2IOSA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form 3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
124
Chain Sequence
b'PVNHLVKEIDMLLKEYLLSGDISEAEHLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed Cell Death 4, Pdcd4
molecule tags Antitumor protein
source organism Mus musculus
publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
total genus 50
structure length 124
sequence length 126
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iosA00
4B8CB 2RG8A 2VSOE 3EIJA 4JHKA 2KZTA 4JHJA 1UG3A 4B8AA 1H2UA 4CT4A 2I2OA 2FULA 5ANRA 3FEXA 1H2VC 1H6KA 4CEMA 3JUIA 2IOLA 2HM8A 2KZTB 2NSZA 2VSXE 4GMLA 4LUNU 2ZU6B 4CRWA 2GGFA 2IOSA 3EIQC 1H2TC 1HU3A 3FEYA 4B89A 4IULA 3L6AA 1N54A 2IONA 2IU1A 4GMJA 1UW4B 3RK6A 4C9BB 1PAQA 1N52A 3D3MA
chains in the Genus database with same CATH superfamily
3Q15A 5FQ6A 1Y8MA 1HF8A 5KBAA 1TN6A 4GPKA 2AXVA 2ZGDA 1E8ZA 5E76A 3GZSA 5BV1A 3T9KA 4CT0A 4U8YD 1WM5A 4JB8P 4A1GA 3CQCB 3ZW3A 1OWPA 1DCQA 3PEUB 4XEIG 1SQMA 1HFAA 3FUDA 1E90A 3LEWA 1NZNA 3UT8A 1FT1A 4XI9A 4QFVA 1WG0A 3AJIA 3ULYA 4ATGA 3DEOA 1DNPA 4I1MA 4GYYA 3TXNA 5EKQD 2X3MA 3CR3A 3B13A 3X2QE 3Q75A 4F3VA 1KZPA 3OXLA 3ASDA 4LUNU 4YDOA 3D9KA 4ABNA 2WXIA 3L22A 4GTQA 3PEVB 3UIPC 2RD0A 4WNDA 2H6FA 4WWPA 1LD8A 3PZ1A 3E30A 4OAUC 4NIKA 1DVPA 3Q78A 3DSSA 2XZTG 3ZEFA 3AG4E 1BPOA 2J9QA 1KPSB 2J49A 2LO6A 4G26A 1Q2ZA 4E6HA 2DBAA 4U0ZA 2OEVA 3TWWA 4DX6D 3VLEA 3R7QA 3SY2A 2RFMA 1HE8A 1K1AA 5E75A 3D9JA 3B7TA 1UJJA 3RIBA 2I1KA 5HRYA 3FDHA 1UG3A 5CCLA 4R7LA 4GTPA 4CEMA 3TWVA 4JZYA 4BEPA 1NP7A 3L54A 2XRZA 3ZYKA 3TWQA 2R05A 5KJKA 1UN9A 5EX0A 4UQYA 2GRPB 1EDUA 2VTBB 3C5RA 4C9BB 2PZIA 3QARA 4J0UA 2WXQA 3G2WA 1MX2A 2OEWA 4AJWA 2P9NG 4KZ0A 2XEVA 3LVQE 4U95D 4K03A 5D66A 1MX6A 5A7DB 3RO3A 3TWUA 3Q4AB 1FPPA 4LSZE 4UQXA 1YYHA 3EIJA 5C2YA 3OAWA 2J09A 5LX8A 2XENA 5CEDB 2WXJA 5ENSD 3VLFA 4JEUA 3ZVVA 3VLDA 1H6PA 1D8EA 4HRLA 5AQAA 1H6OA 5ENQD 4GZ6A 5KJMA 1FVFA 5D0OD 4Q94A 4B94A 5LP0A 4RG9A 3KAEA 5ARGA 4UUCA 3E33A 3VTXA 2R02A 3UUXA 2Y3AA 4ACKA 3ZHEB 4U63A 3ML8A 3ONLA 2A5UA 5B1AE 2VSNA 4QQIA 2CFZA 4C48B 2KC7A 3UM2A 3JCKC 3FUEA 4GZ3A 4CDNA 1XNFA 3UINC 3JQ0A 4HRMB 4OAVB 4U04A 1TR4A 1K1BA 5KNHD 4KT6B 4LNUD 4PDXA 2UY1A 4B8CB 2XEHA 2AW6A 2V0PA 3GZ2A 3TG4A 5J90A 4JPSA 4MLPA 4ILHB 4FJZA 2WXOA 4OVUA 4FA6A 4GTVA 4AVXA 3PZ3A 4CGWA 3CKBA 5AARA 2VSYA 3QB2A 4AOFA 2JLBA 1YMPA 1OUVA 4ILGA 3LY7A 3LJNA 2MRIA 3RU0A 4XZ4A 1XGWA 3FWVA 5CEAA 2I9CA 2LAIA 3IXEA 4HBDA 3UT4A 4DX7D 2P58C 3S7FA 5EILA 2H6HA 5KJLA 3C3OA 5EX3A 4B93B 3QC1A 4BWRA 2OV8A 3D3MA 2FF4A 4GZ5A 3U66A 2CFUA 2Y1LE 4N2QA 3APDA 3FTZA 4C0EA 1TNOA 3APFA 3VTYA 5HI7A 3SHFA 3V31A 2WXNA 4AIFA 3JQ1A 3MEKA 5CMWA 2L6BA 2BTDA 3MA5A 4FHJA 4GYOA 3R7RA 5T4YA 4K5CA 5KJNA 2XQ0A 3HHMA 4ILIA 1OWMA 2F8XK 4I6JA 2V5QC 4YDWA 4EPZA 5AQBA 4BX9A 5G55A 2LUHA 2IY0C 3C3RA 4A3TA 3PE4A 3LYAA 1TN8A 3Q47B 4G2VA 4HRNA 5JA4D 3T5VA 4OVVA 1TNBA 3PUKA 1GW6A 4JVSA 2YNQA 1S64A 1NFIE 4EBAA 2J07A 2WQHA 1SZ9A 3G2SA 1BD8A 4FJYA 2WVIA 5JJ7A 4BETA 2IJGX 3DWLG 3P2BA 5JHBA 2V4LA 3O48A 3LXUX 5ENPD 2FBNA 1B89A 3ASHA 4WAFA 3D9OA 1KT1A 2ZU6B 2GGFA 3FUMA 3OXFA 4I9CA 3IKOB 1N9AA 1G3NB 5JMND 3MV3B 4JEHA 2GRLA 5EYPF 5FZRA 1E8YA 3FTYA 5JJTA 1PY1A 3MKQA 4HI9A 2DWZA 3EJNA 3PZ2A 5AJDA 3WXXA 2OVBA 4U0SA 4E85A 4O1OA 4LRZA 4TXRA 3TWTA 2NYJA 3KSQA 3CHOA 3PE3A 2HR2A 3S7BA 5JJ6A 4GU5A 2BKGA 5G04C 3FUJA 3ZKJA 2XGOA 3L82A 5A6CA 5BT1A 4BT8A 1FCHA 3JXIA 4G8KA 1X5BA 1N52A 3JXJA 3CVLA 2LXMA 5BW8C 4JC8A 3T8MA 1N95A 3CKCA 3EDTB 4DX2A 5KNGA 4MS6A 3D9LA 2HYZA 1DCEA 4ZHBA 2HO1A 2LSUA 4I17A 1LF8A 2ZIRA 4ME2A 3RRUA 2WXHA 3TL5A 2KCVA 5HKPA 2QYUA 4DRXE 5FQ8A 1IYGA 4U0UA 4HXIA 4KVOA 4WNGA 2LXLA 3IBEA 2X6KA 3U64A 3NAWA 3CV0A 4JW1A 1FT2A 5T3RA 2VYIA 1E8XA 3CGHA 4RSYA 3G2VA 4EHMA 1L5JA 3JUEA 3CVXA 3BG0B 4ACLA 3V2XA 5ENOD 1O1TA 4HQDA 3MGBA 5FIOA 1Z3XA 4PUCA 4GTSA 1QZ2A 2L0TB 3DSUA 1IHGA 3UPVA 4Z68A 2P9LG 3ASNE 4U8HA 2AXZA 3JUIA 3RO2A 4FLHA 3CVPA 2EILE 2NXPA 1HG5A 2OOEA 2MHKA 4WUYA 4FLBA 2BEDA 4WWOA 4O60A 4XI0A 1TJCA 4GA2A 3ZN3A 3QK0A 4H7YA 2DIWA 5EIDA 1OWNA 4NACA 5FZSA 3NQPA 3SBTB 3Q9UC 3IV0A 2AVPA 3FEYA 2R03A 2L9BA 4BFRA 2X6HA 3PDNA 2DZNA 3QWVA 3ZNGA 2RFAA 3ZYLA 5ITZF 3GW4A 4GYWA 4N3BA 1TEZA 2XPZA 1SZAA 3TXMA 3FTXA 4TUUA 2AWIA 3EHMA 2YINA 2DYSE 4LG6A 3RKVA 2PM6A 3CVYA 2GRQB 4DX5D 3FFLA 5C1DA 5T8IA 3FUFA 1WY6A 3ZIMA 2P9IG 1JWFA 4L2LA 1UOHA 1FVHA 1OCOE 4BT9A 4HOUA 1N4SA 1E7VA 2YHCA 3PVLA 3MZLB 1S63A 3SFXA 4XX5A 4TV3A 4WNFA 1TN7A 3E37A 2IO3C 5HQ8A 5FINA 3FUHA 3TWRA 3D9PA 5ENTD 3SO8A 3HDXA 2XCCA 1V54E 3I3NA 1OWLA 3FUKA 3ESLA 3SNXA 2AXUA 2XHEA 5AJLA 5CECB 3DSXA 4BSZB 4U7EB 2Q7FA 1HO8A 2WXFA 1MYOA 1AP7A 4MBGA 3MYVA 2RG8A 3ZHEA 4FADA 3JYSA 2WMNA 3PNLB 2VGXA 4M7CA 3HVEA 4GMLA 3FU0A 2MYOA 3UXGA 4I1AA 4IULA 3OXGA 3LCAA 1MHQA 3SF4A 5CCMA 4JA7A 3LDZA 3LJ3A 4A3VA 2M63A 3Q73A 4A55A 5EDSA 1BLXB 1H2UA 4Q69A 1Z3YA 4UI9K 1RZ4A 2IOLA 4G1TA 1IXVA 3CLJA 4G23A 3NOCD 1MZCA 3D9IA 1H19A 4O1PA 2IO2C 4N39A 2LSVA 5G04J 3HXDA 4UI9J 3RK6A 2WXKA 4AP2A 5CRUA 4XKBA 2QZAA 4Y6WA 1N4RA 3ULQA 2BF0X 3C72A 3RSEG 1N4QA 3GYZA 4HFGA 3NZUA 1JCSA 4XIFA 3DSWA 4J6IA 2GRMA 4KVMA 3SD5A 4ANVA 2FEZA 2E0IA 5A23A 3Q79A 5ENRD 4D10C 1W3BA 3B7SA 4I6GA 4GA1A 3UTMA 4HI8A 4B0ZA 1N0RA 3ZPJA 4JXTA 3U4TA 4H7XA 3CVWA 4WNEA 2LAHA 4A63B 3HXBA 1IHBA 4LERA 3MJWA 4U8VD 3KD7A 3S7JA 3UIOC 3FU6A 2KXPC 3E32A 1TNUA 3QNKA 3V2OA 2WB2A 5H7PA 4L1BA 3AU4A 4F7AA 2I2OA 3ABKE 3ESKA 3FTUA 2HM8A 5D2MC 3O4ZA 1U3CA 4ANUA 4JA9A 1YA0A 3G2UA 4F6RD 3FU5A 3E34A 3PREA 4BSXA 4BY6A 1N54A 1N4PA 1OCCE 4RVBA 3I5PA 4LNBA 3AAAC 3I4GA 3B7BA 3N71A 3BU8A 4HORA 3NB2A 1D9SA 3CSTA 2P9UG 5M72A 4BESA 1WDYA 3C3QA 3R9AB 3ABLE 2XCBA 4PS3A 4GAAA 2WM9A 3L6AA 3SZ7A 3BUAA 2VGYA 2WXRA 3D9HA 5AIJA 2CHXA 3FH8A 1NI1A 2VGXB 2IQCA 4I1OB 2C2LA 3AG2E 3ULEG 3I4RB 2KATA 1HH8A 3KEZA 5FTPA 1HG2A 2I1JA 4GCOA 1N0QA 4GMRA 5AYWD 2ETBA 1YCSB 4DI4A 1O1RA 4N5CA 2JABA 2WQ6A 2IOSA 2X6JA 5DBKA 3L17A 1ELWA 2R2LA 2Y4TA 4TXPA 3S7DA 4G24A 3LY9A 4EQFA 5G05C 1Z6TA 3ZXPA 1S0PA 2GROB 1BI8B 4UWKA 3FY4A 3AS5A 4YDYA 2J4DA 3QOUA 5FQ7A 2P9PG 3ASFA 2MOWA 3U9WA 4RG6A 4CYMD 1HXIA 2HE0A 4EBAG 1BU9A 2QY7A 4WWNA 1V55E 5ANRA 2F37A 2J4BA 3Q49B 1MJ0A 2KCLA 3URZA 5AN8A 4U96D 3CVVA 1VDYA 4HOTA 1P5QA 1K3ZD 2ZISA 2VTBA 1N94A 1E96B 1LD7A 4AV7A 4G25A 1UW4B 5KCMA 3QKYA 2WQ7A 1TYQG 2DCPA 1TJFA 2I6HA 3MKQB 3DPDA 3DSTA 4MKTA 2QFCA 4DI3A 5BXOA 4I2ZA 4Q96A 3ZGQA 3V30A 2L0IA 2R59A 2P2CP 3E4BA 3R9MA 4BX8A 2CHWA 2LNIA 4HLEA 3HXCA 3ZFWA 2FI7A 2EIKE 2VGEA 3QAQA 3WG7E 5CHEE 4HS2A 2IEJA 5IY5E 2XS8A 3ZRHA 1ELKA 1HS6A 3FH5A 4N3CA 3ABME 2Y69E 3QWWA 2EQXA 3DBSA 1WAO1 4YNDA 1BI7B 1RW2A 1OXJA 4UWFA 2L6JA 2VJ8A 5J08A 4ANXA 4RQIA 2Y4UA 2BKKB 3B7UX 4AM9A 4C0MA 4EECA 1UN8A 5FJYA 4V3IA 1D8DA 1U3DA 1NL4A 1H0AA 2PL2A 2RKKA 4JHRA 1KZOA 1SW6A 1A5EA 2JEKA 2ETCA 3QWPA 1INZA 3CQGB 3HG0D 1U2VG 4CDRA 2ILRA 2AJAA 3CHPA 1OWOA 2IONA 2WMOA 3UM3A 1S70B 4KMOA 5BUZA 2FO1E 5B3SE 2GRRB 2WPVA 2XPYA 3S2AA 3EU5A 4F53A 3LVRE 4FU3A 5DIZA 3UX4A 3ZYQA 4N2SA 2QC9A 2NC9A 2V8SE 1SA5A 4NURA 3Q7FA 3FH7A 1PAQA 5FZQA 2CHZA 3EHRA 3FHEA 4DUIA 3SFZA 3TWXA 4KYOB 3DRAA 2KCKA 4DJAA 3KS2A 4J8DA 4JL0A 1ZU2A 4FHKA 2R5SA 3IHYA 3UM1A 1O1SA 2EIJE 3SGHA 5AQ7A 4GB9A 4DX1A 4N5QA 2KZTA 4JHJA 4CT4A 2F8YA 3ZYMA 4FC8A 2GRNB 3CEQA 2ONDA 5LCWJ 4A1SA 4HNAD 4YDEA 2B6CA 2ZXWE 3RAUA 4AY5A 2VSOE 2WXPA 3L16A 1Z5SC 4ATZD 1JPLA 1H2VC 3W9FA 1K8KG 2C0LA 5G05J 3HYMB 4G11A 4LNGA 4UWLA 1LTXA 4K0RA 3C98A 3CHSA 2ETAA 4J8SA 3LKUA 1HX8A 4L2YA 1IQUA 3ZUVB 4PH4B 4CRWA 5CRVA 4G8LA 4PS7A 3MCXA 1MQSA 3AG3E 3PUJA 4FP7A 4GTMA 4GMJA 1QQEA 1EPUA 3F6QA 3EHNA 3LY8A 3NBNB 1ELRA 3UKRG 4UQZA 1SA4A 5ARFA 5EYLA 1NA3A 3CSFA 1ZB1A 4TRQA 4DLOA 3LPZA 4APFA 3PRZA 4LEUA 4TUMA 2P9KG 5CBOA 4UWGA 4I9EA 2WXLA 3TAXA 2KM4A 4ANWA 2OCCE 4GZDA 1KT0A 2XS1A 3Q7AA 2VQ2A 3SBSA 3APCA 3QJZA 5BPPA 1JUQA 3TWSA 3UKUG 3J5PA 3CVUA 1EF1C 3NZSA 1OT8A 1MX4A 2EINE 3TGOA 3BG1B 5BV0A 3ASGA 3ISMC 4GTOA 4Y6CA 3UI2A 3IHVA 3BEEA 1ZBPA 2KBXA 1QBQA 2FO7A 4TXQA 4UWHA 3D9MA 1OY3D 4BTAA 5CBNA 3V79K 1EYHA 4AY6A 2IF4A 2C0MA 5CERB 3MV2B 2XRYA 3DXKG 4J7WA 3RJVA 3SQVA 3SI5A 2XGSA 3BQOA 4AEZC 3EU9A 1DC2A 2XPIA 3B7RL 4URKA 2KZTB 4GPMA 1UJKA 3W9GA 4UI9C 5FWQA 4APOA 3CK9A 3P1UA 5AAOA 2DVWA 3ML9A 4GA0A 3ZU7B 3TJPA 4CCAA 2E2EA 4X8QA 2FULA 3TG5A 1H6KA 2X6FA 1O5MA 2NSZA 3UM0A 2PM7A 1PC2A 3PH0C 3RRMB 3Q5MA 2CG2A 3OTNA 5EIBE 2XGMA 2ZGGA 3QDNA 4LCTA 3CIAA 4NQ0A 3LS8A 4I43A 2XEEA 3ZXSA 3B95A 3HRAA 4IYPA 4EZKA 4XE0A 2UWJG 2DYRE 1SVXA 4RLYA 3HXEA 3KEAA 3PS6A 3ONKA 3FUIA 2IFUA 5CMYA 3L9TA 5FQ4A 2IU1A 4XKCA 3NOGD 3UQ3A 4L7TA 1Y6IA 3CVNA 3HVEB 3G2TA 1KLXA 2A4ZA 3PZDA 4L23A 3AS8A 5KWDA 4K5AB 4P29A 3NF1A 2OVFA 5B1BE 3L13A 4KBQA 4HLLA 4K5BA 1IQRA 2QYJA 5G2NA 3SFYA 3AU5A 2A5EA 4EZJA 4BTBA 2EIME 4EZLA 3DXMG 4GTTA 4F1PA 3HIZA 4IRUA 2J08A 4KXKB 4GTRA 4BERA 3D9NA 4O6FA 5LCWC 3HXFA 3FTVA 4IN3B 1OCZE 1JWGA 2PQNA 3CHMA 3FU3A 3Q9NC 2VSXE 2YQ8A 2CG3A 4KZCA 5BNWA 2H6IA 3ASOE 3FP3A 4HB5A 3CK7A 3DPYA 2GW1A 5BXUA 3FULA 4YVQC 2DZOA 4ZFHA 4I6EA 5D0QD 5LOZA 4DLQA 2WXMA 5AENA 5AQ9A 3K9IA 3L08A 3CHRA 3UT7A 5HS0A 4DK5A 2UY1B 1OCRE 2YHEA 1E8WA 2B0OE 1AWCB 4CDMA 3ENEA 2J8SD 1NA0A 3UMVA 3FTSA 3PZ4A 1JCRA 5JHAA 4HOSA 2H6GA 1N11A 3FTWA 4AXHA 2F0YA 4M3OA 4J8YA 3EHQA 3KSLA 5EN5D 1H2TC 1HU3A 4J8FA 4PS8A 1A17A 3CVQA 4W9RA 2X38A 3CHQA 1HZ4A 4HOQA 5LFAA 4GCNA 4JHKA 3AG1E 3FEXA 3GZ1A 4U07A 3DEPA 5FT9A 4F1SA 3PNTB 2XZDG 3CK8A 2BUGA 4B89A 3AS4A 4I2WA 1X81A 3FUNA 4YVOA 3MKRA 4J8EA 4GZCA 1TNYA 4DPRA 2PNNA 1TNZA 4CZ2D 3IEGA 1IKND 5ANLA 3EIQC 4NRHB 4FULA 3DSVA 1QNFA 2V5FA 4N3AA 1QYMA 2R17C 2Y0BG 4JD2G 2V4HC 4MRUA 4HVBA 4B8AA 4CGVA 3U3WA 1JCQA 3T8KA 3J5QB 2WXGA 4L9PA 2X6IA 3RRNB 2P9SG 3T5XA 3MX3A 5ENNA 1E7UA 2PQRA 3EUVA 4OYSA
chains in the Genus database with same CATH topology
4KVMA 4L2YA 3SD5A 3Q15A 1IQUA 4ANVA 3PUKA 2FEZA 4PH4B 1GW6A 4JVSA 2YNQA 5FQ6A 1Y8MA 1HF8A 2E0IA 4CRWA 4EBAA 4PS7A 3MCXA 5A23A 2J07A 4GPKA 2WQHA 1SZ9A 3G2SA 2AXVA 1E8ZA 1MQSA 3PUJA 4FP7A 4FJYA 5E76A 3GZSA 4GMJA 1QQEA 4D10C 1EPUA 1W3BA 2WVIA 5BV1A 5JJ7A 3B7SA 3EHNA 3LY8A 2IJGX 4I6GA 4GA1A 4CT0A 1ELRA 3P2BA 4UQZA 2V4LA 4B0ZA 3O48A 1WM5A 3LXUX 3ZPJA 5JHBA 2FBNA 4JXTA 1B89A 5ARFA 3CQCB 4H7XA 3U4TA 4A1GA 1NA3A 3CVWA 3ZW3A 1OWPA 3ASHA 3CSFA 3PEUB 4WNEA 4WAFA 3D9OA 2LAHA 1SQMA 1HFAA 1KT1A 2ZU6B 2GGFA 3FUMA 4TRQA 4DLOA 3FUDA 4LERA 1E90A 3OXFA 3MJWA 4I9CA 3LPZA 3LEWA 3IKOB 4APFA 1NZNA 3UT8A 3KD7A 3S7JA 3PRZA 4LEUA 4UWGA 4I9EA 4XI9A 2WXLA 3FU6A 2KM4A 4QFVA 3TAXA 4GZDA 4ANWA 1KT0A 4ATGA 1DNPA 4I1MA 3MV3B 2VQ2A 4GYYA 3SBSA 3QNKA 4JEHA 3TXNA 2WB2A 3APCA 2GRLA 3QJZA 5BPPA 4L1BA 1JUQA 5EKQD 3AU4A 4F7AA 2I2OA 2X3MA 5FZRA 1E8YA 3CR3A 3ESKA 3B13A 1PY1A 3FTUA 3FTYA 5JJTA 2HM8A 3MKQA 4F3VA 3O4ZA 3OXLA 3ASDA 1U3CA 4LUNU 3EJNA 4ANUA 4JA9A 5AJDA 1YA0A 2OVBA 4U0SA 3G2UA 3WXXA 3CVUA 1EF1C 3FU5A 3NZSA 3PREA 4BSXA 4E85A 4BY6A 3D9KA 4ABNA 1N54A 4LRZA 2WXIA 3L22A 3TGOA 4RVBA 3I5PA 3BG1B 3PEVB 3I4GA 3N71A 5BV0A 3CHOA 2RD0A 3ASGA 4WNDA 4HORA 3PE3A 2HR2A 3S7BA 3CSTA 5M72A 4WWPA 4Y6CA 5JJ6A 4GU5A 3IHVA 3BEEA 5G04C 3R9AB 3FUJA 1ZBPA 1DVPA 2XGOA 2FO7A 4UWHA 5A6CA 2XCBA 3D9MA 4PS3A 5BT1A 4GAAA 2WM9A 3ZEFA 3L6AA 4BTAA 3SZ7A 4BT8A 1EYHA 2VGYA 1BPOA 2WXRA 1FCHA 4AY6A 2C0MA 2IF4A 2J9QA 5AIJA 1X5BA 3MV2B 2CHXA 1N52A 2J49A 2XRYA 3RJVA 2LO6A 3FH8A 3SI5A 2VGXB 2XGSA 3CVLA 2IQCA 4G26A 5BW8C 4AEZC 4I1OB 4JC8A 3T8MA 2XPIA 2C2LA 4E6HA 3B7RL 4URKA 2KZTB 3CKCA 2DBAA 3EDTB 4U0ZA 3I4RB 1UJKA 1HH8A 2KATA 3KEZA 5FTPA 1HG2A 2I1JA 3VLEA 4MS6A 3R7QA 4UI9C 3D9LA 4GCOA 5FWQA 4APOA 2HYZA 1HE8A 5E75A 3CK9A 2HO1A 3D9JA 3P1UA 2LSUA 3B7TA 4I17A 1LF8A 5AYWD 4ME2A 1UJJA 3RRUA 3RIBA 2WXHA 3TL5A 3ML9A 4GA0A 2KCVA 3TJPA 2I1KA 4CCAA 3FDHA 1UG3A 5CCLA 2E2EA 4DI4A 4R7LA 5FQ8A 2FULA 3TG5A 1H6KA 4CEMA 2X6FA 1IYGA 2NSZA 4JZYA 4U0UA 4N5CA 2WQ6A 4HXIA 2IOSA 2PM7A 2X6JA 4KVOA 5DBKA 1NP7A 3L17A 3L54A 1PC2A 4WNGA 3ZYKA 1ELWA 2XRZA 3PH0C 3RRMB 3IBEA 3Q5MA 2CG2A 2Y4TA 2X6KA 3S7DA 5KJKA 3OTNA 3U64A 4G24A 1UN9A 2XGMA 3LY9A 4EQFA 5EX0A 4UQYA 1Z6TA 5G05C 1EDUA 2VTBB 3QDNA 1S0PA 4LCTA 3CIAA 4NQ0A 4C9BB 2PZIA 3QARA 3LS8A 4I43A 3CV0A 4UWKA 3ZXSA 3FY4A 3AS5A 4J0UA 4JW1A 5T3RA 2VYIA 1E8XA 2WXQA 4IYPA 3CGHA 3G2WA 4RSYA 3G2VA 4EZKA 1L5JA 4XE0A 2UWJG 4AJWA 3CVXA 3BG0B 4KZ0A 4ACLA 2XEVA 2J4DA 3LVQE 3PS6A 3MGBA 3ONKA 4K03A 1Z3XA 4PUCA 3FUIA 2IFUA 5CMYA 5A7DB 3QOUA 1QZ2A 5FQ7A 2L0TB 3RO3A 1IHGA 5FQ4A 2IU1A 3ASFA 3UPVA 4XKCA 2MOWA 3U9WA 4RG6A 4L7TA 3Q4AB 3UQ3A 1HXIA 1Y6IA 3CVNA 3HVEB 4UQXA 3EIJA 4EBAG 4U8HA 2QY7A 5C2YA 4WWNA 3G2TA 2AXZA 5ANRA 3OAWA 2J09A 2J4BA 3Q49B 3JUIA 3RO2A 4FLHA 1KLXA 2KCLA 2A4ZA 5LX8A 3CVPA 3URZA 3PZDA 2WXJA 2NXPA 1HG5A 4L23A 2OOEA 3AS8A 2MHKA 4WUYA 4FLBA 4WWOA 3CVVA 1VDYA 4HOTA 1P5QA 4XI0A 2VTBA 1E96B 4AV7A 4G25A 3VLFA 4P29A 1UW4B 4JEUA 1TJCA 3ZVVA 4OYSA 3NF1A 3QKYA 4GA2A 2OVFA 5KCMA 3ZN3A 2WQ7A 2DCPA 3QK0A 3VLDA 4H7YA 1TJFA 2I6HA 2DIWA 3MKQB 3DPDA 1OWNA 4NACA 4MKTA 3NQPA 5FZSA 3SBTB 2QFCA 4DI3A 3IV0A 4I2ZA 4Q96A 3ZGQA 2AVPA 3FEYA 4GZ6A 2L9BA 2L0IA 2R59A 4BFRA 3L13A 4KBQA 1FVFA 5D0OD 5KJMA 2X6HA 3E4BA 4BX8A 2CHWA 3PDNA 3QWVA 4Q94A 2LNIA 1IQRA 4HLEA 3ZFWA 5G2NA 2FI7A 4B94A 5LP0A 3ZYLA 4RG9A 3AU5A 3GW4A 3QAQA 4GYWA 4EZJA 4N3BA 3KAEA 4BTBA 5CHEE 4EZLA 4HS2A 1TEZA 5ARGA 2XPZA 1SZAA 3HIZA 4IRUA 3ZRHA 1ELKA 1HS6A 3VTXA 2J08A 3FH5A 4KXKB 3TXMA 3UUXA 2Y3AA 4N3CA 4ACKA 3D9NA 3FTXA 2EQXA 3QWWA 4O6FA 3ZHEB 3DBSA 4TUUA 2AWIA 4U63A 1WAO1 3EHMA 3ML8A 2YINA 4YNDA 5LCWC 3ONLA 2A5UA 3FTVA 4IN3B 3RKVA 4UWFA 2L6JA 2VSNA 2PM6A 2VJ8A 3CVYA 1JWGA 4ANXA 5J08A 3FFLA 5C1DA 2PQNA 3CHMA 5T8IA 2CFZA 3FU3A 3FUFA 2Y4UA 1WY6A 2KC7A 3ZIMA 3B7UX 4AM9A 2VSXE 2YQ8A 2CG3A 3JCKC 4KZCA 5BNWA 3FUEA 4C0MA 4GZ3A 4EECA 1JWFA 4CDNA 1UN8A 1XNFA 4L2LA 5FJYA 4V3IA 3FP3A 3JQ0A 3CK7A 1FVHA 1U3DA 4BT9A 2GW1A 1H0AA 4HOUA 2PL2A 4U04A 3FULA 4JHRA 1E7VA 2YHCA 4KT6B 3PVLA 4PDXA 4YVQC 2UY1A 3MZLB 4B8CB 2AW6A 2JEKA 3QWPA 4I6EA 5D0QD 2V0PA 3GZ2A 5LOZA 4DLQA 1INZA 3CQGB 3TG4A 5J90A 4JPSA 4MLPA 2WXMA 5AENA 4XX5A 4CDRA 3K9IA 4ILHB 3L08A 4TV3A 4WNFA 2ILRA 3CHRA 4FJZA 3UT7A 4DK5A 2UY1B 2WXOA 3CHPA 4OVUA 4FA6A 5HQ8A 4AVXA 1OWOA 2YHEA 2IONA 1E8WA 2WMOA 4CGWA 3CKBA 4CDMA 3ENEA 4KMOA 3FUHA 3D9PA 5BUZA 1NA0A 2VSYA 3UMVA 3QB2A 2WPVA 3FTSA 4AOFA 2JLBA 1OUVA 5JHAA 2XPYA 3HDXA 3S2AA 4HOSA 4F53A 4ILGA 3LVRE 3FTWA 3LY7A 4AXHA 2MRIA 2XCCA 4FU3A 3RU0A 4M3OA 3I3NA 4XZ4A 1OWLA 1XGWA 3FWVA 3FUKA 3ESLA 1H2TC 2I9CA 1HU3A 2LAIA 3SNXA 2AXUA 2XHEA 5AJLA 4J8FA 3UT4A 4PS8A 1A17A 5DIZA 2P58C 3CVQA 4W9RA 3S7FA 3UX4A 3ZYQA 4N2SA 2NC9A 2Q7FA 1HO8A 2V8SE 2WXFA 2X38A 4NURA 3CHQA 5EX3A 5KJLA 3FH7A 3QC1A 1HZ4A 1PAQA 4BWRA 2OV8A 5FZQA 4HOQA 5LFAA 3D3MA 4GCNA 3MYVA 2CHZA 2RG8A 4JHKA 3ZHEA 2FF4A 4GZ5A 4FADA 3U66A 3JYSA 2WMNA 3PNLB 2CFUA 2VGXA 3FEXA 3GZ1A 4N2QA 3FHEA 3HVEA 4GMLA 3FU0A 4U07A 3APDA 3FTZA 3PNTB 5FT9A 3SFZA 4F1SA 4KYOB 3CK8A 4C0EA 3APFA 2BUGA 2KCKA 4B89A 4DJAA 4I1AA 3KS2A 3AS4A 4IULA 4J8DA 3VTYA 4I2WA 4JL0A 3OXGA 1ZU2A 3FUNA 3LCAA 4YVOA 1MHQA 3MKRA 4FHKA 5HI7A 2R5SA 3SF4A 3IHYA 4J8EA 4GZCA 5CCMA 4JA7A 3LDZA 3LJ3A 4A3VA 4DPRA 3SHFA 3SGHA 2M63A 4GB9A 4A55A 5EDSA 2WXNA 4AIFA 2KZTA 3JQ1A 4JHJA 1H2UA 4Q69A 1Z3YA 3MEKA 3IEGA 4UI9K 4CT4A 5CMWA 2BTDA 3MA5A 2IOLA 3ZYMA 4FC8A 5ANLA 4FHJA 3CEQA 2ONDA 4G1TA 4GYOA 5LCWJ 3EIQC 3R7RA 4NRHB 5T4YA 4A1SA 4FULA 1QNFA 3CLJA 4G23A 2V5FA 4N3AA 3D9IA 5KJNA 1H19A 2R17C 5G04J 4N39A 2LSVA 2XQ0A 3HHMA 4UI9J 3RK6A 4ILIA 2WXKA 4AP2A 1OWMA 4XKBA 4Y6WA 4AY5A 4MRUA 4HVBA 2VSOE 4I6JA 4B8AA 4CGVA 2WXPA 3L16A 3ULQA 3U3WA 1JPLA 2BF0X 4EPZA 1H2VC 4BX9A 5G55A 2WXGA 2C0LA 5G05J 3PE4A 4A3TA 3LYAA 2X6IA 3HYMB 3Q47B 3RRNB 3GYZA 4HFGA 3T5XA 3MX3A 3NZUA 4G2VA 4XIFA 4G11A 4UWLA 4K0RA 3T5VA 5ENNA 4J6IA 3C98A 1E7UA 3CHSA 2PQRA 4OVVA 4J8SA 2GRMA 3LKUA 1HX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8C B;  2RG8 A;  2VSO E;  3EIJ A;  4JHK A;  2KZT A;  4JHJ A;  1UG3 A;  4B8A A;  1H2U A;  4CT4 A;  2I2O A;  2FUL A;  5ANR A;  3FEX A;  1H2V C;  1H6K A;  4CEM A;  3JUI A;  2IOL A;  2HM8 A;  2KZT B;  2NSZ A;  2VSX E;  4GML A;  4LUN U;  2ZU6 B;  4CRW A;  2GGF A;  2IOS A;  3EIQ C;  1H2T C;  1HU3 A;  3FEY A;  4B89 A;  4IUL A;  3L6A A;  1N54 A;  2ION A;  2IU1 A;  4GMJ A;  1UW4 B;  3RK6 A;  4C9B B;  1PAQ A;  1N52 A;  3D3M A; 
#chains in the Genus database with same CATH topology
 3Q15 A;  5FQ6 A;  1Y8M A;  1HF8 A;  5KBA A;  1TN6 A;  4GPK A;  2AXV A;  2ZGD A;  1E8Z A;  5E76 A;  3GZS A;  5BV1 A;  3T9K A;  4CT0 A;  4U8Y D;  1WM5 A;  4JB8 P;  4A1G A;  3CQC B;  3ZW3 A;  1OWP A;  1DCQ A;  3PEU B;  4XEI G;  1SQM A;  1HFA A;  3FUD A;  1E90 A;  3LEW A;  1NZN A;  3UT8 A;  1FT1 A;  4XI9 A;  4QFV A;  1WG0 A;  3AJI A;  3ULY A;  4ATG A;  3DEO A;  1DNP A;  4I1M A;  4GYY A;  3TXN A;  5EKQ D;  2X3M A;  3CR3 A;  3B13 A;  3X2Q E;  3Q75 A;  4F3V A;  1KZP A;  3OXL A;  3ASD A;  4LUN U;  4YDO A;  3D9K A;  4ABN A;  2WXI A;  3L22 A;  4GTQ A;  3PEV B;  3UIP C;  2RD0 A;  4WND A;  2H6F A;  4WWP A;  1LD8 A;  3PZ1 A;  3E30 A;  4OAU C;  4NIK A;  1DVP A;  3Q78 A;  3DSS A;  2XZT G;  3ZEF A;  3AG4 E;  1BPO A;  2J9Q A;  1KPS B;  2J49 A;  2LO6 A;  4G26 A;  1Q2Z A;  4E6H A;  2DBA A;  4U0Z A;  2OEV A;  3TWW A;  4DX6 D;  3VLE A;  3R7Q A;  3SY2 A;  2RFM A;  1HE8 A;  1K1A A;  5E75 A;  3D9J A;  3B7T A;  1UJJ A;  3RIB A;  2I1K A;  5HRY A;  3FDH A;  1UG3 A;  5CCL A;  4R7L A;  4GTP A;  4CEM A;  3TWV A;  4JZY A;  4BEP A;  1NP7 A;  3L54 A;  2XRZ A;  3ZYK A;  3TWQ A;  2R05 A;  5KJK A;  1UN9 A;  5EX0 A;  4UQY A;  2GRP B;  1EDU A;  2VTB B;  3C5R A;  4C9B B;  2PZI A;  3QAR A;  4J0U A;  2WXQ A;  3G2W A;  1MX2 A;  2OEW A;  4AJW A;  2P9N G;  4KZ0 A;  2XEV A;  3LVQ E;  4U95 D;  4K03 A;  5D66 A;  1MX6 A;  5A7D B;  3RO3 A;  3TWU A;  3Q4A B;  1FPP A;  4LSZ E;  4UQX A;  1YYH A;  3EIJ A;  5C2Y A;  3OAW A;  2J09 A;  5LX8 A;  2XEN A;  5CED B;  2WXJ A;  5ENS D;  3VLF A;  4JEU A;  3ZVV A;  3VLD A;  1H6P A;  1D8E A;  4HRL A;  5AQA A;  1H6O A;  5ENQ D;  4GZ6 A;  5KJM A;  1FVF A;  5D0O D;  4Q94 A;  4B94 A;  5LP0 A;  4RG9 A;  3KAE A;  5ARG A;  4UUC A;  3E33 A;  3VTX A;  2R02 A;  3UUX A;  2Y3A A;  4ACK A;  3ZHE B;  4U63 A;  3ML8 A;  3ONL A;  2A5U A;  5B1A E;  2VSN A;  4QQI A;  2CFZ A;  4C48 B;  2KC7 A;  3UM2 A;  3JCK C;  3FUE A;  4GZ3 A;  4CDN A;  1XNF A;  3UIN C;  3JQ0 A;  4HRM B;  4OAV B;  4U04 A;  1TR4 A;  1K1B A;  5KNH D;  4KT6 B;  4LNU D;  4PDX A;  2UY1 A;  4B8C B;  2XEH A;  2AW6 A;  2V0P A;  3GZ2 A;  3TG4 A;  5J90 A;  4JPS A;  4MLP A;  4ILH B;  4FJZ A;  2WXO A;  4OVU A;  4FA6 A;  4GTV A;  4AVX A;  3PZ3 A;  4CGW A;  3CKB A;  5AAR A;  2VSY A;  3QB2 A;  4AOF A;  2JLB A;  1YMP A;  1OUV A;  4ILG A;  3LY7 A;  3LJN A;  2MRI A;  3RU0 A;  4XZ4 A;  1XGW A;  3FWV A;  5CEA A;  2I9C A;  2LAI A;  3IXE A;  4HBD A;  3UT4 A;  4DX7 D;  2P58 C;  3S7F A;  5EIL A;  2H6H A;  5KJL A;  3C3O A;  5EX3 A;  4B93 B;  3QC1 A;  4BWR A;  2OV8 A;  3D3M A;  2FF4 A;  4GZ5 A;  3U66 A;  2CFU A;  2Y1L E;  4N2Q A;  3APD A;  3FTZ A;  4C0E A;  1TNO A;  3APF A;  3VTY A;  5HI7 A;  3SHF A;  3V31 A;  2WXN A;  4AIF A;  3JQ1 A;  3MEK A;  5CMW A;  2L6B A;  2BTD A;  3MA5 A;  4FHJ A;  4GYO A;  3R7R A;  5T4Y A;  4K5C A;  5KJN A;  2XQ0 A;  3HHM A;  4ILI A;  1OWM A;  2F8X K;  4I6J A;  2V5Q C;  4YDW A;  4EPZ A;  5AQB A;  4BX9 A;  5G55 A;  2LUH A;  2IY0 C;  3C3R A;  4A3T A;  3PE4 A;  3LYA A;  1TN8 A;  3Q47 B;  4G2V A;  4HRN A;  5JA4 D;  3T5V A;  4OVV A;  1TNB A;  3PUK A;  1GW6 A;  4JVS A;  2YNQ A;  1S64 A;  1NFI E;  4EBA A;  2J07 A;  2WQH A;  1SZ9 A;  3G2S A;  1BD8 A;  4FJY A;  2WVI A;  5JJ7 A;  4BET A;  2IJG X;  3DWL G;  3P2B A;  5JHB A;  2V4L A;  3O48 A;  3LXU X;  5ENP D;  2FBN A;  1B89 A;  3ASH A;  4WAF A;  3D9O A;  1KT1 A;  2ZU6 B;  2GGF A;  3FUM A;  3OXF A;  4I9C A;  3IKO B;  1N9A A;  1G3N B;  5JMN D;  3MV3 B;  4JEH A;  2GRL A;  5EYP F;  5FZR A;  1E8Y A;  3FTY A;  5JJT A;  1PY1 A;  3MKQ A;  4HI9 A;  2DWZ A;  3EJN A;  3PZ2 A;  5AJD A;  3WXX A;  2OVB A;  4U0S A;  4E85 A;  4O1O A;  4LRZ A;  4TXR A;  3TWT A;  2NYJ A;  3KSQ A;  3CHO A;  3PE3 A;  2HR2 A;  3S7B A;  5JJ6 A;  4GU5 A;  2BKG A;  5G04 C;  3FUJ A;  3ZKJ A;  2XGO A;  3L82 A;  5A6C A;  5BT1 A;  4BT8 A;  1FCH A;  3JXI A;  4G8K A;  1X5B A;  1N52 A;  3JXJ A;  3CVL A;  2LXM A;  5BW8 C;  4JC8 A;  3T8M A;  1N95 A;  3CKC A;  3EDT B;  4DX2 A;  5KNG A;  4MS6 A;  3D9L A;  2HYZ A;  1DCE A;  4ZHB A;  2HO1 A;  2LSU A;  4I17 A;  1LF8 A;  2ZIR A;  4ME2 A;  3RRU A;  2WXH A;  3TL5 A;  2KCV A;  5HKP A;  2QYU A;  4DRX E;  5FQ8 A;  1IYG A;  4U0U A;  4HXI A;  4KVO A;  4WNG A;  2LXL A;  3IBE A;  2X6K A;  3U64 A;  3NAW A;  3CV0 A;  4JW1 A;  1FT2 A;  5T3R A;  2VYI A;  1E8X A;  3CGH A;  4RSY A;  3G2V A;  4EHM A;  1L5J A;  3JUE A;  3CVX A;  3BG0 B;  4ACL A;  3V2X A;  5ENO D;  1O1T A;  4HQD A;  3MGB A;  5FIO A;  1Z3X A;  4PUC A;  4GTS A;  1QZ2 A;  2L0T B;  3DSU A;  1IHG A;  3UPV A;  4Z68 A;  2P9L G;  3ASN E;  4U8H A;  2AXZ A;  3JUI A;  3RO2 A;  4FLH A;  3CVP A;  2EIL E;  2NXP A;  1HG5 A;  2OOE A;  2MHK A;  4WUY A;  4FLB A;  2BED A;  4WWO A;  4O60 A;  4XI0 A;  1TJC A;  4GA2 A;  3ZN3 A;  3QK0 A;  4H7Y A;  2DIW A;  5EID A;  1OWN A;  4NAC A;  5FZS A;  3NQP A;  3SBT B;  3Q9U C;  3IV0 A;  2AVP A;  3FEY A;  2R03 A;  2L9B A;  4BFR A;  2X6H A;  3PDN A;  2DZN A;  3QWV A;  3ZNG A;  2RFA A;  3ZYL A;  5ITZ F;  3GW4 A;  4GYW A;  4N3B A;  1TEZ A;  2XPZ A;  1SZA A;  3TXM A;  3FTX A;  4TUU A;  2AWI A;  3EHM A;  2YIN A;  2DYS E;  4LG6 A;  3RKV A;  2PM6 A;  3CVY A;  2GRQ B;  4DX5 D;  3FFL A;  5C1D A;  5T8I A;  3FUF A;  1WY6 A;  3ZIM A;  2P9I G;  1JWF A;  4L2L A;  1UOH A;  1FVH A;  1OCO E;  4BT9 A;  4HOU A;  1N4S A;  1E7V A;  2YHC A;  3PVL A;  3MZL B;  1S63 A;  3SFX A;  4XX5 A;  4TV3 A;  4WNF A;  1TN7 A;  3E37 A;  2IO3 C;  5HQ8 A;  5FIN A;  3FUH A;  3TWR A;  3D9P A;  5ENT D;  3SO8 A;  3HDX A;  2XCC A;  1V54 E;  3I3N A;  1OWL A;  3FUK A;  3ESL A;  3SNX A;  2AXU A;  2XHE A;  5AJL A;  5CEC B;  3DSX A;  4BSZ B;  4U7E B;  2Q7F A;  1HO8 A;  2WXF A;  1MYO A;  1AP7 A;  4MBG A;  3MYV A;  2RG8 A;  3ZHE A;  4FAD A;  3JYS A;  2WMN A;  3PNL B;  2VGX A;  4M7C A;  3HVE A;  4GML A;  3FU0 A;  2MYO A;  3UXG A;  4I1A A;  4IUL A;  3OXG A;  3LCA A;  1MHQ A;  3SF4 A;  5CCM A;  4JA7 A;  3LDZ A;  3LJ3 A;  4A3V A;  2M63 A;  3Q73 A;  4A55 A;  5EDS A;  1BLX B;  1H2U A;  4Q69 A;  1Z3Y A;  4UI9 K;  1RZ4 A;  2IOL A;  4G1T A;  1IXV A;  3CLJ A;  4G23 A;  3NOC D;  1MZC A;  3D9I A;  1H19 A;  4O1P A;  2IO2 C;  4N39 A;  2LSV A;  5G04 J;  3HXD A;  4UI9 J;  3RK6 A;  2WXK A;  4AP2 A;  5CRU A;  4XKB A;  2QZA A;  4Y6W A;  1N4R A;  3ULQ A;  2BF0 X;  3C72 A;  3RSE G;  1N4Q A;  3GYZ A;  4HFG A;  3NZU A;  1JCS A;  4XIF A;  3DSW A;  4J6I A;  2GRM A;  4KVM A;  3SD5 A;  4ANV A;  2FEZ A;  2E0I A;  5A23 A;  3Q79 A;  5ENR D;  4D10 C;  1W3B A;  3B7S A;  4I6G A;  4GA1 A;  3UTM A;  4HI8 A;  4B0Z A;  1N0R A;  3ZPJ A;  4JXT A;  3U4T A;  4H7X A;  3CVW A;  4WNE A;  2LAH A;  4A63 B;  3HXB A;  1IHB A;  4LER A;  3MJW A;  4U8V D;  3KD7 A;  3S7J A;  3UIO C;  3FU6 A;  2KXP C;  3E32 A;  1TNU A;  3QNK A;  3V2O A;  2WB2 A;  5H7P A;  4L1B A;  3AU4 A;  4F7A A;  2I2O A;  3ABK E;  3ESK A;  3FTU A;  2HM8 A;  5D2M C;  3O4Z A;  1U3C A;  4ANU A;  4JA9 A;  1YA0 A;  3G2U A;  4F6R D;  3FU5 A;  3E34 A;  3PRE A;  4BSX A;  4BY6 A;  1N54 A;  1N4P A;  1OCC E;  4RVB A;  3I5P A;  4LNB A;  3AAA C;  3I4G A;  3B7B A;  3N71 A;  3BU8 A;  4HOR A;  3NB2 A;  1D9S A;  3CST A;  2P9U G;  5M72 A;  4BES A;  1WDY A;  3C3Q A;  3R9A B;  3ABL E;  2XCB A;  4PS3 A;  4GAA A;  2WM9 A;  3L6A A;  3SZ7 A;  3BUA A;  2VGY A;  2WXR A;  3D9H A;  5AIJ A;  2CHX A;  3FH8 A;  1NI1 A;  2VGX B;  2IQC A;  4I1O B;  2C2L A;  3AG2 E;  3ULE G;  3I4R B;  2KAT A;  1HH8 A;  3KEZ A;  5FTP A;  1HG2 A;  2I1J A;  4GCO A;  1N0Q A;  4GMR A;  5AYW D;  2ETB A;  1YCS B;  4DI4 A;  1O1R A;  4N5C A;  2JAB A;  2WQ6 A;  2IOS A;  2X6J A;  5DBK A;  3L17 A;  1ELW A;  2R2L A;  2Y4T A;  4TXP A;  3S7D A;  4G24 A;  3LY9 A;  4EQF A;  5G05 C;  1Z6T A;  3ZXP A;  1S0P A;  2GRO B;  1BI8 B;  4UWK A;  3FY4 A;  3AS5 A;  4YDY A;  2J4D A;  3QOU A;  5FQ7 A;  2P9P G;  3ASF A;  2MOW A;  3U9W A;  4RG6 A;  4CYM D;  1HXI A;  2HE0 A;  4EBA G;  1BU9 A;  2QY7 A;  4WWN A;  1V55 E;  5ANR A;  2F37 A;  2J4B A;  3Q49 B;  1MJ0 A;  2KCL A;  3URZ A;  5AN8 A;  4U96 D;  3CVV A;  1VDY A;  4HOT A;  1P5Q A;  1K3Z D;  2ZIS A;  2VTB A;  1N94 A;  1E96 B;  1LD7 A;  4AV7 A;  4G25 A;  1UW4 B;  5KCM A;  3QKY A;  2WQ7 A;  1TYQ G;  2DCP A;  1TJF A;  2I6H A;  3MKQ B;  3DPD A;  3DST A;  4MKT A;  2QFC A;  4DI3 A;  5BXO A;  4I2Z A;  4Q96 A;  3ZGQ A;  3V30 A;  2L0I A;  2R59 A;  2P2C P;  3E4B A;  3R9M A;  4BX8 A;  2CHW A;  2LNI A;  4HLE A;  3HXC A;  3ZFW A;  2FI7 A;  2EIK E;  2VGE A;  3QAQ A;  3WG7 E;  5CHE E;  4HS2 A;  2IEJ A;  5IY5 E;  2XS8 A;  3ZRH A;  1ELK A;  1HS6 A;  3FH5 A;  4N3C A;  3ABM E;  2Y69 E;  3QWW A;  2EQX A;  3DBS A;  1WAO 1;  4YND A;  1BI7 B;  1RW2 A;  1OXJ A;  4UWF A;  2L6J A;  2VJ8 A;  5J08 A;  4ANX A;  4RQI A;  2Y4U A;  2BKK B;  3B7U X;  4AM9 A;  4C0M A;  4EEC A;  1UN8 A;  5FJY A;  4V3I A;  1D8D A;  1U3D A;  1NL4 A;  1H0A A;  2PL2 A;  2RKK A;  4JHR A;  1KZO A;  1SW6 A;  1A5E A;  2JEK A;  2ETC A;  3QWP A;  1INZ A;  3CQG B;  3HG0 D;  1U2V G;  4CDR A;  2ILR A;  2AJA A;  3CHP A;  1OWO A;  2ION A;  2WMO A;  3UM3 A;  1S70 B;  4KMO A;  5BUZ A;  2FO1 E;  5B3S E;  2GRR B;  2WPV A;  2XPY A;  3S2A A;  3EU5 A;  4F53 A;  3LVR E;  4FU3 A;  5DIZ A;  3UX4 A;  3ZYQ A;  4N2S A;  2QC9 A;  2NC9 A;  2V8S E;  1SA5 A;  4NUR A;  3Q7F A;  3FH7 A;  1PAQ A;  5FZQ A;  2CHZ A;  3EHR A;  3FHE A;  4DUI A;  3SFZ A;  3TWX A;  4KYO B;  3DRA A;  2KCK A;  4DJA A;  3KS2 A;  4J8D A;  4JL0 A;  1ZU2 A;  4FHK A;  2R5S A;  3IHY A;  3UM1 A;  1O1S A;  2EIJ E;  3SGH A;  5AQ7 A;  4GB9 A;  4DX1 A;  4N5Q A;  2KZT A;  4JHJ A;  4CT4 A;  2F8Y A;  3ZYM A;  4FC8 A;  2GRN B;  3CEQ A;  2OND A;  5LCW J;  4A1S A;  4HNA D;  4YDE A;  2B6C A;  2ZXW E;  3RAU A;  4AY5 A;  2VSO E;  2WXP A;  3L16 A;  1Z5S C;  4ATZ D;  1JPL A;  1H2V C;  3W9F A;  1K8K G;  2C0L A;  5G05 J;  3HYM B;  4G11 A;  4LNG A;  4UWL A;  1LTX A;  4K0R A;  3C98 A;  3CHS A;  2ETA A;  4J8S A;  3LKU A;  1HX8 A;  4L2Y A;  1IQU A;  3ZUV B;  4PH4 B;  4CRW A;  5CRV A;  4G8L A;  4PS7 A;  3MCX A;  1MQS A;  3AG3 E;  3PUJ A;  4FP7 A;  4GTM A;  4GMJ A;  1QQE A;  1EPU A;  3F6Q A;  3EHN A;  3LY8 A;  3NBN B;  1ELR A;  3UKR G;  4UQZ A;  1SA4 A;  5ARF A;  5EYL A;  1NA3 A;  3CSF A;  1ZB1 A;  4TRQ A;  4DLO A;  3LPZ A;  4APF A;  3PRZ A;  4LEU A;  4TUM A;  2P9K G;  5CBO A;  4UWG A;  4I9E A;  2WXL A;  3TAX A;  2KM4 A;  4ANW A;  2OCC E;  4GZD A;  1KT0 A;  2XS1 A;  3Q7A A;  2VQ2 A;  3SBS A;  3APC A;  3QJZ A;  5BPP A;  1JUQ A;  3TWS A;  3UKU G;  3J5P A;  3CVU A;  1EF1 C;  3NZS A;  1OT8 A;  1MX4 A;  2EIN E;  3TGO A;  3BG1 B;  5BV0 A;  3ASG A;  3ISM C;  4GTO A;  4Y6C A;  3UI2 A;  3IHV A;  3BEE A;  1ZBP A;  2KBX A;  1QBQ A;  2FO7 A;  4TXQ A;  4UWH A;  3D9M A;  1OY3 D;  4BTA A;  5CBN A;  3V79 K;  1EYH A;  4AY6 A;  2IF4 A;  2C0M A;  5CER B;  3MV2 B;  2XRY A;  3DXK G;  4J7W A;  3RJV A;  3SQV A;  3SI5 A;  2XGS A;  3BQO A;  4AEZ C;  3EU9 A;  1DC2 A;  2XPI A;  3B7R L;  4URK A;  2KZT B;  4GPM A;  1UJK A;  3W9G A;  4UI9 C;  5FWQ A;  4APO A;  3CK9 A;  3P1U A;  5AAO A;  2DVW A;  3ML9 A;  4GA0 A;  3ZU7 B;  3TJP A;  4CCA A;  2E2E A;  4X8Q A;  2FUL A;  3TG5 A;  1H6K A;  2X6F A;  1O5M A;  2NSZ A;  3UM0 A;  2PM7 A;  1PC2 A;  3PH0 C;  3RRM B;  3Q5M A;  2CG2 A;  3OTN A;  5EIB E;  2XGM A;  2ZGG A;  3QDN A;  4LCT A;  3CIA A;  4NQ0 A;  3LS8 A;  4I43 A;  2XEE A;  3ZXS A;  3B95 A;  3HRA A;  4IYP A;  4EZK A;  4XE0 A;  2UWJ G;  2DYR E;  1SVX A;  4RLY A;  3HXE A;  3KEA A;  3PS6 A;  3ONK A;  3FUI A;  2IFU A;  5CMY A;  3L9T A;  5FQ4 A;  2IU1 A;  4XKC A;  3NOG D;  3UQ3 A;  4L7T A;  1Y6I A;  3CVN A;  3HVE B;  3G2T A;  1KLX A;  2A4Z A;  3PZD A;  4L23 A;  3AS8 A;  5KWD A;  4K5A B;  4P29 A;  3NF1 A;  2OVF A;  5B1B E;  3L13 A;  4KBQ A;  4HLL A;  4K5B A;  1IQR A;  2QYJ A;  5G2N A;  3SFY A;  3AU5 A;  2A5E A;  4EZJ A;  4BTB A;  2EIM E;  4EZL A;  3DXM G;  4GTT A;  4F1P A;  3HIZ A;  4IRU A;  2J08 A;  4KXK B;  4GTR A;  4BER A;  3D9N A;  4O6F A;  5LCW C;  3HXF A;  3FTV A;  4IN3 B;  1OCZ E;  1JWG A;  2PQN A;  3CHM A;  3FU3 A;  3Q9N C;  2VSX E;  2YQ8 A;  2CG3 A;  4KZC A;  5BNW A;  2H6I A;  3ASO E;  3FP3 A;  4HB5 A;  3CK7 A;  3DPY A;  2GW1 A;  5BXU A;  3FUL A;  4YVQ C;  2DZO A;  4ZFH A;  4I6E A;  5D0Q D;  5LOZ A;  4DLQ A;  2WXM A;  5AEN A;  5AQ9 A;  3K9I A;  3L08 A;  3CHR A;  3UT7 A;  5HS0 A;  4DK5 A;  2UY1 B;  1OCR E;  2YHE A;  1E8W A;  2B0O E;  1AWC B;  4CDM A;  3ENE A;  2J8S D;  1NA0 A;  3UMV A;  3FTS A;  3PZ4 A;  1JCR A;  5JHA A;  4HOS A;  2H6G A;  1N11 A;  3FTW A;  4AXH A;  2F0Y A;  4M3O A;  4J8Y A;  3EHQ A;  3KSL A;  5EN5 D;  1H2T C;  1HU3 A;  4J8F A;  4PS8 A;  1A17 A;  3CVQ A;  4W9R A;  2X38 A;  3CHQ A;  1HZ4 A;  4HOQ A;  5LFA A;  4GCN A;  4JHK A;  3AG1 E;  3FEX A;  3GZ1 A;  4U07 A;  3DEP A;  5FT9 A;  4F1S A;  3PNT B;  2XZD G;  3CK8 A;  2BUG A;  4B89 A;  3AS4 A;  4I2W A;  1X81 A;  3FUN A;  4YVO A;  3MKR A;  4J8E A;  4GZC A;  1TNY A;  4DPR A;  2PNN A;  1TNZ A;  4CZ2 D;  3IEG A;  1IKN D;  5ANL A;  3EIQ C;  4NRH B;  4FUL A;  3DSV A;  1QNF A;  2V5F A;  4N3A A;  1QYM A;  2R17 C;  2Y0B G;  4JD2 G;  2V4H C;  4MRU A;  4HVB A;  4B8A A;  4CGV A;  3U3W A;  1JCQ A;  3T8K A;  3J5Q B;  2WXG A;  4L9P A;  2X6I A;  3RRN B;  2P9S G;  3T5X A;  3MX3 A;  5ENN A;  1E7U A;  2PQR A;  3EUV A;  4OYS A; 
#chains in the Genus database with same CATH homology
 4KVM A;  4L2Y A;  3SD5 A;  3Q15 A;  1IQU A;  4ANV A;  3PUK A;  2FEZ A;  4PH4 B;  1GW6 A;  4JVS A;  2YNQ A;  5FQ6 A;  1Y8M A;  1HF8 A;  2E0I A;  4CRW A;  4EBA A;  4PS7 A;  3MCX A;  5A23 A;  2J07 A;  4GPK A;  2WQH A;  1SZ9 A;  3G2S A;  2AXV A;  1E8Z A;  1MQS A;  3PUJ A;  4FP7 A;  4FJY A;  5E76 A;  3GZS A;  4GMJ A;  1QQE A;  4D10 C;  1EPU A;  1W3B A;  2WVI A;  5BV1 A;  5JJ7 A;  3B7S A;  3EHN A;  3LY8 A;  2IJG X;  4I6G A;  4GA1 A;  4CT0 A;  1ELR A;  3P2B A;  4UQZ A;  2V4L A;  4B0Z A;  3O48 A;  1WM5 A;  3LXU X;  3ZPJ A;  5JHB A;  2FBN A;  4JXT A;  1B89 A;  5ARF A;  3CQC B;  4H7X A;  3U4T A;  4A1G A;  1NA3 A;  3CVW A;  3ZW3 A;  1OWP A;  3ASH A;  3CSF A;  3PEU B;  4WNE A;  4WAF A;  3D9O A;  2LAH A;  1SQM A;  1HFA A;  1KT1 A;  2ZU6 B;  2GGF A;  3FUM A;  4TRQ A;  4DLO A;  3FUD A;  4LER A;  1E90 A;  3OXF A;  3MJW A;  4I9C A;  3LPZ A;  3LEW A;  3IKO B;  4APF A;  1NZN A;  3UT8 A;  3KD7 A;  3S7J A;  3PRZ A;  4LEU A;  4UWG A;  4I9E A;  4XI9 A;  2WXL A;  3FU6 A;  2KM4 A;  4QFV A;  3TAX A;  4GZD A;  4ANW A;  1KT0 A;  4ATG A;  1DNP A;  4I1M A;  3MV3 B;  2VQ2 A;  4GYY A;  3SBS A;  3QNK A;  4JEH A;  3TXN A;  2WB2 A;  3APC A;  2GRL A;  3QJZ A;  5BPP A;  4L1B A;  1JUQ A;  5EKQ D;  3AU4 A;  4F7A A;  2I2O A;  2X3M A;  5FZR A;  1E8Y A;  3CR3 A;  3ESK A;  3B13 A;  1PY1 A;  3FTU A;  3FTY A;  5JJT A;  2HM8 A;  3MKQ A;  4F3V A;  3O4Z A;  3OXL A;  3ASD A;  1U3C A;  4LUN U;  3EJN A;  4ANU A;  4JA9 A;  5AJD A;  1YA0 A;  2OVB A;  4U0S A;  3G2U A;  3WXX A;  3CVU A;  1EF1 C;  3FU5 A;  3NZS A;  3PRE A;  4BSX A;  4E85 A;  4BY6 A;  3D9K A;  4ABN A;  1N54 A;  4LRZ A;  2WXI A;  3L22 A;  3TGO A;  4RVB A;  3I5P A;  3BG1 B;  3PEV B;  3I4G A;  3N71 A;  5BV0 A;  3CHO A;  2RD0 A;  3ASG A;  4WND A;  4HOR A;  3PE3 A;  2HR2 A;  3S7B A;  3CST A;  5M72 A;  4WWP A;  4Y6C A;  5JJ6 A;  4GU5 A;  3IHV A;  3BEE A;  5G04 C;  3R9A B;  3FUJ A;  1ZBP A;  1DVP A;  2XGO A;  2FO7 A;  4UWH A;  5A6C A;  2XCB A;  3D9M A;  4PS3 A;  5BT1 A;  4GAA A;  2WM9 A;  3ZEF A;  3L6A A;  4BTA A;  3SZ7 A;  4BT8 A;  1EYH A;  2VGY A;  1BPO A;  2WXR A;  1FCH A;  4AY6 A;  2C0M A;  2IF4 A;  2J9Q A;  5AIJ A;  1X5B A;  3MV2 B;  2CHX A;  1N52 A;  2J49 A;  2XRY A;  3RJV A;  2LO6 A;  3FH8 A;  3SI5 A;  2VGX B;  2XGS A;  3CVL A;  2IQC A;  4G26 A;  5BW8 C;  4AEZ C;  4I1O B;  4JC8 A;  3T8M A;  2XPI A;  2C2L A;  4E6H A;  3B7R L;  4URK A;  2KZT B;  3CKC A;  2DBA A;  3EDT B;  4U0Z A;  3I4R B;  1UJK A;  1HH8 A;  2KAT A;  3KEZ A;  5FTP A;  1HG2 A;  2I1J A;  3VLE A;  4MS6 A;  3R7Q A;  4UI9 C;  3D9L A;  4GCO A;  5FWQ A;  4APO A;  2HYZ A;  1HE8 A;  5E75 A;  3CK9 A;  2HO1 A;  3D9J A;  3P1U A;  2LSU A;  3B7T A;  4I17 A;  1LF8 A;  5AYW D;  4ME2 A;  1UJJ A;  3RRU A;  3RIB A;  2WXH A;  3TL5 A;  3ML9 A;  4GA0 A;  2KCV A;  3TJP A;  2I1K A;  4CCA A;  3FDH A;  1UG3 A;  5CCL A;  2E2E A;  4DI4 A;  4R7L A;  5FQ8 A;  2FUL A;  3TG5 A;  1H6K A;  4CEM A;  2X6F A;  1IYG A;  2NSZ A;  4JZY A;  4U0U A;  4N5C A;  2WQ6 A;  4HXI A;  2IOS A;  2PM7 A;  2X6J A;  4KVO A;  5DBK A;  1NP7 A;  3L17 A;  3L54 A;  1PC2 A;  4WNG A;  3ZYK A;  1ELW A;  2XRZ A;  3PH0 C;  3RRM B;  3IBE A;  3Q5M A;  2CG2 A;  2Y4T A;  2X6K A;  3S7D A;  5KJK A;  3OTN A;  3U64 A;  4G24 A;  1UN9 A;  2XGM A;  3LY9 A;  4EQF A;  5EX0 A;  4UQY A;  1Z6T A;  5G05 C;  1EDU A;  2VTB B;  3QDN A;  1S0P A;  4LCT A;  3CIA A;  4NQ0 A;  4C9B B;  2PZI A;  3QAR A;  3LS8 A;  4I43 A;  3CV0 A;  4UWK A;  3ZXS A;  3FY4 A;  3AS5 A;  4J0U A;  4JW1 A;  5T3R A;  2VYI A;  1E8X A;  2WXQ A;  4IYP A;  3CGH A;  3G2W A;  4RSY A;  3G2V A;  4EZK A;  1L5J A;  4XE0 A;  2UWJ G;  4AJW A;  3CVX A;  3BG0 B;  4KZ0 A;  4ACL A;  2XEV A;  2J4D A;  3LVQ E;  3PS6 A;  3MGB A;  3ONK A;  4K03 A;  1Z3X A;  4PUC A;  3FUI A;  2IFU A;  5CMY A;  5A7D B;  3QOU A;  1QZ2 A;  5FQ7 A;  2L0T B;  3RO3 A;  1IHG A;  5FQ4 A;  2IU1 A;  3ASF A;  3UPV A;  4XKC A;  2MOW A;  3U9W A;  4RG6 A;  4L7T A;  3Q4A B;  3UQ3 A;  1HXI A;  1Y6I A;  3CVN A;  3HVE B;  4UQX A;  3EIJ A;  4EBA G;  4U8H A;  2QY7 A;  5C2Y A;  4WWN A;  3G2T A;  2AXZ A;  5ANR A;  3OAW A;  2J09 A;  2J4B A;  3Q49 B;  3JUI A;  3RO2 A;  4FLH A;  1KLX A;  2KCL A;  2A4Z A;  5LX8 A;  3CVP A;  3URZ A;  3PZD A;  2WXJ A;  2NXP A;  1HG5 A;  4L23 A;  2OOE A;  3AS8 A;  2MHK A;  4WUY A;  4FLB A;  4WWO A;  3CVV A;  1VDY A;  4HOT A;  1P5Q A;  4XI0 A;  2VTB A;  1E96 B;  4AV7 A;  4G25 A;  3VLF A;  4P29 A;  1UW4 B;  4JEU A;  1TJC A;  3ZVV A;  4OYS A;  3NF1 A;  3QKY A;  4GA2 A;  2OVF A;  5KCM A;  3ZN3 A;  2WQ7 A;  2DCP A;  3QK0 A;  3VLD A;  4H7Y A;  1TJF A;  2I6H A;  2DIW A;  3MKQ B;  3DPD A;  1OWN A;  4NAC A;  4MKT A;  3NQP A;  5FZS A;  3SBT B;  2QFC A;  4DI3 A;  3IV0 A;  4I2Z A;  4Q96 A;  3ZGQ A;  2AVP A;  3FEY A;  4GZ6 A;  2L9B A;  2L0I A;  2R59 A;  4BFR A;  3L13 A;  4KBQ A;  1FVF A;  5D0O D;  5KJM A;  2X6H A;  3E4B A;  4BX8 A;  2CHW A;  3PDN A;  3QWV A;  4Q94 A;  2LNI A;  1IQR A;  4HLE A;  3ZFW A;  5G2N A;  2FI7 A;  4B94 A;  5LP0 A;  3ZYL A;  4RG9 A;  3AU5 A;  3GW4 A;  3QAQ A;  4GYW A;  4EZJ A;  4N3B A;  3KAE A;  4BTB A;  5CHE E;  4EZL A;  4HS2 A;  1TEZ A;  5ARG A;  2XPZ A;  1SZA A;  3HIZ A;  4IRU A;  3ZRH A;  1ELK A;  1HS6 A;  3VTX A;  2J08 A;  3FH5 A;  4KXK B;  3TXM A;  3UUX A;  2Y3A A;  4N3C A;  4ACK A;  3D9N A;  3FTX A;  2EQX A;  3QWW A;  4O6F A;  3ZHE B;  3DBS A;  4TUU A;  2AWI A;  4U63 A;  1WAO 1;  3EHM A;  3ML8 A;  2YIN A;  4YND A;  5LCW C;  3ONL A;  2A5U A;  3FTV A;  4IN3 B;  3RKV A;  4UWF A;  2L6J A;  2VSN A;  2PM6 A;  2VJ8 A;  3CVY A;  1JWG A;  4ANX A;  5J08 A;  3FFL A;  5C1D A;  2PQN A;  3CHM A;  5T8I A;  2CFZ A;  3FU3 A;  3FUF A;  2Y4U A;  1WY6 A;  2KC7 A;  3ZIM A;  3B7U X;  4AM9 A;  2VSX E;  2YQ8 A;  2CG3 A;  3JCK C;  4KZC A;  5BNW A;  3FUE A;  4C0M A;  4GZ3 A;  4EEC A;  1JWF A;  4CDN A;  1UN8 A;  1XNF A;  4L2L A;  5FJY A;  4V3I A;  3FP3 A;  3JQ0 A;  3CK7 A;  1FVH A;  1U3D A;  4BT9 A;  2GW1 A;  1H0A A;  4HOU A;  2PL2 A;  4U04 A;  3FUL A;  4JHR A;  1E7V A;  2YHC A;  4KT6 B;  3PVL A;  4PDX A;  4YVQ C;  2UY1 A;  3MZL B;  4B8C B;  2AW6 A;  2JEK A;  3QWP A;  4I6E A;  5D0Q D;  2V0P A;  3GZ2 A;  5LOZ A;  4DLQ A;  1INZ A;  3CQG B;  3TG4 A;  5J90 A;  4JPS A;  4MLP A;  2WXM A;  5AEN A;  4XX5 A;  4CDR A;  3K9I A;  4ILH B;  3L08 A;  4TV3 A;  4WNF A;  2ILR A;  3CHR A;  4FJZ A;  3UT7 A;  4DK5 A;  2UY1 B;  2WXO A;  3CHP A;  4OVU A;  4FA6 A;  5HQ8 A;  4AVX A;  1OWO A;  2YHE A;  2ION A;  1E8W A;  2WMO A;  4CGW A;  3CKB A;  4CDM A;  3ENE A;  4KMO A;  3FUH A;  3D9P A;  5BUZ A;  1NA0 A;  2VSY A;  3UMV A;  3QB2 A;  2WPV A;  3FTS A;  4AOF A;  2JLB A;  1OUV A;  5JHA A;  2XPY A;  3HDX A;  3S2A A;  4HOS A;  4F53 A;  4ILG A;  3LVR E;  3FTW A;  3LY7 A;  4AXH A;  2MRI A;  2XCC A;  4FU3 A;  3RU0 A;  4M3O A;  3I3N A;  4XZ4 A;  1OWL A;  1XGW A;  3FWV A;  3FUK A;  3ESL A;  1H2T C;  2I9C A;  1HU3 A;  2LAI A;  3SNX A;  2AXU A;  2XHE A;  5AJL A;  4J8F A;  3UT4 A;  4PS8 A;  1A17 A;  5DIZ A;  2P58 C;  3CVQ A;  4W9R A;  3S7F A;  3UX4 A;  3ZYQ A;  4N2S A;  2NC9 A;  2Q7F A;  1HO8 A;  2V8S E;  2WXF A;  2X38 A;  4NUR A;  3CHQ A;  5EX3 A;  5KJL A;  3FH7 A;  3QC1 A;  1HZ4 A;  1PAQ A;  4BWR A;  2OV8 A;  5FZQ A;  4HOQ A;  5LFA A;  3D3M A;  4GCN A;  3MYV A;  2CHZ A;  2RG8 A;  4JHK A;  3ZHE A;  2FF4 A;  4GZ5 A;  4FAD A;  3U66 A;  3JYS A;  2WMN A;  3PNL B;  2CFU A;  2VGX A;  3FEX A;  3GZ1 A;  4N2Q A;  3FHE A;  3HVE A;  4GML A;  3FU0 A;  4U07 A;  3APD A;  3FTZ A;  3PNT B;  5FT9 A;  3SFZ A;  4F1S A;  4KYO B;  3CK8 A;  4C0E A;  3APF A;  2BUG A;  2KCK A;  4B89 A;  4DJA A;  4I1A A;  3KS2 A;  3AS4 A;  4IUL A;  4J8D A;  3VTY A;  4I2W A;  4JL0 A;  3OXG A;  1ZU2 A;  3FUN A;  3LCA A;  4YVO A;  1MHQ A;  3MKR A;  4FHK A;  5HI7 A;  2R5S A;  3SF4 A;  3IHY A;  4J8E A;  4GZC A;  5CCM A;  4JA7 A;  3LDZ A;  3LJ3 A;  4A3V A;  4DPR A;  3SHF A;  3SGH A;  2M63 A;  4GB9 A;  4A55 A;  5EDS A;  2WXN A;  4AIF A;  2KZT A;  3JQ1 A;  4JHJ A;  1H2U A;  4Q69 A;  1Z3Y A;  3MEK A;  3IEG A;  4UI9 K;  4CT4 A;  5CMW A;  2BTD A;  3MA5 A;  2IOL A;  3ZYM A;  4FC8 A;  5ANL A;  4FHJ A;  3CEQ A;  2OND A;  4G1T A;  4GYO A;  5LCW J;  3EIQ C;  3R7R A;  4NRH B;  5T4Y A;  4A1S A;  4FUL A;  1QNF A;  3CLJ A;  4G23 A;  2V5F A;  4N3A A;  3D9I A;  5KJN A;  1H19 A;  2R17 C;  5G04 J;  4N39 A;  2LSV A;  2XQ0 A;  3HHM A;  4UI9 J;  3RK6 A;  4ILI A;  2WXK A;  4AP2 A;  1OWM A;  4XKB A;  4Y6W A;  4AY5 A;  4MRU A;  4HVB A;  2VSO E;  4I6J A;  4B8A A;  4CGV A;  2WXP A;  3L16 A;  3ULQ A;  3U3W A;  1JPL A;  2BF0 X;  4EPZ A;  1H2V C;  4BX9 A;  5G55 A;  2WXG A;  2C0L A;  5G05 J;  3PE4 A;  4A3T A;  3LYA A;  2X6I A;  3HYM B;  3Q47 B;  3RRN B;  3GYZ A;  4HFG A;  3T5X A;  3MX3 A;  3NZU A;  4G2V A;  4XIF A;  4G11 A;  4UWL A;  4K0R A;  3T5V A;  5ENN A;  4J6I A;  3C98 A;  1E7U A;  3CHS A;  2PQR A;  4OVV A;  4J8S A;  2GRM A;  3LKU A;  1HX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...