3CHMA

Crystal structure of pci domain from a. thaliana cop9 signalosome subunit 7 (csn7)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
161
Chain Sequence
EQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Arabidopsis COP9 signalosome subunit 7 is a model PCI domain protein with subdomains involved in COP9 signalosome assembly
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords COP9 signalosome complex subunit 7
total genus 57
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3chmA00
3CHMA 3TXMA 3JCKC 4LCTA 3TXNA 3T5XA 2MRIA 4D10C
chains in the Genus database with same CATH superfamily
3SFYA 2F8XK 3K9IA 4Q69A 2J07A 3B7TA 3D9LA 1D8DA 3WXXA 4M7CA 5FQ7A 1JWFA 3RO3A 3T9KA 4I6GA 1OUVA 1K3ZD 3ZYKA 4U0ZA 4W9RA 2CHZA 2AVPA 5EKQD 4PS7A 3GYZA 2VGYA 3RJVA 4GMLA 4MBGA 4EECA 5LCWC 4AP2A 4BSXA 3FUNA 4BESA 1D8EA 3HRAA 4ILGA 4OYSA 3GZSA 2XS1A 1E8WA 3L08A 2EINE 5ITZF 2R05A 3HVEA 2WMNA 3T5VA 3SI5A 2GRQB 3J5PA 5KJNA 4HLEA 3L16A 4MS6A 1A17A 5LCWJ 3G2SA 4JHJA 4ANUA 1H6PA 3HXBA 2FI7A 3OXFA 4R7LA 5CBOA 2KCLA 3SFZA 3OXLA 4GTVA 4RG9A 4GTPA 3FEYA 2H6GA 3VLEA 5ENNA 3DSTA 4KZ0A 2IY0C 2QY7A 3ULEG 2XPIA 3FUFA 3QWPA 2IFUA 4YDEA 1Y8MA 3Q9NC 3HVEB 2FBNA 2A5UA 2WXIA 1E8YA 4K0RA 2A5EA 4HORA 3FTXA 2CFZA 3FP3A 3CVVA 5ARGA 3SO8A 3TAXA 4JHKA 4XE0A 4DX2A 3LKUA 3IKOB 2WXJA 5FQ8A 2WXGA 1KZPA 4U8VD 5KJKA 3PUJA 1X81A 4ATGA 1N54A 4D10C 3HDXA 2DZNA 3CQCB 1E8ZA 4DUIA 3OXGA 2A4ZA 3KEZA 2RKKA 3W9GA 4HFGA 4U8YD 3GW4A 2B6CA 1FVHA 1VDYA 5AJDA 3U64A 3D9JA 3CV0A 2IO2C 4NRHB 3L17A 4ANVA 3NF1A 3HIZA 5B1BE 3FH5A 4KT6B 3UIOC 3UX4A 1TNOA 2M63A 4AOFA 4HRMB 5D2MC 3NZSA 2C0LA 1IYGA 4AIFA 2MOWA 5HRYA 3D9IA 4F6RD 2CHXA 3CSFA 3ZU7B 1KZOA 2OVBA 3B13A 4IN3B 2X6IA 3FUHA 1E90A 4UWHA 1TNBA 1W3BA 4I2WA 5CRVA 4C48B 1EPUA 1BLXB 1SA4A 2FF4A 3BQOA 1E7UA 4EZKA 2IOSA 4L2LA 4I2ZA 5EDSA 2YHCA 2LSVA 4L2YA 3ZGQA 4JZYA 5KJLA 4YVQC 3NOCD 2WXHA 1U3CA 5A6CA 4UI9K 4BX9A 3B7UX 3MKQB 3IHVA 2V4HC 3CVNA 4A55A 1YA0A 2KCKA 3PZ3A 3OAWA 4LCTA 4DK5A 4HOTA 3NZUA 2RD0A 3NOGD 3LYAA 3V79K 5A23A 1E7VA 2V5FA 2KZTB 1HS6A 3PZ4A 2WXRA 4GCNA 4HB5A 4JA9A 5ENSD 3BEEA 3BG1B 4CGWA 2IJGX 3AG3E 3MKRA 4K5BA 4A63B 2EIJE 5JJ6A 3SGHA 2XCBA 5BT1A 4PDXA 1S64A 1HX8A 5JJ7A 5CCLA 3JUEA 4BSZB 3JQ0A 1FT1A 4CT4A 4GTSA 4Z68A 1MX4A 4QFVA 1PC2A 3L6AA 3B7BA 5CBNA 3DPYA 3U66A 3LPZA 3ESLA 2VQ2A 4CT0A 4K5AB 4OAUC 2Y3AA 4ANXA 3C98A 5AQAA 1NZNA 3TWTA 5KJMA 2EQXA 4N5CA 3ZFWA 3ASFA 1H19A 5KBAA 2X3MA 4B8CB 4J7WA 4XI9A 3WG7E 3MJWA 4GMRA 5ENQD 3C72A 4AY5A 5BV1A 3LVRE 2MYOA 2Y4UA 3UXGA 3R7QA 3V2XA 1OXJA 1TN7A 2RFMA 4AV7A 1ELRA 3Q9UC 4AVXA 2HM8A 4QQIA 4NQ0A 3EU9A 4G24A 2BTDA 4WNDA 5BXOA 5BNWA 3UKRG 5DBKA 2R5SA 4O1OA 3LJNA 4RLYA 5ANLA 3Q79A 3E30A 4ILIA 3QK0A 3O48A 5CCMA 3C3QA 5G55A 3PEVB 4JEHA 5C1DA 1K1BA 3JXIA 1MX2A 4ABNA 2XGSA 4CRWA 4U95D 5BW8C 1DVPA 2I9CA 1S70B 4DJAA 3VLFA 1WM5A 3R9AB 1KLXA 2P9SG 3ZKJA 2IONA 4B8AA 1QNFA 5EILA 3MV3B 3VTXA 2F8YA 2Q7FA 1ZB1A 4WNEA 3NB2A 3CVXA 3ASDA 2BEDA 3UM1A 4GZ3A 4L9PA 3CVPA 3FULA 5KNGA 2R2LA 5AARA 3KD7A 3KSQA 1Z3XA 2NC9A 3L82A 3AG4E 4J8YA 3EDTB 4G8KA 4IULA 2AJAA 2CHWA 2C0MA 1FT2A 3RIBA 4DRXE 4LG6A 3EHQA 2J08A 5FT9A 5B3SE 3CSTA 3QOUA 5FQ4A 4J6IA 4RVBA 4HOUA 3DRAA 2WXLA 4G23A 2HO1A 4U96D 5CERB 4L7TA 4XEIG 1U3DA 2OVFA 3ZXPA 2L9BA 4UQXA 4GMJA 4RG6A 2OEVA 3IHYA 3J5QB 2J4DA 4BEPA 2AW6A 2I6HA 1SA5A 2Y0BG 3AAAC 2QFCA 3B95A 3L13A 4DPRA 4HI9A 2DYSE 3FEXA 4RQIA 3JQ1A 3BG0B 4A3TA 2P2CP 5HI7A 2BF0X 4WUYA 4HS2A 1ELKA 4F1PA 1H6KA 4A1SA 2X6FA 3D9OA 3RRMB 1HZ4A 2UY1B 4HQDA 5ARFA 3JUIA 4B93B 5C2YA 2WXMA 2VSOE 1ELWA 4J8EA 3I4RB 5ENOD 4UUCA 4Y6CA 4RSYA 3QWWA 1ZU2A 3CVYA 4A3VA 5E76A 3URZA 4JB8P 5DIZA 3S2AA 4JEUA 2R02A 3UT4A 1EYHA 2X6KA 2YHEA 1JWGA 2GRPB 3LCAA 4XKCA 3VLDA 1QBQA 2KM4A 4DX6D 3PE4A 2WVIA 2FEZA 2P9KG 3EU5A 2GROB 3DWLG 1IHBA 4I1AA 4CZ2D 3I4GA 1OCCE 4G2VA 4H7XA 2GRLA 4H7YA 4HRLA 4B94A 1FVFA 4KBQA 3ASOE 3NBNB 2V0PA 3CLJA 3Q78A 2XGMA 1EF1C 3FUEA 4P29A 5H7PA 3UQ3A 3GZ1A 1IXVA 5ANRA 2VTBB 3EIJA 3CR3A 3Q7AA 4K5CA 1N4SA 4NURA 3KSLA 3MKQA 1TJFA 3P1UA 2P9PG 4FJZA 3PZ2A 2R17C 2PQNA 4AXHA 4FC8A 4LNGA 5AN8A 3AS8A 5G04C 5FZQA 2QC9A 3NAWA 3S7DA 4AM9A 4I9EA 5LP0A 2XQ0A 1HG5A 2RG8A 3SFXA 2GRMA 2R59A 1TN6A 3ZXSA 2PQRA 1HG2A 3ZRHA 4BETA 3SNXA 4Q96A 2XEHA 4AJWA 1O1SA 1MHQA 2DYRE 3AS4A 1TNYA 4HRNA 3IEGA 1UJKA 1FPPA 3PE3A 3FU5A 4GTOA 3G2UA 1IQUA 4G25A 1PAQA 2V8SE 5G05J 3O4ZA 2CG3A 4KYOB 4G11A 2XRYA 3NQPA 3HXFA 2XEEA 5G04J 3LY8A 4JXTA 3FU6A 5FWQA 2VTBA 3I3NA 2OCCE 4DI3A 3Q15A 1SQMA 1RZ4A 3R9MA 3FU0A 3HXDA 1N4QA 2P9UG 3AU5A 4GTQA 3EIQC 5FZRA 4GU5A 3MGBA 2LUHA 3LXUX 4FJYA 2GGFA 4XZ4A 4GYWA 3C3RA 5CECB 4J8DA 3FH7A 2R03A 2UWJG 4FHKA 4GA0A 1WAO1 1UOHA 4CEMA 4BY6A 3FUKA 1UN9A 1SVXA 3CGHA 4N3CA 3ENEA 2AXUA 4GYYA 1QYMA 4BX8A 4HLLA 3TGOA 3Q49B 5HKPA 5FINA 4DX5D 2FO7A 4EBAG 1SZAA 4GA2A 3E32A 2IU1A 3RRNB 1KT0A 4TV3A 1MX6A 3TXMA 4KMOA 5KNHD 5BXUA 3PZ1A 1JPLA 2HYZA 1XGWA 5T4YA 2YINA 4KZCA 3CEQA 4TXRA 4JA7A 2JLBA 5CRUA 4JHRA 3Q5MA 3UM0A 4DLOA 1NFIE 3QWVA 4OVVA 1KPSB 2V4LA 3MV2B 4AEZC 1AWCB 3TL5A 2QZAA 4O1PA 2ILRA 2NSZA 4GB9A 4FLBA 1H0AA 3LY9A 3HHMA 3UM2A 3DSXA 2WXQA 1FCHA 1B89A 2BUGA 2WM9A 5BV0A 3Q7FA 2EIME 1JCSA 2L6BA 1HH8A 2XGOA 1BI8B 4WNFA 4ANWA 3ZEFA 5T3RA 2LAHA 1PY1A 3QNKA 1OWPA 5FJYA 4U7EB 4X8QA 3ZHEB 3ONLA 1Y6IA 3FUJA 3G2TA 3QKYA 4FLHA 1QZ2A 5AQBA 2BKKB 1TR4A 4YNDA 2H6FA 4GTTA 5EX3A 1NA0A 3PVLA 3SD5A 2IOLA 3E4BA 3UMVA 2DZOA 2H6IA 3CIAA 3HG0D 5G2NA 4ZHBA 4C9BB 4I6JA 4N2QA 2VSNA 3ULYA 5EIDA 2V5QC 2Y1LE 3V2OA 5HS0A 4BFRA 3HXCA 2ETAA 5E75A 1DCEA 2J9QA 2YQ8A 3FH8A 4MKTA 4CYMD 4EBAA 4U63A 1EDUA 2LAIA 4CDMA 4I1MA 3FTVA 1DC2A 3ESKA 5JA4D 2LXMA 4IRUA 4JPSA 4F7AA 3PUKA 2HE0A 4DX1A 2XCCA 4ACLA 3S7BA 4DLQA 5EYPF 4BWRA 1DCQA 4CDRA 3EHNA 3UPVA 3L9TA 3W9FA 2J09A 5AIJA 4DX7D 2LXLA 4ATZD 4GZDA 3CHRA 4F1SA 3ZUVB 2ZIRA 3TXNA 2WPVA 3E33A 4GZ5A 3N71A 1K8KG 4N3BA 2IEJA 4JVSA 1N9AA 3TWSA 3EHMA 5ENRD 4F3VA 2H6HA 4F53A 1N95A 3ZW3A 1LD8A 4L23A 4A1GA 3FTYA 4EHMA 3QB2A 3UINC 2P9IG 4EZLA 3Q47B 3JCKC 1E8XA 2OEWA 4U8HA 3MYVA 1UN8A 3ASGA 4B0ZA 1BPOA 3CK7A 2E0IA 3UKUG 3KEAA 1OWNA 3CKCA 2X6JA 4LEUA 3T5XA 3FFLA 1L5JA 3CHOA 3LS8A 3I5PA 3LJ3A 4FHJA 3CHSA 3IXEA 4ZFHA 2EILE 4GA1A 3QARA 1V55E 4FA6A 1HU3A 1S63A 1N4RA 1IHGA 4I43A 3HXEA 2JEKA 1HXIA 4WWNA 5JHBA 4I9CA 3PZDA 3BU8A 4ILHB 3CHMA 1TEZA 1IKND 4UI9C 5EIBE 4PS8A 3FWVA 1P5QA 3G2WA 5T8IA 4URKA 3AU4A 3BUAA 1WY6A 3UIPC 4HBDA 4Y6WA 4GPMA 3RRUA 1U2VG 2OOEA 3APCA 5KCMA 2F0YA 5ENTD 3FDHA 4HOQA 3SZ7A 4BTBA 4NIKA 2XRZA 3VTYA 2ETCA 1Z3YA 2AWIA 3PNTB 2ETBA 3EJNA 4J8FA 1H6OA 4I6EA 3FUDA 5D0QD 1ZBPA 2PL2A 3TWRA 2WQ6A 3X2QE 4EZJA 3SHFA 3B7SA 2DWZA 4HNAD 3MX3A 3ULQA 2XHEA 5FIOA 2VSYA 4C0MA 5EYLA 4UQZA 4KVOA 4XI0A 1AP7A 4HOSA 4GZ6A 4U07A 4IYPA 3SQVA 3FTSA 4XIFA 4TRQA 3MA5A 5FTPA 4N3AA 1KT1A 2NXPA 2FULA 3TG5A 1JUQA 2IO3C 4PUCA 3RO2A 1TNZA 1NL4A 2AXZA 1O1TA 3U4TA 4XX5A 4GCOA 4YDYA 3RKVA 3ONKA 3JXJA 4PS3A 2P9NG 3LVQE 4YVOA 2WXKA 1IQRA 3U9WA 4J8SA 4NACA 4TUUA 3FY4A 2IQCA 1UW4B 3ZHEA 4U04A 1O1RA 1TYQG 5AENA 4M3OA 3CVLA 5ENPD 3LEWA 2WXOA 4BT9A 2WXNA 3UI2A 3D9NA 3CQGB 1OCOE 2ZGDA 1Z6TA 2I2OA 1MQSA 5IY5E 3UM3A 5BPPA 1A5EA 2GRRB 3DXKG 3AG1E 4K03A 2WXPA 3L22A 1H2VC 2DVWA 1NP7A 3IV0A 1TN8A 4YDOA 1N0QA 3G2VA 2DIWA 3Q73A 3CVWA 3MCXA 1TNUA 3AS5A 2CFUA 3DSUA 3ISMC 1NI1A 3V31A 3ASHA 4XKBA 3CKBA 3SBSA 1G3NB 1LD7A 1OCRE 2ZU6B 3QDNA 3D9PA 5AYWD 4G1TA 3CK8A 5JHAA 1O5MA 1H2TC 4UQYA 5AQ9A 4JL0A 4U0UA 4C0EA 3FTWA 3ZYLA 2DBAA 2LO6A 4MLPA 2XEVA 4LSZE 5CMYA 3APDA 3CVQA 1MYOA 4FU3A 4UWKA 3GZ2A 4LUNU 4ME2A 3KS2A 4V3IA 4HVBA 5JMND 1QQEA 1WG0A 3ABME 3FUIA 4GTRA 3SF4A 3DSVA 1YYHA 2MRIA 5KWDA 2ZISA 4B89A 2KATA 2LNIA 4U0SA 2ZGGA 1UJJA 3B7RL 1SZ9A 3DSWA 3CVUA 5HQ8A 1JCQA 2KXPC 4ACKA 3RK6A 5D66A 1MZCA 5EX0A 5J90A 4MRUA 4FADA 2ZXWE 2CG2A 4E6HA 2J49A 4GAAA 3S7FA 2OV8A 2I1KA 3DBSA 2LSUA 3PS6A 5B1AE 5A7DB 4HI8A 4EQFA 3FTUA 2JABA 3QC1A 3PNLB 1OWLA 1MJ0A 3PH0C 3ZN3A 4E85A 1DNPA 3FHEA 2P58C 1N52A 5G05C 3TWUA 4CDNA 5AJLA 2KCVA 2WB2A 1RW2A 2VGXA 3HYMB 1UG3A 1INZA 3DEPA 4APFA 1HO8A 1Z5SC 2L6JA 3SBTB 2QYUA 2VJ8A 2AXVA 5CEAA 2J8SD 1X5BA 3U3WA 1JCRA 4DI4A 2XPYA 5FQ6A 3E37A 2XPZA 3RAUA 2ONDA 2WMOA 4KVMA 4OAVB 5D0OD 4G8LA 1N0RA 1K1AA 3APFA 3R7RA 1OWMA 4AY6A 2YNQA 4LRZA 2B0OE 4GYOA 3MEKA 4J0UA 4L1BA 4KXKB 4UWFA 3C3OA 3TWQA 4GZCA 2XZTG 4CCAA 2PM6A 5AQ7A 3PEUB 3UT8A 3EHRA 2PM7A 4YDWA 3QJZA 3QAQA 5CEDB 1SW6A 3CHQA 2PNNA 4I1OB 2QYJA 3D9KA 1YMPA 3L54A 3KAEA 4FULA 1BI7B 4TXQA 2Y69E 3DSSA 5J08A 4UI9J 1OT8A 4TUMA 3RU0A 2WQ7A 4LERA 2MHKA 3AG2E 3ZYQA 2Y4TA 4GPKA 2VGEA 2GW1A 4GTMA 4BERA 2GRNB 3FUMA 3OTNA 4UWGA 2X6HA 3D9MA 2VSXE 1LTXA 4PH4B 3ML9A 5EN5D 1H2UA 2UY1A 3ZIMA 2VYIA 4I17A 3SY2A 3EUVA 4Q94A 3ASNE 2F37A 2PZIA 3UT7A 4BTAA 2I1JA 4APOA 3Q4AB 1N4PA 4OVUA 3S7JA 4HXIA 2KC7A 3D9HA 3P2BA 1S0PA 4LNBA 3UUXA 4FP7A 1XNFA 4JW1A 4WAFA 3D3MA 2EIKE 3CK9A 2C2LA 3C5RA 4WWOA 4WWPA 1N94A 3PRZA 4JD2G 3DXMG 3ABLE 4WNGA 5CMWA 5JJTA 1OY3D 2L0IA 1YCSB 5LOZA 4N5QA 2FO1E 3V30A 3PREA 2E2EA 3IBEA 5LFAA 4UWLA 3ZNGA 1OWOA 2XENA 2RFAA 3CHPA 3PDNA 4G26A 1HF8A 4TXPA 2P9LG 2KZTA 1WDYA 2XZDG 4JC8A 4N39A 2XS8A 3ZVVA 2WXFA 3Q75A 2X38A 4CGVA 2NYJA 5M72A 3MZLB 3TWXA 4EPZA 5BUZA 1Q2ZA 4BT8A 2BKGA 2WQHA 4LNUD 3ABKE 2IF4A 4N2SA 1V54E 3FU3A 1HFAA 3TG4A 3LDZA 3E34A 5LX8A 1HE8A 3T8KA 3UTMA 1N11A 4O60A 5CHEE 2L0TB 3DPDA 3DEOA 3TWVA 3T8MA 1GW6A 1NA3A 4O6FA 2J4BA 3JYSA 2HR2A 3ML8A 3F6QA 2KBXA 5FZSA 2DCPA 1OCZE 2VGXB 1LF8A 3ZPJA 5AAOA 3FTZA 3LY7A 3TJPA 3AJIA 1E96B 1BD8A 1TJCA 1D9SA 3RSEG 3TWWA 1BU9A 3ZYMA
chains in the Genus database with same CATH topology
3VLFA 3CK8A 1WM5A 3R9AB 1KLXA 2WXQA 3K9IA 1FCHA 4Q69A 2J07A 3B7TA 1B89A 2BUGA 3D9LA 5JHAA 3WXXA 2WM9A 1H2TC 5BV0A 5FQ7A 2IONA 4B8AA 4UQYA 1QNFA 4JL0A 1HH8A 2XGOA 1JWFA 3MV3B 3RO3A 3VTXA 4U0UA 2Q7FA 4I6GA 4WNFA 1OUVA 4C0EA 4ANWA 3ZEFA 3FTWA 3ZYLA 4WNEA 2DBAA 2LO6A 4MLPA 5T3RA 2XEVA 2LAHA 1PY1A 3ZYKA 5CMYA 3APDA 3QNKA 1OWPA 4U0ZA 3CVXA 3CVQA 3ASDA 4FU3A 4UWKA 4W9RA 5FJYA 3ZHEB 2CHZA 3GZ2A 3ONLA 4LUNU 1Y6IA 4GZ3A 4ME2A 3KS2A 2AVPA 4V3IA 3FUJA 3G2TA 3CVPA 3QKYA 5EKQD 3FULA 1QQEA 4FLHA 4PS7A 4HVBA 1QZ2A 3GYZA 3KD7A 2VGYA 3RJVA 4GMLA 4EECA 5LCWC 1Z3XA 2NC9A 3FUNA 4AP2A 4BSXA 3FUIA 3SF4A 4YNDA 2MRIA 3EDTB 5EX3A 1NA0A 4IULA 4B89A 2KATA 4ILGA 4OYSA 2LNIA 3GZSA 4U0SA 2CHWA 3PVLA 1E8WA 1UJJA 3B7RL 1SZ9A 2C0MA 2IOLA 3SD5A 3RIBA 3CVUA 3E4BA 3L08A 5HQ8A 3UMVA 3HVEA 2WMNA 3T5VA 2J08A 5FT9A 4ACKA 3RK6A 3CIAA 3CSTA 5G2NA 3SI5A 5EX0A 5KJNA 4C9BB 3QOUA 5FQ4A 4HLEA 5J90A 4MRUA 3L16A 4FADA 4MS6A 1A17A 4J6IA 4I6JA 4RVBA 4HOUA 5LCWJ 2CG2A 4N2QA 3G2SA 4JHJA 2VSNA 4ANUA 4E6HA 2WXLA 4G23A 2J49A 4GAAA 3S7FA 2FI7A 2OV8A 4BFRA 2HO1A 2I1KA 3DBSA 2LSUA 3OXFA 3PS6A 4R7LA 5E75A 5A7DB 4EQFA 2J9QA 3FTUA 2YQ8A 4L7TA 1U3DA 2KCLA 2OVFA 3SFZA 3QC1A 3OXLA 2L9BA 4RG9A 3FH8A 3PNLB 4MKTA 4EBAA 4U63A 1EDUA 4UQXA 2LAIA 1OWLA 4CDMA 3FEYA 4GMJA 4I1MA 4RG6A 3PH0C 3IHYA 3VLEA 3ZN3A 2J4DA 3FTVA 4E85A 1DNPA 3FHEA 5ENNA 3ESKA 2AW6A 2I6HA 4KZ0A 2P58C 1N52A 5G05C 4IRUA 2QY7A 4CDNA 2XPIA 4JPSA 5AJLA 2QFCA 2KCVA 3L13A 4DPRA 2WB2A 3FUFA 3QWPA 2VGXA 2IFUA 3FEXA 3HYMB 4F7AA 3JQ1A 3PUKA 1UG3A 2XCCA 3BG0B 4A3TA 4ACLA 1INZA 3S7BA 1Y8MA 4APFA 4DLQA 1HO8A 2L6JA 3HVEB 5HI7A 2BF0X 2FBNA 4WUYA 2A5UA 3SBTB 4HS2A 2WXIA 2VJ8A 1ELKA 2AXVA 1H6KA 4BWRA 1E8YA 4A1SA 2X6FA 3D9OA 4K0RA 1X5BA 3EHNA 4CDRA 3U3WA 3UPVA 4HORA 3FTXA 3RRMB 4DI4A 1HZ4A 2CFZA 2UY1B 3FP3A 5ARFA 3CVVA 2XPYA 3JUIA 2J09A 5ARGA 5FQ6A 5C2YA 3TAXA 2WXMA 4JHKA 4XE0A 5AIJA 2XPZA 3LKUA 2ONDA 2VSOE 1ELWA 2WMOA 3CHRA 4GZDA 4KVMA 3IKOB 4F1SA 4J8EA 3TXNA 2WPVA 3I4RB 5D0OD 2WXJA 5FQ8A 4GZ5A 4Y6CA 2WXGA 3QWWA 1ZU2A 3N71A 4RSYA 3PUJA 5KJKA 3APFA 3CVYA 4A3VA 4N3BA 4ATGA 1N54A 4D10C 3HDXA 5E76A 4JVSA 3URZA 5DIZA 3R7RA 3S2AA 4JEUA 1OWMA 4AY6A 3EHMA 3CQCB 1E8ZA 3UT4A 4F3VA 1EYHA 2X6KA 2YNQA 2YHEA 1JWGA 3LCAA 4LRZA 4XKCA 3VLDA 4F53A 4GYOA 3MEKA 4J0UA 3OXGA 4L1BA 2KM4A 2A4ZA 3PE4A 3ZW3A 3KEZA 4KXKB 2WVIA 2FEZA 4HFGA 4UWFA 4L23A 4I1AA 4GZCA 3I4GA 4A1GA 3GW4A 3FTYA 4CCAA 2PM6A 3QB2A 1FVHA 1VDYA 3PEUB 3UT8A 2PM7A 5AJDA 3U64A 3QJZA 3QAQA 3Q47B 3JCKC 4G2VA 4H7XA 2GRLA 4EZLA 1E8XA 3CHQA 4H7YA 4U8HA 4I1OB 4B94A 1FVFA 3MYVA 4KBQA 3D9KA 3D9JA 3CV0A 4NRHB 1UN8A 3L17A 2V0PA 4ANVA 3NF1A 3CLJA 3ASGA 2XGMA 1EF1C 3HIZA 4B0ZA 3L54A 3FUEA 1BPOA 3FH5A 3CK7A 4P29A 3UQ3A 3KAEA 4KT6B 3GZ1A 3UX4A 2E0IA 4FULA 2M63A 1OWNA 4AOFA 5ANRA 3NZSA 5J08A 3CKCA 2X6JA 4UI9J 4LEUA 2VTBB 3EIJA 3T5XA 2C0LA 3FFLA 3RU0A 1IYGA 3CR3A 1L5JA 2WQ7A 3CHOA 4AIFA 2MOWA 4LERA 4NURA 2MHKA 3D9IA 3LS8A 3MKQA 2CHXA 1TJFA 3ZYQA 3CSFA 2Y4TA 3I5PA 3LJ3A 3P1UA 4FHJA 3CHSA 4GPKA 2OVBA 4FJZA 3B13A 4GA1A 4IN3B 2R17C 3QARA 2GW1A 2PQNA 2X6IA 4FA6A 3FUHA 1HU3A 4AXHA 4FC8A 3AS8A 1E90A 4UWHA 1W3BA 1IHGA 4I43A 4I2WA 5G04C 3FUMA 3OTNA 1EPUA 5FZQA 4UWGA 3D9MA 2X6HA 2JEKA 2FF4A 3S7DA 1E7UA 2VSXE 4AM9A 1HXIA 4PH4B 4WWNA 4EZKA 2IOSA 4I9CA 4I9EA 3PZDA 3ML9A 5JHBA 5LP0A 2XQ0A 1HG5A 4L2LA 2RG8A 1H2UA 4I2ZA 5EDSA 4ILHB 2UY1A 3CHMA 2YHCA 2LSVA 1TEZA 3ZIMA 2VYIA 4I17A 4UI9C 4L2YA 3ZGQA 2GRMA 4JZYA 5KJLA 4PS8A 3FWVA 4YVQC 1P5QA 3G2WA 5T8IA 4URKA 3AU4A 1WY6A 2R59A 2WXHA 1U3CA 4Q94A 3ZXSA 2PQRA 1HG2A 3ZRHA 5A6CA 4UI9K 3SNXA 4BX9A 2PZIA 3B7UX 4Y6WA 4Q96A 3UT7A 3MKQB 4AJWA 3IHVA 3RRUA 2OOEA 3APCA 4BTAA 2I1JA 1MHQA 5KCMA 3AS4A 3FDHA 3CVNA 4HOQA 1YA0A 2KCKA 4APOA 4A55A 3Q4AB 3OAWA 4LCTA 3IEGA 1UJKA 4DK5A 4OVUA 3S7JA 4HXIA 3SZ7A 4BTBA 2XRZA 4HOTA 3VTYA 3PE3A 2KC7A 3FU5A 3NZUA 2RD0A 3P2BA 1Z3YA 2AWIA 3PNTB 1S0PA 3EJNA 3G2UA 3LYAA 4J8FA 3UUXA 4FP7A 1IQUA 1XNFA 4I6EA 3FUDA 4JW1A 4WAFA 5D0QD 1ZBPA 4G25A 3D3MA 2PL2A 3CK9A 5A23A 1E7VA 2WQ6A 2V5FA 1PAQA 2C2LA 2KZTB 4EZJA 3SHFA 2V8SE 3B7SA 5G05J 4WWOA 1HS6A 3O4ZA 2CG3A 4KYOB 2WXRA 3MX3A 4WWPA 4GCNA 3ULQA 2XHEA 3PRZA 4JA9A 4G11A 2XRYA 3BEEA 3BG1B 4CGWA 4WNGA 5CMWA 2VSYA 4C0MA 3NQPA 2IJGX 5JJTA 3MKRA 5G04J 3LY8A 4JXTA 2L0IA 4UQZA 3FU6A 5FWQA 4KVOA 5JJ6A 3SGHA 2VTBA 2XCBA 3I3NA 4XI0A 5LOZA 4DI3A 3Q15A 4HOSA 4GZ6A 1SQMA 3PREA 4PDXA 5BT1A 2E2EA 1HX8A 5JJ7A 3IBEA 5CCLA 4U07A 5LFAA 3FU0A 4UWLA 3JQ0A 1OWOA 4IYPA 3CHPA 4CT4A 3PDNA 3FTSA 4G26A 4XIFA 1HF8A 4TRQA 3AU5A 3MA5A 5FTPA 4N3AA 2KZTA 3EIQC 1KT1A 2NXPA 4QFVA 5FZRA 2FULA 1PC2A 3L6AA 4GU5A 4JC8A 3TG5A 1JUQA 3MGBA 3LXUX 4FJYA 3U66A 4N39A 4PUCA 3RO2A 2GGFA 4XZ4A 4GYWA 2AXZA 3LPZA 3U4TA 3ZVVA 3ESLA 4XX5A 2VQ2A 2WXFA 4J8DA 4CT0A 4GCOA 2X38A 3RKVA 2Y3AA 3FH7A 4CGVA 3ONKA 5M72A 3C98A 4ANXA 2UWJG 3MZLB 1NZNA 4PS3A 4FHKA 4GA0A 4EPZA 3LVQE 4YVOA 2EQXA 5BUZA 5KJMA 1WAO1 3ASFA 2WXKA 1IQRA 4N5CA 1H19A 4J8SA 4NACA 2WQHA 2X3MA 3U9WA 3ZFWA 4B8CB 4BT8A 4CEMA 4XI9A 4TUUA 3FY4A 2IF4A 4BY6A 3FUKA 4N2SA 1UN9A 2IQCA 3MJWA 3CGHA 4N3CA 1UW4B 3ENEA 2AXUA 4GYYA 4U04A 3ZHEA 4BX8A 5AENA 3FU3A 1HFAA 3TG4A 4M3OA 3LDZA 4AY5A 5BV1A 3LVRE 5LX8A 3TGOA 1HE8A 3Q49B 2Y4UA 3CVLA 2FO7A 3LEWA 3R7QA 4EBAG 2WXOA 1SZAA 4GA2A 4BT9A 2WXNA 5CHEE 2IU1A 3D9NA 3CQGB 2L0TB 3DPDA 3RRNB 4AV7A 1ELRA 1KT0A 3T8MA 1Z6TA 2I2OA 1MQSA 4TV3A 3TXMA 1GW6A 1NA3A 4O6FA 2HM8A 2J4BA 4NQ0A 4AVXA 5BPPA 3JYSA 4G24A 2HR2A 2BTDA 4KMOA 3ML8A 4WNDA 4K03A 2WXPA 5BNWA 3L22A 5DBKA 2R5SA 1H2VC 1JPLA 2HYZA 1XGWA 1NP7A 5ANLA 3IV0A 5T4YA 5FZSA 2YINA 4ILIA 3QK0A 3G2VA 2DIWA 4KZCA 3CVWA 3CEQA 3O48A 2DCPA 3MCXA 3AS5A 4JA7A 2CFUA 2VGXB 2JLBA 5CCMA 1LF8A 4JHRA 5G55A 3Q5MA 3PEVB 3ZPJA 4DLOA 3QWVA 4JEHA 5C1DA 3ASHA 4OVVA 4XKBA 4ABNA 2XGSA 4CRWA 5BW8C 1DVPA 3MV2B 2V4LA 4AEZC 3CKBA 3TL5A 3FTZA 2ILRA 2NSZA 4GB9A 3SBSA 3LY7A 2I9CA 4FLBA 3TJPA 1E96B 1TJCA 1H0AA 3LY9A 4DJAA 3HHMA 2ZU6B 3QDNA 3D9PA 5AYWD 3ZYMA 4G1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CHM A;  3TXM A;  3JCK C;  4LCT A;  3TXN A;  3T5X A;  2MRI A;  4D10 C; 
#chains in the Genus database with same CATH topology
 3SFY A;  2F8X K;  3K9I A;  4Q69 A;  2J07 A;  3B7T A;  3D9L A;  1D8D A;  3WXX A;  4M7C A;  5FQ7 A;  1JWF A;  3RO3 A;  3T9K A;  4I6G A;  1OUV A;  1K3Z D;  3ZYK A;  4U0Z A;  4W9R A;  2CHZ A;  2AVP A;  5EKQ D;  4PS7 A;  3GYZ A;  2VGY A;  3RJV A;  4GML A;  4MBG A;  4EEC A;  5LCW C;  4AP2 A;  4BSX A;  3FUN A;  4BES A;  1D8E A;  3HRA A;  4ILG A;  4OYS A;  3GZS A;  2XS1 A;  1E8W A;  3L08 A;  2EIN E;  5ITZ F;  2R05 A;  3HVE A;  2WMN A;  3T5V A;  3SI5 A;  2GRQ B;  3J5P A;  5KJN A;  4HLE A;  3L16 A;  4MS6 A;  1A17 A;  5LCW J;  3G2S A;  4JHJ A;  4ANU A;  1H6P A;  3HXB A;  2FI7 A;  3OXF A;  4R7L A;  5CBO A;  2KCL A;  3SFZ A;  3OXL A;  4GTV A;  4RG9 A;  4GTP A;  3FEY A;  2H6G A;  3VLE A;  5ENN A;  3DST A;  4KZ0 A;  2IY0 C;  2QY7 A;  3ULE G;  2XPI A;  3FUF A;  3QWP A;  2IFU A;  4YDE A;  1Y8M A;  3Q9N C;  3HVE B;  2FBN A;  2A5U A;  2WXI A;  1E8Y A;  4K0R A;  2A5E A;  4HOR A;  3FTX A;  2CFZ A;  3FP3 A;  3CVV A;  5ARG A;  3SO8 A;  3TAX A;  4JHK A;  4XE0 A;  4DX2 A;  3LKU A;  3IKO B;  2WXJ A;  5FQ8 A;  2WXG A;  1KZP A;  4U8V D;  5KJK A;  3PUJ A;  1X81 A;  4ATG A;  1N54 A;  4D10 C;  3HDX A;  2DZN A;  3CQC B;  1E8Z A;  4DUI A;  3OXG A;  2A4Z A;  3KEZ A;  2RKK A;  3W9G A;  4HFG A;  4U8Y D;  3GW4 A;  2B6C A;  1FVH A;  1VDY A;  5AJD A;  3U64 A;  3D9J A;  3CV0 A;  2IO2 C;  4NRH B;  3L17 A;  4ANV A;  3NF1 A;  3HIZ A;  5B1B E;  3FH5 A;  4KT6 B;  3UIO C;  3UX4 A;  1TNO A;  2M63 A;  4AOF A;  4HRM B;  5D2M C;  3NZS A;  2C0L A;  1IYG A;  4AIF A;  2MOW A;  5HRY A;  3D9I A;  4F6R D;  2CHX A;  3CSF A;  3ZU7 B;  1KZO A;  2OVB A;  3B13 A;  4IN3 B;  2X6I A;  3FUH A;  1E90 A;  4UWH A;  1TNB A;  1W3B A;  4I2W A;  5CRV A;  4C48 B;  1EPU A;  1BLX B;  1SA4 A;  2FF4 A;  3BQO A;  1E7U A;  4EZK A;  2IOS A;  4L2L A;  4I2Z A;  5EDS A;  2YHC A;  2LSV A;  4L2Y A;  3ZGQ A;  4JZY A;  5KJL A;  4YVQ C;  3NOC D;  2WXH A;  1U3C A;  5A6C A;  4UI9 K;  4BX9 A;  3B7U X;  3MKQ B;  3IHV A;  2V4H C;  3CVN A;  4A55 A;  1YA0 A;  2KCK A;  3PZ3 A;  3OAW A;  4LCT A;  4DK5 A;  4HOT A;  3NZU A;  2RD0 A;  3NOG D;  3LYA A;  3V79 K;  5A23 A;  1E7V A;  2V5F A;  2KZT B;  1HS6 A;  3PZ4 A;  2WXR A;  4GCN A;  4HB5 A;  4JA9 A;  5ENS D;  3BEE A;  3BG1 B;  4CGW A;  2IJG X;  3AG3 E;  3MKR A;  4K5B A;  4A63 B;  2EIJ E;  5JJ6 A;  3SGH A;  2XCB A;  5BT1 A;  4PDX A;  1S64 A;  1HX8 A;  5JJ7 A;  5CCL A;  3JUE A;  4BSZ B;  3JQ0 A;  1FT1 A;  4CT4 A;  4GTS A;  4Z68 A;  1MX4 A;  4QFV A;  1PC2 A;  3L6A A;  3B7B A;  5CBN A;  3DPY A;  3U66 A;  3LPZ A;  3ESL A;  2VQ2 A;  4CT0 A;  4K5A B;  4OAU C;  2Y3A A;  4ANX A;  3C98 A;  5AQA A;  1NZN A;  3TWT A;  5KJM A;  2EQX A;  4N5C A;  3ZFW A;  3ASF A;  1H19 A;  5KBA A;  2X3M A;  4B8C B;  4J7W A;  4XI9 A;  3WG7 E;  3MJW A;  4GMR A;  5ENQ D;  3C72 A;  4AY5 A;  5BV1 A;  3LVR E;  2MYO A;  2Y4U A;  3UXG A;  3R7Q A;  3V2X A;  1OXJ A;  1TN7 A;  2RFM A;  4AV7 A;  1ELR A;  3Q9U C;  4AVX A;  2HM8 A;  4QQI A;  4NQ0 A;  3EU9 A;  4G24 A;  2BTD A;  4WND A;  5BXO A;  5BNW A;  3UKR G;  5DBK A;  2R5S A;  4O1O A;  3LJN A;  4RLY A;  5ANL A;  3Q79 A;  3E30 A;  4ILI A;  3QK0 A;  3O48 A;  5CCM A;  3C3Q A;  5G55 A;  3PEV B;  4JEH A;  5C1D A;  1K1B A;  3JXI A;  1MX2 A;  4ABN A;  2XGS A;  4CRW A;  4U95 D;  5BW8 C;  1DVP A;  2I9C A;  1S70 B;  4DJA A;  3VLF A;  1WM5 A;  3R9A B;  1KLX A;  2P9S G;  3ZKJ A;  2ION A;  4B8A A;  1QNF A;  5EIL A;  3MV3 B;  3VTX A;  2F8Y A;  2Q7F A;  1ZB1 A;  4WNE A;  3NB2 A;  3CVX A;  3ASD A;  2BED A;  3UM1 A;  4GZ3 A;  4L9P A;  3CVP A;  3FUL A;  5KNG A;  2R2L A;  5AAR A;  3KD7 A;  3KSQ A;  1Z3X A;  2NC9 A;  3L82 A;  3AG4 E;  4J8Y A;  3EDT B;  4G8K A;  4IUL A;  2AJA A;  2CHW A;  2C0M A;  1FT2 A;  3RIB A;  4DRX E;  4LG6 A;  3EHQ A;  2J08 A;  5FT9 A;  5B3S E;  3CST A;  3QOU A;  5FQ4 A;  4J6I A;  4RVB A;  4HOU A;  3DRA A;  2WXL A;  4G23 A;  2HO1 A;  4U96 D;  5CER B;  4L7T A;  4XEI G;  1U3D A;  2OVF A;  3ZXP A;  2L9B A;  4UQX A;  4GMJ A;  4RG6 A;  2OEV A;  3IHY A;  3J5Q B;  2J4D A;  4BEP A;  2AW6 A;  2I6H A;  1SA5 A;  2Y0B G;  3AAA C;  2QFC A;  3B95 A;  3L13 A;  4DPR A;  4HI9 A;  2DYS E;  3FEX A;  4RQI A;  3JQ1 A;  3BG0 B;  4A3T A;  2P2C P;  5HI7 A;  2BF0 X;  4WUY A;  4HS2 A;  1ELK A;  4F1P A;  1H6K A;  4A1S A;  2X6F A;  3D9O A;  3RRM B;  1HZ4 A;  2UY1 B;  4HQD A;  5ARF A;  3JUI A;  4B93 B;  5C2Y A;  2WXM A;  2VSO E;  1ELW A;  4J8E A;  3I4R B;  5ENO D;  4UUC A;  4Y6C A;  4RSY A;  3QWW A;  1ZU2 A;  3CVY A;  4A3V A;  5E76 A;  3URZ A;  4JB8 P;  5DIZ A;  3S2A A;  4JEU A;  2R02 A;  3UT4 A;  1EYH A;  2X6K A;  2YHE A;  1JWG A;  2GRP B;  3LCA A;  4XKC A;  3VLD A;  1QBQ A;  2KM4 A;  4DX6 D;  3PE4 A;  2WVI A;  2FEZ A;  2P9K G;  3EU5 A;  2GRO B;  3DWL G;  1IHB A;  4I1A A;  4CZ2 D;  3I4G A;  1OCC E;  4G2V A;  4H7X A;  2GRL A;  4H7Y A;  4HRL A;  4B94 A;  1FVF A;  4KBQ A;  3ASO E;  3NBN B;  2V0P A;  3CLJ A;  3Q78 A;  2XGM A;  1EF1 C;  3FUE A;  4P29 A;  5H7P A;  3UQ3 A;  3GZ1 A;  1IXV A;  5ANR A;  2VTB B;  3EIJ A;  3CR3 A;  3Q7A A;  4K5C A;  1N4S A;  4NUR A;  3KSL A;  3MKQ A;  1TJF A;  3P1U A;  2P9P G;  4FJZ A;  3PZ2 A;  2R17 C;  2PQN A;  4AXH A;  4FC8 A;  4LNG A;  5AN8 A;  3AS8 A;  5G04 C;  5FZQ A;  2QC9 A;  3NAW A;  3S7D A;  4AM9 A;  4I9E A;  5LP0 A;  2XQ0 A;  1HG5 A;  2RG8 A;  3SFX A;  2GRM A;  2R59 A;  1TN6 A;  3ZXS A;  2PQR A;  1HG2 A;  3ZRH A;  4BET A;  3SNX A;  4Q96 A;  2XEH A;  4AJW A;  1O1S A;  1MHQ A;  2DYR E;  3AS4 A;  1TNY A;  4HRN A;  3IEG A;  1UJK A;  1FPP A;  3PE3 A;  3FU5 A;  4GTO A;  3G2U A;  1IQU A;  4G25 A;  1PAQ A;  2V8S E;  5G05 J;  3O4Z A;  2CG3 A;  4KYO B;  4G11 A;  2XRY A;  3NQP A;  3HXF A;  2XEE A;  5G04 J;  3LY8 A;  4JXT A;  3FU6 A;  5FWQ A;  2VTB A;  3I3N A;  2OCC E;  4DI3 A;  3Q15 A;  1SQM A;  1RZ4 A;  3R9M A;  3FU0 A;  3HXD A;  1N4Q A;  2P9U G;  3AU5 A;  4GTQ A;  3EIQ C;  5FZR A;  4GU5 A;  3MGB A;  2LUH A;  3LXU X;  4FJY A;  2GGF A;  4XZ4 A;  4GYW A;  3C3R A;  5CEC B;  4J8D A;  3FH7 A;  2R03 A;  2UWJ G;  4FHK A;  4GA0 A;  1WAO 1;  1UOH A;  4CEM A;  4BY6 A;  3FUK A;  1UN9 A;  1SVX A;  3CGH A;  4N3C A;  3ENE A;  2AXU A;  4GYY A;  1QYM A;  4BX8 A;  4HLL A;  3TGO A;  3Q49 B;  5HKP A;  5FIN A;  4DX5 D;  2FO7 A;  4EBA G;  1SZA A;  4GA2 A;  3E32 A;  2IU1 A;  3RRN B;  1KT0 A;  4TV3 A;  1MX6 A;  3TXM A;  4KMO A;  5KNH D;  5BXU A;  3PZ1 A;  1JPL A;  2HYZ A;  1XGW A;  5T4Y A;  2YIN A;  4KZC A;  3CEQ A;  4TXR A;  4JA7 A;  2JLB A;  5CRU A;  4JHR A;  3Q5M A;  3UM0 A;  4DLO A;  1NFI E;  3QWV A;  4OVV A;  1KPS B;  2V4L A;  3MV2 B;  4AEZ C;  1AWC B;  3TL5 A;  2QZA A;  4O1P A;  2ILR A;  2NSZ A;  4GB9 A;  4FLB A;  1H0A A;  3LY9 A;  3HHM A;  3UM2 A;  3DSX A;  2WXQ A;  1FCH A;  1B89 A;  2BUG A;  2WM9 A;  5BV0 A;  3Q7F A;  2EIM E;  1JCS A;  2L6B A;  1HH8 A;  2XGO A;  1BI8 B;  4WNF A;  4ANW A;  3ZEF A;  5T3R A;  2LAH A;  1PY1 A;  3QNK A;  1OWP A;  5FJY A;  4U7E B;  4X8Q A;  3ZHE B;  3ONL A;  1Y6I A;  3FUJ A;  3G2T A;  3QKY A;  4FLH A;  1QZ2 A;  5AQB A;  2BKK B;  1TR4 A;  4YND A;  2H6F A;  4GTT A;  5EX3 A;  1NA0 A;  3PVL A;  3SD5 A;  2IOL A;  3E4B A;  3UMV A;  2DZO A;  2H6I A;  3CIA A;  3HG0 D;  5G2N A;  4ZHB A;  4C9B B;  4I6J A;  4N2Q A;  2VSN A;  3ULY A;  5EID A;  2V5Q C;  2Y1L E;  3V2O A;  5HS0 A;  4BFR A;  3HXC A;  2ETA A;  5E75 A;  1DCE A;  2J9Q A;  2YQ8 A;  3FH8 A;  4MKT A;  4CYM D;  4EBA A;  4U63 A;  1EDU A;  2LAI A;  4CDM A;  4I1M A;  3FTV A;  1DC2 A;  3ESK A;  5JA4 D;  2LXM A;  4IRU A;  4JPS A;  4F7A A;  3PUK A;  2HE0 A;  4DX1 A;  2XCC A;  4ACL A;  3S7B A;  4DLQ A;  5EYP F;  4BWR A;  1DCQ A;  4CDR A;  3EHN A;  3UPV A;  3L9T A;  3W9F A;  2J09 A;  5AIJ A;  4DX7 D;  2LXL A;  4ATZ D;  4GZD A;  3CHR A;  4F1S A;  3ZUV B;  2ZIR A;  3TXN A;  2WPV A;  3E33 A;  4GZ5 A;  3N71 A;  1K8K G;  4N3B A;  2IEJ A;  4JVS A;  1N9A A;  3TWS A;  3EHM A;  5ENR D;  4F3V A;  2H6H A;  4F53 A;  1N95 A;  3ZW3 A;  1LD8 A;  4L23 A;  4A1G A;  3FTY A;  4EHM A;  3QB2 A;  3UIN C;  2P9I G;  4EZL A;  3Q47 B;  3JCK C;  1E8X A;  2OEW A;  4U8H A;  3MYV A;  1UN8 A;  3ASG A;  4B0Z A;  1BPO A;  3CK7 A;  2E0I A;  3UKU G;  3KEA A;  1OWN A;  3CKC A;  2X6J A;  4LEU A;  3T5X A;  3FFL A;  1L5J A;  3CHO A;  3LS8 A;  3I5P A;  3LJ3 A;  4FHJ A;  3CHS A;  3IXE A;  4ZFH A;  2EIL E;  4GA1 A;  3QAR A;  1V55 E;  4FA6 A;  1HU3 A;  1S63 A;  1N4R A;  1IHG A;  4I43 A;  3HXE A;  2JEK A;  1HXI A;  4WWN A;  5JHB A;  4I9C A;  3PZD A;  3BU8 A;  4ILH B;  3CHM A;  1TEZ A;  1IKN D;  4UI9 C;  5EIB E;  4PS8 A;  3FWV A;  1P5Q A;  3G2W A;  5T8I A;  4URK A;  3AU4 A;  3BUA A;  1WY6 A;  3UIP C;  4HBD A;  4Y6W A;  4GPM A;  3RRU A;  1U2V G;  2OOE A;  3APC A;  5KCM A;  2F0Y A;  5ENT D;  3FDH A;  4HOQ A;  3SZ7 A;  4BTB A;  4NIK A;  2XRZ A;  3VTY A;  2ETC A;  1Z3Y A;  2AWI A;  3PNT B;  2ETB A;  3EJN A;  4J8F A;  1H6O A;  4I6E A;  3FUD A;  5D0Q D;  1ZBP A;  2PL2 A;  3TWR A;  2WQ6 A;  3X2Q E;  4EZJ A;  3SHF A;  3B7S A;  2DWZ A;  4HNA D;  3MX3 A;  3ULQ A;  2XHE A;  5FIO A;  2VSY A;  4C0M A;  5EYL A;  4UQZ A;  4KVO A;  4XI0 A;  1AP7 A;  4HOS A;  4GZ6 A;  4U07 A;  4IYP A;  3SQV A;  3FTS A;  4XIF A;  4TRQ A;  3MA5 A;  5FTP A;  4N3A A;  1KT1 A;  2NXP A;  2FUL A;  3TG5 A;  1JUQ A;  2IO3 C;  4PUC A;  3RO2 A;  1TNZ A;  1NL4 A;  2AXZ A;  1O1T A;  3U4T A;  4XX5 A;  4GCO A;  4YDY A;  3RKV A;  3ONK A;  3JXJ A;  4PS3 A;  2P9N G;  3LVQ E;  4YVO A;  2WXK A;  1IQR A;  3U9W A;  4J8S A;  4NAC A;  4TUU A;  3FY4 A;  2IQC A;  1UW4 B;  3ZHE A;  4U04 A;  1O1R A;  1TYQ G;  5AEN A;  4M3O A;  3CVL A;  5ENP D;  3LEW A;  2WXO A;  4BT9 A;  2WXN A;  3UI2 A;  3D9N A;  3CQG B;  1OCO E;  2ZGD A;  1Z6T A;  2I2O A;  1MQS A;  5IY5 E;  3UM3 A;  5BPP A;  1A5E A;  2GRR B;  3DXK G;  3AG1 E;  4K03 A;  2WXP A;  3L22 A;  1H2V C;  2DVW A;  1NP7 A;  3IV0 A;  1TN8 A;  4YDO A;  1N0Q A;  3G2V A;  2DIW A;  3Q73 A;  3CVW A;  3MCX A;  1TNU A;  3AS5 A;  2CFU A;  3DSU A;  3ISM C;  1NI1 A;  3V31 A;  3ASH A;  4XKB A;  3CKB A;  3SBS A;  1G3N B;  1LD7 A;  1OCR E;  2ZU6 B;  3QDN A;  3D9P A;  5AYW D;  4G1T A;  3CK8 A;  5JHA A;  1O5M A;  1H2T C;  4UQY A;  5AQ9 A;  4JL0 A;  4U0U A;  4C0E A;  3FTW A;  3ZYL A;  2DBA A;  2LO6 A;  4MLP A;  2XEV A;  4LSZ E;  5CMY A;  3APD A;  3CVQ A;  1MYO A;  4FU3 A;  4UWK A;  3GZ2 A;  4LUN U;  4ME2 A;  3KS2 A;  4V3I A;  4HVB A;  5JMN D;  1QQE A;  1WG0 A;  3ABM E;  3FUI A;  4GTR A;  3SF4 A;  3DSV A;  1YYH A;  2MRI A;  5KWD A;  2ZIS A;  4B89 A;  2KAT A;  2LNI A;  4U0S A;  2ZGG A;  1UJJ A;  3B7R L;  1SZ9 A;  3DSW A;  3CVU A;  5HQ8 A;  1JCQ A;  2KXP C;  4ACK A;  3RK6 A;  5D66 A;  1MZC A;  5EX0 A;  5J90 A;  4MRU A;  4FAD A;  2ZXW E;  2CG2 A;  4E6H A;  2J49 A;  4GAA A;  3S7F A;  2OV8 A;  2I1K A;  3DBS A;  2LSU A;  3PS6 A;  5B1A E;  5A7D B;  4HI8 A;  4EQF A;  3FTU A;  2JAB A;  3QC1 A;  3PNL B;  1OWL A;  1MJ0 A;  3PH0 C;  3ZN3 A;  4E85 A;  1DNP A;  3FHE A;  2P58 C;  1N52 A;  5G05 C;  3TWU A;  4CDN A;  5AJL A;  2KCV A;  2WB2 A;  1RW2 A;  2VGX A;  3HYM B;  1UG3 A;  1INZ A;  3DEP A;  4APF A;  1HO8 A;  1Z5S C;  2L6J A;  3SBT B;  2QYU A;  2VJ8 A;  2AXV A;  5CEA A;  2J8S D;  1X5B A;  3U3W A;  1JCR A;  4DI4 A;  2XPY A;  5FQ6 A;  3E37 A;  2XPZ A;  3RAU A;  2OND A;  2WMO A;  4KVM A;  4OAV B;  5D0O D;  4G8L A;  1N0R A;  1K1A A;  3APF A;  3R7R A;  1OWM A;  4AY6 A;  2YNQ A;  4LRZ A;  2B0O E;  4GYO A;  3MEK A;  4J0U A;  4L1B A;  4KXK B;  4UWF A;  3C3O A;  3TWQ A;  4GZC A;  2XZT G;  4CCA A;  2PM6 A;  5AQ7 A;  3PEU B;  3UT8 A;  3EHR A;  2PM7 A;  4YDW A;  3QJZ A;  3QAQ A;  5CED B;  1SW6 A;  3CHQ A;  2PNN A;  4I1O B;  2QYJ A;  3D9K A;  1YMP A;  3L54 A;  3KAE A;  4FUL A;  1BI7 B;  4TXQ A;  2Y69 E;  3DSS A;  5J08 A;  4UI9 J;  1OT8 A;  4TUM A;  3RU0 A;  2WQ7 A;  4LER A;  2MHK A;  3AG2 E;  3ZYQ A;  2Y4T A;  4GPK A;  2VGE A;  2GW1 A;  4GTM A;  4BER A;  2GRN B;  3FUM A;  3OTN A;  4UWG A;  2X6H A;  3D9M A;  2VSX E;  1LTX A;  4PH4 B;  3ML9 A;  5EN5 D;  1H2U A;  2UY1 A;  3ZIM A;  2VYI A;  4I17 A;  3SY2 A;  3EUV A;  4Q94 A;  3ASN E;  2F37 A;  2PZI A;  3UT7 A;  4BTA A;  2I1J A;  4APO A;  3Q4A B;  1N4P A;  4OVU A;  3S7J A;  4HXI A;  2KC7 A;  3D9H A;  3P2B A;  1S0P A;  4LNB A;  3UUX A;  4FP7 A;  1XNF A;  4JW1 A;  4WAF A;  3D3M A;  2EIK E;  3CK9 A;  2C2L A;  3C5R A;  4WWO A;  4WWP A;  1N94 A;  3PRZ A;  4JD2 G;  3DXM G;  3ABL E;  4WNG A;  5CMW A;  5JJT A;  1OY3 D;  2L0I A;  1YCS B;  5LOZ A;  4N5Q A;  2FO1 E;  3V30 A;  3PRE A;  2E2E A;  3IBE A;  5LFA A;  4UWL A;  3ZNG A;  1OWO A;  2XEN A;  2RFA A;  3CHP A;  3PDN A;  4G26 A;  1HF8 A;  4TXP A;  2P9L G;  2KZT A;  1WDY A;  2XZD G;  4JC8 A;  4N39 A;  2XS8 A;  3ZVV A;  2WXF A;  3Q75 A;  2X38 A;  4CGV A;  2NYJ A;  5M72 A;  3MZL B;  3TWX A;  4EPZ A;  5BUZ A;  1Q2Z A;  4BT8 A;  2BKG A;  2WQH A;  4LNU D;  3ABK E;  2IF4 A;  4N2S A;  1V54 E;  3FU3 A;  1HFA A;  3TG4 A;  3LDZ A;  3E34 A;  5LX8 A;  1HE8 A;  3T8K A;  3UTM A;  1N11 A;  4O60 A;  5CHE E;  2L0T B;  3DPD A;  3DEO A;  3TWV A;  3T8M A;  1GW6 A;  1NA3 A;  4O6F A;  2J4B A;  3JYS A;  2HR2 A;  3ML8 A;  3F6Q A;  2KBX A;  5FZS A;  2DCP A;  1OCZ E;  2VGX B;  1LF8 A;  3ZPJ A;  5AAO A;  3FTZ A;  3LY7 A;  3TJP A;  3AJI A;  1E96 B;  1BD8 A;  1TJC A;  1D9S A;  3RSE G;  3TWW A;  1BU9 A;  3ZYM A; 
#chains in the Genus database with same CATH homology
 3VLF A;  3CK8 A;  1WM5 A;  3R9A B;  1KLX A;  2WXQ A;  3K9I A;  1FCH A;  4Q69 A;  2J07 A;  3B7T A;  1B89 A;  2BUG A;  3D9L A;  5JHA A;  3WXX A;  2WM9 A;  1H2T C;  5BV0 A;  5FQ7 A;  2ION A;  4B8A A;  4UQY A;  1QNF A;  4JL0 A;  1HH8 A;  2XGO A;  1JWF A;  3MV3 B;  3RO3 A;  3VTX A;  4U0U A;  2Q7F A;  4I6G A;  4WNF A;  1OUV A;  4C0E A;  4ANW A;  3ZEF A;  3FTW A;  3ZYL A;  4WNE A;  2DBA A;  2LO6 A;  4MLP A;  5T3R A;  2XEV A;  2LAH A;  1PY1 A;  3ZYK A;  5CMY A;  3APD A;  3QNK A;  1OWP A;  4U0Z A;  3CVX A;  3CVQ A;  3ASD A;  4FU3 A;  4UWK A;  4W9R A;  5FJY A;  3ZHE B;  2CHZ A;  3GZ2 A;  3ONL A;  4LUN U;  1Y6I A;  4GZ3 A;  4ME2 A;  3KS2 A;  2AVP A;  4V3I A;  3FUJ A;  3G2T A;  3CVP A;  3QKY A;  5EKQ D;  3FUL A;  1QQE A;  4FLH A;  4PS7 A;  4HVB A;  1QZ2 A;  3GYZ A;  3KD7 A;  2VGY A;  3RJV A;  4GML A;  4EEC A;  5LCW C;  1Z3X A;  2NC9 A;  3FUN A;  4AP2 A;  4BSX A;  3FUI A;  3SF4 A;  4YND A;  2MRI A;  3EDT B;  5EX3 A;  1NA0 A;  4IUL A;  4B89 A;  2KAT A;  4ILG A;  4OYS A;  2LNI A;  3GZS A;  4U0S A;  2CHW A;  3PVL A;  1E8W A;  1UJJ A;  3B7R L;  1SZ9 A;  2C0M A;  2IOL A;  3SD5 A;  3RIB A;  3CVU A;  3E4B A;  3L08 A;  5HQ8 A;  3UMV A;  3HVE A;  2WMN A;  3T5V A;  2J08 A;  5FT9 A;  4ACK A;  3RK6 A;  3CIA A;  3CST A;  5G2N A;  3SI5 A;  5EX0 A;  5KJN A;  4C9B B;  3QOU A;  5FQ4 A;  4HLE A;  5J90 A;  4MRU A;  3L16 A;  4FAD A;  4MS6 A;  1A17 A;  4J6I A;  4I6J A;  4RVB A;  4HOU A;  5LCW J;  2CG2 A;  4N2Q A;  3G2S A;  4JHJ A;  2VSN A;  4ANU A;  4E6H A;  2WXL A;  4G23 A;  2J49 A;  4GAA A;  3S7F A;  2FI7 A;  2OV8 A;  4BFR A;  2HO1 A;  2I1K A;  3DBS A;  2LSU A;  3OXF A;  3PS6 A;  4R7L A;  5E75 A;  5A7D B;  4EQF A;  2J9Q A;  3FTU A;  2YQ8 A;  4L7T A;  1U3D A;  2KCL A;  2OVF A;  3SFZ A;  3QC1 A;  3OXL A;  2L9B A;  4RG9 A;  3FH8 A;  3PNL B;  4MKT A;  4EBA A;  4U63 A;  1EDU A;  4UQX A;  2LAI A;  1OWL A;  4CDM A;  3FEY A;  4GMJ A;  4I1M A;  4RG6 A;  3PH0 C;  3IHY A;  3VLE A;  3ZN3 A;  2J4D A;  3FTV A;  4E85 A;  1DNP A;  3FHE A;  5ENN A;  3ESK A;  2AW6 A;  2I6H A;  4KZ0 A;  2P58 C;  1N52 A;  5G05 C;  4IRU A;  2QY7 A;  4CDN A;  2XPI A;  4JPS A;  5AJL A;  2QFC A;  2KCV A;  3L13 A;  4DPR A;  2WB2 A;  3FUF A;  3QWP A;  2VGX A;  2IFU A;  3FEX A;  3HYM B;  4F7A A;  3JQ1 A;  3PUK A;  1UG3 A;  2XCC A;  3BG0 B;  4A3T A;  4ACL A;  1INZ A;  3S7B A;  1Y8M A;  4APF A;  4DLQ A;  1HO8 A;  2L6J A;  3HVE B;  5HI7 A;  2BF0 X;  2FBN A;  4WUY A;  2A5U A;  3SBT B;  4HS2 A;  2WXI A;  2VJ8 A;  1ELK A;  2AXV A;  1H6K A;  4BWR A;  1E8Y A;  4A1S A;  2X6F A;  3D9O A;  4K0R A;  1X5B A;  3EHN A;  4CDR A;  3U3W A;  3UPV A;  4HOR A;  3FTX A;  3RRM B;  4DI4 A;  1HZ4 A;  2CFZ A;  2UY1 B;  3FP3 A;  5ARF A;  3CVV A;  2XPY A;  3JUI A;  2J09 A;  5ARG A;  5FQ6 A;  5C2Y A;  3TAX A;  2WXM A;  4JHK A;  4XE0 A;  5AIJ A;  2XPZ A;  3LKU A;  2OND A;  2VSO E;  1ELW A;  2WMO A;  3CHR A;  4GZD A;  4KVM A;  3IKO B;  4F1S A;  4J8E A;  3TXN A;  2WPV A;  3I4R B;  5D0O D;  2WXJ A;  5FQ8 A;  4GZ5 A;  4Y6C A;  2WXG A;  3QWW A;  1ZU2 A;  3N71 A;  4RSY A;  3PUJ A;  5KJK A;  3APF A;  3CVY A;  4A3V A;  4N3B A;  4ATG A;  1N54 A;  4D10 C;  3HDX A;  5E76 A;  4JVS A;  3URZ A;  5DIZ A;  3R7R A;  3S2A A;  4JEU A;  1OWM A;  4AY6 A;  3EHM A;  3CQC B;  1E8Z A;  3UT4 A;  4F3V A;  1EYH A;  2X6K A;  2YNQ A;  2YHE A;  1JWG A;  3LCA A;  4LRZ A;  4XKC A;  3VLD A;  4F53 A;  4GYO A;  3MEK A;  4J0U A;  3OXG A;  4L1B A;  2KM4 A;  2A4Z A;  3PE4 A;  3ZW3 A;  3KEZ A;  4KXK B;  2WVI A;  2FEZ A;  4HFG A;  4UWF A;  4L23 A;  4I1A A;  4GZC A;  3I4G A;  4A1G A;  3GW4 A;  3FTY A;  4CCA A;  2PM6 A;  3QB2 A;  1FVH A;  1VDY A;  3PEU B;  3UT8 A;  2PM7 A;  5AJD A;  3U64 A;  3QJZ A;  3QAQ A;  3Q47 B;  3JCK C;  4G2V A;  4H7X A;  2GRL A;  4EZL A;  1E8X A;  3CHQ A;  4H7Y A;  4U8H A;  4I1O B;  4B94 A;  1FVF A;  3MYV A;  4KBQ A;  3D9K A;  3D9J A;  3CV0 A;  4NRH B;  1UN8 A;  3L17 A;  2V0P A;  4ANV A;  3NF1 A;  3CLJ A;  3ASG A;  2XGM A;  1EF1 C;  3HIZ A;  4B0Z A;  3L54 A;  3FUE A;  1BPO A;  3FH5 A;  3CK7 A;  4P29 A;  3UQ3 A;  3KAE A;  4KT6 B;  3GZ1 A;  3UX4 A;  2E0I A;  4FUL A;  2M63 A;  1OWN A;  4AOF A;  5ANR A;  3NZS A;  5J08 A;  3CKC A;  2X6J A;  4UI9 J;  4LEU A;  2VTB B;  3EIJ A;  3T5X A;  2C0L A;  3FFL A;  3RU0 A;  1IYG A;  3CR3 A;  1L5J A;  2WQ7 A;  3CHO A;  4AIF A;  2MOW A;  4LER A;  4NUR A;  2MHK A;  3D9I A;  3LS8 A;  3MKQ A;  2CHX A;  1TJF A;  3ZYQ A;  3CSF A;  2Y4T A;  3I5P A;  3LJ3 A;  3P1U A;  4FHJ A;  3CHS A;  4GPK A;  2OVB A;  4FJZ A;  3B13 A;  4GA1 A;  4IN3 B;  2R17 C;  3QAR A;  2GW1 A;  2PQN A;  2X6I A;  4FA6 A;  3FUH A;  1HU3 A;  4AXH A;  4FC8 A;  3AS8 A;  1E90 A;  4UWH A;  1W3B A;  1IHG A;  4I43 A;  4I2W A;  5G04 C;  3FUM A;  3OTN A;  1EPU A;  5FZQ A;  4UWG A;  3D9M A;  2X6H A;  2JEK A;  2FF4 A;  3S7D A;  1E7U A;  2VSX E;  4AM9 A;  1HXI A;  4PH4 B;  4WWN A;  4EZK A;  2IOS A;  4I9C A;  4I9E A;  3PZD A;  3ML9 A;  5JHB A;  5LP0 A;  2XQ0 A;  1HG5 A;  4L2L A;  2RG8 A;  1H2U A;  4I2Z A;  5EDS A;  4ILH B;  2UY1 A;  3CHM A;  2YHC A;  2LSV A;  1TEZ A;  3ZIM A;  2VYI A;  4I17 A;  4UI9 C;  4L2Y A;  3ZGQ A;  2GRM A;  4JZY A;  5KJL A;  4PS8 A;  3FWV A;  4YVQ C;  1P5Q A;  3G2W A;  5T8I A;  4URK A;  3AU4 A;  1WY6 A;  2R59 A;  2WXH A;  1U3C A;  4Q94 A;  3ZXS A;  2PQR A;  1HG2 A;  3ZRH A;  5A6C A;  4UI9 K;  3SNX A;  4BX9 A;  2PZI A;  3B7U X;  4Y6W A;  4Q96 A;  3UT7 A;  3MKQ B;  4AJW A;  3IHV A;  3RRU A;  2OOE A;  3APC A;  4BTA A;  2I1J A;  1MHQ A;  5KCM A;  3AS4 A;  3FDH A;  3CVN A;  4HOQ A;  1YA0 A;  2KCK A;  4APO A;  4A55 A;  3Q4A B;  3OAW A;  4LCT A;  3IEG A;  1UJK A;  4DK5 A;  4OVU A;  3S7J A;  4HXI A;  3SZ7 A;  4BTB A;  2XRZ A;  4HOT A;  3VTY A;  3PE3 A;  2KC7 A;  3FU5 A;  3NZU A;  2RD0 A;  3P2B A;  1Z3Y A;  2AWI A;  3PNT B;  1S0P A;  3EJN A;  3G2U A;  3LYA A;  4J8F A;  3UUX A;  4FP7 A;  1IQU A;  1XNF A;  4I6E A;  3FUD A;  4JW1 A;  4WAF A;  5D0Q D;  1ZBP A;  4G25 A;  3D3M A;  2PL2 A;  3CK9 A;  5A23 A;  1E7V A;  2WQ6 A;  2V5F A;  1PAQ A;  2C2L A;  2KZT B;  4EZJ A;  3SHF A;  2V8S E;  3B7S A;  5G05 J;  4WWO A;  1HS6 A;  3O4Z A;  2CG3 A;  4KYO B;  2WXR A;  3MX3 A;  4WWP A;  4GCN A;  3ULQ A;  2XHE A;  3PRZ A;  4JA9 A;  4G11 A;  2XRY A;  3BEE A;  3BG1 B;  4CGW A;  4WNG A;  5CMW A;  2VSY A;  4C0M A;  3NQP A;  2IJG X;  5JJT A;  3MKR A;  5G04 J;  3LY8 A;  4JXT A;  2L0I A;  4UQZ A;  3FU6 A;  5FWQ A;  4KVO A;  5JJ6 A;  3SGH A;  2VTB A;  2XCB A;  3I3N A;  4XI0 A;  5LOZ A;  4DI3 A;  3Q15 A;  4HOS A;  4GZ6 A;  1SQM A;  3PRE A;  4PDX A;  5BT1 A;  2E2E A;  1HX8 A;  5JJ7 A;  3IBE A;  5CCL A;  4U07 A;  5LFA A;  3FU0 A;  4UWL A;  3JQ0 A;  1OWO A;  4IYP A;  3CHP A;  4CT4 A;  3PDN A;  3FTS A;  4G26 A;  4XIF A;  1HF8 A;  4TRQ A;  3AU5 A;  3MA5 A;  5FTP A;  4N3A A;  2KZT A;  3EIQ C;  1KT1 A;  2NXP A;  4QFV A;  5FZR A;  2FUL A;  1PC2 A;  3L6A A;  4GU5 A;  4JC8 A;  3TG5 A;  1JUQ A;  3MGB A;  3LXU X;  4FJY A;  3U66 A;  4N39 A;  4PUC A;  3RO2 A;  2GGF A;  4XZ4 A;  4GYW A;  2AXZ A;  3LPZ A;  3U4T A;  3ZVV A;  3ESL A;  4XX5 A;  2VQ2 A;  2WXF A;  4J8D A;  4CT0 A;  4GCO A;  2X38 A;  3RKV A;  2Y3A A;  3FH7 A;  4CGV A;  3ONK A;  5M72 A;  3C98 A;  4ANX A;  2UWJ G;  3MZL B;  1NZN A;  4PS3 A;  4FHK A;  4GA0 A;  4EPZ A;  3LVQ E;  4YVO A;  2EQX A;  5BUZ A;  5KJM A;  1WAO 1;  3ASF A;  2WXK A;  1IQR A;  4N5C A;  1H19 A;  4J8S A;  4NAC A;  2WQH A;  2X3M A;  3U9W A;  3ZFW A;  4B8C B;  4BT8 A;  4CEM A;  4XI9 A;  4TUU A;  3FY4 A;  2IF4 A;  4BY6 A;  3FUK A;  4N2S A;  1UN9 A;  2IQC A;  3MJW A;  3CGH A;  4N3C A;  1UW4 B;  3ENE A;  2AXU A;  4GYY A;  4U04 A;  3ZHE A;  4BX8 A;  5AEN A;  3FU3 A;  1HFA A;  3TG4 A;  4M3O A;  3LDZ A;  4AY5 A;  5BV1 A;  3LVR E;  5LX8 A;  3TGO A;  1HE8 A;  3Q49 B;  2Y4U A;  3CVL A;  2FO7 A;  3LEW A;  3R7Q A;  4EBA G;  2WXO A;  1SZA A;  4GA2 A;  4BT9 A;  2WXN A;  5CHE E;  2IU1 A;  3D9N A;  3CQG B;  2L0T B;  3DPD A;  3RRN B;  4AV7 A;  1ELR A;  1KT0 A;  3T8M A;  1Z6T A;  2I2O A;  1MQS A;  4TV3 A;  3TXM A;  1GW6 A;  1NA3 A;  4O6F A;  2HM8 A;  2J4B A;  4NQ0 A;  4AVX A;  5BPP A;  3JYS A;  4G24 A;  2HR2 A;  2BTD A;  4KMO A;  3ML8 A;  4WND A;  4K03 A;  2WXP A;  5BNW A;  3L22 A;  5DBK A;  2R5S A;  1H2V C;  1JPL A;  2HYZ A;  1XGW A;  1NP7 A;  5ANL A;  3IV0 A;  5T4Y A;  5FZS A;  2YIN A;  4ILI A;  3QK0 A;  3G2V A;  2DIW A;  4KZC A;  3CVW A;  3CEQ A;  3O48 A;  2DCP A;  3MCX A;  3AS5 A;  4JA7 A;  2CFU A;  2VGX B;  2JLB A;  5CCM A;  1LF8 A;  4JHR A;  5G55 A;  3Q5M A;  3PEV B;  3ZPJ A;  4DLO A;  3QWV A;  4JEH A;  5C1D A;  3ASH A;  4OVV A;  4XKB A;  4ABN A;  2XGS A;  4CRW A;  5BW8 C;  1DVP A;  3MV2 B;  2V4L A;  4AEZ C;  3CKB A;  3TL5 A;  3FTZ A;  2ILR A;  2NSZ A;  4GB9 A;  3SBS A;  3LY7 A;  2I9C A;  4FLB A;  3TJP A;  1E96 B;  1TJC A;  1H0A A;  3LY9 A;  4DJA A;  3HHM A;  2ZU6 B;  3QDN A;  3D9P A;  5AYW D;  3ZYM A;  4G1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...