5CERB

Bd0816 predatory endopeptidase from bdellovibrio bacteriovorus in complex with immunity protein bd3460
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
KSSKALNEAAEQGDLAKVKNLVQKNKIDLNAQDETGMTPLMNAAMGGNLDIVKFLLSKKVNLELKNNGGETALAFAVTNDAYDVAEELIKAGANVDIIVAGDEGDTLFMRAAQNNKKTAESILAKNKSLINKANTLGETALFAVARYGTPADIDFLIKKGADLKLKNKKGQTALDVAKEASNQDTAKALSKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Bd0816
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus hd100
total genus 65
structure length 193
sequence length 193
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cerB00
4G8KA 5EILA 3EU9A 3ZU7B 1DC2A 3ZKJA 5EYPF 4ZFHA 4GPMA 4A63B 2ETBA 2ZGGA 1AWCB 1BU9A 4YDYA 1K3ZD 3DEPA 2XZTG 4CZ2D 3W9FA 4LG6A 5AQ9A 5CBNA 3V79K 3J5PA 5D66A 3IXEA 3TWXA 3F6QA 1MX6A 4HRMB 2ZGDA 4GMRA 3TWWA 2F37A 2NYJA 3UI2A 4F1PA 5CECB 4YDWA 2RFAA 1NFIE 2KBXA 5ENTD 2A5EA 4B93B 2FO1E 3EHRA 1MYOA 4BSZB 4DX1A 4HQDA 1IHBA 4DX7D 3NOGD 1OT8A 4G8LA 2HE0A 3C5RA 5HRYA 4DX5D 1BD8A 3D9HA 5ENRD 4CYMD 2V5QC 3TWSA 2PNNA 4DRXE 1MX2A 1IXVA 4BETA 5HKPA 4QQIA 2BKKB 3LJNA 2DZOA 3UTMA 5FIOA 5EN5D 4HI9A 1WDYA 4LSZE 4DUIA 1A5EA 5KNHD 5KBAA 3KEAA 2VGEA 1WG0A 3UXGA 4UUCA 2B0OE 4U8VD 3SO8A 4HLLA 3V30A 1G3NB 4U8YD 4NIKA 4QFVA 3ZUVB 2AJAA 4U96D 2XEEA 3Q9UC 3HRAA 2BKGA 1SW6A 3JXIA 1MX4A 5ITZF 1S70B 5ENPD 4HRLA 2ETAA 2JABA 3Q9NC 4ZHBA 3NBNB 1TR4A 3V2XA 2QC9A 5JMND 1UOHA 4J7WA 1BI7B 3EHQA 4RLYA 1MJ0A 5CEDB 4O1PA 1D9SA 5ENOD 2V4HC 4BERA 5CERB 4LNUD 1K1BA 5KWDA 1IKND 1BI8B 2RFMA 5ENSD 4HRNA 5FINA 4C48B 1DCQA 4Z68A 3TWQA 4ATZD 1YMPA 1K1AA 4O1OA 5AQBA 4O60A 3NOCD 2DZNA 2ETCA 4HNAD 3ZNGA 3W9GA 4BEPA 1N11A 5EIBE 4U95D 5BXOA 2Y1LE 3JUEA 2KXPC 4F6RD 5CBOA 1AP7A 4K5CA 4HBDA 2DWZA 5BXUA 2MYOA 4BESA 2XENA 1QYMA 5AQAA 4DX2A 3HG0D 2P2CP 4TUMA 5AARA 5JA4D 4OAUC 2L6BA 3B7BA 3J5QB 2QYJA 4K5AB 4HI8A 5AAOA 2F8XK 2Y0BG 5AN8A 3V2OA 3JXJA 4HB5A 4JB8P 4OAVB 5AQ7A 1YYHA 3TWUA 3TWVA 1SVXA 3AJIA 4N5QA 3V31A 1N0QA 3TWRA 2J8SD 5KNGA 1YCSB 2F8YA 5HS0A 4K5BA 5ENQD 2XZDG 3DEOA 2DVWA 2XEHA 5CEAA 1BLXB 3B95A 3T8KA 5EIDA 1OY3D 5EYLA 4J8YA 1N0RA 3T9KA 3TWTA 3AAAC 4DX6D
chains in the Genus database with same CATH superfamily
2AWIA 4H7YA 4YVQC 2LUHA 4U0ZA 4UI9J 3D9OA 1KZOA 3ABKE 3J5PA 4O6FA 4XI9A 4GMRA 2OEVA 4B93B 3EJNA 3ASDA 3EHRA 4WWNA 4DX7D 4G24A 3L17A 3HHMA 4DX5D 4ABNA 2CHWA 2GW1A 2FO7A 3UINC 3AG3E 4K03A 3B7SA 4J6IA 3MA5A 3ASOE 2CG3A 4NIKA 4UQZA 2WPVA 2XEEA 1MX4A 1IYGA 1UN8A 2C0LA 1E8YA 1HG5A 1E96B 5CCLA 1HX8A 3PE3A 3Q78A 4GTMA 1KZPA 2WXMA 5FQ4A 1P5QA 5EIBE 2IOLA 4MLPA 2PZIA 2GGFA 2DWZA 4NRHB 2WB2A 4JA9A 3N71A 3EHNA 4GCOA 4V3IA 1VDYA 3J5QB 4K5AB 3I4RB 3URZA 1H6PA 4N2QA 2FEZA 2Y4UA 4N5QA 2YNQA 2WXGA 4MS6A 2MHKA 1NA3A 3FU0A 3FH7A 5ENQD 1OY3D 4C0MA 1N0RA 5CRUA 4U8HA 1WAO1 4GPMA 3TXMA 3GW4A 1AWCB 3S7JA 5CBNA 4FU3A 3TWXA 2IO3C 1MX6A 5G05J 4ILHB 4DJAA 5J08A 3QK0A 3NOGD 3ONLA 3HYMB 1H2VC 4CYMD 1N4SA 4TXRA 4HOTA 5FIOA 5HQ8A 3ZYMA 3KEAA 2VGEA 4GMLA 3UXGA 4TXPA 1GW6A 1G3NB 5BUZA 4ME2A 2AJAA 3TL5A 3PREA 2M63A 4J0UA 3JXIA 2BTDA 5T3RA 3MKQA 1JWGA 3GZ1A 3HVEB 3C3OA 1W3BA 3FTVA 1INZA 4C9BB 3MV2B 2I2OA 3ZEFA 3CKBA 3I5PA 1OCCE 4NURA 1N4QA 4XE0A 2VSYA 4EBAG 5AQBA 2IONA 5BPPA 3LVQE 2YINA 3Q79A 3GZ2A 3NB2A 1AP7A 1H6OA 4K5CA 1Z3XA 4RVBA 5C1DA 5B1BE 1O1RA 3CVNA 3QWWA 3UM0A 4HB5A 3AG4E 3C98A 4L9PA 2HR2A 4AIFA 2XQ0A 3JCKC 3R9AB 3FULA 3PUKA 4GTVA 2OVFA 3ZU7B 4KVMA 3ZKJA 2ZISA 4A63B 4BY6A 4G1TA 3MCXA 2ZGDA 5ENTD 4JW1A 5FZSA 3CGHA 4N3AA 1LF8A 3OAWA 3FUDA 3HDXA 2H6IA 2UWJG 3ZRHA 3IBEA 1MX2A 1WDYA 3Q47B 4H7XA 1WG0A 3R7QA 2XCCA 4JZYA 3ZIMA 3ASFA 3Q75A 4U07A 2VYIA 2AXZA 3FUJA 3L22A 4U8YD 1KLXA 2OEWA 4XX5A 2E2EA 3PNTB 4CGWA 2R03A 4RLYA 3I4GA 3ZVVA 2XPZA 4C48B 4ATZD 4B94A 4HORA 1V55E 4JA7A 1JCRA 5CBOA 4GTRA 4GMJA 3RRNB 2CFUA 2QYJA 1FCHA 4OVVA 3DRAA 2WXJA 1TN8A 1N94A 3D9JA 5AENA 4N3CA 3PZ3A 3ENEA 3MGBA 4TUUA 3QARA 3C3QA 3UM1A 4GTQA 3HXDA 3K9IA 4EHMA 1TNBA 4I1AA 4B89A 2J07A 2NSZA 3KAEA 3DPDA 5AQ9A 5D66A 3U4TA 2LO6A 3QAQA 4FJZA 3ZPJA 3E33A 2FO1E 3NQPA 3PRZA 5KCMA 3AU5A 3DXMG 4QQIA 1IHGA 3ZHEB 3HXEA 2XPYA 1X5BA 3IEGA 2FBNA 5BW8C 1SQMA 4A1GA 4KVOA 2I1JA 2YHCA 1HE8A 3MEKA 1KPSB 2H6GA 4L2LA 5ENOD 1N4RA 3FUIA 5EDSA 1KT0A 2WXQA 5ARFA 4FP7A 3W9GA 3HXBA 5DIZA 3FTUA 4I2ZA 2DBAA 1TNUA 1HU3A 1HZ4A 3BUAA 4UI9C 4UWFA 3V31A 1ELKA 5KNGA 4FHKA 1HS6A 5EIDA 2X6FA 5B1AE 2CHXA 4PUCA 1E7VA 1WM5A 1UN9A 1X81A 4Q96A 3R9MA 3HVEA 5EYPF 2H6FA 4FA6A 2DYRE 4CRWA 2VSNA 4GZ5A 3RRMB 2IEJA 3F6QA 2P9SG 1NFIE 3Q73A 3FEYA 1MYOA 2LSVA 4GPKA 3UMVA 2HE0A 4HLEA 2V5QC 1O1TA 3HXCA 3ZXSA 5LOZA 1Z3YA 3Q49B 4KZCA 1H0AA 4EECA 4G25A 1ELWA 4ANVA 1ZBPA 4ILGA 4BSXA 1PAQA 3RK6A 2IO2C 4I1OB 3FTZA 1YA0A 2GRLA 3FHEA 4BEPA 4W9RA 5AJLA 3RIBA 4KT6B 5FQ8A 3EIJA 4PS7A 5JA4D 2L6BA 3SF4A 5AAOA 3JXJA 5JJ7A 5CMYA 3IHVA 3G2UA 2XCBA 3DPYA 4JXTA 4GZDA 4HOUA 4FLHA 3AS4A 4G23A 5G05C 1S64A 3TWTA 5AYWD 4U7EB 4WNDA 3FY4A 3FTXA 4LCTA 3E4BA 2QYUA 4JC8A 2ZIRA 4PS3A 4Y6WA 3LY7A 2R17C 3TXNA 1JCQA 2J4BA 3OXFA 3QB2A 4I2WA 3R7RA 3LXUX 3ASGA 2QY7A 3FWVA 3CHPA 4U0SA 3PNLB 4UWGA 2X6JA 3FUMA 4L2YA 3RO3A 1TJFA 3P2BA 5ITZF 3Q9NC 4ZHBA 3NBNB 3UQ3A 2V4HC 3EUVA 5ENSD 3EDTB 4M3OA 3DSVA 1K1AA 3QOUA 4GYWA 4CT0A 4NQ0A 3RKVA 4EQFA 5BXOA 2AVPA 3D9IA 1FVHA 3DSSA 1HO8A 2DYSE 1JUQA 2J49A 2KC7A 2KM4A 3ZHEA 3RSEG 4G26A 3UM3A 1UJKA 2F8YA 4AY5A 4MBGA 4GZCA 4N5CA 2XZDG 4UQYA 4KBQA 4BT8A 4APOA 1IQUA 2C2LA 3FDHA 2KZTA 4I6JA 4XKCA 1SA5A 2ETBA 2GRQB 3CKCA 1K3ZD 4PS8A 3CIAA 2XS1A 3APCA 2RFAA 3WG7E 3ULEG 5LCWC 4G8LA 4IN3B 3LPZA 4I17A 3D9HA 1PC2A 2PNNA 3L16A 3CVUA 3BG1B 3OXGA 4UUCA 3T5XA 1FVFA 4GZ3A 4RG6A 3L54A 4L7TA 2GRPB 4GU5A 3AG2E 4XEIG 3FP3A 3HRAA 2EINE 1SW6A 4GCNA 3D3MA 2JABA 1TNOA 3B13A 2LXMA 2IJGX 4DK5A 3E37A 4AVXA 4HRNA 1OWPA 2OVBA 1EF1C 1N11A 3T8MA 3G2TA 4HBDA 5JJTA 1QYMA 3Q4AB 3UIPC 3HG0D 2VSXE 1EPUA 2WXLA 3PUJA 4HOSA 1BPOA 3B95A 3AAAC 3GZSA 4G8KA 3ZYQA 3TAXA 3SBTB 4EPZA 5G04C 4ZFHA 2EQXA 3AU4A 4YDYA 2R5SA 1MQSA 3LDZA 3U66A 1ZU2A 3QWPA 1E8ZA 1XNFA 1HFAA 3ONKA 3QDNA 3IKOB 5HRYA 3AS8A 3CQGB 4APFA 2IY0C 3IV0A 3T5VA 4LEUA 4LNGA 3HXFA 2X6IA 3UT8A 5D0OD 2C0MA 2BKKB 3VLEA 1JWFA 3X2QE 5EKQD 5IY5E 3LS8A 3ZW3A 4ANUA 1H6KA 1E90A 2XS8A 3U64A 3UX4A 3CVPA 2DIWA 4UI9K 5JMND 4JHKA 5LCWJ 3CV0A 3FUEA 4F53A 2JLBA 4OYSA 2Y1LE 3JUEA 2E0IA 1WY6A 4UWKA 3SZ7A 2WXIA 5AQAA 3FTSA 3LEWA 1LD7A 1QZ2A 5E75A 3V2OA 3Q5MA 3ASHA 5AQ7A 4P29A 4GA0A 1TN6A 1YCSB 4I43A 3D9KA 3SI5A 4YNDA 3VLFA 1OWLA 4BWRA 3T8KA 2NC9A 4I6EA 2PQRA 1N9AA 1S63A 2GRRB 3NZUA 2IOSA 3FU6A 4CZ2D 3FH5A 3SFYA 2XRYA 2F37A 1NI1A 4DLOA 2KCVA 2UY1B 3SFZA 3ZFWA 4GYYA 4CDMA 2WQ7A 3TGOA 5B3SE 3EHMA 1TYQG 2Y69E 3S7FA 5FWQA 3LJNA 3MX3A 2X38A 3CK7A 2LXLA 3EIQC 3SO8A 1QQEA 4WNGA 3UIOC 4GA1A 1QBQA 5T4YA 4N3BA 2WMNA 5G04J 2VGXB 4RG9A 4IRUA 5AJDA 5E76A 2WXKA 1OCOE 2BEDA 1PY1A 2OCCE 4WUYA 1H2UA 2EIME 2RFMA 2EIJE 2IQCA 4HXIA 2LNIA 2DZNA 1Z6TA 4WWOA 3NZSA 3ULYA 2ONDA 5JJ6A 4F6RD 2I9CA 4XKBA 5BNWA 2XENA 4DX2A 1D8EA 5AARA 2KZTB 4ANWA 1UW4B 5T8IA 3LY9A 2KATA 1U3CA 3PEVB 4CDRA 1N95A 2I1KA 5HS0A 4HVBA 4URKA 3C72A 2L0IA 4BX9A 2P9PG 1FPPA 2QFCA 5FZRA 2OOEA 4I9EA 4AJWA 1NL4A 4FLBA 3Q7AA 5H7PA 2I6HA 2V8SE 3CSTA 4FULA 4HQDA 5CCMA 2HM8A 5ENNA 4Q94A 3L13A 3UKRG 2P9LG 3ABLE 5D0QD 1DCEA 4GYOA 3ML9A 2XEVA 5EX0A 5KBAA 4HLLA 3P1UA 5M72A 3V30A 2JEKA 5FT9A 4QFVA 2WMOA 4FC8A 4DPRA 3KSQA 5FTPA 2BKGA 4BT9A 3U9WA 4HRLA 3CSFA 4GZ6A 4N39A 2XGOA 4L1BA 2QC9A 3DSXA 1UOHA 4M7CA 5CERB 1YMPA 2ZXWE 3BG0B 4HNAD 1UJJA 3CVQA 4LERA 3B7UX 4K0RA 3KEZA 2MYOA 1FT1A 2P2CP 4TUMA 2R02A 3NF1A 1N4PA 4GAAA 3B7BA 4HI8A 4U04A 5AN8A 5KJLA 2MRIA 4I9CA 3TG5A 1N0QA 2FF4A 4DI4A 3CVXA 4A3TA 3ZXPA 2XEHA 2P9KG 3RJVA 3EU9A 3UT4A 2PM7A 3G2WA 1SZ9A 3APDA 3B7RL 3DEPA 4ATGA 3CHSA 4XZ4A 2IFUA 2NYJA 2YQ8A 3DSTA 2A5EA 4IYPA 2NXPA 4AY6A 3SFXA 2XPIA 3L82A 4ANXA 1U3DA 4UWLA 1TN7A 4D10C 2PL2A 3S7DA 2DZOA 2VJ8A 4HI9A 2GRMA 4J8DA 1A5EA 4JEHA 3PZDA 2Y3AA 2J09A 4G2VA 2WM9A 5LFAA 1Y8MA 3UT7A 2J9QA 3PZ2A 3QKYA 3DSUA 3DBSA 5EX3A 4AP2A 4O1PA 1D9SA 5ARGA 4LNUD 4E6HA 3SD5A 5J90A 3ZNGA 2VTBA 2UY1A 4FJYA 3RO2A 5ANLA 4OAUC 4OVUA 2A5UA 1V54E 4YVOA 3TWVA 4JEUA 2J8SD 4WAFA 3ASNE 2WXFA 1MHQA 4BX8A 3DEOA 2WXHA 5A23A 2P9UG 2VGXA 2GRNB 5EILA 3UPVA 1TNYA 2XGSA 1DC2A 4FADA 3S7BA 2ZGGA 4ACLA 3SQVA 2KCLA 2WXOA 4YDWA 2WQHA 3CK9A 4XIFA 3LCAA 1HH8A 2VQ2A 5CRVA 3DWLG 4J8FA 1RZ4A 2B0OE 4U8VD 2CFZA 5CHEE 2GROB 2A4ZA 5A6CA 4R7LA 1TNZA 3VLDA 1TR4A 3JYSA 1MJ0A 5CEDB 1EYHA 1LTXA 3PVLA 2ETCA 3JUIA 4HFGA 3CVVA 2V5FA 3CHRA 4U63A 2WXRA 4RQIA 4N2SA 2LAHA 2V4LA 4KMOA 2FI7A 3ZN3A 2Y0BG 3EU5A 3FTYA 3AG1E 3AJIA 2X6KA 1SA4A 3TWRA 1E8XA 2L0TB 3U3WA 2XHEA 5ANRA 5EYLA 4J8YA 3MYVA 5BV0A 3QNKA 3PZ4A 1IQRA 3TJPA 3CVWA 2RD0A 2CG2A 4Q69A 2XZTG 1UG3A 3V79K 2LAIA 4LNBA 1HXIA 4KYOB 5LP0A 4F1PA 2EILE 4GTOA 4DX1A 3C5RA 3ZYLA 4J8SA 1BD8A 3MV3B 3Q7FA 3TWSA 4DRXE 3ML8A 5HKPA 1E8WA 3CEQA 4DUIA 1TJCA 3L08A 2J4DA 2ZU6B 1XGWA 5D2MC 4U96D 4AV7A 3Q15A 2VSOE 2HO1A 4TRQA 2ETAA 3LVRE 3V2XA 3KS2A 4AM9A 3CHOA 5JHBA 1BI7B 4I1MA 2AXVA 4BERA 2R59A 1K1BA 5KWDA 1IKND 4A55A 4WNFA 3KSLA 2XRZA 2IF4A 4U95D 4CGVA 1D8DA 3UKUG 4TXQA 4BTAA 3LYAA 4GTTA 3D9LA 4TV3A 1Y6IA 1SVXA 3BQOA 4LUNU 3LKUA 4EZJA 2DCPA 3D9PA 2MOWA 4CEMA 3OXLA 3T9KA 2VGYA 5G2NA 4GA2A 3FH8A 2FULA 3FUHA 2LSUA 3G2SA 2BUGA 3CVLA 3E32A 4I6GA 4DLQA 2KCKA 4LG6A 2PQNA 1QNFA 3OTNA 3UI2A 3SHFA 2Q7FA 1IHBA 1OT8A 3QC1A 5ENRD 4YDEA 4FHJA 3QJZA 1OCZE 1FT2A 2WXPA 5EN5D 4EZKA 4AXHA 2IU1A 5KNHD 3CQCB 1LD8A 4G11A 1ELRA 3LJ3A 3PDNA 1JPLA 3TG4A 2VTBB 2YHEA 1ZB1A 3PH0C 3E34A 4U0UA 4B8AA 3L6AA 4JVSA 1HG2A 4ACKA 1E7UA 5ENPD 3MJWA 4UWHA 1OWNA 1O1SA 1A17A 4MRUA 3JQ1A 1TEZA 3FTWA 3UM2A 4ILIA 3KD7A 4KZ0A 2WVIA 2Y4TA 4Z68A 3CVYA 3TWQA 4O1OA 4AOFA 1Z5SC 2QZAA 2KXPC 3GYZA 1S0PA 2ILRA 2HYZA 1NP7A 2F0YA 3DXKG 3SY2A 3SGHA 4CCAA 3SBSA 4OAVB 1N54A 3CHMA 5CMWA 4DI3A 4PDXA 4A1SA 4K5BA 4JPSA 2J08A 5CEAA 1BLXB 3ESLA 5FQ6A 1MZCA 3LY8A 3VTYA 4UQXA 3QWVA 2L9BA 1BU9A 1NA0A 3E30A 3BEEA 3HIZA 5HI7A 4CDNA 1SZAA 5KJMA 3PEUB 5CECB 2KBXA 1JCSA 3CK8A 4Y6CA 1OUVA 2AXUA 1DVPA 2X3MA 5FZQA 4HOQA 3UUXA 3SNXA 4CT4A 1OXJA 2P58C 5G55A 3FUFA 1IXVA 4BETA 4WWPA 3IHYA 3UTMA 4C0EA 2R05A 4HS2A 4YDOA 2RG8A 4EBAA 2AW6A 3PE4A 3ISMC 3ZUVB 5BT1A 2XGMA 2X6HA 4GTPA 3Q9UC 1OWMA 1DNPA 3WXXA 5FQ7A 4F7AA 4J7WA 4X8QA 3RRUA 2PM6A 4L23A 1L5JA 4AEZC 5FINA 1H19A 1DCQA 4NACA 4O60A 3NOCD 4E85A 4F1SA 1OWOA 1OCRE 3G2VA 4EZLA 3FU3A 4BESA 3MZLB 3C3RA 3JQ0A 4PH4B 3CR3A 3O4ZA 2F8XK 3RU0A 5FJYA 4GB9A 4JB8P 2P9IG 3L9TA 3VTXA 2CHZA 3ZYKA 3BU8A 2RKKA 2DVWA 2OV8A 3FUNA 3AS5A 1U2VG 4BFRA 2L6JA 1K8KG 3MKQB 4MKTA 4B8CB 5BV1A 3APFA 1Q2ZA 1B89A 2P9NG 1KT1A 4JD2G 2B6CA 3RAUA 3W9FA 3NAWA 4GTSA 5JHAA 3ZGQA 3IXEA 3TWWA 4HRMB 4IULA 4B0ZA 1N52A 3PZ1A 4BSZB 3CLJA 3FUKA 2BF0X 3B7TA 3S2AA 5KJKA 2WQ6A 3PS6A 4LRZA 2EIKE 3D9MA 4JHJA 4LSZE 1RW2A 3O48A 3CHQA 2WXNA 4A3VA 4J8EA 4RSYA 4WNEA 1S70B 1HF8A 3FEXA 4BTBA 1NZNA 4XI0A 3EHQA 4KXKB 4JL0A 1BI8B 1H2TC 3FFLA 1EDUA 5KJNA 3ULQA 3DSWA 5LX8A 4JHRA 3FU5A 1O5MA 5BXUA 2V0PA 2R2LA 5C2YA 5A7DB 4F3VA 3D9NA 5AIJA 1YYHA 3TWUA 3ABME 3MKRA 2H6HA 3I3NA 5DBKA 3ESKA 4DX6D
chains in the Genus database with same CATH topology
4G8KA 5EILA 3EU9A 3ZU7B 1DC2A 3ZKJA 5EYPF 4ZFHA 4GPMA 4A63B 2ETBA 2ZGGA 1AWCB 1BU9A 4YDYA 1K3ZD 3DEPA 2XZTG 4CZ2D 3W9FA 4LG6A 5AQ9A 5CBNA 3V79K 3J5PA 5D66A 3IXEA 3TWXA 3F6QA 1MX6A 4HRMB 2ZGDA 4GMRA 3TWWA 2F37A 2NYJA 3UI2A 4F1PA 5CECB 4YDWA 2RFAA 1NFIE 2KBXA 5ENTD 2A5EA 4B93B 2FO1E 3EHRA 1MYOA 4BSZB 4DX1A 4HQDA 1IHBA 4DX7D 3NOGD 1OT8A 4G8LA 2HE0A 3C5RA 5HRYA 4DX5D 1BD8A 3D9HA 5ENRD 4CYMD 2V5QC 3TWSA 2PNNA 4DRXE 1MX2A 1IXVA 4BETA 5HKPA 4QQIA 2BKKB 3LJNA 2DZOA 3UTMA 5FIOA 5EN5D 4HI9A 1WDYA 4LSZE 4DUIA 1A5EA 5KNHD 5KBAA 3KEAA 2VGEA 1WG0A 3UXGA 4UUCA 2B0OE 4U8VD 3SO8A 4HLLA 3V30A 1G3NB 4U8YD 4NIKA 4QFVA 3ZUVB 2AJAA 4U96D 2XEEA 3Q9UC 3HRAA 2BKGA 1SW6A 3JXIA 1MX4A 5ITZF 1S70B 5ENPD 4HRLA 2ETAA 2JABA 3Q9NC 4ZHBA 3NBNB 1TR4A 3V2XA 2QC9A 5JMND 1UOHA 4J7WA 1BI7B 3EHQA 4RLYA 1MJ0A 5CEDB 4O1PA 1D9SA 5ENOD 2V4HC 4BERA 5CERB 4LNUD 1K1BA 5KWDA 1IKND 1BI8B 2RFMA 5ENSD 4HRNA 5FINA 4C48B 1DCQA 4Z68A 3TWQA 4ATZD 1YMPA 1K1AA 4O1OA 5AQBA 4O60A 3NOCD 2DZNA 2ETCA 4HNAD 3ZNGA 3W9GA 4BEPA 1N11A 5EIBE 4U95D 5BXOA 2Y1LE 3JUEA 2KXPC 4F6RD 5CBOA 1AP7A 4K5CA 4HBDA 2DWZA 5BXUA 2MYOA 4BESA 2XENA 1QYMA 5AQAA 4DX2A 3HG0D 2P2CP 4TUMA 5AARA 5JA4D 4OAUC 2L6BA 3B7BA 3J5QB 2QYJA 4K5AB 4HI8A 5AAOA 2F8XK 2Y0BG 5AN8A 3V2OA 3JXJA 4HB5A 4JB8P 4OAVB 5AQ7A 1YYHA 3TWUA 3TWVA 1SVXA 3AJIA 4N5QA 3V31A 1N0QA 3TWRA 2J8SD 5KNGA 1YCSB 2F8YA 5HS0A 4K5BA 5ENQD 2XZDG 3DEOA 2DVWA 2XEHA 5CEAA 1BLXB 3B95A 3T8KA 5EIDA 1OY3D 5EYLA 4J8YA 1N0RA 3T9KA 3TWTA 3AAAC 4DX6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G8K A;  5EIL A;  3EU9 A;  3ZU7 B;  1DC2 A;  3ZKJ A;  5EYP F;  4ZFH A;  4GPM A;  4A63 B;  2ETB A;  2ZGG A;  1AWC B;  1BU9 A;  4YDY A;  1K3Z D;  3DEP A;  2XZT G;  4CZ2 D;  3W9F A;  4LG6 A;  5AQ9 A;  5CBN A;  3V79 K;  3J5P A;  5D66 A;  3IXE A;  3TWX A;  3F6Q A;  1MX6 A;  4HRM B;  2ZGD A;  4GMR A;  3TWW A;  2F37 A;  2NYJ A;  3UI2 A;  4F1P A;  5CEC B;  4YDW A;  2RFA A;  1NFI E;  2KBX A;  5ENT D;  2A5E A;  4B93 B;  2FO1 E;  3EHR A;  1MYO A;  4BSZ B;  4DX1 A;  4HQD A;  1IHB A;  4DX7 D;  3NOG D;  1OT8 A;  4G8L A;  2HE0 A;  3C5R A;  5HRY A;  4DX5 D;  1BD8 A;  3D9H A;  5ENR D;  4CYM D;  2V5Q C;  3TWS A;  2PNN A;  4DRX E;  1MX2 A;  1IXV A;  4BET A;  5HKP A;  4QQI A;  2BKK B;  3LJN A;  2DZO A;  3UTM A;  5FIO A;  5EN5 D;  4HI9 A;  1WDY A;  4LSZ E;  4DUI A;  1A5E A;  5KNH D;  5KBA A;  3KEA A;  2VGE A;  1WG0 A;  3UXG A;  4UUC A;  2B0O E;  4U8V D;  3SO8 A;  4HLL A;  3V30 A;  1G3N B;  4U8Y D;  4NIK A;  4QFV A;  3ZUV B;  2AJA A;  4U96 D;  2XEE A;  3Q9U C;  3HRA A;  2BKG A;  1SW6 A;  3JXI A;  1MX4 A;  5ITZ F;  1S70 B;  5ENP D;  4HRL A;  2ETA A;  2JAB A;  3Q9N C;  4ZHB A;  3NBN B;  1TR4 A;  3V2X A;  2QC9 A;  5JMN D;  1UOH A;  4J7W A;  1BI7 B;  3EHQ A;  4RLY A;  1MJ0 A;  5CED B;  4O1P A;  1D9S A;  5ENO D;  2V4H C;  4BER A;  5CER B;  4LNU D;  1K1B A;  5KWD A;  1IKN D;  1BI8 B;  2RFM A;  5ENS D;  4HRN A;  5FIN A;  4C48 B;  1DCQ A;  4Z68 A;  3TWQ A;  4ATZ D;  1YMP A;  1K1A A;  4O1O A;  5AQB A;  4O60 A;  3NOC D;  2DZN A;  2ETC A;  4HNA D;  3ZNG A;  3W9G A;  4BEP A;  1N11 A;  5EIB E;  4U95 D;  5BXO A;  2Y1L E;  3JUE A;  2KXP C;  4F6R D;  5CBO A;  1AP7 A;  4K5C A;  4HBD A;  2DWZ A;  5BXU A;  2MYO A;  4BES A;  2XEN A;  1QYM A;  5AQA A;  4DX2 A;  3HG0 D;  2P2C P;  4TUM A;  5AAR A;  5JA4 D;  4OAU C;  2L6B A;  3B7B A;  3J5Q B;  2QYJ A;  4K5A B;  4HI8 A;  5AAO A;  2F8X K;  2Y0B G;  5AN8 A;  3V2O A;  3JXJ A;  4HB5 A;  4JB8 P;  4OAV B;  5AQ7 A;  1YYH A;  3TWU A;  3TWV A;  1SVX A;  3AJI A;  4N5Q A;  3V31 A;  1N0Q A;  3TWR A;  2J8S D;  5KNG A;  1YCS B;  2F8Y A;  5HS0 A;  4K5B A;  5ENQ D;  2XZD G;  3DEO A;  2DVW A;  2XEH A;  5CEA A;  1BLX B;  3B95 A;  3T8K A;  5EID A;  1OY3 D;  5EYL A;  4J8Y A;  1N0R A;  3T9K A;  3TWT A;  3AAA C;  4DX6 D; 
#chains in the Genus database with same CATH topology
 2AWI A;  4H7Y A;  4YVQ C;  2LUH A;  4U0Z A;  4UI9 J;  3D9O A;  1KZO A;  3ABK E;  3J5P A;  4O6F A;  4XI9 A;  4GMR A;  2OEV A;  4B93 B;  3EJN A;  3ASD A;  3EHR A;  4WWN A;  4DX7 D;  4G24 A;  3L17 A;  3HHM A;  4DX5 D;  4ABN A;  2CHW A;  2GW1 A;  2FO7 A;  3UIN C;  3AG3 E;  4K03 A;  3B7S A;  4J6I A;  3MA5 A;  3ASO E;  2CG3 A;  4NIK A;  4UQZ A;  2WPV A;  2XEE A;  1MX4 A;  1IYG A;  1UN8 A;  2C0L A;  1E8Y A;  1HG5 A;  1E96 B;  5CCL A;  1HX8 A;  3PE3 A;  3Q78 A;  4GTM A;  1KZP A;  2WXM A;  5FQ4 A;  1P5Q A;  5EIB E;  2IOL A;  4MLP A;  2PZI A;  2GGF A;  2DWZ A;  4NRH B;  2WB2 A;  4JA9 A;  3N71 A;  3EHN A;  4GCO A;  4V3I A;  1VDY A;  3J5Q B;  4K5A B;  3I4R B;  3URZ A;  1H6P A;  4N2Q A;  2FEZ A;  2Y4U A;  4N5Q A;  2YNQ A;  2WXG A;  4MS6 A;  2MHK A;  1NA3 A;  3FU0 A;  3FH7 A;  5ENQ D;  1OY3 D;  4C0M A;  1N0R A;  5CRU A;  4U8H A;  1WAO 1;  4GPM A;  3TXM A;  3GW4 A;  1AWC B;  3S7J A;  5CBN A;  4FU3 A;  3TWX A;  2IO3 C;  1MX6 A;  5G05 J;  4ILH B;  4DJA A;  5J08 A;  3QK0 A;  3NOG D;  3ONL A;  3HYM B;  1H2V C;  4CYM D;  1N4S A;  4TXR A;  4HOT A;  5FIO A;  5HQ8 A;  3ZYM A;  3KEA A;  2VGE A;  4GML A;  3UXG A;  4TXP A;  1GW6 A;  1G3N B;  5BUZ A;  4ME2 A;  2AJA A;  3TL5 A;  3PRE A;  2M63 A;  4J0U A;  3JXI A;  2BTD A;  5T3R A;  3MKQ A;  1JWG A;  3GZ1 A;  3HVE B;  3C3O A;  1W3B A;  3FTV A;  1INZ A;  4C9B B;  3MV2 B;  2I2O A;  3ZEF A;  3CKB A;  3I5P A;  1OCC E;  4NUR A;  1N4Q A;  4XE0 A;  2VSY A;  4EBA G;  5AQB A;  2ION A;  5BPP A;  3LVQ E;  2YIN A;  3Q79 A;  3GZ2 A;  3NB2 A;  1AP7 A;  1H6O A;  4K5C A;  1Z3X A;  4RVB A;  5C1D A;  5B1B E;  1O1R A;  3CVN A;  3QWW A;  3UM0 A;  4HB5 A;  3AG4 E;  3C98 A;  4L9P A;  2HR2 A;  4AIF A;  2XQ0 A;  3JCK C;  3R9A B;  3FUL A;  3PUK A;  4GTV A;  2OVF A;  3ZU7 B;  4KVM A;  3ZKJ A;  2ZIS A;  4A63 B;  4BY6 A;  4G1T A;  3MCX A;  2ZGD A;  5ENT D;  4JW1 A;  5FZS A;  3CGH A;  4N3A A;  1LF8 A;  3OAW A;  3FUD A;  3HDX A;  2H6I A;  2UWJ G;  3ZRH A;  3IBE A;  1MX2 A;  1WDY A;  3Q47 B;  4H7X A;  1WG0 A;  3R7Q A;  2XCC A;  4JZY A;  3ZIM A;  3ASF A;  3Q75 A;  4U07 A;  2VYI A;  2AXZ A;  3FUJ A;  3L22 A;  4U8Y D;  1KLX A;  2OEW A;  4XX5 A;  2E2E A;  3PNT B;  4CGW A;  2R03 A;  4RLY A;  3I4G A;  3ZVV A;  2XPZ A;  4C48 B;  4ATZ D;  4B94 A;  4HOR A;  1V55 E;  4JA7 A;  1JCR A;  5CBO A;  4GTR A;  4GMJ A;  3RRN B;  2CFU A;  2QYJ A;  1FCH A;  4OVV A;  3DRA A;  2WXJ A;  1TN8 A;  1N94 A;  3D9J A;  5AEN A;  4N3C A;  3PZ3 A;  3ENE A;  3MGB A;  4TUU A;  3QAR A;  3C3Q A;  3UM1 A;  4GTQ A;  3HXD A;  3K9I A;  4EHM A;  1TNB A;  4I1A A;  4B89 A;  2J07 A;  2NSZ A;  3KAE A;  3DPD A;  5AQ9 A;  5D66 A;  3U4T A;  2LO6 A;  3QAQ A;  4FJZ A;  3ZPJ A;  3E33 A;  2FO1 E;  3NQP A;  3PRZ A;  5KCM A;  3AU5 A;  3DXM G;  4QQI A;  1IHG A;  3ZHE B;  3HXE A;  2XPY A;  1X5B A;  3IEG A;  2FBN A;  5BW8 C;  1SQM A;  4A1G A;  4KVO A;  2I1J A;  2YHC A;  1HE8 A;  3MEK A;  1KPS B;  2H6G A;  4L2L A;  5ENO D;  1N4R A;  3FUI A;  5EDS A;  1KT0 A;  2WXQ A;  5ARF A;  4FP7 A;  3W9G A;  3HXB A;  5DIZ A;  3FTU A;  4I2Z A;  2DBA A;  1TNU A;  1HU3 A;  1HZ4 A;  3BUA A;  4UI9 C;  4UWF A;  3V31 A;  1ELK A;  5KNG A;  4FHK A;  1HS6 A;  5EID A;  2X6F A;  5B1A E;  2CHX A;  4PUC A;  1E7V A;  1WM5 A;  1UN9 A;  1X81 A;  4Q96 A;  3R9M A;  3HVE A;  5EYP F;  2H6F A;  4FA6 A;  2DYR E;  4CRW A;  2VSN A;  4GZ5 A;  3RRM B;  2IEJ A;  3F6Q A;  2P9S G;  1NFI E;  3Q73 A;  3FEY A;  1MYO A;  2LSV A;  4GPK A;  3UMV A;  2HE0 A;  4HLE A;  2V5Q C;  1O1T A;  3HXC A;  3ZXS A;  5LOZ A;  1Z3Y A;  3Q49 B;  4KZC A;  1H0A A;  4EEC A;  4G25 A;  1ELW A;  4ANV A;  1ZBP A;  4ILG A;  4BSX A;  1PAQ A;  3RK6 A;  2IO2 C;  4I1O B;  3FTZ A;  1YA0 A;  2GRL A;  3FHE A;  4BEP A;  4W9R A;  5AJL A;  3RIB A;  4KT6 B;  5FQ8 A;  3EIJ A;  4PS7 A;  5JA4 D;  2L6B A;  3SF4 A;  5AAO A;  3JXJ A;  5JJ7 A;  5CMY A;  3IHV A;  3G2U A;  2XCB A;  3DPY A;  4JXT A;  4GZD A;  4HOU A;  4FLH A;  3AS4 A;  4G23 A;  5G05 C;  1S64 A;  3TWT A;  5AYW D;  4U7E B;  4WND A;  3FY4 A;  3FTX A;  4LCT A;  3E4B A;  2QYU A;  4JC8 A;  2ZIR A;  4PS3 A;  4Y6W A;  3LY7 A;  2R17 C;  3TXN A;  1JCQ A;  2J4B A;  3OXF A;  3QB2 A;  4I2W A;  3R7R A;  3LXU X;  3ASG A;  2QY7 A;  3FWV A;  3CHP A;  4U0S A;  3PNL B;  4UWG A;  2X6J A;  3FUM A;  4L2Y A;  3RO3 A;  1TJF A;  3P2B A;  5ITZ F;  3Q9N C;  4ZHB A;  3NBN B;  3UQ3 A;  2V4H C;  3EUV A;  5ENS D;  3EDT B;  4M3O A;  3DSV A;  1K1A A;  3QOU A;  4GYW A;  4CT0 A;  4NQ0 A;  3RKV A;  4EQF A;  5BXO A;  2AVP A;  3D9I A;  1FVH A;  3DSS A;  1HO8 A;  2DYS E;  1JUQ A;  2J49 A;  2KC7 A;  2KM4 A;  3ZHE A;  3RSE G;  4G26 A;  3UM3 A;  1UJK A;  2F8Y A;  4AY5 A;  4MBG A;  4GZC A;  4N5C A;  2XZD G;  4UQY A;  4KBQ A;  4BT8 A;  4APO A;  1IQU A;  2C2L A;  3FDH A;  2KZT A;  4I6J A;  4XKC A;  1SA5 A;  2ETB A;  2GRQ B;  3CKC A;  1K3Z D;  4PS8 A;  3CIA A;  2XS1 A;  3APC A;  2RFA A;  3WG7 E;  3ULE G;  5LCW C;  4G8L A;  4IN3 B;  3LPZ A;  4I17 A;  3D9H A;  1PC2 A;  2PNN A;  3L16 A;  3CVU A;  3BG1 B;  3OXG A;  4UUC A;  3T5X A;  1FVF A;  4GZ3 A;  4RG6 A;  3L54 A;  4L7T A;  2GRP B;  4GU5 A;  3AG2 E;  4XEI G;  3FP3 A;  3HRA A;  2EIN E;  1SW6 A;  4GCN A;  3D3M A;  2JAB A;  1TNO A;  3B13 A;  2LXM A;  2IJG X;  4DK5 A;  3E37 A;  4AVX A;  4HRN A;  1OWP A;  2OVB A;  1EF1 C;  1N11 A;  3T8M A;  3G2T A;  4HBD A;  5JJT A;  1QYM A;  3Q4A B;  3UIP C;  3HG0 D;  2VSX E;  1EPU A;  2WXL A;  3PUJ A;  4HOS A;  1BPO A;  3B95 A;  3AAA C;  3GZS A;  4G8K A;  3ZYQ A;  3TAX A;  3SBT B;  4EPZ A;  5G04 C;  4ZFH A;  2EQX A;  3AU4 A;  4YDY A;  2R5S A;  1MQS A;  3LDZ A;  3U66 A;  1ZU2 A;  3QWP A;  1E8Z A;  1XNF A;  1HFA A;  3ONK A;  3QDN A;  3IKO B;  5HRY A;  3AS8 A;  3CQG B;  4APF A;  2IY0 C;  3IV0 A;  3T5V A;  4LEU A;  4LNG A;  3HXF A;  2X6I A;  3UT8 A;  5D0O D;  2C0M A;  2BKK B;  3VLE A;  1JWF A;  3X2Q E;  5EKQ D;  5IY5 E;  3LS8 A;  3ZW3 A;  4ANU A;  1H6K A;  1E90 A;  2XS8 A;  3U64 A;  3UX4 A;  3CVP A;  2DIW A;  4UI9 K;  5JMN D;  4JHK A;  5LCW J;  3CV0 A;  3FUE A;  4F53 A;  2JLB A;  4OYS A;  2Y1L E;  3JUE A;  2E0I A;  1WY6 A;  4UWK A;  3SZ7 A;  2WXI A;  5AQA A;  3FTS A;  3LEW A;  1LD7 A;  1QZ2 A;  5E75 A;  3V2O A;  3Q5M A;  3ASH A;  5AQ7 A;  4P29 A;  4GA0 A;  1TN6 A;  1YCS B;  4I43 A;  3D9K A;  3SI5 A;  4YND A;  3VLF A;  1OWL A;  4BWR A;  3T8K A;  2NC9 A;  4I6E A;  2PQR A;  1N9A A;  1S63 A;  2GRR B;  3NZU A;  2IOS A;  3FU6 A;  4CZ2 D;  3FH5 A;  3SFY A;  2XRY A;  2F37 A;  1NI1 A;  4DLO A;  2KCV A;  2UY1 B;  3SFZ A;  3ZFW A;  4GYY A;  4CDM A;  2WQ7 A;  3TGO A;  5B3S E;  3EHM A;  1TYQ G;  2Y69 E;  3S7F A;  5FWQ A;  3LJN A;  3MX3 A;  2X38 A;  3CK7 A;  2LXL A;  3EIQ C;  3SO8 A;  1QQE A;  4WNG A;  3UIO C;  4GA1 A;  1QBQ A;  5T4Y A;  4N3B A;  2WMN A;  5G04 J;  2VGX B;  4RG9 A;  4IRU A;  5AJD A;  5E76 A;  2WXK A;  1OCO E;  2BED A;  1PY1 A;  2OCC E;  4WUY A;  1H2U A;  2EIM E;  2RFM A;  2EIJ E;  2IQC A;  4HXI A;  2LNI A;  2DZN A;  1Z6T A;  4WWO A;  3NZS A;  3ULY A;  2OND A;  5JJ6 A;  4F6R D;  2I9C A;  4XKB A;  5BNW A;  2XEN A;  4DX2 A;  1D8E A;  5AAR A;  2KZT B;  4ANW A;  1UW4 B;  5T8I A;  3LY9 A;  2KAT A;  1U3C A;  3PEV B;  4CDR A;  1N95 A;  2I1K A;  5HS0 A;  4HVB A;  4URK A;  3C72 A;  2L0I A;  4BX9 A;  2P9P G;  1FPP A;  2QFC A;  5FZR A;  2OOE A;  4I9E A;  4AJW A;  1NL4 A;  4FLB A;  3Q7A A;  5H7P A;  2I6H A;  2V8S E;  3CST A;  4FUL A;  4HQD A;  5CCM A;  2HM8 A;  5ENN A;  4Q94 A;  3L13 A;  3UKR G;  2P9L G;  3ABL E;  5D0Q D;  1DCE A;  4GYO A;  3ML9 A;  2XEV A;  5EX0 A;  5KBA A;  4HLL A;  3P1U A;  5M72 A;  3V30 A;  2JEK A;  5FT9 A;  4QFV A;  2WMO A;  4FC8 A;  4DPR A;  3KSQ A;  5FTP A;  2BKG A;  4BT9 A;  3U9W A;  4HRL A;  3CSF A;  4GZ6 A;  4N39 A;  2XGO A;  4L1B A;  2QC9 A;  3DSX A;  1UOH A;  4M7C A;  5CER B;  1YMP A;  2ZXW E;  3BG0 B;  4HNA D;  1UJJ A;  3CVQ A;  4LER A;  3B7U X;  4K0R A;  3KEZ A;  2MYO A;  1FT1 A;  2P2C P;  4TUM A;  2R02 A;  3NF1 A;  1N4P A;  4GAA A;  3B7B A;  4HI8 A;  4U04 A;  5AN8 A;  5KJL A;  2MRI A;  4I9C A;  3TG5 A;  1N0Q A;  2FF4 A;  4DI4 A;  3CVX A;  4A3T A;  3ZXP A;  2XEH A;  2P9K G;  3RJV A;  3EU9 A;  3UT4 A;  2PM7 A;  3G2W A;  1SZ9 A;  3APD A;  3B7R L;  3DEP A;  4ATG A;  3CHS A;  4XZ4 A;  2IFU A;  2NYJ A;  2YQ8 A;  3DST A;  2A5E A;  4IYP A;  2NXP A;  4AY6 A;  3SFX A;  2XPI A;  3L82 A;  4ANX A;  1U3D A;  4UWL A;  1TN7 A;  4D10 C;  2PL2 A;  3S7D A;  2DZO A;  2VJ8 A;  4HI9 A;  2GRM A;  4J8D A;  1A5E A;  4JEH A;  3PZD A;  2Y3A A;  2J09 A;  4G2V A;  2WM9 A;  5LFA A;  1Y8M A;  3UT7 A;  2J9Q A;  3PZ2 A;  3QKY A;  3DSU A;  3DBS A;  5EX3 A;  4AP2 A;  4O1P A;  1D9S A;  5ARG A;  4LNU D;  4E6H A;  3SD5 A;  5J90 A;  3ZNG A;  2VTB A;  2UY1 A;  4FJY A;  3RO2 A;  5ANL A;  4OAU C;  4OVU A;  2A5U A;  1V54 E;  4YVO A;  3TWV A;  4JEU A;  2J8S D;  4WAF A;  3ASN E;  2WXF A;  1MHQ A;  4BX8 A;  3DEO A;  2WXH A;  5A23 A;  2P9U G;  2VGX A;  2GRN B;  5EIL A;  3UPV A;  1TNY A;  2XGS A;  1DC2 A;  4FAD A;  3S7B A;  2ZGG A;  4ACL A;  3SQV A;  2KCL A;  2WXO A;  4YDW A;  2WQH A;  3CK9 A;  4XIF A;  3LCA A;  1HH8 A;  2VQ2 A;  5CRV A;  3DWL G;  4J8F A;  1RZ4 A;  2B0O E;  4U8V D;  2CFZ A;  5CHE E;  2GRO B;  2A4Z A;  5A6C A;  4R7L A;  1TNZ A;  3VLD A;  1TR4 A;  3JYS A;  1MJ0 A;  5CED B;  1EYH A;  1LTX A;  3PVL A;  2ETC A;  3JUI A;  4HFG A;  3CVV A;  2V5F A;  3CHR A;  4U63 A;  2WXR A;  4RQI A;  4N2S A;  2LAH A;  2V4L A;  4KMO A;  2FI7 A;  3ZN3 A;  2Y0B G;  3EU5 A;  3FTY A;  3AG1 E;  3AJI A;  2X6K A;  1SA4 A;  3TWR A;  1E8X A;  2L0T B;  3U3W A;  2XHE A;  5ANR A;  5EYL A;  4J8Y A;  3MYV A;  5BV0 A;  3QNK A;  3PZ4 A;  1IQR A;  3TJP A;  3CVW A;  2RD0 A;  2CG2 A;  4Q69 A;  2XZT G;  1UG3 A;  3V79 K;  2LAI A;  4LNB A;  1HXI A;  4KYO B;  5LP0 A;  4F1P A;  2EIL E;  4GTO A;  4DX1 A;  3C5R A;  3ZYL A;  4J8S A;  1BD8 A;  3MV3 B;  3Q7F A;  3TWS A;  4DRX E;  3ML8 A;  5HKP A;  1E8W A;  3CEQ A;  4DUI A;  1TJC A;  3L08 A;  2J4D A;  2ZU6 B;  1XGW A;  5D2M C;  4U96 D;  4AV7 A;  3Q15 A;  2VSO E;  2HO1 A;  4TRQ A;  2ETA A;  3LVR E;  3V2X A;  3KS2 A;  4AM9 A;  3CHO A;  5JHB A;  1BI7 B;  4I1M A;  2AXV A;  4BER A;  2R59 A;  1K1B A;  5KWD A;  1IKN D;  4A55 A;  4WNF A;  3KSL A;  2XRZ A;  2IF4 A;  4U95 D;  4CGV A;  1D8D A;  3UKU G;  4TXQ A;  4BTA A;  3LYA A;  4GTT A;  3D9L A;  4TV3 A;  1Y6I A;  1SVX A;  3BQO A;  4LUN U;  3LKU A;  4EZJ A;  2DCP A;  3D9P A;  2MOW A;  4CEM A;  3OXL A;  3T9K A;  2VGY A;  5G2N A;  4GA2 A;  3FH8 A;  2FUL A;  3FUH A;  2LSU A;  3G2S A;  2BUG A;  3CVL A;  3E32 A;  4I6G A;  4DLQ A;  2KCK A;  4LG6 A;  2PQN A;  1QNF A;  3OTN A;  3UI2 A;  3SHF A;  2Q7F A;  1IHB A;  1OT8 A;  3QC1 A;  5ENR D;  4YDE A;  4FHJ A;  3QJZ A;  1OCZ E;  1FT2 A;  2WXP A;  5EN5 D;  4EZK A;  4AXH A;  2IU1 A;  5KNH D;  3CQC B;  1LD8 A;  4G11 A;  1ELR A;  3LJ3 A;  3PDN A;  1JPL A;  3TG4 A;  2VTB B;  2YHE A;  1ZB1 A;  3PH0 C;  3E34 A;  4U0U A;  4B8A A;  3L6A A;  4JVS A;  1HG2 A;  4ACK A;  1E7U A;  5ENP D;  3MJW A;  4UWH A;  1OWN A;  1O1S A;  1A17 A;  4MRU A;  3JQ1 A;  1TEZ A;  3FTW A;  3UM2 A;  4ILI A;  3KD7 A;  4KZ0 A;  2WVI A;  2Y4T A;  4Z68 A;  3CVY A;  3TWQ A;  4O1O A;  4AOF A;  1Z5S C;  2QZA A;  2KXP C;  3GYZ A;  1S0P A;  2ILR A;  2HYZ A;  1NP7 A;  2F0Y A;  3DXK G;  3SY2 A;  3SGH A;  4CCA A;  3SBS A;  4OAV B;  1N54 A;  3CHM A;  5CMW A;  4DI3 A;  4PDX A;  4A1S A;  4K5B A;  4JPS A;  2J08 A;  5CEA A;  1BLX B;  3ESL A;  5FQ6 A;  1MZC A;  3LY8 A;  3VTY A;  4UQX A;  3QWV A;  2L9B A;  1BU9 A;  1NA0 A;  3E30 A;  3BEE A;  3HIZ A;  5HI7 A;  4CDN A;  1SZA A;  5KJM A;  3PEU B;  5CEC B;  2KBX A;  1JCS A;  3CK8 A;  4Y6C A;  1OUV A;  2AXU A;  1DVP A;  2X3M A;  5FZQ A;  4HOQ A;  3UUX A;  3SNX A;  4CT4 A;  1OXJ A;  2P58 C;  5G55 A;  3FUF A;  1IXV A;  4BET A;  4WWP A;  3IHY A;  3UTM A;  4C0E A;  2R05 A;  4HS2 A;  4YDO A;  2RG8 A;  4EBA A;  2AW6 A;  3PE4 A;  3ISM C;  3ZUV B;  5BT1 A;  2XGM A;  2X6H A;  4GTP A;  3Q9U C;  1OWM A;  1DNP A;  3WXX A;  5FQ7 A;  4F7A A;  4J7W A;  4X8Q A;  3RRU A;  2PM6 A;  4L23 A;  1L5J A;  4AEZ C;  5FIN A;  1H19 A;  1DCQ A;  4NAC A;  4O60 A;  3NOC D;  4E85 A;  4F1S A;  1OWO A;  1OCR E;  3G2V A;  4EZL A;  3FU3 A;  4BES A;  3MZL B;  3C3R A;  3JQ0 A;  4PH4 B;  3CR3 A;  3O4Z A;  2F8X K;  3RU0 A;  5FJY A;  4GB9 A;  4JB8 P;  2P9I G;  3L9T A;  3VTX A;  2CHZ A;  3ZYK A;  3BU8 A;  2RKK A;  2DVW A;  2OV8 A;  3FUN A;  3AS5 A;  1U2V G;  4BFR A;  2L6J A;  1K8K G;  3MKQ B;  4MKT A;  4B8C B;  5BV1 A;  3APF A;  1Q2Z A;  1B89 A;  2P9N G;  1KT1 A;  4JD2 G;  2B6C A;  3RAU A;  3W9F A;  3NAW A;  4GTS A;  5JHA A;  3ZGQ A;  3IXE A;  3TWW A;  4HRM B;  4IUL A;  4B0Z A;  1N52 A;  3PZ1 A;  4BSZ B;  3CLJ A;  3FUK A;  2BF0 X;  3B7T A;  3S2A A;  5KJK A;  2WQ6 A;  3PS6 A;  4LRZ A;  2EIK E;  3D9M A;  4JHJ A;  4LSZ E;  1RW2 A;  3O48 A;  3CHQ A;  2WXN A;  4A3V A;  4J8E A;  4RSY A;  4WNE A;  1S70 B;  1HF8 A;  3FEX A;  4BTB A;  1NZN A;  4XI0 A;  3EHQ A;  4KXK B;  4JL0 A;  1BI8 B;  1H2T C;  3FFL A;  1EDU A;  5KJN A;  3ULQ A;  3DSW A;  5LX8 A;  4JHR A;  3FU5 A;  1O5M A;  5BXU A;  2V0P A;  2R2L A;  5C2Y A;  5A7D B;  4F3V A;  3D9N A;  5AIJ A;  1YYH A;  3TWU A;  3ABM E;  3MKR A;  2H6H A;  3I3N A;  5DBK A;  3ESK A;  4DX6 D; 
#chains in the Genus database with same CATH homology
 4G8K A;  5EIL A;  3EU9 A;  3ZU7 B;  1DC2 A;  3ZKJ A;  5EYP F;  4ZFH A;  4GPM A;  4A63 B;  2ETB A;  2ZGG A;  1AWC B;  1BU9 A;  4YDY A;  1K3Z D;  3DEP A;  2XZT G;  4CZ2 D;  3W9F A;  4LG6 A;  5AQ9 A;  5CBN A;  3V79 K;  3J5P A;  5D66 A;  3IXE A;  3TWX A;  3F6Q A;  1MX6 A;  4HRM B;  2ZGD A;  4GMR A;  3TWW A;  2F37 A;  2NYJ A;  3UI2 A;  4F1P A;  5CEC B;  4YDW A;  2RFA A;  1NFI E;  2KBX A;  5ENT D;  2A5E A;  4B93 B;  2FO1 E;  3EHR A;  1MYO A;  4BSZ B;  4DX1 A;  4HQD A;  1IHB A;  4DX7 D;  3NOG D;  1OT8 A;  4G8L A;  2HE0 A;  3C5R A;  5HRY A;  4DX5 D;  1BD8 A;  3D9H A;  5ENR D;  4CYM D;  2V5Q C;  3TWS A;  2PNN A;  4DRX E;  1MX2 A;  1IXV A;  4BET A;  5HKP A;  4QQI A;  2BKK B;  3LJN A;  2DZO A;  3UTM A;  5FIO A;  5EN5 D;  4HI9 A;  1WDY A;  4LSZ E;  4DUI A;  1A5E A;  5KNH D;  5KBA A;  3KEA A;  2VGE A;  1WG0 A;  3UXG A;  4UUC A;  2B0O E;  4U8V D;  3SO8 A;  4HLL A;  3V30 A;  1G3N B;  4U8Y D;  4NIK A;  4QFV A;  3ZUV B;  2AJA A;  4U96 D;  2XEE A;  3Q9U C;  3HRA A;  2BKG A;  1SW6 A;  3JXI A;  1MX4 A;  5ITZ F;  1S70 B;  5ENP D;  4HRL A;  2ETA A;  2JAB A;  3Q9N C;  4ZHB A;  3NBN B;  1TR4 A;  3V2X A;  2QC9 A;  5JMN D;  1UOH A;  4J7W A;  1BI7 B;  3EHQ A;  4RLY A;  1MJ0 A;  5CED B;  4O1P A;  1D9S A;  5ENO D;  2V4H C;  4BER A;  5CER B;  4LNU D;  1K1B A;  5KWD A;  1IKN D;  1BI8 B;  2RFM A;  5ENS D;  4HRN A;  5FIN A;  4C48 B;  1DCQ A;  4Z68 A;  3TWQ A;  4ATZ D;  1YMP A;  1K1A A;  4O1O A;  5AQB A;  4O60 A;  3NOC D;  2DZN A;  2ETC A;  4HNA D;  3ZNG A;  3W9G A;  4BEP A;  1N11 A;  5EIB E;  4U95 D;  5BXO A;  2Y1L E;  3JUE A;  2KXP C;  4F6R D;  5CBO A;  1AP7 A;  4K5C A;  4HBD A;  2DWZ A;  5BXU A;  2MYO A;  4BES A;  2XEN A;  1QYM A;  5AQA A;  4DX2 A;  3HG0 D;  2P2C P;  4TUM A;  5AAR A;  5JA4 D;  4OAU C;  2L6B A;  3B7B A;  3J5Q B;  2QYJ A;  4K5A B;  4HI8 A;  5AAO A;  2F8X K;  2Y0B G;  5AN8 A;  3V2O A;  3JXJ A;  4HB5 A;  4JB8 P;  4OAV B;  5AQ7 A;  1YYH A;  3TWU A;  3TWV A;  1SVX A;  3AJI A;  4N5Q A;  3V31 A;  1N0Q A;  3TWR A;  2J8S D;  5KNG A;  1YCS B;  2F8Y A;  5HS0 A;  4K5B A;  5ENQ D;  2XZD G;  3DEO A;  2DVW A;  2XEH A;  5CEA A;  1BLX B;  3B95 A;  3T8K A;  5EID A;  1OY3 D;  5EYL A;  4J8Y A;  1N0R A;  3T9K A;  3TWT A;  3AAA C;  4DX6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...