2IOSA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form 3
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
124
Chain Sequence
PVNHLVKEIDMLLKEYLLSGDISEAEHLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed Cell Death 4, Pdcd4
publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antitumor protein
total genus 50
structure length 124
sequence length 126
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iosA00
2HM8A 3FEYA 2NSZA 2KZTA 4B8AA 1PAQA 2VSXE 4JHJA 2IOSA 1HU3A 3RK6A 2GGFA 2IONA 3L6AA 1H2VC 2KZTB 1H2UA 3EIJA 4C9BB 1H2TC 1N52A 4B8CB 2IOLA 4GMJA 2VSOE 4JHKA 1UW4B 1H6KA 2ZU6B 4CT4A 3D3MA 2FULA 3JUIA 2RG8A 2IU1A 4CEMA 4GMLA 4B89A 4LUNU 4CRWA 3EIQC 5ANRA 3FEXA 1UG3A 4IULA 1N54A 2I2OA
chains in the Genus database with same CATH superfamily
3ML8A 3DSXA 3FTWA 5FIOA 4MKTA 4L1BA 3AJIA 2LNIA 2OEVA 4GZ6A 3OXLA 2PZIA 3AG2E 3PREA 2RD0A 3CHQA 2AJAA 2WMOA 2LO6A 3QAQA 1OCOE 4I1OB 5BXOA 1IXVA 5ENPD 1H6OA 3QC1A 2QZAA 3RSEG 3GZ1A 5A23A 3U64A 5KNGA 4WWOA 3JXJA 3U66A 3FHEA 3Q75A 2DCPA 1TNBA 2IOSA 2I1JA 2IONA 2PM7A 5EDSA 3L22A 4E85A 4AVXA 4XKCA 3KSLA 3ZEFA 2X6FA 4WNGA 2UWJG 4RVBA 3P2BA 4U0ZA 3DSUA 1IQRA 3FEYA 2IF4A 3MGBA 1G3NB 4BEPA 4CGVA 1INZA 2F0YA 2KZTB 4DJAA 4KVOA 3UM2A 1TEZA 2WXQA 5ARFA 2L9BA 2HR2A 3Q49B 2IJGX 5AQ7A 3D9OA 2DYSE 4LCTA 1AP7A 4GZ5A 2VTBA 2DYRE 3KD7A 1JWGA 4F6RD 5JJ7A 4AIFA 2ZGGA 3KEZA 3UKUG 4RG6A 1O1TA 4RSYA 4LG6A 4PDXA 3EU9A 3ESLA 1S63A 2C2LA 2IU1A 2ILRA 1FVHA 4A3TA 5FJYA 2FEZA 3CK8A 4FU3A 3LEWA 2AVPA 3PH0C 4KMOA 2AW6A 4G8LA 3MKQA 5G04C 4I2WA 3IXEA 5ANLA 1O1RA 2FBNA 3TL5A 1WG0A 2XGOA 4ANVA 3E30A 1B89A 4EBAA 1JCQA 5AQAA 2A5EA 3ML9A 1K1BA 4NQ0A 5G04J 3CVUA 4FHJA 3TWUA 1WAO1 2ZGDA 3CHPA 2IOLA 2XEHA 3ULYA 4CCAA 3QDNA 1ELKA 3OAWA 1PC2A 4KZ0A 2LAIA 4HOTA 2UY1A 3MV2B 1SZAA 4G1TA 3KSQA 3NOCD 3BUAA 1E96B 1OWOA 2XCCA 4KYOB 4RLYA 2J4DA 1TNOA 1U2VG 1D8DA 4GAAA 3MJWA 3B7BA 1HFAA 3K9IA 4GYOA 1DCEA 3CLJA 4PH4B 3SFXA 3C98A 3HVEA 4K0RA 3TWWA 3LXUX 1ELRA 4GPMA 3JUEA 3J5QB 1QZ2A 3PZ4A 2QYJA 4JPSA 2PL2A 4PUCA 1HH8A 5ENOD 4A1GA 5IY5E 3QNKA 5FQ6A 5D2MC 1TYQG 3MYVA 3R9MA 1Z3YA 2P9IG 4UWHA 2R02A 3SD5A 3APCA 3FDHA 1UOHA 3ZGQA 2OOEA 2ETCA 2FF4A 3PNLB 4G11A 3S2AA 2MOWA 2C0MA 2EIME 1E7VA 3TXNA 2CHZA 4XI9A 4DX5D 3ASGA 1NA0A 3R9AB 3ZXSA 2J49A 5M72A 3PDNA 4U96D 3C72A 1Y6IA 2GRLA 4IYPA 3B7TA 4J8EA 4DUIA 3RAUA 4JEUA 4A1SA 2XPIA 1N4QA 4U95D 2XPZA 2AXVA 4ATGA 1UJJA 3EDTB 2X6HA 1YYHA 3UT4A 4WUYA 4J8YA 3I4GA 3SZ7A 2KCLA 4GYWA 2P9SG 5KJKA 4BX9A 2V4HC 3S7FA 3KAEA 3CVWA 1N0QA 3ZHEB 2KC7A 2WXHA 1N54A 2Y3AA 3D9KA 4JD2G 3SNXA 3RO3A 5D0QD 5C1DA 2WXLA 3NBNB 3EUVA 4ZFHA 2I9CA 3JQ1A 4GTOA 4RG9A 4JA9A 3DXKG 4A55A 3SBTB 3FEXA 3RRUA 3V2OA 4R7LA 3QWWA 3ASHA 4UQYA 2OVBA 3BQOA 4YDEA 3TWXA 4OVUA 3ZW3A 1PAQA 2WXGA 2H6IA 3OTNA 2R59A 3CHSA 2QFCA 2Y4TA 3PEUB 4TRQA 5E76A 5CBNA 1H6KA 3B7RL 4PS7A 2V4LA 3JQ0A 4AXHA 5HRYA 1NA3A 4TUUA 4GCNA 3ZIMA 3W9GA 1DCQA 4WNDA 4K5BA 5H7PA 3LJ3A 2WQHA 4BETA 5CCLA 5HKPA 5AJLA 2YINA 1UJKA 4N3BA 1IKND 2V5QC 1TJCA 5CHEE 3L9TA 1BD8A 2DWZA 4HRNA 1OWPA 4BSZB 4BWRA 3R7RA 2IFUA 1FT1A 2GGFA 3Q9NC 5KBAA 3TXMA 3EU5A 4GTVA 2WXMA 4CT0A 3EHMA 4DX7D 1E90A 1BPOA 3TG5A 4GZ3A 1K3ZD 5HS0A 2IQCA 4HI9A 4AEZC 1E8YA 3FU6A 1X81A 4Q96A 2Y69E 4B89A 3RO2A 1KZOA 4GTPA 4YDWA 3ASOE 3J5PA 1YMPA 1TR4A 4G8KA 3T5XA 3ISMC 4TUMA 2JLBA 3FUMA 5EN5D 2XQ0A 1ZU2A 5KNHD 3LYAA 2I6HA 2EILE 3D9NA 2VGXA 3AG1E 4HS2A 1JWFA 2KCVA 1SW6A 4HORA 3ZYKA 1TN6A 2VSYA 4DX6D 3BU8A 2F8YA 2BTDA 3DSSA 2L0IA 1XNFA 2Y4UA 4G25A 1IYGA 1K8KG 3D9HA 2HE0A 1Z3XA 4XIFA 3L17A 2GRPB 3HDXA 4HRMB 3FP3A 3UXGA 4B94A 2BF0X 1H2VC 3D9JA 4N5QA 5BXUA 1SVXA 3FUDA 5BNWA 1JPLA 5JA4D 4XEIG 3GZ2A 4PS8A 3FTXA 4EZKA 2LAHA 3OXGA 1N4PA 2X6IA 4EQFA 4HOSA 1GW6A 4NURA 2QC9A 4GA2A 1K1AA 3ZXPA 3TWVA 4ANXA 3L13A 3FUJA 3FTZA 4AM9A 5BUZA 3HIZA 5DBKA 5AIJA 4CEMA 1UN8A 4HBDA 5E75A 2ZISA 4HOQA 2DBAA 2WXJA 3VLEA 3AS4A 2H6GA 3TWQA 3UKRG 4DRXE 3ZRHA 3FU0A 1AWCB 5CRUA 4UI9C 5B1BE 4ANWA 4OAVB 3O48A 2VGEA 1U3CA 3FUKA 4I1AA 2LXLA 5ENTD 2BKGA 3DEOA 3UM1A 3ZPJA 1OCZE 4MS6A 4UI9J 3V30A 1FVFA 3CVQA 3I5PA 2PNNA 5LCWJ 1H19A 1NFIE 5D0OD 3T5VA 4UQXA 4O60A 2HYZA 3CQCB 2NC9A 5EILA 3PVLA 3DBSA 4N3CA 3RU0A 1WDYA 2BEDA 2C0LA 3IEGA 4BFRA 2WXFA 4GU5A 1MX2A 2XGSA 4C0EA 3CVYA 1V55E 3SBSA 3S7JA 3TGOA 4GMRA 2BKKB 4JB8P 5HQ8A 3C3OA 3AAAC 5G55A 4FJYA 3IHVA 3BEEA 4O1PA 2DZOA 2J07A 1MX6A 1HS6A 2P9UG 3E33A 2X6KA 2J09A 3ENEA 4HB5A 5ITZF 5EIDA 1W3BA 4JVSA 3APDA 2GRQB 3EHNA 3Q9UC 3L82A 4DK5A 4I17A 4I6GA 4GTTA 3AG3E 1TN7A 2XRYA 4BTAA 3GZSA 4F1SA 4AV7A 4I9EA 2OEWA 1LD8A 3CGHA 5KJLA 4JA7A 3FUNA 2BUGA 4W9RA 3Q47B 2LSUA 3DSWA 5AQ9A 3T9KA 2J08A 3ZUVB 2VJ8A 1E8ZA 4G24A 2GRRB 1PY1A 3TG4A 2XHEA 1HG5A 1HU3A 2VQ2A 2LSVA 3LDZA 1N52A 3L08A 3LY8A 1HF8A 5EKQD 4CT4A 3CVLA 2CFUA 2LXMA 3ONLA 3CK9A 2XPYA 5FZSA 4J7WA 4N5CA 4Q69A 1UG3A 4WNFA 4BESA 3CKCA 5ENNA 2GROB 4G26A 4C48B 5CBOA 1LF8A 1MZCA 4Y6WA 1RW2A 3B7SA 2XCBA 4IN3B 2KM4A 4GTMA 4KT6B 3C3QA 1NL4A 3SF4A 4U04A 1KPSB 1N4SA 4GTQA 1OCRE 3FTSA 5KJMA 3FUIA 4DLOA 3FULA 4ATZD 4BT8A 3G2VA 4LUNU 3MCXA 4GTSA 3FWVA 4H7YA 3T8KA 3I3NA 3FH5A 2CFZA 2R2LA 4HI8A 3CR3A 3RRMB 3E4BA 3FH8A 3KEAA 3G2SA 3PNTB 3NOGD 2I1KA 3D3MA 4EZJA 5FQ8A 2XZDG 4CRWA 3U3WA 2VTBB 4F7AA 4UWKA 3AS8A 3L6AA 2DVWA 3NAWA 4GZCA 1SZ9A 2R17C 2MRIA 3URZA 2Y1LE 1IQUA 3RJVA 3QK0A 5HI7A 1BI7B 4FA6A 4IRUA 4EBAG 4AJWA 3UX4A 3ABME 3KS2A 3MKQB 4U07A 1FCHA 4AOFA 3D9MA 4I43A 1E8XA 1O1SA 4I6EA 4UWLA 3P1UA 2LUHA 4JC8A 4K03A 4GA1A 3C3RA 2WMNA 2NSZA 3DRAA 3T8MA 4LNGA 2VYIA 5JHAA 3MV3B 4M7CA 4HRLA 3Q73A 3U4TA 1BU9A 2WXKA 1O5MA 1RZ4A 4E6HA 4AP2A 2F8XK 2VSXE 2DIWA 3TJPA 2H6HA 2OCCE 4EHMA 2UY1B 3IKOB 3GYZA 4I9CA 2WPVA 3ZKJA 4FLBA 4ANUA 3NZUA 2P2CP 3VLFA 3WXXA 4BTBA 3FU5A 5LOZA 4MBGA 5FZQA 1V54E 5BV1A 3PZDA 4DLQA 3CHRA 4CDNA 3HVEB 1S64A 3NQPA 4B93B 2VSNA 1OWNA 1OCCE 3UM0A 1ZB1A 2RFMA 2QY7A 1SA4A 4AY6A 2V0PA 3PRZA 1N0RA 3FH7A 4U7EB 3F6QA 4O6FA 3ZU7B 2R03A 3CV0A 4UWFA 1N11A 3ASDA 2WXPA 3TWRA 3E37A 4B8AA 2IO3C 3EHRA 3N71A 4A63B 1QQEA 4LERA 1DC2A 4GMJA 4Y6CA 1EYHA 2ZU6B 5CMYA 1SA5A 2X38A 3JXIA 2P9LG 5A6CA 3PE3A 4IULA 2X6JA 4U8YD 5JJTA 5J08A 3MKRA 4XI0A 4NIKA 2XGMA 4OVVA 4URKA 4L2LA 2KXPC 4HFGA 2YHCA 2A5UA 3HYMB 4H7XA 3L16A 2J8SD 3HHMA 4UI9K 4JW1A 5ENRD 4V3IA 1HG2A 4YVOA 2ETBA 3CK7A 3D9LA 5CMWA 4JXTA 3FUFA 3Q4AB 3QWVA 4AY5A 3ASFA 3VLDA 2IO2C 4Q94A 4B8CB 5EX3A 3FTYA 1YCSB 5T4YA 2P58C 3RKVA 2WM9A 5FINA 2KZTA 3D9PA 3O4ZA 3QB2A 5CCMA 2KATA 4L23A 4HXIA 5FZRA 3ZNGA 1OT8A 3LVRE 4CGWA 1ELWA 2NXPA 5AQBA 3RIBA 3HRAA 1N9AA 4G23A 2Y0BG 5C2YA 3Q79A 4L7TA 2KCKA 1Z6TA 1EPUA 3CHOA 2EINE 3CEQA 2AXUA 1FPPA 2R05A 4KBQA 5ARGA 3NZSA 3FUHA 1IHBA 5FWQA 3PS6A 3IBEA 5CEDB 3CVNA 3CVXA 4GMLA 5ANRA 1OXJA 2HM8A 5BT1A 4BERA 3G2WA 4N2SA 3QARA 4PS3A 5B3SE 1NZNA 3CKBA 4J6IA 2V8SE 1IHGA 4I1MA 4ILHB 4ILIA 1H0AA 3PZ3A 4K5CA 3WG7E 3CSTA 2XZTG 2WVIA 3SGHA 5CECB 5T3RA 3FY4A 3PZ1A 4JHRA 3ZYMA 2MHKA 1KT1A 4MLPA 1A17A 5AARA 3L54A 5G05J 4JZYA 1Y8MA 2ZXWE 1LD7A 2YNQA 2XENA 3EHQA 4P29A 5LCWC 3EJNA 2I2OA 4WWNA 2E0IA 5FTPA 1HX8A 3CQGB 3UM3A 5KWDA 3HXEA 4J0UA 5KCMA 2YHEA 3FU3A 3LS8A 1DNPA 2WXNA 3ESKA 5A7DB 3SI5A 1NI1A 5FT9A 3OXFA 3CHMA 4L2YA 4O1OA 1DVPA 3ULQA 1HE8A 2L6BA 4U8VD 3AU4A 5B1AE 4FULA 4CDMA 1H6PA 3AG4E 2B6CA 2H6FA 3APFA 4NRHB 2WQ7A 1MHQA 5KJNA 2P9NG 4DX1A 3MA5A 2IEJA 4HVBA 1E8WA 3CSFA 4L9PA 4KZCA 3HG0D 1OWMA 4TXPA 2VGXB 4G2VA 3HXDA 1QNFA 4BSXA 4C9BB 1HXIA 4GYYA 2CHWA 5JMND 2XRZA 1BI8B 3UIOC 3FFLA 3W9FA 3PZ2A 3DPDA 1SQMA 3AS5A 3SFZA 5AENA 1XGWA 5J90A 1E7UA 1TNZA 1P5QA 2RFAA 3LY7A 1FT2A 4FADA 4XE0A 1H2UA 4ILGA 2FULA 4YVQC 4LRZA 3SY2A 4XX5A 5BW8C 5JHBA 1TN8A 3S7BA 2KBXA 2VGYA 2MYOA 4KVMA 4FP7A 3IHYA 2DZNA 3V31A 3UIPC 3JCKC 3JUIA 1D9SA 3DEPA 1MQSA 2V5FA 5CEAA 3LVQE 3ZVVA 1YA0A 3TAXA 3SFYA 5EX0A 3CVVA 4BT9A 4JEHA 1KZPA 1WM5A 3E34A 2X3MA 2L0TB 3ZHEA 2AWIA 4FLHA 2FO7A 3QKYA 2CG2A 5AAOA 2FI7A 1U3DA 3C5RA 1OUVA 2PQNA 4TXRA 5ENQD 1KT0A 3QWPA 4GPKA 3MX3A 4FHKA 5EIBE 3TWTA 5CRVA 3NB2A 4U0SA 5FQ7A 1Q2ZA 1EDUA 4I6JA 2J4BA 3G2TA 4LSZE 4DI3A 4CYMD 3S7DA 4M3OA 2B0OE 3D9IA 3RK6A 5ENSD 4YNDA 2CHXA 1BLXB 3EIJA 4ACLA 3CVPA 4HQDA 2RG8A 2PQRA 4JL0A 2ZIRA 3AU5A 1UN9A 4TV3A 4F1PA 4UUCA 2GRMA 4DX2A 3UMVA 5D66A 1ZBPA 2F37A 2WXRA 4JHKA 3DSVA 2JEKA 3G2UA 4MRUA 3R7QA 1S70B 4GZDA 2P9PG 3VTYA 3PUKA 4U8HA 5CERB 3UT8A 4Z68A 3U9WA 4I2ZA 3IV0A 4QFVA 3FTVA 2Q7FA 1HO8A 2EIJE 4FC8A 3B7UX 1HZ4A 4LEUA 2EQXA 3DXMG 3QJZA 4X8QA 3LCAA 4GTRA 3ZYQA 4APFA 1LTXA 3V79K 3ABKE 3NF1A 4C0MA 1N95A 5EYPF 5LFAA 3JYSA 4QQIA 2ONDA 3LKUA 4F53A 2XEEA 4N39A 4XKBA 4HOUA 2HO1A 3ABLE 1KLXA 4LNBA 4J8FA 4FJZA 3X2QE 3UUXA 4ACKA 4ABNA 2E2EA 3QOUA 3BG1B 2A4ZA 1X5BA 3V2XA 2M63A 4GA0A 3I4RB 4EZLA 3MEKA 2L6JA 4BY6A 1TJFA 2CG3A 5AJDA 1QBQA 3UINC 5AN8A 3HXCA 3TWSA 3Q7FA 2AXZA 3DPYA 3UTMA 2PM6A 4YDYA 3HXBA 4WAFA 4B0ZA 2WB2A 3HXFA 1A5EA 3FTUA 1MJ0A 1OWLA 3E32A 4WNEA 3DSTA 5LX8A 3ONKA 4CDRA 4TXQA 3PE4A 1JUQA 3UQ3A 3LY9A 2XS8A 4HLLA 3Q78A 5DIZA 3B95A 3B13A 2XS1A 3LJNA 5G2NA 3ZFWA 1N94A 1Z5SC 1EF1C 5AYWD 3ZYLA 4DI4A 5LP0A 2GW1A 4CZ2D 4YDOA 4K5AB 1D8EA 3DWLG 2OVFA 1JCSA 4UQZA 4N3AA 1N4RA 4OYSA 1VDYA 4J8SA 3RRNB 2P9KG 3VTXA 3CIAA 4U0UA 4U63A 4GB9A 1QYMA 3UT7A 4ZHBA 4NACA 4APOA 2IY0C 4F3VA 4KXKB 2WQ6A 2JABA 2ETAA 3ULEG 4XZ4A 4EECA 5BV0A 4EPZA 5EYLA 5T8IA 2RKKA 4OAUC 1OY3D 1WY6A 2XEVA 1H2TC 1NP7A 3ASNE 3Q15A 1UW4B 1MX4A 4J8DA 4UWGA 2OV8A 3Q5MA 5FQ4A 4LNUD 2FO1E 3EIQC 2R5SA 2WXOA 3SQVA 4JHJA 5BPPA 4HNAD 4DPRA 2EIKE 1JCRA 3BG0B 2QYUA 3PEVB 2VSOE 4HLEA 1L5JA 1S0PA 3GW4A 2GRNB 3FUEA 4RQIA 5JJ6A 1TNYA 2J9QA 4GCOA 3LPZA 3UI2A 2YQ8A 3UPVA 1MYOA 3SO8A 3MZLB 4BX8A 2NYJA 1TNUA 3SHFA 3Q7AA 3ZN3A 2WXIA 4WWPA 3PUJA 4ME2A 5G05C 4N2QA 4A3VA 4D10C
chains in the Genus database with same CATH topology
2IFUA 3S7BA 3ML8A 4IRUA 2VGYA 4KVMA 3FTWA 4FP7A 4MKTA 4L1BA 3IHYA 4EBAG 2LNIA 3UX4A 4AJWA 2GGFA 4GZ6A 3OXLA 2PZIA 3PREA 3KS2A 3MKQB 4U07A 2RD0A 1FCHA 3CHQA 4AOFA 3TXMA 3D9MA 3JCKC 3JUIA 4I43A 2WMOA 1E8XA 2LO6A 1MQSA 2V5FA 4I6EA 4UWLA 3QAQA 3P1UA 3LVQE 3ZVVA 2WXMA 4CT0A 1YA0A 4I1OB 4JC8A 3EHMA 4K03A 4GA1A 2WMNA 1E90A 3TAXA 1BPOA 2NSZA 3T8MA 5EX0A 3CVVA 4BT9A 2VYIA 3TG5A 4GZ3A 5JHAA 3MV3B 4JEHA 3QC1A 2IQCA 1WM5A 4AEZC 2X3MA 3GZ1A 1E8YA 5A23A 3U64A 3FU6A 2L0TB 3U4TA 3ZHEA 2WXKA 2AWIA 4FLHA 2FO7A 4Q96A 3QKYA 4B89A 2CG2A 4WWOA 3RO2A 3U66A 2FI7A 3FHEA 1U3DA 4E6HA 4AP2A 1OUVA 2DCPA 2PQNA 1KT0A 2VSXE 2DIWA 3TJPA 2IOSA 2I1JA 3QWPA 4GPKA 2IONA 2UY1B 3MX3A 3IKOB 3GYZA 2PM7A 4I9CA 4FHKA 2WPVA 3T5XA 5EDSA 3L22A 4E85A 4AVXA 2JLBA 3FUMA 4FLBA 4U0SA 4ANUA 3NZUA 4XKCA 5FQ7A 3VLFA 3WXXA 4BTBA 3ZEFA 2X6FA 4WNGA 2UWJG 2XQ0A 3FU5A 1ZU2A 1EDUA 4I6JA 2J4BA 3G2TA 4RVBA 5LOZA 3P2BA 5FZQA 3LYAA 4DI3A 2I6HA 4U0ZA 3S7DA 3D9NA 4M3OA 1IQRA 3FEYA 5BV1A 2VGXA 2IF4A 3PZDA 3D9IA 3MGBA 4DLQA 3CHRA 4CGVA 1INZA 3RK6A 4HS2A 4YNDA 4CDNA 2KZTB 1JWFA 2CHXA 3HVEB 2KCVA 3NQPA 4DJAA 2VSNA 3EIJA 4KVOA 3ZYKA 1OWNA 4ACLA 4HORA 3CVPA 1TEZA 2WXQA 2VSYA 5ARFA 2L9BA 2HR2A 2BTDA 3Q49B 2IJGX 2L0IA 2RG8A 1XNFA 3D9OA 2PQRA 2Y4UA 4JL0A 4G25A 3AU5A 4LCTA 2QY7A 1IYGA 1UN9A 4TV3A 4GZ5A 2V0PA 2VTBA 4AY6A 3KD7A 3PRZA 1Z3XA 1JWGA 4XIFA 5JJ7A 3FH7A 4AIFA 2GRMA 3L17A 3HDXA 3FP3A 4B94A 4O6FA 3KEZA 2BF0X 4RG6A 4RSYA 3UMVA 1H2VC 4PDXA 3CV0A 3D9JA 1ZBPA 2WXRA 4JHKA 4UWFA 3ESLA 2JEKA 3FUDA 5BNWA 2C2LA 2IU1A 3G2UA 1JPLA 2ILRA 1FVHA 4MRUA 3R7QA 4GZDA 3VTYA 3GZ2A 3PUKA 4PS8A 4A3TA 4U8HA 3FTXA 4EZKA 5FJYA 3UT8A 3ASDA 2WXPA 3U9WA 2FEZA 2LAHA 3OXGA 4I2ZA 3IV0A 3CK8A 4QFVA 2X6IA 4FU3A 3FTVA 4EQFA 3LEWA 2AVPA 3PH0C 4KMOA 4B8AA 2AW6A 2Q7FA 1HO8A 4HOSA 3N71A 1GW6A 3MKQA 4NURA 4FC8A 4I2WA 5G04C 3B7UX 5ANLA 1QQEA 2FBNA 3TL5A 4GA2A 4LERA 4ANXA 1HZ4A 2XGOA 4LEUA 3L13A 4GMJA 4Y6CA 1EYHA 2EQXA 3FUJA 3FTZA 4ANVA 2ZU6B 3QJZA 4AM9A 1B89A 3LCAA 4EBAA 5BUZA 3HIZA 5DBKA 5CMYA 5AIJA 4CEMA 1UN8A 2X38A 3ZYQA 4APFA 5E75A 4HOQA 2DBAA 2WXJA 3NF1A 5A6CA 3ML9A 3PE3A 4IULA 4C0MA 3VLEA 2X6JA 4NQ0A 5G04J 3AS4A 5LFAA 3JYSA 3CVUA 5JJTA 5J08A 3MKRA 4FHJA 2ONDA 4XI0A 1WAO1 3CHPA 3LKUA 4F53A 4N39A 4OVVA 2XGMA 4XKBA 2IOLA 4HOUA 3ZRHA 4URKA 4L2LA 3FU0A 4HFGA 2HO1A 2YHCA 2A5UA 3HYMB 4H7XA 3L16A 4UI9C 1KLXA 3HHMA 4UI9K 4JW1A 4ANWA 4V3IA 1HG2A 4CCAA 4YVOA 3O48A 3CK7A 3D9LA 3QDNA 1U3CA 4FJZA 1ELKA 3FUKA 3OAWA 4J8FA 5CMWA 4JXTA 4I1AA 3UUXA 1PC2A 3FUFA 2LAIA 4KZ0A 4HOTA 4ACKA 3Q4AB 2UY1A 3QWVA 3MV2B 4ABNA 3ZPJA 4AY5A 3ASFA 3VLDA 1SZAA 4G1TA 4MS6A 2E2EA 3QOUA 4UI9J 2XCCA 1E96B 1OWOA 4KYOB 3BG1B 1FVFA 3CVQA 3I5PA 4Q94A 2J4DA 4B8CB 5EX3A 2A4ZA 5LCWJ 1H19A 1X5BA 3FTYA 5T4YA 4GAAA 2P58C 5D0OD 3MJWA 2M63A 1HFAA 3K9IA 3RKVA 3T5VA 4GA0A 4UQXA 2HYZA 3CQCB 2WM9A 2NC9A 3I4RB 3MEKA 4GYOA 4EZLA 2L6JA 4BY6A 3PVLA 3DBSA 4N3CA 1TJFA 2CG3A 3CLJA 3RU0A 4PH4B 3C98A 3IEGA 2C0LA 2KZTA 3HVEA 5AJDA 3D9PA 2WXFA 4BFRA 4GU5A 2XGSA 4C0EA 3CVYA 3O4ZA 3QB2A 5CCMA 2KATA 4L23A 4HXIA 5FZRA 3SBSA 4K0RA 3S7JA 3TGOA 3LVRE 4CGWA 1ELWA 2AXZA 2NXPA 3RIBA 3LXUX 1ELRA 2PM6A 4G23A 5HQ8A 5G55A 5C2YA 1QZ2A 3IHVA 3BEEA 2KCKA 4FJYA 4L7TA 4JPSA 4WAFA 1Z6TA 1EPUA 2J07A 2PL2A 3CHOA 4B0ZA 4PUCA 1HH8A 2WB2A 1HS6A 4A1GA 3QNKA 2X6KA 2J09A 3ENEA 5FQ6A 3CEQA 3FTUA 1OWLA 2AXUA 1W3BA 4JVSA 4KBQA 3MYVA 5ARGA 3APDA 1Z3YA 3EHNA 3NZSA 4WNEA 3FUHA 4UWHA 4DK5A 5LX8A 3ONKA 4I17A 3SD5A 3APCA 4I6GA 4CDRA 2XRYA 4BTAA 3FDHA 5FWQA 3PS6A 3PE4A 3GZSA 3ZGQA 2OOEA 2FF4A 3IBEA 3PNLB 1JUQA 3CVNA 4F1SA 4GMLA 4AV7A 4I9EA 3UQ3A 3CVXA 4G11A 3LY9A 3S2AA 2MOWA 2C0MA 5ANRA 1E7VA 5DIZA 3TXNA 2CHZA 4XI9A 3CGHA 5KJLA 2HM8A 3ASGA 1NA0A 4JA7A 3FUNA 2BUGA 3R9AB 5BT1A 3B13A 3ZXSA 3G2WA 4N2SA 3QARA 2J49A 4PS3A 5M72A 4W9RA 3PDNA 1NZNA 3CKBA 3Q47B 2LSUA 5G2NA 3ZFWA 4J6IA 2V8SE 1IHGA 1EF1C 2J08A 1Y6IA 4I1MA 4ILHB 4ILIA 1H0AA 2GRLA 4IYPA 5AYWD 3ZYLA 3B7TA 4J8EA 2VJ8A 4DI4A 5LP0A 1E8ZA 3CSTA 2GW1A 4G24A 2WVIA 1PY1A 3SGHA 4JEUA 3TG4A 4A1SA 2XHEA 1HG5A 2XPIA 1HU3A 5T3RA 2VQ2A 3FY4A 2LSVA 3LDZA 4JHRA 3ZYMA 1N52A 2MHKA 3L08A 3LY8A 1HF8A 1KT1A 2OVFA 4MLPA 5EKQD 2XPZA 1A17A 4CT4A 3L54A 2AXVA 3CVLA 5G05J 1UJJA 2CFUA 3EDTB 4ATGA 3ONLA 3CK9A 2XPYA 4JZYA 2X6HA 1Y8MA 4UQZA 5FZSA 4N3AA 2YNQA 3UT4A 4P29A 4WUYA 4N5CA 5LCWC 4Q69A 3EJNA 1UG3A 4WNFA 4OYSA 3CKCA 1VDYA 2I2OA 5ENNA 4J8SA 2E0IA 4WWNA 5FTPA 3I4GA 4G26A 3SZ7A 1HX8A 3CQGB 3RRNB 3VTXA 3CIAA 4J0UA 4U0UA 4U63A 4GB9A 5KCMA 2KCLA 4GYWA 2YHEA 3FU3A 3LS8A 1LF8A 3UT7A 4NACA 4APOA 4F3VA 1DNPA 2WXNA 5KJKA 4KXKB 3ESKA 4BX9A 2WQ6A 4Y6WA 5A7DB 3SI5A 3S7FA 3KAEA 3CVWA 3ZHEB 5FT9A 4XZ4A 4EECA 3OXFA 3B7SA 3CHMA 2KC7A 2XCBA 1N54A 2WXHA 2Y3AA 3D9KA 4L2YA 1DVPA 3SNXA 4IN3B 2KM4A 3ULQA 5BV0A 1HE8A 4EPZA 3RO3A 4KT6B 5D0QD 3SF4A 3AU4A 5T8IA 5C1DA 2WXLA 4FULA 4U04A 1WY6A 4CDMA 2XEVA 1H2TC 1NP7A 3Q15A 3APFA 1UW4B 3FTSA 4NRHB 3FUIA 4J8DA 5KJMA 2WQ7A 4UWGA 1MHQA 4DLOA 3FULA 5KJNA 2I9CA 2OV8A 3Q5MA 5FQ4A 3JQ1A 4BT8A 3MA5A 3G2VA 4LUNU 4JA9A 3MCXA 4RG9A 3EIQC 4A55A 3SBTB 3FEXA 3FWVA 4H7YA 1E8WA 3RRUA 4HVBA 3I3NA 4R7LA 2R5SA 3ASHA 3CSFA 3QWWA 3FH5A 4UQYA 2OVBA 2WXOA 4OVUA 2CFZA 4KZCA 3ZW3A 1PAQA 2WXGA 4JHJA 5BPPA 3CR3A 3OTNA 2R59A 3CHSA 3RRMB 4DPRA 1OWMA 2VGXB 4G2VA 3E4BA 3FH8A 2QFCA 1QNFA 2Y4TA 3PEUB 4TRQA 3G2SA 3BG0B 1HXIA 5E76A 4BSXA 4C9BB 3PEVB 3PNTB 2VSOE 2CHWA 4GYYA 4HLEA 1L5JA 1H6KA 2I1KA 1S0PA 3D3MA 2XRZA 3GW4A 3B7RL 4EZJA 3FUEA 5FQ8A 4CRWA 4PS7A 2V4LA 5JJ6A 3FFLA 2J9QA 4GCOA 3JQ0A 4AXHA 3DPDA 3U3WA 1SQMA 3LPZA 1NA3A 3AS5A 3SFZA 5AENA 2VTBB 4TUUA 1XGWA 4GCNA 3ZIMA 1E7UA 4F7AA 5J90A 1P5QA 2YQ8A 3UPVA 4UWKA 3LY7A 4WNDA 3AS8A 4FADA 3L6AA 4XE0A 3LJ3A 2WQHA 1H2UA 3MZLB 4BX8A 5CCLA 4ILGA 5AJLA 2YINA 1UJKA 4N3BA 4GZCA 3SHFA 2FULA 1SZ9A 4YVQC 1TJCA 2R17C 4LRZA 5CHEE 2MRIA 3ZN3A 3URZA 2WXIA 4WWPA 1IQUA 1OWPA 3RJVA 3QK0A 4XX5A 5BW8C 3PUJA 4ME2A 5HI7A 5G05C 4N2QA 5JHBA 4BWRA 4A3VA 4FA6A 3R7RA 4D10C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HM8 A;  3FEY A;  2NSZ A;  2KZT A;  4B8A A;  1PAQ A;  2VSX E;  4JHJ A;  2IOS A;  1HU3 A;  3RK6 A;  2GGF A;  2ION A;  3L6A A;  1H2V C;  2KZT B;  1H2U A;  3EIJ A;  4C9B B;  1H2T C;  1N52 A;  4B8C B;  2IOL A;  4GMJ A;  2VSO E;  4JHK A;  1UW4 B;  1H6K A;  2ZU6 B;  4CT4 A;  3D3M A;  2FUL A;  3JUI A;  2RG8 A;  2IU1 A;  4CEM A;  4GML A;  4B89 A;  4LUN U;  4CRW A;  3EIQ C;  5ANR A;  3FEX A;  1UG3 A;  4IUL A;  1N54 A;  2I2O A; 
#chains in the Genus database with same CATH topology
 3ML8 A;  3DSX A;  3FTW A;  5FIO A;  4MKT A;  4L1B A;  3AJI A;  2LNI A;  2OEV A;  4GZ6 A;  3OXL A;  2PZI A;  3AG2 E;  3PRE A;  2RD0 A;  3CHQ A;  2AJA A;  2WMO A;  2LO6 A;  3QAQ A;  1OCO E;  4I1O B;  5BXO A;  1IXV A;  5ENP D;  1H6O A;  3QC1 A;  2QZA A;  3RSE G;  3GZ1 A;  5A23 A;  3U64 A;  5KNG A;  4WWO A;  3JXJ A;  3U66 A;  3FHE A;  3Q75 A;  2DCP A;  1TNB A;  2IOS A;  2I1J A;  2ION A;  2PM7 A;  5EDS A;  3L22 A;  4E85 A;  4AVX A;  4XKC A;  3KSL A;  3ZEF A;  2X6F A;  4WNG A;  2UWJ G;  4RVB A;  3P2B A;  4U0Z A;  3DSU A;  1IQR A;  3FEY A;  2IF4 A;  3MGB A;  1G3N B;  4BEP A;  4CGV A;  1INZ A;  2F0Y A;  2KZT B;  4DJA A;  4KVO A;  3UM2 A;  1TEZ A;  2WXQ A;  5ARF A;  2L9B A;  2HR2 A;  3Q49 B;  2IJG X;  5AQ7 A;  3D9O A;  2DYS E;  4LCT A;  1AP7 A;  4GZ5 A;  2VTB A;  2DYR E;  3KD7 A;  1JWG A;  4F6R D;  5JJ7 A;  4AIF A;  2ZGG A;  3KEZ A;  3UKU G;  4RG6 A;  1O1T A;  4RSY A;  4LG6 A;  4PDX A;  3EU9 A;  3ESL A;  1S63 A;  2C2L A;  2IU1 A;  2ILR A;  1FVH A;  4A3T A;  5FJY A;  2FEZ A;  3CK8 A;  4FU3 A;  3LEW A;  2AVP A;  3PH0 C;  4KMO A;  2AW6 A;  4G8L A;  3MKQ A;  5G04 C;  4I2W A;  3IXE A;  5ANL A;  1O1R A;  2FBN A;  3TL5 A;  1WG0 A;  2XGO A;  4ANV A;  3E30 A;  1B89 A;  4EBA A;  1JCQ A;  5AQA A;  2A5E A;  3ML9 A;  1K1B A;  4NQ0 A;  5G04 J;  3CVU A;  4FHJ A;  3TWU A;  1WAO 1;  2ZGD A;  3CHP A;  2IOL A;  2XEH A;  3ULY A;  4CCA A;  3QDN A;  1ELK A;  3OAW A;  1PC2 A;  4KZ0 A;  2LAI A;  4HOT A;  2UY1 A;  3MV2 B;  1SZA A;  4G1T A;  3KSQ A;  3NOC D;  3BUA A;  1E96 B;  1OWO A;  2XCC A;  4KYO B;  4RLY A;  2J4D A;  1TNO A;  1U2V G;  1D8D A;  4GAA A;  3MJW A;  3B7B A;  1HFA A;  3K9I A;  4GYO A;  1DCE A;  3CLJ A;  4PH4 B;  3SFX A;  3C98 A;  3HVE A;  4K0R A;  3TWW A;  3LXU X;  1ELR A;  4GPM A;  3JUE A;  3J5Q B;  1QZ2 A;  3PZ4 A;  2QYJ A;  4JPS A;  2PL2 A;  4PUC A;  1HH8 A;  5ENO D;  4A1G A;  5IY5 E;  3QNK A;  5FQ6 A;  5D2M C;  1TYQ G;  3MYV A;  3R9M A;  1Z3Y A;  2P9I G;  4UWH A;  2R02 A;  3SD5 A;  3APC A;  3FDH A;  1UOH A;  3ZGQ A;  2OOE A;  2ETC A;  2FF4 A;  3PNL B;  4G11 A;  3S2A A;  2MOW A;  2C0M A;  2EIM E;  1E7V A;  3TXN A;  2CHZ A;  4XI9 A;  4DX5 D;  3ASG A;  1NA0 A;  3R9A B;  3ZXS A;  2J49 A;  5M72 A;  3PDN A;  4U96 D;  3C72 A;  1Y6I A;  2GRL A;  4IYP A;  3B7T A;  4J8E A;  4DUI A;  3RAU A;  4JEU A;  4A1S A;  2XPI A;  1N4Q A;  4U95 D;  2XPZ A;  2AXV A;  4ATG A;  1UJJ A;  3EDT B;  2X6H A;  1YYH A;  3UT4 A;  4WUY A;  4J8Y A;  3I4G A;  3SZ7 A;  2KCL A;  4GYW A;  2P9S G;  5KJK A;  4BX9 A;  2V4H C;  3S7F A;  3KAE A;  3CVW A;  1N0Q A;  3ZHE B;  2KC7 A;  2WXH A;  1N54 A;  2Y3A A;  3D9K A;  4JD2 G;  3SNX A;  3RO3 A;  5D0Q D;  5C1D A;  2WXL A;  3NBN B;  3EUV A;  4ZFH A;  2I9C A;  3JQ1 A;  4GTO A;  4RG9 A;  4JA9 A;  3DXK G;  4A55 A;  3SBT B;  3FEX A;  3RRU A;  3V2O A;  4R7L A;  3QWW A;  3ASH A;  4UQY A;  2OVB A;  3BQO A;  4YDE A;  3TWX A;  4OVU A;  3ZW3 A;  1PAQ A;  2WXG A;  2H6I A;  3OTN A;  2R59 A;  3CHS A;  2QFC A;  2Y4T A;  3PEU B;  4TRQ A;  5E76 A;  5CBN A;  1H6K A;  3B7R L;  4PS7 A;  2V4L A;  3JQ0 A;  4AXH A;  5HRY A;  1NA3 A;  4TUU A;  4GCN A;  3ZIM A;  3W9G A;  1DCQ A;  4WND A;  4K5B A;  5H7P A;  3LJ3 A;  2WQH A;  4BET A;  5CCL A;  5HKP A;  5AJL A;  2YIN A;  1UJK A;  4N3B A;  1IKN D;  2V5Q C;  1TJC A;  5CHE E;  3L9T A;  1BD8 A;  2DWZ A;  4HRN A;  1OWP A;  4BSZ B;  4BWR A;  3R7R A;  2IFU A;  1FT1 A;  2GGF A;  3Q9N C;  5KBA A;  3TXM A;  3EU5 A;  4GTV A;  2WXM A;  4CT0 A;  3EHM A;  4DX7 D;  1E90 A;  1BPO A;  3TG5 A;  4GZ3 A;  1K3Z D;  5HS0 A;  2IQC A;  4HI9 A;  4AEZ C;  1E8Y A;  3FU6 A;  1X81 A;  4Q96 A;  2Y69 E;  4B89 A;  3RO2 A;  1KZO A;  4GTP A;  4YDW A;  3ASO E;  3J5P A;  1YMP A;  1TR4 A;  4G8K A;  3T5X A;  3ISM C;  4TUM A;  2JLB A;  3FUM A;  5EN5 D;  2XQ0 A;  1ZU2 A;  5KNH D;  3LYA A;  2I6H A;  2EIL E;  3D9N A;  2VGX A;  3AG1 E;  4HS2 A;  1JWF A;  2KCV A;  1SW6 A;  4HOR A;  3ZYK A;  1TN6 A;  2VSY A;  4DX6 D;  3BU8 A;  2F8Y A;  2BTD A;  3DSS A;  2L0I A;  1XNF A;  2Y4U A;  4G25 A;  1IYG A;  1K8K G;  3D9H A;  2HE0 A;  1Z3X A;  4XIF A;  3L17 A;  2GRP B;  3HDX A;  4HRM B;  3FP3 A;  3UXG A;  4B94 A;  2BF0 X;  1H2V C;  3D9J A;  4N5Q A;  5BXU A;  1SVX A;  3FUD A;  5BNW A;  1JPL A;  5JA4 D;  4XEI G;  3GZ2 A;  4PS8 A;  3FTX A;  4EZK A;  2LAH A;  3OXG A;  1N4P A;  2X6I A;  4EQF A;  4HOS A;  1GW6 A;  4NUR A;  2QC9 A;  4GA2 A;  1K1A A;  3ZXP A;  3TWV A;  4ANX A;  3L13 A;  3FUJ A;  3FTZ A;  4AM9 A;  5BUZ A;  3HIZ A;  5DBK A;  5AIJ A;  4CEM A;  1UN8 A;  4HBD A;  5E75 A;  2ZIS A;  4HOQ A;  2DBA A;  2WXJ A;  3VLE A;  3AS4 A;  2H6G A;  3TWQ A;  3UKR G;  4DRX E;  3ZRH A;  3FU0 A;  1AWC B;  5CRU A;  4UI9 C;  5B1B E;  4ANW A;  4OAV B;  3O48 A;  2VGE A;  1U3C A;  3FUK A;  4I1A A;  2LXL A;  5ENT D;  2BKG A;  3DEO A;  3UM1 A;  3ZPJ A;  1OCZ E;  4MS6 A;  4UI9 J;  3V30 A;  1FVF A;  3CVQ A;  3I5P A;  2PNN A;  5LCW J;  1H19 A;  1NFI E;  5D0O D;  3T5V A;  4UQX A;  4O60 A;  2HYZ A;  3CQC B;  2NC9 A;  5EIL A;  3PVL A;  3DBS A;  4N3C A;  3RU0 A;  1WDY A;  2BED A;  2C0L A;  3IEG A;  4BFR A;  2WXF A;  4GU5 A;  1MX2 A;  2XGS A;  4C0E A;  3CVY A;  1V55 E;  3SBS A;  3S7J A;  3TGO A;  4GMR A;  2BKK B;  4JB8 P;  5HQ8 A;  3C3O A;  3AAA C;  5G55 A;  4FJY A;  3IHV A;  3BEE A;  4O1P A;  2DZO A;  2J07 A;  1MX6 A;  1HS6 A;  2P9U G;  3E33 A;  2X6K A;  2J09 A;  3ENE A;  4HB5 A;  5ITZ F;  5EID A;  1W3B A;  4JVS A;  3APD A;  2GRQ B;  3EHN A;  3Q9U C;  3L82 A;  4DK5 A;  4I17 A;  4I6G A;  4GTT A;  3AG3 E;  1TN7 A;  2XRY A;  4BTA A;  3GZS A;  4F1S A;  4AV7 A;  4I9E A;  2OEW A;  1LD8 A;  3CGH A;  5KJL A;  4JA7 A;  3FUN A;  2BUG A;  4W9R A;  3Q47 B;  2LSU A;  3DSW A;  5AQ9 A;  3T9K A;  2J08 A;  3ZUV B;  2VJ8 A;  1E8Z A;  4G24 A;  2GRR B;  1PY1 A;  3TG4 A;  2XHE A;  1HG5 A;  1HU3 A;  2VQ2 A;  2LSV A;  3LDZ A;  1N52 A;  3L08 A;  3LY8 A;  1HF8 A;  5EKQ D;  4CT4 A;  3CVL A;  2CFU A;  2LXM A;  3ONL A;  3CK9 A;  2XPY A;  5FZS A;  4J7W A;  4N5C A;  4Q69 A;  1UG3 A;  4WNF A;  4BES A;  3CKC A;  5ENN A;  2GRO B;  4G26 A;  4C48 B;  5CBO A;  1LF8 A;  1MZC A;  4Y6W A;  1RW2 A;  3B7S A;  2XCB A;  4IN3 B;  2KM4 A;  4GTM A;  4KT6 B;  3C3Q A;  1NL4 A;  3SF4 A;  4U04 A;  1KPS B;  1N4S A;  4GTQ A;  1OCR E;  3FTS A;  5KJM A;  3FUI A;  4DLO A;  3FUL A;  4ATZ D;  4BT8 A;  3G2V A;  4LUN U;  3MCX A;  4GTS A;  3FWV A;  4H7Y A;  3T8K A;  3I3N A;  3FH5 A;  2CFZ A;  2R2L A;  4HI8 A;  3CR3 A;  3RRM B;  3E4B A;  3FH8 A;  3KEA A;  3G2S A;  3PNT B;  3NOG D;  2I1K A;  3D3M A;  4EZJ A;  5FQ8 A;  2XZD G;  4CRW A;  3U3W A;  2VTB B;  4F7A A;  4UWK A;  3AS8 A;  3L6A A;  2DVW A;  3NAW A;  4GZC A;  1SZ9 A;  2R17 C;  2MRI A;  3URZ A;  2Y1L E;  1IQU A;  3RJV A;  3QK0 A;  5HI7 A;  1BI7 B;  4FA6 A;  4IRU A;  4EBA G;  4AJW A;  3UX4 A;  3ABM E;  3KS2 A;  3MKQ B;  4U07 A;  1FCH A;  4AOF A;  3D9M A;  4I43 A;  1E8X A;  1O1S A;  4I6E A;  4UWL A;  3P1U A;  2LUH A;  4JC8 A;  4K03 A;  4GA1 A;  3C3R A;  2WMN A;  2NSZ A;  3DRA A;  3T8M A;  4LNG A;  2VYI A;  5JHA A;  3MV3 B;  4M7C A;  4HRL A;  3Q73 A;  3U4T A;  1BU9 A;  2WXK A;  1O5M A;  1RZ4 A;  4E6H A;  4AP2 A;  2F8X K;  2VSX E;  2DIW A;  3TJP A;  2H6H A;  2OCC E;  4EHM A;  2UY1 B;  3IKO B;  3GYZ A;  4I9C A;  2WPV A;  3ZKJ A;  4FLB A;  4ANU A;  3NZU A;  2P2C P;  3VLF A;  3WXX A;  4BTB A;  3FU5 A;  5LOZ A;  4MBG A;  5FZQ A;  1V54 E;  5BV1 A;  3PZD A;  4DLQ A;  3CHR A;  4CDN A;  3HVE B;  1S64 A;  3NQP A;  4B93 B;  2VSN A;  1OWN A;  1OCC E;  3UM0 A;  1ZB1 A;  2RFM A;  2QY7 A;  1SA4 A;  4AY6 A;  2V0P A;  3PRZ A;  1N0R A;  3FH7 A;  4U7E B;  3F6Q A;  4O6F A;  3ZU7 B;  2R03 A;  3CV0 A;  4UWF A;  1N11 A;  3ASD A;  2WXP A;  3TWR A;  3E37 A;  4B8A A;  2IO3 C;  3EHR A;  3N71 A;  4A63 B;  1QQE A;  4LER A;  1DC2 A;  4GMJ A;  4Y6C A;  1EYH A;  2ZU6 B;  5CMY A;  1SA5 A;  2X38 A;  3JXI A;  2P9L G;  5A6C A;  3PE3 A;  4IUL A;  2X6J A;  4U8Y D;  5JJT A;  5J08 A;  3MKR A;  4XI0 A;  4NIK A;  2XGM A;  4OVV A;  4URK A;  4L2L A;  2KXP C;  4HFG A;  2YHC A;  2A5U A;  3HYM B;  4H7X A;  3L16 A;  2J8S D;  3HHM A;  4UI9 K;  4JW1 A;  5ENR D;  4V3I A;  1HG2 A;  4YVO A;  2ETB A;  3CK7 A;  3D9L A;  5CMW A;  4JXT A;  3FUF A;  3Q4A B;  3QWV A;  4AY5 A;  3ASF A;  3VLD A;  2IO2 C;  4Q94 A;  4B8C B;  5EX3 A;  3FTY A;  1YCS B;  5T4Y A;  2P58 C;  3RKV A;  2WM9 A;  5FIN A;  2KZT A;  3D9P A;  3O4Z A;  3QB2 A;  5CCM A;  2KAT A;  4L23 A;  4HXI A;  5FZR A;  3ZNG A;  1OT8 A;  3LVR E;  4CGW A;  1ELW A;  2NXP A;  5AQB A;  3RIB A;  3HRA A;  1N9A A;  4G23 A;  2Y0B G;  5C2Y A;  3Q79 A;  4L7T A;  2KCK A;  1Z6T A;  1EPU A;  3CHO A;  2EIN E;  3CEQ A;  2AXU A;  1FPP A;  2R05 A;  4KBQ A;  5ARG A;  3NZS A;  3FUH A;  1IHB A;  5FWQ A;  3PS6 A;  3IBE A;  5CED B;  3CVN A;  3CVX A;  4GML A;  5ANR A;  1OXJ A;  2HM8 A;  5BT1 A;  4BER A;  3G2W A;  4N2S A;  3QAR A;  4PS3 A;  5B3S E;  1NZN A;  3CKB A;  4J6I A;  2V8S E;  1IHG A;  4I1M A;  4ILH B;  4ILI A;  1H0A A;  3PZ3 A;  4K5C A;  3WG7 E;  3CST A;  2XZT G;  2WVI A;  3SGH A;  5CEC B;  5T3R A;  3FY4 A;  3PZ1 A;  4JHR A;  3ZYM A;  2MHK A;  1KT1 A;  4MLP A;  1A17 A;  5AAR A;  3L54 A;  5G05 J;  4JZY A;  1Y8M A;  2ZXW E;  1LD7 A;  2YNQ A;  2XEN A;  3EHQ A;  4P29 A;  5LCW C;  3EJN A;  2I2O A;  4WWN A;  2E0I A;  5FTP A;  1HX8 A;  3CQG B;  3UM3 A;  5KWD A;  3HXE A;  4J0U A;  5KCM A;  2YHE A;  3FU3 A;  3LS8 A;  1DNP A;  2WXN A;  3ESK A;  5A7D B;  3SI5 A;  1NI1 A;  5FT9 A;  3OXF A;  3CHM A;  4L2Y A;  4O1O A;  1DVP A;  3ULQ A;  1HE8 A;  2L6B A;  4U8V D;  3AU4 A;  5B1A E;  4FUL A;  4CDM A;  1H6P A;  3AG4 E;  2B6C A;  2H6F A;  3APF A;  4NRH B;  2WQ7 A;  1MHQ A;  5KJN A;  2P9N G;  4DX1 A;  3MA5 A;  2IEJ A;  4HVB A;  1E8W A;  3CSF A;  4L9P A;  4KZC A;  3HG0 D;  1OWM A;  4TXP A;  2VGX B;  4G2V A;  3HXD A;  1QNF A;  4BSX A;  4C9B B;  1HXI A;  4GYY A;  2CHW A;  5JMN D;  2XRZ A;  1BI8 B;  3UIO C;  3FFL A;  3W9F A;  3PZ2 A;  3DPD A;  1SQM A;  3AS5 A;  3SFZ A;  5AEN A;  1XGW A;  5J90 A;  1E7U A;  1TNZ A;  1P5Q A;  2RFA A;  3LY7 A;  1FT2 A;  4FAD A;  4XE0 A;  1H2U A;  4ILG A;  2FUL A;  4YVQ C;  4LRZ A;  3SY2 A;  4XX5 A;  5BW8 C;  5JHB A;  1TN8 A;  3S7B A;  2KBX A;  2VGY A;  2MYO A;  4KVM A;  4FP7 A;  3IHY A;  2DZN A;  3V31 A;  3UIP C;  3JCK C;  3JUI A;  1D9S A;  3DEP A;  1MQS A;  2V5F A;  5CEA A;  3LVQ E;  3ZVV A;  1YA0 A;  3TAX A;  3SFY A;  5EX0 A;  3CVV A;  4BT9 A;  4JEH A;  1KZP A;  1WM5 A;  3E34 A;  2X3M A;  2L0T B;  3ZHE A;  2AWI A;  4FLH A;  2FO7 A;  3QKY A;  2CG2 A;  5AAO A;  2FI7 A;  1U3D A;  3C5R A;  1OUV A;  2PQN A;  4TXR A;  5ENQ D;  1KT0 A;  3QWP A;  4GPK A;  3MX3 A;  4FHK A;  5EIB E;  3TWT A;  5CRV A;  3NB2 A;  4U0S A;  5FQ7 A;  1Q2Z A;  1EDU A;  4I6J A;  2J4B A;  3G2T A;  4LSZ E;  4DI3 A;  4CYM D;  3S7D A;  4M3O A;  2B0O E;  3D9I A;  3RK6 A;  5ENS D;  4YND A;  2CHX A;  1BLX B;  3EIJ A;  4ACL A;  3CVP A;  4HQD A;  2RG8 A;  2PQR A;  4JL0 A;  2ZIR A;  3AU5 A;  1UN9 A;  4TV3 A;  4F1P A;  4UUC A;  2GRM A;  4DX2 A;  3UMV A;  5D66 A;  1ZBP A;  2F37 A;  2WXR A;  4JHK A;  3DSV A;  2JEK A;  3G2U A;  4MRU A;  3R7Q A;  1S70 B;  4GZD A;  2P9P G;  3VTY A;  3PUK A;  4U8H A;  5CER B;  3UT8 A;  4Z68 A;  3U9W A;  4I2Z A;  3IV0 A;  4QFV A;  3FTV A;  2Q7F A;  1HO8 A;  2EIJ E;  4FC8 A;  3B7U X;  1HZ4 A;  4LEU A;  2EQX A;  3DXM G;  3QJZ A;  4X8Q A;  3LCA A;  4GTR A;  3ZYQ A;  4APF A;  1LTX A;  3V79 K;  3ABK E;  3NF1 A;  4C0M A;  1N95 A;  5EYP F;  5LFA A;  3JYS A;  4QQI A;  2OND A;  3LKU A;  4F53 A;  2XEE A;  4N39 A;  4XKB A;  4HOU A;  2HO1 A;  3ABL E;  1KLX A;  4LNB A;  4J8F A;  4FJZ A;  3X2Q E;  3UUX A;  4ACK A;  4ABN A;  2E2E A;  3QOU A;  3BG1 B;  2A4Z A;  1X5B A;  3V2X A;  2M63 A;  4GA0 A;  3I4R B;  4EZL A;  3MEK A;  2L6J A;  4BY6 A;  1TJF A;  2CG3 A;  5AJD A;  1QBQ A;  3UIN C;  5AN8 A;  3HXC A;  3TWS A;  3Q7F A;  2AXZ A;  3DPY A;  3UTM A;  2PM6 A;  4YDY A;  3HXB A;  4WAF A;  4B0Z A;  2WB2 A;  3HXF A;  1A5E A;  3FTU A;  1MJ0 A;  1OWL A;  3E32 A;  4WNE A;  3DST A;  5LX8 A;  3ONK A;  4CDR A;  4TXQ A;  3PE4 A;  1JUQ A;  3UQ3 A;  3LY9 A;  2XS8 A;  4HLL A;  3Q78 A;  5DIZ A;  3B95 A;  3B13 A;  2XS1 A;  3LJN A;  5G2N A;  3ZFW A;  1N94 A;  1Z5S C;  1EF1 C;  5AYW D;  3ZYL A;  4DI4 A;  5LP0 A;  2GW1 A;  4CZ2 D;  4YDO A;  4K5A B;  1D8E A;  3DWL G;  2OVF A;  1JCS A;  4UQZ A;  4N3A A;  1N4R A;  4OYS A;  1VDY A;  4J8S A;  3RRN B;  2P9K G;  3VTX A;  3CIA A;  4U0U A;  4U63 A;  4GB9 A;  1QYM A;  3UT7 A;  4ZHB A;  4NAC A;  4APO A;  2IY0 C;  4F3V A;  4KXK B;  2WQ6 A;  2JAB A;  2ETA A;  3ULE G;  4XZ4 A;  4EEC A;  5BV0 A;  4EPZ A;  5EYL A;  5T8I A;  2RKK A;  4OAU C;  1OY3 D;  1WY6 A;  2XEV A;  1H2T C;  1NP7 A;  3ASN E;  3Q15 A;  1UW4 B;  1MX4 A;  4J8D A;  4UWG A;  2OV8 A;  3Q5M A;  5FQ4 A;  4LNU D;  2FO1 E;  3EIQ C;  2R5S A;  2WXO A;  3SQV A;  4JHJ A;  5BPP A;  4HNA D;  4DPR A;  2EIK E;  1JCR A;  3BG0 B;  2QYU A;  3PEV B;  2VSO E;  4HLE A;  1L5J A;  1S0P A;  3GW4 A;  2GRN B;  3FUE A;  4RQI A;  5JJ6 A;  1TNY A;  2J9Q A;  4GCO A;  3LPZ A;  3UI2 A;  2YQ8 A;  3UPV A;  1MYO A;  3SO8 A;  3MZL B;  4BX8 A;  2NYJ A;  1TNU A;  3SHF A;  3Q7A A;  3ZN3 A;  2WXI A;  4WWP A;  3PUJ A;  4ME2 A;  5G05 C;  4N2Q A;  4A3V A;  4D10 C; 
#chains in the Genus database with same CATH homology
 2IFU A;  3S7B A;  3ML8 A;  4IRU A;  2VGY A;  4KVM A;  3FTW A;  4FP7 A;  4MKT A;  4L1B A;  3IHY A;  4EBA G;  2LNI A;  3UX4 A;  4AJW A;  2GGF A;  4GZ6 A;  3OXL A;  2PZI A;  3PRE A;  3KS2 A;  3MKQ B;  4U07 A;  2RD0 A;  1FCH A;  3CHQ A;  4AOF A;  3TXM A;  3D9M A;  3JCK C;  3JUI A;  4I43 A;  2WMO A;  1E8X A;  2LO6 A;  1MQS A;  2V5F A;  4I6E A;  4UWL A;  3QAQ A;  3P1U A;  3LVQ E;  3ZVV A;  2WXM A;  4CT0 A;  1YA0 A;  4I1O B;  4JC8 A;  3EHM A;  4K03 A;  4GA1 A;  2WMN A;  1E90 A;  3TAX A;  1BPO A;  2NSZ A;  3T8M A;  5EX0 A;  3CVV A;  4BT9 A;  2VYI A;  3TG5 A;  4GZ3 A;  5JHA A;  3MV3 B;  4JEH A;  3QC1 A;  2IQC A;  1WM5 A;  4AEZ C;  2X3M A;  3GZ1 A;  1E8Y A;  5A23 A;  3U64 A;  3FU6 A;  2L0T B;  3U4T A;  3ZHE A;  2WXK A;  2AWI A;  4FLH A;  2FO7 A;  4Q96 A;  3QKY A;  4B89 A;  2CG2 A;  4WWO A;  3RO2 A;  3U66 A;  2FI7 A;  3FHE A;  1U3D A;  4E6H A;  4AP2 A;  1OUV A;  2DCP A;  2PQN A;  1KT0 A;  2VSX E;  2DIW A;  3TJP A;  2IOS A;  2I1J A;  3QWP A;  4GPK A;  2ION A;  2UY1 B;  3MX3 A;  3IKO B;  3GYZ A;  2PM7 A;  4I9C A;  4FHK A;  2WPV A;  3T5X A;  5EDS A;  3L22 A;  4E85 A;  4AVX A;  2JLB A;  3FUM A;  4FLB A;  4U0S A;  4ANU A;  3NZU A;  4XKC A;  5FQ7 A;  3VLF A;  3WXX A;  4BTB A;  3ZEF A;  2X6F A;  4WNG A;  2UWJ G;  2XQ0 A;  3FU5 A;  1ZU2 A;  1EDU A;  4I6J A;  2J4B A;  3G2T A;  4RVB A;  5LOZ A;  3P2B A;  5FZQ A;  3LYA A;  4DI3 A;  2I6H A;  4U0Z A;  3S7D A;  3D9N A;  4M3O A;  1IQR A;  3FEY A;  5BV1 A;  2VGX A;  2IF4 A;  3PZD A;  3D9I A;  3MGB A;  4DLQ A;  3CHR A;  4CGV A;  1INZ A;  3RK6 A;  4HS2 A;  4YND A;  4CDN A;  2KZT B;  1JWF A;  2CHX A;  3HVE B;  2KCV A;  3NQP A;  4DJA A;  2VSN A;  3EIJ A;  4KVO A;  3ZYK A;  1OWN A;  4ACL A;  4HOR A;  3CVP A;  1TEZ A;  2WXQ A;  2VSY A;  5ARF A;  2L9B A;  2HR2 A;  2BTD A;  3Q49 B;  2IJG X;  2L0I A;  2RG8 A;  1XNF A;  3D9O A;  2PQR A;  2Y4U A;  4JL0 A;  4G25 A;  3AU5 A;  4LCT A;  2QY7 A;  1IYG A;  1UN9 A;  4TV3 A;  4GZ5 A;  2V0P A;  2VTB A;  4AY6 A;  3KD7 A;  3PRZ A;  1Z3X A;  1JWG A;  4XIF A;  5JJ7 A;  3FH7 A;  4AIF A;  2GRM A;  3L17 A;  3HDX A;  3FP3 A;  4B94 A;  4O6F A;  3KEZ A;  2BF0 X;  4RG6 A;  4RSY A;  3UMV A;  1H2V C;  4PDX A;  3CV0 A;  3D9J A;  1ZBP A;  2WXR A;  4JHK A;  4UWF A;  3ESL A;  2JEK A;  3FUD A;  5BNW A;  2C2L A;  2IU1 A;  3G2U A;  1JPL A;  2ILR A;  1FVH A;  4MRU A;  3R7Q A;  4GZD A;  3VTY A;  3GZ2 A;  3PUK A;  4PS8 A;  4A3T A;  4U8H A;  3FTX A;  4EZK A;  5FJY A;  3UT8 A;  3ASD A;  2WXP A;  3U9W A;  2FEZ A;  2LAH A;  3OXG A;  4I2Z A;  3IV0 A;  3CK8 A;  4QFV A;  2X6I A;  4FU3 A;  3FTV A;  4EQF A;  3LEW A;  2AVP A;  3PH0 C;  4KMO A;  4B8A A;  2AW6 A;  2Q7F A;  1HO8 A;  4HOS A;  3N71 A;  1GW6 A;  3MKQ A;  4NUR A;  4FC8 A;  4I2W A;  5G04 C;  3B7U X;  5ANL A;  1QQE A;  2FBN A;  3TL5 A;  4GA2 A;  4LER A;  4ANX A;  1HZ4 A;  2XGO A;  4LEU A;  3L13 A;  4GMJ A;  4Y6C A;  1EYH A;  2EQX A;  3FUJ A;  3FTZ A;  4ANV A;  2ZU6 B;  3QJZ A;  4AM9 A;  1B89 A;  3LCA A;  4EBA A;  5BUZ A;  3HIZ A;  5DBK A;  5CMY A;  5AIJ A;  4CEM A;  1UN8 A;  2X38 A;  3ZYQ A;  4APF A;  5E75 A;  4HOQ A;  2DBA A;  2WXJ A;  3NF1 A;  5A6C A;  3ML9 A;  3PE3 A;  4IUL A;  4C0M A;  3VLE A;  2X6J A;  4NQ0 A;  5G04 J;  3AS4 A;  5LFA A;  3JYS A;  3CVU A;  5JJT A;  5J08 A;  3MKR A;  4FHJ A;  2OND A;  4XI0 A;  1WAO 1;  3CHP A;  3LKU A;  4F53 A;  4N39 A;  4OVV A;  2XGM A;  4XKB A;  2IOL A;  4HOU A;  3ZRH A;  4URK A;  4L2L A;  3FU0 A;  4HFG A;  2HO1 A;  2YHC A;  2A5U A;  3HYM B;  4H7X A;  3L16 A;  4UI9 C;  1KLX A;  3HHM A;  4UI9 K;  4JW1 A;  4ANW A;  4V3I A;  1HG2 A;  4CCA A;  4YVO A;  3O48 A;  3CK7 A;  3D9L A;  3QDN A;  1U3C A;  4FJZ A;  1ELK A;  3FUK A;  3OAW A;  4J8F A;  5CMW A;  4JXT A;  4I1A A;  3UUX A;  1PC2 A;  3FUF A;  2LAI A;  4KZ0 A;  4HOT A;  4ACK A;  3Q4A B;  2UY1 A;  3QWV A;  3MV2 B;  4ABN A;  3ZPJ A;  4AY5 A;  3ASF A;  3VLD A;  1SZA A;  4G1T A;  4MS6 A;  2E2E A;  3QOU A;  4UI9 J;  2XCC A;  1E96 B;  1OWO A;  4KYO B;  3BG1 B;  1FVF A;  3CVQ A;  3I5P A;  4Q94 A;  2J4D A;  4B8C B;  5EX3 A;  2A4Z A;  5LCW J;  1H19 A;  1X5B A;  3FTY A;  5T4Y A;  4GAA A;  2P58 C;  5D0O D;  3MJW A;  2M63 A;  1HFA A;  3K9I A;  3RKV A;  3T5V A;  4GA0 A;  4UQX A;  2HYZ A;  3CQC B;  2WM9 A;  2NC9 A;  3I4R B;  3MEK A;  4GYO A;  4EZL A;  2L6J A;  4BY6 A;  3PVL A;  3DBS A;  4N3C A;  1TJF A;  2CG3 A;  3CLJ A;  3RU0 A;  4PH4 B;  3C98 A;  3IEG A;  2C0L A;  2KZT A;  3HVE A;  5AJD A;  3D9P A;  2WXF A;  4BFR A;  4GU5 A;  2XGS A;  4C0E A;  3CVY A;  3O4Z A;  3QB2 A;  5CCM A;  2KAT A;  4L23 A;  4HXI A;  5FZR A;  3SBS A;  4K0R A;  3S7J A;  3TGO A;  3LVR E;  4CGW A;  1ELW A;  2AXZ A;  2NXP A;  3RIB A;  3LXU X;  1ELR A;  2PM6 A;  4G23 A;  5HQ8 A;  5G55 A;  5C2Y A;  1QZ2 A;  3IHV A;  3BEE A;  2KCK A;  4FJY A;  4L7T A;  4JPS A;  4WAF A;  1Z6T A;  1EPU A;  2J07 A;  2PL2 A;  3CHO A;  4B0Z A;  4PUC A;  1HH8 A;  2WB2 A;  1HS6 A;  4A1G A;  3QNK A;  2X6K A;  2J09 A;  3ENE A;  5FQ6 A;  3CEQ A;  3FTU A;  1OWL A;  2AXU A;  1W3B A;  4JVS A;  4KBQ A;  3MYV A;  5ARG A;  3APD A;  1Z3Y A;  3EHN A;  3NZS A;  4WNE A;  3FUH A;  4UWH A;  4DK5 A;  5LX8 A;  3ONK A;  4I17 A;  3SD5 A;  3APC A;  4I6G A;  4CDR A;  2XRY A;  4BTA A;  3FDH A;  5FWQ A;  3PS6 A;  3PE4 A;  3GZS A;  3ZGQ A;  2OOE A;  2FF4 A;  3IBE A;  3PNL B;  1JUQ A;  3CVN A;  4F1S A;  4GML A;  4AV7 A;  4I9E A;  3UQ3 A;  3CVX A;  4G11 A;  3LY9 A;  3S2A A;  2MOW A;  2C0M A;  5ANR A;  1E7V A;  5DIZ A;  3TXN A;  2CHZ A;  4XI9 A;  3CGH A;  5KJL A;  2HM8 A;  3ASG A;  1NA0 A;  4JA7 A;  3FUN A;  2BUG A;  3R9A B;  5BT1 A;  3B13 A;  3ZXS A;  3G2W A;  4N2S A;  3QAR A;  2J49 A;  4PS3 A;  5M72 A;  4W9R A;  3PDN A;  1NZN A;  3CKB A;  3Q47 B;  2LSU A;  5G2N A;  3ZFW A;  4J6I A;  2V8S E;  1IHG A;  1EF1 C;  2J08 A;  1Y6I A;  4I1M A;  4ILH B;  4ILI A;  1H0A A;  2GRL A;  4IYP A;  5AYW D;  3ZYL A;  3B7T A;  4J8E A;  2VJ8 A;  4DI4 A;  5LP0 A;  1E8Z A;  3CST A;  2GW1 A;  4G24 A;  2WVI A;  1PY1 A;  3SGH A;  4JEU A;  3TG4 A;  4A1S A;  2XHE A;  1HG5 A;  2XPI A;  1HU3 A;  5T3R A;  2VQ2 A;  3FY4 A;  2LSV A;  3LDZ A;  4JHR A;  3ZYM A;  1N52 A;  2MHK A;  3L08 A;  3LY8 A;  1HF8 A;  1KT1 A;  2OVF A;  4MLP A;  5EKQ D;  2XPZ A;  1A17 A;  4CT4 A;  3L54 A;  2AXV A;  3CVL A;  5G05 J;  1UJJ A;  2CFU A;  3EDT B;  4ATG A;  3ONL A;  3CK9 A;  2XPY A;  4JZY A;  2X6H A;  1Y8M A;  4UQZ A;  5FZS A;  4N3A A;  2YNQ A;  3UT4 A;  4P29 A;  4WUY A;  4N5C A;  5LCW C;  4Q69 A;  3EJN A;  1UG3 A;  4WNF A;  4OYS A;  3CKC A;  1VDY A;  2I2O A;  5ENN A;  4J8S A;  2E0I A;  4WWN A;  5FTP A;  3I4G A;  4G26 A;  3SZ7 A;  1HX8 A;  3CQG B;  3RRN B;  3VTX A;  3CIA A;  4J0U A;  4U0U A;  4U63 A;  4GB9 A;  5KCM A;  2KCL A;  4GYW A;  2YHE A;  3FU3 A;  3LS8 A;  1LF8 A;  3UT7 A;  4NAC A;  4APO A;  4F3V A;  1DNP A;  2WXN A;  5KJK A;  4KXK B;  3ESK A;  4BX9 A;  2WQ6 A;  4Y6W A;  5A7D B;  3SI5 A;  3S7F A;  3KAE A;  3CVW A;  3ZHE B;  5FT9 A;  4XZ4 A;  4EEC A;  3OXF A;  3B7S A;  3CHM A;  2KC7 A;  2XCB A;  1N54 A;  2WXH A;  2Y3A A;  3D9K A;  4L2Y A;  1DVP A;  3SNX A;  4IN3 B;  2KM4 A;  3ULQ A;  5BV0 A;  1HE8 A;  4EPZ A;  3RO3 A;  4KT6 B;  5D0Q D;  3SF4 A;  3AU4 A;  5T8I A;  5C1D A;  2WXL A;  4FUL A;  4U04 A;  1WY6 A;  4CDM A;  2XEV A;  1H2T C;  1NP7 A;  3Q15 A;  3APF A;  1UW4 B;  3FTS A;  4NRH B;  3FUI A;  4J8D A;  5KJM A;  2WQ7 A;  4UWG A;  1MHQ A;  4DLO A;  3FUL A;  5KJN A;  2I9C A;  2OV8 A;  3Q5M A;  5FQ4 A;  3JQ1 A;  4BT8 A;  3MA5 A;  3G2V A;  4LUN U;  4JA9 A;  3MCX A;  4RG9 A;  3EIQ C;  4A55 A;  3SBT B;  3FEX A;  3FWV A;  4H7Y A;  1E8W A;  3RRU A;  4HVB A;  3I3N A;  4R7L A;  2R5S A;  3ASH A;  3CSF A;  3QWW A;  3FH5 A;  4UQY A;  2OVB A;  2WXO A;  4OVU A;  2CFZ A;  4KZC A;  3ZW3 A;  1PAQ A;  2WXG A;  4JHJ A;  5BPP A;  3CR3 A;  3OTN A;  2R59 A;  3CHS A;  3RRM B;  4DPR A;  1OWM A;  2VGX B;  4G2V A;  3E4B A;  3FH8 A;  2QFC A;  1QNF A;  2Y4T A;  3PEU B;  4TRQ A;  3G2S A;  3BG0 B;  1HXI A;  5E76 A;  4BSX A;  4C9B B;  3PEV B;  3PNT B;  2VSO E;  2CHW A;  4GYY A;  4HLE A;  1L5J A;  1H6K A;  2I1K A;  1S0P A;  3D3M A;  2XRZ A;  3GW4 A;  3B7R L;  4EZJ A;  3FUE A;  5FQ8 A;  4CRW A;  4PS7 A;  2V4L A;  5JJ6 A;  3FFL A;  2J9Q A;  4GCO A;  3JQ0 A;  4AXH A;  3DPD A;  3U3W A;  1SQM A;  3LPZ A;  1NA3 A;  3AS5 A;  3SFZ A;  5AEN A;  2VTB B;  4TUU A;  1XGW A;  4GCN A;  3ZIM A;  1E7U A;  4F7A A;  5J90 A;  1P5Q A;  2YQ8 A;  3UPV A;  4UWK A;  3LY7 A;  4WND A;  3AS8 A;  4FAD A;  3L6A A;  4XE0 A;  3LJ3 A;  2WQH A;  1H2U A;  3MZL B;  4BX8 A;  5CCL A;  4ILG A;  5AJL A;  2YIN A;  1UJK A;  4N3B A;  4GZC A;  3SHF A;  2FUL A;  1SZ9 A;  4YVQ C;  1TJC A;  2R17 C;  4LRZ A;  5CHE E;  2MRI A;  3ZN3 A;  3URZ A;  2WXI A;  4WWP A;  1IQU A;  1OWP A;  3RJV A;  3QK0 A;  4XX5 A;  5BW8 C;  3PUJ A;  4ME2 A;  5HI7 A;  5G05 C;  4N2Q A;  5JHB A;  4BWR A;  4A3V A;  4FA6 A;  3R7R A;  4D10 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...