3CHMA

Crystal structure of pci domain from a. thaliana cop9 signalosome subunit 7 (csn7)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
161
Chain Sequence
b'EQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COP9 signalosome complex subunit 7
publication title The Arabidopsis COP9 signalosome subunit 7 is a model PCI domain protein with subdomains involved in COP9 signalosome assembly
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 57
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3chmA00
3TXNA 3TXMA 3T5XA 3CHMA 2MRIA 4D10C 4LCTA 3JCKC
chains in the Genus database with same CATH superfamily
1D8EA 1OWLA 3QK0A 1HH8A 2CG2A 3SBTB 2UY1A 1H2VC 3RAUA 1E7UA 1Z6TA 5AYWD 4KT6B 5HI7A 1YYHA 3ZGQA 2KCKA 4OYSA 1OUVA 3L17A 4RLYA 3QWWA 3L16A 2R02A 2J49A 1BI7B 4EQFA 5HKPA 3LCAA 4A1GA 4I9CA 4AM9A 5JJ7A 3S2AA 4RSYA 3EHNA 3FH8A 3MKQB 2EIME 3ASDA 5EX3A 2XRZA 4U8HA 3FTSA 3KAEA 2I1KA 4IN3B 4LERA 4JEHA 3ZYKA 3TXMA 2X6IA 4UWFA 2I9CA 3T5VA 5AARA 3MCXA 3FU3A 4Z68A 3FHEA 3PH0C 3LEWA 3KEZA 3UXGA 1WG0A 1OWMA 5B3SE 2KZTA 2WXFA 1RZ4A 3ZYLA 4MLPA 5BNWA 1IXVA 5BV1A 1D9SA 5D0OD 1TEZA 3Q7AA 4N39A 3IKOB 2P9NG 5AJDA 4NIKA 2JEKA 4LRZA 3TXNA 4A55A 2AXZA 3QKYA 3PREA 1E90A 5AJLA 3J5QB 4F6RD 3FH7A 3SHFA 2OV8A 2VGXB 1HX8A 3TG5A 4FADA 4RVBA 4WUYA 4GMRA 4HVBA 5CBNA 3MGBA 5EDSA 3HIZA 3FU5A 3CHRA 3FUKA 3SFXA 5LP0A 3D9OA 4G24A 4AIFA 5D0QD 1O5MA 3R7RA 2F8YA 5T4YA 4DX5D 4C0MA 4U8VD 3Q79A 3RO2A 2J09A 4N3CA 4H7XA 2XGSA 4U95D 3FU0A 5CEDB 2J4DA 5HS0A 1E96B 2MHKA 2OCCE 2ZXWE 3Q7FA 4DX1A 2R03A 4HI9A 1BPOA 4J7WA 2XRYA 2WXLA 4ANVA 3LY7A 3HYMB 3BG0B 2VSOE 2CHWA 3AU5A 2H6IA 3KSQA 1OCRE 4QFVA 3L82A 2WXNA 3GZ1A 4BX8A 3B7BA 3PZDA 3UUXA 3ULQA 3APFA 3BU8A 4DX7D 1N52A 1IYGA 3Q9NC 3CVWA 3VTYA 3ABKE 4Q69A 2H6GA 3FTVA 3SD5A 3ESLA 3FTUA 2VSNA 1IQRA 4TUUA 1G3NB 4J8DA 4KVOA 1RW2A 3LY8A 2C0MA 5JHAA 3LYAA 2LAHA 3FTZA 3SGHA 1MHQA 4U0UA 4FHKA 4U0ZA 2CHXA 3WXXA 3C3RA 4GA0A 3MV2B 1Q2ZA 4X8QA 2XENA 2OEVA 4BSZB 2EINE 2LUHA 2Y4UA 5T8IA 2ETBA 4ATGA 1EPUA 5CMYA 2V4LA 1LTXA 4N2SA 3CR3A 3JUIA 4GA2A 3PE3A 3FEYA 2LNIA 4TXQA 4TXRA 5AAOA 3HVEA 3ML8A 2KCLA 4KVMA 5FQ6A 1SZAA 3LVQE 2KXPC 3JCKC 2DWZA 4AXHA 1KPSB 2PQRA 4FLBA 4BEPA 2CG3A 3CVPA 4PS8A 2VTBB 2BKKB 3DXMG 4EBAG 3HXBA 3AG1E 2J8SD 3CHOA 3UIPC 4CCAA 3TWQA 3G2SA 3DSXA 3UT7A 2XGOA 4AP2A 4KZ0A 3TWSA 3NZSA 4UWLA 1E8WA 4I1MA 4URKA 4AY5A 1NA3A 2XS1A 4HOUA 3EU5A 1X81A 2NYJA 5ENPD 3U66A 1K8KG 1TNBA 2GGFA 4KMOA 5AQ9A 1HE8A 2GRPB 1H0AA 3ZRHA 4DI4A 3ZUVB 5FJYA 2IU1A 3FUNA 3X2QE 4M7CA 5DIZA 4KXKB 2L9BA 2P9PG 5KNGA 2MOWA 2WXRA 5HQ8A 3HDXA 3LJ3A 1LD7A 4JD2G 4AEZC 4F1SA 4WWOA 3CVUA 1IQUA 3CKCA 3LS8A 3E37A 4IYPA 3ASNE 3R9AB 5ENTD 4FJYA 2MRIA 4I6EA 4GYWA 4HFGA 2XEHA 3TWUA 1JUQA 4PUCA 2KCVA 3SFZA 4JHRA 2BF0X 3L6AA 4GTMA 3JUEA 3L9TA 4ANWA 4I9EA 2J4BA 2OVFA 3B95A 5ENRD 1HG2A 3PUJA 3I3NA 4HQDA 4GPMA 2YHCA 1H19A 3PS6A 3FEXA 3SBSA 4FULA 3JQ1A 3TWRA 2BUGA 2FBNA 2GW1A 1O1RA 2EQXA 4NACA 3MKQA 2P2CP 4XIFA 2JLBA 4GA1A 4DX2A 2C0LA 1SZ9A 4TRQA 2P58C 3D3MA 1N94A 4OAVB 3NOGD 1AWCB 2WXPA 5EIBE 4FJZA 3RSEG 4ILGA 1UJKA 4XX5A 3JXJA 1FPPA 4HORA 1D8DA 3S7FA 2IY0C 3UKRG 2AW6A 4LCTA 3G2VA 3B7SA 1OY3D 2QC9A 3NAWA 4GU5A 2IEJA 4GZDA 1L5JA 3RRUA 4U0SA 4G1TA 5EYLA 3EIQC 5ANRA 1U2VG 4HRMB 3URZA 1H6KA 3RIBA 4BETA 3QOUA 1JWFA 1U3CA 1Z3XA 2L0IA 2IOSA 3HXFA 3LJNA 4JPSA 3QC1A 4HBDA 5KCMA 4J8YA 2E2EA 2JABA 4CYMD 5DBKA 2CFZA 5FTPA 2P9IG 5B1AE 2XGMA 4UQXA 5J08A 2WMNA 2V5QC 4B89A 5FQ7A 4U96D 1MQSA 2GRLA 1UOHA 2FEZA 1SQMA 4XKBA 3OXLA 4HRLA 3D9LA 5AIJA 3U64A 2IFUA 1OXJA 4DPRA 3MJWA 2RKKA 5BUZA 1TNZA 3TWVA 3UT8A 3I5PA 1NFIE 4KBQA 1QQEA 2GRNB 3DSVA 4DLOA 3L22A 3HXCA 4L23A 2PM6A 4Y6CA 3FULA 2EIJE 3CHQA 4CRWA 2P9SG 4TV3A 3L13A 5H7PA 4XZ4A 3ONKA 2PZIA 1N11A 5FQ8A 4IULA 4ANUA 3CSTA 1HZ4A 4KZCA 2KBXA 4F53A 4ZFHA 2OEWA 5KJNA 3EIJA 5G2NA 4CDNA 3AG2E 3Q4AB 3PDNA 4B93B 2Y3AA 3R7QA 5LOZA 4GTRA 4DJAA 3FUHA 4N5QA 2X3MA 3QARA 4UQYA 4L2LA 4ACKA 4JVSA 4ME2A 3DPDA 3C5RA 4DLQA 2H6HA 3TL5A 3Q49B 2RFMA 5CRVA 4ILIA 3ZKJA 1KT0A 3TJPA 3MX3A 3O4ZA 3PUKA 4FC8A 1DC2A 2ONDA 2PNNA 3DEOA 3QNKA 3E34A 4ACLA 5EYPF 4O1OA 3C72A 3CGHA 3MZLB 1K1BA 3HRAA 2OVBA 2GRMA 5C1DA 4APFA 4N5CA 1N4QA 4U04A 4LNGA 1LF8A 5BXUA 1H6PA 3APCA 2FULA 4HXIA 1BI8B 2A5EA 3QDNA 2FI7A 4CGWA 3PNLB 1KLXA 4P29A 2DYRE 1E7VA 4I2WA 5FINA 1OCOE 4F1PA 2AXUA 3VLEA 4LNBA 2UY1B 2Y0BG 2RG8A 3CHSA 4W9RA 5B1BE 3IEGA 5AN8A 3NB2A 3EDTB 1TN7A 2ZIRA 3C98A 1Z3YA 2F0YA 5JMND 4APOA 4ANXA 2GROB 3UINC 3Q47B 4ZHBA 3OAWA 3Q5MA 4HOSA 3ZHEA 4JA9A 1KZOA 2AXVA 3QB2A 1WM5A 4YVQC 1HU3A 4G23A 3V2OA 1H2TC 3KD7A 4UI9K 5ENOD 5BV0A 2X38A 3GZSA 4DUIA 4H7YA 3NBNB 5FZSA 3FWVA 1NL4A 4IRUA 3FTYA 2AJAA 2Q7FA 2ETAA 3UT4A 2QY7A 2LSUA 3CVLA 5EIDA 4K03A 2KZTB 3KSLA 5AQBA 4NRHB 2XEEA 1PC2A 1N0QA 1NI1A 4I1AA 3DSWA 1OWPA 1K3ZD 2EILE 1X5BA 2LAIA 5T3RA 3OTNA 5EILA 1UG3A 4CDMA 2P9UG 4UWKA 3APDA 4U7EB 4WNDA 3ESKA 3Q78A 4BT9A 2XEVA 3CHPA 4TUMA 1E8XA 1N0RA 4HLLA 4K0RA 3FTWA 4O1PA 1NA0A 3CVYA 2VSXE 3FUDA 3BEEA 4L9PA 4TXPA 2WB2A 1MX4A 3RO3A 1LD8A 4FP7A 4HOQA 3ZEFA 3U4TA 2WXJA 4I6GA 5BPPA 1OCZE 2DBAA 3GZ2A 3ASOE 3V30A 5FIOA 2XPIA 2RFAA 5A7DB 3RKVA 1S64A 2ZU6B 4D10C 2PM7A 5AQ7A 1ZBPA 1ZU2A 5ARGA 3FH5A 3HXEA 2DVWA 5EN5D 3I4GA 3FY4A 3RRMB 1FT2A 2QZAA 1SA5A 1A17A 1MJ0A 3CLJA 4U63A 1JCQA 4C0EA 4J8FA 2HR2A 4CT0A 2QYJA 4A3TA 3ZU7B 4GAAA 3CQCB 3RRNB 3ABLE 4AV7A 5BT1A 1S70B 1N4PA 4DI3A 2Y4TA 1H6OA 3CVQA 5ANLA 2I6HA 2R05A 4AOFA 5LCWC 3ZIMA 5FWQA 5KJLA 4BTAA 5KNHD 3AJIA 1NP7A 3EJNA 3DBSA 3UM3A 1B89A 5FZQA 3TG4A 3R9MA 4L7TA 1QZ2A 3UPVA 2XZTG 4AY6A 4LEUA 3D9HA 3AG3E 1TJCA 1W3BA 4XI9A 4J8SA 4OVVA 1HFAA 2R59A 5CHEE 1E8ZA 3PRZA 3SZ7A 1N54A 5LCWJ 4JHJA 3AU4A 1V54E 2IF4A 3CIAA 3ISMC 1N95A 4J0UA 1QBQA 4GB9A 4O6FA 3LXUX 3MA5A 1TN6A 1P5QA 3OXGA 1FVHA 4JXTA 4AJWA 2Y1LE 3ZXSA 5FT9A 4L2YA 2V8SE 3HVEB 2AVPA 5AQAA 2NC9A 4XEIG 2HO1A 3IBEA 3B13A 4NURA 4BERA 4K5AB 2NSZA 2YQ8A 3AS4A 3ZYMA 1HG5A 5ENSD 1V55E 4C48B 1QYMA 2XPZA 1WY6A 4JHKA 4U8YD 2X6JA 4BESA 2V4HC 3SFYA 3G2UA 1VDYA 3ZVVA 2L6JA 1BU9A 4GZ3A 3E33A 5LX8A 1IHBA 3LKUA 1UJJA 3P1UA 3IV0A 2I1JA 2BTDA 3KS2A 5FQ4A 4MBGA 1AP7A 3LVRE 3DSUA 4E85A 3T9KA 4BTBA 5BW8C 1N4SA 3ML9A 3TWTA 3PE4A 1A5EA 2YNQA 4GYYA 1KT1A 3MKRA 5KWDA 4GTSA 5G05C 3CKBA 3PNTB 4CEMA 2L0TB 2VGXA 3QWVA 3CK7A 2KM4A 3E30A 2V0PA 2ZGGA 3NQPA 4JL0A 3CVXA 5CERB 2IO2C 4CT4A 4WWPA 3D9IA 1K1AA 4ABNA 4Q96A 3W9FA 4GTQA 5ARFA 4EBAA 2DYSE 2AWIA 4I2ZA 5G05J 3QWPA 4B0ZA 4CDRA 1IHGA 1EYHA 1N4RA 4I17A 4NQ0A 3FUJA 4PS7A 3ASFA 5C2YA 4BX9A 4CZ2D 3FFLA 4K5CA 5ENNA 4BFRA 2WMOA 5J90A 3FP3A 5CMWA 4HI8A 3CQGB 4HS2A 5HRYA 1JPLA 3ULEG 1UW4B 1DCEA 4GPKA 1PY1A 1WDYA 3B7RL 4BWRA 3AG4E 4EZKA 4B94A 3U9WA 4JZYA 4LNUD 4O60A 3DSTA 4HB5A 3PEUB 3CK8A 4MRUA 3LDZA 3SI5A 1JCSA 3W9GA 4G2VA 1DCQA 2J9QA 4UWGA 5E76A 4YVOA 1HO8A 4GZ5A 2VQ2A 4YDWA 3OXFA 2DZNA 2CHZA 4F3VA 3VLDA 1OWNA 3T8KA 3E32A 1Y6IA 1JCRA 3V2XA 3ZW3A 2XS8A 3UIOC 3PVLA 3D9PA 5D66A 2QFCA 4GTPA 2CFUA 1NZNA 3CV0A 3ZNGA 4U07A 3AS8A 1FVFA 5BXOA 1KZPA 2B6CA 4MKTA 3TGOA 3ABME 3AS5A 3RK6A 5CECB 3N71A 4GTVA 4B8CB 4DRXE 3U3WA 3ULYA 4WNFA 4Q94A 4GTTA 3PZ3A 3LY9A 3B7UX 5LFAA 4HOTA 4RG9A 4LG6A 3T8MA 2IQCA 1MX6A 2LXMA 4UI9C 1H2UA 3EUVA 5CRUA 2ETCA 2EIKE 5JJTA 2GRQB 2XCBA 3DEPA 3TWWA 3CEQA 4JC8A 3B7TA 3BG1B 3D9JA 2HM8A 4G11A 2VTBA 5A6CA 2XPYA 2WXGA 1U3DA 3UX4A 4PH4B 1ZB1A 3FUMA 1QNFA 4HNAD 4XI0A 1OCCE 3UTMA 3K9IA 4M3OA 2VJ8A 4G8LA 2P9LG 3SF4A 3ONLA 2C2LA 2KATA 4YDYA 4FA6A 3NZUA 3O48A 3EU9A 2M63A 4JEUA 4UI9J 3DXKG 2IOLA 2FO7A 4GTOA 3F6QA 3VLFA 2IJGX 3S7BA 4G8KA 1Y8MA 3G2TA 1TR4A 2X6FA 2YHEA 4GMJA 5M72A 1BLXB 4WWNA 2VGEA 2HYZA 4OVUA 5D2MC 4EHMA 2OOEA 5CCMA 4BY6A 2WQHA 3HXDA 3ASHA 1MX2A 2GRRB 2Y69E 3D9KA 4GCNA 3IHYA 2WM9A 2WXQA 1SA4A 4HLEA 3PZ1A 4FU3A 3JYSA 4A1SA 3L08A 3FUEA 2VGYA 2DIWA 2PL2A 3SY2A 1TNYA 3NOCD 4K5BA 4A3VA 2E0IA 3EHMA 5IY5E 5ITZF 4GZCA 2P9KG 3CVVA 3UQ3A 4GYOA 2VYIA 4ATZD 1SVXA 5A23A 3FDHA 3V79K 5E75A 3MYVA 1ELKA 3JQ0A 3LPZA 1SW6A 2QYUA 2I2OA 1EF1C 3CSFA 3AAAC 3MV3B 4EZLA 3SO8A 3HG0D 2WXKA 3V31A 1GW6A 4OAUC 5CBOA 1HF8A 4C9BB 3L54A 5KJMA 2WXIA 5JA4D 4BSXA 5JHBA 3MEKA 1TNUA 2WXOA 1UN9A 4PDXA 4UWHA 4Y6WA 1S63A 1TJFA 2BEDA 4XKCA 4YDEA 3GW4A 5CCLA 4V3IA 2V5FA 3SNXA 3DWLG 1MYOA 3UKUG 2BKGA 3J5PA 4WAFA 5ENQD 3ZHEB 2NXPA 3ZFWA 2WQ7A 4N2QA 4ILHB 1E8YA 1FT1A 3GYZA 3UM0A 4XE0A 1HS6A 1PAQA 5EX0A 4AVXA 1EDUA 4MS6A 4PS3A 4YNDA 4RG6A 3CVNA 1HXIA 3SQVA 3DRAA 2F37A 2R5SA 2LO6A 3QJZA 1YA0A 2WXMA 3NF1A 2WQ6A 2ZGDA 3ZXPA 3P2BA 4BT8A 3UI2A 5AENA 3DPYA 1FCHA 2MYOA 3ZYQA 4F7AA 5CEAA 1INZA 3S7JA 1MZCA 2ZISA 2LSVA 4FLHA 4WNGA 4KYOB 1O1TA 5G55A 4FHJA 3D9MA 5FZRA 3Q73A 1TNOA 3UMVA 1WAO1 3FTXA 4QQIA 1XNFA 2J08A 4LSZE 3Q9UC 5EKQD 2F8XK 1YCSB 1JWGA 3C3OA 4GMLA 2WXHA 3RU0A 1DVPA 2WVIA 4JB8P 4G26A 4RQIA 2HE0A 2R2LA 4J6IA 4N3AA 2YINA 2R17C 1ELWA 3CHMA 3BUAA 4I43A 2H6FA 2DZOA 3C3QA 3HHMA 3KEAA 3ENEA 4I6JA 4B8AA 3QAQA 4DK5A 1S0PA 2A4ZA 2XZDG 2LXLA 3ZN3A 4J8EA 3E4BA 4A63B 4JA7A 4I1OB 4EZJA 2IO3C 3ZPJA 3S7DA 3FUIA 2DCPA 4EPZA 2FO1E 3EHQA 1BD8A 3PEVB 4N3BA 3BQOA 2XHEA 2J07A 3I4RB 3IXEA 5KJKA 5JJ6A 2X6KA 2RD0A 3TAXA 1TN8A 1N9AA 3T5XA 3RJVA 4HRNA 4G25A 1DNPA 2XQ0A 3ASGA 3WG7E 3G2WA 2WPVA 2ILRA 2PQNA 3DSSA 1IKND 5KBAA 3Q75A 4JW1A 4GZ6A 3VTXA 2UWJG 4CGVA 2L6BA 2FF4A 3UM1A 3PZ4A 5G04C 1Z5SC 4WNEA 4LUNU 1UN8A 3TWXA 2A5UA 3FU6A 3EHRA 1XGWA 2KC7A 3D9NA 3UM2A 3Q15A 2XCCA 4R7LA 4DX6D 4UUCA 3CK9A 1OT8A 2X6HA 4UQZA 3IHVA 1O1SA 1TYQG 1OWOA 5G04J 4L1BA 4EECA 1YMPA 2B0OE 3PZ2A 4E6HA 2IONA 1ELRA 3JXIA 4GCOA 4YDOA 3FUFA 2VSYA
chains in the Genus database with same CATH topology
4HFGA 1OWLA 4HOTA 4RG9A 3QK0A 1HH8A 3FUDA 3T8MA 1JUQA 2IQCA 4PUCA 2KCVA 3BEEA 3SFZA 2CG2A 4JHRA 3SBTB 2UY1A 2BF0X 1H2VC 4UI9C 2WB2A 1E7UA 1Z6TA 1H2UA 3L6AA 4KT6B 5AYWD 4ANWA 4I9EA 5JJTA 5HI7A 3ZGQA 2XCBA 2J4BA 2KCKA 2OVFA 3CEQA 4FP7A 3RO3A 4OYSA 1HG2A 3PUJA 3B7TA 4JC8A 1OUVA 3I3NA 3BG1B 4HOQA 3ZEFA 3U4TA 3L17A 3D9JA 2YHCA 1H19A 2HM8A 2WXJA 3QWWA 3PS6A 3L16A 3FEXA 4I6GA 4G11A 4EQFA 2J49A 3SBSA 5BPPA 5A6CA 2XPYA 2VTBA 4FULA 2WXGA 2DBAA 1U3DA 3GZ2A 3LCAA 3UX4A 4PH4B 3JQ1A 4A1GA 3FUMA 1QNFA 4XI0A 4I9CA 2BUGA 2FBNA 4AM9A 5JJ7A 2GW1A 3K9IA 3S2AA 2XPIA 4M3OA 2VJ8A 3SF4A 4RSYA 5A7DB 3EHNA 2EQXA 2C2LA 3FH8A 3ONLA 3MKQB 4NACA 3RKVA 3MKQA 2KATA 3ASDA 5EX3A 2XRZA 2ZU6B 4U8HA 4D10C 2PM7A 4XIFA 1ZBPA 1ZU2A 5ARGA 3FH5A 2JLBA 3FTSA 4FA6A 3NZUA 3KAEA 2I1KA 2M63A 3O48A 4GA1A 4IN3B 4JEUA 4LERA 4UI9J 3I4GA 4JEHA 3FY4A 2IOLA 2FO7A 3ZYKA 3RRMB 3TXMA 2X6IA 3VLFA 2IJGX 3S7BA 2C0LA 4UWFA 1SZ9A 4TRQA 2I9CA 1Y8MA 2P58C 3G2TA 3D3MA 1A17A 3T5VA 3CLJA 2WXPA 2X6FA 3MCXA 4U63A 3FU3A 4C0EA 4FJZA 2YHEA 4GMJA 5M72A 4J8FA 4WWNA 2HR2A 3FHEA 4ILGA 1UJKA 4CT0A 4XX5A 2HYZA 4A3TA 3PH0C 4GAAA 4OVUA 3CQCB 2OOEA 3LEWA 3KEZA 4HORA 5CCMA 1OWMA 3RRNB 3S7FA 4BY6A 4AV7A 2WQHA 5BT1A 4DI3A 2KZTA 2Y4TA 2AW6A 2WXFA 3CVQA 4LCTA 5ANLA 3G2VA 3ASHA 3ZYLA 3B7SA 3D9KA 4MLPA 5BNWA 2I6HA 5BV1A 4GU5A 4GCNA 4AOFA 3IHYA 4GZDA 1L5JA 2WM9A 2WXQA 3RRUA 5D0OD 5LCWC 4U0SA 3ZIMA 5FWQA 1TEZA 4G1TA 4N39A 4BTAA 5KJLA 3IKOB 1NP7A 3EJNA 3EIQC 3DBSA 5AJDA 5ANRA 4HLEA 1B89A 5FZQA 2JEKA 3URZA 1H6KA 3TG4A 4FU3A 4LRZA 3RIBA 3JYSA 3TXNA 4A1SA 4A55A 3QOUA 2AXZA 3L08A 4L7TA 1QZ2A 1JWFA 3UPVA 1U3CA 1Z3XA 3QKYA 2L0IA 3PREA 3FUEA 2VGYA 2IOSA 2DIWA 2PL2A 1E90A 4JPSA 5AJLA 3QC1A 3FH7A 5KCMA 2OV8A 3SHFA 4AY6A 2VGXB 1HX8A 2E2EA 4LEUA 5DBKA 2CFZA 5FTPA 3TG5A 4A3VA 4FADA 2E0IA 2XGMA 1TJCA 1W3BA 3EHMA 4RVBA 4XI9A 4J8SA 4GZCA 4UQXA 5J08A 4WUYA 2WMNA 3CVVA 3UQ3A 4GYOA 4HVBA 2VYIA 4OVVA 1HFAA 4B89A 3MGBA 5EDSA 2R59A 5CHEE 1E8ZA 5FQ7A 5A23A 3FDHA 3HIZA 3PRZA 3FU5A 3CHRA 3FUKA 3SZ7A 1N54A 5LCWJ 4JHJA 5LP0A 3AU4A 3D9OA 1MQSA 5E75A 2GRLA 4G24A 2IF4A 2FEZA 3MYVA 1SQMA 3CIAA 4XKBA 4AIFA 1ELKA 5D0QD 3OXLA 3JQ0A 3LPZA 3R7RA 4J0UA 3D9LA 4GB9A 2I2OA 5AIJA 1EF1C 3CSFA 4O6FA 3U64A 3MV3B 3LXUX 4EZLA 3MA5A 2IFUA 5T4YA 4DPRA 3MJWA 2WXKA 1P5QA 1GW6A 3OXGA 1FVHA 4JXTA 1HF8A 4C0MA 4C9BB 5BUZA 3L54A 4AJWA 5KJMA 3UT8A 3I5PA 4KBQA 3ZXSA 5FT9A 1QQEA 2V8SE 4L2YA 4DLOA 2WXIA 3HVEB 3L22A 3RO2A 4BSXA 2AVPA 5JHBA 2J09A 2NC9A 3MEKA 4N3CA 4L23A 2PM6A 4Y6CA 3FULA 4H7XA 2WXOA 2HO1A 1UN9A 3IBEA 4PDXA 2XGSA 3B13A 3CHQA 4NURA 4UWHA 4Y6WA 4CRWA 1TJFA 3FU0A 2J4DA 4XKCA 4TV3A 1E96B 2MHKA 3GW4A 3L13A 2NSZA 4V3IA 5CCLA 2YQ8A 3AS4A 4XZ4A 3ZYMA 2V5FA 3ONKA 3SNXA 2PZIA 1HG5A 1BPOA 4WAFA 3ZHEB 2XRYA 5FQ8A 2WXLA 4IULA 4ANUA 3CSTA 2NXPA 2XPZA 3ZFWA 2WQ7A 4ANVA 3LY7A 5LFAA 1HZ4A 1WY6A 3BG0B 3HYMB 4JHKA 2X6JA 4N2QA 4ILHB 4KZCA 2VSOE 1E8YA 2CHWA 3AU5A 3GYZA 4F53A 4XE0A 1HS6A 1PAQA 3G2UA 5EX0A 4AVXA 1EDUA 4QFVA 5KJNA 1VDYA 3EIJA 4MS6A 4PS3A 4YNDA 3Q4AB 2L6JA 5G2NA 3ZVVA 4CDNA 2WXNA 3GZ1A 4GZ3A 4BX8A 3PDNA 5LX8A 4RG6A 3PZDA 2Y3AA 3LKUA 3UUXA 3CVNA 1UJJA 3APFA 3P1UA 3IV0A 3ULQA 2I1JA 1N52A 1HXIA 3R7QA 1IYGA 2BTDA 3KS2A 5FQ4A 3CVWA 2R5SA 5LOZA 3VTYA 4DJAA 2LO6A 3FUHA 4Q69A 3QJZA 1YA0A 2X3MA 2WXMA 3NF1A 3QARA 2WQ6A 3LVRE 4UQYA 4E85A 3FTVA 4BTBA 3P2BA 4L2LA 5BW8C 3SD5A 4BT8A 4ACKA 5AENA 1FCHA 4JVSA 3ML9A 4ME2A 3PE4A 3DPDA 4DLQA 2YNQA 3ESLA 4GYYA 3ZYQA 4F7AA 3TL5A 3Q49B 3FTUA 2VSNA 1INZA 1IQRA 1KT1A 3S7JA 3MKRA 4TUUA 2LSVA 4FLHA 4ILIA 1KT0A 4WNGA 3TJPA 4KYOB 5G05C 3MX3A 5G55A 3O4ZA 3CKBA 3PNTB 3PUKA 4FC8A 4FHJA 3D9MA 4J8DA 4KVOA 5FZRA 2ONDA 4CEMA 3LY8A 2C0MA 5JHAA 3UMVA 2L0TB 2VGXA 3LYAA 3QNKA 1WAO1 2LAHA 3FTXA 4ACLA 3QWVA 3FTZA 3CGHA 3SGHA 3CK7A 1MHQA 1XNFA 2J08A 2KM4A 3MZLB 4U0UA 5EKQD 2OVBA 2V0PA 3NQPA 4JL0A 4FHKA 3CVXA 2GRMA 1JWGA 4U0ZA 4GMLA 4CT4A 5C1DA 4WWPA 4APFA 2CHXA 4N5CA 3WXXA 3D9IA 2WXHA 3RU0A 4ABNA 4Q96A 1DVPA 2WVIA 4GA0A 3MV2B 4G26A 4U04A 4J6IA 4N3AA 1LF8A 5ARFA 4EBAA 3APCA 2FULA 4HXIA 2Y4UA 2YINA 5T8IA 2R17C 3QDNA 1ELWA 4ATGA 2FI7A 1EPUA 5CMYA 2AWIA 4CGWA 2V4LA 3CHMA 3PNLB 1KLXA 4P29A 4I43A 4I2ZA 1E7VA 5G05J 4I2WA 3QWPA 4B0ZA 3HHMA 4N2SA 4CDRA 3CR3A 3JUIA 3ENEA 4I6JA 1IHGA 1EYHA 2AXUA 3QAQA 4GA2A 3VLEA 1S0PA 3PE3A 3FEYA 4B8AA 4I17A 2A4ZA 4DK5A 2LNIA 4NQ0A 3ZN3A 2UY1B 4J8EA 3HVEA 3FUJA 3ML8A 2KCLA 4KVMA 2RG8A 5FQ6A 1SZAA 4PS7A 3E4BA 3ASFA 3CHSA 3LVQE 4W9RA 4JA7A 3IEGA 4I1OB 4EZJA 3EDTB 3JCKC 3ZPJA 3S7DA 5C2YA 3FUIA 4AXHA 2DCPA 4BX9A 4EPZA 3C98A 2PQRA 3FFLA 5ENNA 1Z3YA 4FLBA 3PEVB 4APOA 4BFRA 4N3BA 2WMOA 4ANXA 2CG3A 2XHEA 5J90A 3CVPA 2J07A 4PS8A 3I4RB 3FP3A 2VTBB 5KJKA 5CMWA 3Q47B 5JJ6A 2X6KA 2RD0A 3CQGB 3OAWA 4HS2A 3Q5MA 3TAXA 4EBAG 1JPLA 4HOSA 3ZHEA 1UW4B 4GPKA 3CHOA 4JA9A 4CCAA 3T5XA 3RJVA 1PY1A 2AXVA 3QB2A 3G2SA 1WM5A 3B7RL 4G25A 4YVQC 1DNPA 1HU3A 2XQ0A 2XGOA 3ASGA 3UT7A 4AP2A 4KZ0A 3NZSA 4BWRA 3G2WA 4G23A 4UWLA 1E8WA 2WPVA 1H2TC 3KD7A 4B94A 4EZKA 2ILRA 2PQNA 3U9WA 4JZYA 4UI9K 4I1MA 5BV0A 2X38A 3PEUB 4URKA 3CK8A 4AY5A 4JW1A 4MRUA 4GZ6A 1NA3A 3GZSA 4H7YA 3LDZA 3SI5A 3VTXA 2UWJG 5FZSA 4HOUA 4CGVA 3FWVA 4G2VA 2J9QA 4IRUA 3FTYA 2FF4A 2Q7FA 4UWGA 5E76A 4YVOA 3UT4A 2QY7A 5G04C 3U66A 1HO8A 4GZ5A 2VQ2A 4WNEA 2GGFA 3OXFA 2LSUA 3CVLA 4KMOA 4LUNU 1UN8A 2CHZA 4K03A 4F3VA 1HE8A 2A5UA 1OWNA 3FU6A 3VLDA 1H0AA 1Y6IA 2KZTB 3ZRHA 4DI4A 1XGWA 3ZW3A 4NRHB 5FJYA 2KC7A 3D9NA 1PC2A 2IU1A 3FUNA 4I1AA 1OWPA 4GYWA 1X5BA 2LAIA 3PVLA 5DIZA 3D9PA 3Q15A 2QFCA 5T3RA 4KXKB 2XCCA 2CFUA 4R7LA 1NZNA 2L9BA 3CV0A 3CK9A 3OTNA 2X6HA 1UG3A 2MOWA 4U07A 3AS8A 2WXRA 4UWKA 4CDMA 1FVFA 5HQ8A 3HDXA 3LJ3A 4UQZA 4AEZC 3IHVA 4F1SA 4MKTA 1OWOA 3APDA 5G04J 3TGOA 3AS5A 4L1BA 4EECA 4WWOA 3RK6A 3CVUA 4WNDA 3ESKA 1IQUA 4BT9A 2XEVA 3CHPA 3CKCA 3LS8A 3N71A 4E6HA 2IONA 4B8CB 1E8XA 4IYPA 3U3WA 1ELRA 3R9AB 4WNFA 4K0RA 4Q94A 3FTWA 4GCOA 1NA0A 3FUFA 3CVYA 4FJYA 2MRIA 3LY9A 4I6EA 3B7UX 2VSXE 2VSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TXN A;  3TXM A;  3T5X A;  3CHM A;  2MRI A;  4D10 C;  4LCT A;  3JCK C; 
#chains in the Genus database with same CATH topology
 1D8E A;  1OWL A;  3QK0 A;  1HH8 A;  2CG2 A;  3SBT B;  2UY1 A;  1H2V C;  3RAU A;  1E7U A;  1Z6T A;  5AYW D;  4KT6 B;  5HI7 A;  1YYH A;  3ZGQ A;  2KCK A;  4OYS A;  1OUV A;  3L17 A;  4RLY A;  3QWW A;  3L16 A;  2R02 A;  2J49 A;  1BI7 B;  4EQF A;  5HKP A;  3LCA A;  4A1G A;  4I9C A;  4AM9 A;  5JJ7 A;  3S2A A;  4RSY A;  3EHN A;  3FH8 A;  3MKQ B;  2EIM E;  3ASD A;  5EX3 A;  2XRZ A;  4U8H A;  3FTS A;  3KAE A;  2I1K A;  4IN3 B;  4LER A;  4JEH A;  3ZYK A;  3TXM A;  2X6I A;  4UWF A;  2I9C A;  3T5V A;  5AAR A;  3MCX A;  3FU3 A;  4Z68 A;  3FHE A;  3PH0 C;  3LEW A;  3KEZ A;  3UXG A;  1WG0 A;  1OWM A;  5B3S E;  2KZT A;  2WXF A;  1RZ4 A;  3ZYL A;  4MLP A;  5BNW A;  1IXV A;  5BV1 A;  1D9S A;  5D0O D;  1TEZ A;  3Q7A A;  4N39 A;  3IKO B;  2P9N G;  5AJD A;  4NIK A;  2JEK A;  4LRZ A;  3TXN A;  4A55 A;  2AXZ A;  3QKY A;  3PRE A;  1E90 A;  5AJL A;  3J5Q B;  4F6R D;  3FH7 A;  3SHF A;  2OV8 A;  2VGX B;  1HX8 A;  3TG5 A;  4FAD A;  4RVB A;  4WUY A;  4GMR A;  4HVB A;  5CBN A;  3MGB A;  5EDS A;  3HIZ A;  3FU5 A;  3CHR A;  3FUK A;  3SFX A;  5LP0 A;  3D9O A;  4G24 A;  4AIF A;  5D0Q D;  1O5M A;  3R7R A;  2F8Y A;  5T4Y A;  4DX5 D;  4C0M A;  4U8V D;  3Q79 A;  3RO2 A;  2J09 A;  4N3C A;  4H7X A;  2XGS A;  4U95 D;  3FU0 A;  5CED B;  2J4D A;  5HS0 A;  1E96 B;  2MHK A;  2OCC E;  2ZXW E;  3Q7F A;  4DX1 A;  2R03 A;  4HI9 A;  1BPO A;  4J7W A;  2XRY A;  2WXL A;  4ANV A;  3LY7 A;  3HYM B;  3BG0 B;  2VSO E;  2CHW A;  3AU5 A;  2H6I A;  3KSQ A;  1OCR E;  4QFV A;  3L82 A;  2WXN A;  3GZ1 A;  4BX8 A;  3B7B A;  3PZD A;  3UUX A;  3ULQ A;  3APF A;  3BU8 A;  4DX7 D;  1N52 A;  1IYG A;  3Q9N C;  3CVW A;  3VTY A;  3ABK E;  4Q69 A;  2H6G A;  3FTV A;  3SD5 A;  3ESL A;  3FTU A;  2VSN A;  1IQR A;  4TUU A;  1G3N B;  4J8D A;  4KVO A;  1RW2 A;  3LY8 A;  2C0M A;  5JHA A;  3LYA A;  2LAH A;  3FTZ A;  3SGH A;  1MHQ A;  4U0U A;  4FHK A;  4U0Z A;  2CHX A;  3WXX A;  3C3R A;  4GA0 A;  3MV2 B;  1Q2Z A;  4X8Q A;  2XEN A;  2OEV A;  4BSZ B;  2EIN E;  2LUH A;  2Y4U A;  5T8I A;  2ETB A;  4ATG A;  1EPU A;  5CMY A;  2V4L A;  1LTX A;  4N2S A;  3CR3 A;  3JUI A;  4GA2 A;  3PE3 A;  3FEY A;  2LNI A;  4TXQ A;  4TXR A;  5AAO A;  3HVE A;  3ML8 A;  2KCL A;  4KVM A;  5FQ6 A;  1SZA A;  3LVQ E;  2KXP C;  3JCK C;  2DWZ A;  4AXH A;  1KPS B;  2PQR A;  4FLB A;  4BEP A;  2CG3 A;  3CVP A;  4PS8 A;  2VTB B;  2BKK B;  3DXM G;  4EBA G;  3HXB A;  3AG1 E;  2J8S D;  3CHO A;  3UIP C;  4CCA A;  3TWQ A;  3G2S A;  3DSX A;  3UT7 A;  2XGO A;  4AP2 A;  4KZ0 A;  3TWS A;  3NZS A;  4UWL A;  1E8W A;  4I1M A;  4URK A;  4AY5 A;  1NA3 A;  2XS1 A;  4HOU A;  3EU5 A;  1X81 A;  2NYJ A;  5ENP D;  3U66 A;  1K8K G;  1TNB A;  2GGF A;  4KMO A;  5AQ9 A;  1HE8 A;  2GRP B;  1H0A A;  3ZRH A;  4DI4 A;  3ZUV B;  5FJY A;  2IU1 A;  3FUN A;  3X2Q E;  4M7C A;  5DIZ A;  4KXK B;  2L9B A;  2P9P G;  5KNG A;  2MOW A;  2WXR A;  5HQ8 A;  3HDX A;  3LJ3 A;  1LD7 A;  4JD2 G;  4AEZ C;  4F1S A;  4WWO A;  3CVU A;  1IQU A;  3CKC A;  3LS8 A;  3E37 A;  4IYP A;  3ASN E;  3R9A B;  5ENT D;  4FJY A;  2MRI A;  4I6E A;  4GYW A;  4HFG A;  2XEH A;  3TWU A;  1JUQ A;  4PUC A;  2KCV A;  3SFZ A;  4JHR A;  2BF0 X;  3L6A A;  4GTM A;  3JUE A;  3L9T A;  4ANW A;  4I9E A;  2J4B A;  2OVF A;  3B95 A;  5ENR D;  1HG2 A;  3PUJ A;  3I3N A;  4HQD A;  4GPM A;  2YHC A;  1H19 A;  3PS6 A;  3FEX A;  3SBS A;  4FUL A;  3JQ1 A;  3TWR A;  2BUG A;  2FBN A;  2GW1 A;  1O1R A;  2EQX A;  4NAC A;  3MKQ A;  2P2C P;  4XIF A;  2JLB A;  4GA1 A;  4DX2 A;  2C0L A;  1SZ9 A;  4TRQ A;  2P58 C;  3D3M A;  1N94 A;  4OAV B;  3NOG D;  1AWC B;  2WXP A;  5EIB E;  4FJZ A;  3RSE G;  4ILG A;  1UJK A;  4XX5 A;  3JXJ A;  1FPP A;  4HOR A;  1D8D A;  3S7F A;  2IY0 C;  3UKR G;  2AW6 A;  4LCT A;  3G2V A;  3B7S A;  1OY3 D;  2QC9 A;  3NAW A;  4GU5 A;  2IEJ A;  4GZD A;  1L5J A;  3RRU A;  4U0S A;  4G1T A;  5EYL A;  3EIQ C;  5ANR A;  1U2V G;  4HRM B;  3URZ A;  1H6K A;  3RIB A;  4BET A;  3QOU A;  1JWF A;  1U3C A;  1Z3X A;  2L0I A;  2IOS A;  3HXF A;  3LJN A;  4JPS A;  3QC1 A;  4HBD A;  5KCM A;  4J8Y A;  2E2E A;  2JAB A;  4CYM D;  5DBK A;  2CFZ A;  5FTP A;  2P9I G;  5B1A E;  2XGM A;  4UQX A;  5J08 A;  2WMN A;  2V5Q C;  4B89 A;  5FQ7 A;  4U96 D;  1MQS A;  2GRL A;  1UOH A;  2FEZ A;  1SQM A;  4XKB A;  3OXL A;  4HRL A;  3D9L A;  5AIJ A;  3U64 A;  2IFU A;  1OXJ A;  4DPR A;  3MJW A;  2RKK A;  5BUZ A;  1TNZ A;  3TWV A;  3UT8 A;  3I5P A;  1NFI E;  4KBQ A;  1QQE A;  2GRN B;  3DSV A;  4DLO A;  3L22 A;  3HXC A;  4L23 A;  2PM6 A;  4Y6C A;  3FUL A;  2EIJ E;  3CHQ A;  4CRW A;  2P9S G;  4TV3 A;  3L13 A;  5H7P A;  4XZ4 A;  3ONK A;  2PZI A;  1N11 A;  5FQ8 A;  4IUL A;  4ANU A;  3CST A;  1HZ4 A;  4KZC A;  2KBX A;  4F53 A;  4ZFH A;  2OEW A;  5KJN A;  3EIJ A;  5G2N A;  4CDN A;  3AG2 E;  3Q4A B;  3PDN A;  4B93 B;  2Y3A A;  3R7Q A;  5LOZ A;  4GTR A;  4DJA A;  3FUH A;  4N5Q A;  2X3M A;  3QAR A;  4UQY A;  4L2L A;  4ACK A;  4JVS A;  4ME2 A;  3DPD A;  3C5R A;  4DLQ A;  2H6H A;  3TL5 A;  3Q49 B;  2RFM A;  5CRV A;  4ILI A;  3ZKJ A;  1KT0 A;  3TJP A;  3MX3 A;  3O4Z A;  3PUK A;  4FC8 A;  1DC2 A;  2OND A;  2PNN A;  3DEO A;  3QNK A;  3E34 A;  4ACL A;  5EYP F;  4O1O A;  3C72 A;  3CGH A;  3MZL B;  1K1B A;  3HRA A;  2OVB A;  2GRM A;  5C1D A;  4APF A;  4N5C A;  1N4Q A;  4U04 A;  4LNG A;  1LF8 A;  5BXU A;  1H6P A;  3APC A;  2FUL A;  4HXI A;  1BI8 B;  2A5E A;  3QDN A;  2FI7 A;  4CGW A;  3PNL B;  1KLX A;  4P29 A;  2DYR E;  1E7V A;  4I2W A;  5FIN A;  1OCO E;  4F1P A;  2AXU A;  3VLE A;  4LNB A;  2UY1 B;  2Y0B G;  2RG8 A;  3CHS A;  4W9R A;  5B1B E;  3IEG A;  5AN8 A;  3NB2 A;  3EDT B;  1TN7 A;  2ZIR A;  3C98 A;  1Z3Y A;  2F0Y A;  5JMN D;  4APO A;  4ANX A;  2GRO B;  3UIN C;  3Q47 B;  4ZHB A;  3OAW A;  3Q5M A;  4HOS A;  3ZHE A;  4JA9 A;  1KZO A;  2AXV A;  3QB2 A;  1WM5 A;  4YVQ C;  1HU3 A;  4G23 A;  3V2O A;  1H2T C;  3KD7 A;  4UI9 K;  5ENO D;  5BV0 A;  2X38 A;  3GZS A;  4DUI A;  4H7Y A;  3NBN B;  5FZS A;  3FWV A;  1NL4 A;  4IRU A;  3FTY A;  2AJA A;  2Q7F A;  2ETA A;  3UT4 A;  2QY7 A;  2LSU A;  3CVL A;  5EID A;  4K03 A;  2KZT B;  3KSL A;  5AQB A;  4NRH B;  2XEE A;  1PC2 A;  1N0Q A;  1NI1 A;  4I1A A;  3DSW A;  1OWP A;  1K3Z D;  2EIL E;  1X5B A;  2LAI A;  5T3R A;  3OTN A;  5EIL A;  1UG3 A;  4CDM A;  2P9U G;  4UWK A;  3APD A;  4U7E B;  4WND A;  3ESK A;  3Q78 A;  4BT9 A;  2XEV A;  3CHP A;  4TUM A;  1E8X A;  1N0R A;  4HLL A;  4K0R A;  3FTW A;  4O1P A;  1NA0 A;  3CVY A;  2VSX E;  3FUD A;  3BEE A;  4L9P A;  4TXP A;  2WB2 A;  1MX4 A;  3RO3 A;  1LD8 A;  4FP7 A;  4HOQ A;  3ZEF A;  3U4T A;  2WXJ A;  4I6G A;  5BPP A;  1OCZ E;  2DBA A;  3GZ2 A;  3ASO E;  3V30 A;  5FIO A;  2XPI A;  2RFA A;  5A7D B;  3RKV A;  1S64 A;  2ZU6 B;  4D10 C;  2PM7 A;  5AQ7 A;  1ZBP A;  1ZU2 A;  5ARG A;  3FH5 A;  3HXE A;  2DVW A;  5EN5 D;  3I4G A;  3FY4 A;  3RRM B;  1FT2 A;  2QZA A;  1SA5 A;  1A17 A;  1MJ0 A;  3CLJ A;  4U63 A;  1JCQ A;  4C0E A;  4J8F A;  2HR2 A;  4CT0 A;  2QYJ A;  4A3T A;  3ZU7 B;  4GAA A;  3CQC B;  3RRN B;  3ABL E;  4AV7 A;  5BT1 A;  1S70 B;  1N4P A;  4DI3 A;  2Y4T A;  1H6O A;  3CVQ A;  5ANL A;  2I6H A;  2R05 A;  4AOF A;  5LCW C;  3ZIM A;  5FWQ A;  5KJL A;  4BTA A;  5KNH D;  3AJI A;  1NP7 A;  3EJN A;  3DBS A;  3UM3 A;  1B89 A;  5FZQ A;  3TG4 A;  3R9M A;  4L7T A;  1QZ2 A;  3UPV A;  2XZT G;  4AY6 A;  4LEU A;  3D9H A;  3AG3 E;  1TJC A;  1W3B A;  4XI9 A;  4J8S A;  4OVV A;  1HFA A;  2R59 A;  5CHE E;  1E8Z A;  3PRZ A;  3SZ7 A;  1N54 A;  5LCW J;  4JHJ A;  3AU4 A;  1V54 E;  2IF4 A;  3CIA A;  3ISM C;  1N95 A;  4J0U A;  1QBQ A;  4GB9 A;  4O6F A;  3LXU X;  3MA5 A;  1TN6 A;  1P5Q A;  3OXG A;  1FVH A;  4JXT A;  4AJW A;  2Y1L E;  3ZXS A;  5FT9 A;  4L2Y A;  2V8S E;  3HVE B;  2AVP A;  5AQA A;  2NC9 A;  4XEI G;  2HO1 A;  3IBE A;  3B13 A;  4NUR A;  4BER A;  4K5A B;  2NSZ A;  2YQ8 A;  3AS4 A;  3ZYM A;  1HG5 A;  5ENS D;  1V55 E;  4C48 B;  1QYM A;  2XPZ A;  1WY6 A;  4JHK A;  4U8Y D;  2X6J A;  4BES A;  2V4H C;  3SFY A;  3G2U A;  1VDY A;  3ZVV A;  2L6J A;  1BU9 A;  4GZ3 A;  3E33 A;  5LX8 A;  1IHB A;  3LKU A;  1UJJ A;  3P1U A;  3IV0 A;  2I1J A;  2BTD A;  3KS2 A;  5FQ4 A;  4MBG A;  1AP7 A;  3LVR E;  3DSU A;  4E85 A;  3T9K A;  4BTB A;  5BW8 C;  1N4S A;  3ML9 A;  3TWT A;  3PE4 A;  1A5E A;  2YNQ A;  4GYY A;  1KT1 A;  3MKR A;  5KWD A;  4GTS A;  5G05 C;  3CKB A;  3PNT B;  4CEM A;  2L0T B;  2VGX A;  3QWV A;  3CK7 A;  2KM4 A;  3E30 A;  2V0P A;  2ZGG A;  3NQP A;  4JL0 A;  3CVX A;  5CER B;  2IO2 C;  4CT4 A;  4WWP A;  3D9I A;  1K1A A;  4ABN A;  4Q96 A;  3W9F A;  4GTQ A;  5ARF A;  4EBA A;  2DYS E;  2AWI A;  4I2Z A;  5G05 J;  3QWP A;  4B0Z A;  4CDR A;  1IHG A;  1EYH A;  1N4R A;  4I17 A;  4NQ0 A;  3FUJ A;  4PS7 A;  3ASF A;  5C2Y A;  4BX9 A;  4CZ2 D;  3FFL A;  4K5C A;  5ENN A;  4BFR A;  2WMO A;  5J90 A;  3FP3 A;  5CMW A;  4HI8 A;  3CQG B;  4HS2 A;  5HRY A;  1JPL A;  3ULE G;  1UW4 B;  1DCE A;  4GPK A;  1PY1 A;  1WDY A;  3B7R L;  4BWR A;  3AG4 E;  4EZK A;  4B94 A;  3U9W A;  4JZY A;  4LNU D;  4O60 A;  3DST A;  4HB5 A;  3PEU B;  3CK8 A;  4MRU A;  3LDZ A;  3SI5 A;  1JCS A;  3W9G A;  4G2V A;  1DCQ A;  2J9Q A;  4UWG A;  5E76 A;  4YVO A;  1HO8 A;  4GZ5 A;  2VQ2 A;  4YDW A;  3OXF A;  2DZN A;  2CHZ A;  4F3V A;  3VLD A;  1OWN A;  3T8K A;  3E32 A;  1Y6I A;  1JCR A;  3V2X A;  3ZW3 A;  2XS8 A;  3UIO C;  3PVL A;  3D9P A;  5D66 A;  2QFC A;  4GTP A;  2CFU A;  1NZN A;  3CV0 A;  3ZNG A;  4U07 A;  3AS8 A;  1FVF A;  5BXO A;  1KZP A;  2B6C A;  4MKT A;  3TGO A;  3ABM E;  3AS5 A;  3RK6 A;  5CEC B;  3N71 A;  4GTV A;  4B8C B;  4DRX E;  3U3W A;  3ULY A;  4WNF A;  4Q94 A;  4GTT A;  3PZ3 A;  3LY9 A;  3B7U X;  5LFA A;  4HOT A;  4RG9 A;  4LG6 A;  3T8M A;  2IQC A;  1MX6 A;  2LXM A;  4UI9 C;  1H2U A;  3EUV A;  5CRU A;  2ETC A;  2EIK E;  5JJT A;  2GRQ B;  2XCB A;  3DEP A;  3TWW A;  3CEQ A;  4JC8 A;  3B7T A;  3BG1 B;  3D9J A;  2HM8 A;  4G11 A;  2VTB A;  5A6C A;  2XPY A;  2WXG A;  1U3D A;  3UX4 A;  4PH4 B;  1ZB1 A;  3FUM A;  1QNF A;  4HNA D;  4XI0 A;  1OCC E;  3UTM A;  3K9I A;  4M3O A;  2VJ8 A;  4G8L A;  2P9L G;  3SF4 A;  3ONL A;  2C2L A;  2KAT A;  4YDY A;  4FA6 A;  3NZU A;  3O48 A;  3EU9 A;  2M63 A;  4JEU A;  4UI9 J;  3DXK G;  2IOL A;  2FO7 A;  4GTO A;  3F6Q A;  3VLF A;  2IJG X;  3S7B A;  4G8K A;  1Y8M A;  3G2T A;  1TR4 A;  2X6F A;  2YHE A;  4GMJ A;  5M72 A;  1BLX B;  4WWN A;  2VGE A;  2HYZ A;  4OVU A;  5D2M C;  4EHM A;  2OOE A;  5CCM A;  4BY6 A;  2WQH A;  3HXD A;  3ASH A;  1MX2 A;  2GRR B;  2Y69 E;  3D9K A;  4GCN A;  3IHY A;  2WM9 A;  2WXQ A;  1SA4 A;  4HLE A;  3PZ1 A;  4FU3 A;  3JYS A;  4A1S A;  3L08 A;  3FUE A;  2VGY A;  2DIW A;  2PL2 A;  3SY2 A;  1TNY A;  3NOC D;  4K5B A;  4A3V A;  2E0I A;  3EHM A;  5IY5 E;  5ITZ F;  4GZC A;  2P9K G;  3CVV A;  3UQ3 A;  4GYO A;  2VYI A;  4ATZ D;  1SVX A;  5A23 A;  3FDH A;  3V79 K;  5E75 A;  3MYV A;  1ELK A;  3JQ0 A;  3LPZ A;  1SW6 A;  2QYU A;  2I2O A;  1EF1 C;  3CSF A;  3AAA C;  3MV3 B;  4EZL A;  3SO8 A;  3HG0 D;  2WXK A;  3V31 A;  1GW6 A;  4OAU C;  5CBO A;  1HF8 A;  4C9B B;  3L54 A;  5KJM A;  2WXI A;  5JA4 D;  4BSX A;  5JHB A;  3MEK A;  1TNU A;  2WXO A;  1UN9 A;  4PDX A;  4UWH A;  4Y6W A;  1S63 A;  1TJF A;  2BED A;  4XKC A;  4YDE A;  3GW4 A;  5CCL A;  4V3I A;  2V5F A;  3SNX A;  3DWL G;  1MYO A;  3UKU G;  2BKG A;  3J5P A;  4WAF A;  5ENQ D;  3ZHE B;  2NXP A;  3ZFW A;  2WQ7 A;  4N2Q A;  4ILH B;  1E8Y A;  1FT1 A;  3GYZ A;  3UM0 A;  4XE0 A;  1HS6 A;  1PAQ A;  5EX0 A;  4AVX A;  1EDU A;  4MS6 A;  4PS3 A;  4YND A;  4RG6 A;  3CVN A;  1HXI A;  3SQV A;  3DRA A;  2F37 A;  2R5S A;  2LO6 A;  3QJZ A;  1YA0 A;  2WXM A;  3NF1 A;  2WQ6 A;  2ZGD A;  3ZXP A;  3P2B A;  4BT8 A;  3UI2 A;  5AEN A;  3DPY A;  1FCH A;  2MYO A;  3ZYQ A;  4F7A A;  5CEA A;  1INZ A;  3S7J A;  1MZC A;  2ZIS A;  2LSV A;  4FLH A;  4WNG A;  4KYO B;  1O1T A;  5G55 A;  4FHJ A;  3D9M A;  5FZR A;  3Q73 A;  1TNO A;  3UMV A;  1WAO 1;  3FTX A;  4QQI A;  1XNF A;  2J08 A;  4LSZ E;  3Q9U C;  5EKQ D;  2F8X K;  1YCS B;  1JWG A;  3C3O A;  4GML A;  2WXH A;  3RU0 A;  1DVP A;  2WVI A;  4JB8 P;  4G26 A;  4RQI A;  2HE0 A;  2R2L A;  4J6I A;  4N3A A;  2YIN A;  2R17 C;  1ELW A;  3CHM A;  3BUA A;  4I43 A;  2H6F A;  2DZO A;  3C3Q A;  3HHM A;  3KEA A;  3ENE A;  4I6J A;  4B8A A;  3QAQ A;  4DK5 A;  1S0P A;  2A4Z A;  2XZD G;  2LXL A;  3ZN3 A;  4J8E A;  3E4B A;  4A63 B;  4JA7 A;  4I1O B;  4EZJ A;  2IO3 C;  3ZPJ A;  3S7D A;  3FUI A;  2DCP A;  4EPZ A;  2FO1 E;  3EHQ A;  1BD8 A;  3PEV B;  4N3B A;  3BQO A;  2XHE A;  2J07 A;  3I4R B;  3IXE A;  5KJK A;  5JJ6 A;  2X6K A;  2RD0 A;  3TAX A;  1TN8 A;  1N9A A;  3T5X A;  3RJV A;  4HRN A;  4G25 A;  1DNP A;  2XQ0 A;  3ASG A;  3WG7 E;  3G2W A;  2WPV A;  2ILR A;  2PQN A;  3DSS A;  1IKN D;  5KBA A;  3Q75 A;  4JW1 A;  4GZ6 A;  3VTX A;  2UWJ G;  4CGV A;  2L6B A;  2FF4 A;  3UM1 A;  3PZ4 A;  5G04 C;  1Z5S C;  4WNE A;  4LUN U;  1UN8 A;  3TWX A;  2A5U A;  3FU6 A;  3EHR A;  1XGW A;  2KC7 A;  3D9N A;  3UM2 A;  3Q15 A;  2XCC A;  4R7L A;  4DX6 D;  4UUC A;  3CK9 A;  1OT8 A;  2X6H A;  4UQZ A;  3IHV A;  1O1S A;  1TYQ G;  1OWO A;  5G04 J;  4L1B A;  4EEC A;  1YMP A;  2B0O E;  3PZ2 A;  4E6H A;  2ION A;  1ELR A;  3JXI A;  4GCO A;  4YDO A;  3FUF A;  2VSY A; 
#chains in the Genus database with same CATH homology
 4HFG A;  1OWL A;  4HOT A;  4RG9 A;  3QK0 A;  1HH8 A;  3FUD A;  3T8M A;  1JUQ A;  2IQC A;  4PUC A;  2KCV A;  3BEE A;  3SFZ A;  2CG2 A;  4JHR A;  3SBT B;  2UY1 A;  2BF0 X;  1H2V C;  4UI9 C;  2WB2 A;  1E7U A;  1Z6T A;  1H2U A;  3L6A A;  4KT6 B;  5AYW D;  4ANW A;  4I9E A;  5JJT A;  5HI7 A;  3ZGQ A;  2XCB A;  2J4B A;  2KCK A;  2OVF A;  3CEQ A;  4FP7 A;  3RO3 A;  4OYS A;  1HG2 A;  3PUJ A;  3B7T A;  4JC8 A;  1OUV A;  3I3N A;  3BG1 B;  4HOQ A;  3ZEF A;  3U4T A;  3L17 A;  3D9J A;  2YHC A;  1H19 A;  2HM8 A;  2WXJ A;  3QWW A;  3PS6 A;  3L16 A;  3FEX A;  4I6G A;  4G11 A;  4EQF A;  2J49 A;  3SBS A;  5BPP A;  5A6C A;  2XPY A;  2VTB A;  4FUL A;  2WXG A;  2DBA A;  1U3D A;  3GZ2 A;  3LCA A;  3UX4 A;  4PH4 B;  3JQ1 A;  4A1G A;  3FUM A;  1QNF A;  4XI0 A;  4I9C A;  2BUG A;  2FBN A;  4AM9 A;  5JJ7 A;  2GW1 A;  3K9I A;  3S2A A;  2XPI A;  4M3O A;  2VJ8 A;  3SF4 A;  4RSY A;  5A7D B;  3EHN A;  2EQX A;  2C2L A;  3FH8 A;  3ONL A;  3MKQ B;  4NAC A;  3RKV A;  3MKQ A;  2KAT A;  3ASD A;  5EX3 A;  2XRZ A;  2ZU6 B;  4U8H A;  4D10 C;  2PM7 A;  4XIF A;  1ZBP A;  1ZU2 A;  5ARG A;  3FH5 A;  2JLB A;  3FTS A;  4FA6 A;  3NZU A;  3KAE A;  2I1K A;  2M63 A;  3O48 A;  4GA1 A;  4IN3 B;  4JEU A;  4LER A;  4UI9 J;  3I4G A;  4JEH A;  3FY4 A;  2IOL A;  2FO7 A;  3ZYK A;  3RRM B;  3TXM A;  2X6I A;  3VLF A;  2IJG X;  3S7B A;  2C0L A;  4UWF A;  1SZ9 A;  4TRQ A;  2I9C A;  1Y8M A;  2P58 C;  3G2T A;  3D3M A;  1A17 A;  3T5V A;  3CLJ A;  2WXP A;  2X6F A;  3MCX A;  4U63 A;  3FU3 A;  4C0E A;  4FJZ A;  2YHE A;  4GMJ A;  5M72 A;  4J8F A;  4WWN A;  2HR2 A;  3FHE A;  4ILG A;  1UJK A;  4CT0 A;  4XX5 A;  2HYZ A;  4A3T A;  3PH0 C;  4GAA A;  4OVU A;  3CQC B;  2OOE A;  3LEW A;  3KEZ A;  4HOR A;  5CCM A;  1OWM A;  3RRN B;  3S7F A;  4BY6 A;  4AV7 A;  2WQH A;  5BT1 A;  4DI3 A;  2KZT A;  2Y4T A;  2AW6 A;  2WXF A;  3CVQ A;  4LCT A;  5ANL A;  3G2V A;  3ASH A;  3ZYL A;  3B7S A;  3D9K A;  4MLP A;  5BNW A;  2I6H A;  5BV1 A;  4GU5 A;  4GCN A;  4AOF A;  3IHY A;  4GZD A;  1L5J A;  2WM9 A;  2WXQ A;  3RRU A;  5D0O D;  5LCW C;  4U0S A;  3ZIM A;  5FWQ A;  1TEZ A;  4G1T A;  4N39 A;  4BTA A;  5KJL A;  3IKO B;  1NP7 A;  3EJN A;  3EIQ C;  3DBS A;  5AJD A;  5ANR A;  4HLE A;  1B89 A;  5FZQ A;  2JEK A;  3URZ A;  1H6K A;  3TG4 A;  4FU3 A;  4LRZ A;  3RIB A;  3JYS A;  3TXN A;  4A1S A;  4A55 A;  3QOU A;  2AXZ A;  3L08 A;  4L7T A;  1QZ2 A;  1JWF A;  3UPV A;  1U3C A;  1Z3X A;  3QKY A;  2L0I A;  3PRE A;  3FUE A;  2VGY A;  2IOS A;  2DIW A;  2PL2 A;  1E90 A;  4JPS A;  5AJL A;  3QC1 A;  3FH7 A;  5KCM A;  2OV8 A;  3SHF A;  4AY6 A;  2VGX B;  1HX8 A;  2E2E A;  4LEU A;  5DBK A;  2CFZ A;  5FTP A;  3TG5 A;  4A3V A;  4FAD A;  2E0I A;  2XGM A;  1TJC A;  1W3B A;  3EHM A;  4RVB A;  4XI9 A;  4J8S A;  4GZC A;  4UQX A;  5J08 A;  4WUY A;  2WMN A;  3CVV A;  3UQ3 A;  4GYO A;  4HVB A;  2VYI A;  4OVV A;  1HFA A;  4B89 A;  3MGB A;  5EDS A;  2R59 A;  5CHE E;  1E8Z A;  5FQ7 A;  5A23 A;  3FDH A;  3HIZ A;  3PRZ A;  3FU5 A;  3CHR A;  3FUK A;  3SZ7 A;  1N54 A;  5LCW J;  4JHJ A;  5LP0 A;  3AU4 A;  3D9O A;  1MQS A;  5E75 A;  2GRL A;  4G24 A;  2IF4 A;  2FEZ A;  3MYV A;  1SQM A;  3CIA A;  4XKB A;  4AIF A;  1ELK A;  5D0Q D;  3OXL A;  3JQ0 A;  3LPZ A;  3R7R A;  4J0U A;  3D9L A;  4GB9 A;  2I2O A;  5AIJ A;  1EF1 C;  3CSF A;  4O6F A;  3U64 A;  3MV3 B;  3LXU X;  4EZL A;  3MA5 A;  2IFU A;  5T4Y A;  4DPR A;  3MJW A;  2WXK A;  1P5Q A;  1GW6 A;  3OXG A;  1FVH A;  4JXT A;  1HF8 A;  4C0M A;  4C9B B;  5BUZ A;  3L54 A;  4AJW A;  5KJM A;  3UT8 A;  3I5P A;  4KBQ A;  3ZXS A;  5FT9 A;  1QQE A;  2V8S E;  4L2Y A;  4DLO A;  2WXI A;  3HVE B;  3L22 A;  3RO2 A;  4BSX A;  2AVP A;  5JHB A;  2J09 A;  2NC9 A;  3MEK A;  4N3C A;  4L23 A;  2PM6 A;  4Y6C A;  3FUL A;  4H7X A;  2WXO A;  2HO1 A;  1UN9 A;  3IBE A;  4PDX A;  2XGS A;  3B13 A;  3CHQ A;  4NUR A;  4UWH A;  4Y6W A;  4CRW A;  1TJF A;  3FU0 A;  2J4D A;  4XKC A;  4TV3 A;  1E96 B;  2MHK A;  3GW4 A;  3L13 A;  2NSZ A;  4V3I A;  5CCL A;  2YQ8 A;  3AS4 A;  4XZ4 A;  3ZYM A;  2V5F A;  3ONK A;  3SNX A;  2PZI A;  1HG5 A;  1BPO A;  4WAF A;  3ZHE B;  2XRY A;  5FQ8 A;  2WXL A;  4IUL A;  4ANU A;  3CST A;  2NXP A;  2XPZ A;  3ZFW A;  2WQ7 A;  4ANV A;  3LY7 A;  5LFA A;  1HZ4 A;  1WY6 A;  3BG0 B;  3HYM B;  4JHK A;  2X6J A;  4N2Q A;  4ILH B;  4KZC A;  2VSO E;  1E8Y A;  2CHW A;  3AU5 A;  3GYZ A;  4F53 A;  4XE0 A;  1HS6 A;  1PAQ A;  3G2U A;  5EX0 A;  4AVX A;  1EDU A;  4QFV A;  5KJN A;  1VDY A;  3EIJ A;  4MS6 A;  4PS3 A;  4YND A;  3Q4A B;  2L6J A;  5G2N A;  3ZVV A;  4CDN A;  2WXN A;  3GZ1 A;  4GZ3 A;  4BX8 A;  3PDN A;  5LX8 A;  4RG6 A;  3PZD A;  2Y3A A;  3LKU A;  3UUX A;  3CVN A;  1UJJ A;  3APF A;  3P1U A;  3IV0 A;  3ULQ A;  2I1J A;  1N52 A;  1HXI A;  3R7Q A;  1IYG A;  2BTD A;  3KS2 A;  5FQ4 A;  3CVW A;  2R5S A;  5LOZ A;  3VTY A;  4DJA A;  2LO6 A;  3FUH A;  4Q69 A;  3QJZ A;  1YA0 A;  2X3M A;  2WXM A;  3NF1 A;  3QAR A;  2WQ6 A;  3LVR E;  4UQY A;  4E85 A;  3FTV A;  4BTB A;  3P2B A;  4L2L A;  5BW8 C;  3SD5 A;  4BT8 A;  4ACK A;  5AEN A;  1FCH A;  4JVS A;  3ML9 A;  4ME2 A;  3PE4 A;  3DPD A;  4DLQ A;  2YNQ A;  3ESL A;  4GYY A;  3ZYQ A;  4F7A A;  3TL5 A;  3Q49 B;  3FTU A;  2VSN A;  1INZ A;  1IQR A;  1KT1 A;  3S7J A;  3MKR A;  4TUU A;  2LSV A;  4FLH A;  4ILI A;  1KT0 A;  4WNG A;  3TJP A;  4KYO B;  5G05 C;  3MX3 A;  5G55 A;  3O4Z A;  3CKB A;  3PNT B;  3PUK A;  4FC8 A;  4FHJ A;  3D9M A;  4J8D A;  4KVO A;  5FZR A;  2OND A;  4CEM A;  3LY8 A;  2C0M A;  5JHA A;  3UMV A;  2L0T B;  2VGX A;  3LYA A;  3QNK A;  1WAO 1;  2LAH A;  3FTX A;  4ACL A;  3QWV A;  3FTZ A;  3CGH A;  3SGH A;  3CK7 A;  1MHQ A;  1XNF A;  2J08 A;  2KM4 A;  3MZL B;  4U0U A;  5EKQ D;  2OVB A;  2V0P A;  3NQP A;  4JL0 A;  4FHK A;  3CVX A;  2GRM A;  1JWG A;  4U0Z A;  4GML A;  4CT4 A;  5C1D A;  4WWP A;  4APF A;  2CHX A;  4N5C A;  3WXX A;  3D9I A;  2WXH A;  3RU0 A;  4ABN A;  4Q96 A;  1DVP A;  2WVI A;  4GA0 A;  3MV2 B;  4G26 A;  4U04 A;  4J6I A;  4N3A A;  1LF8 A;  5ARF A;  4EBA A;  3APC A;  2FUL A;  4HXI A;  2Y4U A;  2YIN A;  5T8I A;  2R17 C;  3QDN A;  1ELW A;  4ATG A;  2FI7 A;  1EPU A;  5CMY A;  2AWI A;  4CGW A;  2V4L A;  3CHM A;  3PNL B;  1KLX A;  4P29 A;  4I43 A;  4I2Z A;  1E7V A;  5G05 J;  4I2W A;  3QWP A;  4B0Z A;  3HHM A;  4N2S A;  4CDR A;  3CR3 A;  3JUI A;  3ENE A;  4I6J A;  1IHG A;  1EYH A;  2AXU A;  3QAQ A;  4GA2 A;  3VLE A;  1S0P A;  3PE3 A;  3FEY A;  4B8A A;  4I17 A;  2A4Z A;  4DK5 A;  2LNI A;  4NQ0 A;  3ZN3 A;  2UY1 B;  4J8E A;  3HVE A;  3FUJ A;  3ML8 A;  2KCL A;  4KVM A;  2RG8 A;  5FQ6 A;  1SZA A;  4PS7 A;  3E4B A;  3ASF A;  3CHS A;  3LVQ E;  4W9R A;  4JA7 A;  3IEG A;  4I1O B;  4EZJ A;  3EDT B;  3JCK C;  3ZPJ A;  3S7D A;  5C2Y A;  3FUI A;  4AXH A;  2DCP A;  4BX9 A;  4EPZ A;  3C98 A;  2PQR A;  3FFL A;  5ENN A;  1Z3Y A;  4FLB A;  3PEV B;  4APO A;  4BFR A;  4N3B A;  2WMO A;  4ANX A;  2CG3 A;  2XHE A;  5J90 A;  3CVP A;  2J07 A;  4PS8 A;  3I4R B;  3FP3 A;  2VTB B;  5KJK A;  5CMW A;  3Q47 B;  5JJ6 A;  2X6K A;  2RD0 A;  3CQG B;  3OAW A;  4HS2 A;  3Q5M A;  3TAX A;  4EBA G;  1JPL A;  4HOS A;  3ZHE A;  1UW4 B;  4GPK A;  3CHO A;  4JA9 A;  4CCA A;  3T5X A;  3RJV A;  1PY1 A;  2AXV A;  3QB2 A;  3G2S A;  1WM5 A;  3B7R L;  4G25 A;  4YVQ C;  1DNP A;  1HU3 A;  2XQ0 A;  2XGO A;  3ASG A;  3UT7 A;  4AP2 A;  4KZ0 A;  3NZS A;  4BWR A;  3G2W A;  4G23 A;  4UWL A;  1E8W A;  2WPV A;  1H2T C;  3KD7 A;  4B94 A;  4EZK A;  2ILR A;  2PQN A;  3U9W A;  4JZY A;  4UI9 K;  4I1M A;  5BV0 A;  2X38 A;  3PEU B;  4URK A;  3CK8 A;  4AY5 A;  4JW1 A;  4MRU A;  4GZ6 A;  1NA3 A;  3GZS A;  4H7Y A;  3LDZ A;  3SI5 A;  3VTX A;  2UWJ G;  5FZS A;  4HOU A;  4CGV A;  3FWV A;  4G2V A;  2J9Q A;  4IRU A;  3FTY A;  2FF4 A;  2Q7F A;  4UWG A;  5E76 A;  4YVO A;  3UT4 A;  2QY7 A;  5G04 C;  3U66 A;  1HO8 A;  4GZ5 A;  2VQ2 A;  4WNE A;  2GGF A;  3OXF A;  2LSU A;  3CVL A;  4KMO A;  4LUN U;  1UN8 A;  2CHZ A;  4K03 A;  4F3V A;  1HE8 A;  2A5U A;  1OWN A;  3FU6 A;  3VLD A;  1H0A A;  1Y6I A;  2KZT B;  3ZRH A;  4DI4 A;  1XGW A;  3ZW3 A;  4NRH B;  5FJY A;  2KC7 A;  3D9N A;  1PC2 A;  2IU1 A;  3FUN A;  4I1A A;  1OWP A;  4GYW A;  1X5B A;  2LAI A;  3PVL A;  5DIZ A;  3D9P A;  3Q15 A;  2QFC A;  5T3R A;  4KXK B;  2XCC A;  2CFU A;  4R7L A;  1NZN A;  2L9B A;  3CV0 A;  3CK9 A;  3OTN A;  2X6H A;  1UG3 A;  2MOW A;  4U07 A;  3AS8 A;  2WXR A;  4UWK A;  4CDM A;  1FVF A;  5HQ8 A;  3HDX A;  3LJ3 A;  4UQZ A;  4AEZ C;  3IHV A;  4F1S A;  4MKT A;  1OWO A;  3APD A;  5G04 J;  3TGO A;  3AS5 A;  4L1B A;  4EEC A;  4WWO A;  3RK6 A;  3CVU A;  4WND A;  3ESK A;  1IQU A;  4BT9 A;  2XEV A;  3CHP A;  3CKC A;  3LS8 A;  3N71 A;  4E6H A;  2ION A;  4B8C B;  1E8X A;  4IYP A;  3U3W A;  1ELR A;  3R9A B;  4WNF A;  4K0R A;  4Q94 A;  3FTW A;  4GCO A;  1NA0 A;  3FUF A;  3CVY A;  4FJY A;  2MRI A;  3LY9 A;  4I6E A;  3B7U X;  2VSX E;  2VSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...