3CHMA

Crystal structure of pci domain from a. thaliana cop9 signalosome subunit 7 (csn7)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
161
Chain Sequence
EQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COP9 signalosome complex subunit 7
publication title The Arabidopsis COP9 signalosome subunit 7 is a model PCI domain protein with subdomains involved in COP9 signalosome assembly
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 57
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3chmA00
3TXNA 3JCKC 2MRIA 3T5XA 3TXMA 4LCTA 4D10C 3CHMA
chains in the Genus database with same CATH superfamily
4MBGA 3RAUA 2WXJA 4ILHB 2DZOA 3MYVA 3B13A 4J8FA 3SI5A 1OXJA 4AEZC 4J8SA 3TWUA 2E0IA 5KJNA 2Y69E 3MZLB 4HOQA 4AJWA 2Y0BG 2WXFA 5CERB 4XEIG 3NB2A 4A1SA 4AM9A 1SVXA 1TNYA 2VSNA 2R5SA 4GTRA 5EX3A 5CRUA 3CEQA 2IONA 4JXTA 2PM7A 4U04A 5J90A 4JEUA 4QQIA 3HXBA 4XIFA 4GA1A 5AAOA 2GROB 3DEOA 5IY5E 2L0TB 4OVVA 5FZSA 2Y1LE 4C48B 3QC1A 4I6JA 3KS2A 5FIOA 5G04C 4J8EA 1KT1A 1NZNA 4RLYA 4WWNA 4XI0A 2C2LA 3EIQC 4GMLA 4H7XA 1LD7A 2H6HA 1ZBPA 2WXPA 5CMWA 5EIDA 4AY6A 2P9UG 3FUMA 4FADA 2CFZA 4I1OB 1SA4A 4URKA 5ENOD 2AXUA 2P58C 4K03A 4HLEA 2EILE 3R7QA 1TYQG 1OCRE 3CGHA 1N4PA 3JXIA 1TN6A 2DYRE 5HI7A 3DRAA 4EQFA 4U07A 4LCTA 2P9LG 3Q5MA 5AJDA 2BTDA 3TG5A 3RO2A 2V5FA 1H6OA 4JZYA 4I2WA 5CRVA 4WNDA 1D9SA 3QARA 3ESKA 4G1TA 4J0UA 1Q2ZA 1HS6A 3G2SA 2WMOA 1ELRA 4FHJA 2AXZA 1SZ9A 2R59A 4JHKA 1LTXA 1YMPA 4CT4A 2WMNA 1KZOA 2P9NG 5JA4D 5ENNA 1RZ4A 2LNIA 3UMVA 5C2YA 4L1BA 1ELKA 2DCPA 4N3BA 1TNOA 3VLDA 4I1MA 2XEVA 3FDHA 4HI8A 2F0YA 3MKRA 4NIKA 3FTUA 3CK9A 3TWSA 1TJFA 4PS8A 3JQ1A 3CV0A 2QZAA 3ZN3A 5HS0A 2XRZA 1OCZE 3UM1A 3SNXA 3MA5A 4AOFA 2VYIA 1BLXB 3PNLB 4EPZA 3LVRE 3FUHA 4I6EA 2VSXE 4BY6A 4EBAA 1N9AA 4HOTA 2ETCA 1JWFA 2P9IG 5DIZA 3ZYKA 3Q4AB 2XS8A 2HM8A 4MKTA 4YDWA 2XS1A 4RG9A 4BFRA 4GMRA 1Y6IA 3VTYA 2R03A 3ULYA 4JW1A 2ZIRA 3FTSA 4F1PA 4U8VD 3HDXA 4U96D 3MJWA 2H6IA 2WXRA 3SO8A 1NFIE 2X6JA 5BV0A 2XRYA 4HORA 1N52A 4GA0A 3FTVA 2Y3AA 3UTMA 2H6FA 3AG4E 1H6KA 3CHPA 2F8YA 2J07A 3HXFA 4AP2A 2XPYA 3G2TA 4XZ4A 3UIOC 2LUHA 3RK6A 3MCXA 1FCHA 4GTPA 4TRQA 4L9PA 3S7DA 3FFLA 2WXHA 1QYMA 3ML8A 3GZ1A 5AJLA 4CEMA 1OT8A 4AIFA 5HQ8A 3FUDA 5CCMA 4GB9A 3CHRA 1MX2A 3ABKE 2DYSE 1JPLA 4GZ3A 3B7RL 2KZTB 1E8WA 4IYPA 4N3CA 5KCMA 1K1AA 3FU0A 3FULA 3TWWA 1OWLA 1HU3A 2OVFA 4YVQC 2IO3C 3EDTB 3L16A 3SFZA 3Q78A 2XPIA 4BTAA 4GCOA 3JUIA 3R9MA 4FLBA 3TWTA 1E96B 4N5CA 3O4ZA 4NURA 1E90A 2YHCA 1SQMA 2CHXA 1N0QA 1E8YA 4JVSA 4G8KA 2Q7FA 4LSZE 5KBAA 1OWOA 1B89A 4HS2A 2KM4A 4WNFA 3ASHA 2Y4TA 2QFCA 2J08A 3J5PA 4U0ZA 4DPRA 4P29A 2YINA 3CVXA 2WXNA 2YHEA 5FWQA 4FC8A 4C0EA 2QYJA 4Q69A 1WM5A 1JCRA 5CBNA 3CK8A 5EN5D 3S7BA 3SZ7A 2CG3A 1UW4B 1PAQA 3IHVA 3SQVA 3RRNB 1WY6A 1UOHA 2L0IA 2V0PA 3Q9UC 3I4RB 1OCCE 4U8HA 4RVBA 5T3RA 3FUIA 5CCLA 4UQXA 3BQOA 2MYOA 4GZ6A 4BESA 3C3RA 5FQ8A 1AP7A 4AY5A 3SD5A 3SF4A 1S0PA 2MOWA 3AAAC 3WG7E 5FQ4A 4K5CA 4WWOA 5LX8A 2F37A 4EZKA 3Q49B 4CYMD 1MJ0A 4APOA 1JUQA 2X38A 3B7TA 3CVVA 3BU8A 1N94A 2DZNA 3ZNGA 1MYOA 4N5QA 4K5AB 4GAAA 3ABLE 4GYYA 4MRUA 3UKRG 2FF4A 1WG0A 3ZFWA 4WNGA 3ZYLA 4GA2A 3D9IA 2KC7A 2X3MA 4YVOA 2KCLA 3D9JA 2J4BA 4A3TA 3L54A 4RG6A 3CVPA 3DXMG 4KYOB 1HG5A 2A5UA 3L22A 4W9RA 2GRPB 3S7JA 3FH8A 2IU1A 3CVUA 2LAIA 3SFXA 3B95A 3TAXA 5HRYA 3CSTA 4WAFA 5CBOA 2VSOE 3LDZA 3L9TA 3APDA 3PREA 2RKKA 5ENRD 2GRLA 4JD2G 3PS6A 2VGXA 3ISMC 4KZCA 1H6PA 4UI9C 5ENPD 2VTBA 4GPMA 4BSXA 2XEEA 1IHBA 5DBKA 3EJNA 2KATA 5EKQD 3Q7AA 1E8ZA 3L6AA 4KZ0A 1QQEA 5LOZA 3BG0B 3DSTA 5G04J 1JCSA 1HFAA 4F1SA 3T5VA 4N39A 4BT9A 5FINA 5FZQA 1HF8A 4Y6WA 3UINC 3ZU7B 2GRRB 5AIJA 1MQSA 4HRNA 1BI7B 1Z5SC 4HRLA 3RIBA 3T5XA 3CR3A 1PC2A 1LD8A 3V2XA 1QNFA 4ILIA 1NA0A 2LO6A 3GYZA 1W3BA 3ZIMA 2C0LA 5EYPF 2IEJA 5D0OD 4KVMA 2XHEA 3FU3A 2X6HA 3HG0D 5G05C 2GRQB 5AQAA 4KMOA 2NXPA 3UT7A 4LERA 1N4RA 4LEUA 1DCEA 3E33A 1K3ZD 5ANRA 3PRZA 3PUKA 3TXMA 3FTWA 5AQ9A 1NP7A 4ANVA 4U0UA 1XGWA 1OY3D 2XCBA 4BERA 2KXPC 3RJVA 3ENEA 4DX1A 3ASFA 4ATGA 4HOUA 4OAUC 3LY9A 3PDNA 5KNHD 3PE4A 2C0MA 1X81A 4LG6A 3KSLA 4KVOA 3G2WA 5ENSD 3QKYA 2NC9A 3W9GA 5FJYA 2B0OE 3NAWA 2XPZA 3HVEA 4O60A 4HRMB 4N3AA 2CHZA 3PVLA 3SGHA 2RD0A 3ZXSA 3Q47B 4CGVA 4HFGA 3HXEA 3J5QB 5A6CA 2XENA 5AN8A 4I2ZA 4ANWA 2X6KA 4GTQA 4Q96A 2P9SG 2J8SD 2WQHA 3RO3A 4DUIA 3ZYMA 3PZ2A 3ZXPA 3APCA 4OAVB 3ZW3A 2P9PG 2FEZA 1S64A 3C5RA 3D9KA 1NA3A 5CEDB 4BT8A 4WNEA 1UN8A 2PL2A 3TWVA 4AV7A 1ZB1A 5BT1A 2L6JA 3L17A 4GTOA 3DBSA 2OEWA 2R05A 1PY1A 1UJJA 4HI9A 2FI7A 3QWVA 3CVNA 2QYUA 2EQXA 3TJPA 2HO1A 4B8CB 4G26A 3CK7A 3OAWA 3LPZA 1TN7A 3AG1E 3O48A 5B1AE 1JCQA 1HH8A 2GRMA 4JPSA 1HZ4A 4GCNA 3ULQA 2F8XK 3FTYA 2ETAA 4UWHA 3D9PA 3KEZA 1A17A 2XZTG 4M3OA 4U63A 1N0RA 2EIJE 4WWPA 4PDXA 4NACA 4XI9A 5JJTA 2R17C 3EU5A 4TV3A 2EINE 3FEYA 4JA7A 4PS7A 2AXVA 2V5QC 2WXMA 3AG3E 5CHEE 1Z6TA 3CIAA 4O1OA 2QY7A 5FZRA 1TJCA 1P5QA 3AS5A 4ACLA 5FTPA 4DX7D 4HOSA 4DK5A 1N4SA 2YQ8A 2AW6A 3LVQE 2BF0X 5D0QD 3ZGQA 4AXHA 3I5PA 5KJLA 4UUCA 4ABNA 4M7CA 4YDOA 4GYOA 4L7TA 3U64A 3AU5A 5EYLA 3AJIA 2KCVA 3GZ2A 2HR2A 4J7WA 4CCAA 4GTTA 4JB8P 4HXIA 2I6HA 3ML9A 3AG2E 3EIJA 3UKUG 3EHMA 3OXLA 3ASOE 3TWRA 3NOCD 5LP0A 3ZHEA 2MRIA 3U66A 3CLJA 3AS4A 3MGBA 4TUMA 3FH7A 4DLQA 4DJAA 2V4LA 3SHFA 3EHRA 3UM0A 4BX8A 3CHQA 2UY1A 1H2TC 3QWWA 4I9CA 3E34A 1OWPA 1KLXA 3D9HA 3Q79A 4FLHA 2WXGA 4B94A 3ZUVB 3K9IA 4OVUA 3CVQA 3Q15A 4C0MA 3FP3A 4JHJA 4A3VA 4Z68A 3DEPA 1SZAA 4BEPA 3CHSA 4DI4A 2J49A 3FUEA 3QK0A 3PE3A 5G2NA 5T8IA 3Q75A 2KCKA 3U9WA 4K0RA 3ASDA 3PUJA 3VLFA 1IKND 3TWXA 1D8DA 1H2VC 3D9MA 2IOSA 2M63A 2XGOA 4A63B 3Q7FA 1MZCA 4DI3A 2FULA 2H6GA 2I1KA 3ZKJA 4FA6A 4EZLA 1DNPA 1BPOA 3U4TA 1TNBA 4JL0A 4UWLA 2RG8A 3WXXA 5JMND 4F6RD 4UQYA 1VDYA 1U3CA 2RFAA 1FT1A 3FUKA 2PNNA 2OOEA 3DWLG 3I4GA 3CQGB 5BNWA 3PNTB 4G25A 4JHRA 3LYAA 3X2QE 3DSUA 3CSFA 1KPSB 4UI9J 4PH4B 3RSEG 4ANUA 3ASNE 1HG2A 3ZRHA 3HXDA 4GMJA 1XNFA 3TGOA 1FVFA 1KZPA 1TEZA 1WAO1 2JEKA 3RKVA 2IJGX 1BI8B 4ILGA 4N2QA 3CHMA 2OEVA 2LSVA 4TXPA 3ASGA 5BXOA 5D2MC 1DVPA 2ETBA 4H7YA 5LCWC 3UT4A 2VGXB 2Y4UA 2BEDA 2VTBB 2J4DA 3MX3A 3MV2B 1IQRA 4BSZB 4YNDA 3V31A 3T8KA 3ZVVA 5KWDA 2JABA 2VQ2A 3HHMA 3D9LA 3HYMB 5T4YA 4JA9A 5LFAA 1Y8MA 4I6GA 2ZXWE 4G2VA 3LJNA 5FT9A 3IBEA 2YNQA 4BWRA 3QB2A 1N54A 1INZA 1V55E 1O1TA 1EF1C 4HB5A 4UWFA 4FU3A 3FU5A 1H19A 2J9QA 4IULA 1D8EA 1GW6A 5G05J 3DSWA 1LF8A 3L08A 3DSVA 2IY0C 3TWQA 3UXGA 2WXQA 3IKOB 2UWJG 4FHKA 5ITZF 2JLBA 1ELWA 1UN9A 4EBAG 4X8QA 5JJ6A 1HE8A 4IN3B 3D9OA 3URZA 2XCCA 3T9KA 4EECA 1HXIA 3IEGA 2HYZA 2CFUA 3V79K 1NL4A 3RRUA 3T8MA 1MHQA 4BETA 3B7UX 2VSYA 3CVLA 4UWGA 3JCKC 2IF4A 2L9BA 1YA0A 2DIWA 5BV1A 5AARA 1K8KG 3FHEA 4G24A 4CZ2D 3CVWA 4Y6CA 2MHKA 3NZSA 5A23A 4QFVA 5EILA 4MS6A 5ARGA 5BXUA 4E85A 3KD7A 3Q9NC 3U3WA 3ABME 3R9AB 3UPVA 3CVYA 5EX0A 1TR4A 5JHAA 4UWKA 3ZPJA 3NQPA 3QOUA 2WXKA 3QAQA 3HVEB 2I2OA 4B89A 4I9EA 4TUUA 1HX8A 3NOGD 4CDNA 3R7RA 3BEEA 3UM3A 4J8YA 1OWMA 1X5BA 4NQ0A 1NI1A 5C1DA 4GTSA 2LXLA 1IXVA 3JQ0A 2LSUA 3EUVA 4I1AA 4E6HA 3LEWA 1JWGA 5ARFA 3JYSA 1DCQA 3SFYA 2NSZA 2WVIA 3MV3B 1FPPA 5AQBA 3CKBA 2OV8A 1OUVA 5CEAA 4F3VA 4FJZA 2X6IA 4APFA 1U2VG 2PZIA 4U0SA 3SBSA 4ZFHA 3TG4A 3B7SA 1E7UA 2OVBA 3OTNA 3ZEFA 1FVHA 4D10C 2XGMA 3IHYA 4GPKA 3FTZA 3ONLA 3FU6A 1E8XA 2IOLA 3P2BA 3W9FA 2EIKE 1EPUA 2BKKB 2IFUA 5FQ7A 4HLLA 2BUGA 2PQRA 1WDYA 2XGSA 3E32A 2WPVA 1IQUA 4GZ5A 5ANLA 4DX5D 1AWCB 1H0AA 4GU5A 5M72A 3UQ3A 4XKBA 4HBDA 4XX5A 4ANXA 4U95D 3QDNA 4K5BA 2NYJA 5ENQD 3QJZA 4FJYA 2FBNA 2WXOA 5ENTD 4GZDA 3D9NA 1SA5A 3PZ1A 4LUNU 3KSQA 1DC2A 4RQIA 2ZGDA 3HRAA 3UM2A 2IO2C 2GRNB 5J08A 3ONKA 4PUCA 4I17A 5B1BE 5HKPA 1SW6A 3I3NA 2CG2A 5AYWD 4O6FA 4L2YA 3DPYA 3NBNB 1S70B 1L5JA 1MX4A 4L2LA 4LNGA 3JUEA 2B6CA 3E37A 3IV0A 4NRHB 2VGYA 4J8DA 3NF1A 4RSYA 4G11A 2QC9A 2VGEA 3UI2A 2AVPA 2PM6A 1V54E 4F7AA 3P1UA 2ILRA 5CMYA 3PZ3A 3C72A 5H7PA 4CT0A 4ATZD 3C98A 4GTMA 1OWNA 2FO1E 4CDRA 1YYHA 4B0ZA 2OCCE 5BW8C 2WQ6A 4DX2A 2ZU6B 3ZHEB 3KAEA 3OXGA 1TN8A 3LY7A 4OYSA 2GGFA 3PEUB 4TXQA 2LAHA 3FWVA 1O5MA 4HVBA 1RW2A 3LCAA 4GTVA 4DX6D 2UY1B 1G3NB 1U3DA 4GZCA 5KJMA 2WB2A 2EIME 1O1SA 3EU9A 4JC8A 2A4ZA 4KXKB 3AS8A 1QZ2A 1EYHA 3LXUX 4FULA 4EHMA 1H2UA 3PH0C 4U8YD 2X6FA 3N71A 2V4HC 2WXIA 1MX6A 4LNBA 3GW4A 3JXJA 3TL5A 4JEHA 3V2OA 3HXCA 5JHBA 1ZU2A 2AWIA 3SY2A 5CECB 2ONDA 3MEKA 4TXRA 5E75A 4N2SA 3E30A 4CRWA 1N95A 1UJKA 1TNUA 1Z3XA 3FEXA 4EZJA 5B3SE 4J6IA 3DXKG 3SBTB 2ZISA 2GW1A 4UI9K 4U7EB 4ZHBA 4WUYA 1HO8A 1EDUA 4G23A 2FO7A 3FH5A 2KZTA 3Q73A 3LS8A 3DSSA 4B93B 3PZ4A 3EHQA 1K1BA 2IQCA 2R2LA 4A1GA 3FUFA 5JJ7A 2I9CA 3V30A 2V8SE 2KBXA 4R7LA 3NZUA 3PZDA 1IYGA 4KBQA 5LCWJ 3HIZA 4HNAD 4ACKA 2RFMA 3AU4A 2WXLA 1UG3A 4DRXE 5FQ6A 3IXEA 3QNKA 1O1RA 3D3MA 4BTBA 2A5EA 5AENA 1BU9A 3RU0A 1Z3YA 2WQ7A 3C3OA 3ESLA 4LRZA 4KT6B 2R02A 2DWZA 2DVWA 3B7BA 3PEVB 5AQ7A 2ZGGA 3UIPC 3CKCA 2WM9A 5KNGA 2VJ8A 3C3QA 4YDEA 4XE0A 5G55A 4F53A 1S63A 3KEAA 3EHNA 2DBAA 4I43A 3LY8A 5E76A 2J09A 5EIBE 4LNUD 2P2CP 4C9BB 3FTXA 3F6QA 2HE0A 3S2AA 4XKCA 4HQDA 3LJ3A 5D66A 3ULEG 2L6BA 3S7FA 1QBQA 4DLOA 3G2VA 3E4BA 3MKQB 3VLEA 3GZSA 2LXMA 4A55A 3FUNA 1IHGA 4CDMA 4BX9A 3CHOA 3BG1B 4ME2A 1BD8A 2PQNA 3LKUA 4V3IA 1TNZA 3FUJA 4B8AA 5BPPA 3ZYQA 4GYWA 1YCSB 2XEHA 3UUXA 3VTXA 3MKQA 2BKGA 3APFA 2XZDG 4IRUA 3DPDA 4O1PA 2AJAA 3FY4A 3QWPA 4AVXA 5KJKA 3G2UA 3RRMB 4PS3A 3UT8A 4MLPA 1KT0A 5EDSA 2XQ0A 3DSXA 1A5EA 1FT2A 4L23A 4UQZA 1OCOE 4Q94A 1N11A 5A7DB 2CHWA 5BUZA 3TXNA 1E7VA 3L82A 4CGWA 3UX4A 3BUAA 4YDYA 1N4QA 2E2EA 4FP7A 3OXFA 2P9KG 4G8LA 2I1JA 3L13A 3CQCB
chains in the Genus database with same CATH topology
4ABNA 5FQ7A 5FQ4A 4WWOA 2WXJA 4GYOA 2BUGA 2PQRA 4L7TA 2XGSA 3AU5A 4ILHB 2WPVA 1IQUA 4GZ5A 5ANLA 3U64A 3MYVA 3Q49B 4EZKA 3B13A 2KCVA 4J8FA 3SI5A 1H0AA 4APOA 3GZ2A 1JUQA 2HR2A 4AEZC 4GU5A 5M72A 3UQ3A 4J8SA 2X38A 4CCAA 2E0IA 4XKBA 5KJNA 3B7TA 3CVVA 4HXIA 2I6HA 3MZLB 3ML9A 4HOQA 4AJWA 3EIJA 4XX5A 2WXFA 3EHMA 3OXLA 4ANXA 3QDNA 4A1SA 5LP0A 4GAAA 3ZHEA 4AM9A 4GYYA 4MRUA 2MRIA 3QJZA 3U66A 4FJYA 2FBNA 2WXOA 2FF4A 3CLJA 2VSNA 3D9NA 4GZDA 3AS4A 3MGBA 3ZFWA 2R5SA 4WNGA 5EX3A 4LUNU 3CEQA 3FH7A 2IONA 3ZYLA 2V4LA 3SHFA 4DLQA 4DJAA 4GA2A 4JXTA 2PM7A 3D9IA 4BX8A 2KC7A 4U04A 5J90A 3CHQA 4JEUA 5J08A 2X3MA 4XIFA 4YVOA 2UY1A 4GA1A 2KCLA 1H2TC 3QWWA 4I9CA 3D9JA 2J4BA 4A3TA 2L0TB 3ONKA 4OVVA 3L54A 5FZSA 4RG6A 3CVPA 4PUCA 3QC1A 1OWPA 1KLXA 4I17A 4I6JA 4KYOB 1HG5A 3I3NA 3KS2A 5G04C 2A5UA 2CG2A 3L22A 2WXGA 4FLHA 4W9RA 4B94A 4J8EA 5AYWD 1KT1A 4O6FA 1NZNA 4L2YA 3S7JA 4WWNA 3FH8A 3K9IA 4XI0A 4OVUA 2C2LA 2IU1A 3CVQA 3EIQC 3CVUA 4GMLA 4H7XA 1L5JA 2LAIA 3Q15A 4C0MA 3FP3A 4JHJA 3TAXA 4A3VA 4L2LA 3CSTA 1ZBPA 4WAFA 2VSOE 1SZAA 3LDZA 3IV0A 3CHSA 4NRHB 2WXPA 2VGYA 5CMWA 4DI4A 4J8DA 4AY6A 3APDA 2J49A 3FUMA 3NF1A 2CFZA 3FUEA 3PREA 4I1OB 4FADA 4URKA 4RSYA 2GRLA 4G11A 2AXUA 3QK0A 3PE3A 3PS6A 2P58C 5G2NA 5T8IA 4K03A 4HLEA 2KCKA 2VGXA 2AVPA 3R7QA 3U9WA 4KZCA 2PM6A 4K0RA 3CGHA 4UI9C 4F7AA 3P1UA 2ILRA 3ASDA 5CMYA 2VTBA 3PUJA 3VLFA 4BT9A 1H2VC 3D9MA 4BSXA 2IOSA 2M63A 5HI7A 4CT0A 2XGOA 3C98A 4DI3A 5DBKA 4EQFA 1OWNA 2FULA 4U07A 3EJNA 2KATA 5EKQD 2I1KA 1E8ZA 4LCTA 4CDRA 3L6AA 3Q5MA 5AJDA 2BTDA 4FA6A 4KZ0A 3TG5A 3RO2A 2V5FA 1DNPA 1QQEA 4JZYA 5LOZA 4B0ZA 4EZLA 1BPOA 3BG0B 4I2WA 3U4TA 5BW8C 2WQ6A 4WNDA 5G04J 2ZU6B 3QARA 3ZHEB 3KAEA 3OXGA 4JL0A 3ESKA 4G1TA 4UWLA 1HFAA 4F1SA 3LY7A 4J0UA 2RG8A 4OYSA 3T5VA 1HS6A 3WXXA 3G2SA 2GGFA 2WMOA 1ELRA 3PEUB 2LAHA 4FHJA 3FWVA 4N39A 1VDYA 4UQYA 5FZQA 1U3CA 1SZ9A 2AXZA 2R59A 4JHKA 4HVBA 1HF8A 4Y6WA 3LCAA 3FUKA 5AIJA 4CT4A 1MQSA 2OOEA 2UY1B 2WMNA 3I4GA 1U3DA 3CQGB 4GZCA 5BNWA 5KJMA 3RIBA 3T5XA 2WB2A 5ENNA 3CR3A 1PC2A 3PNTB 4G25A 4JHRA 1QNFA 3LYAA 2LNIA 4ILIA 5C2YA 3UMVA 4L1BA 1ELKA 4JC8A 1NA0A 2A4ZA 2DCPA 3CSFA 4N3BA 2LO6A 4UI9J 4PH4B 3VLDA 3GYZA 4I1MA 1W3BA 4ANUA 3ZIMA 4KXKB 1HG2A 2XEVA 3AS8A 4GMJA 1QZ2A 3FDHA 3ZRHA 1EYHA 1XNFA 2C0LA 3LXUX 4FULA 1FVFA 1H2UA 3PH0C 3TGOA 1WAO1 3MKRA 1TEZA 3FTUA 2X6FA 5D0OD 4KVMA 2JEKA 3CK9A 3N71A 2XHEA 2WXIA 3FU3A 2IJGX 3RKVA 2X6HA 3GW4A 4ILGA 1TJFA 4N2QA 3TL5A 5G05C 4JEHA 4PS8A 3JQ1A 5JHBA 3CHMA 1ZU2A 2AWIA 2LSVA 3CV0A 4KMOA 2ONDA 3ASGA 3MEKA 3ZN3A 2NXPA 1DVPA 4LERA 5E75A 3UT7A 2XRZA 4H7YA 5LCWC 4N2SA 3UT4A 2VGXB 3SNXA 4CRWA 1UJKA 4LEUA 3MA5A 2Y4UA 1Z3XA 4AOFA 3FEXA 2VYIA 4EZJA 4J6IA 2VTBB 5ANRA 2J4DA 3MX3A 3PRZA 3PNLB 4EPZA 3LVRE 3MV2B 3SBTB 3PUKA 1IQRA 3FUHA 2GW1A 4I6EA 3TXMA 4UI9K 3FTWA 2VSXE 4WUYA 1HO8A 1NP7A 4YNDA 4BY6A 1EDUA 4G23A 4EBAA 3ZVVA 2FO7A 4ANVA 2VQ2A 3HHMA 3FH5A 4U0UA 2KZTA 4HOTA 1XGWA 2XCBA 1JWFA 3D9LA 3HYMB 5DIZA 5T4YA 3ZYKA 4JA9A 3Q4AB 3RJVA 3ENEA 2HM8A 5LFAA 1Y8MA 4I6GA 3ASFA 4MKTA 4ATGA 4HOUA 3LS8A 3LY9A 3PDNA 4G2VA 5FT9A 3IBEA 2YNQA 4BWRA 3PE4A 3QB2A 2C0MA 4RG9A 4BFRA 1N54A 1INZA 1Y6IA 3VTYA 4KVOA 1EF1C 2IQCA 3G2WA 4JW1A 4A1GA 3FTSA 4UWFA 4FU3A 3QKYA 3FU5A 3HDXA 2NC9A 3FUFA 1H19A 2J9QA 3MJWA 4IULA 2I9CA 5JJ7A 5FJYA 2WXRA 2V8SE 1GW6A 5G05J 2XPZA 3HVEA 2X6JA 1LF8A 3L08A 4R7LA 3NZUA 5BV0A 3PZDA 1IYGA 2WXQA 2XRYA 4KBQA 4N3AA 3IKOB 2CHZA 5LCWJ 4HORA 3PVLA 2UWJG 4FHKA 1N52A 3HIZA 2JLBA 4GA0A 1ELWA 1UN9A 3SGHA 4ACKA 4EBAG 3FTVA 3AU4A 2WXLA 2Y3AA 5JJ6A 1HE8A 2RD0A 4IN3B 1UG3A 1H6KA 3D9OA 3URZA 3CHPA 3ZXSA 2XCCA 5FQ6A 2J07A 3QNKA 3Q47B 4EECA 4CGVA 4HFGA 1HXIA 3IEGA 4AP2A 4BTBA 2HYZA 3D3MA 2XPYA 5A6CA 3G2TA 4I2ZA 4ANWA 4XZ4A 5AENA 2X6KA 2CFUA 4Q96A 3RU0A 2WQHA 3RO3A 3RK6A 3RRUA 1Z3YA 3MCXA 2WQ7A 3T8MA 1MHQA 3ESLA 1FCHA 3B7UX 4LRZA 4TRQA 4KT6B 3PEVB 3S7DA 3ZYMA 2VSYA 3CKCA 3FFLA 3CVLA 2WM9A 3APCA 2WXHA 3ML8A 4UWGA 2VJ8A 3JCKC 4XE0A 3ZW3A 2IF4A 2L9BA 5G55A 1YA0A 3GZ1A 5AJLA 4F53A 4CEMA 2DIWA 2FEZA 3EHNA 5BV1A 4AIFA 5HQ8A 2DBAA 3D9KA 3FUDA 4I43A 5CCMA 1NA3A 3LY8A 3FHEA 4GB9A 4G24A 4BT8A 4WNEA 2J09A 5E76A 1UN8A 2PL2A 3CHRA 3CVWA 4Y6CA 2MHKA 3NZSA 4C9BB 3FTXA 4AV7A 5A23A 1JPLA 4GZ3A 3B7RL 4QFVA 2KZTB 1E8WA 4IYPA 4N3CA 4MS6A 5ARGA 5KCMA 3S2AA 4XKCA 3FU0A 4E85A 3LJ3A 3FULA 3KD7A 3U3WA 5BT1A 3S7FA 3R9AB 2L6JA 4DLOA 3L17A 3UPVA 1OWLA 3E4BA 3G2VA 1HU3A 2OVFA 3DBSA 3CVYA 5EX0A 4YVQC 3MKQB 1PY1A 3EDTB 5JHAA 3L16A 3SFZA 3VLEA 3GZSA 2XPIA 4BTAA 4GCOA 3JUIA 1UJJA 4UWKA 4A55A 3FUNA 3ZPJA 4FLBA 3NQPA 1IHGA 1E96B 3QOUA 4CDMA 2FI7A 4N5CA 2WXKA 3QWVA 3O4ZA 3QAQA 3HVEB 3CVNA 4BX9A 2I2OA 4NURA 2EQXA 3TJPA 1E90A 4I9EA 4TUUA 4B89A 2HO1A 1HX8A 1SQMA 2YHCA 3CHOA 2CHXA 4B8CB 4CDNA 3BG1B 4G26A 3R7RA 3CK7A 3BEEA 1E8YA 4ME2A 4JVSA 1OWMA 3OAWA 2PQNA 1X5BA 3LKUA 4NQ0A 4V3IA 3LPZA 2Q7FA 5C1DA 3FUJA 3O48A 4B8AA 1HH8A 3JQ0A 1OWOA 1B89A 4HS2A 2KM4A 4WNFA 3ASHA 5BPPA 2GRMA 2Y4TA 4JPSA 3ZYQA 1HZ4A 4GCNA 4GYWA 2LSUA 3ULQA 2QFCA 2J08A 3UUXA 3FTYA 3VTXA 3MKQA 4I1AA 4U0ZA 4UWHA 4P29A 2YINA 4DPRA 3D9PA 2WXNA 4E6HA 3CVXA 3KEZA 2YHEA 1JWGA 3LEWA 1A17A 3APFA 4FC8A 5FWQA 4C0EA 4M3OA 5ARFA 4Q69A 3JYSA 1WM5A 4U63A 4IRUA 2NSZA 4WWPA 2WVIA 3CK8A 3DPDA 4PDXA 3MV3B 4NACA 4XI9A 3S7BA 3SZ7A 5JJTA 2R17C 2CG3A 1UW4B 3CKBA 2OV8A 1PAQA 3IHVA 3FY4A 1OUVA 4TV3A 3RRNB 1WY6A 4F3VA 3FEYA 3QWPA 4AVXA 4FJZA 2L0IA 4JA7A 5KJKA 2X6IA 3G2UA 3RRMB 2V0PA 4PS3A 4APFA 3I4RB 3UT8A 4PS7A 4MLPA 2AXVA 2PZIA 2WXMA 1KT0A 4U0SA 2XQ0A 5EDSA 5CHEE 3SBSA 1Z6TA 4U8HA 3TG4A 4RVBA 3B7SA 5T3RA 4L23A 1E7UA 2OVBA 3CIAA 3FUIA 3OTNA 4Q94A 4UQZA 3ZEFA 5CCLA 2QY7A 5FZRA 1TJCA 5A7DB 4UQXA 2CHWA 1P5QA 3AS5A 4ACLA 5BUZA 5FTPA 1FVHA 4HOSA 4D10C 2XGMA 3TXNA 3IHYA 5LX8A 4GZ6A 4DK5A 1E7VA 4GPKA 2YQ8A 3FTZA 3ONLA 2AW6A 5FQ8A 3FU6A 3LVQE 4CGWA 1E8XA 3UX4A 2BF0X 4AY5A 2IOLA 3P2BA 3SD5A 3SF4A 1S0PA 5D0QD 3ZGQA 2E2EA 1EPUA 4FP7A 3I5PA 3OXFA 4AXHA 2IFUA 5KJLA 2I1JA 3L13A 2MOWA 3CQCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TXN A;  3JCK C;  2MRI A;  3T5X A;  3TXM A;  4LCT A;  4D10 C;  3CHM A; 
#chains in the Genus database with same CATH topology
 4MBG A;  3RAU A;  2WXJ A;  4ILH B;  2DZO A;  3MYV A;  3B13 A;  4J8F A;  3SI5 A;  1OXJ A;  4AEZ C;  4J8S A;  3TWU A;  2E0I A;  5KJN A;  2Y69 E;  3MZL B;  4HOQ A;  4AJW A;  2Y0B G;  2WXF A;  5CER B;  4XEI G;  3NB2 A;  4A1S A;  4AM9 A;  1SVX A;  1TNY A;  2VSN A;  2R5S A;  4GTR A;  5EX3 A;  5CRU A;  3CEQ A;  2ION A;  4JXT A;  2PM7 A;  4U04 A;  5J90 A;  4JEU A;  4QQI A;  3HXB A;  4XIF A;  4GA1 A;  5AAO A;  2GRO B;  3DEO A;  5IY5 E;  2L0T B;  4OVV A;  5FZS A;  2Y1L E;  4C48 B;  3QC1 A;  4I6J A;  3KS2 A;  5FIO A;  5G04 C;  4J8E A;  1KT1 A;  1NZN A;  4RLY A;  4WWN A;  4XI0 A;  2C2L A;  3EIQ C;  4GML A;  4H7X A;  1LD7 A;  2H6H A;  1ZBP A;  2WXP A;  5CMW A;  5EID A;  4AY6 A;  2P9U G;  3FUM A;  4FAD A;  2CFZ A;  4I1O B;  1SA4 A;  4URK A;  5ENO D;  2AXU A;  2P58 C;  4K03 A;  4HLE A;  2EIL E;  3R7Q A;  1TYQ G;  1OCR E;  3CGH A;  1N4P A;  3JXI A;  1TN6 A;  2DYR E;  5HI7 A;  3DRA A;  4EQF A;  4U07 A;  4LCT A;  2P9L G;  3Q5M A;  5AJD A;  2BTD A;  3TG5 A;  3RO2 A;  2V5F A;  1H6O A;  4JZY A;  4I2W A;  5CRV A;  4WND A;  1D9S A;  3QAR A;  3ESK A;  4G1T A;  4J0U A;  1Q2Z A;  1HS6 A;  3G2S A;  2WMO A;  1ELR A;  4FHJ A;  2AXZ A;  1SZ9 A;  2R59 A;  4JHK A;  1LTX A;  1YMP A;  4CT4 A;  2WMN A;  1KZO A;  2P9N G;  5JA4 D;  5ENN A;  1RZ4 A;  2LNI A;  3UMV A;  5C2Y A;  4L1B A;  1ELK A;  2DCP A;  4N3B A;  1TNO A;  3VLD A;  4I1M A;  2XEV A;  3FDH A;  4HI8 A;  2F0Y A;  3MKR A;  4NIK A;  3FTU A;  3CK9 A;  3TWS A;  1TJF A;  4PS8 A;  3JQ1 A;  3CV0 A;  2QZA A;  3ZN3 A;  5HS0 A;  2XRZ A;  1OCZ E;  3UM1 A;  3SNX A;  3MA5 A;  4AOF A;  2VYI A;  1BLX B;  3PNL B;  4EPZ A;  3LVR E;  3FUH A;  4I6E A;  2VSX E;  4BY6 A;  4EBA A;  1N9A A;  4HOT A;  2ETC A;  1JWF A;  2P9I G;  5DIZ A;  3ZYK A;  3Q4A B;  2XS8 A;  2HM8 A;  4MKT A;  4YDW A;  2XS1 A;  4RG9 A;  4BFR A;  4GMR A;  1Y6I A;  3VTY A;  2R03 A;  3ULY A;  4JW1 A;  2ZIR A;  3FTS A;  4F1P A;  4U8V D;  3HDX A;  4U96 D;  3MJW A;  2H6I A;  2WXR A;  3SO8 A;  1NFI E;  2X6J A;  5BV0 A;  2XRY A;  4HOR A;  1N52 A;  4GA0 A;  3FTV A;  2Y3A A;  3UTM A;  2H6F A;  3AG4 E;  1H6K A;  3CHP A;  2F8Y A;  2J07 A;  3HXF A;  4AP2 A;  2XPY A;  3G2T A;  4XZ4 A;  3UIO C;  2LUH A;  3RK6 A;  3MCX A;  1FCH A;  4GTP A;  4TRQ A;  4L9P A;  3S7D A;  3FFL A;  2WXH A;  1QYM A;  3ML8 A;  3GZ1 A;  5AJL A;  4CEM A;  1OT8 A;  4AIF A;  5HQ8 A;  3FUD A;  5CCM A;  4GB9 A;  3CHR A;  1MX2 A;  3ABK E;  2DYS E;  1JPL A;  4GZ3 A;  3B7R L;  2KZT B;  1E8W A;  4IYP A;  4N3C A;  5KCM A;  1K1A A;  3FU0 A;  3FUL A;  3TWW A;  1OWL A;  1HU3 A;  2OVF A;  4YVQ C;  2IO3 C;  3EDT B;  3L16 A;  3SFZ A;  3Q78 A;  2XPI A;  4BTA A;  4GCO A;  3JUI A;  3R9M A;  4FLB A;  3TWT A;  1E96 B;  4N5C A;  3O4Z A;  4NUR A;  1E90 A;  2YHC A;  1SQM A;  2CHX A;  1N0Q A;  1E8Y A;  4JVS A;  4G8K A;  2Q7F A;  4LSZ E;  5KBA A;  1OWO A;  1B89 A;  4HS2 A;  2KM4 A;  4WNF A;  3ASH A;  2Y4T A;  2QFC A;  2J08 A;  3J5P A;  4U0Z A;  4DPR A;  4P29 A;  2YIN A;  3CVX A;  2WXN A;  2YHE A;  5FWQ A;  4FC8 A;  4C0E A;  2QYJ A;  4Q69 A;  1WM5 A;  1JCR A;  5CBN A;  3CK8 A;  5EN5 D;  3S7B A;  3SZ7 A;  2CG3 A;  1UW4 B;  1PAQ A;  3IHV A;  3SQV A;  3RRN B;  1WY6 A;  1UOH A;  2L0I A;  2V0P A;  3Q9U C;  3I4R B;  1OCC E;  4U8H A;  4RVB A;  5T3R A;  3FUI A;  5CCL A;  4UQX A;  3BQO A;  2MYO A;  4GZ6 A;  4BES A;  3C3R A;  5FQ8 A;  1AP7 A;  4AY5 A;  3SD5 A;  3SF4 A;  1S0P A;  2MOW A;  3AAA C;  3WG7 E;  5FQ4 A;  4K5C A;  4WWO A;  5LX8 A;  2F37 A;  4EZK A;  3Q49 B;  4CYM D;  1MJ0 A;  4APO A;  1JUQ A;  2X38 A;  3B7T A;  3CVV A;  3BU8 A;  1N94 A;  2DZN A;  3ZNG A;  1MYO A;  4N5Q A;  4K5A B;  4GAA A;  3ABL E;  4GYY A;  4MRU A;  3UKR G;  2FF4 A;  1WG0 A;  3ZFW A;  4WNG A;  3ZYL A;  4GA2 A;  3D9I A;  2KC7 A;  2X3M A;  4YVO A;  2KCL A;  3D9J A;  2J4B A;  4A3T A;  3L54 A;  4RG6 A;  3CVP A;  3DXM G;  4KYO B;  1HG5 A;  2A5U A;  3L22 A;  4W9R A;  2GRP B;  3S7J A;  3FH8 A;  2IU1 A;  3CVU A;  2LAI A;  3SFX A;  3B95 A;  3TAX A;  5HRY A;  3CST A;  4WAF A;  5CBO A;  2VSO E;  3LDZ A;  3L9T A;  3APD A;  3PRE A;  2RKK A;  5ENR D;  2GRL A;  4JD2 G;  3PS6 A;  2VGX A;  3ISM C;  4KZC A;  1H6P A;  4UI9 C;  5ENP D;  2VTB A;  4GPM A;  4BSX A;  2XEE A;  1IHB A;  5DBK A;  3EJN A;  2KAT A;  5EKQ D;  3Q7A A;  1E8Z A;  3L6A A;  4KZ0 A;  1QQE A;  5LOZ A;  3BG0 B;  3DST A;  5G04 J;  1JCS A;  1HFA A;  4F1S A;  3T5V A;  4N39 A;  4BT9 A;  5FIN A;  5FZQ A;  1HF8 A;  4Y6W A;  3UIN C;  3ZU7 B;  2GRR B;  5AIJ A;  1MQS A;  4HRN A;  1BI7 B;  1Z5S C;  4HRL A;  3RIB A;  3T5X A;  3CR3 A;  1PC2 A;  1LD8 A;  3V2X A;  1QNF A;  4ILI A;  1NA0 A;  2LO6 A;  3GYZ A;  1W3B A;  3ZIM A;  2C0L A;  5EYP F;  2IEJ A;  5D0O D;  4KVM A;  2XHE A;  3FU3 A;  2X6H A;  3HG0 D;  5G05 C;  2GRQ B;  5AQA A;  4KMO A;  2NXP A;  3UT7 A;  4LER A;  1N4R A;  4LEU A;  1DCE A;  3E33 A;  1K3Z D;  5ANR A;  3PRZ A;  3PUK A;  3TXM A;  3FTW A;  5AQ9 A;  1NP7 A;  4ANV A;  4U0U A;  1XGW A;  1OY3 D;  2XCB A;  4BER A;  2KXP C;  3RJV A;  3ENE A;  4DX1 A;  3ASF A;  4ATG A;  4HOU A;  4OAU C;  3LY9 A;  3PDN A;  5KNH D;  3PE4 A;  2C0M A;  1X81 A;  4LG6 A;  3KSL A;  4KVO A;  3G2W A;  5ENS D;  3QKY A;  2NC9 A;  3W9G A;  5FJY A;  2B0O E;  3NAW A;  2XPZ A;  3HVE A;  4O60 A;  4HRM B;  4N3A A;  2CHZ A;  3PVL A;  3SGH A;  2RD0 A;  3ZXS A;  3Q47 B;  4CGV A;  4HFG A;  3HXE A;  3J5Q B;  5A6C A;  2XEN A;  5AN8 A;  4I2Z A;  4ANW A;  2X6K A;  4GTQ A;  4Q96 A;  2P9S G;  2J8S D;  2WQH A;  3RO3 A;  4DUI A;  3ZYM A;  3PZ2 A;  3ZXP A;  3APC A;  4OAV B;  3ZW3 A;  2P9P G;  2FEZ A;  1S64 A;  3C5R A;  3D9K A;  1NA3 A;  5CED B;  4BT8 A;  4WNE A;  1UN8 A;  2PL2 A;  3TWV A;  4AV7 A;  1ZB1 A;  5BT1 A;  2L6J A;  3L17 A;  4GTO A;  3DBS A;  2OEW A;  2R05 A;  1PY1 A;  1UJJ A;  4HI9 A;  2FI7 A;  3QWV A;  3CVN A;  2QYU A;  2EQX A;  3TJP A;  2HO1 A;  4B8C B;  4G26 A;  3CK7 A;  3OAW A;  3LPZ A;  1TN7 A;  3AG1 E;  3O48 A;  5B1A E;  1JCQ A;  1HH8 A;  2GRM A;  4JPS A;  1HZ4 A;  4GCN A;  3ULQ A;  2F8X K;  3FTY A;  2ETA A;  4UWH A;  3D9P A;  3KEZ A;  1A17 A;  2XZT G;  4M3O A;  4U63 A;  1N0R A;  2EIJ E;  4WWP A;  4PDX A;  4NAC A;  4XI9 A;  5JJT A;  2R17 C;  3EU5 A;  4TV3 A;  2EIN E;  3FEY A;  4JA7 A;  4PS7 A;  2AXV A;  2V5Q C;  2WXM A;  3AG3 E;  5CHE E;  1Z6T A;  3CIA A;  4O1O A;  2QY7 A;  5FZR A;  1TJC A;  1P5Q A;  3AS5 A;  4ACL A;  5FTP A;  4DX7 D;  4HOS A;  4DK5 A;  1N4S A;  2YQ8 A;  2AW6 A;  3LVQ E;  2BF0 X;  5D0Q D;  3ZGQ A;  4AXH A;  3I5P A;  5KJL A;  4UUC A;  4ABN A;  4M7C A;  4YDO A;  4GYO A;  4L7T A;  3U64 A;  3AU5 A;  5EYL A;  3AJI A;  2KCV A;  3GZ2 A;  2HR2 A;  4J7W A;  4CCA A;  4GTT A;  4JB8 P;  4HXI A;  2I6H A;  3ML9 A;  3AG2 E;  3EIJ A;  3UKU G;  3EHM A;  3OXL A;  3ASO E;  3TWR A;  3NOC D;  5LP0 A;  3ZHE A;  2MRI A;  3U66 A;  3CLJ A;  3AS4 A;  3MGB A;  4TUM A;  3FH7 A;  4DLQ A;  4DJA A;  2V4L A;  3SHF A;  3EHR A;  3UM0 A;  4BX8 A;  3CHQ A;  2UY1 A;  1H2T C;  3QWW A;  4I9C A;  3E34 A;  1OWP A;  1KLX A;  3D9H A;  3Q79 A;  4FLH A;  2WXG A;  4B94 A;  3ZUV B;  3K9I A;  4OVU A;  3CVQ A;  3Q15 A;  4C0M A;  3FP3 A;  4JHJ A;  4A3V A;  4Z68 A;  3DEP A;  1SZA A;  4BEP A;  3CHS A;  4DI4 A;  2J49 A;  3FUE A;  3QK0 A;  3PE3 A;  5G2N A;  5T8I A;  3Q75 A;  2KCK A;  3U9W A;  4K0R A;  3ASD A;  3PUJ A;  3VLF A;  1IKN D;  3TWX A;  1D8D A;  1H2V C;  3D9M A;  2IOS A;  2M63 A;  2XGO A;  4A63 B;  3Q7F A;  1MZC A;  4DI3 A;  2FUL A;  2H6G A;  2I1K A;  3ZKJ A;  4FA6 A;  4EZL A;  1DNP A;  1BPO A;  3U4T A;  1TNB A;  4JL0 A;  4UWL A;  2RG8 A;  3WXX A;  5JMN D;  4F6R D;  4UQY A;  1VDY A;  1U3C A;  2RFA A;  1FT1 A;  3FUK A;  2PNN A;  2OOE A;  3DWL G;  3I4G A;  3CQG B;  5BNW A;  3PNT B;  4G25 A;  4JHR A;  3LYA A;  3X2Q E;  3DSU A;  3CSF A;  1KPS B;  4UI9 J;  4PH4 B;  3RSE G;  4ANU A;  3ASN E;  1HG2 A;  3ZRH A;  3HXD A;  4GMJ A;  1XNF A;  3TGO A;  1FVF A;  1KZP A;  1TEZ A;  1WAO 1;  2JEK A;  3RKV A;  2IJG X;  1BI8 B;  4ILG A;  4N2Q A;  3CHM A;  2OEV A;  2LSV A;  4TXP A;  3ASG A;  5BXO A;  5D2M C;  1DVP A;  2ETB A;  4H7Y A;  5LCW C;  3UT4 A;  2VGX B;  2Y4U A;  2BED A;  2VTB B;  2J4D A;  3MX3 A;  3MV2 B;  1IQR A;  4BSZ B;  4YND A;  3V31 A;  3T8K A;  3ZVV A;  5KWD A;  2JAB A;  2VQ2 A;  3HHM A;  3D9L A;  3HYM B;  5T4Y A;  4JA9 A;  5LFA A;  1Y8M A;  4I6G A;  2ZXW E;  4G2V A;  3LJN A;  5FT9 A;  3IBE A;  2YNQ A;  4BWR A;  3QB2 A;  1N54 A;  1INZ A;  1V55 E;  1O1T A;  1EF1 C;  4HB5 A;  4UWF A;  4FU3 A;  3FU5 A;  1H19 A;  2J9Q A;  4IUL A;  1D8E A;  1GW6 A;  5G05 J;  3DSW A;  1LF8 A;  3L08 A;  3DSV A;  2IY0 C;  3TWQ A;  3UXG A;  2WXQ A;  3IKO B;  2UWJ G;  4FHK A;  5ITZ F;  2JLB A;  1ELW A;  1UN9 A;  4EBA G;  4X8Q A;  5JJ6 A;  1HE8 A;  4IN3 B;  3D9O A;  3URZ A;  2XCC A;  3T9K A;  4EEC A;  1HXI A;  3IEG A;  2HYZ A;  2CFU A;  3V79 K;  1NL4 A;  3RRU A;  3T8M A;  1MHQ A;  4BET A;  3B7U X;  2VSY A;  3CVL A;  4UWG A;  3JCK C;  2IF4 A;  2L9B A;  1YA0 A;  2DIW A;  5BV1 A;  5AAR A;  1K8K G;  3FHE A;  4G24 A;  4CZ2 D;  3CVW A;  4Y6C A;  2MHK A;  3NZS A;  5A23 A;  4QFV A;  5EIL A;  4MS6 A;  5ARG A;  5BXU A;  4E85 A;  3KD7 A;  3Q9N C;  3U3W A;  3ABM E;  3R9A B;  3UPV A;  3CVY A;  5EX0 A;  1TR4 A;  5JHA A;  4UWK A;  3ZPJ A;  3NQP A;  3QOU A;  2WXK A;  3QAQ A;  3HVE B;  2I2O A;  4B89 A;  4I9E A;  4TUU A;  1HX8 A;  3NOG D;  4CDN A;  3R7R A;  3BEE A;  3UM3 A;  4J8Y A;  1OWM A;  1X5B A;  4NQ0 A;  1NI1 A;  5C1D A;  4GTS A;  2LXL A;  1IXV A;  3JQ0 A;  2LSU A;  3EUV A;  4I1A A;  4E6H A;  3LEW A;  1JWG A;  5ARF A;  3JYS A;  1DCQ A;  3SFY A;  2NSZ A;  2WVI A;  3MV3 B;  1FPP A;  5AQB A;  3CKB A;  2OV8 A;  1OUV A;  5CEA A;  4F3V A;  4FJZ A;  2X6I A;  4APF A;  1U2V G;  2PZI A;  4U0S A;  3SBS A;  4ZFH A;  3TG4 A;  3B7S A;  1E7U A;  2OVB A;  3OTN A;  3ZEF A;  1FVH A;  4D10 C;  2XGM A;  3IHY A;  4GPK A;  3FTZ A;  3ONL A;  3FU6 A;  1E8X A;  2IOL A;  3P2B A;  3W9F A;  2EIK E;  1EPU A;  2BKK B;  2IFU A;  5FQ7 A;  4HLL A;  2BUG A;  2PQR A;  1WDY A;  2XGS A;  3E32 A;  2WPV A;  1IQU A;  4GZ5 A;  5ANL A;  4DX5 D;  1AWC B;  1H0A A;  4GU5 A;  5M72 A;  3UQ3 A;  4XKB A;  4HBD A;  4XX5 A;  4ANX A;  4U95 D;  3QDN A;  4K5B A;  2NYJ A;  5ENQ D;  3QJZ A;  4FJY A;  2FBN A;  2WXO A;  5ENT D;  4GZD A;  3D9N A;  1SA5 A;  3PZ1 A;  4LUN U;  3KSQ A;  1DC2 A;  4RQI A;  2ZGD A;  3HRA A;  3UM2 A;  2IO2 C;  2GRN B;  5J08 A;  3ONK A;  4PUC A;  4I17 A;  5B1B E;  5HKP A;  1SW6 A;  3I3N A;  2CG2 A;  5AYW D;  4O6F A;  4L2Y A;  3DPY A;  3NBN B;  1S70 B;  1L5J A;  1MX4 A;  4L2L A;  4LNG A;  3JUE A;  2B6C A;  3E37 A;  3IV0 A;  4NRH B;  2VGY A;  4J8D A;  3NF1 A;  4RSY A;  4G11 A;  2QC9 A;  2VGE A;  3UI2 A;  2AVP A;  2PM6 A;  1V54 E;  4F7A A;  3P1U A;  2ILR A;  5CMY A;  3PZ3 A;  3C72 A;  5H7P A;  4CT0 A;  4ATZ D;  3C98 A;  4GTM A;  1OWN A;  2FO1 E;  4CDR A;  1YYH A;  4B0Z A;  2OCC E;  5BW8 C;  2WQ6 A;  4DX2 A;  2ZU6 B;  3ZHE B;  3KAE A;  3OXG A;  1TN8 A;  3LY7 A;  4OYS A;  2GGF A;  3PEU B;  4TXQ A;  2LAH A;  3FWV A;  1O5M A;  4HVB A;  1RW2 A;  3LCA A;  4GTV A;  4DX6 D;  2UY1 B;  1G3N B;  1U3D A;  4GZC A;  5KJM A;  2WB2 A;  2EIM E;  1O1S A;  3EU9 A;  4JC8 A;  2A4Z A;  4KXK B;  3AS8 A;  1QZ2 A;  1EYH A;  3LXU X;  4FUL A;  4EHM A;  1H2U A;  3PH0 C;  4U8Y D;  2X6F A;  3N71 A;  2V4H C;  2WXI A;  1MX6 A;  4LNB A;  3GW4 A;  3JXJ A;  3TL5 A;  4JEH A;  3V2O A;  3HXC A;  5JHB A;  1ZU2 A;  2AWI A;  3SY2 A;  5CEC B;  2OND A;  3MEK A;  4TXR A;  5E75 A;  4N2S A;  3E30 A;  4CRW A;  1N95 A;  1UJK A;  1TNU A;  1Z3X A;  3FEX A;  4EZJ A;  5B3S E;  4J6I A;  3DXK G;  3SBT B;  2ZIS A;  2GW1 A;  4UI9 K;  4U7E B;  4ZHB A;  4WUY A;  1HO8 A;  1EDU A;  4G23 A;  2FO7 A;  3FH5 A;  2KZT A;  3Q73 A;  3LS8 A;  3DSS A;  4B93 B;  3PZ4 A;  3EHQ A;  1K1B A;  2IQC A;  2R2L A;  4A1G A;  3FUF A;  5JJ7 A;  2I9C A;  3V30 A;  2V8S E;  2KBX A;  4R7L A;  3NZU A;  3PZD A;  1IYG A;  4KBQ A;  5LCW J;  3HIZ A;  4HNA D;  4ACK A;  2RFM A;  3AU4 A;  2WXL A;  1UG3 A;  4DRX E;  5FQ6 A;  3IXE A;  3QNK A;  1O1R A;  3D3M A;  4BTB A;  2A5E A;  5AEN A;  1BU9 A;  3RU0 A;  1Z3Y A;  2WQ7 A;  3C3O A;  3ESL A;  4LRZ A;  4KT6 B;  2R02 A;  2DWZ A;  2DVW A;  3B7B A;  3PEV B;  5AQ7 A;  2ZGG A;  3UIP C;  3CKC A;  2WM9 A;  5KNG A;  2VJ8 A;  3C3Q A;  4YDE A;  4XE0 A;  5G55 A;  4F53 A;  1S63 A;  3KEA A;  3EHN A;  2DBA A;  4I43 A;  3LY8 A;  5E76 A;  2J09 A;  5EIB E;  4LNU D;  2P2C P;  4C9B B;  3FTX A;  3F6Q A;  2HE0 A;  3S2A A;  4XKC A;  4HQD A;  3LJ3 A;  5D66 A;  3ULE G;  2L6B A;  3S7F A;  1QBQ A;  4DLO A;  3G2V A;  3E4B A;  3MKQ B;  3VLE A;  3GZS A;  2LXM A;  4A55 A;  3FUN A;  1IHG A;  4CDM A;  4BX9 A;  3CHO A;  3BG1 B;  4ME2 A;  1BD8 A;  2PQN A;  3LKU A;  4V3I A;  1TNZ A;  3FUJ A;  4B8A A;  5BPP A;  3ZYQ A;  4GYW A;  1YCS B;  2XEH A;  3UUX A;  3VTX A;  3MKQ A;  2BKG A;  3APF A;  2XZD G;  4IRU A;  3DPD A;  4O1P A;  2AJA A;  3FY4 A;  3QWP A;  4AVX A;  5KJK A;  3G2U A;  3RRM B;  4PS3 A;  3UT8 A;  4MLP A;  1KT0 A;  5EDS A;  2XQ0 A;  3DSX A;  1A5E A;  1FT2 A;  4L23 A;  4UQZ A;  1OCO E;  4Q94 A;  1N11 A;  5A7D B;  2CHW A;  5BUZ A;  3TXN A;  1E7V A;  3L82 A;  4CGW A;  3UX4 A;  3BUA A;  4YDY A;  1N4Q A;  2E2E A;  4FP7 A;  3OXF A;  2P9K G;  4G8L A;  2I1J A;  3L13 A;  3CQC B; 
#chains in the Genus database with same CATH homology
 4ABN A;  5FQ7 A;  5FQ4 A;  4WWO A;  2WXJ A;  4GYO A;  2BUG A;  2PQR A;  4L7T A;  2XGS A;  3AU5 A;  4ILH B;  2WPV A;  1IQU A;  4GZ5 A;  5ANL A;  3U64 A;  3MYV A;  3Q49 B;  4EZK A;  3B13 A;  2KCV A;  4J8F A;  3SI5 A;  1H0A A;  4APO A;  3GZ2 A;  1JUQ A;  2HR2 A;  4AEZ C;  4GU5 A;  5M72 A;  3UQ3 A;  4J8S A;  2X38 A;  4CCA A;  2E0I A;  4XKB A;  5KJN A;  3B7T A;  3CVV A;  4HXI A;  2I6H A;  3MZL B;  3ML9 A;  4HOQ A;  4AJW A;  3EIJ A;  4XX5 A;  2WXF A;  3EHM A;  3OXL A;  4ANX A;  3QDN A;  4A1S A;  5LP0 A;  4GAA A;  3ZHE A;  4AM9 A;  4GYY A;  4MRU A;  2MRI A;  3QJZ A;  3U66 A;  4FJY A;  2FBN A;  2WXO A;  2FF4 A;  3CLJ A;  2VSN A;  3D9N A;  4GZD A;  3AS4 A;  3MGB A;  3ZFW A;  2R5S A;  4WNG A;  5EX3 A;  4LUN U;  3CEQ A;  3FH7 A;  2ION A;  3ZYL A;  2V4L A;  3SHF A;  4DLQ A;  4DJA A;  4GA2 A;  4JXT A;  2PM7 A;  3D9I A;  4BX8 A;  2KC7 A;  4U04 A;  5J90 A;  3CHQ A;  4JEU A;  5J08 A;  2X3M A;  4XIF A;  4YVO A;  2UY1 A;  4GA1 A;  2KCL A;  1H2T C;  3QWW A;  4I9C A;  3D9J A;  2J4B A;  4A3T A;  2L0T B;  3ONK A;  4OVV A;  3L54 A;  5FZS A;  4RG6 A;  3CVP A;  4PUC A;  3QC1 A;  1OWP A;  1KLX A;  4I17 A;  4I6J A;  4KYO B;  1HG5 A;  3I3N A;  3KS2 A;  5G04 C;  2A5U A;  2CG2 A;  3L22 A;  2WXG A;  4FLH A;  4W9R A;  4B94 A;  4J8E A;  5AYW D;  1KT1 A;  4O6F A;  1NZN A;  4L2Y A;  3S7J A;  4WWN A;  3FH8 A;  3K9I A;  4XI0 A;  4OVU A;  2C2L A;  2IU1 A;  3CVQ A;  3EIQ C;  3CVU A;  4GML A;  4H7X A;  1L5J A;  2LAI A;  3Q15 A;  4C0M A;  3FP3 A;  4JHJ A;  3TAX A;  4A3V A;  4L2L A;  3CST A;  1ZBP A;  4WAF A;  2VSO E;  1SZA A;  3LDZ A;  3IV0 A;  3CHS A;  4NRH B;  2WXP A;  2VGY A;  5CMW A;  4DI4 A;  4J8D A;  4AY6 A;  3APD A;  2J49 A;  3FUM A;  3NF1 A;  2CFZ A;  3FUE A;  3PRE A;  4I1O B;  4FAD A;  4URK A;  4RSY A;  2GRL A;  4G11 A;  2AXU A;  3QK0 A;  3PE3 A;  3PS6 A;  2P58 C;  5G2N A;  5T8I A;  4K03 A;  4HLE A;  2KCK A;  2VGX A;  2AVP A;  3R7Q A;  3U9W A;  4KZC A;  2PM6 A;  4K0R A;  3CGH A;  4UI9 C;  4F7A A;  3P1U A;  2ILR A;  3ASD A;  5CMY A;  2VTB A;  3PUJ A;  3VLF A;  4BT9 A;  1H2V C;  3D9M A;  4BSX A;  2IOS A;  2M63 A;  5HI7 A;  4CT0 A;  2XGO A;  3C98 A;  4DI3 A;  5DBK A;  4EQF A;  1OWN A;  2FUL A;  4U07 A;  3EJN A;  2KAT A;  5EKQ D;  2I1K A;  1E8Z A;  4LCT A;  4CDR A;  3L6A A;  3Q5M A;  5AJD A;  2BTD A;  4FA6 A;  4KZ0 A;  3TG5 A;  3RO2 A;  2V5F A;  1DNP A;  1QQE A;  4JZY A;  5LOZ A;  4B0Z A;  4EZL A;  1BPO A;  3BG0 B;  4I2W A;  3U4T A;  5BW8 C;  2WQ6 A;  4WND A;  5G04 J;  2ZU6 B;  3QAR A;  3ZHE B;  3KAE A;  3OXG A;  4JL0 A;  3ESK A;  4G1T A;  4UWL A;  1HFA A;  4F1S A;  3LY7 A;  4J0U A;  2RG8 A;  4OYS A;  3T5V A;  1HS6 A;  3WXX A;  3G2S A;  2GGF A;  2WMO A;  1ELR A;  3PEU B;  2LAH A;  4FHJ A;  3FWV A;  4N39 A;  1VDY A;  4UQY A;  5FZQ A;  1U3C A;  1SZ9 A;  2AXZ A;  2R59 A;  4JHK A;  4HVB A;  1HF8 A;  4Y6W A;  3LCA A;  3FUK A;  5AIJ A;  4CT4 A;  1MQS A;  2OOE A;  2UY1 B;  2WMN A;  3I4G A;  1U3D A;  3CQG B;  4GZC A;  5BNW A;  5KJM A;  3RIB A;  3T5X A;  2WB2 A;  5ENN A;  3CR3 A;  1PC2 A;  3PNT B;  4G25 A;  4JHR A;  1QNF A;  3LYA A;  2LNI A;  4ILI A;  5C2Y A;  3UMV A;  4L1B A;  1ELK A;  4JC8 A;  1NA0 A;  2A4Z A;  2DCP A;  3CSF A;  4N3B A;  2LO6 A;  4UI9 J;  4PH4 B;  3VLD A;  3GYZ A;  4I1M A;  1W3B A;  4ANU A;  3ZIM A;  4KXK B;  1HG2 A;  2XEV A;  3AS8 A;  4GMJ A;  1QZ2 A;  3FDH A;  3ZRH A;  1EYH A;  1XNF A;  2C0L A;  3LXU X;  4FUL A;  1FVF A;  1H2U A;  3PH0 C;  3TGO A;  1WAO 1;  3MKR A;  1TEZ A;  3FTU A;  2X6F A;  5D0O D;  4KVM A;  2JEK A;  3CK9 A;  3N71 A;  2XHE A;  2WXI A;  3FU3 A;  2IJG X;  3RKV A;  2X6H A;  3GW4 A;  4ILG A;  1TJF A;  4N2Q A;  3TL5 A;  5G05 C;  4JEH A;  4PS8 A;  3JQ1 A;  5JHB A;  3CHM A;  1ZU2 A;  2AWI A;  2LSV A;  3CV0 A;  4KMO A;  2OND A;  3ASG A;  3MEK A;  3ZN3 A;  2NXP A;  1DVP A;  4LER A;  5E75 A;  3UT7 A;  2XRZ A;  4H7Y A;  5LCW C;  4N2S A;  3UT4 A;  2VGX B;  3SNX A;  4CRW A;  1UJK A;  4LEU A;  3MA5 A;  2Y4U A;  1Z3X A;  4AOF A;  3FEX A;  2VYI A;  4EZJ A;  4J6I A;  2VTB B;  5ANR A;  2J4D A;  3MX3 A;  3PRZ A;  3PNL B;  4EPZ A;  3LVR E;  3MV2 B;  3SBT B;  3PUK A;  1IQR A;  3FUH A;  2GW1 A;  4I6E A;  3TXM A;  4UI9 K;  3FTW A;  2VSX E;  4WUY A;  1HO8 A;  1NP7 A;  4YND A;  4BY6 A;  1EDU A;  4G23 A;  4EBA A;  3ZVV A;  2FO7 A;  4ANV A;  2VQ2 A;  3HHM A;  3FH5 A;  4U0U A;  2KZT A;  4HOT A;  1XGW A;  2XCB A;  1JWF A;  3D9L A;  3HYM B;  5DIZ A;  5T4Y A;  3ZYK A;  4JA9 A;  3Q4A B;  3RJV A;  3ENE A;  2HM8 A;  5LFA A;  1Y8M A;  4I6G A;  3ASF A;  4MKT A;  4ATG A;  4HOU A;  3LS8 A;  3LY9 A;  3PDN A;  4G2V A;  5FT9 A;  3IBE A;  2YNQ A;  4BWR A;  3PE4 A;  3QB2 A;  2C0M A;  4RG9 A;  4BFR A;  1N54 A;  1INZ A;  1Y6I A;  3VTY A;  4KVO A;  1EF1 C;  2IQC A;  3G2W A;  4JW1 A;  4A1G A;  3FTS A;  4UWF A;  4FU3 A;  3QKY A;  3FU5 A;  3HDX A;  2NC9 A;  3FUF A;  1H19 A;  2J9Q A;  3MJW A;  4IUL A;  2I9C A;  5JJ7 A;  5FJY A;  2WXR A;  2V8S E;  1GW6 A;  5G05 J;  2XPZ A;  3HVE A;  2X6J A;  1LF8 A;  3L08 A;  4R7L A;  3NZU A;  5BV0 A;  3PZD A;  1IYG A;  2WXQ A;  2XRY A;  4KBQ A;  4N3A A;  3IKO B;  2CHZ A;  5LCW J;  4HOR A;  3PVL A;  2UWJ G;  4FHK A;  1N52 A;  3HIZ A;  2JLB A;  4GA0 A;  1ELW A;  1UN9 A;  3SGH A;  4ACK A;  4EBA G;  3FTV A;  3AU4 A;  2WXL A;  2Y3A A;  5JJ6 A;  1HE8 A;  2RD0 A;  4IN3 B;  1UG3 A;  1H6K A;  3D9O A;  3URZ A;  3CHP A;  3ZXS A;  2XCC A;  5FQ6 A;  2J07 A;  3QNK A;  3Q47 B;  4EEC A;  4CGV A;  4HFG A;  1HXI A;  3IEG A;  4AP2 A;  4BTB A;  2HYZ A;  3D3M A;  2XPY A;  5A6C A;  3G2T A;  4I2Z A;  4ANW A;  4XZ4 A;  5AEN A;  2X6K A;  2CFU A;  4Q96 A;  3RU0 A;  2WQH A;  3RO3 A;  3RK6 A;  3RRU A;  1Z3Y A;  3MCX A;  2WQ7 A;  3T8M A;  1MHQ A;  3ESL A;  1FCH A;  3B7U X;  4LRZ A;  4TRQ A;  4KT6 B;  3PEV B;  3S7D A;  3ZYM A;  2VSY A;  3CKC A;  3FFL A;  3CVL A;  2WM9 A;  3APC A;  2WXH A;  3ML8 A;  4UWG A;  2VJ8 A;  3JCK C;  4XE0 A;  3ZW3 A;  2IF4 A;  2L9B A;  5G55 A;  1YA0 A;  3GZ1 A;  5AJL A;  4F53 A;  4CEM A;  2DIW A;  2FEZ A;  3EHN A;  5BV1 A;  4AIF A;  5HQ8 A;  2DBA A;  3D9K A;  3FUD A;  4I43 A;  5CCM A;  1NA3 A;  3LY8 A;  3FHE A;  4GB9 A;  4G24 A;  4BT8 A;  4WNE A;  2J09 A;  5E76 A;  1UN8 A;  2PL2 A;  3CHR A;  3CVW A;  4Y6C A;  2MHK A;  3NZS A;  4C9B B;  3FTX A;  4AV7 A;  5A23 A;  1JPL A;  4GZ3 A;  3B7R L;  4QFV A;  2KZT B;  1E8W A;  4IYP A;  4N3C A;  4MS6 A;  5ARG A;  5KCM A;  3S2A A;  4XKC A;  3FU0 A;  4E85 A;  3LJ3 A;  3FUL A;  3KD7 A;  3U3W A;  5BT1 A;  3S7F A;  3R9A B;  2L6J A;  4DLO A;  3L17 A;  3UPV A;  1OWL A;  3E4B A;  3G2V A;  1HU3 A;  2OVF A;  3DBS A;  3CVY A;  5EX0 A;  4YVQ C;  3MKQ B;  1PY1 A;  3EDT B;  5JHA A;  3L16 A;  3SFZ A;  3VLE A;  3GZS A;  2XPI A;  4BTA A;  4GCO A;  3JUI A;  1UJJ A;  4UWK A;  4A55 A;  3FUN A;  3ZPJ A;  4FLB A;  3NQP A;  1IHG A;  1E96 B;  3QOU A;  4CDM A;  2FI7 A;  4N5C A;  2WXK A;  3QWV A;  3O4Z A;  3QAQ A;  3HVE B;  3CVN A;  4BX9 A;  2I2O A;  4NUR A;  2EQX A;  3TJP A;  1E90 A;  4I9E A;  4TUU A;  4B89 A;  2HO1 A;  1HX8 A;  1SQM A;  2YHC A;  3CHO A;  2CHX A;  4B8C B;  4CDN A;  3BG1 B;  4G26 A;  3R7R A;  3CK7 A;  3BEE A;  1E8Y A;  4ME2 A;  4JVS A;  1OWM A;  3OAW A;  2PQN A;  1X5B A;  3LKU A;  4NQ0 A;  4V3I A;  3LPZ A;  2Q7F A;  5C1D A;  3FUJ A;  3O48 A;  4B8A A;  1HH8 A;  3JQ0 A;  1OWO A;  1B89 A;  4HS2 A;  2KM4 A;  4WNF A;  3ASH A;  5BPP A;  2GRM A;  2Y4T A;  4JPS A;  3ZYQ A;  1HZ4 A;  4GCN A;  4GYW A;  2LSU A;  3ULQ A;  2QFC A;  2J08 A;  3UUX A;  3FTY A;  3VTX A;  3MKQ A;  4I1A A;  4U0Z A;  4UWH A;  4P29 A;  2YIN A;  4DPR A;  3D9P A;  2WXN A;  4E6H A;  3CVX A;  3KEZ A;  2YHE A;  1JWG A;  3LEW A;  1A17 A;  3APF A;  4FC8 A;  5FWQ A;  4C0E A;  4M3O A;  5ARF A;  4Q69 A;  3JYS A;  1WM5 A;  4U63 A;  4IRU A;  2NSZ A;  4WWP A;  2WVI A;  3CK8 A;  3DPD A;  4PDX A;  3MV3 B;  4NAC A;  4XI9 A;  3S7B A;  3SZ7 A;  5JJT A;  2R17 C;  2CG3 A;  1UW4 B;  3CKB A;  2OV8 A;  1PAQ A;  3IHV A;  3FY4 A;  1OUV A;  4TV3 A;  3RRN B;  1WY6 A;  4F3V A;  3FEY A;  3QWP A;  4AVX A;  4FJZ A;  2L0I A;  4JA7 A;  5KJK A;  2X6I A;  3G2U A;  3RRM B;  2V0P A;  4PS3 A;  4APF A;  3I4R B;  3UT8 A;  4PS7 A;  4MLP A;  2AXV A;  2PZI A;  2WXM A;  1KT0 A;  4U0S A;  2XQ0 A;  5EDS A;  5CHE E;  3SBS A;  1Z6T A;  4U8H A;  3TG4 A;  4RVB A;  3B7S A;  5T3R A;  4L23 A;  1E7U A;  2OVB A;  3CIA A;  3FUI A;  3OTN A;  4Q94 A;  4UQZ A;  3ZEF A;  5CCL A;  2QY7 A;  5FZR A;  1TJC A;  5A7D B;  4UQX A;  2CHW A;  1P5Q A;  3AS5 A;  4ACL A;  5BUZ A;  5FTP A;  1FVH A;  4HOS A;  4D10 C;  2XGM A;  3TXN A;  3IHY A;  5LX8 A;  4GZ6 A;  4DK5 A;  1E7V A;  4GPK A;  2YQ8 A;  3FTZ A;  3ONL A;  2AW6 A;  5FQ8 A;  3FU6 A;  3LVQ E;  4CGW A;  1E8X A;  3UX4 A;  2BF0 X;  4AY5 A;  2IOL A;  3P2B A;  3SD5 A;  3SF4 A;  1S0P A;  5D0Q D;  3ZGQ A;  2E2E A;  1EPU A;  4FP7 A;  3I5P A;  3OXF A;  4AXH A;  2IFU A;  5KJL A;  2I1J A;  3L13 A;  2MOW A;  3CQC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...