WXR A;  1ELK A;  2V8S E;  3V79 K;  3PEV B;  1K1A A;  3DEO A;  5CMW A;  1EYH A;  1O1R A;  1XGW A;  4CZ2 D;  4JPS A;  5CCM A;  3HIZ A;  2WQ7 A;  4MKT A;  3ZRH A;  2PQR A;  5CBN A;  3NZS A;  2Y4T A;  3HYM B;  4GZC A;  3B7S A;  3CR3 A;  3UIN C;  2ZIR A;  4HBD A;  3JXI A;  3RSE G;  4KMO A;  1OCZ E;  3NAW A;  2L6J A;  2AW6 A;  3U4T A;  2JLB A;  3B7U X;  5LFA A;  1EF1 C;  3MA5 A;  3JUE A;  1QBQ A;  1TR4 A;  2VGX B;  3CK7 A;  3U3W A;  1N54 A;  4JEU A;  1WDY A;  4RVB A;  4HLL A;  4UI9 J;  3QWP A;  4NRH B;  3IXE A;  3HXC A;  4DX2 A;  3U9W A;  3D9O A;  1LD7 A;  4LUN U;  2AWI A;  4JHJ A;  5C1D A;  3ML8 A;  1TNU A;  3SHF A;  4XKC A;  1H6P A;  3HXB A;  2EQX A;  5HS0 A;  1FVF A;  3VTY A;  5FQ8 A;  1HZ4 A;  4J6I A;  2DZO A;  3LS8 A;  2BF0 X;  4ME2 A;  2XRY A;  3ULY A;  3QKY A;  1X5B A;  3CLJ A;  2IQC A;  4HNA D;  5ITZ F;  2V0P A;  2JEK A;  4P29 A;  4O1O A;  3DSV A;  4YVO A;  3SI5 A;  1BI8 B;  4J8F A;  4U96 D;  5BXU A;  1Z5S C;  4Y6C A;  4GU5 A;  1QZ2 A;  3QC1 A;  5D66 A;  4BT9 A;  5T8I A;  5JMN D;  3URZ A;  3P2B A;  1SA5 A;  1D9S A;  1SA4 A;  5BNW A;  3HXD A;  2J4B A;  3F6Q A;  2B6C A;  1H2T C;  3LYA A;  4NUR A;  4J7W A;  3OXL A;  3FU5 A;  2LAI A;  3UM2 A;  2H6H A;  2AXV A;  2VSX E;  5ENN A;  4K03 A;  5B1A E;  1N11 A;  3U64 A;  1SQM A;  3UT8 A;  4U8Y D;  3BUA A;  4HLE A;  4ZHB A;  2X6K A;  1IHB A;  2EIM E;  3SBS A;  2CG2 A;  4FJY A;  5KJL A;  3CQG B;  4LCT A;  2RD0 A;  4F7A A;  1OCO E;  5ENT D;  5ENS D;  2WXM A;  2L0T B;  2CFU A;  2QYJ A;  4FC8 A;  3CSF A;  3OXG A;  3ZUV B;  2Y4U A;  4K0R A;  1BPO A;  2WQH A;  4IYP A;  1WAO 1;  2FI7 A;  2DIW A;  2AXZ A;  3D9L A;  4H7Y A;  3L54 A;  3ZIM A;  4AY6 A;  1WY6 A;  4AOF A;  4Q96 A;  3UMV A;  4NQ0 A;  3TWQ A;  2VSY A;  5HQ8 A;  3D9I A;  3B7R L;  5C2Y A;  5EKQ D;  2MYO A;  1QQE A;  3MZL B;  2XS8 A;  2IO2 C;  2XEE A;  2H6I A;  2VSO E;  1E96 B;  1SW6 A;  4EPZ A;  4FP7 A;  4HB5 A;  5CRV A;  3SQV A;  4LRZ A;  4B93 B;  4KZ0 A;  1ELW A;  4YDW A;  1UJJ A;  1H19 A;  1Y6I A;  3KEA A;  2KBX A;  1N52 A;  3QDN A;  2XCB A;  4I43 A;  1JUQ A;  1N4P A;  4KYO B;  4I17 A;  1OWN A;  3DSS A;  4BFR A;  4GZ5 A;  2P9P G;  3Q5M A;  2XGO A;  2CG3 A;  3CVW A;  4UWF A;  5FIO A;  4I2Z A;  4N3A A;  3IKO B;  4N2Q A;  4WNE A;  3ULE G;  3NBN B;  3E32 A;  1LF8 A;  4GTT A;  3APC A;  4UI9 K;  3TGO A;  5G05 C;  3PRE A;  2E2E A;  4FLB A;  3S7F A;  5KCM A;  1K3Z D;  4PS3 A;  3O48 A;  1BLX B;  4ANX A;  2XPY A;  1HG2 A;  4ANW A;  3JYS A;  1MHQ A;  2GRL A;  4AEZ C;  2XEH A;  4LNB A;  4IRU A;  3VLD A;  2C2L A;  2LNI A;  1E7U A;  1RZ4 A;  5AQA A;  3R9A B;  3VLF A;  4HFG A;  3JUI A;  4GTQ A;  4TXP A;  1H6K A;  3AS4 A;  4XEI G;  3Q75 A;  3B95 A;  5FZS A;  4CRW A;  3LJ3 A;  4FAD A;  4HOQ A;  3PZ3 A;  4YDE A;  3MEK A;  1LTX A;  1P5Q A;  1BU9 A;  4GB9 A;  5G04 J;  2P9L G;  3N71 A;  1VDY A;  5EIB E;  2XHE A;  2IEJ A;  3CST A;  3QAR A;  5EID A;  1TJC A;  3ZYQ A;  5G05 J;  3CHQ A;  2VSN A;  5LOZ A;  3PZ1 A;  1GW6 A;  4CDM A;  4DRX E;  1FCH A;  4U8H A;  1HX8 A;  3TWR A;  5BUZ A;  1N4R A;  4L23 A;  3FH7 A;  2WM9 A;  1W3B A;  2J49 A;  5CHE E;  2GGF A;  3FUE A;  1JCR A;  2XPI A;  2Y0B G;  5AAO A;  2EIL E;  4GA0 A;  4A63 B;  2P9I G;  4DLQ A;  5ENQ D;  3TG5 A;  3ZEF A;  4UWG A;  2PZI A;  3C3Q A;  3SBT B;  5T4Y A;  5CER B;  2WMO A;  1OY3 D;  4GML A;  3MV2 B;  5CRU A;  3TAX A;  1DC2 A;  3FTX A;  5JHB A;  4U0Z A;  4GYO A;  3E34 A;  4U07 A;  3PNL B;  5BXO A;  5AQ9 A;  1DNP A;  5AQB A;  4TRQ A;  4CT0 A;  3R7Q A;  4WWO A;  3UXG A;  3V31 A;  3ZXS A;  4J0U A;  5LCW C;  3RU0 A;  4OAU C;  3TWS A;  1EDU A;  1OCC E;  3G2W A;  3LY7 A;  1E8X A;  4XZ4 A;  2OEW A;  1MX6 A;  4OVV A;  4LSZ E;  3O4Z A;  3NF1 A;  4BWR A;  2NXP A;  4U63 A;  4A3V A;  2WQ6 A;  2BTD A;  1AP7 A;  4JZY A;  2ION A;  3PRZ A;  3CEQ A;  4L7T A;  2WXF A;  2HYZ A;  5ARF A;  3Q7A A;  1HE8 A;  3T8M A;  2FUL A;  3Q7F A;  4G1T A;  4UQY A;  3WG7 E;  1LD8 A;  3TWV A;  4RG6 A;  1K8K G;  2LUH A;  4TUM A;  3JCK C;  5BPP A;  2WXL A;  4I1A A;  3FUL A;  1SZA A;  5HRY A;  4UI9 C;  2X6I A;  1OUV A;  2NC9 A;  4A1G A;  4MRU A;  4EZK A;  3G2T A;  4WND A;  3QWV A;  4AIF A;  2XGS A;  3J5Q B;  1TNO A;  3LXU X;  4U8V D;  5DIZ A;  2PNN A;  4DPR A;  4QQI A;  3UKR G;  3FU6 A;  1DCE A;  3DST A;  3IHY A;  2ZGD A;  3PZ2 A;  4JD2 G;  3RRM B;  3RKV A;  4JL0 A;  5J90 A;  1JCQ A;  2OEV A;  4JVS A;  1Q2Z A;  2DVW A;  1HH8 A;  2J07 A;  5ENR D;  1E7V A;  1SZ9 A;  4EEC A;  4MBG A;  3C98 A;  5EYP F;  2A4Z A;  2KXP C;  2RFM A;  3GW4 A;  3R7R A;  4NIK A;  4V3I A;  4C0E A;  4EQF A;  2GW1 A;  4EBA A;  4PDX A;  3GYZ A;  3AG1 E;  3FHE A;  2HM8 A;  4B89 A;  3AJI A;  4RLY A;  2KCV A;  1JCS A;  2WXJ A;  1OWL A;  3G2V A;  5FJY A;  4AV7 A;  4LNU D;  3MV3 B;  3DWL G;  5EN5 D;  3EHR A;  1IHG A;  1DCQ A;  4HOU A;  4XKB A;  2QYU A;  2JAB A;  3FEX A;  3ZVV A;  1IYG A;  3Q47 B;  3FY4 A;  3BQO A;  4LEU A;  3FFL A;  4AJW A;  2LO6 A;  4BTA A;  2P2C P;  2P9S G;  2V4L A;  3ABM E;  2RFA A;  4UWK A;  3EU9 A;  3Q9U C;  1MZC A;  1OT8 A;  4GTV A;  2IOL A;  3SFX A;  3ZHE B;  3L13 A;  4AXH A;  2QFC A;  5G2N A;  4DX5 D;  4GYW A;  3AG2 E;  1TN7 A;  3UPV A;  3BG0 B;  1D8D A;  3Q49 B;  4ANU A;  3MKQ A;  4LNG A;  4UQX A;  5ANR A;  3EHQ A;  5FWQ A;  3KD7 A;  2L0I A;  2V5F A;  2WXH A;  2WVI A;  4AY5 A;  5KJK A;  1ELR A;  4KBQ A;  4K5B A;  2RKK A;  2KCL A;  2PM6 A;  4CCA A;  5FQ7 A;  3VTX A;  2ZU6 B;  1TNZ A;  3B13 A;  3Q4A B;  3DSU A;  1PY1 A;  4O6F A;  4FA6 A;  2XS1 A;  4CDN A;  4GPM A;  1YA0 A;  3ZHE A;  4N5Q A;  3OAW A;  4TUU A;  2EIK E;  1HS6 A;  5AYW D;  4L9P A;  4I9C A;  4WNG A;  1KT1 A;  3FUJ A;  3MKQ B;  2YHC A;  3FH8 A;  2XCC A;  3S2A A;  2MHK A;  3L17 A;  4AM9 A;  2FO7 A;  3CHS A;  4FHJ A;  4BY6 A;  3RRN B;  4BET A;  5FTP A;  4UWH A;  2YNQ A;  3UM1 A;  2I2O A;  1NZN A;  4XI0 A;  1N4S A;  4GAA A;  1BI7 B;  4GMR A;  2AXU A;  3ESK A;  4KVM A;  3T8K A;  2F8Y A;  2AVP A;  3K9I A;  4A1S A;  1MQS A;  5KNG A;  2XZT G;  4C48 B;  3T9K A;  4UUC A;  5EX3 A;  3ASH A;  4XX5 A;  1QNF A;  2R03 A;  3SFY A;  1H2V C;  4EZJ A;  4O60 A;  4JXT A;  3ESL A;  4DX6 D;  5AJL A;  5ENP D;  3LKU A;  2F0Y A;  1SVX A;  3ONL A;  5LX8 A;  3FTU A;  1TYQ G;  1UN8 A;  3SZ7 A;  4Q94 A;  3DRA A;  3D9M A;  2L6B A;  4APF A;  4Z68 A;  3PVL A;  1NA3 A;  4CYM D;  2FO1 E;  4BX9 A;  4I6G A;  4GTS A;  2YIN A;  3LY9 A;  2XGM A;  4OAV B;  5ENO D;  3GZS A;  3IV0 A;  3KS2 A;  4U0U A;  1IKN D;  3I4G A;  1TN6 A;  3FH5 A;  3FUD A;  3L9T A;  4TXR A;  3UX4 A;  4I6E A;  1IQR A;  5FZR A;  4G24 A;  3LJN A;  3FEY A;  3UQ3 A;  4JHR A;  2WMN A;  3PE4 A;  4G25 A;  3EHN A;  3C72 A;  2R17 C;  1U3D A;  4U7E B;  3DSX A;  5HKP A;  1HO8 A;  2LAH A;  4N2S A;  4EHM A;  1HG5 A;  2V5Q C;  2HO1 A;  4YDY A;  2IY0 C;  4GPK A;  3IHV A;  1B89 A;  3HDX A;  2C0L A;  3DSW A;  4GYY A;  3OTN A;  3SY2 A;  1OWM A;  2P9U G;  3AG3 E;  2XPZ A;  4XI9 A;  4A3T A;  2WXQ A;  3EIJ A;  2R02 A;  4C9B B;  3L82 A;  2CHX A;  4FUL A;  2V4H C;  4LER A;  3CVN A;  3CHO A;  3PNT B;  2FBN A;  4U04 A;  3Q15 A;  2H6G A;  3DPY A;  5CBO A;  2ZIS A;  4B0Z A;  2WXI A;  2Y69 E;  3D9N A;  5BV1 A;  2Y1L E;  2R05 A; 
#chains in the Genus database with same CATH homology
 2AWI A;  4JHJ A;  5C1D A;  2CFZ A;  3ML8 A;  3JQ1 A;  5KJN A;  3B7T A;  3SHF A;  4XKC A;  4YND A;  2I6H A;  3BEE A;  4G11 A;  4GMJ A;  3ZW3 A;  4L2Y A;  2GRM A;  4N3B A;  4UI9 C;  2EQX A;  1FVF A;  3MKR A;  1HFA A;  2X6I A;  1OUV A;  3VTY A;  2NC9 A;  5FQ8 A;  4A1G A;  3PS6 A;  4MRU A;  4XIF A;  4EZK A;  1HZ4 A;  4J6I A;  3G2T A;  4F1S A;  3FWV A;  4WND A;  3LS8 A;  2BF0 X;  4ME2 A;  2XRY A;  3EDT B;  3QKY A;  1X5B A;  4JA7 A;  1UG3 A;  4HOR A;  3CLJ A;  3ZYL A;  3QWV A;  2IQC A;  4I1O B;  4AIF A;  4CDR A;  2V0P A;  2XGS A;  4FHK A;  2JEK A;  4P29 A;  3LXU X;  2LSV A;  4DI3 A;  1PAQ A;  4YVO A;  1UN9 A;  2VGX A;  5DIZ A;  3ASF A;  4DPR A;  3SI5 A;  3FU6 A;  4GCO A;  1EPU A;  4J8F A;  4JW1 A;  4APO A;  1UW4 B;  3IHY A;  3ASG A;  4OVU A;  3DBS A;  3QK0 A;  4Y6C A;  3TG4 A;  4GU5 A;  1QZ2 A;  3RRM B;  3QC1 A;  4N3C A;  3QAQ A;  3FDH A;  4BT9 A;  4ILG A;  5T8I A;  2HR2 A;  2IU1 A;  3RKV A;  4JL0 A;  2M63 A;  3FTW A;  3URZ A;  3P2B A;  5J90 A;  1HU3 A;  2VJ8 A;  3D9J A;  5BNW A;  5J08 A;  3RK6 A;  3LCA A;  3TXM A;  3G2U A;  4PS7 A;  2J4B A;  2CHW A;  4JVS A;  2J4D A;  3PE3 A;  4I1M A;  1H2T C;  1HH8 A;  3LYA A;  3MCX A;  3L08 A;  1A17 A;  2J07 A;  4NUR A;  2DBA A;  3OXL A;  3FU5 A;  4UWL A;  3VLE A;  1E7V A;  2LAI A;  1SZ9 A;  4EEC A;  2AXV A;  2VSX E;  3C98 A;  5ENN A;  4K03 A;  2VGY A;  5FQ4 A;  3BG1 B;  4N5C A;  3U64 A;  5EDS A;  2A4Z A;  1SQM A;  1TJF A;  3UT8 A;  3PEU B;  2LSU A;  4C0M A;  3GW4 A;  3R7R A;  4V3I A;  3APF A;  4C0E A;  3SGH A;  4EQF A;  1H2U A;  4BX8 A;  4HLE A;  2GW1 A;  2X6K A;  4EBA A;  2UWJ G;  4PDX A;  2J08 A;  2WXP A;  3SBS A;  1H0A A;  3GYZ A;  2CG2 A;  4FJY A;  5KJL A;  3CQG B;  3FHE A;  4LCT A;  2HM8 A;  4B89 A;  2KCV A;  2X6F A;  4DJA A;  3FU0 A;  2RD0 A;  2WXJ A;  1OWL A;  3G2V A;  4KVO A;  1S0P A;  4CT4 A;  5FJY A;  2E0I A;  3U66 A;  4AV7 A;  3QOU A;  4F7A A;  3FUI A;  3MV3 B;  4HOS A;  4L1B A;  2KAT A;  2WXM A;  4HVB A;  2L0T B;  1IHG A;  1L5J A;  3PDN A;  2Y3A A;  3ZPJ A;  2CFU A;  5AJD A;  4HOU A;  3ZN3 A;  4FC8 A;  4PUC A;  4JHK A;  3CVQ A;  2I9C A;  4XKB A;  3CSF A;  3OXG A;  4ACK A;  4WNF A;  3FEX A;  2Y4U A;  4K0R A;  4L2L A;  3CK9 A;  3ZVV A;  1IYG A;  3MGB A;  1Z3X A;  3UT7 A;  1NA0 A;  3Q47 B;  1BPO A;  2WQH A;  4IYP A;  3LVQ E;  3FY4 A;  1WAO 1;  2RG8 A;  4YVQ C;  1ZU2 A;  4IUL A;  3CGH A;  2FI7 A;  4LEU A;  3FFL A;  2DIW A;  2WPV A;  4J8E A;  4AJW A;  2AXZ A;  3D9L A;  4H7Y A;  3L54 A;  3ZIM A;  4ANV A;  4AVX A;  2C0M A;  2LO6 A;  4BTA A;  4AY6 A;  1WY6 A;  5M72 A;  2FEZ A;  2V4L A;  4AOF A;  4UWK A;  3CVL A;  4Q96 A;  1JPL A;  3ONK A;  5JHA A;  3UMV A;  4NQ0 A;  2IOL A;  3ZHE B;  4Q69 A;  3L13 A;  3L22 A;  2IOS A;  4AXH A;  2VSY A;  4BTB A;  5HQ8 A;  3D9I A;  2QFC A;  3ZGQ A;  5G2N A;  3CQC B;  3ML9 A;  3B7R L;  5C2Y A;  4GYW A;  5EKQ D;  1QQE A;  3MZL B;  3UPV A;  1HF8 A;  3BG0 B;  3MYV A;  3Q49 B;  2VSO E;  1E96 B;  3D3M A;  3NQP A;  4ANU A;  4M3O A;  3MKQ A;  5BW8 C;  4UQX A;  5ANR A;  5EX0 A;  4EPZ A;  5FWQ A;  3KD7 A;  2L0I A;  4FP7 A;  1WM5 A;  2V5F A;  2WXH A;  2WVI A;  5FQ6 A;  4AY5 A;  2PM7 A;  5A23 A;  1E8W A;  5KJK A;  4DLO A;  1ELR A;  4LRZ A;  4KZ0 A;  1ELW A;  2KC7 A;  4KBQ A;  1UJJ A;  5HI7 A;  4AP2 A;  1H19 A;  1Y6I A;  2KCL A;  2PM6 A;  1N52 A;  4UQZ A;  3SF4 A;  3D9K A;  3QDN A;  4CCA A;  5FQ7 A;  2Q7F A;  3VTX A;  5LP0 A;  2XCB A;  3QJZ A;  4I43 A;  4GA2 A;  4PH4 B;  3L6A A;  1JUQ A;  2ZU6 B;  3QWW A;  4J8D A;  4H7X A;  2KZT B;  3B13 A;  4MS6 A;  2I1J A;  3FTS A;  3Q4A B;  3RO2 A;  1E8Z A;  4KYO B;  1ZBP A;  4I6J A;  1PY1 A;  4I17 A;  4O6F A;  1OWN A;  4FA6 A;  5JJ6 A;  4GZD A;  3AS5 A;  4CDN A;  4BFR A;  3ASD A;  4GZ5 A;  4B8A A;  1YA0 A;  3ZHE A;  2IFU A;  3Q5M A;  3LY8 A;  4URK A;  4U0S A;  3OAW A;  2XGO A;  2CG3 A;  2IJG X;  1HS6 A;  3CKB A;  2PL2 A;  1UJK A;  4TUU A;  4DK5 A;  3CVW A;  5AYW D;  4UWF A;  4DI4 A;  4JEH A;  2XEV A;  4I2Z A;  1KT0 A;  3CVP A;  3NZU A;  4I9C A;  4WNG A;  1KT1 A;  2J09 A;  3FUJ A;  3G2S A;  4N3A A;  5G55 A;  3MKQ B;  3IKO B;  4N2Q A;  2R5S A;  2I1K A;  4EBA G;  3GZ1 A;  4E85 A;  2YHC A;  2VYI A;  3MJW A;  3PZD A;  3FH8 A;  3QNK A;  3TL5 A;  4WNE A;  3CVV A;  2CHZ A;  2XCC A;  5FT9 A;  3S2A A;  2MHK A;  3L17 A;  5ARG A;  4AM9 A;  2FO7 A;  3CHS A;  4FHJ A;  1Y8M A;  5ANL A;  2KM4 A;  4BY6 A;  3T5V A;  3RRN B;  3IEG A;  1E8Y A;  4I2W A;  1LF8 A;  5FTP A;  3APC A;  2WXK A;  4UI9 K;  4UWH A;  3FTV A;  4NAC A;  5AEN A;  4JA9 A;  2YNQ A;  3T5X A;  5G05 C;  3TGO A;  5D0Q D;  3ULQ A;  2I2O A;  5DBK A;  1NZN A;  3PRE A;  2E2E A;  4FJZ A;  4XI0 A;  4G2V A;  5D0O D;  3TXN A;  4GAA A;  5JJ7 A;  3I5P A;  5E76 A;  2KZT A;  4ACL A;  2R59 A;  3PUJ A;  4FLB A;  2PQN A;  3S7F A;  5KCM A;  4PS3 A;  3O48 A;  2AXU A;  4ANX A;  3ESK A;  3CIA A;  4KVM A;  4LUN U;  2XPY A;  1HG2 A;  2AVP A;  5LCW J;  3K9I A;  4ANW A;  2OV8 A;  3SFZ A;  2X38 A;  4A1S A;  3JYS A;  4I9E A;  5BV0 A;  1MQS A;  1MHQ A;  5E75 A;  4ILI A;  2GRL A;  2P58 C;  5EX3 A;  4AEZ C;  3ASH A;  3FUH A;  3GZ2 A;  1QNF A;  4IRU A;  4XX5 A;  2C2L A;  3VLD A;  4PS8 A;  1H2V C;  4E6H A;  3KEZ A;  2LNI A;  4EZJ A;  4CGW A;  3RRU A;  4TV3 A;  2X6J A;  4FU3 A;  4WWP A;  1HXI A;  4JXT A;  2XRZ A;  3ESL A;  1E7U A;  5AJL A;  1XNF A;  3AS8 A;  4HXI A;  1TEZ A;  3D9P A;  3R9A B;  3VLF A;  4HFG A;  3LKU A;  3CVU A;  1NP7 A;  3JUI A;  3MX3 A;  2BUG A;  5FZQ A;  3ZFW A;  3WXX A;  3ONL A;  5LX8 A;  3FTU A;  4XE0 A;  4IN3 B;  1H6K A;  3AS4 A;  1UN8 A;  3SZ7 A;  3EIQ C;  3LDZ A;  4Q94 A;  5FZS A;  2WXG A;  3PH0 C;  4CRW A;  2UY1 A;  4CGV A;  3D9M A;  3LJ3 A;  4APF A;  4HOQ A;  4FAD A;  3DPD A;  3MEK A;  3PVL A;  3RO3 A;  4A55 A;  5T3R A;  3SD5 A;  3CHM A;  1NA3 A;  1P5Q A;  2IF4 A;  4GB9 A;  4BX9 A;  1Z6T A;  4ILH B;  5A6C A;  5G04 J;  3I4R B;  3CKC A;  1OWP A;  4I6G A;  4J8S A;  4BT8 A;  3N71 A;  2YIN A;  3FUF A;  3LY9 A;  1VDY A;  2ILR A;  2XGM A;  2XHE A;  4G26 A;  3ZYM A;  1E90 A;  3CST A;  3FTY A;  3FUL A;  3LPZ A;  4HS2 A;  3GZS A;  3IV0 A;  3CHR A;  3AU5 A;  3KS2 A;  3CK8 A;  3QAR A;  1DVP A;  2WXO A;  4U0U A;  1INZ A;  1TJC A;  1PC2 A;  3ZYQ A;  3FUM A;  5G05 J;  3I4G A;  4KT6 B;  3CHQ A;  2VSN A;  3FH5 A;  3FUD A;  4GZ3 A;  4R7L A;  5LOZ A;  1GW6 A;  4GCN A;  4CDM A;  2KCK A;  4W9R A;  2OVF A;  4GA1 A;  1FCH A;  4U8H A;  1HX8 A;  3S7B A;  5BUZ A;  3P1U A;  3UX4 A;  4I6E A;  1IQR A;  2FF4 A;  3FTZ A;  5FZR A;  4ABN A;  2J9Q A;  3APD A;  3HHM A;  1Z3Y A;  2X3M A;  2WM9 A;  3CV0 A;  3FH7 A;  3FEY A;  4G24 A;  1W3B A;  4G23 A;  5G04 C;  4WAF A;  2J49 A;  5KJM A;  5JJT A;  5CHE E;  3UQ3 A;  4JHR A;  2WMN A;  1FVH A;  2A5U A;  2WB2 A;  2GGF A;  3FUE A;  4N39 A;  2XPI A;  3PE4 A;  3RJV A;  3AU4 A;  3HVE B;  2MOW A;  2WXN A;  4G25 A;  2VTB A;  3E4B A;  3EHN A;  3KAE A;  3CVX A;  4GA0 A;  3FP3 A;  2R17 C;  2XQ0 A;  2OOE A;  4DLQ A;  5BT1 A;  5CMY A;  2L9B A;  2UY1 B;  1U3D A;  4MLP A;  3TG5 A;  4FLH A;  3ZEF A;  3PUK A;  3S7D A;  1HO8 A;  2LAH A;  4UWG A;  2PZI A;  3S7J A;  4N2S A;  4EZL A;  4KXK B;  2MRI A;  1HG5 A;  3ENE A;  3I3N A;  4CEM A;  3CVY A;  3CHP A;  3FUK A;  3SBT B;  5T4Y A;  3OXF A;  2HO1 A;  4QFV A;  3SNX A;  2WMO A;  4GML A;  3MV2 B;  4B94 A;  2VQ2 A;  3TAX A;  3L16 A;  3ZYK A;  4GPK A;  1IQU A;  3QB2 A;  4WUY A;  3FTX A;  3JQ0 A;  5JHB A;  2WXR A;  3IHV A;  4U0Z A;  4GYO A;  4U07 A;  1ELK A;  1B89 A;  3HDX A;  3PNL B;  5CCL A;  2V8S E;  4RG9 A;  1DNP A;  3PEV B;  4B8C B;  4D10 C;  2C0L A;  4GYY A;  4TRQ A;  3LEW A;  3R7Q A;  3OTN A;  3FUN A;  4CT0 A;  1OWM A;  1JWF A;  1JWG A;  5CMW A;  1EYH A;  4WWO A;  1XGW A;  1OWO A;  4ATG A;  3UT4 A;  3ZXS A;  4J0U A;  4JPS A;  2XPZ A;  5LCW C;  4XI9 A;  2OVB A;  5CCM A;  3RU0 A;  3HIZ A;  4JC8 A;  4A3T A;  2WXQ A;  2WQ7 A;  4MKT A;  3ZRH A;  2PQR A;  1EDU A;  3G2W A;  3NZS A;  2Y4T A;  3HVE A;  3HYM B;  3LY7 A;  1E8X A;  4GZC A;  4XZ4 A;  2VTB B;  3B7S A;  3CR3 A;  3EIJ A;  4WWN A;  4OVV A;  4C9B B;  3UUX A;  3O4Z A;  3NF1 A;  2CHX A;  4KMO A;  2DCP A;  3TJP A;  2NXP A;  4U63 A;  4A3V A;  4BWR A;  4F3V A;  4FUL A;  3RIB A;  2BTD A;  5AIJ A;  2L6J A;  2WQ6 A;  2AW6 A;  2NSZ A;  3U4T A;  4JZY A;  2ION A;  2JLB A;  2YHE A;  3B7U X;  3PRZ A;  1KLX A;  4KZC A;  5LFA A;  1EF1 C;  3MA5 A;  3CEQ A;  4LER A;  4OYS A;  3CVN A;  3CHO A;  4L7T A;  2WXF A;  4BSX A;  3FU3 A;  4Y6W A;  3PNT B;  2HYZ A;  5ARF A;  4HOT A;  2FBN A;  5A7D B;  2VGX B;  2X6H A;  4U04 A;  3LVR E;  3CK7 A;  3Q15 A;  1U3C A;  1HE8 A;  3T8M A;  3U3W A;  2FUL A;  1N54 A;  4JEU A;  2OND A;  4G1T A;  4L23 A;  2YQ8 A;  4RVB A;  4UQY A;  2QY7 A;  4UI9 J;  4RG6 A;  3QWP A;  4NRH B;  4GZ6 A;  4B0Z A;  2WXI A;  3D9N A;  4RSY A;  3U9W A;  4F53 A;  5BV1 A;  3JCK C;  5BPP A;  2WXL A;  4I1A A;  3EJN A;  3EHM A;  3D9O A;  3IBE A;  1SZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...