3CHMA

Crystal structure of pci domain from a. thaliana cop9 signalosome subunit 7 (csn7)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
161
Chain Sequence
EQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COP9 signalosome complex subunit 7
publication title The Arabidopsis COP9 signalosome subunit 7 is a model PCI domain protein with subdomains involved in COP9 signalosome assembly
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 57
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3chmA00
4D10C 3TXNA 3TXMA 3T5XA 2MRIA 3CHMA 4LCTA 3JCKC
chains in the Genus database with same CATH superfamily
4IULA 1DVPA 3URZA 3ASDA 2X3MA 4I1OB 3AU4A 3PVLA 5EYLA 3KD7A 4ACKA 2LXMA 2R03A 3CGHA 4OVUA 3LY8A 1SVXA 3CKCA 1N4QA 4I6EA 2C0LA 4CGWA 4BT8A 2J49A 2P9NG 3ZW3A 1Z3YA 4A1SA 4UI9C 4CT0A 5FQ6A 4F3VA 2VGYA 4UWGA 1N4SA 4HRMB 2EIKE 3E32A 3LDZA 3ASOE 3HRAA 2VGXB 4HNAD 5KJLA 3EHMA 3S7FA 5EYPF 5LOZA 3FWVA 3PEVB 3FH7A 4GMJA 1FPPA 2CHWA 2LO6A 4HLLA 2P9LG 3EDTB 4K03A 4BEPA 3FTVA 2X6FA 5T4YA 1TNZA 2XZDG 4NURA 1WG0A 5HKPA 4HOTA 1E90A 4JXTA 1HE8A 5KJKA 1FT1A 2YHEA 2JABA 2WQHA 2VGXA 3QDNA 3Q79A 4EHMA 2XEVA 4BX9A 2ETAA 3U66A 4JB8P 1OUVA 3NAWA 3PDNA 5AQAA 2B0OE 1HU3A 3GZ2A 1IHGA 4GTSA 3EHRA 5EX3A 1INZA 3FUMA 3V30A 1SZAA 4J8DA 5G55A 1TNOA 2IY0C 4JA7A 4U0ZA 4L2LA 3P1UA 1H19A 4G8LA 2LSUA 4AEZC 3X2QE 4PDXA 5KNHD 3UIOC 1TNYA 3VLEA 4Z68A 4WWNA 4X8QA 4XZ4A 3TG5A 3C3RA 3KEZA 4BTBA 2YINA 3RRUA 1OWNA 2I6HA 2I1KA 3BU8A 3FUJA 4O1PA 1XNFA 1MQSA 1N54A 3QOUA 3CKBA 3RU0A 1Y6IA 2VQ2A 3MX3A 5FZSA 1UJJA 3ASHA 2AXUA 2L0TB 2P9UG 2P2CP 1GW6A 2OEVA 3GW4A 2R59A 4EBAA 3UT8A 2UY1B 4FP7A 5JJ7A 1TN6A 1KT0A 3FUKA 3IXEA 3QNKA 1AP7A 1V54E 2CHXA 2J4DA 2WXFA 3FU5A 3RIBA 2HE0A 1QZ2A 5ARFA 4ACLA 2QY7A 5CERB 3G2TA 3OXLA 3CVLA 3VTXA 4TXRA 1XGWA 5ENSD 2KCVA 3W9FA 2DZNA 3BG0B 3E34A 2GRRB 4CRWA 2IF4A 4IRUA 1X5BA 3Q9NC 3ONKA 3LPZA 4Q69A 3ML8A 3UM3A 1ELKA 2UY1A 2C2LA 2MHKA 3PEUB 5FT9A 4JPSA 4Q94A 4GTRA 3I4RB 4H7XA 3UI2A 1Y8MA 4GMRA 2P9KG 2WXLA 4PS3A 3E4BA 2FF4A 3SY2A 3JUIA 4PS8A 4XE0A 3VLDA 4TUUA 3RKVA 1B89A 1QNFA 2PNNA 2ZIRA 5DIZA 4HBDA 4TXQA 3CV0A 3SF4A 3FP3A 2RKKA 2VGEA 2XGOA 4DX7D 3Q73A 2QZAA 3MKQB 3CVNA 5ANRA 3FTXA 4J7WA 4FU3A 4E6HA 1U2VG 3VLFA 2JLBA 3LEWA 4XI9A 3Q7AA 1SQMA 3ZXSA 4NACA 2WXPA 3AAAC 4UWFA 4L1BA 1N4PA 2XENA 4ATZD 1N94A 2R2LA 3CLJA 1O1RA 5G05C 1JWFA 1JCRA 3J5QB 4MLPA 4CDMA 4N39A 2BKKB 3C3QA 1K3ZD 2NC9A 4KZCA 2Y69E 3FUDA 2V8SE 5AQ7A 4U07A 1TN7A 3ZFWA 3SO8A 4F1SA 3FUHA 4YDYA 4IYPA 1S70B 2F8XK 5CRVA 5EDSA 4ABNA 3MV3B 2PQRA 4HB5A 4FJYA 2CFUA 3O4ZA 3PH0C 2FI7A 4GB9A 3S2AA 4J0UA 3RK6A 2E0IA 2ZU6B 5D2MC 4UQXA 3S7JA 2GRNB 3B7UX 1DNPA 4HS2A 2DIWA 2L9BA 4A55A 4UUCA 5ENTD 2IO2C 5KJNA 3L08A 5LX8A 3EHQA 4BSZB 3LY9A 3FU6A 3C5RA 3U3WA 2XGMA 3RSEG 1YYHA 2J07A 5AQ9A 4A63B 1H6KA 3J5PA 5FQ8A 2EINE 1KT1A 3FFLA 3L9TA 3NOCD 3AS5A 4ANVA 2AWIA 1ELRA 5G05J 3U9WA 3ZEFA 3FH5A 1HO8A 4YDOA 4F1PA 1Q2ZA 4UWKA 4GZ5A 2P58C 2XRYA 4G11A 1N9AA 5FJYA 2IOSA 4U8YD 3FTYA 4DLQA 2XCBA 2MOWA 3DPDA 3Q75A 3IBEA 2VJ8A 2HYZA 2R02A 3Q78A 3ZIMA 5FZRA 3D9PA 4R7LA 1NA0A 3CK7A 4G24A 2P9PG 4JA9A 3L82A 3ULEG 3JCKC 2AW6A 3AS8A 5ENRD 3FTSA 4F6RD 3CHSA 5KCMA 3FH8A 5G2NA 3ABME 1HS6A 4U8VD 4PS7A 4LG6A 1IYGA 4GTPA 4C48B 1TJFA 2ETCA 3TWVA 1UN8A 1H0AA 5ARGA 4KT6B 2DBAA 5HQ8A 3Q47B 3KS2A 1E7UA 3ISMC 4DX6D 1G3NB 5J90A 4GTTA 3L54A 5HI7A 4QFVA 3ZPJA 5BXOA 3P2BA 2HO1A 3TXNA 1NFIE 4HRLA 3CVVA 3D3MA 3UQ3A 2LUHA 1EYHA 3CQCB 1SZ9A 5AAOA 5E76A 4EPZA 4MBGA 5E75A 3PREA 1E96B 3QWPA 2H6GA 4KZ0A 4N3BA 4LNBA 3B13A 3TAXA 3DPYA 4UWHA 3D9OA 1BI7B 5CMYA 2RG8A 5EKQD 4FLHA 4XKCA 4DPRA 4C9BB 5CEDB 2WVIA 3C3OA 5ANLA 4K5CA 2ILRA 1MYOA 2EQXA 4URKA 3MJWA 3UKRG 3L22A 2DCPA 3MCXA 2LXLA 1HX8A 3APFA 3ESKA 3E30A 4RQIA 4EZKA 4B89A 3L13A 5AQBA 2FO1E 2V5FA 4GAAA 1E7VA 4GZ6A 4B93B 5AIJA 2I9CA 1N52A 4JD2G 3UTMA 2WM9A 4DK5A 4AXHA 3HXCA 3MEKA 5BT1A 4TV3A 4ME2A 1LTXA 3Q15A 4JEHA 2DWZA 2UWJG 3L6AA 3DBSA 5JHAA 2KBXA 2ZXWE 4APOA 4WNGA 5BNWA 1TEZA 3E37A 2J4BA 4AOFA 3PZ2A 4NIKA 3QC1A 4WAFA 3UIPC 1ELWA 4ILIA 4GTMA 2IJGX 4G8KA 4JHJA 4WUYA 4AJWA 1W3BA 1S0PA 4ILHB 3APCA 4JC8A 4B0ZA 4KMOA 3NOGD 2RFAA 3TWRA 2MYOA 2WB2A 3IHYA 3FY4A 1AWCB 1HZ4A 4DLOA 3R9MA 3TGOA 4NRHB 2NSZA 2OVBA 3G2UA 2XEEA 4U95D 3PE4A 2BKGA 4NQ0A 4FA6A 4BWRA 4HOSA 2ONDA 4DX2A 1QQEA 3UX4A 1N0QA 3TWQA 3LS8A 2PQNA 5LFAA 3CVXA 1YMPA 1FCHA 3KSQA 3CIAA 4TUMA 4CDNA 4V3IA 2OEWA 4HLEA 2V4LA 1H2TC 4M3OA 5KJMA 4I6JA 5A23A 5FIOA 4Y6WA 3GYZA 2J9QA 2L6JA 4HI9A 3HIZA 4GZDA 3SFXA 1BLXB 4RVBA 4DUIA 4YVOA 3EIJA 5EIDA 3BUAA 5AN8A 3KAEA 3ZRHA 1HH8A 4GA1A 4JHRA 5LCWC 1UG3A 2CG2A 4CCAA 1SA4A 4ZHBA 2WXRA 4XIFA 3MA5A 5EILA 3D9IA 3CHOA 2VYIA 2LNIA 3SBSA 4FADA 3V2OA 3MZLB 2I1JA 2RFMA 4TRQA 4XEIG 2BEDA 4WNFA 5B3SE 2WXHA 3VTYA 4N2QA 3FDHA 4N3AA 1P5QA 2HM8A 3QB2A 3LJ3A 3DXMG 5CMWA 2X6JA 4RLYA 1SA5A 1L5JA 4GCOA 3I3NA 3LYAA 3CVQA 2WMNA 1H6PA 3AG1E 3B7SA 1OY3D 5BV1A 2KM4A 1BPOA 2KC7A 2QC9A 4N5CA 5FQ7A 4HORA 1V55E 4HXIA 3HXEA 3SHFA 3JQ0A 3I5PA 1NZNA 4FJZA 4BT9A 4FLBA 4U04A 4J8FA 1O1SA 1A17A 4YVQC 3Q49B 2MRIA 2BF0X 4O6FA 3UT7A 2WPVA 1MX4A 2GW1A 4RSYA 2VTBB 5BUZA 5LCWJ 3AG4E 3EJNA 3IHVA 3UPVA 3GZ1A 1MX6A 4I9EA 4G25A 3ZGQA 1FVHA 4GZ3A 3ASNE 5KWDA 2OCCE 4K5BA 1HXIA 3LXUX 1Z3XA 3ZNGA 3D9MA 1UOHA 2IONA 2NXPA 3D9NA 2VTBA 5HS0A 4F7AA 3MKQA 4U0SA 4CZ2D 4BTAA 4LEUA 1N95A 4P29A 2IFUA 3R7RA 2A5UA 1WAO1 4I2WA 3LVQE 4FULA 1EPUA 1U3CA 3ESLA 2WXOA 1MJ0A 5EX0A 2R05A 4BY6A 1BI8B 3T8MA 4DX5D 4M7CA 1JCQA 4IN3B 5AYWD 4QQIA 1U3DA 2VSNA 2HR2A 2WQ6A 5CCLA 1KZPA 4EZJA 3SQVA 4B8CB 3JXJA 3MKRA 3I4GA 5FQ4A 3FULA 3UINC 2L0IA 4U0UA 5D0QD 2AJAA 1IHBA 1EF1C 4LRZA 1BD8A 3ABLE 3T5VA 3DSXA 2E2EA 1NP7A 1OCZE 2KCKA 4W9RA 3CSFA 3PNLB 3ZHEB 4OAUC 5LP0A 1N0RA 1JWGA 5CEAA 3KEAA 3L17A 4AIFA 3HXBA 5H7PA 2XPIA 5FINA 4K0RA 5D66A 5BPPA 5BXUA 3D9LA 3EHNA 3ZVVA 1QYMA 3ASGA 4GCNA 4DI4A 4BX8A 1TR4A 1MX2A 3LCAA 1DC2A 4GA2A 3R7QA 3RO2A 4CT4A 3UM1A 1D9SA 1X81A 3ZHEA 4L7TA 1OWMA 2PM6A 4HFGA 1FVFA 4JW1A 4O60A 5ENPD 4ILGA 3TWXA 5CRUA 3T8KA 2JEKA 2PZIA 1NI1A 4KVMA 3LVRE 4BESA 2EIME 2DYSE 3B7TA 3ZYKA 4FHJA 3FHEA 3MGBA 2P9IG 3TL5A 2WXGA 3PRZA 5HRYA 4ZFHA 3UMVA 2Q7FA 2H6HA 3DEPA 4BETA 2OVFA 4DI3A 2XS8A 1H2VC 2ZISA 3WXXA 5B1BE 3B95A 3Q7FA 3HHMA 2FBNA 4YNDA 2V4HC 5ENOD 1K8KG 3FTZA 1JCSA 3PZ4A 5KBAA 2OV8A 4A3VA 1WDYA 4I6GA 3UM0A 1BU9A 2GRQB 2Y3AA 2ETBA 1LD8A 1HG2A 1S63A 4U63A 4LSZE 4ANWA 2R17C 3UT4A 4OYSA 2OOEA 3DEOA 3OAWA 3JQ1A 5AENA 4G23A 3ENEA 3V2XA 5CHEE 4CDRA 2DVWA 1WM5A 1FT2A 3JUEA 3AJIA 3T9KA 5J08A 3KSLA 1PC2A 2X6IA 3NB2A 3ZYQA 3ZUVB 3APDA 1JUQA 4UQZA 3SD5A 5ENQD 1TYQG 4G26A 1KLXA 2V0PA 5T3RA 2PM7A 1E8XA 3CHPA 4HOUA 3SI5A 4KVOA 4JZYA 3ZU7B 2QFCA 3B7RL 1MHQA 4LERA 4H7YA 4ANXA 1Z6TA 4B8AA 4F53A 3CHMA 3CVYA 3CQGB 3QKYA 4TXPA 3D9HA 3AU5A 3FEXA 2EIJE 4U96D 4GPMA 4AY6A 1S64A 3OXFA 4C0MA 4KBQA 3DWLG 2WXNA 3NBNB 4LNUD 1N11A 5FWQA 3JXIA 4YDWA 2EILE 5A6CA 1KZOA 4UQYA 1YA0A 4YDEA 3ZKJA 4DX1A 4C0EA 3HG0D 2IQCA 5FTPA 5DBKA 1Z5SC 2Y4TA 1PY1A 2WXIA 4I43A 4L9PA 3CEQA 3HXFA 4I9CA 1O5MA 5CBNA 3CVWA 2J8SD 1OCCE 2XPYA 3QWWA 4I17A 3RRNB 3S7BA 3N71A 4RG9A 2I2OA 3JYSA 4A1GA 2P9SG 1TNBA 3PUJA 3PE3A 4GTOA 4N3CA 1A5EA 2R5SA 3V79K 3LJNA 3O48A 4K5AB 4MKTA 2YQ8A 4O1OA 2X6KA 3LKUA 3CVPA 5B1AE 4JVSA 3EU9A 2X6HA 2F0YA 2WXMA 3NZSA 5ITZF 2C0MA 4U8HA 4WWPA 4Q96A 2QYUA 3DXKG 3B7BA 4DRXE 4JHKA 3V31A 5CCMA 2WXKA 3MYVA 4PH4B 3DSUA 4OVVA 4APFA 4ANUA 1JPLA 4WWOA 5AJDA 2VSXE 4EQFA 2XGSA 4HVBA 1K1AA 4UI9J 3HXDA 4GTVA 5CBOA 4EECA 1DCQA 3D9KA 3DSWA 4CEMA 1D8DA 4ATGA 4KYOB 3UUXA 3ULYA 1HG5A 3TJPA 1EDUA 4MRUA 2H6FA 1OXJA 3DSSA 4HRNA 1SW6A 3DRAA 3EIQC 3PZDA 1NL4A 4GYOA 3HVEB 5A7DB 1E8YA 2BTDA 4LUNU 5T8IA 3UM2A 2IOLA 3BQOA 1TJCA 4G1TA 3EU5A 4GPKA 5CECB 2X38A 4DJAA 3SGHA 1VDYA 3AG3E 3S7DA 1E8ZA 2J08A 3GZSA 3FUEA 2XHEA 3FEYA 2KXPC 3CHRA 3HVEA 1OCOE 3OXGA 2LSVA 3E33A 2WMOA 2Y1LE 4BFRA 1TN8A 4XKBA 1E8WA 2ZGDA 3QAQA 2AXVA 1OT8A 3NF1A 3G2SA 3ZYMA 2B6CA 1H6OA 4CGVA 1ZU2A 5BV0A 3DSVA 1UN9A 3RRMB 1RW2A 3EUVA 5JHBA 1IKND 1KPSB 3UKUG 3NZUA 2CHZA 2XCCA 2KZTB 4OAVB 5D0OD 1ZB1A 4AVXA 2GROB 3R9AB 1QBQA 4U7EB 3FU3A 3RJVA 2YNQA 2KCLA 4WNDA 3TXMA 1DCEA 4MS6A 4N5QA 3QK0A 4HI8A 3QARA 3IV0A 1PAQA 5AJLA 4LNGA 4N2SA 3ULQA 1RZ4A 1OWOA 4XX5A 3TG4A 3QJZA 2H6IA 5M72A 2KZTA 4Y6CA 1N4RA 2Y4UA 2AXZA 2GRPB 3PUKA 4EZLA 2GRMA 3CR3A 3IEGA 4GYYA 4E85A 5KNGA 3SNXA 2CFZA 3ASFA 3ML9A 3C98A 2XQ0A 2M63A 4AP2A 5FZQA 4GU5A 4I1AA 4KXKB 3U64A 3T5XA 1OWPA 4J8EA 3F6QA 3AG2E 2FO7A 2DZOA 1LF8A 3SFYA 4J6IA 4I2ZA 2ZGGA 3UXGA 5BW8C 2CG3A 3PNTB 4JL0A 4GYWA 1IXVA 3ONLA 1LD7A 3FUFA 4HQDA 4FC8A 4GA0A 4GMLA 2V5QC 2YHCA 4G2VA 2XS1A 5AARA 4L23A 4I1MA 3G2WA 2BUGA 3SBTB 2F8YA 3OTNA 3CK9A 2J09A 4J8SA 1HFAA 2QYJA 4JEUA 3AS4A 1IQRA 3ZN3A 1NA3A 2PL2A 3U4TA 4AM9A 5JJ6A 4BSXA 5C2YA 4WNEA 4LCTA 2XPZA 3CK8A 3C72A 4PUCA 2IU1A 3W9GA 2WXJA 2NYJA 5JJTA 4EBAG 1MZCA 4UI9K 1UJKA 3PZ3A 3CSTA 5JMND 2DYRE 5G04C 4BERA 1ZBPA 2Y0BG 4XI0A 3TWSA 3FUNA 3MV2B 2FEZA 5JA4D 3LY7A 1HF8A 3K9IA 3FTWA 3CVUA 2VSYA 1OWLA 3HYMB 4A3TA 2XEHA 3TWWA 3NQPA 4GZCA 4B94A 1D8EA 5IY5E 4UWLA 3HDXA 2IEJA 2A4ZA 3BEEA 3PS6A 2LAHA 1K1BA 4D10C 1UW4B 3BG1B 2FULA 3TWTA 2RD0A 3CHQA 3PZ1A 1OCRE 2XZTG 3WG7E 5C1DA 2F37A 4AV7A 3ZXPA 2GRLA 3FU0A 2AVPA 5EN5D 2WXQA 2LAIA 3RAUA 1WY6A 3FUIA 3G2VA 4FHKA 4L2YA 3Q9UC 3D9JA 3FTUA 3RO3A 4AY5A 3ABKE 1IQUA 3SZ7A 5G04J 3L16A 5ENNA 3SFZA 3Q5MA 1TNUA 2GGFA 3IKOB 2WQ7A 1H2UA 1O1TA 2IO3C 3TWUA 3QWVA 5EIBE 3Q4AB 2A5EA 2L6BA 3ZYLA 2KATA 3DSTA 1YCSB 2VSOE 4CYMD 4J8YA 2XRZA 4GTQA 4RG6A 4HOQA
chains in the Genus database with same CATH topology
4IULA 2IONA 1DVPA 3URZA 4HVBA 1NA0A 3CK7A 2NXPA 3D9NA 4UI9J 4G24A 4JA9A 2VTBA 4F7AA 3MKQA 3JCKC 4U0SA 3ASDA 4LEUA 2X3MA 4BTAA 4P29A 2IFUA 4I1OB 3AU4A 2AW6A 3R7RA 4EECA 3AS8A 2A5UA 3D9KA 1WAO1 3PVLA 4CEMA 3KD7A 4ACKA 4ATGA 3FTSA 4I2WA 4KYOB 3UUXA 3LVQE 3CHSA 4B89A 4FULA 1EPUA 3CGHA 5KCMA 1U3CA 3FH8A 4OVUA 5G2NA 3LY8A 1HG5A 3CKCA 3TJPA 3ESLA 2WXOA 5EX0A 1HS6A 4PS7A 1EDUA 4BY6A 4I6EA 4MRUA 2C0LA 4CGWA 4BT8A 2J49A 1IYGA 1TJFA 3ZW3A 1Z3YA 3T8MA 1UN8A 1H0AA 3EIQC 4A1SA 4IN3B 3PZDA 4UI9C 5FQ6A 1U3DA 2VSNA 2VGYA 5AYWD 4UWGA 4CT0A 4F3VA 2HR2A 5ARGA 4GYOA 2WQ6A 3HVEB 5CCLA 4KT6B 2DBAA 3LDZA 4EZJA 5HQ8A 3Q47B 5A7DB 2VGXB 1E8YA 3KS2A 1E7UA 5KJLA 3EHMA 2BTDA 4LUNU 3S7FA 3MKRA 4B8CB 5LOZA 5T8IA 3FWVA 3I4GA 5J90A 2IOLA 5FQ4A 1TJCA 4G1TA 3PEVB 3FH7A 3FULA 4GMJA 2L0IA 4U0UA 4GPKA 2CHWA 5D0QD 2LO6A 3L54A 3EDTB 5HI7A 4QFVA 3ZPJA 4K03A 1EF1C 4LRZA 2X38A 3FTVA 4DJAA 3SGHA 1VDYA 3T5VA 2X6FA 3S7DA 1E8ZA 5T4YA 2J08A 2E2EA 3P2BA 3GZSA 1NP7A 2HO1A 2KCKA 3FUEA 3TXNA 2XHEA 4W9RA 3CVVA 4NURA 3CSFA 3PNLB 3D3MA 3ZHEB 3UQ3A 5LP0A 1EYHA 3FEYA 3CQCB 4HOTA 1SZ9A 1E90A 1JWGA 1HE8A 3CHRA 3HVEA 4JXTA 5E76A 3OXGA 5E75A 2LSVA 4EPZA 2YHEA 3PREA 1E96B 3QWPA 2WQHA 2VGXA 3QDNA 4KZ0A 2WMOA 2XEVA 3L17A 4BX9A 4AIFA 4BFRA 4N3BA 3U66A 3B13A 2XPIA 4XKBA 1E8WA 1OUVA 4K0RA 3TAXA 4UWHA 5KJKA 5BPPA 3D9OA 3QAQA 3PDNA 2AXVA 1HU3A 3D9LA 3EHNA 3GZ2A 3NF1A 5CMYA 1IHGA 2RG8A 3ASGA 3G2SA 4FLHA 4GCNA 5EKQD 5EX3A 3ZYMA 3ZVVA 4XKCA 4BX8A 4CGVA 4DPRA 1INZA 1ZU2A 3FUMA 5BV0A 3LCAA 1UN9A 4C9BB 4GA2A 3RRMB 1SZAA 4J8DA 5G55A 5JHBA 2WVIA 3R7QA 3RO2A 4JA7A 4CT4A 4U0ZA 5ANLA 4L2LA 2ILRA 3P1UA 1H19A 2EQXA 3ZHEA 3NZUA 2CHZA 4URKA 3MJWA 2LSUA 2XCCA 4L7TA 4AEZC 1OWMA 4DI4A 3L22A 2KZTB 4PDXA 2DCPA 2PM6A 3MCXA 5D0OD 4HFGA 4AVXA 1HX8A 3APFA 1FVFA 4JW1A 3R9AB 3VLEA 3ESKA 4WWNA 4ILGA 4XZ4A 3TG5A 3KEZA 2JEKA 4BTBA 2PZIA 4EZKA 3FU3A 3RJVA 2YNQA 2YINA 3L13A 3LVRE 2KCLA 2V5FA 4GAAA 4KVMA 4WNDA 1OWNA 2I6HA 2I1KA 3FUJA 3RRUA 3TXMA 1XNFA 1MQSA 1N54A 1E7VA 4GZ6A 4MS6A 3B7TA 3QK0A 3ZYKA 3QARA 5AIJA 3QOUA 2I9CA 3IV0A 1N52A 4FHJA 3CKBA 3RU0A 1PAQA 3FHEA 5AJLA 1Y6IA 2WM9A 2VQ2A 3MGBA 4N2SA 3MX3A 5FZSA 1UJJA 4AXHA 4DK5A 3ULQA 3TL5A 3MEKA 2WXGA 3ASHA 3PRZA 2AXUA 2L0TB 5BT1A 4TV3A 1GW6A 1OWOA 4XX5A 4ME2A 3TG4A 3GW4A 2R59A 3Q15A 3QJZA 4JEHA 4EBAA 3UMVA 2KZTA 3UT8A 2UY1B 5M72A 2Q7FA 4FP7A 5JJ7A 2UWJG 3L6AA 4Y6CA 1KT0A 3DBSA 2Y4UA 2OVFA 2AXZA 3FUKA 4DI3A 3PUKA 3QNKA 5JHAA 1H2VC 2CHXA 2J4DA 2WXFA 3FU5A 3RIBA 3WXXA 1QZ2A 3HHMA 5ARFA 2FBNA 4WNGA 4APOA 4YNDA 4EZLA 5BNWA 1TEZA 2J4BA 2GRMA 2QY7A 3CR3A 3IEGA 4GYYA 4ACLA 4E85A 4AOFA 3G2TA 3SNXA 3FTZA 2CFZA 3OXLA 3QC1A 3CVLA 2OV8A 4WAFA 4A3VA 3ASFA 3VTXA 1ELWA 4I6GA 3ML9A 4ILIA 1XGWA 3C98A 2Y3AA 2IJGX 2XQ0A 2KCVA 2M63A 4AP2A 5FZQA 3BG0B 4GU5A 4JHJA 4I1AA 4WUYA 4AJWA 4KXKB 1HG2A 1W3BA 4U63A 4CRWA 2IF4A 4IRUA 1S0PA 3U64A 4ILHB 3T5XA 1OWPA 4ANWA 1X5BA 2R17C 4J8EA 3ONKA 3APCA 3LPZA 4Q69A 3ML8A 3UT4A 4JC8A 2OOEA 4OYSA 3OAWA 4B0ZA 4KMOA 3JQ1A 1ELKA 2UY1A 2C2LA 4G23A 5AENA 2MHKA 3ENEA 3PEUB 5CHEE 2FO7A 4CDRA 2WB2A 3IHYA 1WM5A 5FT9A 4JPSA 1LF8A 3FY4A 1HZ4A 4Q94A 4J6IA 4I2ZA 4DLOA 3TGOA 5J08A 3I4RB 5BW8C 2CG3A 4NRHB 2NSZA 3PNTB 2OVBA 4H7XA 4JL0A 3G2UA 4GYWA 1PC2A 1Y8MA 3PE4A 2X6IA 2WXLA 3ZYQA 3ONLA 4PS3A 3E4BA 2FF4A 3JUIA 3FUFA 4NQ0A 4PS8A 4XE0A 4FA6A 3VLDA 4FC8A 4TUUA 4GA0A 4GMLA 4BWRA 3RKVA 1B89A 3APDA 4HOSA 2ONDA 1JUQA 1QNFA 4UQZA 3SD5A 1QQEA 2YHCA 4G2VA 5DIZA 3UX4A 3CV0A 4G26A 3LS8A 3SF4A 1KLXA 2PQNA 3FP3A 4L23A 4I1MA 2V0PA 5T3RA 3G2WA 5LFAA 3CVXA 2PM7A 1E8XA 3CHPA 4HOUA 2XGOA 1FCHA 2BUGA 3SBTB 3OTNA 3CK9A 3SI5A 3CIAA 4JZYA 4KVOA 4CDNA 3MKQB 2J09A 4V3IA 4J8SA 3CVNA 2QFCA 4HLEA 2V4LA 3B7RL 1H2TC 5ANRA 4M3OA 1MHQA 1HFAA 3FTXA 4LERA 4H7YA 4FU3A 4E6HA 4JEUA 4ANXA 5KJMA 1Z6TA 3AS4A 4I6JA 5A23A 1IQRA 4Y6WA 3GYZA 4B8AA 3ZN3A 3VLFA 2J9QA 4F53A 1NA3A 2JLBA 2L6JA 2PL2A 3CHMA 3LEWA 4XI9A 3CVYA 3U4TA 3CQGB 1SQMA 5JJ6A 4AM9A 3QKYA 3ZXSA 3HIZA 3AU5A 4GZDA 4NACA 4BSXA 3FEXA 5C2YA 2WXPA 4LCTA 2XPZA 3CK8A 4WNEA 4AY6A 4RVBA 4PUCA 4UWFA 2IU1A 4YVOA 4L1BA 3EIJA 2WXJA 3OXFA 4C0MA 5JJTA 4EBAG 4UI9K 4KBQA 1UJKA 3CLJA 3KAEA 3ZRHA 1HH8A 2WXNA 3CSTA 4GA1A 5FWQA 4JHRA 5G04C 5LCWC 1UG3A 1ZBPA 2CG2A 5G05C 4CCAA 5A6CA 4XI0A 1JWFA 2WXRA 1YA0A 3FUNA 4UQYA 4XIFA 3MV2B 3MA5A 4MLPA 4CDMA 3D9IA 4N39A 2FEZA 3CHOA 2VYIA 4C0EA 2LNIA 3LY7A 3SBSA 4FADA 2NC9A 4KZCA 1HF8A 2IQCA 3FUDA 3MZLB 2V8SE 3K9IA 5DBKA 5FTPA 2I1JA 3FTWA 3CVUA 2Y4TA 4TRQA 2VSYA 4U07A 1OWLA 1PY1A 2WXIA 3HYMB 4WNFA 4I43A 3ZFWA 3CEQA 4A3TA 2WXHA 4I9CA 4F1SA 3FUHA 3VTYA 3NQPA 4GZCA 4B94A 3CVWA 4IYPA 4N2QA 3FDHA 4N3AA 5EDSA 1P5QA 2XPYA 4ABNA 3MV3B 4UWLA 3QWWA 4I17A 3RRNB 2PQRA 2HM8A 3HDXA 3QB2A 3LJ3A 2A4ZA 4FJYA 3S7BA 3BEEA 5CMWA 2CFUA 2X6JA 1L5JA 3PS6A 4GCOA 2LAHA 3O4ZA 3PH0C 2FI7A 3I3NA 4GB9A 3LYAA 3CVQA 4D10C 3N71A 3S2AA 1UW4B 4J0UA 2I2OA 2WMNA 4RG9A 3RK6A 2E0IA 2ZU6B 3B7SA 3JYSA 5BV1A 3BG1B 4UQXA 3S7JA 2FULA 4A1GA 2KM4A 1BPOA 2RD0A 3CHQA 3B7UX 3PUJA 2KC7A 1DNPA 4N5CA 4HS2A 3PE3A 5FQ7A 2DIWA 4HORA 5C1DA 4N3CA 2L9BA 4AV7A 4A55A 4HXIA 2GRLA 2R5SA 3SHFA 3FU0A 2AVPA 3JQ0A 3O48A 3I5PA 5KJNA 3L08A 5LX8A 1NZNA 4FJZA 2WXQA 3LY9A 4MKTA 4BT9A 3FU6A 2LAIA 4FLBA 2YQ8A 3U3WA 1WY6A 2XGMA 3FUIA 3G2VA 2X6KA 4FHKA 4J8FA 4L2YA 4U04A 3LKUA 1A17A 4YVQC 2J07A 3CVPA 3D9JA 4JVSA 3Q49B 2MRIA 3FTUA 2BF0X 4O6FA 3UT7A 2X6HA 2WPVA 3RO3A 4AY5A 2GW1A 1H6KA 4RSYA 5FQ8A 2WXMA 1KT1A 3FFLA 3NZSA 2VTBB 1IQUA 5BUZA 4ANVA 3AS5A 2C0MA 5G04J 3SZ7A 5LCWJ 4U8HA 2AWIA 1ELRA 3L16A 5ENNA 5G05J 3U9WA 3EJNA 4WWPA 3ZEFA 3IHVA 3SFZA 3FH5A 3Q5MA 3UPVA 4Q96A 2GGFA 1HO8A 3GZ1A 3IKOB 4I9EA 4UWKA 2WQ7A 4G25A 4GZ5A 1H2UA 1FVHA 3ZGQA 2P58C 4GZ3A 2XRYA 3QWVA 4JHKA 4G11A 3Q4AB 5CCMA 5FJYA 3ZYLA 2IOSA 3FTYA 2WXKA 3MYVA 2XCBA 4PH4B 4OVVA 4ANUA 4APFA 4DLQA 1JPLA 4WWOA 2MOWA 3DPDA 2KATA 5AJDA 1HXIA 2VSOE 3IBEA 3LXUX 2VJ8A 2HYZA 2VSXE 2XRZA 4EQFA 1Z3XA 2XGSA 4RG6A 3D9MA 4HOQA 3ZIMA 5FZRA 3D9PA 4R7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D10 C;  3TXN A;  3TXM A;  3T5X A;  2MRI A;  3CHM A;  4LCT A;  3JCK C; 
#chains in the Genus database with same CATH topology
 4IUL A;  1DVP A;  3URZ A;  3ASD A;  2X3M A;  4I1O B;  3AU4 A;  3PVL A;  5EYL A;  3KD7 A;  4ACK A;  2LXM A;  2R03 A;  3CGH A;  4OVU A;  3LY8 A;  1SVX A;  3CKC A;  1N4Q A;  4I6E A;  2C0L A;  4CGW A;  4BT8 A;  2J49 A;  2P9N G;  3ZW3 A;  1Z3Y A;  4A1S A;  4UI9 C;  4CT0 A;  5FQ6 A;  4F3V A;  2VGY A;  4UWG A;  1N4S A;  4HRM B;  2EIK E;  3E32 A;  3LDZ A;  3ASO E;  3HRA A;  2VGX B;  4HNA D;  5KJL A;  3EHM A;  3S7F A;  5EYP F;  5LOZ A;  3FWV A;  3PEV B;  3FH7 A;  4GMJ A;  1FPP A;  2CHW A;  2LO6 A;  4HLL A;  2P9L G;  3EDT B;  4K03 A;  4BEP A;  3FTV A;  2X6F A;  5T4Y A;  1TNZ A;  2XZD G;  4NUR A;  1WG0 A;  5HKP A;  4HOT A;  1E90 A;  4JXT A;  1HE8 A;  5KJK A;  1FT1 A;  2YHE A;  2JAB A;  2WQH A;  2VGX A;  3QDN A;  3Q79 A;  4EHM A;  2XEV A;  4BX9 A;  2ETA A;  3U66 A;  4JB8 P;  1OUV A;  3NAW A;  3PDN A;  5AQA A;  2B0O E;  1HU3 A;  3GZ2 A;  1IHG A;  4GTS A;  3EHR A;  5EX3 A;  1INZ A;  3FUM A;  3V30 A;  1SZA A;  4J8D A;  5G55 A;  1TNO A;  2IY0 C;  4JA7 A;  4U0Z A;  4L2L A;  3P1U A;  1H19 A;  4G8L A;  2LSU A;  4AEZ C;  3X2Q E;  4PDX A;  5KNH D;  3UIO C;  1TNY A;  3VLE A;  4Z68 A;  4WWN A;  4X8Q A;  4XZ4 A;  3TG5 A;  3C3R A;  3KEZ A;  4BTB A;  2YIN A;  3RRU A;  1OWN A;  2I6H A;  2I1K A;  3BU8 A;  3FUJ A;  4O1P A;  1XNF A;  1MQS A;  1N54 A;  3QOU A;  3CKB A;  3RU0 A;  1Y6I A;  2VQ2 A;  3MX3 A;  5FZS A;  1UJJ A;  3ASH A;  2AXU A;  2L0T B;  2P9U G;  2P2C P;  1GW6 A;  2OEV A;  3GW4 A;  2R59 A;  4EBA A;  3UT8 A;  2UY1 B;  4FP7 A;  5JJ7 A;  1TN6 A;  1KT0 A;  3FUK A;  3IXE A;  3QNK A;  1AP7 A;  1V54 E;  2CHX A;  2J4D A;  2WXF A;  3FU5 A;  3RIB A;  2HE0 A;  1QZ2 A;  5ARF A;  4ACL A;  2QY7 A;  5CER B;  3G2T A;  3OXL A;  3CVL A;  3VTX A;  4TXR A;  1XGW A;  5ENS D;  2KCV A;  3W9F A;  2DZN A;  3BG0 B;  3E34 A;  2GRR B;  4CRW A;  2IF4 A;  4IRU A;  1X5B A;  3Q9N C;  3ONK A;  3LPZ A;  4Q69 A;  3ML8 A;  3UM3 A;  1ELK A;  2UY1 A;  2C2L A;  2MHK A;  3PEU B;  5FT9 A;  4JPS A;  4Q94 A;  4GTR A;  3I4R B;  4H7X A;  3UI2 A;  1Y8M A;  4GMR A;  2P9K G;  2WXL A;  4PS3 A;  3E4B A;  2FF4 A;  3SY2 A;  3JUI A;  4PS8 A;  4XE0 A;  3VLD A;  4TUU A;  3RKV A;  1B89 A;  1QNF A;  2PNN A;  2ZIR A;  5DIZ A;  4HBD A;  4TXQ A;  3CV0 A;  3SF4 A;  3FP3 A;  2RKK A;  2VGE A;  2XGO A;  4DX7 D;  3Q73 A;  2QZA A;  3MKQ B;  3CVN A;  5ANR A;  3FTX A;  4J7W A;  4FU3 A;  4E6H A;  1U2V G;  3VLF A;  2JLB A;  3LEW A;  4XI9 A;  3Q7A A;  1SQM A;  3ZXS A;  4NAC A;  2WXP A;  3AAA C;  4UWF A;  4L1B A;  1N4P A;  2XEN A;  4ATZ D;  1N94 A;  2R2L A;  3CLJ A;  1O1R A;  5G05 C;  1JWF A;  1JCR A;  3J5Q B;  4MLP A;  4CDM A;  4N39 A;  2BKK B;  3C3Q A;  1K3Z D;  2NC9 A;  4KZC A;  2Y69 E;  3FUD A;  2V8S E;  5AQ7 A;  4U07 A;  1TN7 A;  3ZFW A;  3SO8 A;  4F1S A;  3FUH A;  4YDY A;  4IYP A;  1S70 B;  2F8X K;  5CRV A;  5EDS A;  4ABN A;  3MV3 B;  2PQR A;  4HB5 A;  4FJY A;  2CFU A;  3O4Z A;  3PH0 C;  2FI7 A;  4GB9 A;  3S2A A;  4J0U A;  3RK6 A;  2E0I A;  2ZU6 B;  5D2M C;  4UQX A;  3S7J A;  2GRN B;  3B7U X;  1DNP A;  4HS2 A;  2DIW A;  2L9B A;  4A55 A;  4UUC A;  5ENT D;  2IO2 C;  5KJN A;  3L08 A;  5LX8 A;  3EHQ A;  4BSZ B;  3LY9 A;  3FU6 A;  3C5R A;  3U3W A;  2XGM A;  3RSE G;  1YYH A;  2J07 A;  5AQ9 A;  4A63 B;  1H6K A;  3J5P A;  5FQ8 A;  2EIN E;  1KT1 A;  3FFL A;  3L9T A;  3NOC D;  3AS5 A;  4ANV A;  2AWI A;  1ELR A;  5G05 J;  3U9W A;  3ZEF A;  3FH5 A;  1HO8 A;  4YDO A;  4F1P A;  1Q2Z A;  4UWK A;  4GZ5 A;  2P58 C;  2XRY A;  4G11 A;  1N9A A;  5FJY A;  2IOS A;  4U8Y D;  3FTY A;  4DLQ A;  2XCB A;  2MOW A;  3DPD A;  3Q75 A;  3IBE A;  2VJ8 A;  2HYZ A;  2R02 A;  3Q78 A;  3ZIM A;  5FZR A;  3D9P A;  4R7L A;  1NA0 A;  3CK7 A;  4G24 A;  2P9P G;  4JA9 A;  3L82 A;  3ULE G;  3JCK C;  2AW6 A;  3AS8 A;  5ENR D;  3FTS A;  4F6R D;  3CHS A;  5KCM A;  3FH8 A;  5G2N A;  3ABM E;  1HS6 A;  4U8V D;  4PS7 A;  4LG6 A;  1IYG A;  4GTP A;  4C48 B;  1TJF A;  2ETC A;  3TWV A;  1UN8 A;  1H0A A;  5ARG A;  4KT6 B;  2DBA A;  5HQ8 A;  3Q47 B;  3KS2 A;  1E7U A;  3ISM C;  4DX6 D;  1G3N B;  5J90 A;  4GTT A;  3L54 A;  5HI7 A;  4QFV A;  3ZPJ A;  5BXO A;  3P2B A;  2HO1 A;  3TXN A;  1NFI E;  4HRL A;  3CVV A;  3D3M A;  3UQ3 A;  2LUH A;  1EYH A;  3CQC B;  1SZ9 A;  5AAO A;  5E76 A;  4EPZ A;  4MBG A;  5E75 A;  3PRE A;  1E96 B;  3QWP A;  2H6G A;  4KZ0 A;  4N3B A;  4LNB A;  3B13 A;  3TAX A;  3DPY A;  4UWH A;  3D9O A;  1BI7 B;  5CMY A;  2RG8 A;  5EKQ D;  4FLH A;  4XKC A;  4DPR A;  4C9B B;  5CED B;  2WVI A;  3C3O A;  5ANL A;  4K5C A;  2ILR A;  1MYO A;  2EQX A;  4URK A;  3MJW A;  3UKR G;  3L22 A;  2DCP A;  3MCX A;  2LXL A;  1HX8 A;  3APF A;  3ESK A;  3E30 A;  4RQI A;  4EZK A;  4B89 A;  3L13 A;  5AQB A;  2FO1 E;  2V5F A;  4GAA A;  1E7V A;  4GZ6 A;  4B93 B;  5AIJ A;  2I9C A;  1N52 A;  4JD2 G;  3UTM A;  2WM9 A;  4DK5 A;  4AXH A;  3HXC A;  3MEK A;  5BT1 A;  4TV3 A;  4ME2 A;  1LTX A;  3Q15 A;  4JEH A;  2DWZ A;  2UWJ G;  3L6A A;  3DBS A;  5JHA A;  2KBX A;  2ZXW E;  4APO A;  4WNG A;  5BNW A;  1TEZ A;  3E37 A;  2J4B A;  4AOF A;  3PZ2 A;  4NIK A;  3QC1 A;  4WAF A;  3UIP C;  1ELW A;  4ILI A;  4GTM A;  2IJG X;  4G8K A;  4JHJ A;  4WUY A;  4AJW A;  1W3B A;  1S0P A;  4ILH B;  3APC A;  4JC8 A;  4B0Z A;  4KMO A;  3NOG D;  2RFA A;  3TWR A;  2MYO A;  2WB2 A;  3IHY A;  3FY4 A;  1AWC B;  1HZ4 A;  4DLO A;  3R9M A;  3TGO A;  4NRH B;  2NSZ A;  2OVB A;  3G2U A;  2XEE A;  4U95 D;  3PE4 A;  2BKG A;  4NQ0 A;  4FA6 A;  4BWR A;  4HOS A;  2OND A;  4DX2 A;  1QQE A;  3UX4 A;  1N0Q A;  3TWQ A;  3LS8 A;  2PQN A;  5LFA A;  3CVX A;  1YMP A;  1FCH A;  3KSQ A;  3CIA A;  4TUM A;  4CDN A;  4V3I A;  2OEW A;  4HLE A;  2V4L A;  1H2T C;  4M3O A;  5KJM A;  4I6J A;  5A23 A;  5FIO A;  4Y6W A;  3GYZ A;  2J9Q A;  2L6J A;  4HI9 A;  3HIZ A;  4GZD A;  3SFX A;  1BLX B;  4RVB A;  4DUI A;  4YVO A;  3EIJ A;  5EID A;  3BUA A;  5AN8 A;  3KAE A;  3ZRH A;  1HH8 A;  4GA1 A;  4JHR A;  5LCW C;  1UG3 A;  2CG2 A;  4CCA A;  1SA4 A;  4ZHB A;  2WXR A;  4XIF A;  3MA5 A;  5EIL A;  3D9I A;  3CHO A;  2VYI A;  2LNI A;  3SBS A;  4FAD A;  3V2O A;  3MZL B;  2I1J A;  2RFM A;  4TRQ A;  4XEI G;  2BED A;  4WNF A;  5B3S E;  2WXH A;  3VTY A;  4N2Q A;  3FDH A;  4N3A A;  1P5Q A;  2HM8 A;  3QB2 A;  3LJ3 A;  3DXM G;  5CMW A;  2X6J A;  4RLY A;  1SA5 A;  1L5J A;  4GCO A;  3I3N A;  3LYA A;  3CVQ A;  2WMN A;  1H6P A;  3AG1 E;  3B7S A;  1OY3 D;  5BV1 A;  2KM4 A;  1BPO A;  2KC7 A;  2QC9 A;  4N5C A;  5FQ7 A;  4HOR A;  1V55 E;  4HXI A;  3HXE A;  3SHF A;  3JQ0 A;  3I5P A;  1NZN A;  4FJZ A;  4BT9 A;  4FLB A;  4U04 A;  4J8F A;  1O1S A;  1A17 A;  4YVQ C;  3Q49 B;  2MRI A;  2BF0 X;  4O6F A;  3UT7 A;  2WPV A;  1MX4 A;  2GW1 A;  4RSY A;  2VTB B;  5BUZ A;  5LCW J;  3AG4 E;  3EJN A;  3IHV A;  3UPV A;  3GZ1 A;  1MX6 A;  4I9E A;  4G25 A;  3ZGQ A;  1FVH A;  4GZ3 A;  3ASN E;  5KWD A;  2OCC E;  4K5B A;  1HXI A;  3LXU X;  1Z3X A;  3ZNG A;  3D9M A;  1UOH A;  2ION A;  2NXP A;  3D9N A;  2VTB A;  5HS0 A;  4F7A A;  3MKQ A;  4U0S A;  4CZ2 D;  4BTA A;  4LEU A;  1N95 A;  4P29 A;  2IFU A;  3R7R A;  2A5U A;  1WAO 1;  4I2W A;  3LVQ E;  4FUL A;  1EPU A;  1U3C A;  3ESL A;  2WXO A;  1MJ0 A;  5EX0 A;  2R05 A;  4BY6 A;  1BI8 B;  3T8M A;  4DX5 D;  4M7C A;  1JCQ A;  4IN3 B;  5AYW D;  4QQI A;  1U3D A;  2VSN A;  2HR2 A;  2WQ6 A;  5CCL A;  1KZP A;  4EZJ A;  3SQV A;  4B8C B;  3JXJ A;  3MKR A;  3I4G A;  5FQ4 A;  3FUL A;  3UIN C;  2L0I A;  4U0U A;  5D0Q D;  2AJA A;  1IHB A;  1EF1 C;  4LRZ A;  1BD8 A;  3ABL E;  3T5V A;  3DSX A;  2E2E A;  1NP7 A;  1OCZ E;  2KCK A;  4W9R A;  3CSF A;  3PNL B;  3ZHE B;  4OAU C;  5LP0 A;  1N0R A;  1JWG A;  5CEA A;  3KEA A;  3L17 A;  4AIF A;  3HXB A;  5H7P A;  2XPI A;  5FIN A;  4K0R A;  5D66 A;  5BPP A;  5BXU A;  3D9L A;  3EHN A;  3ZVV A;  1QYM A;  3ASG A;  4GCN A;  4DI4 A;  4BX8 A;  1TR4 A;  1MX2 A;  3LCA A;  1DC2 A;  4GA2 A;  3R7Q A;  3RO2 A;  4CT4 A;  3UM1 A;  1D9S A;  1X81 A;  3ZHE A;  4L7T A;  1OWM A;  2PM6 A;  4HFG A;  1FVF A;  4JW1 A;  4O60 A;  5ENP D;  4ILG A;  3TWX A;  5CRU A;  3T8K A;  2JEK A;  2PZI A;  1NI1 A;  4KVM A;  3LVR E;  4BES A;  2EIM E;  2DYS E;  3B7T A;  3ZYK A;  4FHJ A;  3FHE A;  3MGB A;  2P9I G;  3TL5 A;  2WXG A;  3PRZ A;  5HRY A;  4ZFH A;  3UMV A;  2Q7F A;  2H6H A;  3DEP A;  4BET A;  2OVF A;  4DI3 A;  2XS8 A;  1H2V C;  2ZIS A;  3WXX A;  5B1B E;  3B95 A;  3Q7F A;  3HHM A;  2FBN A;  4YND A;  2V4H C;  5ENO D;  1K8K G;  3FTZ A;  1JCS A;  3PZ4 A;  5KBA A;  2OV8 A;  4A3V A;  1WDY A;  4I6G A;  3UM0 A;  1BU9 A;  2GRQ B;  2Y3A A;  2ETB A;  1LD8 A;  1HG2 A;  1S63 A;  4U63 A;  4LSZ E;  4ANW A;  2R17 C;  3UT4 A;  4OYS A;  2OOE A;  3DEO A;  3OAW A;  3JQ1 A;  5AEN A;  4G23 A;  3ENE A;  3V2X A;  5CHE E;  4CDR A;  2DVW A;  1WM5 A;  1FT2 A;  3JUE A;  3AJI A;  3T9K A;  5J08 A;  3KSL A;  1PC2 A;  2X6I A;  3NB2 A;  3ZYQ A;  3ZUV B;  3APD A;  1JUQ A;  4UQZ A;  3SD5 A;  5ENQ D;  1TYQ G;  4G26 A;  1KLX A;  2V0P A;  5T3R A;  2PM7 A;  1E8X A;  3CHP A;  4HOU A;  3SI5 A;  4KVO A;  4JZY A;  3ZU7 B;  2QFC A;  3B7R L;  1MHQ A;  4LER A;  4H7Y A;  4ANX A;  1Z6T A;  4B8A A;  4F53 A;  3CHM A;  3CVY A;  3CQG B;  3QKY A;  4TXP A;  3D9H A;  3AU5 A;  3FEX A;  2EIJ E;  4U96 D;  4GPM A;  4AY6 A;  1S64 A;  3OXF A;  4C0M A;  4KBQ A;  3DWL G;  2WXN A;  3NBN B;  4LNU D;  1N11 A;  5FWQ A;  3JXI A;  4YDW A;  2EIL E;  5A6C A;  1KZO A;  4UQY A;  1YA0 A;  4YDE A;  3ZKJ A;  4DX1 A;  4C0E A;  3HG0 D;  2IQC A;  5FTP A;  5DBK A;  1Z5S C;  2Y4T A;  1PY1 A;  2WXI A;  4I43 A;  4L9P A;  3CEQ A;  3HXF A;  4I9C A;  1O5M A;  5CBN A;  3CVW A;  2J8S D;  1OCC E;  2XPY A;  3QWW A;  4I17 A;  3RRN B;  3S7B A;  3N71 A;  4RG9 A;  2I2O A;  3JYS A;  4A1G A;  2P9S G;  1TNB A;  3PUJ A;  3PE3 A;  4GTO A;  4N3C A;  1A5E A;  2R5S A;  3V79 K;  3LJN A;  3O48 A;  4K5A B;  4MKT A;  2YQ8 A;  4O1O A;  2X6K A;  3LKU A;  3CVP A;  5B1A E;  4JVS A;  3EU9 A;  2X6H A;  2F0Y A;  2WXM A;  3NZS A;  5ITZ F;  2C0M A;  4U8H A;  4WWP A;  4Q96 A;  2QYU A;  3DXK G;  3B7B A;  4DRX E;  4JHK A;  3V31 A;  5CCM A;  2WXK A;  3MYV A;  4PH4 B;  3DSU A;  4OVV A;  4APF A;  4ANU A;  1JPL A;  4WWO A;  5AJD A;  2VSX E;  4EQF A;  2XGS A;  4HVB A;  1K1A A;  4UI9 J;  3HXD A;  4GTV A;  5CBO A;  4EEC A;  1DCQ A;  3D9K A;  3DSW A;  4CEM A;  1D8D A;  4ATG A;  4KYO B;  3UUX A;  3ULY A;  1HG5 A;  3TJP A;  1EDU A;  4MRU A;  2H6F A;  1OXJ A;  3DSS A;  4HRN A;  1SW6 A;  3DRA A;  3EIQ C;  3PZD A;  1NL4 A;  4GYO A;  3HVE B;  5A7D B;  1E8Y A;  2BTD A;  4LUN U;  5T8I A;  3UM2 A;  2IOL A;  3BQO A;  1TJC A;  4G1T A;  3EU5 A;  4GPK A;  5CEC B;  2X38 A;  4DJA A;  3SGH A;  1VDY A;  3AG3 E;  3S7D A;  1E8Z A;  2J08 A;  3GZS A;  3FUE A;  2XHE A;  3FEY A;  2KXP C;  3CHR A;  3HVE A;  1OCO E;  3OXG A;  2LSV A;  3E33 A;  2WMO A;  2Y1L E;  4BFR A;  1TN8 A;  4XKB A;  1E8W A;  2ZGD A;  3QAQ A;  2AXV A;  1OT8 A;  3NF1 A;  3G2S A;  3ZYM A;  2B6C A;  1H6O A;  4CGV A;  1ZU2 A;  5BV0 A;  3DSV A;  1UN9 A;  3RRM B;  1RW2 A;  3EUV A;  5JHB A;  1IKN D;  1KPS B;  3UKU G;  3NZU A;  2CHZ A;  2XCC A;  2KZT B;  4OAV B;  5D0O D;  1ZB1 A;  4AVX A;  2GRO B;  3R9A B;  1QBQ A;  4U7E B;  3FU3 A;  3RJV A;  2YNQ A;  2KCL A;  4WND A;  3TXM A;  1DCE A;  4MS6 A;  4N5Q A;  3QK0 A;  4HI8 A;  3QAR A;  3IV0 A;  1PAQ A;  5AJL A;  4LNG A;  4N2S A;  3ULQ A;  1RZ4 A;  1OWO A;  4XX5 A;  3TG4 A;  3QJZ A;  2H6I A;  5M72 A;  2KZT A;  4Y6C A;  1N4R A;  2Y4U A;  2AXZ A;  2GRP B;  3PUK A;  4EZL A;  2GRM A;  3CR3 A;  3IEG A;  4GYY A;  4E85 A;  5KNG A;  3SNX A;  2CFZ A;  3ASF A;  3ML9 A;  3C98 A;  2XQ0 A;  2M63 A;  4AP2 A;  5FZQ A;  4GU5 A;  4I1A A;  4KXK B;  3U64 A;  3T5X A;  1OWP A;  4J8E A;  3F6Q A;  3AG2 E;  2FO7 A;  2DZO A;  1LF8 A;  3SFY A;  4J6I A;  4I2Z A;  2ZGG A;  3UXG A;  5BW8 C;  2CG3 A;  3PNT B;  4JL0 A;  4GYW A;  1IXV A;  3ONL A;  1LD7 A;  3FUF A;  4HQD A;  4FC8 A;  4GA0 A;  4GML A;  2V5Q C;  2YHC A;  4G2V A;  2XS1 A;  5AAR A;  4L23 A;  4I1M A;  3G2W A;  2BUG A;  3SBT B;  2F8Y A;  3OTN A;  3CK9 A;  2J09 A;  4J8S A;  1HFA A;  2QYJ A;  4JEU A;  3AS4 A;  1IQR A;  3ZN3 A;  1NA3 A;  2PL2 A;  3U4T A;  4AM9 A;  5JJ6 A;  4BSX A;  5C2Y A;  4WNE A;  4LCT A;  2XPZ A;  3CK8 A;  3C72 A;  4PUC A;  2IU1 A;  3W9G A;  2WXJ A;  2NYJ A;  5JJT A;  4EBA G;  1MZC A;  4UI9 K;  1UJK A;  3PZ3 A;  3CST A;  5JMN D;  2DYR E;  5G04 C;  4BER A;  1ZBP A;  2Y0B G;  4XI0 A;  3TWS A;  3FUN A;  3MV2 B;  2FEZ A;  5JA4 D;  3LY7 A;  1HF8 A;  3K9I A;  3FTW A;  3CVU A;  2VSY A;  1OWL A;  3HYM B;  4A3T A;  2XEH A;  3TWW A;  3NQP A;  4GZC A;  4B94 A;  1D8E A;  5IY5 E;  4UWL A;  3HDX A;  2IEJ A;  2A4Z A;  3BEE A;  3PS6 A;  2LAH A;  1K1B A;  4D10 C;  1UW4 B;  3BG1 B;  2FUL A;  3TWT A;  2RD0 A;  3CHQ A;  3PZ1 A;  1OCR E;  2XZT G;  3WG7 E;  5C1D A;  2F37 A;  4AV7 A;  3ZXP A;  2GRL A;  3FU0 A;  2AVP A;  5EN5 D;  2WXQ A;  2LAI A;  3RAU A;  1WY6 A;  3FUI A;  3G2V A;  4FHK A;  4L2Y A;  3Q9U C;  3D9J A;  3FTU A;  3RO3 A;  4AY5 A;  3ABK E;  1IQU A;  3SZ7 A;  5G04 J;  3L16 A;  5ENN A;  3SFZ A;  3Q5M A;  1TNU A;  2GGF A;  3IKO B;  2WQ7 A;  1H2U A;  1O1T A;  2IO3 C;  3TWU A;  3QWV A;  5EIB E;  3Q4A B;  2A5E A;  2L6B A;  3ZYL A;  2KAT A;  3DST A;  1YCS B;  2VSO E;  4CYM D;  4J8Y A;  2XRZ A;  4GTQ A;  4RG6 A;  4HOQ A; 
#chains in the Genus database with same CATH homology
 4IUL A;  2ION A;  1DVP A;  3URZ A;  4HVB A;  1NA0 A;  3CK7 A;  2NXP A;  3D9N A;  4UI9 J;  4G24 A;  4JA9 A;  2VTB A;  4F7A A;  3MKQ A;  3JCK C;  4U0S A;  3ASD A;  4LEU A;  2X3M A;  4BTA A;  4P29 A;  2IFU A;  4I1O B;  3AU4 A;  2AW6 A;  3R7R A;  4EEC A;  3AS8 A;  2A5U A;  3D9K A;  1WAO 1;  3PVL A;  4CEM A;  3KD7 A;  4ACK A;  4ATG A;  3FTS A;  4I2W A;  4KYO B;  3UUX A;  3LVQ E;  3CHS A;  4B89 A;  4FUL A;  1EPU A;  3CGH A;  5KCM A;  1U3C A;  3FH8 A;  4OVU A;  5G2N A;  3LY8 A;  1HG5 A;  3CKC A;  3TJP A;  3ESL A;  2WXO A;  5EX0 A;  1HS6 A;  4PS7 A;  1EDU A;  4BY6 A;  4I6E A;  4MRU A;  2C0L A;  4CGW A;  4BT8 A;  2J49 A;  1IYG A;  1TJF A;  3ZW3 A;  1Z3Y A;  3T8M A;  1UN8 A;  1H0A A;  3EIQ C;  4A1S A;  4IN3 B;  3PZD A;  4UI9 C;  5FQ6 A;  1U3D A;  2VSN A;  2VGY A;  5AYW D;  4UWG A;  4CT0 A;  4F3V A;  2HR2 A;  5ARG A;  4GYO A;  2WQ6 A;  3HVE B;  5CCL A;  4KT6 B;  2DBA A;  3LDZ A;  4EZJ A;  5HQ8 A;  3Q47 B;  5A7D B;  2VGX B;  1E8Y A;  3KS2 A;  1E7U A;  5KJL A;  3EHM A;  2BTD A;  4LUN U;  3S7F A;  3MKR A;  4B8C B;  5LOZ A;  5T8I A;  3FWV A;  3I4G A;  5J90 A;  2IOL A;  5FQ4 A;  1TJC A;  4G1T A;  3PEV B;  3FH7 A;  3FUL A;  4GMJ A;  2L0I A;  4U0U A;  4GPK A;  2CHW A;  5D0Q D;  2LO6 A;  3L54 A;  3EDT B;  5HI7 A;  4QFV A;  3ZPJ A;  4K03 A;  1EF1 C;  4LRZ A;  2X38 A;  3FTV A;  4DJA A;  3SGH A;  1VDY A;  3T5V A;  2X6F A;  3S7D A;  1E8Z A;  5T4Y A;  2J08 A;  2E2E A;  3P2B A;  3GZS A;  1NP7 A;  2HO1 A;  2KCK A;  3FUE A;  3TXN A;  2XHE A;  4W9R A;  3CVV A;  4NUR A;  3CSF A;  3PNL B;  3D3M A;  3ZHE B;  3UQ3 A;  5LP0 A;  1EYH A;  3FEY A;  3CQC B;  4HOT A;  1SZ9 A;  1E90 A;  1JWG A;  1HE8 A;  3CHR A;  3HVE A;  4JXT A;  5E76 A;  3OXG A;  5E75 A;  2LSV A;  4EPZ A;  2YHE A;  3PRE A;  1E96 B;  3QWP A;  2WQH A;  2VGX A;  3QDN A;  4KZ0 A;  2WMO A;  2XEV A;  3L17 A;  4BX9 A;  4AIF A;  4BFR A;  4N3B A;  3U66 A;  3B13 A;  2XPI A;  4XKB A;  1E8W A;  1OUV A;  4K0R A;  3TAX A;  4UWH A;  5KJK A;  5BPP A;  3D9O A;  3QAQ A;  3PDN A;  2AXV A;  1HU3 A;  3D9L A;  3EHN A;  3GZ2 A;  3NF1 A;  5CMY A;  1IHG A;  2RG8 A;  3ASG A;  3G2S A;  4FLH A;  4GCN A;  5EKQ D;  5EX3 A;  3ZYM A;  3ZVV A;  4XKC A;  4BX8 A;  4CGV A;  4DPR A;  1INZ A;  1ZU2 A;  3FUM A;  5BV0 A;  3LCA A;  1UN9 A;  4C9B B;  4GA2 A;  3RRM B;  1SZA A;  4J8D A;  5G55 A;  5JHB A;  2WVI A;  3R7Q A;  3RO2 A;  4JA7 A;  4CT4 A;  4U0Z A;  5ANL A;  4L2L A;  2ILR A;  3P1U A;  1H19 A;  2EQX A;  3ZHE A;  3NZU A;  2CHZ A;  4URK A;  3MJW A;  2LSU A;  2XCC A;  4L7T A;  4AEZ C;  1OWM A;  4DI4 A;  3L22 A;  2KZT B;  4PDX A;  2DCP A;  2PM6 A;  3MCX A;  5D0O D;  4HFG A;  4AVX A;  1HX8 A;  3APF A;  1FVF A;  4JW1 A;  3R9A B;  3VLE A;  3ESK A;  4WWN A;  4ILG A;  4XZ4 A;  3TG5 A;  3KEZ A;  2JEK A;  4BTB A;  2PZI A;  4EZK A;  3FU3 A;  3RJV A;  2YNQ A;  2YIN A;  3L13 A;  3LVR E;  2KCL A;  2V5F A;  4GAA A;  4KVM A;  4WND A;  1OWN A;  2I6H A;  2I1K A;  3FUJ A;  3RRU A;  3TXM A;  1XNF A;  1MQS A;  1N54 A;  1E7V A;  4GZ6 A;  4MS6 A;  3B7T A;  3QK0 A;  3ZYK A;  3QAR A;  5AIJ A;  3QOU A;  2I9C A;  3IV0 A;  1N52 A;  4FHJ A;  3CKB A;  3RU0 A;  1PAQ A;  3FHE A;  5AJL A;  1Y6I A;  2WM9 A;  2VQ2 A;  3MGB A;  4N2S A;  3MX3 A;  5FZS A;  1UJJ A;  4AXH A;  4DK5 A;  3ULQ A;  3TL5 A;  3MEK A;  2WXG A;  3ASH A;  3PRZ A;  2AXU A;  2L0T B;  5BT1 A;  4TV3 A;  1GW6 A;  1OWO A;  4XX5 A;  4ME2 A;  3TG4 A;  3GW4 A;  2R59 A;  3Q15 A;  3QJZ A;  4JEH A;  4EBA A;  3UMV A;  2KZT A;  3UT8 A;  2UY1 B;  5M72 A;  2Q7F A;  4FP7 A;  5JJ7 A;  2UWJ G;  3L6A A;  4Y6C A;  1KT0 A;  3DBS A;  2Y4U A;  2OVF A;  2AXZ A;  3FUK A;  4DI3 A;  3PUK A;  3QNK A;  5JHA A;  1H2V C;  2CHX A;  2J4D A;  2WXF A;  3FU5 A;  3RIB A;  3WXX A;  1QZ2 A;  3HHM A;  5ARF A;  2FBN A;  4WNG A;  4APO A;  4YND A;  4EZL A;  5BNW A;  1TEZ A;  2J4B A;  2GRM A;  2QY7 A;  3CR3 A;  3IEG A;  4GYY A;  4ACL A;  4E85 A;  4AOF A;  3G2T A;  3SNX A;  3FTZ A;  2CFZ A;  3OXL A;  3QC1 A;  3CVL A;  2OV8 A;  4WAF A;  4A3V A;  3ASF A;  3VTX A;  1ELW A;  4I6G A;  3ML9 A;  4ILI A;  1XGW A;  3C98 A;  2Y3A A;  2IJG X;  2XQ0 A;  2KCV A;  2M63 A;  4AP2 A;  5FZQ A;  3BG0 B;  4GU5 A;  4JHJ A;  4I1A A;  4WUY A;  4AJW A;  4KXK B;  1HG2 A;  1W3B A;  4U63 A;  4CRW A;  2IF4 A;  4IRU A;  1S0P A;  3U64 A;  4ILH B;  3T5X A;  1OWP A;  4ANW A;  1X5B A;  2R17 C;  4J8E A;  3ONK A;  3APC A;  3LPZ A;  4Q69 A;  3ML8 A;  3UT4 A;  4JC8 A;  2OOE A;  4OYS A;  3OAW A;  4B0Z A;  4KMO A;  3JQ1 A;  1ELK A;  2UY1 A;  2C2L A;  4G23 A;  5AEN A;  2MHK A;  3ENE A;  3PEU B;  5CHE E;  2FO7 A;  4CDR A;  2WB2 A;  3IHY A;  1WM5 A;  5FT9 A;  4JPS A;  1LF8 A;  3FY4 A;  1HZ4 A;  4Q94 A;  4J6I A;  4I2Z A;  4DLO A;  3TGO A;  5J08 A;  3I4R B;  5BW8 C;  2CG3 A;  4NRH B;  2NSZ A;  3PNT B;  2OVB A;  4H7X A;  4JL0 A;  3G2U A;  4GYW A;  1PC2 A;  1Y8M A;  3PE4 A;  2X6I A;  2WXL A;  3ZYQ A;  3ONL A;  4PS3 A;  3E4B A;  2FF4 A;  3JUI A;  3FUF A;  4NQ0 A;  4PS8 A;  4XE0 A;  4FA6 A;  3VLD A;  4FC8 A;  4TUU A;  4GA0 A;  4GML A;  4BWR A;  3RKV A;  1B89 A;  3APD A;  4HOS A;  2OND A;  1JUQ A;  1QNF A;  4UQZ A;  3SD5 A;  1QQE A;  2YHC A;  4G2V A;  5DIZ A;  3UX4 A;  3CV0 A;  4G26 A;  3LS8 A;  3SF4 A;  1KLX A;  2PQN A;  3FP3 A;  4L23 A;  4I1M A;  2V0P A;  5T3R A;  3G2W A;  5LFA A;  3CVX A;  2PM7 A;  1E8X A;  3CHP A;  4HOU A;  2XGO A;  1FCH A;  2BUG A;  3SBT B;  3OTN A;  3CK9 A;  3SI5 A;  3CIA A;  4JZY A;  4KVO A;  4CDN A;  3MKQ B;  2J09 A;  4V3I A;  4J8S A;  3CVN A;  2QFC A;  4HLE A;  2V4L A;  3B7R L;  1H2T C;  5ANR A;  4M3O A;  1MHQ A;  1HFA A;  3FTX A;  4LER A;  4H7Y A;  4FU3 A;  4E6H A;  4JEU A;  4ANX A;  5KJM A;  1Z6T A;  3AS4 A;  4I6J A;  5A23 A;  1IQR A;  4Y6W A;  3GYZ A;  4B8A A;  3ZN3 A;  3VLF A;  2J9Q A;  4F53 A;  1NA3 A;  2JLB A;  2L6J A;  2PL2 A;  3CHM A;  3LEW A;  4XI9 A;  3CVY A;  3U4T A;  3CQG B;  1SQM A;  5JJ6 A;  4AM9 A;  3QKY A;  3ZXS A;  3HIZ A;  3AU5 A;  4GZD A;  4NAC A;  4BSX A;  3FEX A;  5C2Y A;  2WXP A;  4LCT A;  2XPZ A;  3CK8 A;  4WNE A;  4AY6 A;  4RVB A;  4PUC A;  4UWF A;  2IU1 A;  4YVO A;  4L1B A;  3EIJ A;  2WXJ A;  3OXF A;  4C0M A;  5JJT A;  4EBA G;  4UI9 K;  4KBQ A;  1UJK A;  3CLJ A;  3KAE A;  3ZRH A;  1HH8 A;  2WXN A;  3CST A;  4GA1 A;  5FWQ A;  4JHR A;  5G04 C;  5LCW C;  1UG3 A;  1ZBP A;  2CG2 A;  5G05 C;  4CCA A;  5A6C A;  4XI0 A;  1JWF A;  2WXR A;  1YA0 A;  3FUN A;  4UQY A;  4XIF A;  3MV2 B;  3MA5 A;  4MLP A;  4CDM A;  3D9I A;  4N39 A;  2FEZ A;  3CHO A;  2VYI A;  4C0E A;  2LNI A;  3LY7 A;  3SBS A;  4FAD A;  2NC9 A;  4KZC A;  1HF8 A;  2IQC A;  3FUD A;  3MZL B;  2V8S E;  3K9I A;  5DBK A;  5FTP A;  2I1J A;  3FTW A;  3CVU A;  2Y4T A;  4TRQ A;  2VSY A;  4U07 A;  1OWL A;  1PY1 A;  2WXI A;  3HYM B;  4WNF A;  4I43 A;  3ZFW A;  3CEQ A;  4A3T A;  2WXH A;  4I9C A;  4F1S A;  3FUH A;  3VTY A;  3NQP A;  4GZC A;  4B94 A;  3CVW A;  4IYP A;  4N2Q A;  3FDH A;  4N3A A;  5EDS A;  1P5Q A;  2XPY A;  4ABN A;  3MV3 B;  4UWL A;  3QWW A;  4I17 A;  3RRN B;  2PQR A;  2HM8 A;  3HDX A;  3QB2 A;  3LJ3 A;  2A4Z A;  4FJY A;  3S7B A;  3BEE A;  5CMW A;  2CFU A;  2X6J A;  1L5J A;  3PS6 A;  4GCO A;  2LAH A;  3O4Z A;  3PH0 C;  2FI7 A;  3I3N A;  4GB9 A;  3LYA A;  3CVQ A;  4D10 C;  3N71 A;  3S2A A;  1UW4 B;  4J0U A;  2I2O A;  2WMN A;  4RG9 A;  3RK6 A;  2E0I A;  2ZU6 B;  3B7S A;  3JYS A;  5BV1 A;  3BG1 B;  4UQX A;  3S7J A;  2FUL A;  4A1G A;  2KM4 A;  1BPO A;  2RD0 A;  3CHQ A;  3B7U X;  3PUJ A;  2KC7 A;  1DNP A;  4N5C A;  4HS2 A;  3PE3 A;  5FQ7 A;  2DIW A;  4HOR A;  5C1D A;  4N3C A;  2L9B A;  4AV7 A;  4A55 A;  4HXI A;  2GRL A;  2R5S A;  3SHF A;  3FU0 A;  2AVP A;  3JQ0 A;  3O48 A;  3I5P A;  5KJN A;  3L08 A;  5LX8 A;  1NZN A;  4FJZ A;  2WXQ A;  3LY9 A;  4MKT A;  4BT9 A;  3FU6 A;  2LAI A;  4FLB A;  2YQ8 A;  3U3W A;  1WY6 A;  2XGM A;  3FUI A;  3G2V A;  2X6K A;  4FHK A;  4J8F A;  4L2Y A;  4U04 A;  3LKU A;  1A17 A;  4YVQ C;  2J07 A;  3CVP A;  3D9J A;  4JVS A;  3Q49 B;  2MRI A;  3FTU A;  2BF0 X;  4O6F A;  3UT7 A;  2X6H A;  2WPV A;  3RO3 A;  4AY5 A;  2GW1 A;  1H6K A;  4RSY A;  5FQ8 A;  2WXM A;  1KT1 A;  3FFL A;  3NZS A;  2VTB B;  1IQU A;  5BUZ A;  4ANV A;  3AS5 A;  2C0M A;  5G04 J;  3SZ7 A;  5LCW J;  4U8H A;  2AWI A;  1ELR A;  3L16 A;  5ENN A;  5G05 J;  3U9W A;  3EJN A;  4WWP A;  3ZEF A;  3IHV A;  3SFZ A;  3FH5 A;  3Q5M A;  3UPV A;  4Q96 A;  2GGF A;  1HO8 A;  3GZ1 A;  3IKO B;  4I9E A;  4UWK A;  2WQ7 A;  4G25 A;  4GZ5 A;  1H2U A;  1FVH A;  3ZGQ A;  2P58 C;  4GZ3 A;  2XRY A;  3QWV A;  4JHK A;  4G11 A;  3Q4A B;  5CCM A;  5FJY A;  3ZYL A;  2IOS A;  3FTY A;  2WXK A;  3MYV A;  2XCB A;  4PH4 B;  4OVV A;  4ANU A;  4APF A;  4DLQ A;  1JPL A;  4WWO A;  2MOW A;  3DPD A;  2KAT A;  5AJD A;  1HXI A;  2VSO E;  3IBE A;  3LXU X;  2VJ8 A;  2HYZ A;  2VSX E;  2XRZ A;  4EQF A;  1Z3X A;  2XGS A;  4RG6 A;  3D9M A;  4HOQ A;  3ZIM A;  5FZR A;  3D9P A;  4R7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...