2IOSA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form 3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
124
Chain Sequence
PVNHLVKEIDMLLKEYLLSGDISEAEHLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antitumor protein
molecule keywords Programmed Cell Death 4, Pdcd4
publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 124
sequence length 126
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iosA00
1HU3A 3L6AA 1UW4B 3JUIA 4B89A 2VSXE 2IONA 2RG8A 2FULA 1N52A 4GMJA 4IULA 2GGFA 4LUNU 1H2UA 2VSOE 4GMLA 4B8AA 2HM8A 2NSZA 3D3MA 2IOLA 1H2VC 1PAQA 2KZTA 4C9BB 1UG3A 3FEXA 2ZU6B 2KZTB 4B8CB 4CT4A 1H6KA 2IU1A 1H2TC 4JHKA 3RK6A 3EIQC 1N54A 4JHJA 4CEMA 4CRWA 2IOSA 3EIJA 5ANRA 2I2OA 3FEYA
chains in the Genus database with same CATH superfamily
2P9UG 2FEZA 2EIME 2MYOA 1MJ0A 3PZDA 4DUIA 4XE0A 3ZYQA 1TN7A 4I1MA 4N2SA 3PZ1A 1HH8A 2FBNA 1PY1A 5J08A 2EQXA 4UI9J 3B7SA 2YQ8A 3L54A 5T8IA 3APCA 1TNZA 2GRQB 4YDYA 4E85A 5ITZF 4IN3B 1FT1A 4WWPA 2IJGX 3D3MA 5AENA 4APFA 3ZXPA 3LY8A 4U95D 1XGWA 2V5FA 2XQ0A 2B0OE 4NRHB 1O1SA 5JJ7A 4HB5A 3T8MA 3ABME 3CHSA 1UN8A 5ENOD 4GYYA 5DIZA 5BUZA 4WWNA 3O4ZA 3UM3A 3QARA 3CLJA 4PDXA 3UT7A 1RZ4A 4ANVA 4GTTA 2AXVA 3EHRA 1E90A 3CVWA 3CVXA 1P5QA 2CG3A 2R03A 5EDSA 3CIAA 2F37A 2MHKA 2XEHA 4EPZA 3T5VA 2X6KA 3G2TA 3DBSA 4H7XA 3LXUX 2VGXA 4LNUD 3NF1A 5JHBA 2XCBA 5AQAA 3QWPA 4GMLA 4D10C 4GTMA 4GTRA 2RFAA 4A55A 3T9KA 4EZKA 4CEMA 3LYAA 4GTSA 4UI9K 4BTBA 4RVBA 1YCSB 1FCHA 5AIJA 2V5QC 1E8ZA 3L9TA 2GRMA 4A63B 4DX6D 3CVYA 3BEEA 1NP7A 3EIQC 3SFXA 3ZYKA 2HR2A 3APDA 4PS8A 4N2QA 2IO3C 3LPZA 4PH4B 3AG3E 3FUMA 2E0IA 1LTXA 3L17A 4G8KA 4U96D 3APFA 4K5CA 3LS8A 4PS3A 4HORA 2L6JA 3CQCB 2WXIA 4UWLA 4HXIA 4YDWA 4ZHBA 4KBQA 5E76A 4IULA 1A5EA 3ASNE 1HXIA 5HKPA 2LUHA 2NC9A 5ENPD 3SI5A 2J08A 2GRPB 1H6KA 4FU3A 1U2VG 3TWWA 1KT1A 5BXUA 1JCSA 2XZTG 2F8XK 4LCTA 3TAXA 2IY0C 4YVOA 2XGOA 3DPYA 4WAFA 1TNBA 2ETCA 4LEUA 5FZSA 3NOGD 4Y6WA 3D9JA 3FUKA 4WNEA 3D9HA 5G2NA 4HOSA 2OEWA 3RRNB 2P9IG 5G05J 1HE8A 2KCLA 3ZGQA 3NOCD 4I9CA 4APOA 1HU3A 3MEKA 3LVQE 2WMNA 1DCEA 3EDTB 3UM1A 3PNTB 4GCOA 2OOEA 3ZUVB 2R59A 3KEZA 3DSWA 4L2YA 1FVHA 4B8CB 3PUKA 2ZGDA 3E30A 3DEPA 3MYVA 2M63A 1HFAA 1N0QA 3ASFA 4ILIA 1SA4A 3DSTA 3FUIA 4JW1A 3E32A 3QAQA 3CHOA 1TJCA 4OAUC 4K03A 1BD8A 3DRAA 1FPPA 3UXGA 4U0UA 3UMVA 5KJLA 3BQOA 3L08A 1E7UA 2IO2C 4GYOA 4LERA 1HS6A 5EILA 3QK0A 4EHMA 2IOLA 3HYMB 2CFUA 2ETAA 4U0ZA 4ILGA 4FULA 4CT4A 2VGYA 3FY4A 2OCCE 2HE0A 1MHQA 2GRNB 2QY7A 4ANUA 1WAO1 3Q9NC 4Y6CA 4MLPA 3HG0D 2ZIRA 1YYHA 3VLFA 3JQ1A 3VLDA 4RQIA 4E6HA 3EUVA 3CKBA 3MCXA 2H6IA 2YNQA 1AP7A 2FO7A 1O5MA 4AM9A 4AV7A 3UKRG 1QNFA 1TR4A 1KLXA 4O6FA 3UTMA 3MA5A 4HOUA 4A3VA 1BU9A 2AXUA 5A6CA 4ZFHA 3ASDA 2P9NG 2HYZA 4CDMA 3FU0A 3PVLA 4LSZE 4GZ3A 3R9AB 1NFIE 3ZFWA 2DYRE 3TWUA 1OY3D 4DX2A 4ANWA 2OV8A 3GZ2A 3ABLE 1XNFA 3DPDA 2WXFA 3UI2A 4BEPA 4XX5A 5ARGA 3FEXA 3UT4A 4KZCA 4UWHA 3PZ3A 4K5BA 3JYSA 5CMYA 4CDRA 1LF8A 2KBXA 3EHQA 3ZU7B 1Z3XA 4EQFA 3S7DA 4GCNA 3BG0B 4ATZD 3SF4A 1QQEA 3IKOB 5KCMA 3E4BA 3NB2A 3U3WA 4JHKA 4NQ0A 3SQVA 4L23A 4YDEA 4J8FA 4N5CA 3OXFA 3V30A 1HF8A 3OXGA 5JJ6A 4BETA 1N52A 4UWFA 2VTBA 4N39A 1N4PA 3D9IA 5FTPA 3CSTA 1V54E 1EYHA 5KBAA 1UG3A 3UM0A 1Z5SC 3CEQA 4ILHB 3PEUB 1INZA 2VGEA 4GZ6A 1EDUA 2EINE 1PC2A 2AJAA 3VLEA 3MX3A 2ETBA 5CMWA 5ARFA 1AWCB 2X6HA 5H7PA 3CK8A 3I5PA 2C0LA 1E7VA 3LVRE 4GYWA 1QZ2A 5D2MC 1Z6TA 1TN8A 3LCAA 3SY2A 3LJNA 2WXGA 4JVSA 3K9IA 4U04A 5ENNA 2UWJG 2BUGA 5BNWA 4KZ0A 3FWVA 4YNDA 3LJ3A 1E8XA 1VDYA 3IBEA 4GPMA 4AY6A 2XEVA 3KEAA 3FP3A 2WXNA 5KWDA 2Y0BG 1OWNA 4JZYA 5ENQD 5CHEE 4DX5D 3FU5A 2X6IA 1JCRA 3ESLA 3D9MA 5CRVA 4JHJA 3IHYA 3ZPJA 1IHGA 5J90A 1QYMA 1SZ9A 2B6CA 2GGFA 1KT0A 3KSLA 1U3CA 1WM5A 4TXRA 4GTPA 5EKQD 3TG4A 2NXPA 3ENEA 3Q78A 4K5AB 3RAUA 4OVUA 3B7UX 2LXMA 3ZVVA 3RKVA 3MJWA 1E8WA 1SZAA 4TUUA 1SQMA 2VSOE 4HRLA 3N71A 4QQIA 3FUEA 2KZTA 4HI9A 3CVLA 5D66A 3MKRA 4B94A 4K0RA 2UY1B 4KT6B 3UX4A 1MZCA 4DX7D 4ACLA 4YVQC 4XKCA 3C5RA 4RSYA 4FJZA 4MRUA 4HRNA 3D9LA 3SFZA 3AAAC 4WNDA 4FLBA 2E2EA 2JABA 3CV0A 2XRZA 2BKKB 1S70B 1K1AA 1PAQA 2FI7A 3FUHA 4JHRA 4NIKA 4FA6A 3QKYA 3PDNA 5FQ7A 1DCQA 2WXRA 5CBOA 4U8VD 2ZU6B 4IYPA 3DXMG 4X8QA 3UIOC 4AOFA 5ANRA 4P29A 3L16A 3CK9A 4PS7A 2PQNA 4C0EA 2EIJE 1H2UA 4KXKB 2RFMA 4N3CA 5FWQA 2WVIA 1D8EA 3T5XA 3V79K 1S0PA 3ULYA 3JXJA 4J8SA 4HBDA 2CHZA 2QZAA 5C2YA 4C48B 3FEYA 4I1AA 3FTYA 1OCZE 3ZIMA 1V55E 2DZOA 2VYIA 1MX6A 3CHPA 5EIDA 1OUVA 4MS6A 2Y3AA 1HO8A 2MOWA 1TEZA 3DSSA 4J7WA 4UI9C 1OCRE 1N4SA 1OWOA 3SBTB 3NZUA 3TJPA 4C9BB 1MYOA 2VQ2A 2ZGGA 3B7RL 4BSZB 4QFVA 4GB9A 4BY6A 2LSVA 1OCCE 4TRQA 4GZ5A 1KZOA 4G2VA 5AYWD 3TWSA 2I6HA 5CEAA 3SFYA 3PNLB 3JUEA 3Q49B 5A23A 1NI1A 3QWWA 3RU0A 3E33A 4I17A 5T4YA 3KD7A 1E8YA 2Y1LE 2GRLA 2IF4A 3JCKC 2KC7A 4FADA 1OT8A 2QYJA 2VSXE 2A5EA 1ELRA 2RG8A 4LUNU 3JXIA 3GZ1A 1SVXA 3ZW3A 4A3TA 4TUMA 5BV0A 4I6GA 1N9AA 3C72A 4EBAA 4EZLA 4ACKA 2WQ6A 5KNGA 1L5JA 2R02A 1ELKA 5B3SE 2H6FA 4IRUA 3CVVA 2P58C 4GTQA 3ULEG 3W9GA 4AEZC 4ATGA 5CRUA 3RK6A 3Q4AB 1O1RA 5JJTA 4U63A 3ULQA 1JPLA 1IQUA 4DPRA 4F6RD 1X81A 4XKBA 4V3IA 3G2WA 3Q79A 3QDNA 4Z68A 5BV1A 1BPOA 4J8DA 4UWKA 4ANXA 5G04C 4F53A 3ML8A 4JA7A 3FTZA 1DC2A 1MQSA 2Y4TA 2YHEA 1TNUA 5LX8A 1W3BA 4GAAA 5KJMA 5ENSD 2R2LA 4DLOA 4BT8A 3NBNB 3T8KA 3PH0C 2ILRA 1FVFA 5C1DA 3LY7A 3B7BA 3EHNA 2LXLA 1G3NB 2GROB 3MKQB 4BESA 3CQGB 2KATA 3PEVB 1OXJA 1NL4A 1SA5A 2YHCA 2J07A 2L0IA 3HVEB 4LNGA 3FTSA 4GA1A 4C0MA 2P9KG 2H6GA 1N94A 3IHVA 2BF0X 1HZ4A 2IONA 4URKA 1UOHA 3FH5A 4JEHA 3S2AA 3EJNA 2Q7FA 5AJDA 2NYJA 4GTVA 3ZHEB 1WY6A 3TL5A 3RJVA 3OXLA 2GRRB 2XGMA 1A17A 2BTDA 1WDYA 3TWQA 1EPUA 2VSNA 3U4TA 3PZ2A 3PREA 4G25A 1ZB1A 4Q94A 3L13A 3TWXA 4OAVB 3SHFA 4XZ4A 2Y4UA 3PS6A 3DSXA 5EYLA 2WXQA 3KAEA 4HNAD 4CYMD 5G05C 3ONKA 4F7AA 1BI7B 3FUNA 1TNYA 3P2BA 4WWOA 4JB8P 3AG1E 2AWIA 4G8LA 2CFZA 5FQ4A 3TXNA 4DI4A 5FIOA 2V4HC 2J8SD 2EILE 3ASOE 3JQ0A 3L82A 4U07A 4BFRA 4J0UA 3G2UA 3PZ4A 1TJFA 4WUYA 1Y6IA 3ZYLA 2J9QA 3P1UA 1Q2ZA 1KPSB 2WXPA 1OCOE 4ME2A 3FFLA 1DVPA 3MV2B 1X5BA 2P2CP 5FZQA 5HI7A 4BX9A 1Y8MA 3X2QE 3PRZA 3ZNGA 3FULA 3BG1B 4L7TA 3ZRHA 3CVPA 3LDZA 2IQCA 3CHRA 3Q7FA 1O1TA 4AVXA 4RG6A 5HQ8A 5IY5E 1HX8A 4BERA 3C98A 3AG2E 2P9LG 1N11A 2VGXB 3ABKE 4UQZA 4F1PA 2WPVA 5EX3A 2WMOA 4FHJA 3EU9A 2WXKA 2XEEA 3IXEA 4CCAA 4JL0A 3FTWA 1SW6A 3W9FA 5ANLA 1H19A 1H0AA 4JC8A 5AARA 3LEWA 4G11A 3AG4E 4KYOB 1H2VC 3D9PA 3V2OA 3SBSA 2X6FA 3B95A 5KJNA 2LSUA 2KXPC 3CK7A 4TV3A 3FU6A 5EYPF 2L0TB 2IFUA 5LP0A 4RG9A 3CVQA 2A4ZA 3MV3B 4H7YA 5LCWC 4HQDA 3UPVA 2FF4A 5LOZA 3PUJA 5HRYA 3J5PA 2IOSA 3VTYA 3D9KA 5FQ6A 4DJAA 4DK5A 3NAWA 4HS2A 5EX0A 3O48A 2WM9A 4J8YA 1GW6A 4GA0A 2C2LA 3ZN3A 3RRMB 2OVBA 2C0MA 2R17C 2DWZA 4YDOA 3CR3A 5FT9A 3LKUA 1DNPA 4U7EB 3E34A 1ELWA 3AS5A 4I9EA 5CEDB 4GPKA 1WG0A 3CVUA 2XS8A 4R7LA 2P9SG 1HG5A 2J09A 4AY5A 2I2OA 2XHEA 3DEOA 4UWGA 2WXHA 4U0SA 5E75A 3Q73A 2PL2A 1IYGA 3CGHA 4KVMA 4XIFA 2BKGA 3BU8A 1S63A 2ONDA 1E96B 4AP2A 2ZISA 4BSXA 4Q96A 1UJJA 3IV0A 2WXMA 4JXTA 1D9SA 3R7QA 3UM2A 1IHBA 1K3ZD 3TXMA 3V31A 2R5SA 4KVOA 3UQ3A 4CDNA 3Q7AA 4GZDA 5B1BE 1H2TC 3RSEG 4I6JA 4O60A 4FLHA 2XENA 3I4GA 3ONLA 3CHQA 3FH8A 2R05A 4I6EA 5BW8C 2AVPA 2QC9A 4CZ2D 4I2WA 4GMRA 4G26A 2XRYA 3MZLB 1N0RA 1ZU2A 2DZNA 2V4LA 3D9OA 4XEIG 2KCKA 1BI8B 1D8DA 3HDXA 5JHAA 1IXVA 4LRZA 3R7RA 2PZIA 4JA9A 4G24A 5JMND 1FT2A 4UUCA 2DCPA 2AW6A 5BPPA 1TNOA 3QJZA 4CRWA 5EN5D 3EIJA 3ML9A 5G04J 4HLEA 4DLQA 4DX1A 4BT9A 2PM6A 1OWLA 5AN8A 5M72A 3TG5A 2QYUA 5AQBA 4DRXE 4DI3A 3TWRA 2A5UA 2RD0A 2P9PG 3CVNA 4JD2G 2XPIA 3UKUG 3PE4A 4L2LA 2EIKE 3QNKA 2DBAA 3AU4A 3G2VA 5CBNA 4A1SA 3ASHA 4B0ZA 4LNBA 5FZRA 5KJKA 3SO8A 4A1GA 5CERB 3C3QA 1KZPA 2OVFA 3NQPA 5LFAA 3C3RA 3L6AA 3J5QB 2JLBA 2VSYA 3ZEFA 1YA0A 4GMJA 2BEDA 2OEVA 2V8SE 4BTAA 2X6JA 2DYSE 3E37A 2NSZA 1K8KG 5FQ8A 3LY9A 3DWLG 4EBAG 3CSFA 3ESKA 3DXKG 4FJYA 4UQYA 4G23A 3CKCA 3GW4A 3BUAA 4CGVA 4U8HA 1YMPA 2CHWA 4B93B 1U3DA 3VTXA 3HXEA 2Y69E 3G2SA 4HRMB 3SGHA 4BWRA 4NACA 3I4RB 4XI0A 5D0QD 1NA3A 2UY1A 4FHKA 2WXLA 5DBKA 3DSVA 2PM7A 3Q47B 3JUIA 5T3RA 2IEJA 3RO3A 2KM4A 5D0OD 2VTBB 4UQXA 4ABNA 3FUFA 2FO1E 5AQ7A 3TGOA 2IU1A 5B1AE 2JEKA 1TN6A 2WB2A 2WXOA 3GZSA 5FINA 2XS1A 3U66A 3HXFA 4I1OB 4I2ZA 3AS8A 2HO1A 3U64A 3Q15A 4KMOA 3B7TA 5AQ9A 3GYZA 5AAOA 5JA4D 2RKKA 3OTNA 5KNHD 1RW2A 5CCLA 2YINA 3OAWA 1JUQA 5HS0A 5BT1A 2LAIA 2AXZA 3L22A 4N5QA 4TXPA 4N3BA 2I9CA 3TWVA 1TYQG 2LNIA 3QOUA 1IKND 1LD7A 5FJYA 1NZNA 2J4BA 4RLYA 5A7DB 3MGBA 3FUJA 5ENTD 1NA0A 3HXDA 2PQRA 3QB2A 4U8YD 1ZBPA 1UN9A 4B89A 2FULA 1MX2A 4N3AA 4BX8A 2I1KA 3FU3A 1N4RA 1OWMA 4XI9A 3I3NA 1N54A 2PNNA 4M3OA 4GTOA 3B13A 3IEGA 1JWGA 4EZJA 4F3VA 3FTXA 5CECB 2LAHA 4O1PA 3ZXSA 2XPZA 2KCVA 4J8EA 2WXJA 1JCQA 5AJLA 3ISMC 3DSUA 1OWPA 4F1SA 2I1JA 2VJ8A 3Q9UC 4OYSA 5ENRD 3ZYMA 2V0PA 3C3OA 4HI8A 4B8AA 1S64A 1IQRA 4EECA 3KSQA 2DIWA 2KZTB 4OVVA 4L9PA 3U9WA 3SNXA 3AS4A 4GZCA 2CHXA 4FP7A 3UT8A 4HOTA 4GA2A 4J6IA 5LCWJ 3HIZA 3PE3A 3UIPC 3WG7E 2X3MA 3CHMA 3V2XA 4HLLA 1BLXB 4WNFA 2WQ7A 4PUCA 4Q69A 3Q5MA 5BXOA 4CGWA 3SD5A 4TXQA 1UJKA 4JPSA 3FH7A 3HXBA 4WNGA 4I43A 1K1BA 2XPYA 3S7BA 4G1TA 4L1BA 3FTUA 4AIFA 2CG2A 4O1OA 2L6BA 4M7CA 2LO6A 3NZSA 2MRIA 5EIBE 3EHMA 4MBGA 2L9BA 3ASGA 2ZXWE 1LD8A 4AJWA 3UUXA 2J49A 3QWVA 1MX4A 2XGSA 4GU5A 3S7FA 3KS2A 3R9MA 3FDHA 3RIBA 1JWFA 2XCCA 2DVWA 4MKTA 3HRAA 4HFGA 3D9NA 3WXXA 3AJIA 3Q75A 4LG6A 3FUDA 1EF1C 2XZDG 4NURA 1N95A 2H6HA 3SZ7A 3MKQA 4HVBA 3QC1A 3ZKJA 5CCMA 3TWTA 3FTVA 3RRUA 3RO2A 3AU5A 3HVEA 4HOQA 3FHEA 2GW1A 3URZA 3HHMA 4FC8A 2J4DA 1Z3YA 1H6OA 1HG2A 3F6QA 5G55A 2WQHA 1UW4B 3UINC 3S7JA 2X38A 1QBQA 2F8YA 4CT0A 2HM8A 3EU5A 1H6PA 4W9RA 2F0YA 4AXHA 4JEUA 2QFCA 3ZHEA 1B89A 3HXCA 1N4QA
chains in the Genus database with same CATH topology
5G04J 1W3BA 4GAAA 4HLEA 5KJMA 2FEZA 1LF8A 4DLQA 4DLOA 3PZDA 1Z3XA 4EQFA 3S7DA 4GCNA 4BT8A 4XE0A 3BG0B 3ZYQA 4BT9A 2PM6A 3PH0C 1OWLA 3SF4A 2ILRA 1QQEA 1FVFA 3IKOB 5C1DA 5KCMA 5M72A 3E4BA 3TG5A 4I1MA 3LY7A 4N2SA 3U3WA 4DI3A 4JHKA 1HH8A 2FBNA 3EHNA 4NQ0A 4L23A 2A5UA 1PY1A 2RD0A 3CVNA 4J8FA 4N5CA 3OXFA 5J08A 2XPIA 2EQXA 4UI9J 1HF8A 3B7SA 3MKQB 3CQGB 3OXGA 2YQ8A 3PE4A 3L54A 2KATA 3PEVB 4L2LA 5T8IA 5JJ6A 3QNKA 3APCA 2DBAA 1N52A 2YHCA 2J07A 3AU4A 4N39A 4UWFA 3G2VA 4E85A 2VTBA 4IN3B 3D9IA 5FTPA 3ASHA 4A1SA 4B0ZA 4WWPA 2IJGX 2L0IA 3D3MA 3CSTA 3HVEB 1EYHA 5AENA 1UG3A 5FZRA 4APFA 5KJKA 3LY8A 4A1GA 3FTSA 1XGWA 4GA1A 2V5FA 2XQ0A 4NRHB 4C0MA 2OVFA 3NQPA 5LFAA 5JJ7A 3CEQA 3L6AA 2JLBA 3PEUB 4ILHB 1INZA 3IHVA 2BF0X 1HZ4A 2IONA 2VSYA 3T8MA 1YA0A 4GZ6A 4GMJA 1EDUA 3ZEFA 4URKA 3CHSA 1PC2A 1UN8A 2V8SE 4GYYA 2X6JA 3VLEA 4BTAA 4CDRA 2NSZA 3FH5A 5FQ8A 3LY9A 4JEHA 5DIZA 3MX3A 3S2AA 5BUZA 4EBAG 3CSFA 3EJNA 5CMWA 3ESKA 2Q7FA 5ARFA 4FJYA 4UQYA 4WWNA 4G23A 3O4ZA 2X6HA 5AJDA 3CKCA 3GW4A 3ZHEB 3QARA 3CLJA 3CK8A 3I5PA 4PDXA 1WY6A 2C0LA 1E7VA 3LVRE 4GYWA 3RJVA 3TL5A 3OXLA 4U8HA 3UT7A 4CGVA 1QZ2A 4ANVA 2CHWA 2XGMA 1A17A 2AXVA 2BTDA 1Z6TA 3LCAA 1EPUA 2VSNA 1U3DA 3U4TA 3VTXA 3G2SA 3PREA 3SGHA 1E90A 2WXGA 4G25A 3CVWA 3CVXA 4JVSA 4Q94A 1P5QA 4BWRA 3L13A 2CG3A 5EDSA 3K9IA 3CIAA 4U04A 4NACA 5ENNA 2UWJG 2BUGA 5BNWA 3I4RB 4KZ0A 4XI0A 2MHKA 2Y4UA 3FWVA 4XZ4A 3PS6A 4YNDA 5D0QD 3SHFA 1NA3A 4EPZA 3T5VA 4HOTA 2X6KA 3G2TA 2UY1A 3LJ3A 1E8XA 2WXQA 3DBSA 3KAEA 1VDYA 4FHKA 3IBEA 4H7XA 5G05C 3LXUX 4AY6A 2WXLA 2VGXA 5DBKA 3NF1A 3ONKA 2PM7A 2XEVA 3JUIA 3FP3A 3Q47B 5T3RA 2WXNA 3RO3A 2KM4A 5JHBA 4F7AA 2XCBA 3FUNA 5D0OD 1OWNA 3P2BA 3QWPA 4JZYA 4WWOA 2VTBB 2AWIA 5CHEE 4GMLA 2CFZA 5FQ4A 3TXNA 4DI4A 4D10C 4UQXA 3FU5A 4ABNA 2X6IA 3FUFA 3ESLA 3D9MA 3TGOA 4A55A 2IU1A 2JEKA 4JHJA 4EZKA 2WB2A 4CEMA 2WXOA 3GZSA 3IHYA 3JQ0A 4U07A 4BFRA 3ZPJA 3LYAA 4J0UA 4UI9K 3U66A 3G2UA 4BTBA 4I1OB 1IHGA 4I2ZA 3AS8A 5J90A 1TJFA 1SZ9A 2HO1A 4RVBA 3U64A 1FCHA 3Q15A 4WUYA 5AIJA 1Y6IA 3ZYLA 2J9QA 2GGFA 3P1UA 4KMOA 1KT0A 1E8ZA 3B7TA 3GYZA 1U3CA 1WM5A 2GRMA 3CVYA 5EKQD 3BEEA 3OTNA 3TG4A 2NXPA 3ENEA 2WXPA 1NP7A 4ME2A 4OVUA 5CCLA 3EIQC 3B7UX 3FFLA 1DVPA 3MV2B 1X5BA 2HR2A 2YINA 5FZQA 5HI7A 3RKVA 3ZYKA 3ZVVA 3MJWA 1JUQA 3APDA 3OAWA 1Y8MA 4BX9A 3PRZA 1E8WA 4PS8A 5BT1A 2LAIA 3FULA 3BG1B 4N2QA 2AXZA 1SZAA 3L22A 4L7TA 4TUUA 3ZRHA 4N3BA 3LPZA 1SQMA 4PH4B 3CVPA 2I9CA 3LDZA 2VSOE 2IQCA 3N71A 3FUEA 2LNIA 3QOUA 3CHRA 3FUMA 2E0IA 5FJYA 1NZNA 2KZTA 2J4BA 3L17A 5A7DB 3CVLA 3MGBA 3APFA 3MKRA 4B94A 3FUJA 1NA0A 3LS8A 4K0RA 4PS3A 4HORA 2L6JA 4RG6A 2PQRA 4AVXA 2UY1B 3CQCB 4KT6B 5HQ8A 3UX4A 2WXIA 4UWLA 4HXIA 1HX8A 3C98A 3QB2A 1ZBPA 1UN9A 4YVQC 4ACLA 2VGXB 4B89A 4KBQA 2FULA 5E76A 4IULA 4XKCA 4UQZA 4RSYA 4N3AA 4BX8A 2I1KA 4FJZA 3FU3A 4MRUA 2WPVA 1HXIA 1OWMA 2NC9A 3D9LA 5EX3A 3SFZA 3SI5A 2WMOA 4XI9A 2J08A 3I3NA 4FHJA 4WNDA 1H6KA 4FLBA 1N54A 2E2EA 4M3OA 3CV0A 2XRZA 2WXKA 4FU3A 3B13A 3IEGA 1JWGA 4EZJA 4CCAA 1PAQA 2FI7A 4JL0A 3FTWA 5ANLA 1KT1A 4F3VA 3FTXA 3FUHA 4JHRA 4FA6A 3QKYA 4LCTA 3TAXA 1H19A 1H0AA 2LAHA 3PDNA 4JC8A 5FQ7A 3ZXSA 2XPZA 3LEWA 4G11A 4YVOA 2XGOA 2KCVA 2WXRA 4J8EA 4KYOB 2WXJA 1H2VC 4WAFA 3D9PA 3SBSA 2ZU6B 5AJLA 4LEUA 2X6FA 4IYPA 5FZSA 5KJNA 2LSUA 1OWPA 4AOFA 4F1SA 4Y6WA 3D9JA 3CK7A 4P29A 4TV3A 3L16A 5ANRA 3FUKA 3FU6A 3CK9A 4WNEA 2L0TB 4PS7A 2PQNA 2I1JA 2VJ8A 4C0EA 2IFUA 4OYSA 5LP0A 4RG9A 1H2UA 4KXKB 3ZYMA 2V0PA 5G2NA 3CVQA 4N3CA 5FWQA 4B8AA 4HOSA 1IQRA 4EECA 2WVIA 2A4ZA 3RRNB 5G05J 3MV3B 4H7YA 5LCWC 3UPVA 3T5XA 1HE8A 2DIWA 2FF4A 2KZTB 3PUJA 5LOZA 4OVVA 1S0PA 2KCLA 3ZGQA 3U9WA 4J8SA 2CHZA 2IOSA 3SNXA 3VTYA 3AS4A 4GZCA 4I9CA 5C2YA 4APOA 2CHXA 4FP7A 3FEYA 4I1AA 3FTYA 1HU3A 4GA2A 3MEKA 4J6IA 3HIZA 3UT8A 3PE3A 5LCWJ 2X3MA 3D9KA 3LVQE 3CHMA 3ZIMA 2WMNA 5FQ6A 4DJAA 4DK5A 3EDTB 3PNTB 4GCOA 2OOEA 4HS2A 5EX0A 4WNFA 2WQ7A 4PUCA 4Q69A 3O48A 2WM9A 1GW6A 2R59A 3KEZA 3Q5MA 4GA0A 2VYIA 4L2YA 1FVHA 2C2LA 4B8CB 3CHPA 3SD5A 4CGWA 1UJKA 3PUKA 3FH7A 4JPSA 3RRMB 1OUVA 3ZN3A 2OVBA 4MS6A 2C0MA 4WNGA 2R17C 4I43A 2Y3AA 1HO8A 2XPYA 3CR3A 3MYVA 5FT9A 2M63A 1HFAA 3LKUA 3S7BA 4G1TA 1DNPA 2MOWA 1TEZA 3ASFA 4L1BA 4ILIA 3FTUA 4AIFA 2CG2A 1ELWA 3AS5A 4I9EA 3ML9A 4UI9C 3FUIA 4JW1A 4GPKA 1OWOA 2LO6A 3NZSA 3SBTB 3CVUA 3NZUA 3TJPA 3QAQA 2MRIA 4C9BB 3CHOA 4R7LA 1TJCA 3EHMA 2VQ2A 3B7RL 1HG5A 4K03A 4QFVA 2J09A 4GB9A 4BY6A 2L9BA 4AY5A 4U0UA 2LSVA 3ASGA 2I2OA 3UMVA 5KJLA 2XHEA 4AJWA 4TRQA 3UUXA 4GZ5A 3L08A 1E7UA 4UWGA 2J49A 3QWVA 2WXHA 4G2VA 4GYOA 4LERA 4U0SA 5E75A 5AYWD 1HS6A 2I6HA 2XGSA 2PL2A 3QK0A 1IYGA 3CGHA 4KVMA 4XIFA 2IOLA 3HYMB 2CFUA 3PNLB 3KS2A 4GU5A 3S7FA 4U0ZA 3Q49B 4ILGA 5A23A 3QWWA 3FDHA 4FULA 4CT4A 2VGYA 3RIBA 3RU0A 3FY4A 1MHQA 1JWFA 2XCCA 4I17A 5T4YA 3KD7A 1E8YA 1E96B 2ONDA 4AP2A 2QY7A 4ANUA 1WAO1 2GRLA 4MKTA 2IF4A 4BSXA 4Q96A 3JCKC 1UJJA 3IV0A 2KC7A 4HFGA 3D9NA 4Y6CA 2WXMA 4MLPA 3WXXA 4FADA 4JXTA 2VSXE 1ELRA 2RG8A 3VLFA 3JQ1A 3R7QA 3VLDA 4LUNU 3GZ1A 4E6HA 3CKBA 3MCXA 3TXMA 3ZW3A 2YNQA 3FUDA 4A3TA 1EF1C 5BV0A 2FO7A 4I6GA 2R5SA 4KVOA 3UQ3A 4CDNA 4GZDA 4AM9A 4NURA 1H2TC 4AV7A 3SZ7A 1QNFA 3MKQA 4HVBA 1KLXA 4O6FA 4EBAA 3QC1A 3MA5A 4EZLA 4ACKA 4HOUA 2WQ6A 1L5JA 4A3VA 5CCMA 2AXUA 4I6JA 5A6CA 1ELKA 4FLHA 3FTVA 3RRUA 3I4GA 3ONLA 3ASDA 3CHQA 3RO2A 3AU5A 2HYZA 3HVEA 3FH8A 3FU0A 3PVLA 4IRUA 4CDMA 3CVVA 2P58C 4I6EA 4HOQA 4AEZC 4ATGA 3FHEA 2GW1A 5BW8C 2AVPA 3URZA 4GZ3A 3R9AB 3RK6A 3HHMA 3Q4AB 3ZFWA 5JJTA 4I2WA 4G26A 4FC8A 2XRYA 2J4DA 4U63A 3MZLB 3ULQA 1Z3YA 1JPLA 1IQUA 1HG2A 1ZU2A 5G55A 4ANWA 4DPRA 4XKBA 2WQHA 1UW4B 2V4LA 4V3IA 3D9OA 2KCKA 2OV8A 3G2WA 3GZ2A 3S7JA 2X38A 3QDNA 1XNFA 3HDXA 3DPDA 2WXFA 5BV1A 4CT0A 2HM8A 1BPOA 4LRZA 5JHAA 4J8DA 3R7RA 4UWKA 4ANXA 4W9RA 4XX5A 4AXHA 5ARGA 4JEUA 2PZIA 5G04C 4F53A 3FEXA 3ML8A 4JA7A 3UT4A 3FTZA 4JA9A 1MQSA 4G24A 2QFCA 2Y4TA 4KZCA 4UWHA 3ZHEA 5BPPA 2DCPA 2AW6A 1B89A 3QJZA 2YHEA 4CRWA 3EIJA 5LX8A 3JYSA 5CMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HU3 A;  3L6A A;  1UW4 B;  3JUI A;  4B89 A;  2VSX E;  2ION A;  2RG8 A;  2FUL A;  1N52 A;  4GMJ A;  4IUL A;  2GGF A;  4LUN U;  1H2U A;  2VSO E;  4GML A;  4B8A A;  2HM8 A;  2NSZ A;  3D3M A;  2IOL A;  1H2V C;  1PAQ A;  2KZT A;  4C9B B;  1UG3 A;  3FEX A;  2ZU6 B;  2KZT B;  4B8C B;  4CT4 A;  1H6K A;  2IU1 A;  1H2T C;  4JHK A;  3RK6 A;  3EIQ C;  1N54 A;  4JHJ A;  4CEM A;  4CRW A;  2IOS A;  3EIJ A;  5ANR A;  2I2O A;  3FEY A; 
#chains in the Genus database with same CATH topology
 2P9U G;  2FEZ A;  2EIM E;  2MYO A;  1MJ0 A;  3PZD A;  4DUI A;  4XE0 A;  3ZYQ A;  1TN7 A;  4I1M A;  4N2S A;  3PZ1 A;  1HH8 A;  2FBN A;  1PY1 A;  5J08 A;  2EQX A;  4UI9 J;  3B7S A;  2YQ8 A;  3L54 A;  5T8I A;  3APC A;  1TNZ A;  2GRQ B;  4YDY A;  4E85 A;  5ITZ F;  4IN3 B;  1FT1 A;  4WWP A;  2IJG X;  3D3M A;  5AEN A;  4APF A;  3ZXP A;  3LY8 A;  4U95 D;  1XGW A;  2V5F A;  2XQ0 A;  2B0O E;  4NRH B;  1O1S A;  5JJ7 A;  4HB5 A;  3T8M A;  3ABM E;  3CHS A;  1UN8 A;  5ENO D;  4GYY A;  5DIZ A;  5BUZ A;  4WWN A;  3O4Z A;  3UM3 A;  3QAR A;  3CLJ A;  4PDX A;  3UT7 A;  1RZ4 A;  4ANV A;  4GTT A;  2AXV A;  3EHR A;  1E90 A;  3CVW A;  3CVX A;  1P5Q A;  2CG3 A;  2R03 A;  5EDS A;  3CIA A;  2F37 A;  2MHK A;  2XEH A;  4EPZ A;  3T5V A;  2X6K A;  3G2T A;  3DBS A;  4H7X A;  3LXU X;  2VGX A;  4LNU D;  3NF1 A;  5JHB A;  2XCB A;  5AQA A;  3QWP A;  4GML A;  4D10 C;  4GTM A;  4GTR A;  2RFA A;  4A55 A;  3T9K A;  4EZK A;  4CEM A;  3LYA A;  4GTS A;  4UI9 K;  4BTB A;  4RVB A;  1YCS B;  1FCH A;  5AIJ A;  2V5Q C;  1E8Z A;  3L9T A;  2GRM A;  4A63 B;  4DX6 D;  3CVY A;  3BEE A;  1NP7 A;  3EIQ C;  3SFX A;  3ZYK A;  2HR2 A;  3APD A;  4PS8 A;  4N2Q A;  2IO3 C;  3LPZ A;  4PH4 B;  3AG3 E;  3FUM A;  2E0I A;  1LTX A;  3L17 A;  4G8K A;  4U96 D;  3APF A;  4K5C A;  3LS8 A;  4PS3 A;  4HOR A;  2L6J A;  3CQC B;  2WXI A;  4UWL A;  4HXI A;  4YDW A;  4ZHB A;  4KBQ A;  5E76 A;  4IUL A;  1A5E A;  3ASN E;  1HXI A;  5HKP A;  2LUH A;  2NC9 A;  5ENP D;  3SI5 A;  2J08 A;  2GRP B;  1H6K A;  4FU3 A;  1U2V G;  3TWW A;  1KT1 A;  5BXU A;  1JCS A;  2XZT G;  2F8X K;  4LCT A;  3TAX A;  2IY0 C;  4YVO A;  2XGO A;  3DPY A;  4WAF A;  1TNB A;  2ETC A;  4LEU A;  5FZS A;  3NOG D;  4Y6W A;  3D9J A;  3FUK A;  4WNE A;  3D9H A;  5G2N A;  4HOS A;  2OEW A;  3RRN B;  2P9I G;  5G05 J;  1HE8 A;  2KCL A;  3ZGQ A;  3NOC D;  4I9C A;  4APO A;  1HU3 A;  3MEK A;  3LVQ E;  2WMN A;  1DCE A;  3EDT B;  3UM1 A;  3PNT B;  4GCO A;  2OOE A;  3ZUV B;  2R59 A;  3KEZ A;  3DSW A;  4L2Y A;  1FVH A;  4B8C B;  3PUK A;  2ZGD A;  3E30 A;  3DEP A;  3MYV A;  2M63 A;  1HFA A;  1N0Q A;  3ASF A;  4ILI A;  1SA4 A;  3DST A;  3FUI A;  4JW1 A;  3E32 A;  3QAQ A;  3CHO A;  1TJC A;  4OAU C;  4K03 A;  1BD8 A;  3DRA A;  1FPP A;  3UXG A;  4U0U A;  3UMV A;  5KJL A;  3BQO A;  3L08 A;  1E7U A;  2IO2 C;  4GYO A;  4LER A;  1HS6 A;  5EIL A;  3QK0 A;  4EHM A;  2IOL A;  3HYM B;  2CFU A;  2ETA A;  4U0Z A;  4ILG A;  4FUL A;  4CT4 A;  2VGY A;  3FY4 A;  2OCC E;  2HE0 A;  1MHQ A;  2GRN B;  2QY7 A;  4ANU A;  1WAO 1;  3Q9N C;  4Y6C A;  4MLP A;  3HG0 D;  2ZIR A;  1YYH A;  3VLF A;  3JQ1 A;  3VLD A;  4RQI A;  4E6H A;  3EUV A;  3CKB A;  3MCX A;  2H6I A;  2YNQ A;  1AP7 A;  2FO7 A;  1O5M A;  4AM9 A;  4AV7 A;  3UKR G;  1QNF A;  1TR4 A;  1KLX A;  4O6F A;  3UTM A;  3MA5 A;  4HOU A;  4A3V A;  1BU9 A;  2AXU A;  5A6C A;  4ZFH A;  3ASD A;  2P9N G;  2HYZ A;  4CDM A;  3FU0 A;  3PVL A;  4LSZ E;  4GZ3 A;  3R9A B;  1NFI E;  3ZFW A;  2DYR E;  3TWU A;  1OY3 D;  4DX2 A;  4ANW A;  2OV8 A;  3GZ2 A;  3ABL E;  1XNF A;  3DPD A;  2WXF A;  3UI2 A;  4BEP A;  4XX5 A;  5ARG A;  3FEX A;  3UT4 A;  4KZC A;  4UWH A;  3PZ3 A;  4K5B A;  3JYS A;  5CMY A;  4CDR A;  1LF8 A;  2KBX A;  3EHQ A;  3ZU7 B;  1Z3X A;  4EQF A;  3S7D A;  4GCN A;  3BG0 B;  4ATZ D;  3SF4 A;  1QQE A;  3IKO B;  5KCM A;  3E4B A;  3NB2 A;  3U3W A;  4JHK A;  4NQ0 A;  3SQV A;  4L23 A;  4YDE A;  4J8F A;  4N5C A;  3OXF A;  3V30 A;  1HF8 A;  3OXG A;  5JJ6 A;  4BET A;  1N52 A;  4UWF A;  2VTB A;  4N39 A;  1N4P A;  3D9I A;  5FTP A;  3CST A;  1V54 E;  1EYH A;  5KBA A;  1UG3 A;  3UM0 A;  1Z5S C;  3CEQ A;  4ILH B;  3PEU B;  1INZ A;  2VGE A;  4GZ6 A;  1EDU A;  2EIN E;  1PC2 A;  2AJA A;  3VLE A;  3MX3 A;  2ETB A;  5CMW A;  5ARF A;  1AWC B;  2X6H A;  5H7P A;  3CK8 A;  3I5P A;  2C0L A;  1E7V A;  3LVR E;  4GYW A;  1QZ2 A;  5D2M C;  1Z6T A;  1TN8 A;  3LCA A;  3SY2 A;  3LJN A;  2WXG A;  4JVS A;  3K9I A;  4U04 A;  5ENN A;  2UWJ G;  2BUG A;  5BNW A;  4KZ0 A;  3FWV A;  4YND A;  3LJ3 A;  1E8X A;  1VDY A;  3IBE A;  4GPM A;  4AY6 A;  2XEV A;  3KEA A;  3FP3 A;  2WXN A;  5KWD A;  2Y0B G;  1OWN A;  4JZY A;  5ENQ D;  5CHE E;  4DX5 D;  3FU5 A;  2X6I A;  1JCR A;  3ESL A;  3D9M A;  5CRV A;  4JHJ A;  3IHY A;  3ZPJ A;  1IHG A;  5J90 A;  1QYM A;  1SZ9 A;  2B6C A;  2GGF A;  1KT0 A;  3KSL A;  1U3C A;  1WM5 A;  4TXR A;  4GTP A;  5EKQ D;  3TG4 A;  2NXP A;  3ENE A;  3Q78 A;  4K5A B;  3RAU A;  4OVU A;  3B7U X;  2LXM A;  3ZVV A;  3RKV A;  3MJW A;  1E8W A;  1SZA A;  4TUU A;  1SQM A;  2VSO E;  4HRL A;  3N71 A;  4QQI A;  3FUE A;  2KZT A;  4HI9 A;  3CVL A;  5D66 A;  3MKR A;  4B94 A;  4K0R A;  2UY1 B;  4KT6 B;  3UX4 A;  1MZC A;  4DX7 D;  4ACL A;  4YVQ C;  4XKC A;  3C5R A;  4RSY A;  4FJZ A;  4MRU A;  4HRN A;  3D9L A;  3SFZ A;  3AAA C;  4WND A;  4FLB A;  2E2E A;  2JAB A;  3CV0 A;  2XRZ A;  2BKK B;  1S70 B;  1K1A A;  1PAQ A;  2FI7 A;  3FUH A;  4JHR A;  4NIK A;  4FA6 A;  3QKY A;  3PDN A;  5FQ7 A;  1DCQ A;  2WXR A;  5CBO A;  4U8V D;  2ZU6 B;  4IYP A;  3DXM G;  4X8Q A;  3UIO C;  4AOF A;  5ANR A;  4P29 A;  3L16 A;  3CK9 A;  4PS7 A;  2PQN A;  4C0E A;  2EIJ E;  1H2U A;  4KXK B;  2RFM A;  4N3C A;  5FWQ A;  2WVI A;  1D8E A;  3T5X A;  3V79 K;  1S0P A;  3ULY A;  3JXJ A;  4J8S A;  4HBD A;  2CHZ A;  2QZA A;  5C2Y A;  4C48 B;  3FEY A;  4I1A A;  3FTY A;  1OCZ E;  3ZIM A;  1V55 E;  2DZO A;  2VYI A;  1MX6 A;  3CHP A;  5EID A;  1OUV A;  4MS6 A;  2Y3A A;  1HO8 A;  2MOW A;  1TEZ A;  3DSS A;  4J7W A;  4UI9 C;  1OCR E;  1N4S A;  1OWO A;  3SBT B;  3NZU A;  3TJP A;  4C9B B;  1MYO A;  2VQ2 A;  2ZGG A;  3B7R L;  4BSZ B;  4QFV A;  4GB9 A;  4BY6 A;  2LSV A;  1OCC E;  4TRQ A;  4GZ5 A;  1KZO A;  4G2V A;  5AYW D;  3TWS A;  2I6H A;  5CEA A;  3SFY A;  3PNL B;  3JUE A;  3Q49 B;  5A23 A;  1NI1 A;  3QWW A;  3RU0 A;  3E33 A;  4I17 A;  5T4Y A;  3KD7 A;  1E8Y A;  2Y1L E;  2GRL A;  2IF4 A;  3JCK C;  2KC7 A;  4FAD A;  1OT8 A;  2QYJ A;  2VSX E;  2A5E A;  1ELR A;  2RG8 A;  4LUN U;  3JXI A;  3GZ1 A;  1SVX A;  3ZW3 A;  4A3T A;  4TUM A;  5BV0 A;  4I6G A;  1N9A A;  3C72 A;  4EBA A;  4EZL A;  4ACK A;  2WQ6 A;  5KNG A;  1L5J A;  2R02 A;  1ELK A;  5B3S E;  2H6F A;  4IRU A;  3CVV A;  2P58 C;  4GTQ A;  3ULE G;  3W9G A;  4AEZ C;  4ATG A;  5CRU A;  3RK6 A;  3Q4A B;  1O1R A;  5JJT A;  4U63 A;  3ULQ A;  1JPL A;  1IQU A;  4DPR A;  4F6R D;  1X81 A;  4XKB A;  4V3I A;  3G2W A;  3Q79 A;  3QDN A;  4Z68 A;  5BV1 A;  1BPO A;  4J8D A;  4UWK A;  4ANX A;  5G04 C;  4F53 A;  3ML8 A;  4JA7 A;  3FTZ A;  1DC2 A;  1MQS A;  2Y4T A;  2YHE A;  1TNU A;  5LX8 A;  1W3B A;  4GAA A;  5KJM A;  5ENS D;  2R2L A;  4DLO A;  4BT8 A;  3NBN B;  3T8K A;  3PH0 C;  2ILR A;  1FVF A;  5C1D A;  3LY7 A;  3B7B A;  3EHN A;  2LXL A;  1G3N B;  2GRO B;  3MKQ B;  4BES A;  3CQG B;  2KAT A;  3PEV B;  1OXJ A;  1NL4 A;  1SA5 A;  2YHC A;  2J07 A;  2L0I A;  3HVE B;  4LNG A;  3FTS A;  4GA1 A;  4C0M A;  2P9K G;  2H6G A;  1N94 A;  3IHV A;  2BF0 X;  1HZ4 A;  2ION A;  4URK A;  1UOH A;  3FH5 A;  4JEH A;  3S2A A;  3EJN A;  2Q7F A;  5AJD A;  2NYJ A;  4GTV A;  3ZHE B;  1WY6 A;  3TL5 A;  3RJV A;  3OXL A;  2GRR B;  2XGM A;  1A17 A;  2BTD A;  1WDY A;  3TWQ A;  1EPU A;  2VSN A;  3U4T A;  3PZ2 A;  3PRE A;  4G25 A;  1ZB1 A;  4Q94 A;  3L13 A;  3TWX A;  4OAV B;  3SHF A;  4XZ4 A;  2Y4U A;  3PS6 A;  3DSX A;  5EYL A;  2WXQ A;  3KAE A;  4HNA D;  4CYM D;  5G05 C;  3ONK A;  4F7A A;  1BI7 B;  3FUN A;  1TNY A;  3P2B A;  4WWO A;  4JB8 P;  3AG1 E;  2AWI A;  4G8L A;  2CFZ A;  5FQ4 A;  3TXN A;  4DI4 A;  5FIO A;  2V4H C;  2J8S D;  2EIL E;  3ASO E;  3JQ0 A;  3L82 A;  4U07 A;  4BFR A;  4J0U A;  3G2U A;  3PZ4 A;  1TJF A;  4WUY A;  1Y6I A;  3ZYL A;  2J9Q A;  3P1U A;  1Q2Z A;  1KPS B;  2WXP A;  1OCO E;  4ME2 A;  3FFL A;  1DVP A;  3MV2 B;  1X5B A;  2P2C P;  5FZQ A;  5HI7 A;  4BX9 A;  1Y8M A;  3X2Q E;  3PRZ A;  3ZNG A;  3FUL A;  3BG1 B;  4L7T A;  3ZRH A;  3CVP A;  3LDZ A;  2IQC A;  3CHR A;  3Q7F A;  1O1T A;  4AVX A;  4RG6 A;  5HQ8 A;  5IY5 E;  1HX8 A;  4BER A;  3C98 A;  3AG2 E;  2P9L G;  1N11 A;  2VGX B;  3ABK E;  4UQZ A;  4F1P A;  2WPV A;  5EX3 A;  2WMO A;  4FHJ A;  3EU9 A;  2WXK A;  2XEE A;  3IXE A;  4CCA A;  4JL0 A;  3FTW A;  1SW6 A;  3W9F A;  5ANL A;  1H19 A;  1H0A A;  4JC8 A;  5AAR A;  3LEW A;  4G11 A;  3AG4 E;  4KYO B;  1H2V C;  3D9P A;  3V2O A;  3SBS A;  2X6F A;  3B95 A;  5KJN A;  2LSU A;  2KXP C;  3CK7 A;  4TV3 A;  3FU6 A;  5EYP F;  2L0T B;  2IFU A;  5LP0 A;  4RG9 A;  3CVQ A;  2A4Z A;  3MV3 B;  4H7Y A;  5LCW C;  4HQD A;  3UPV A;  2FF4 A;  5LOZ A;  3PUJ A;  5HRY A;  3J5P A;  2IOS A;  3VTY A;  3D9K A;  5FQ6 A;  4DJA A;  4DK5 A;  3NAW A;  4HS2 A;  5EX0 A;  3O48 A;  2WM9 A;  4J8Y A;  1GW6 A;  4GA0 A;  2C2L A;  3ZN3 A;  3RRM B;  2OVB A;  2C0M A;  2R17 C;  2DWZ A;  4YDO A;  3CR3 A;  5FT9 A;  3LKU A;  1DNP A;  4U7E B;  3E34 A;  1ELW A;  3AS5 A;  4I9E A;  5CED B;  4GPK A;  1WG0 A;  3CVU A;  2XS8 A;  4R7L A;  2P9S G;  1HG5 A;  2J09 A;  4AY5 A;  2I2O A;  2XHE A;  3DEO A;  4UWG A;  2WXH A;  4U0S A;  5E75 A;  3Q73 A;  2PL2 A;  1IYG A;  3CGH A;  4KVM A;  4XIF A;  2BKG A;  3BU8 A;  1S63 A;  2OND A;  1E96 B;  4AP2 A;  2ZIS A;  4BSX A;  4Q96 A;  1UJJ A;  3IV0 A;  2WXM A;  4JXT A;  1D9S A;  3R7Q A;  3UM2 A;  1IHB A;  1K3Z D;  3TXM A;  3V31 A;  2R5S A;  4KVO A;  3UQ3 A;  4CDN A;  3Q7A A;  4GZD A;  5B1B E;  1H2T C;  3RSE G;  4I6J A;  4O60 A;  4FLH A;  2XEN A;  3I4G A;  3ONL A;  3CHQ A;  3FH8 A;  2R05 A;  4I6E A;  5BW8 C;  2AVP A;  2QC9 A;  4CZ2 D;  4I2W A;  4GMR A;  4G26 A;  2XRY A;  3MZL B;  1N0R A;  1ZU2 A;  2DZN A;  2V4L A;  3D9O A;  4XEI G;  2KCK A;  1BI8 B;  1D8D A;  3HDX A;  5JHA A;  1IXV A;  4LRZ A;  3R7R A;  2PZI A;  4JA9 A;  4G24 A;  5JMN D;  1FT2 A;  4UUC A;  2DCP A;  2AW6 A;  5BPP A;  1TNO A;  3QJZ A;  4CRW A;  5EN5 D;  3EIJ A;  3ML9 A;  5G04 J;  4HLE A;  4DLQ A;  4DX1 A;  4BT9 A;  2PM6 A;  1OWL A;  5AN8 A;  5M72 A;  3TG5 A;  2QYU A;  5AQB A;  4DRX E;  4DI3 A;  3TWR A;  2A5U A;  2RD0 A;  2P9P G;  3CVN A;  4JD2 G;  2XPI A;  3UKU G;  3PE4 A;  4L2L A;  2EIK E;  3QNK A;  2DBA A;  3AU4 A;  3G2V A;  5CBN A;  4A1S A;  3ASH A;  4B0Z A;  4LNB A;  5FZR A;  5KJK A;  3SO8 A;  4A1G A;  5CER B;  3C3Q A;  1KZP A;  2OVF A;  3NQP A;  5LFA A;  3C3R A;  3L6A A;  3J5Q B;  2JLB A;  2VSY A;  3ZEF A;  1YA0 A;  4GMJ A;  2BED A;  2OEV A;  2V8S E;  4BTA A;  2X6J A;  2DYS E;  3E37 A;  2NSZ A;  1K8K G;  5FQ8 A;  3LY9 A;  3DWL G;  4EBA G;  3CSF A;  3ESK A;  3DXK G;  4FJY A;  4UQY A;  4G23 A;  3CKC A;  3GW4 A;  3BUA A;  4CGV A;  4U8H A;  1YMP A;  2CHW A;  4B93 B;  1U3D A;  3VTX A;  3HXE A;  2Y69 E;  3G2S A;  4HRM B;  3SGH A;  4BWR A;  4NAC A;  3I4R B;  4XI0 A;  5D0Q D;  1NA3 A;  2UY1 A;  4FHK A;  2WXL A;  5DBK A;  3DSV A;  2PM7 A;  3Q47 B;  3JUI A;  5T3R A;  2IEJ A;  3RO3 A;  2KM4 A;  5D0O D;  2VTB B;  4UQX A;  4ABN A;  3FUF A;  2FO1 E;  5AQ7 A;  3TGO A;  2IU1 A;  5B1A E;  2JEK A;  1TN6 A;  2WB2 A;  2WXO A;  3GZS A;  5FIN A;  2XS1 A;  3U66 A;  3HXF A;  4I1O B;  4I2Z A;  3AS8 A;  2HO1 A;  3U64 A;  3Q15 A;  4KMO A;  3B7T A;  5AQ9 A;  3GYZ A;  5AAO A;  5JA4 D;  2RKK A;  3OTN A;  5KNH D;  1RW2 A;  5CCL A;  2YIN A;  3OAW A;  1JUQ A;  5HS0 A;  5BT1 A;  2LAI A;  2AXZ A;  3L22 A;  4N5Q A;  4TXP A;  4N3B A;  2I9C A;  3TWV A;  1TYQ G;  2LNI A;  3QOU A;  1IKN D;  1LD7 A;  5FJY A;  1NZN A;  2J4B A;  4RLY A;  5A7D B;  3MGB A;  3FUJ A;  5ENT D;  1NA0 A;  3HXD A;  2PQR A;  3QB2 A;  4U8Y D;  1ZBP A;  1UN9 A;  4B89 A;  2FUL A;  1MX2 A;  4N3A A;  4BX8 A;  2I1K A;  3FU3 A;  1N4R A;  1OWM A;  4XI9 A;  3I3N A;  1N54 A;  2PNN A;  4M3O A;  4GTO A;  3B13 A;  3IEG A;  1JWG A;  4EZJ A;  4F3V A;  3FTX A;  5CEC B;  2LAH A;  4O1P A;  3ZXS A;  2XPZ A;  2KCV A;  4J8E A;  2WXJ A;  1JCQ A;  5AJL A;  3ISM C;  3DSU A;  1OWP A;  4F1S A;  2I1J A;  2VJ8 A;  3Q9U C;  4OYS A;  5ENR D;  3ZYM A;  2V0P A;  3C3O A;  4HI8 A;  4B8A A;  1S64 A;  1IQR A;  4EEC A;  3KSQ A;  2DIW A;  2KZT B;  4OVV A;  4L9P A;  3U9W A;  3SNX A;  3AS4 A;  4GZC A;  2CHX A;  4FP7 A;  3UT8 A;  4HOT A;  4GA2 A;  4J6I A;  5LCW J;  3HIZ A;  3PE3 A;  3UIP C;  3WG7 E;  2X3M A;  3CHM A;  3V2X A;  4HLL A;  1BLX B;  4WNF A;  2WQ7 A;  4PUC A;  4Q69 A;  3Q5M A;  5BXO A;  4CGW A;  3SD5 A;  4TXQ A;  1UJK A;  4JPS A;  3FH7 A;  3HXB A;  4WNG A;  4I43 A;  1K1B A;  2XPY A;  3S7B A;  4G1T A;  4L1B A;  3FTU A;  4AIF A;  2CG2 A;  4O1O A;  2L6B A;  4M7C A;  2LO6 A;  3NZS A;  2MRI A;  5EIB E;  3EHM A;  4MBG A;  2L9B A;  3ASG A;  2ZXW E;  1LD8 A;  4AJW A;  3UUX A;  2J49 A;  3QWV A;  1MX4 A;  2XGS A;  4GU5 A;  3S7F A;  3KS2 A;  3R9M A;  3FDH A;  3RIB A;  1JWF A;  2XCC A;  2DVW A;  4MKT A;  3HRA A;  4HFG A;  3D9N A;  3WXX A;  3AJI A;  3Q75 A;  4LG6 A;  3FUD A;  1EF1 C;  2XZD G;  4NUR A;  1N95 A;  2H6H A;  3SZ7 A;  3MKQ A;  4HVB A;  3QC1 A;  3ZKJ A;  5CCM A;  3TWT A;  3FTV A;  3RRU A;  3RO2 A;  3AU5 A;  3HVE A;  4HOQ A;  3FHE A;  2GW1 A;  3URZ A;  3HHM A;  4FC8 A;  2J4D A;  1Z3Y A;  1H6O A;  1HG2 A;  3F6Q A;  5G55 A;  2WQH A;  1UW4 B;  3UIN C;  3S7J A;  2X38 A;  1QBQ A;  2F8Y A;  4CT0 A;  2HM8 A;  3EU5 A;  1H6P A;  4W9R A;  2F0Y A;  4AXH A;  4JEU A;  2QFC A;  3ZHE A;  1B89 A;  3HXC A;  1N4Q A; 
#chains in the Genus database with same CATH homology
 5G04 J;  1W3B A;  4GAA A;  4HLE A;  5KJM A;  2FEZ A;  1LF8 A;  4DLQ A;  4DLO A;  3PZD A;  1Z3X A;  4EQF A;  3S7D A;  4GCN A;  4BT8 A;  4XE0 A;  3BG0 B;  3ZYQ A;  4BT9 A;  2PM6 A;  3PH0 C;  1OWL A;  3SF4 A;  2ILR A;  1QQE A;  1FVF A;  3IKO B;  5C1D A;  5KCM A;  5M72 A;  3E4B A;  3TG5 A;  4I1M A;  3LY7 A;  4N2S A;  3U3W A;  4DI3 A;  4JHK A;  1HH8 A;  2FBN A;  3EHN A;  4NQ0 A;  4L23 A;  2A5U A;  1PY1 A;  2RD0 A;  3CVN A;  4J8F A;  4N5C A;  3OXF A;  5J08 A;  2XPI A;  2EQX A;  4UI9 J;  1HF8 A;  3B7S A;  3MKQ B;  3CQG B;  3OXG A;  2YQ8 A;  3PE4 A;  3L54 A;  2KAT A;  3PEV B;  4L2L A;  5T8I A;  5JJ6 A;  3QNK A;  3APC A;  2DBA A;  1N52 A;  2YHC A;  2J07 A;  3AU4 A;  4N39 A;  4UWF A;  3G2V A;  4E85 A;  2VTB A;  4IN3 B;  3D9I A;  5FTP A;  3ASH A;  4A1S A;  4B0Z A;  4WWP A;  2IJG X;  2L0I A;  3D3M A;  3CST A;  3HVE B;  1EYH A;  5AEN A;  1UG3 A;  5FZR A;  4APF A;  5KJK A;  3LY8 A;  4A1G A;  3FTS A;  1XGW A;  4GA1 A;  2V5F A;  2XQ0 A;  4NRH B;  4C0M A;  2OVF A;  3NQP A;  5LFA A;  5JJ7 A;  3CEQ A;  3L6A A;  2JLB A;  3PEU B;  4ILH B;  1INZ A;  3IHV A;  2BF0 X;  1HZ4 A;  2ION A;  2VSY A;  3T8M A;  1YA0 A;  4GZ6 A;  4GMJ A;  1EDU A;  3ZEF A;  4URK A;  3CHS A;  1PC2 A;  1UN8 A;  2V8S E;  4GYY A;  2X6J A;  3VLE A;  4BTA A;  4CDR A;  2NSZ A;  3FH5 A;  5FQ8 A;  3LY9 A;  4JEH A;  5DIZ A;  3MX3 A;  3S2A A;  5BUZ A;  4EBA G;  3CSF A;  3EJN A;  5CMW A;  3ESK A;  2Q7F A;  5ARF A;  4FJY A;  4UQY A;  4WWN A;  4G23 A;  3O4Z A;  2X6H A;  5AJD A;  3CKC A;  3GW4 A;  3ZHE B;  3QAR A;  3CLJ A;  3CK8 A;  3I5P A;  4PDX A;  1WY6 A;  2C0L A;  1E7V A;  3LVR E;  4GYW A;  3RJV A;  3TL5 A;  3OXL A;  4U8H A;  3UT7 A;  4CGV A;  1QZ2 A;  4ANV A;  2CHW A;  2XGM A;  1A17 A;  2AXV A;  2BTD A;  1Z6T A;  3LCA A;  1EPU A;  2VSN A;  1U3D A;  3U4T A;  3VTX A;  3G2S A;  3PRE A;  3SGH A;  1E90 A;  2WXG A;  4G25 A;  3CVW A;  3CVX A;  4JVS A;  4Q94 A;  1P5Q A;  4BWR A;  3L13 A;  2CG3 A;  5EDS A;  3K9I A;  3CIA A;  4U04 A;  4NAC A;  5ENN A;  2UWJ G;  2BUG A;  5BNW A;  3I4R B;  4KZ0 A;  4XI0 A;  2MHK A;  2Y4U A;  3FWV A;  4XZ4 A;  3PS6 A;  4YND A;  5D0Q D;  3SHF A;  1NA3 A;  4EPZ A;  3T5V A;  4HOT A;  2X6K A;  3G2T A;  2UY1 A;  3LJ3 A;  1E8X A;  2WXQ A;  3DBS A;  3KAE A;  1VDY A;  4FHK A;  3IBE A;  4H7X A;  5G05 C;  3LXU X;  4AY6 A;  2WXL A;  2VGX A;  5DBK A;  3NF1 A;  3ONK A;  2PM7 A;  2XEV A;  3JUI A;  3FP3 A;  3Q47 B;  5T3R A;  2WXN A;  3RO3 A;  2KM4 A;  5JHB A;  4F7A A;  2XCB A;  3FUN A;  5D0O D;  1OWN A;  3P2B A;  3QWP A;  4JZY A;  4WWO A;  2VTB B;  2AWI A;  5CHE E;  4GML A;  2CFZ A;  5FQ4 A;  3TXN A;  4DI4 A;  4D10 C;  4UQX A;  3FU5 A;  4ABN A;  2X6I A;  3FUF A;  3ESL A;  3D9M A;  3TGO A;  4A55 A;  2IU1 A;  2JEK A;  4JHJ A;  4EZK A;  2WB2 A;  4CEM A;  2WXO A;  3GZS A;  3IHY A;  3JQ0 A;  4U07 A;  4BFR A;  3ZPJ A;  3LYA A;  4J0U A;  4UI9 K;  3U66 A;  3G2U A;  4BTB A;  4I1O B;  1IHG A;  4I2Z A;  3AS8 A;  5J90 A;  1TJF A;  1SZ9 A;  2HO1 A;  4RVB A;  3U64 A;  1FCH A;  3Q15 A;  4WUY A;  5AIJ A;  1Y6I A;  3ZYL A;  2J9Q A;  2GGF A;  3P1U A;  4KMO A;  1KT0 A;  1E8Z A;  3B7T A;  3GYZ A;  1U3C A;  1WM5 A;  2GRM A;  3CVY A;  5EKQ D;  3BEE A;  3OTN A;  3TG4 A;  2NXP A;  3ENE A;  2WXP A;  1NP7 A;  4ME2 A;  4OVU A;  5CCL A;  3EIQ C;  3B7U X;  3FFL A;  1DVP A;  3MV2 B;  1X5B A;  2HR2 A;  2YIN A;  5FZQ A;  5HI7 A;  3RKV A;  3ZYK A;  3ZVV A;  3MJW A;  1JUQ A;  3APD A;  3OAW A;  1Y8M A;  4BX9 A;  3PRZ A;  1E8W A;  4PS8 A;  5BT1 A;  2LAI A;  3FUL A;  3BG1 B;  4N2Q A;  2AXZ A;  1SZA A;  3L22 A;  4L7T A;  4TUU A;  3ZRH A;  4N3B A;  3LPZ A;  1SQM A;  4PH4 B;  3CVP A;  2I9C A;  3LDZ A;  2VSO E;  2IQC A;  3N71 A;  3FUE A;  2LNI A;  3QOU A;  3CHR A;  3FUM A;  2E0I A;  5FJY A;  1NZN A;  2KZT A;  2J4B A;  3L17 A;  5A7D B;  3CVL A;  3MGB A;  3APF A;  3MKR A;  4B94 A;  3FUJ A;  1NA0 A;  3LS8 A;  4K0R A;  4PS3 A;  4HOR A;  2L6J A;  4RG6 A;  2PQR A;  4AVX A;  2UY1 B;  3CQC B;  4KT6 B;  5HQ8 A;  3UX4 A;  2WXI A;  4UWL A;  4HXI A;  1HX8 A;  3C98 A;  3QB2 A;  1ZBP A;  1UN9 A;  4YVQ C;  4ACL A;  2VGX B;  4B89 A;  4KBQ A;  2FUL A;  5E76 A;  4IUL A;  4XKC A;  4UQZ A;  4RSY A;  4N3A A;  4BX8 A;  2I1K A;  4FJZ A;  3FU3 A;  4MRU A;  2WPV A;  1HXI A;  1OWM A;  2NC9 A;  3D9L A;  5EX3 A;  3SFZ A;  3SI5 A;  2WMO A;  4XI9 A;  2J08 A;  3I3N A;  4FHJ A;  4WND A;  1H6K A;  4FLB A;  1N54 A;  2E2E A;  4M3O A;  3CV0 A;  2XRZ A;  2WXK A;  4FU3 A;  3B13 A;  3IEG A;  1JWG A;  4EZJ A;  4CCA A;  1PAQ A;  2FI7 A;  4JL0 A;  3FTW A;  5ANL A;  1KT1 A;  4F3V A;  3FTX A;  3FUH A;  4JHR A;  4FA6 A;  3QKY A;  4LCT A;  3TAX A;  1H19 A;  1H0A A;  2LAH A;  3PDN A;  4JC8 A;  5FQ7 A;  3ZXS A;  2XPZ A;  3LEW A;  4G11 A;  4YVO A;  2XGO A;  2KCV A;  2WXR A;  4J8E A;  4KYO B;  2WXJ A;  1H2V C;  4WAF A;  3D9P A;  3SBS A;  2ZU6 B;  5AJL A;  4LEU A;  2X6F A;  4IYP A;  5FZS A;  5KJN A;  2LSU A;  1OWP A;  4AOF A;  4F1S A;  4Y6W A;  3D9J A;  3CK7 A;  4P29 A;  4TV3 A;  3L16 A;  5ANR A;  3FUK A;  3FU6 A;  3CK9 A;  4WNE A;  2L0T B;  4PS7 A;  2PQN A;  2I1J A;  2VJ8 A;  4C0E A;  2IFU A;  4OYS A;  5LP0 A;  4RG9 A;  1H2U A;  4KXK B;  3ZYM A;  2V0P A;  5G2N A;  3CVQ A;  4N3C A;  5FWQ A;  4B8A A;  4HOS A;  1IQR A;  4EEC A;  2WVI A;  2A4Z A;  3RRN B;  5G05 J;  3MV3 B;  4H7Y A;  5LCW C;  3UPV A;  3T5X A;  1HE8 A;  2DIW A;  2FF4 A;  2KZT B;  3PUJ A;  5LOZ A;  4OVV A;  1S0P A;  2KCL A;  3ZGQ A;  3U9W A;  4J8S A;  2CHZ A;  2IOS A;  3SNX A;  3VTY A;  3AS4 A;  4GZC A;  4I9C A;  5C2Y A;  4APO A;  2CHX A;  4FP7 A;  3FEY A;  4I1A A;  3FTY A;  1HU3 A;  4GA2 A;  3MEK A;  4J6I A;  3HIZ A;  3UT8 A;  3PE3 A;  5LCW J;  2X3M A;  3D9K A;  3LVQ E;  3CHM A;  3ZIM A;  2WMN A;  5FQ6 A;  4DJA A;  4DK5 A;  3EDT B;  3PNT B;  4GCO A;  2OOE A;  4HS2 A;  5EX0 A;  4WNF A;  2WQ7 A;  4PUC A;  4Q69 A;  3O48 A;  2WM9 A;  1GW6 A;  2R59 A;  3KEZ A;  3Q5M A;  4GA0 A;  2VYI A;  4L2Y A;  1FVH A;  2C2L A;  4B8C B;  3CHP A;  3SD5 A;  4CGW A;  1UJK A;  3PUK A;  3FH7 A;  4JPS A;  3RRM B;  1OUV A;  3ZN3 A;  2OVB A;  4MS6 A;  2C0M A;  4WNG A;  2R17 C;  4I43 A;  2Y3A A;  1HO8 A;  2XPY A;  3CR3 A;  3MYV A;  5FT9 A;  2M63 A;  1HFA A;  3LKU A;  3S7B A;  4G1T A;  1DNP A;  2MOW A;  1TEZ A;  3ASF A;  4L1B A;  4ILI A;  3FTU A;  4AIF A;  2CG2 A;  1ELW A;  3AS5 A;  4I9E A;  3ML9 A;  4UI9 C;  3FUI A;  4JW1 A;  4GPK A;  1OWO A;  2LO6 A;  3NZS A;  3SBT B;  3CVU A;  3NZU A;  3TJP A;  3QAQ A;  2MRI A;  4C9B B;  3CHO A;  4R7L A;  1TJC A;  3EHM A;  2VQ2 A;  3B7R L;  1HG5 A;  4K03 A;  4QFV A;  2J09 A;  4GB9 A;  4BY6 A;  2L9B A;  4AY5 A;  4U0U A;  2LSV A;  3ASG A;  2I2O A;  3UMV A;  5KJL A;  2XHE A;  4AJW A;  4TRQ A;  3UUX A;  4GZ5 A;  3L08 A;  1E7U A;  4UWG A;  2J49 A;  3QWV A;  2WXH A;  4G2V A;  4GYO A;  4LER A;  4U0S A;  5E75 A;  5AYW D;  1HS6 A;  2I6H A;  2XGS A;  2PL2 A;  3QK0 A;  1IYG A;  3CGH A;  4KVM A;  4XIF A;  2IOL A;  3HYM B;  2CFU A;  3PNL B;  3KS2 A;  4GU5 A;  3S7F A;  4U0Z A;  3Q49 B;  4ILG A;  5A23 A;  3QWW A;  3FDH A;  4FUL A;  4CT4 A;  2VGY A;  3RIB A;  3RU0 A;  3FY4 A;  1MHQ A;  1JWF A;  2XCC A;  4I17 A;  5T4Y A;  3KD7 A;  1E8Y A;  1E96 B;  2OND A;  4AP2 A;  2QY7 A;  4ANU A;  1WAO 1;  2GRL A;  4MKT A;  2IF4 A;  4BSX A;  4Q96 A;  3JCK C;  1UJJ A;  3IV0 A;  2KC7 A;  4HFG A;  3D9N A;  4Y6C A;  2WXM A;  4MLP A;  3WXX A;  4FAD A;  4JXT A;  2VSX E;  1ELR A;  2RG8 A;  3VLF A;  3JQ1 A;  3R7Q A;  3VLD A;  4LUN U;  3GZ1 A;  4E6H A;  3CKB A;  3MCX A;  3TXM A;  3ZW3 A;  2YNQ A;  3FUD A;  4A3T A;  1EF1 C;  5BV0 A;  2FO7 A;  4I6G A;  2R5S A;  4KVO A;  3UQ3 A;  4CDN A;  4GZD A;  4AM9 A;  4NUR A;  1H2T C;  4AV7 A;  3SZ7 A;  1QNF A;  3MKQ A;  4HVB A;  1KLX A;  4O6F A;  4EBA A;  3QC1 A;  3MA5 A;  4EZL A;  4ACK A;  4HOU A;  2WQ6 A;  1L5J A;  4A3V A;  5CCM A;  2AXU A;  4I6J A;  5A6C A;  1ELK A;  4FLH A;  3FTV A;  3RRU A;  3I4G A;  3ONL A;  3ASD A;  3CHQ A;  3RO2 A;  3AU5 A;  2HYZ A;  3HVE A;  3FH8 A;  3FU0 A;  3PVL A;  4IRU A;  4CDM A;  3CVV A;  2P58 C;  4I6E A;  4HOQ A;  4AEZ C;  4ATG A;  3FHE A;  2GW1 A;  5BW8 C;  2AVP A;  3URZ A;  4GZ3 A;  3R9A B;  3RK6 A;  3HHM A;  3Q4A B;  3ZFW A;  5JJT A;  4I2W A;  4G26 A;  4FC8 A;  2XRY A;  2J4D A;  4U63 A;  3MZL B;  3ULQ A;  1Z3Y A;  1JPL A;  1IQU A;  1HG2 A;  1ZU2 A;  5G55 A;  4ANW A;  4DPR A;  4XKB A;  2WQH A;  1UW4 B;  2V4L A;  4V3I A;  3D9O A;  2KCK A;  2OV8 A;  3G2W A;  3GZ2 A;  3S7J A;  2X38 A;  3QDN A;  1XNF A;  3HDX A;  3DPD A;  2WXF A;  5BV1 A;  4CT0 A;  2HM8 A;  1BPO A;  4LRZ A;  5JHA A;  4J8D A;  3R7R A;  4UWK A;  4ANX A;  4W9R A;  4XX5 A;  4AXH A;  5ARG A;  4JEU A;  2PZI A;  5G04 C;  4F53 A;  3FEX A;  3ML8 A;  4JA7 A;  3UT4 A;  3FTZ A;  4JA9 A;  1MQS A;  4G24 A;  2QFC A;  2Y4T A;  4KZC A;  4UWH A;  3ZHE A;  5BPP A;  2DCP A;  2AW6 A;  1B89 A;  3QJZ A;  2YHE A;  4CRW A;  3EIJ A;  5LX8 A;  3JYS A;  5CMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...