5CERB

Bd0816 predatory endopeptidase from bdellovibrio bacteriovorus in complex with immunity protein bd3460
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
193
structure length
193
Chain Sequence
KSSKALNEAAEQGDLAKVKNLVQKNKIDLNAQDETGMTPLMNAAMGGNLDIVKFLLSKKVNLELKNNGGETALAFAVTNDAYDVAEELIKAGANVDIIVAGDEGDTLFMRAAQNNKKTAESILAKNKSLINKANTLGETALFAVARYGTPADIDFLIKKGADLKLKNKKGQTALDVAKEASNQDTAKALSKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ankyrin-mediated self-protection during cell invasion by the bacterial predator Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus hd100
molecule tags Immune system
molecule keywords Bd0816
total genus 65
structure length 193
sequence length 193
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2015-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cerB00
1QYMA 5AQAA 3F6QA 4B93B 2QC9A 4YDYA 4O60A 4ATZD 1MX2A 2V4HC 4TUMA 3UTMA 5JMND 5ENQD 1BLXB 4F1PA 3V79K 4LSZE 4DRXE 4DUIA 5JA4D 5CEAA 5FIOA 3ZU7B 4K5AB 5BXOA 3C5RA 4BERA 4U8VD 2KXPC 1IHBA 2ETBA 1IXVA 2MYOA 4HB5A 3EHRA 4HRMB 3Q9NC 2Y0BG 4K5BA 4HNAD 3V30A 1G3NB 2DZNA 2L6BA 4C48B 5CERB 5EYLA 1YMPA 1SW6A 4DX2A 1AWCB 2F8XK 2A5EA 2ZGGA 1N11A 3ZNGA 1OT8A 3NBNB 2F8YA 2KBXA 1YYHA 5KNGA 3TWTA 3HRAA 2V5QC 5AQ7A 3Q9UC 5CEDB 3EHQA 2DWZA 4RLYA 4HRNA 5CECB 1NFIE 5AAOA 5EILA 3AAAC 3AJIA 5ENSD 1DCQA 3IXEA 2HE0A 3JXIA 2ETAA 1K1BA 5AN8A 2XENA 1K3ZD 3DEPA 3T8KA 3T9KA 2Y1LE 3JXJA 3D9HA 3KEAA 4G8KA 4OAUC 4F6RD 3NOCD 4CZ2D 1YCSB 2DVWA 4HI9A 4QQIA 1WG0A 2XEHA 4ZHBA 3TWRA 3V2XA 5KBAA 5HKPA 1K1AA 4DX5D 1A5EA 3NOGD 2QYJA 4U8YD 4DX1A 3SO8A 4HRLA 4GPMA 1BD8A 2BKKB 5ENPD 4DX7D 4Z68A 4HLLA 1D9SA 4BESA 4G8LA 3V31A 2RFAA 3LJNA 5CBNA 5ENOD 3JUEA 3ZUVB 2RFMA 5EN5D 1WDYA 1BI8B 4GMRA 4U95D 3TWWA 2XZDG 4HI8A 3W9FA 2XEEA 1UOHA 3DEOA 4K5CA 5FINA 1AP7A 2JABA 2FO1E 3TWSA 3J5PA 2DZOA 2P2CP 5EIDA 5KNHD 5CBOA 4HQDA 4BEPA 3TWVA 4U96D 5ENTD 1MX4A 1OY3D 2B0OE 2ETCA 4J8YA 4QFVA 3V2OA 4A63B 1MX6A 5HS0A 5AQ9A 5AARA 4DX6D 4ZFHA 5EYPF 2XZTG 1MJ0A 3EU9A 1N0RA 4JB8P 4YDWA 4UUCA 2BKGA 2J8SD 3TWXA 1DC2A 4NIKA 4OAVB 2F37A 5ENRD 2PNNA 2ZGDA 5D66A 4BETA 3B95A 5HRYA 5BXUA 1BU9A 3UXGA 4CYMD 5ITZF 5EIBE 1N0QA 2VGEA 3TWQA 4O1OA 3ZKJA 3HG0D 4LG6A 4HBDA 2NYJA 1TR4A 1S70B 1SVXA 1MYOA 4J7WA 4LNUD 3B7BA 1BI7B 4O1PA 2AJAA 5KWDA 3W9GA 3UI2A 3J5QB 3TWUA 1IKND 4N5QA 5AQBA 4BSZB
chains in the Genus database with same CATH superfamily
5D2MC 5KJMA 1N52A 4DRXE 5JA4D 4GA2A 4XE0A 3QDNA 4U8VD 3CHRA 4WNGA 1OCOE 4B94A 2Q7FA 1E8WA 3ENEA 3CVWA 3UT7A 1MHQA 3ZVVA 4BSXA 3Q75A 3GZ2A 5KNGA 4AV7A 5FWQA 3ZHEB 4Q69A 3LJ3A 3AAAC 1E7VA 4C0EA 2WXIA 2KZTB 3DSXA 4PS3A 3FHEA 3DRAA 3OAWA 5LCWC 4ANUA 4Z68A 3L08A 4BESA 5ENOD 4DK5A 3PREA 1UG3A 3I3NA 2P2CP 5EIDA 4L23A 3AS5A 2CHXA 3C72A 4U96D 4UWFA 5CRVA 3NZUA 4ILHB 2DYSE 3DPYA 3SZ7A 1NL4A 4I1AA 3Q79A 1P5QA 4JB8P 4A1SA 3CKCA 4GZ5A 3B95A 5HRYA 1N0QA 1TJCA 5T4YA 3UQ3A 4LNUD 5HQ8A 3B7BA 5FT9A 2CFUA 3HXFA 4N5QA 4BSZB 3MZLB 3S7JA 4EPZA 4O6FA 3GW4A 3TXMA 1HS6A 5LFAA 4ME2A 3AU4A 3UUXA 3L6AA 2MYOA 4HRMB 3V30A 3FDHA 1TNBA 3RSEG 3NBNB 4DPRA 4IYPA 3Q47B 3FTXA 2DWZA 2YHEA 3APDA 2HO1A 3RJVA 3FTVA 1K3ZD 3NQPA 1Y6IA 2R05A 1NI1A 3D9LA 3OXGA 4WNFA 2DVWA 1WG0A 3V2XA 4M3OA 2X6FA 3PUJA 4APFA 2QZAA 1IYGA 2CG2A 2IF4A 3FTYA 2I1KA 5JJTA 5CCMA 3V31A 1H2TC 4N3BA 3D9JA 5FTPA 3CHSA 2ZXWE 2P9SG 2DBAA 4BY6A 5B1AE 1S0PA 4N2SA 2VSOE 4K03A 3V2OA 2VTBB 4I1OB 3EU9A 3FUJA 3AG4E 3FU0A 1UJJA 5C1DA 1HF8A 4L2LA 4AJWA 5T8IA 5ITZF 2IJGX 3HG0D 4EBAG 1IQUA 3DSSA 2OEVA 3HYMB 2CFZA 3HVEA 4AP2A 4N2QA 1JWFA 3RO2A 2I2OA 4U7EB 3N71A 3LY9A 3C5RA 1QBQA 2H6FA 2Y0BG 5B1BE 5CERB 1JCRA 3D9OA 3PS6A 3MEKA 3PDNA 2ZGGA 3LDZA 2LAIA 1OT8A 3CVPA 3G2SA 2R2LA 2H6HA 1NFIE 5AAOA 5ENSD 3MA5A 2HE0A 3D9NA 2GRNB 3KSQA 3SD5A 2Y1LE 3JXJA 4OAUC 4FC8A 2M63A 2WXOA 3NF1A 1HG2A 4XI0A 3JCKC 1QQEA 4DX5D 1WY6A 2YNQA 5CRUA 2GRQB 3SY2A 4UI9C 2NC9A 4A3VA 3GZSA 4TRQA 4HVBA 5CBOA 2BUGA 4XKCA 3B7SA 2LNIA 3APCA 3MYVA 4FJZA 3QNKA 4E6HA 2J9QA 4RG9A 5DIZA 3SGHA 3CVLA 1EPUA 3RAUA 1JPLA 4JXTA 3UKRG 1H2VC 3ONKA 1Z3YA 4FLBA 1SZ9A 1FCHA 2EINE 4BETA 5BXUA 2C0LA 3BQOA 3ASHA 5CHEE 2X6KA 3C98A 1BI7B 3ZYLA 1FT1A 4ACKA 5ANLA 2LO6A 2AXVA 2NXPA 4KBQA 2LAHA 4FHKA 3TL5A 2R5SA 3V79K 3AU5A 3UT8A 3FH7A 1G3NB 1TN7A 4FP7A 3ASOE 3CK7A 4GYOA 3ML9A 2F8XK 4DJAA 5D0QD 1HFAA 3CEQA 3URZA 3EIQC 3ZGQA 4F1SA 4ACLA 2CHWA 1NA0A 4CGVA 4KVMA 2CHZA 4L9PA 2KM4A 3AG2E 4BX8A 4LUNU 3DWLG 4CT4A 4A3TA 4AIFA 5ENPD 3DSTA 3RRUA 4EZJA 2WXGA 2VGYA 3TWWA 2ZIRA 2QY7A 5BNWA 4G11A 2XHEA 4HQDA 5ENTD 1TN8A 4A63B 2B0OE 4J8YA 3ZIMA 4PDXA 3CSFA 4APOA 2GGFA 1UN9A 4YDWA 3I4GA 4UWKA 3IEGA 5EIBE 3G2VA 2HR2A 3UMVA 1TR4A 1N4PA 3GYZA 3UX4A 5FZRA 3TWUA 3JQ1A 4AVXA 3IHVA 3UPVA 2V8SE 5FZQA 5ENQD 2IO2C 3EJNA 5JHAA 3PNLB 4I6EA 1U3DA 5E75A 2P9KG 2HYZA 2YHCA 2CG3A 5IY5E 4U0ZA 5ENNA 2P9UG 1N95A 1OWMA 3HRAA 5KJNA 1EF1C 4J6IA 4I2ZA 1UJKA 3RRMB 2OVBA 3T8KA 4XZ4A 2JLBA 4YVQC 3R9MA 2WXHA 5BT1A 2XCBA 2E0IA 4U0SA 2UY1B 4GPMA 2BTDA 4Q96A 2XGMA 3DBSA 4JW1A 1S63A 4MKTA 4EZLA 2XEEA 4HOUA 4GZ6A 3PUKA 3CK8A 2IOSA 3LEWA 2GRPB 2B6CA 3ULYA 1SZAA 1H6PA 4W9RA 2XZTG 4KXKB 2Y69E 4HLEA 3BG1B 3RIBA 2FEZA 3ESLA 5M72A 3FH5A 4N3AA 2LXLA 4G2VA 5D66A 4V3IA 1H6KA 1WAO1 2VGEA 1OCZE 3C3RA 2A5UA 2V4LA 5G05C 3QK0A 4GTSA 3J5QB 1E8YA 5LCWJ 2E2EA 2JEKA 4YDYA 3TG5A 4XIFA 4KZ0A 1LF8A 4UWLA 4DUIA 2VTBA 1N94A 4HNAD 4GA1A 3QB2A 3DSUA 5FQ6A 3B7RL 4BFRA 1TEZA 3GZ1A 3EUVA 1NP7A 3LXUX 4J8DA 3SF4A 5G04C 1SQMA 3K9IA 5JJ6A 1KLXA 4WWNA 4WNDA 5CCLA 3CIAA 3SQVA 1V55E 3FU6A 1KZPA 1E96B 4HOSA 3Q5MA 3DPDA 4NQ0A 2KCKA 5C2YA 4MRUA 3CSTA 4U8YD 2RD0A 1W3BA 5ANRA 3UM1A 1DVPA 3PZ2A 3MGBA 4GA0A 1SA4A 4FU3A 2XPZA 2AWIA 4UWHA 1BI8B 4HI8A 3DEOA 4N5CA 1H6OA 2J08A 1QZ2A 2PL2A 4HXIA 5KJKA 1Q2ZA 2XEVA 2WXKA 3D3MA 4KZCA 5EYPF 4Q94A 2GRLA 4JA9A 1PC2A 5FQ8A 1HXIA 1BU9A 2FF4A 4O1OA 2WQ7A 3ULEG 4J7WA 3LY8A 2WPVA 4BX9A 4JHKA 4TXQA 4JL0A 3I5PA 5AQAA 5BW8C 4GCOA 1S64A 1SA5A 4WWPA 4XEIG 2ZISA 4BERA 4EHMA 2ETBA 3EHRA 4K5BA 2KZTA 2DZNA 5HI7A 2OVFA 2FBNA 3I4RB 1YMPA 2IONA 4YVOA 4AEZC 3KS2A 4L7TA 3WG7E 2LXMA 4H7YA 1ZU2A 5EX0A 3FH8A 1N9AA 3U9WA 3CVQA 3EHQA 4FA6A 3AS4A 3BEEA 1Y8MA 1JUQA 5AN8A 4JEUA 3ZYKA 2BF0X 3B7UX 1ELWA 3ONLA 4J0UA 4WWOA 1JWGA 2YINA 1K1AA 2WXFA 1E8XA 3SO8A 1BD8A 3KEZA 1N4QA 2H6IA 2XS1A 1ZBPA 2J4DA 2YQ8A 4AM9A 4U95D 3W9FA 4L1BA 3ABKE 3CHQA 2LSUA 4U8HA 5KNHD 4BWRA 3TJPA 4JC8A 4CRWA 3CQGB 4J8EA 4DI4A 2AW6A 3TWXA 3EHMA 5ENRD 5EX3A 2ZGDA 5BV0A 3RK6A 1QNFA 2XQ0A 3CHPA 4HBDA 2V5FA 2EIME 4GTQA 3UI2A 3D9IA 3L22A 3Q49B 5AQBA 1WM5A 5G2NA 4B93B 4X8QA 1MX2A 3PE3A 5A7DB 3ZU7B 3ABLE 2OV8A 3S2AA 3P1UA 4JEHA 4K0RA 2PM6A 3FU5A 4PUCA 4KVOA 1SW6A 4DX2A 2OEWA 1NA3A 2IY0C 3T8MA 2MRIA 2EQXA 4JA7A 4CDNA 3LVQE 2A4ZA 4LNBA 4CDRA 4L2YA 1HU3A 2ETAA 4IRUA 3X2QE 2DYRE 2VYIA 2J49A 1O1SA 1E7UA 1FT2A 3MKQA 4RVBA 1A5EA 3VTXA 2AXUA 4MBGA 1GW6A 3ZUVB 4BTBA 2XZDG 1EDUA 2IEJA 4GTTA 2WXPA 3TWSA 3U66A 2I6HA 1Z6TA 5J90A 4P29A 3SFYA 1DCEA 4XI9A 1OCRE 5AJLA 5EDSA 1MJ0A 4UUCA 1Z5SC 5AYWD 4NIKA 1NZNA 1ELRA 4U07A 4UI9J 3CHMA 4JPSA 4LERA 4U0UA 3PE4A 2UY1A 3U4TA 3S7FA 3S7BA 3AG3E 2IQCA 2VQ2A 3EU5A 3FUDA 3CKBA 1E90A 2ONDA 3ML8A 3ZHEA 2QC9A 3O4ZA 4TUUA 3QAQA 2J4BA 3SBSA 4RSYA 3LYAA 4HS2A 3Q9NC 1X81A 4N3CA 3DSVA 3ISMC 2GRRB 4I6GA 3ZYMA 3IHYA 5CEDB 4RLYA 3VLDA 1TNYA 3VLFA 1K1BA 1ZB1A 1H0AA 3EIJA 5ARFA 2X6HA 3DEPA 4M7CA 3D9HA 2X6IA 4PS7A 3APFA 3TWRA 3UM3A 3Q7AA 1FVHA 4FJYA 3S7DA 4HLLA 4FLHA 3PH0C 2WB2A 4KT6B 4B8AA 3DXMG 1K8KG 5G05J 1HE8A 3HXCA 3KAEA 4BT9A 2R59A 3RRNB 3KD7A 3QOUA 2WXLA 4CT0A 4ZFHA 2I1JA 3MCXA 4ANVA 4OAVB 2F37A 2AVPA 3R9AB 5FJYA 3ZKJA 4LG6A 2WXJA 1HH8A 3HXDA 2Y3AA 4O1PA 3HDXA 2AJAA 5CMYA 1LD8A 1HO8A 1JCSA 3F6QA 1H2UA 3ASDA 4G24A 5FIOA 4D10C 4K5AB 3PEUB 2WVIA 3SNXA 3MKRA 5A6CA 2PQNA 2PM7A 5CMWA 2KCLA 1N11A 4YDOA 3TWTA 2WXMA 2UWJG 4FADA 3TAXA 3NZSA 1DCQA 1V54E 2WQ6A 3KEAA 3L13A 5BPPA 3ZEFA 3CLJA 1YCSB 4HI9A 3D9PA 2Y4UA 4EZKA 3G2UA 5HKPA 3WXXA 1PAQA 2BKKB 1BPOA 1D9SA 1VDYA 2RG8A 3RO3A 1OXJA 3CGHA 4F3VA 5LOZA 5G04J 2C0MA 2JABA 3ASNE 2FO1E 4NRHB 4AY5A 4BEPA 4JVSA 2XRZA 4I43A 1IQRA 3SFXA 1OWOA 3HXEA 5E76A 4LCTA 4B8CB 4WUYA 4G1TA 1D8DA 4BT8A 3ASGA 3U3WA 3UIPC 1S70B 1U2VG 2P9IG 2BEDA 4U04A 3CVUA 1QYMA 2ZU6B 2P9PG 4HOQA 3CVVA 1INZA 3O48A 1IHBA 4MS6A 1IXVA 4HB5A 2L6BA 4GTMA 1HX8A 3Q4AB 3MX3A 4ATGA 2A5EA 1RW2A 2KC7A 4ANWA 4G23A 3CVYA 3AJIA 3ZRHA 4GB9A 3L17A 2XGOA 3JXIA 5AENA 1PY1A 1TNOA 4UQZA 3FTWA 5AJDA 3FUIA 4ANXA 4R7LA 1KZOA 4QQIA 3QKYA 2P9NG 1TNZA 1A17A 5KBAA 3BU8A 3CQCB 2L0TB 1OWPA 3E4BA 2WXNA 2J07A 4OVVA 5FINA 4IN3B 3QWPA 3UKUG 4I2WA 1OWNA 4Y6CA 1MX4A 3FUFA 4C9BB 2KATA 4AY6A 5AQ9A 5AARA 4EQFA 1LTXA 3TWQA 3G2WA 2X6JA 2I9CA 2WXRA 4UQYA 2PQRA 3SHFA 3HVEB 3Q73A 3NB2A 1L5JA 1HZ4A 3QWVA 4O60A 4ATZD 3UTMA 4TUMA 4OYSA 5CEAA 4YNDA 3JUIA 4XKBA 1X5BA 4DI3A 5ARGA 2MHKA 4C48B 4F53A 3FULA 3RU0A 3LS8A 4GZCA 2F8YA 5EKQD 3T5VA 2Y4TA 3OXFA 3E30A 1KT0A 3Q15A 4CGWA 2L0IA 3FU3A 4F6RD 5D0OD 1FVFA 3FFLA 4TXRA 5BUZA 4IULA 1B89A 3NOGD 2J09A 4MLPA 3FUHA 4DLQA 2FI7A 1KPSB 2RFMA 5EN5D 2IFUA 4B89A 3R7RA 4OVUA 2XGSA 4YDEA 5T3RA 5LP0A 3UINC 5H7PA 2P9LG 1YA0A 4GAAA 4GU5A 1DC2A 5FQ7A 4J8SA 3QJZA 3L16A 1JCQA 2PNNA 4GMLA 5FZSA 5FQ4A 3HXBA 3EHNA 2L6JA 5A23A 1DNPA 1IKND 3QWWA 4PS8A 3AS8A 3FTSA 3TGOA 4HFGA 4F1PA 3SBTB 3C3OA 4Y6WA 4A55A 2KXPC 3D9MA 2LUHA 5CBNA 4ABNA 3B7TA 3ZFWA 3FUMA 4RG6A 3E33A 3PEVB 2OCCE 4ILIA 3ZNGA 5JJ7A 3E34A 2KBXA 4HORA 5AQ7A 4I1MA 3Q9UC 4GZ3A 2P58C 5EILA 2MOWA 3IXEA 2IOLA 2XENA 1E8ZA 3FEXA 3PZ4A 4GCNA 2VGXB 1TJFA 1MZCA 4LRZA 2RFAA 5J08A 5KCMA 1XNFA 4URKA 3FUEA 4K5CA 4GYWA 3SI5A 2DZOA 4U63A 1OY3D 2ETCA 2LSVA 1MX6A 2VSXE 4UWGA 1N0RA 3TXNA 2J8SD 2XRYA 4F7AA 4XX5A 2WMOA 2XCCA 1O1TA 2DIWA 5DBKA 1ELKA 3VTYA 4NURA 3PVLA 4EECA 1XGWA 3JYSA 1UW4B 5JMND 1BLXB 3ASFA 1O1RA 4JD2G 2OOEA 3SFZA 4FULA 5EYLA 3FTUA 1AWCB 5B3SE 2QYUA 4CEMA 2EIKE 3P2BA 3FEYA 3CVXA 2X38A 2PZIA 4UQXA 2DCPA 3OTNA 4G8KA 2WM9A 3UT4A 3FWVA 1MQSA 3PZDA 4CZ2D 4GMJA 1EYHA 2GROB 3PZ1A 3LY7A 2QYJA 4KMOA 4CDMA 3CHOA 1TYQG 2VGXA 3VLEA 3JUEA 4HOTA 1UOHA 1AP7A 2VSNA 4GTRA 3UM2A 3L54A 4NACA 2VJ8A 2R02A 1LD7A 3NAWA 4I17A 1OUVA 4JZYA 3ZN3A 3E32A 2L9BA 3L82A 3B13A 2RKKA 3FTZA 3UXGA 4CYMD 4PH4B 3FUKA 2C2LA 3ZW3A 3G2TA 1SVXA 1MYOA 1TN6A 2V0PA 4GYYA 5KWDA 2F0YA 4UI9K 2HM8A 1OWLA 3ZPJA 2IO3C 3IKOB 4N39A 2V4HC 4AXHA 4LSZE 3AG1E 2FO7A 3BUAA 3PZ3A 3C3QA 4BTAA 3BG0B 2VSYA 4GTVA 4LNGA 3ZYQA 4DLOA 4ILGA 4EBAA 4GPKA 2R03A 4JHRA 1YYHA 3KSLA 3CV0A 1OCCE 5CECB 3LVRE 2XPIA 2NSZA 1RZ4A 4I9EA 2WQHA 3T9KA 3MV3B 3QARA 3NOCD 3CVNA 3IV0A 1N4RA 4HRLA 2GW1A 4DX7D 3OXLA 3Q7FA 1WDYA 3R7QA 3TG4A 2EIJE 1N4SA 3T5XA 5LX8A 3TWVA 4TXPA 1HG5A 4QFVA 4C0MA 3JQ0A 5AIJA 5HS0A 4DX6D 5KJLA 3LCAA 4RQIA 2BKGA 4WNEA 1FPPA 4G26A 4AOFA 2AXZA 2QFCA 3L9TA 2R17C 3MJWA 1IHGA 5G55A 4JHJA 3W9GA 3HHMA 4E85A 3LPZA 3U64A 4GTPA 3FP3A 5BXOA 3PNTB 3FUNA 1U3CA 1KT1A 3CR3A 4TV3A 4GTOA 3Q78A 3LKUA 3ESKA 3ABME 2H6GA 2V5QC 4FHJA 3PRZA 4G25A 4HRNA 1TNUA 3ZXPA 1Z3XA 3DSWA 3HIZA 3IBEA 3MV2B 2XEHA 4ZHBA 1N54A 4J8FA 4DX1A 1D8EA 1UN8A 5JHBA 4I9CA 4CCAA 4G8LA 3LJNA 4GMRA 3FY4A 2XS8A 4GZDA 2WXQA 3J5PA 3D9KA 3RKVA 3ULQA 4I6JA 2EILE 1H19A 5BV1A 4H7XA 3EDTB 4LEUA 3ZXSA 3CK9A 2IU1A 4WAFA 2ILRA 2GRMA 2WMNA 3QC1A 4A1GA 3DXKG 3UIOC 3E37A 3UM0A 4KYOB 2FULA 1O5MA 2NYJA 2KCVA 2XPYA 2X3MA 3MKQB 4B0ZA
chains in the Genus database with same CATH topology
1QYMA 5AQAA 3F6QA 4B93B 2QC9A 4YDYA 4O60A 4ATZD 1MX2A 2V4HC 4TUMA 3UTMA 5JMND 5ENQD 1BLXB 4F1PA 3V79K 4LSZE 4DRXE 4DUIA 5JA4D 5CEAA 5FIOA 3ZU7B 4K5AB 5BXOA 3C5RA 4BERA 4U8VD 2KXPC 1IHBA 2ETBA 1IXVA 2MYOA 4HB5A 3EHRA 4HRMB 3Q9NC 2Y0BG 4K5BA 4HNAD 3V30A 1G3NB 2DZNA 2L6BA 4C48B 5CERB 5EYLA 1YMPA 1SW6A 4DX2A 1AWCB 2F8XK 2A5EA 2ZGGA 1N11A 3ZNGA 1OT8A 3NBNB 2F8YA 2KBXA 1YYHA 5KNGA 3TWTA 3HRAA 2V5QC 5AQ7A 3Q9UC 5CEDB 3EHQA 2DWZA 4RLYA 4HRNA 5CECB 1NFIE 5AAOA 5EILA 3AAAC 3AJIA 5ENSD 1DCQA 3IXEA 2HE0A 3JXIA 2ETAA 1K1BA 5AN8A 2XENA 1K3ZD 3DEPA 3T8KA 3T9KA 2Y1LE 3JXJA 3D9HA 3KEAA 4G8KA 4OAUC 4F6RD 3NOCD 4CZ2D 1YCSB 2DVWA 4HI9A 4QQIA 1WG0A 2XEHA 4ZHBA 3TWRA 3V2XA 5KBAA 5HKPA 1K1AA 4DX5D 1A5EA 3NOGD 2QYJA 4U8YD 4DX1A 3SO8A 4HRLA 4GPMA 1BD8A 2BKKB 5ENPD 4DX7D 4Z68A 4HLLA 1D9SA 4BESA 4G8LA 3V31A 2RFAA 3LJNA 5CBNA 5ENOD 3JUEA 3ZUVB 2RFMA 5EN5D 1WDYA 1BI8B 4GMRA 4U95D 3TWWA 2XZDG 4HI8A 3W9FA 2XEEA 1UOHA 3DEOA 4K5CA 5FINA 1AP7A 2JABA 2FO1E 3TWSA 3J5PA 2DZOA 2P2CP 5EIDA 5KNHD 5CBOA 4HQDA 4BEPA 3TWVA 4U96D 5ENTD 1MX4A 1OY3D 2B0OE 2ETCA 4J8YA 4QFVA 3V2OA 4A63B 1MX6A 5HS0A 5AQ9A 5AARA 4DX6D 4ZFHA 5EYPF 2XZTG 1MJ0A 3EU9A 1N0RA 4JB8P 4YDWA 4UUCA 2BKGA 2J8SD 3TWXA 1DC2A 4NIKA 4OAVB 2F37A 5ENRD 2PNNA 2ZGDA 5D66A 4BETA 3B95A 5HRYA 5BXUA 1BU9A 3UXGA 4CYMD 5ITZF 5EIBE 1N0QA 2VGEA 3TWQA 4O1OA 3ZKJA 3HG0D 4LG6A 4HBDA 2NYJA 1TR4A 1S70B 1SVXA 1MYOA 4J7WA 4LNUD 3B7BA 1BI7B 4O1PA 2AJAA 5KWDA 3W9GA 3UI2A 3J5QB 3TWUA 1IKND 4N5QA 5AQBA 4BSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYM A;  5AQA A;  3F6Q A;  4B93 B;  2QC9 A;  4YDY A;  4O60 A;  4ATZ D;  1MX2 A;  2V4H C;  4TUM A;  3UTM A;  5JMN D;  5ENQ D;  1BLX B;  4F1P A;  3V79 K;  4LSZ E;  4DRX E;  4DUI A;  5JA4 D;  5CEA A;  5FIO A;  3ZU7 B;  4K5A B;  5BXO A;  3C5R A;  4BER A;  4U8V D;  2KXP C;  1IHB A;  2ETB A;  1IXV A;  2MYO A;  4HB5 A;  3EHR A;  4HRM B;  3Q9N C;  2Y0B G;  4K5B A;  4HNA D;  3V30 A;  1G3N B;  2DZN A;  2L6B A;  4C48 B;  5CER B;  5EYL A;  1YMP A;  1SW6 A;  4DX2 A;  1AWC B;  2F8X K;  2A5E A;  2ZGG A;  1N11 A;  3ZNG A;  1OT8 A;  3NBN B;  2F8Y A;  2KBX A;  1YYH A;  5KNG A;  3TWT A;  3HRA A;  2V5Q C;  5AQ7 A;  3Q9U C;  5CED B;  3EHQ A;  2DWZ A;  4RLY A;  4HRN A;  5CEC B;  1NFI E;  5AAO A;  5EIL A;  3AAA C;  3AJI A;  5ENS D;  1DCQ A;  3IXE A;  2HE0 A;  3JXI A;  2ETA A;  1K1B A;  5AN8 A;  2XEN A;  1K3Z D;  3DEP A;  3T8K A;  3T9K A;  2Y1L E;  3JXJ A;  3D9H A;  3KEA A;  4G8K A;  4OAU C;  4F6R D;  3NOC D;  4CZ2 D;  1YCS B;  2DVW A;  4HI9 A;  4QQI A;  1WG0 A;  2XEH A;  4ZHB A;  3TWR A;  3V2X A;  5KBA A;  5HKP A;  1K1A A;  4DX5 D;  1A5E A;  3NOG D;  2QYJ A;  4U8Y D;  4DX1 A;  3SO8 A;  4HRL A;  4GPM A;  1BD8 A;  2BKK B;  5ENP D;  4DX7 D;  4Z68 A;  4HLL A;  1D9S A;  4BES A;  4G8L A;  3V31 A;  2RFA A;  3LJN A;  5CBN A;  5ENO D;  3JUE A;  3ZUV B;  2RFM A;  5EN5 D;  1WDY A;  1BI8 B;  4GMR A;  4U95 D;  3TWW A;  2XZD G;  4HI8 A;  3W9F A;  2XEE A;  1UOH A;  3DEO A;  4K5C A;  5FIN A;  1AP7 A;  2JAB A;  2FO1 E;  3TWS A;  3J5P A;  2DZO A;  2P2C P;  5EID A;  5KNH D;  5CBO A;  4HQD A;  4BEP A;  3TWV A;  4U96 D;  5ENT D;  1MX4 A;  1OY3 D;  2B0O E;  2ETC A;  4J8Y A;  4QFV A;  3V2O A;  4A63 B;  1MX6 A;  5HS0 A;  5AQ9 A;  5AAR A;  4DX6 D;  4ZFH A;  5EYP F;  2XZT G;  1MJ0 A;  3EU9 A;  1N0R A;  4JB8 P;  4YDW A;  4UUC A;  2BKG A;  2J8S D;  3TWX A;  1DC2 A;  4NIK A;  4OAV B;  2F37 A;  5ENR D;  2PNN A;  2ZGD A;  5D66 A;  4BET A;  3B95 A;  5HRY A;  5BXU A;  1BU9 A;  3UXG A;  4CYM D;  5ITZ F;  5EIB E;  1N0Q A;  2VGE A;  3TWQ A;  4O1O A;  3ZKJ A;  3HG0 D;  4LG6 A;  4HBD A;  2NYJ A;  1TR4 A;  1S70 B;  1SVX A;  1MYO A;  4J7W A;  4LNU D;  3B7B A;  1BI7 B;  4O1P A;  2AJA A;  5KWD A;  3W9G A;  3UI2 A;  3J5Q B;  3TWU A;  1IKN D;  4N5Q A;  5AQB A;  4BSZ B; 
#chains in the Genus database with same CATH topology
 5D2M C;  5KJM A;  1N52 A;  4DRX E;  5JA4 D;  4GA2 A;  4XE0 A;  3QDN A;  4U8V D;  3CHR A;  4WNG A;  1OCO E;  4B94 A;  2Q7F A;  1E8W A;  3ENE A;  3CVW A;  3UT7 A;  1MHQ A;  3ZVV A;  4BSX A;  3Q75 A;  3GZ2 A;  5KNG A;  4AV7 A;  5FWQ A;  3ZHE B;  4Q69 A;  3LJ3 A;  3AAA C;  1E7V A;  4C0E A;  2WXI A;  2KZT B;  3DSX A;  4PS3 A;  3FHE A;  3DRA A;  3OAW A;  5LCW C;  4ANU A;  4Z68 A;  3L08 A;  4BES A;  5ENO D;  4DK5 A;  3PRE A;  1UG3 A;  3I3N A;  2P2C P;  5EID A;  4L23 A;  3AS5 A;  2CHX A;  3C72 A;  4U96 D;  4UWF A;  5CRV A;  3NZU A;  4ILH B;  2DYS E;  3DPY A;  3SZ7 A;  1NL4 A;  4I1A A;  3Q79 A;  1P5Q A;  4JB8 P;  4A1S A;  3CKC A;  4GZ5 A;  3B95 A;  5HRY A;  1N0Q A;  1TJC A;  5T4Y A;  3UQ3 A;  4LNU D;  5HQ8 A;  3B7B A;  5FT9 A;  2CFU A;  3HXF A;  4N5Q A;  4BSZ B;  3MZL B;  3S7J A;  4EPZ A;  4O6F A;  3GW4 A;  3TXM A;  1HS6 A;  5LFA A;  4ME2 A;  3AU4 A;  3UUX A;  3L6A A;  2MYO A;  4HRM B;  3V30 A;  3FDH A;  1TNB A;  3RSE G;  3NBN B;  4DPR A;  4IYP A;  3Q47 B;  3FTX A;  2DWZ A;  2YHE A;  3APD A;  2HO1 A;  3RJV A;  3FTV A;  1K3Z D;  3NQP A;  1Y6I A;  2R05 A;  1NI1 A;  3D9L A;  3OXG A;  4WNF A;  2DVW A;  1WG0 A;  3V2X A;  4M3O A;  2X6F A;  3PUJ A;  4APF A;  2QZA A;  1IYG A;  2CG2 A;  2IF4 A;  3FTY A;  2I1K A;  5JJT A;  5CCM A;  3V31 A;  1H2T C;  4N3B A;  3D9J A;  5FTP A;  3CHS A;  2ZXW E;  2P9S G;  2DBA A;  4BY6 A;  5B1A E;  1S0P A;  4N2S A;  2VSO E;  4K03 A;  3V2O A;  2VTB B;  4I1O B;  3EU9 A;  3FUJ A;  3AG4 E;  3FU0 A;  1UJJ A;  5C1D A;  1HF8 A;  4L2L A;  4AJW A;  5T8I A;  5ITZ F;  2IJG X;  3HG0 D;  4EBA G;  1IQU A;  3DSS A;  2OEV A;  3HYM B;  2CFZ A;  3HVE A;  4AP2 A;  4N2Q A;  1JWF A;  3RO2 A;  2I2O A;  4U7E B;  3N71 A;  3LY9 A;  3C5R A;  1QBQ A;  2H6F A;  2Y0B G;  5B1B E;  5CER B;  1JCR A;  3D9O A;  3PS6 A;  3MEK A;  3PDN A;  2ZGG A;  3LDZ A;  2LAI A;  1OT8 A;  3CVP A;  3G2S A;  2R2L A;  2H6H A;  1NFI E;  5AAO A;  5ENS D;  3MA5 A;  2HE0 A;  3D9N A;  2GRN B;  3KSQ A;  3SD5 A;  2Y1L E;  3JXJ A;  4OAU C;  4FC8 A;  2M63 A;  2WXO A;  3NF1 A;  1HG2 A;  4XI0 A;  3JCK C;  1QQE A;  4DX5 D;  1WY6 A;  2YNQ A;  5CRU A;  2GRQ B;  3SY2 A;  4UI9 C;  2NC9 A;  4A3V A;  3GZS A;  4TRQ A;  4HVB A;  5CBO A;  2BUG A;  4XKC A;  3B7S A;  2LNI A;  3APC A;  3MYV A;  4FJZ A;  3QNK A;  4E6H A;  2J9Q A;  4RG9 A;  5DIZ A;  3SGH A;  3CVL A;  1EPU A;  3RAU A;  1JPL A;  4JXT A;  3UKR G;  1H2V C;  3ONK A;  1Z3Y A;  4FLB A;  1SZ9 A;  1FCH A;  2EIN E;  4BET A;  5BXU A;  2C0L A;  3BQO A;  3ASH A;  5CHE E;  2X6K A;  3C98 A;  1BI7 B;  3ZYL A;  1FT1 A;  4ACK A;  5ANL A;  2LO6 A;  2AXV A;  2NXP A;  4KBQ A;  2LAH A;  4FHK A;  3TL5 A;  2R5S A;  3V79 K;  3AU5 A;  3UT8 A;  3FH7 A;  1G3N B;  1TN7 A;  4FP7 A;  3ASO E;  3CK7 A;  4GYO A;  3ML9 A;  2F8X K;  4DJA A;  5D0Q D;  1HFA A;  3CEQ A;  3URZ A;  3EIQ C;  3ZGQ A;  4F1S A;  4ACL A;  2CHW A;  1NA0 A;  4CGV A;  4KVM A;  2CHZ A;  4L9P A;  2KM4 A;  3AG2 E;  4BX8 A;  4LUN U;  3DWL G;  4CT4 A;  4A3T A;  4AIF A;  5ENP D;  3DST A;  3RRU A;  4EZJ A;  2WXG A;  2VGY A;  3TWW A;  2ZIR A;  2QY7 A;  5BNW A;  4G11 A;  2XHE A;  4HQD A;  5ENT D;  1TN8 A;  4A63 B;  2B0O E;  4J8Y A;  3ZIM A;  4PDX A;  3CSF A;  4APO A;  2GGF A;  1UN9 A;  4YDW A;  3I4G A;  4UWK A;  3IEG A;  5EIB E;  3G2V A;  2HR2 A;  3UMV A;  1TR4 A;  1N4P A;  3GYZ A;  3UX4 A;  5FZR A;  3TWU A;  3JQ1 A;  4AVX A;  3IHV A;  3UPV A;  2V8S E;  5FZQ A;  5ENQ D;  2IO2 C;  3EJN A;  5JHA A;  3PNL B;  4I6E A;  1U3D A;  5E75 A;  2P9K G;  2HYZ A;  2YHC A;  2CG3 A;  5IY5 E;  4U0Z A;  5ENN A;  2P9U G;  1N95 A;  1OWM A;  3HRA A;  5KJN A;  1EF1 C;  4J6I A;  4I2Z A;  1UJK A;  3RRM B;  2OVB A;  3T8K A;  4XZ4 A;  2JLB A;  4YVQ C;  3R9M A;  2WXH A;  5BT1 A;  2XCB A;  2E0I A;  4U0S A;  2UY1 B;  4GPM A;  2BTD A;  4Q96 A;  2XGM A;  3DBS A;  4JW1 A;  1S63 A;  4MKT A;  4EZL A;  2XEE A;  4HOU A;  4GZ6 A;  3PUK A;  3CK8 A;  2IOS A;  3LEW A;  2GRP B;  2B6C A;  3ULY A;  1SZA A;  1H6P A;  4W9R A;  2XZT G;  4KXK B;  2Y69 E;  4HLE A;  3BG1 B;  3RIB A;  2FEZ A;  3ESL A;  5M72 A;  3FH5 A;  4N3A A;  2LXL A;  4G2V A;  5D66 A;  4V3I A;  1H6K A;  1WAO 1;  2VGE A;  1OCZ E;  3C3R A;  2A5U A;  2V4L A;  5G05 C;  3QK0 A;  4GTS A;  3J5Q B;  1E8Y A;  5LCW J;  2E2E A;  2JEK A;  4YDY A;  3TG5 A;  4XIF A;  4KZ0 A;  1LF8 A;  4UWL A;  4DUI A;  2VTB A;  1N94 A;  4HNA D;  4GA1 A;  3QB2 A;  3DSU A;  5FQ6 A;  3B7R L;  4BFR A;  1TEZ A;  3GZ1 A;  3EUV A;  1NP7 A;  3LXU X;  4J8D A;  3SF4 A;  5G04 C;  1SQM A;  3K9I A;  5JJ6 A;  1KLX A;  4WWN A;  4WND A;  5CCL A;  3CIA A;  3SQV A;  1V55 E;  3FU6 A;  1KZP A;  1E96 B;  4HOS A;  3Q5M A;  3DPD A;  4NQ0 A;  2KCK A;  5C2Y A;  4MRU A;  3CST A;  4U8Y D;  2RD0 A;  1W3B A;  5ANR A;  3UM1 A;  1DVP A;  3PZ2 A;  3MGB A;  4GA0 A;  1SA4 A;  4FU3 A;  2XPZ A;  2AWI A;  4UWH A;  1BI8 B;  4HI8 A;  3DEO A;  4N5C A;  1H6O A;  2J08 A;  1QZ2 A;  2PL2 A;  4HXI A;  5KJK A;  1Q2Z A;  2XEV A;  2WXK A;  3D3M A;  4KZC A;  5EYP F;  4Q94 A;  2GRL A;  4JA9 A;  1PC2 A;  5FQ8 A;  1HXI A;  1BU9 A;  2FF4 A;  4O1O A;  2WQ7 A;  3ULE G;  4J7W A;  3LY8 A;  2WPV A;  4BX9 A;  4JHK A;  4TXQ A;  4JL0 A;  3I5P A;  5AQA A;  5BW8 C;  4GCO A;  1S64 A;  1SA5 A;  4WWP A;  4XEI G;  2ZIS A;  4BER A;  4EHM A;  2ETB A;  3EHR A;  4K5B A;  2KZT A;  2DZN A;  5HI7 A;  2OVF A;  2FBN A;  3I4R B;  1YMP A;  2ION A;  4YVO A;  4AEZ C;  3KS2 A;  4L7T A;  3WG7 E;  2LXM A;  4H7Y A;  1ZU2 A;  5EX0 A;  3FH8 A;  1N9A A;  3U9W A;  3CVQ A;  3EHQ A;  4FA6 A;  3AS4 A;  3BEE A;  1Y8M A;  1JUQ A;  5AN8 A;  4JEU A;  3ZYK A;  2BF0 X;  3B7U X;  1ELW A;  3ONL A;  4J0U A;  4WWO A;  1JWG A;  2YIN A;  1K1A A;  2WXF A;  1E8X A;  3SO8 A;  1BD8 A;  3KEZ A;  1N4Q A;  2H6I A;  2XS1 A;  1ZBP A;  2J4D A;  2YQ8 A;  4AM9 A;  4U95 D;  3W9F A;  4L1B A;  3ABK E;  3CHQ A;  2LSU A;  4U8H A;  5KNH D;  4BWR A;  3TJP A;  4JC8 A;  4CRW A;  3CQG B;  4J8E A;  4DI4 A;  2AW6 A;  3TWX A;  3EHM A;  5ENR D;  5EX3 A;  2ZGD A;  5BV0 A;  3RK6 A;  1QNF A;  2XQ0 A;  3CHP A;  4HBD A;  2V5F A;  2EIM E;  4GTQ A;  3UI2 A;  3D9I A;  3L22 A;  3Q49 B;  5AQB A;  1WM5 A;  5G2N A;  4B93 B;  4X8Q A;  1MX2 A;  3PE3 A;  5A7D B;  3ZU7 B;  3ABL E;  2OV8 A;  3S2A A;  3P1U A;  4JEH A;  4K0R A;  2PM6 A;  3FU5 A;  4PUC A;  4KVO A;  1SW6 A;  4DX2 A;  2OEW A;  1NA3 A;  2IY0 C;  3T8M A;  2MRI A;  2EQX A;  4JA7 A;  4CDN A;  3LVQ E;  2A4Z A;  4LNB A;  4CDR A;  4L2Y A;  1HU3 A;  2ETA A;  4IRU A;  3X2Q E;  2DYR E;  2VYI A;  2J49 A;  1O1S A;  1E7U A;  1FT2 A;  3MKQ A;  4RVB A;  1A5E A;  3VTX A;  2AXU A;  4MBG A;  1GW6 A;  3ZUV B;  4BTB A;  2XZD G;  1EDU A;  2IEJ A;  4GTT A;  2WXP A;  3TWS A;  3U66 A;  2I6H A;  1Z6T A;  5J90 A;  4P29 A;  3SFY A;  1DCE A;  4XI9 A;  1OCR E;  5AJL A;  5EDS A;  1MJ0 A;  4UUC A;  1Z5S C;  5AYW D;  4NIK A;  1NZN A;  1ELR A;  4U07 A;  4UI9 J;  3CHM A;  4JPS A;  4LER A;  4U0U A;  3PE4 A;  2UY1 A;  3U4T A;  3S7F A;  3S7B A;  3AG3 E;  2IQC A;  2VQ2 A;  3EU5 A;  3FUD A;  3CKB A;  1E90 A;  2OND A;  3ML8 A;  3ZHE A;  2QC9 A;  3O4Z A;  4TUU A;  3QAQ A;  2J4B A;  3SBS A;  4RSY A;  3LYA A;  4HS2 A;  3Q9N C;  1X81 A;  4N3C A;  3DSV A;  3ISM C;  2GRR B;  4I6G A;  3ZYM A;  3IHY A;  5CED B;  4RLY A;  3VLD A;  1TNY A;  3VLF A;  1K1B A;  1ZB1 A;  1H0A A;  3EIJ A;  5ARF A;  2X6H A;  3DEP A;  4M7C A;  3D9H A;  2X6I A;  4PS7 A;  3APF A;  3TWR A;  3UM3 A;  3Q7A A;  1FVH A;  4FJY A;  3S7D A;  4HLL A;  4FLH A;  3PH0 C;  2WB2 A;  4KT6 B;  4B8A A;  3DXM G;  1K8K G;  5G05 J;  1HE8 A;  3HXC A;  3KAE A;  4BT9 A;  2R59 A;  3RRN B;  3KD7 A;  3QOU A;  2WXL A;  4CT0 A;  4ZFH A;  2I1J A;  3MCX A;  4ANV A;  4OAV B;  2F37 A;  2AVP A;  3R9A B;  5FJY A;  3ZKJ A;  4LG6 A;  2WXJ A;  1HH8 A;  3HXD A;  2Y3A A;  4O1P A;  3HDX A;  2AJA A;  5CMY A;  1LD8 A;  1HO8 A;  1JCS A;  3F6Q A;  1H2U A;  3ASD A;  4G24 A;  5FIO A;  4D10 C;  4K5A B;  3PEU B;  2WVI A;  3SNX A;  3MKR A;  5A6C A;  2PQN A;  2PM7 A;  5CMW A;  2KCL A;  1N11 A;  4YDO A;  3TWT A;  2WXM A;  2UWJ G;  4FAD A;  3TAX A;  3NZS A;  1DCQ A;  1V54 E;  2WQ6 A;  3KEA A;  3L13 A;  5BPP A;  3ZEF A;  3CLJ A;  1YCS B;  4HI9 A;  3D9P A;  2Y4U A;  4EZK A;  3G2U A;  5HKP A;  3WXX A;  1PAQ A;  2BKK B;  1BPO A;  1D9S A;  1VDY A;  2RG8 A;  3RO3 A;  1OXJ A;  3CGH A;  4F3V A;  5LOZ A;  5G04 J;  2C0M A;  2JAB A;  3ASN E;  2FO1 E;  4NRH B;  4AY5 A;  4BEP A;  4JVS A;  2XRZ A;  4I43 A;  1IQR A;  3SFX A;  1OWO A;  3HXE A;  5E76 A;  4LCT A;  4B8C B;  4WUY A;  4G1T A;  1D8D A;  4BT8 A;  3ASG A;  3U3W A;  3UIP C;  1S70 B;  1U2V G;  2P9I G;  2BED A;  4U04 A;  3CVU A;  1QYM A;  2ZU6 B;  2P9P G;  4HOQ A;  3CVV A;  1INZ A;  3O48 A;  1IHB A;  4MS6 A;  1IXV A;  4HB5 A;  2L6B A;  4GTM A;  1HX8 A;  3Q4A B;  3MX3 A;  4ATG A;  2A5E A;  1RW2 A;  2KC7 A;  4ANW A;  4G23 A;  3CVY A;  3AJI A;  3ZRH A;  4GB9 A;  3L17 A;  2XGO A;  3JXI A;  5AEN A;  1PY1 A;  1TNO A;  4UQZ A;  3FTW A;  5AJD A;  3FUI A;  4ANX A;  4R7L A;  1KZO A;  4QQI A;  3QKY A;  2P9N G;  1TNZ A;  1A17 A;  5KBA A;  3BU8 A;  3CQC B;  2L0T B;  1OWP A;  3E4B A;  2WXN A;  2J07 A;  4OVV A;  5FIN A;  4IN3 B;  3QWP A;  3UKU G;  4I2W A;  1OWN A;  4Y6C A;  1MX4 A;  3FUF A;  4C9B B;  2KAT A;  4AY6 A;  5AQ9 A;  5AAR A;  4EQF A;  1LTX A;  3TWQ A;  3G2W A;  2X6J A;  2I9C A;  2WXR A;  4UQY A;  2PQR A;  3SHF A;  3HVE B;  3Q73 A;  3NB2 A;  1L5J A;  1HZ4 A;  3QWV A;  4O60 A;  4ATZ D;  3UTM A;  4TUM A;  4OYS A;  5CEA A;  4YND A;  3JUI A;  4XKB A;  1X5B A;  4DI3 A;  5ARG A;  2MHK A;  4C48 B;  4F53 A;  3FUL A;  3RU0 A;  3LS8 A;  4GZC A;  2F8Y A;  5EKQ D;  3T5V A;  2Y4T A;  3OXF A;  3E30 A;  1KT0 A;  3Q15 A;  4CGW A;  2L0I A;  3FU3 A;  4F6R D;  5D0O D;  1FVF A;  3FFL A;  4TXR A;  5BUZ A;  4IUL A;  1B89 A;  3NOG D;  2J09 A;  4MLP A;  3FUH A;  4DLQ A;  2FI7 A;  1KPS B;  2RFM A;  5EN5 D;  2IFU A;  4B89 A;  3R7R A;  4OVU A;  2XGS A;  4YDE A;  5T3R A;  5LP0 A;  3UIN C;  5H7P A;  2P9L G;  1YA0 A;  4GAA A;  4GU5 A;  1DC2 A;  5FQ7 A;  4J8S A;  3QJZ A;  3L16 A;  1JCQ A;  2PNN A;  4GML A;  5FZS A;  5FQ4 A;  3HXB A;  3EHN A;  2L6J A;  5A23 A;  1DNP A;  1IKN D;  3QWW A;  4PS8 A;  3AS8 A;  3FTS A;  3TGO A;  4HFG A;  4F1P A;  3SBT B;  3C3O A;  4Y6W A;  4A55 A;  2KXP C;  3D9M A;  2LUH A;  5CBN A;  4ABN A;  3B7T A;  3ZFW A;  3FUM A;  4RG6 A;  3E33 A;  3PEV B;  2OCC E;  4ILI A;  3ZNG A;  5JJ7 A;  3E34 A;  2KBX A;  4HOR A;  5AQ7 A;  4I1M A;  3Q9U C;  4GZ3 A;  2P58 C;  5EIL A;  2MOW A;  3IXE A;  2IOL A;  2XEN A;  1E8Z A;  3FEX A;  3PZ4 A;  4GCN A;  2VGX B;  1TJF A;  1MZC A;  4LRZ A;  2RFA A;  5J08 A;  5KCM A;  1XNF A;  4URK A;  3FUE A;  4K5C A;  4GYW A;  3SI5 A;  2DZO A;  4U63 A;  1OY3 D;  2ETC A;  2LSV A;  1MX6 A;  2VSX E;  4UWG A;  1N0R A;  3TXN A;  2J8S D;  2XRY A;  4F7A A;  4XX5 A;  2WMO A;  2XCC A;  1O1T A;  2DIW A;  5DBK A;  1ELK A;  3VTY A;  4NUR A;  3PVL A;  4EEC A;  1XGW A;  3JYS A;  1UW4 B;  5JMN D;  1BLX B;  3ASF A;  1O1R A;  4JD2 G;  2OOE A;  3SFZ A;  4FUL A;  5EYL A;  3FTU A;  1AWC B;  5B3S E;  2QYU A;  4CEM A;  2EIK E;  3P2B A;  3FEY A;  3CVX A;  2X38 A;  2PZI A;  4UQX A;  2DCP A;  3OTN A;  4G8K A;  2WM9 A;  3UT4 A;  3FWV A;  1MQS A;  3PZD A;  4CZ2 D;  4GMJ A;  1EYH A;  2GRO B;  3PZ1 A;  3LY7 A;  2QYJ A;  4KMO A;  4CDM A;  3CHO A;  1TYQ G;  2VGX A;  3VLE A;  3JUE A;  4HOT A;  1UOH A;  1AP7 A;  2VSN A;  4GTR A;  3UM2 A;  3L54 A;  4NAC A;  2VJ8 A;  2R02 A;  1LD7 A;  3NAW A;  4I17 A;  1OUV A;  4JZY A;  3ZN3 A;  3E32 A;  2L9B A;  3L82 A;  3B13 A;  2RKK A;  3FTZ A;  3UXG A;  4CYM D;  4PH4 B;  3FUK A;  2C2L A;  3ZW3 A;  3G2T A;  1SVX A;  1MYO A;  1TN6 A;  2V0P A;  4GYY A;  5KWD A;  2F0Y A;  4UI9 K;  2HM8 A;  1OWL A;  3ZPJ A;  2IO3 C;  3IKO B;  4N39 A;  2V4H C;  4AXH A;  4LSZ E;  3AG1 E;  2FO7 A;  3BUA A;  3PZ3 A;  3C3Q A;  4BTA A;  3BG0 B;  2VSY A;  4GTV A;  4LNG A;  3ZYQ A;  4DLO A;  4ILG A;  4EBA A;  4GPK A;  2R03 A;  4JHR A;  1YYH A;  3KSL A;  3CV0 A;  1OCC E;  5CEC B;  3LVR E;  2XPI A;  2NSZ A;  1RZ4 A;  4I9E A;  2WQH A;  3T9K A;  3MV3 B;  3QAR A;  3NOC D;  3CVN A;  3IV0 A;  1N4R A;  4HRL A;  2GW1 A;  4DX7 D;  3OXL A;  3Q7F A;  1WDY A;  3R7Q A;  3TG4 A;  2EIJ E;  1N4S A;  3T5X A;  5LX8 A;  3TWV A;  4TXP A;  1HG5 A;  4QFV A;  4C0M A;  3JQ0 A;  5AIJ A;  5HS0 A;  4DX6 D;  5KJL A;  3LCA A;  4RQI A;  2BKG A;  4WNE A;  1FPP A;  4G26 A;  4AOF A;  2AXZ A;  2QFC A;  3L9T A;  2R17 C;  3MJW A;  1IHG A;  5G55 A;  4JHJ A;  3W9G A;  3HHM A;  4E85 A;  3LPZ A;  3U64 A;  4GTP A;  3FP3 A;  5BXO A;  3PNT B;  3FUN A;  1U3C A;  1KT1 A;  3CR3 A;  4TV3 A;  4GTO A;  3Q78 A;  3LKU A;  3ESK A;  3ABM E;  2H6G A;  2V5Q C;  4FHJ A;  3PRZ A;  4G25 A;  4HRN A;  1TNU A;  3ZXP A;  1Z3X A;  3DSW A;  3HIZ A;  3IBE A;  3MV2 B;  2XEH A;  4ZHB A;  1N54 A;  4J8F A;  4DX1 A;  1D8E A;  1UN8 A;  5JHB A;  4I9C A;  4CCA A;  4G8L A;  3LJN A;  4GMR A;  3FY4 A;  2XS8 A;  4GZD A;  2WXQ A;  3J5P A;  3D9K A;  3RKV A;  3ULQ A;  4I6J A;  2EIL E;  1H19 A;  5BV1 A;  4H7X A;  3EDT B;  4LEU A;  3ZXS A;  3CK9 A;  2IU1 A;  4WAF A;  2ILR A;  2GRM A;  2WMN A;  3QC1 A;  4A1G A;  3DXK G;  3UIO C;  3E37 A;  3UM0 A;  4KYO B;  2FUL A;  1O5M A;  2NYJ A;  2KCV A;  2XPY A;  2X3M A;  3MKQ B;  4B0Z A; 
#chains in the Genus database with same CATH homology
 1QYM A;  5AQA A;  3F6Q A;  4B93 B;  2QC9 A;  4YDY A;  4O60 A;  4ATZ D;  1MX2 A;  2V4H C;  4TUM A;  3UTM A;  5JMN D;  5ENQ D;  1BLX B;  4F1P A;  3V79 K;  4LSZ E;  4DRX E;  4DUI A;  5JA4 D;  5CEA A;  5FIO A;  3ZU7 B;  4K5A B;  5BXO A;  3C5R A;  4BER A;  4U8V D;  2KXP C;  1IHB A;  2ETB A;  1IXV A;  2MYO A;  4HB5 A;  3EHR A;  4HRM B;  3Q9N C;  2Y0B G;  4K5B A;  4HNA D;  3V30 A;  1G3N B;  2DZN A;  2L6B A;  4C48 B;  5CER B;  5EYL A;  1YMP A;  1SW6 A;  4DX2 A;  1AWC B;  2F8X K;  2A5E A;  2ZGG A;  1N11 A;  3ZNG A;  1OT8 A;  3NBN B;  2F8Y A;  2KBX A;  1YYH A;  5KNG A;  3TWT A;  3HRA A;  2V5Q C;  5AQ7 A;  3Q9U C;  5CED B;  3EHQ A;  2DWZ A;  4RLY A;  4HRN A;  5CEC B;  1NFI E;  5AAO A;  5EIL A;  3AAA C;  3AJI A;  5ENS D;  1DCQ A;  3IXE A;  2HE0 A;  3JXI A;  2ETA A;  1K1B A;  5AN8 A;  2XEN A;  1K3Z D;  3DEP A;  3T8K A;  3T9K A;  2Y1L E;  3JXJ A;  3D9H A;  3KEA A;  4G8K A;  4OAU C;  4F6R D;  3NOC D;  4CZ2 D;  1YCS B;  2DVW A;  4HI9 A;  4QQI A;  1WG0 A;  2XEH A;  4ZHB A;  3TWR A;  3V2X A;  5KBA A;  5HKP A;  1K1A A;  4DX5 D;  1A5E A;  3NOG D;  2QYJ A;  4U8Y D;  4DX1 A;  3SO8 A;  4HRL A;  4GPM A;  1BD8 A;  2BKK B;  5ENP D;  4DX7 D;  4Z68 A;  4HLL A;  1D9S A;  4BES A;  4G8L A;  3V31 A;  2RFA A;  3LJN A;  5CBN A;  5ENO D;  3JUE A;  3ZUV B;  2RFM A;  5EN5 D;  1WDY A;  1BI8 B;  4GMR A;  4U95 D;  3TWW A;  2XZD G;  4HI8 A;  3W9F A;  2XEE A;  1UOH A;  3DEO A;  4K5C A;  5FIN A;  1AP7 A;  2JAB A;  2FO1 E;  3TWS A;  3J5P A;  2DZO A;  2P2C P;  5EID A;  5KNH D;  5CBO A;  4HQD A;  4BEP A;  3TWV A;  4U96 D;  5ENT D;  1MX4 A;  1OY3 D;  2B0O E;  2ETC A;  4J8Y A;  4QFV A;  3V2O A;  4A63 B;  1MX6 A;  5HS0 A;  5AQ9 A;  5AAR A;  4DX6 D;  4ZFH A;  5EYP F;  2XZT G;  1MJ0 A;  3EU9 A;  1N0R A;  4JB8 P;  4YDW A;  4UUC A;  2BKG A;  2J8S D;  3TWX A;  1DC2 A;  4NIK A;  4OAV B;  2F37 A;  5ENR D;  2PNN A;  2ZGD A;  5D66 A;  4BET A;  3B95 A;  5HRY A;  5BXU A;  1BU9 A;  3UXG A;  4CYM D;  5ITZ F;  5EIB E;  1N0Q A;  2VGE A;  3TWQ A;  4O1O A;  3ZKJ A;  3HG0 D;  4LG6 A;  4HBD A;  2NYJ A;  1TR4 A;  1S70 B;  1SVX A;  1MYO A;  4J7W A;  4LNU D;  3B7B A;  1BI7 B;  4O1P A;  2AJA A;  5KWD A;  3W9G A;  3UI2 A;  3J5Q B;  3TWU A;  1IKN D;  4N5Q A;  5AQB A;  4BSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...