3CHMA

Crystal structure of pci domain from a. thaliana cop9 signalosome subunit 7 (csn7)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
161
structure length
161
Chain Sequence
EQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords COP9 signalosome complex subunit 7
publication title The Arabidopsis COP9 signalosome subunit 7 is a model PCI domain protein with subdomains involved in COP9 signalosome assembly
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 57
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2008-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3chmA00
3TXMA 3CHMA 3JCKC 3T5XA 2MRIA 3TXNA 4LCTA 4D10C
chains in the Genus database with same CATH superfamily
1OCOE 4XIFA 4MS6A 4X8QA 3G2UA 5AQ7A 1UOHA 2IQCA 4NRHB 2YHEA 3MGBA 3QAQA 2X6IA 3RRNB 2JLBA 4U95D 2ILRA 4HOSA 3BUAA 3HG0D 2J07A 2P9NG 5FJYA 3DXMG 4LNBA 5CEAA 3C5RA 2ZISA 1N95A 3NBNB 4APFA 3N71A 5T3RA 2BUGA 2MHKA 1N11A 2WXOA 1K3ZD 4F1PA 3Q4AB 1PC2A 3AU4A 4XKCA 3EHQA 5D0OD 1TN7A 3TG5A 2OEVA 1TR4A 2BKGA 3UT8A 3CVWA 3LCAA 3B95A 4G23A 4GCOA 4UUCA 4FC8A 3RU0A 3D3MA 4DLOA 3PREA 3IHYA 1WY6A 2NC9A 2AJAA 1TN8A 2XRZA 2LAHA 4E85A 3W9FA 4GMJA 1MX6A 2QZAA 4HLLA 4KVMA 4FU3A 4HI9A 3PZDA 4FULA 4K03A 3GZ2A 1HZ4A 1JPLA 1ELRA 5A23A 5J90A 2L6BA 3RJVA 3S7BA 3G2SA 4U96D 2DZNA 1U3CA 3C3OA 5ITZF 4TXRA 3DEPA 3WXXA 4E6HA 4WWOA 3Q5MA 4N5CA 3CR3A 1TNOA 3AG2E 3UINC 4ANXA 4Q96A 4G8LA 4DX1A 3FH7A 2XGSA 4GYYA 3I5PA 4FP7A 3ASGA 1IHGA 4B8CB 4HOTA 2IOLA 4XI0A 1XGWA 2OVBA 3K9IA 2WB2A 3UUXA 4B89A 3Q78A 2BEDA 3D9LA 1HXIA 1HF8A 1YCSB 3QOUA 1NI1A 3OXGA 5AENA 1FT1A 4DI4A 4L2YA 2GRLA 3MKQB 3QB2A 4EPZA 2XGMA 4JW1A 3EIQC 3E37A 3FFLA 3FH8A 4O1PA 3BU8A 1Y8MA 3QARA 3CKBA 3TXNA 4DI3A 1HX8A 3DPDA 4ILIA 3HYMB 3V2OA 4CCAA 5DIZA 4N3CA 4UWKA 4A3VA 2WMOA 4F6RD 4A1GA 3DSWA 4CT0A 5AQAA 3UT4A 3FU3A 3D9PA 2FI7A 1KT0A 3PZ4A 2XENA 3UMVA 3L82A 4GTRA 3C72A 2VGEA 5AJLA 3ASHA 1UN8A 2ETBA 4I1OB 1ELKA 2VGXB 3NB2A 1SA5A 5HKPA 3IXEA 4GTVA 2XHEA 2P58C 2GGFA 3ASDA 5AN8A 4GA0A 2WXIA 5C2YA 2H6FA 5KNGA 3ZU7B 3UM2A 2ETAA 1A5EA 2UY1A 3IEGA 1H0AA 4HRMB 3T5VA 2YHCA 3B13A 1H19A 3ZKJA 2I2OA 4FJYA 2EILE 4YDOA 3CGHA 4J8DA 2XPZA 2Y0BG 3CQCB 4L23A 4BX8A 2H6GA 2KZTB 4JZYA 4OYSA 4Y6CA 1NZNA 3D9JA 4PS3A 2XQ0A 4BEPA 4FJZA 3L17A 1OWPA 2ONDA 4CDNA 3ZW3A 3OXFA 4LERA 2C2LA 2VSOE 2L6JA 4RG6A 1OCZE 2UWJG 4K5BA 2LSUA 2E0IA 4KZCA 2R05A 4U0SA 4NIKA 4G8KA 5AAOA 4GPMA 1OWOA 2GRPB 2AXVA 2MYOA 3MA5A 4U04A 5CECB 4K5CA 2AVPA 5JA4D 2OOEA 5HI7A 2CG3A 1HE8A 5JJTA 4BTAA 3UIOC 3HIZA 2XZTG 2P2CP 5HS0A 1WAO1 3SY2A 4GB9A 2VSNA 1GW6A 2PNNA 4YVOA 4WNEA 4YVQC 2QYJA 4APOA 1FVFA 4UI9C 4GAAA 3ZN3A 5CBOA 1LD7A 4CT4A 3EHMA 5CCMA 3SGHA 3RAUA 3OAWA 3MEKA 3DSUA 4PS8A 3FU6A 3V79K 1N9AA 2F37A 3T9KA 1DNPA 1TEZA 2XPYA 5BNWA 3Q79A 4AV7A 5EILA 3MV2B 3IKOB 2VYIA 5BUZA 2MRIA 1V55E 4PH4B 2NYJA 1BPOA 1HG2A 3MYVA 4G11A 4XKBA 5FINA 5LCWC 4C0EA 4GZ6A 3ONKA 2XEEA 5G04J 3U3WA 1HH8A 4ACLA 4HRLA 4J8YA 3CLJA 3G2WA 3PEUB 4HBDA 5ENSD 3KAEA 3QC1A 5FWQA 4I6GA 2X38A 3QWVA 3O48A 4CDRA 3MX3A 2EINE 3SFZA 5JJ6A 4AJWA 1FVHA 3AG1E 3FEXA 3HXDA 2R17C 3OTNA 3SFYA 2E2EA 1MX2A 3I3NA 4G2VA 3AU5A 4TUMA 2FEZA 3U64A 4BY6A 4OVVA 5LOZA 3C98A 5DBKA 3HRAA 3E33A 4HXIA 4IYPA 1IHBA 3FDHA 4A1SA 4AM9A 2LAIA 4OVUA 3IBEA 2J08A 5LX8A 4V3IA 2X6KA 1UW4B 2DZOA 4RQIA 1H6OA 3ZNGA 5KBAA 3ASFA 5C1DA 1G3NB 4FHKA 5FQ7A 1Z3XA 2FF4A 1QZ2A 3FHEA 3Q73A 4DUIA 4A55A 3Q9NC 1KZPA 4ATZD 2VSYA 2VTBB 3CHOA 3SD5A 1H2TC 5BV0A 2I1KA 5G2NA 4JD2G 4DX2A 3ZUVB 5CMWA 3DPYA 5ANRA 3B7UX 4YNDA 2XS8A 4CGVA 3CHRA 4UWFA 1D8DA 3T8MA 1SW6A 5AQ9A 3TWUA 4BETA 2CHXA 2UY1B 4AXHA 3ESKA 5LFAA 4JEUA 4C0MA 5KJLA 4JXTA 1LD8A 5ENRD 1N94A 1ZB1A 4U07A 1PY1A 5D2MC 2XRYA 3QKYA 4RVBA 2LNIA 2DIWA 3ABLE 1N4SA 3RIBA 3I4GA 2NSZA 4FLBA 3AG4E 3ZVVA 5BV1A 4DRXE 2Y4TA 4XE0A 1UJKA 2PM7A 5ARGA 2Y1LE 3RO3A 1BLXB 3LY8A 2PQRA 3FTZA 4UWHA 1FCHA 4J8FA 1DC2A 4KT6B 4NQ0A 5FQ8A 2I9CA 2CHZA 4KVOA 4GTPA 4GA2A 1H2VC 4J8EA 3FUMA 1O5MA 2R2LA 3LY9A 4L1BA 3ZYMA 5HQ8A 5FT9A 4JA7A 1IKND 2IFUA 4ABNA 4N2SA 2GROB 4I1AA 3PDNA 3HXEA 2F0YA 4G26A 4Q94A 4EBAA 5CRUA 1OCCE 3LEWA 3ABKE 5BPPA 4B8AA 3CHMA 4RG9A 4EBAG 3GW4A 4F53A 5E76A 2ZIRA 2HE0A 3ZYKA 3VLDA 4I9CA 4F1SA 3DWLG 2WXJA 2L0IA 4GTOA 4Z68A 4U8YD 3QWPA 4NURA 1XNFA 2R02A 3CVPA 3JQ1A 3FTWA 4I2WA 2PM6A 1SA4A 4EECA 4FADA 1IQUA 3JXJA 3E4BA 1DCEA 2LO6A 5HRYA 1N4PA 5AQBA 1BU9A 3MKRA 1OUVA 2V8SE 2PQNA 4YDEA 4BT8A 1IYGA 4N39A 1UN9A 1LTXA 1O1RA 2VGYA 1KLXA 3J5PA 2M63A 5JHBA 2IOSA 4AVXA 4GTTA 3NZSA 1QBQA 2DCPA 4EZJA 2P9KG 5KCMA 1OY3D 1S64A 1E96B 2Y69E 1K1BA 3FUIA 4GZ3A 5FZQA 5CRVA 4L2LA 2IEJA 1TNYA 4WAFA 2ZGDA 3HXFA 3DEOA 3KSQA 1Q2ZA 4GTQA 3TAXA 4WUYA 4JVSA 1MYOA 4K0RA 3NF1A 1S63A 4AIFA 4CYMD 3U4TA 4DK5A 2VTBA 4I2ZA 1EPUA 4H7YA 2XCBA 2GRQB 3CVVA 3FTYA 3LXUX 4M7CA 5CMYA 4AOFA 4URKA 4G24A 4HOUA 3D9OA 3FTVA 3JUEA 3NOCD 3U66A 2LUHA 3B7SA 5J08A 3TWQA 2EIME 2WXRA 3APFA 3I4RB 2WXHA 4Q69A 4UI9J 2KBXA 3L08A 2YQ8A 3JQ0A 3RSEG 1E90A 2LXLA 2P9UG 3VTXA 4BESA 1IQRA 3D9NA 4MRUA 4A3TA 2A5UA 3L54A 4Y6WA 4WWNA 3RO2A 4QFVA 3L16A 5B1BE 3E32A 2AW6A 4K5AB 4BFRA 3URZA 3ZXSA 2Y4UA 2WXNA 1N52A 4ZHBA 3NAWA 3PE3A 3W9GA 3ENEA 4EQFA 3UXGA 2XEHA 3NZUA 5AIJA 2OCCE 1VDYA 2B6CA 3HHMA 3CVXA 1NP7A 5G05J 3UI2A 3FUNA 2X3MA 3SF4A 3WG7E 4G25A 3SI5A 1A17A 3LS8A 3E30A 4G1TA 2KCLA 3APDA 3LVQE 1N0RA 4F7AA 1YMPA 3QWWA 4I43A 3V2XA 3BEEA 2V4LA 2ZXWE 3G2TA 4WNGA 2V5FA 4HVBA 1RZ4A 4LCTA 2HO1A 3FH5A 2P9IG 3ZIMA 2WXQA 4DPRA 5BXUA 3ML9A 2XCCA 4BERA 1NA3A 3RRMB 3DSXA 1E8WA 4JHRA 3CHQA 5EIDA 3CVUA 2LXMA 2H6IA 5CHEE 3PNTB 1UJJA 3UKRG 2LSVA 1U2VG 3LKUA 5AJDA 4DJAA 4TV3A 1BI8B 1O1TA 3LYAA 5FQ4A 2CFZA 2WVIA 3LDZA 3V30A 3CK9A 4GYWA 3ULQA 3AJIA 4LG6A 1NL4A 1FPPA 4FLHA 3ZEFA 2KCKA 2HYZA 3ONLA 3SHFA 2NXPA 4WWPA 1OCRE 3LPZA 3SQVA 4W9RA 1Z3YA 3CVQA 3FULA 3PNLB 3JCKC 1FT2A 4L9PA 3CQGB 5JJ7A 2YNQA 4BWRA 4GMRA 2VQ2A 4AY6A 3APCA 1JCSA 4IN3B 4JHJA 3FUHA 2PZIA 3L13A 1TYQG 4HB5A 3PZ1A 4LUNU 4JEHA 2WXPA 2GW1A 4TRQA 1E7UA 2R59A 1EDUA 4C48B 4PDXA 1RW2A 1HS6A 4NACA 1ZBPA 3KS2A 4DLQA 1HU3A 4N2QA 5ENTD 3EU9A 1TJFA 3DSVA 3CVLA 2J4BA 3HXCA 2IF4A 4GZDA 4KBQA 3LJNA 2I1JA 4U7EB 5LP0A 1B89A 2IJGX 5JHAA 4ZFHA 2RFMA 2L0TB 4BTBA 2J4DA 3CEQA 2DWZA 2KM4A 3PUKA 1HO8A 1JWFA 5CEDB 3CVNA 1TNUA 5ENNA 3UIPC 1HFAA 2IONA 3CSTA 3D9MA 3Q15A 3SNXA 4HOQA 5KJNA 1E8YA 4AP2A 2GRRB 3EDTB 3GZSA 2BKKB 3ZHEA 4CGWA 4LEUA 2WPVA 3BG0B 3SO8A 4GPKA 3B7BA 5KJMA 3DSTA 3SZ7A 3EHRA 3D9HA 4KXKB 2Q7FA 2WXFA 4JHKA 2Y3AA 4GZ5A 4H7XA 1H2UA 3MCXA 1K8KG 4XI9A 2GRMA 3DSSA 4XX5A 3PS6A 1H6PA 4J0UA 4U8VD 4B93B 2PL2A 2FO1E 4ME2A 1HG5A 4ILHB 1WM5A 3GYZA 3AG3E 4AEZC 5EN5D 2OEWA 4KYOB 2I6HA 4DX7D 2EIJE 5H7PA 3IHVA 1QYMA 4BX9A 3CVYA 2QFCA 5M72A 2XPIA 4BSZB 4CZ2D 3TWXA 3HVEA 3AS4A 4U0UA 1Y6IA 2CFUA 1EYHA 1MQSA 3FP3A 4DX6D 4CRWA 3T8KA 2WXGA 3FTXA 4I6EA 4JL0A 5G55A 3Q7AA 3D9IA 4O1OA 5EYLA 3GZ1A 3SBSA 3FUJA 1E8ZA 1X5BA 3CKCA 3FUDA 3ML8A 2KXPC 4D10C 3TWSA 4N3AA 3EJNA 1KT1A 2ZGGA 3SBTB 1L5JA 3CIAA 5ENOD 3UKUG 5ANLA 5EDSA 2ZU6B 3EU5A 3UPVA 3BQOA 4HLEA 3EUVA 3PRZA 4HI8A 5D66A 4ANWA 1OWNA 3U9WA 4P29A 4OAUC 4QQIA 4OAVB 4GMLA 3TL5A 4A63B 2VSXE 3CK8A 3TWWA 1MHQA 1H6KA 4R7LA 4JC8A 5CBNA 5AARA 3TGOA 4HRNA 1JCQA 2XGOA 2QY7A 3UT7A 2YINA 3MV3B 4B94A 3AS5A 3HDXA 5BXOA 1D8EA 4EZLA 2R5SA 4MLPA 3UQ3A 2JABA 3QDNA 4UI9K 1LF8A 2DVWA 3S7DA 3FUKA 2XS1A 1KPSB 3P2BA 3RKVA 3LY7A 4ACKA 2H6HA 3FTUA 4HNAD 1AP7A 3LVRE 1OWMA 2RG8A 3CSFA 4I17A 4GU5A 3FEYA 1QNFA 3IV0A 5AYWD 1X81A 3CV0A 1TNZA 3L9TA 5FQ6A 4YDYA 1S0PA 2BTDA 3HXBA 1K1AA 3RRUA 3T5XA 2IU1A 4KMOA 3RK6A 4U0ZA 3FU5A 3VLEA 2BF0X 3Q7FA 2EQXA 2EIKE 4JB8P 1DVPA 4BSXA 5EYPF 2WQHA 3VLFA 3VTYA 1IXVA 3UM0A 5JMND 4J7WA 5KWDA 4U8HA 3KSLA 2F8XK 3CHPA 3G2VA 1INZA 5CERB 3PZ3A 3AS8A 1JCRA 4TXQA 5BW8C 3Q75A 4LSZE 3QNKA 3LJ3A 4HQDA 4O60A 2MOWA 4TUUA 3AAAC 1N4RA 3TWRA 4CDMA 3ZXPA 3R9MA 2WMNA 4GA1A 1ELWA 1MZCA 1QQEA 3OXLA 2IO3C 4BT9A 3O4ZA 3UM3A 5EX3A 4EZKA 5IY5E 1TNBA 1WG0A 4GZCA 1E7VA 2IY0C 4MKTA 1SQMA 3ZFWA 2C0MA 3B7TA 3V31A 5KNHD 3ZHEB 3FTSA 1YYHA 3ESLA 4MBGA 4O6FA 2GRNB 2WQ6A 3FY4A 2V5QC 2J09A 2ETCA 1MX4A 2V4HC 4L7TA 4ANVA 2AWIA 1N4QA 4C9BB 1BI7B 2OV8A 3X2QE 2L9BA 2JEKA 2F8YA 1JWGA 2KATA 3E34A 3F6QA 2P9SG 4N3BA 3PE4A 5KJKA 3R7QA 3S7JA 2XEVA 5EIBE 3KD7A 3CK7A 3FWVA 1V54E 1P5QA 2C0LA 5LCWJ 4I6JA 4WNFA 3JYSA 3DRAA 2J9QA 4GCNA 1NA0A 1YA0A 2RFAA 4JA9A 3ZYLA 5BT1A 2RKKA 1PAQA 3PVLA 2WXLA 3JUIA 2AXZA 4J6IA 1SZAA 2FULA 5EX0A 1Z5SC 4ILGA 3HVEB 3DXKG 3ASNE 1EF1C 3TG4A 1U3DA 3PH0C 4XZ4A 3JXIA 4XEIG 3FUFA 3R7RA 4U63A 5D0QD 4GTMA 3ASOE 2XZDG 4HORA 5ENPD 4UQXA 4RSYA 3J5QB 3ZRHA 1OXJA 4DX5D 2R03A 2DBAA 4HS2A 3FUEA 1SVXA 4N5QA 3MJWA 2P9LG 5CCLA 4UQYA 2WXMA 4PUCA 3ULYA 5ARFA 5FTPA 1AWCB 3ABME 3DBSA 4TXPA 2WM9A 3L22A 3PZ2A 1NFIE 1W3BA 2QYUA 4LNGA 2RD0A 4UWLA 3C3RA 1SZ9A 5B3SE 2A5EA 2B0OE 4KZ0A 3MKQA 2DYRE 4LNUD 2WQ7A 4GYOA 4IULA 1MJ0A 5FZRA 3Q47B 3KEZA 2X6FA 4I1MA 2X6HA 2IO2C 1N54A 2QC9A 1KZOA 4ANUA 5G05C 4GTSA 2VJ8A 3CHSA 3UTMA 2X6JA 4IRUA 4PS7A 1WDYA 4M3OA 2KCVA 4YDWA 3C3QA 2FO7A 3SFXA 4FHJA 3NQPA 1BD8A 3ULEG 4JPSA 4LRZA 1N0QA 3QK0A 1DCQA 4EHMA 1TN6A 5A7DB 1D9SA 4J8SA 4F3VA 5A6CA 5FIOA 3TJPA 1ZU2A 2WXKA 3S2AA 4CEMA 1UG3A 3BG1B 3ZYQA 1JUQA 3EIJA 4B0ZA 4ATGA 4UQZA 5T4YA 1O1SA 1S70B 5ENQD 2OVFA 3ISMC 2VGXA 3R9AB 3Q9UC 3PEVB 3Q49B 2J8SD 3ZPJA 2CG2A 1E8XA 3KEAA 3EHNA 3TWTA 5E75A 1Z6TA 3FU0A 3QJZA 4UWGA 3UX4A 3S7FA 3MZLB 2J49A 1TJCA 4RLYA 3ZGQA 4I9EA 3D9KA 3NOGD 4FA6A 4WNDA 2KC7A 3UM1A 2HR2A 5EKQD 2CHWA 2DYSE 3B7RL 3P1UA 3TXMA 2AXUA 3TWVA 2A4ZA 5B1AE 2KZTA 5T8IA 5FZSA 1OWLA 1OT8A 2P9PG 2FBNA 4AY5A 2HM8A 3PUJA 2V0PA 5G04C 4HFGA 3L6AA
chains in the Genus database with same CATH topology
1OWMA 3MV2B 3IKOB 4XIFA 2RG8A 4MS6A 2VYIA 3CSFA 4QFVA 5BUZA 3L16A 2MRIA 4PH4B 4I17A 2AW6A 3G2UA 1BPOA 1HG2A 4BFRA 4GU5A 3MYVA 3FEYA 1QNFA 3URZA 4G11A 2IQCA 3ZXSA 4XKBA 4NRHB 5LCWC 2Y4UA 3IV0A 2WXNA 1N52A 5AYWD 4C0EA 2YHEA 3CV0A 4GZ6A 3ONKA 3MGBA 3PE3A 3ENEA 5G04J 4EQFA 1HH8A 3QAQA 2X6IA 3U3WA 3RRNB 5FQ6A 3NZUA 1S0PA 2BTDA 2JLBA 4ACLA 4HOSA 2ILRA 3CLJA 3G2WA 3RRUA 3T5XA 2J07A 3PEUB 5FJYA 5AIJA 1VDYA 2IU1A 3KAEA 4KMOA 3HHMA 3CVXA 3RK6A 3QC1A 1NP7A 4U0ZA 3FU5A 5FWQA 5G05J 4I6GA 2X38A 3FUNA 3VLEA 2X3MA 3SF4A 2BF0X 4APFA 3N71A 3QWVA 4G25A 3SI5A 1A17A 2EQXA 3LS8A 5T3RA 3O48A 4CDRA 4G1TA 1DVPA 4BSXA 2KCLA 3APDA 3MX3A 2WQHA 2BUGA 3SFZA 2MHKA 3VLFA 3LVQE 2WXOA 3VTYA 5JJ6A 4AJWA 4F7AA 1FVHA 3QWWA 4I43A 4U8HA 3Q4AB 1PC2A 3CHPA 3FEXA 2R17C 3AU4A 4XKCA 3OTNA 3G2VA 1INZA 2E2EA 5D0OD 3I3NA 4G2VA 3AU5A 3BEEA 3TG5A 2V4LA 3AS8A 3G2TA 4WNGA 2V5FA 4HVBA 4LCTA 2HO1A 3FH5A 2FEZA 3U64A 4BY6A 4OVVA 3ZIMA 5BW8C 3UT8A 5LOZA 3QNKA 3C98A 2WXQA 3CVWA 3LCAA 4DPRA 5DBKA 3LJ3A 3ML9A 4Y6WA 2XCCA 1NA3A 3RRMB 2MOWA 1E8WA 4JHRA 4TUUA 4G23A 3CHQA 4HXIA 4IYPA 3FDHA 4GCOA 4A1SA 4AM9A 2LAIA 4FC8A 3RU0A 4CDMA 3CVUA 3D3MA 4DLOA 3PREA 4OVUA 3IHYA 3IBEA 1WY6A 5CHEE 2NC9A 2J08A 2WMNA 5LX8A 3PNTB 4GA1A 1UJJA 4V3IA 2XRZA 2LAHA 1ELWA 4E85A 2LSVA 1QQEA 3OXLA 4BT9A 2X6KA 3LKUA 3O4ZA 4GMJA 5AJDA 4DJAA 5EX3A 1UW4B 4KVMA 4FU3A 3PZDA 4FULA 4TV3A 3ASFA 4EZKA 4K03A 3LYAA 5FQ4A 2CFZA 5C1DA 3GZ2A 1HZ4A 2WVIA 3LDZA 4GZCA 1JPLA 1ELRA 1E7VA 5A23A 5J90A 4FHKA 3CK9A 4MKTA 5FQ7A 1Z3XA 4GYWA 2FF4A 1QZ2A 1SQMA 3FHEA 3RJVA 3S7BA 3ULQA 3G2SA 3ZFWA 4A55A 2C0MA 1U3CA 3B7TA 3ZHEB 4FLHA 3ZEFA 3FTSA 2VSYA 2VTBB 3CHOA 2KCKA 3SD5A 3WXXA 1H2TC 5BV0A 2HYZA 3ONLA 3ESLA 3SHFA 2I1KA 4O6FA 4WWOA 3Q5MA 2NXPA 4N5CA 3CR3A 5G2NA 4WWPA 4ANXA 2WQ6A 3FY4A 2J09A 4Q96A 3LPZA 5CMWA 4W9RA 5ANRA 3B7UX 3FH7A 4L7TA 1Z3YA 4YNDA 2AWIA 2XGSA 4ANVA 3CVQA 3FULA 4C9BB 4GYYA 3CHRA 2OV8A 3I5PA 4UWFA 4CGVA 4FP7A 3ASGA 1IHGA 2L9BA 3T8MA 4B8CB 3PNLB 2IOLA 3JCKC 4HOTA 4XI0A 1XGWA 3CQGB 2OVBA 3K9IA 2JEKA 2WB2A 5JJ7A 1JWGA 2KATA 2YNQA 4BWRA 2CHXA 2UY1B 2VQ2A 4N3BA 4AXHA 3PE4A 3UUXA 4B89A 4AY6A 5KJKA 3R7QA 3S7JA 3ESKA 5LFAA 3APCA 2XEVA 3D9LA 4IN3B 4JHJA 4JEUA 3KD7A 3FUHA 2PZIA 4C0MA 3L13A 5KJLA 4JXTA 1HXIA 3CK7A 3FWVA 1HF8A 3QOUA 4LUNU 1P5QA 2C0LA 3OXGA 4U07A 5LCWJ 5AENA 4JEHA 1PY1A 2WXPA 2GW1A 2XRYA 4DI4A 3QKYA 2GRLA 4I6JA 3JYSA 4L2YA 4TRQA 4WNFA 3MKQB 1E7UA 2J9QA 2R59A 4GCNA 1EDUA 3QB2A 1NA0A 4RVBA 2XGMA 4E6HA 4EPZA 1YA0A 4PDXA 4JA9A 4JW1A 3ZYLA 3EIQC 1HS6A 2LNIA 1PAQA 3PVLA 2DIWA 5BT1A 2WXLA 3JUIA 3FFLA 3RIBA 3I4GA 4NACA 3FH8A 2AXZA 1ZBPA 2NSZA 1Y8MA 3KS2A 4FLBA 4DLQA 3QARA 1HU3A 4J6IA 3CKBA 4N2QA 1SZAA 2FULA 5EX0A 3ZVVA 3TXNA 5BV1A 2Y4TA 4XE0A 4ILGA 1TJFA 4DI3A 1UJKA 1HX8A 3HVEB 3DPDA 3CVLA 2J4BA 2PM7A 4ILIA 2IF4A 5ARGA 4GZDA 3RO3A 3HYMB 3LY8A 4KBQA 2PQRA 4CCAA 3FTZA 4UWHA 5DIZA 1FCHA 2I1JA 4N3CA 4J8FA 4UWKA 1EF1C 5LP0A 4KT6B 4A3VA 4NQ0A 1B89A 2IJGX 5FQ8A 3TG4A 2I9CA 5JHAA 2WMOA 1U3DA 2CHZA 4KVOA 3PH0C 2L0TB 4XZ4A 4A1GA 4BTBA 4GA2A 3CEQA 2J4DA 2KM4A 4CT0A 3FUFA 3PUKA 3R7RA 1H2VC 1HO8A 4J8EA 4U63A 3UT4A 3FUMA 5D0QD 1JWFA 3FU3A 3D9PA 3LY9A 4L1BA 3CVNA 2FI7A 3ZYMA 5HQ8A 5FT9A 4AV7A 1KT0A 5ENNA 4HORA 4UQXA 4JA7A 1HFAA 2IONA 3CSTA 4RSYA 3D9MA 2IFUA 4ABNA 3ZRHA 3Q15A 3UMVA 4N2SA 3SNXA 4HOQA 4I1AA 5KJNA 1E8YA 3PDNA 4AP2A 2DBAA 4HS2A 3FUEA 5AJLA 3ASHA 1UN8A 3EDTB 4G26A 4Q94A 3GZSA 4I1OB 3ZHEA 4EBAA 4CGWA 1ELKA 3LEWA 2VGXB 4LEUA 2WPVA 3MJWA 3BG0B 5BPPA 2XHEA 4B8AA 5CCLA 2P58C 3CHMA 4GPKA 2GGFA 4UQYA 3ASDA 2WXMA 4RG9A 5KJMA 4PUCA 4EBAG 5ARFA 4GA0A 3GW4A 2WXIA 5C2YA 5FTPA 4F53A 5E76A 3SZ7A 3ZYKA 4KXKB 3VLDA 3DBSA 4I9CA 4F1SA 2WM9A 2WXJA 2L0IA 2Q7FA 3L22A 2WXFA 4JHKA 2Y3AA 2UY1A 1W3BA 3IEGA 1H0AA 4GZ5A 2RD0A 3QWPA 4H7XA 1H2UA 4NURA 1XNFA 3T5VA 3MCXA 4UWLA 4XI9A 2GRMA 3CVPA 4XX5A 3PS6A 3JQ1A 2YHCA 3B13A 1H19A 3FTWA 4J0UA 4I2WA 2PM6A 1SZ9A 2I2OA 2PL2A 4FJYA 4KZ0A 4EECA 4FADA 3MKQA 4ME2A 3CGHA 4J8DA 1HG5A 1IQUA 4ILHB 1WM5A 2XPZA 3CQCB 3GYZA 4AEZC 2WQ7A 4GYOA 4KYOB 4IULA 4L23A 3E4BA 5FZRA 3Q47B 2I6HA 3UQ3A 4BX8A 2LO6A 3KEZA 2X6FA 3IHVA 4I1MA 2KZTB 2X6HA 4JZYA 1N54A 4OYSA 4Y6CA 3MKRA 4BX9A 3CVYA 2QFCA 4ANUA 5M72A 1NZNA 1OUVA 2XPIA 3D9JA 5G05C 2V8SE 4PS3A 2PQNA 2VJ8A 2XQ0A 3CHSA 2X6JA 3HVEA 4FJZA 4IRUA 3L17A 4BT8A 1OWPA 2ONDA 1IYGA 4CDNA 4N39A 3AS4A 1UN9A 3ZW3A 4U0UA 1Y6IA 2VGYA 4PS7A 1KLXA 2CFUA 1EYHA 1MQSA 3FP3A 4M3OA 2M63A 4CRWA 2KCVA 2WXGA 2FO7A 3FTXA 4I6EA 5JHBA 2IOSA 3OXFA 4JL0A 4FHJA 4LERA 4AVXA 3NQPA 5G55A 2C2LA 2VSOE 3D9IA 3GZ1A 4JPSA 3FUJA 4LRZA 2L6JA 1E8ZA 3SBSA 4RG6A 3QK0A 1X5BA 3NZSA 2UWJG 3CKCA 2DCPA 3FUDA 3ML8A 4D10C 5A7DB 4EZJA 4N3AA 2LSUA 3EJNA 1KT1A 5KCMA 2E0IA 4J8SA 4F3VA 4KZCA 5A6CA 1E96B 3TJPA 1ZU2A 4U0SA 3SBTB 2WXKA 1L5JA 3CIAA 3S2AA 4CEMA 3FUIA 1UG3A 3BG1B 4GZ3A 5FZQA 3ZYQA 1JUQA 4L2LA 3EIJA 4B0ZA 5ANLA 5EDSA 4WAFA 4ATGA 2ZU6B 4UQZA 3UPVA 1OWOA 4HLEA 5T4YA 3PRZA 2AXVA 3MA5A 2OVFA 2VGXA 4U04A 3R9AB 4ANWA 1OWNA 3U9WA 3PEVB 3TAXA 4WUYA 4P29A 3Q49B 2AVPA 4JVSA 2OOEA 5HI7A 2CG3A 1HE8A 4K0RA 3ZPJA 5JJTA 3NF1A 4BTAA 2CG2A 1E8XA 3HIZA 4GMLA 4AIFA 3EHNA 3U4TA 3TL5A 4DK5A 2VTBA 1WAO1 4GB9A 5E75A 1Z6TA 3FU0A 4I2ZA 2VSXE 3CK8A 3QJZA 1MHQA 2VSNA 1GW6A 4UWGA 1H6KA 4R7LA 4JC8A 3UX4A 4YVOA 3MZLB 3S7FA 1EPUA 3TGOA 2J49A 4H7YA 4WNEA 1TJCA 4YVQC 2XCBA 3ZGQA 4APOA 1FVFA 4UI9C 4I9EA 3CVVA 3FTYA 3LXUX 2XGOA 4GAAA 3D9KA 4FA6A 4WNDA 5CMYA 4AOFA 4URKA 2QY7A 4G24A 4HOUA 3D9OA 3FTVA 4WWNA 2YINA 3UT7A 3ZN3A 3MV3B 2KC7A 2HR2A 5EKQD 2CHWA 4CT4A 3EHMA 3B7RL 4B94A 5CCMA 3P1UA 3AS5A 3B7SA 3HDXA 3SGHA 3U66A 3TXMA 4EZLA 5J08A 2AXUA 2R5SA 2WXRA 3APFA 3OAWA 3MEKA 3I4RB 4MLPA 2WXHA 4Q69A 4PS8A 4UI9J 2A4ZA 2KZTA 5T8IA 3QDNA 4UI9K 5FZSA 1LF8A 1OWLA 2YQ8A 3FU6A 1E90A 3JQ0A 3L08A 3VTXA 3S7DA 2FBNA 4AY5A 3FUKA 2HM8A 3RKVA 3P2BA 1IQRA 3D9NA 3LY7A 3PUJA 4MRUA 4A3TA 4ACKA 2V0PA 3FTUA 5G04C 2A5UA 1DNPA 1TEZA 2XPYA 5BNWA 3L54A 4HFGA 3LVRE 3L6AA 3RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TXM A;  3CHM A;  3JCK C;  3T5X A;  2MRI A;  3TXN A;  4LCT A;  4D10 C; 
#chains in the Genus database with same CATH topology
 1OCO E;  4XIF A;  4MS6 A;  4X8Q A;  3G2U A;  5AQ7 A;  1UOH A;  2IQC A;  4NRH B;  2YHE A;  3MGB A;  3QAQ A;  2X6I A;  3RRN B;  2JLB A;  4U95 D;  2ILR A;  4HOS A;  3BUA A;  3HG0 D;  2J07 A;  2P9N G;  5FJY A;  3DXM G;  4LNB A;  5CEA A;  3C5R A;  2ZIS A;  1N95 A;  3NBN B;  4APF A;  3N71 A;  5T3R A;  2BUG A;  2MHK A;  1N11 A;  2WXO A;  1K3Z D;  4F1P A;  3Q4A B;  1PC2 A;  3AU4 A;  4XKC A;  3EHQ A;  5D0O D;  1TN7 A;  3TG5 A;  2OEV A;  1TR4 A;  2BKG A;  3UT8 A;  3CVW A;  3LCA A;  3B95 A;  4G23 A;  4GCO A;  4UUC A;  4FC8 A;  3RU0 A;  3D3M A;  4DLO A;  3PRE A;  3IHY A;  1WY6 A;  2NC9 A;  2AJA A;  1TN8 A;  2XRZ A;  2LAH A;  4E85 A;  3W9F A;  4GMJ A;  1MX6 A;  2QZA A;  4HLL A;  4KVM A;  4FU3 A;  4HI9 A;  3PZD A;  4FUL A;  4K03 A;  3GZ2 A;  1HZ4 A;  1JPL A;  1ELR A;  5A23 A;  5J90 A;  2L6B A;  3RJV A;  3S7B A;  3G2S A;  4U96 D;  2DZN A;  1U3C A;  3C3O A;  5ITZ F;  4TXR A;  3DEP A;  3WXX A;  4E6H A;  4WWO A;  3Q5M A;  4N5C A;  3CR3 A;  1TNO A;  3AG2 E;  3UIN C;  4ANX A;  4Q96 A;  4G8L A;  4DX1 A;  3FH7 A;  2XGS A;  4GYY A;  3I5P A;  4FP7 A;  3ASG A;  1IHG A;  4B8C B;  4HOT A;  2IOL A;  4XI0 A;  1XGW A;  2OVB A;  3K9I A;  2WB2 A;  3UUX A;  4B89 A;  3Q78 A;  2BED A;  3D9L A;  1HXI A;  1HF8 A;  1YCS B;  3QOU A;  1NI1 A;  3OXG A;  5AEN A;  1FT1 A;  4DI4 A;  4L2Y A;  2GRL A;  3MKQ B;  3QB2 A;  4EPZ A;  2XGM A;  4JW1 A;  3EIQ C;  3E37 A;  3FFL A;  3FH8 A;  4O1P A;  3BU8 A;  1Y8M A;  3QAR A;  3CKB A;  3TXN A;  4DI3 A;  1HX8 A;  3DPD A;  4ILI A;  3HYM B;  3V2O A;  4CCA A;  5DIZ A;  4N3C A;  4UWK A;  4A3V A;  2WMO A;  4F6R D;  4A1G A;  3DSW A;  4CT0 A;  5AQA A;  3UT4 A;  3FU3 A;  3D9P A;  2FI7 A;  1KT0 A;  3PZ4 A;  2XEN A;  3UMV A;  3L82 A;  4GTR A;  3C72 A;  2VGE A;  5AJL A;  3ASH A;  1UN8 A;  2ETB A;  4I1O B;  1ELK A;  2VGX B;  3NB2 A;  1SA5 A;  5HKP A;  3IXE A;  4GTV A;  2XHE A;  2P58 C;  2GGF A;  3ASD A;  5AN8 A;  4GA0 A;  2WXI A;  5C2Y A;  2H6F A;  5KNG A;  3ZU7 B;  3UM2 A;  2ETA A;  1A5E A;  2UY1 A;  3IEG A;  1H0A A;  4HRM B;  3T5V A;  2YHC A;  3B13 A;  1H19 A;  3ZKJ A;  2I2O A;  4FJY A;  2EIL E;  4YDO A;  3CGH A;  4J8D A;  2XPZ A;  2Y0B G;  3CQC B;  4L23 A;  4BX8 A;  2H6G A;  2KZT B;  4JZY A;  4OYS A;  4Y6C A;  1NZN A;  3D9J A;  4PS3 A;  2XQ0 A;  4BEP A;  4FJZ A;  3L17 A;  1OWP A;  2OND A;  4CDN A;  3ZW3 A;  3OXF A;  4LER A;  2C2L A;  2VSO E;  2L6J A;  4RG6 A;  1OCZ E;  2UWJ G;  4K5B A;  2LSU A;  2E0I A;  4KZC A;  2R05 A;  4U0S A;  4NIK A;  4G8K A;  5AAO A;  4GPM A;  1OWO A;  2GRP B;  2AXV A;  2MYO A;  3MA5 A;  4U04 A;  5CEC B;  4K5C A;  2AVP A;  5JA4 D;  2OOE A;  5HI7 A;  2CG3 A;  1HE8 A;  5JJT A;  4BTA A;  3UIO C;  3HIZ A;  2XZT G;  2P2C P;  5HS0 A;  1WAO 1;  3SY2 A;  4GB9 A;  2VSN A;  1GW6 A;  2PNN A;  4YVO A;  4WNE A;  4YVQ C;  2QYJ A;  4APO A;  1FVF A;  4UI9 C;  4GAA A;  3ZN3 A;  5CBO A;  1LD7 A;  4CT4 A;  3EHM A;  5CCM A;  3SGH A;  3RAU A;  3OAW A;  3MEK A;  3DSU A;  4PS8 A;  3FU6 A;  3V79 K;  1N9A A;  2F37 A;  3T9K A;  1DNP A;  1TEZ A;  2XPY A;  5BNW A;  3Q79 A;  4AV7 A;  5EIL A;  3MV2 B;  3IKO B;  2VYI A;  5BUZ A;  2MRI A;  1V55 E;  4PH4 B;  2NYJ A;  1BPO A;  1HG2 A;  3MYV A;  4G11 A;  4XKB A;  5FIN A;  5LCW C;  4C0E A;  4GZ6 A;  3ONK A;  2XEE A;  5G04 J;  3U3W A;  1HH8 A;  4ACL A;  4HRL A;  4J8Y A;  3CLJ A;  3G2W A;  3PEU B;  4HBD A;  5ENS D;  3KAE A;  3QC1 A;  5FWQ A;  4I6G A;  2X38 A;  3QWV A;  3O48 A;  4CDR A;  3MX3 A;  2EIN E;  3SFZ A;  5JJ6 A;  4AJW A;  1FVH A;  3AG1 E;  3FEX A;  3HXD A;  2R17 C;  3OTN A;  3SFY A;  2E2E A;  1MX2 A;  3I3N A;  4G2V A;  3AU5 A;  4TUM A;  2FEZ A;  3U64 A;  4BY6 A;  4OVV A;  5LOZ A;  3C98 A;  5DBK A;  3HRA A;  3E33 A;  4HXI A;  4IYP A;  1IHB A;  3FDH A;  4A1S A;  4AM9 A;  2LAI A;  4OVU A;  3IBE A;  2J08 A;  5LX8 A;  4V3I A;  2X6K A;  1UW4 B;  2DZO A;  4RQI A;  1H6O A;  3ZNG A;  5KBA A;  3ASF A;  5C1D A;  1G3N B;  4FHK A;  5FQ7 A;  1Z3X A;  2FF4 A;  1QZ2 A;  3FHE A;  3Q73 A;  4DUI A;  4A55 A;  3Q9N C;  1KZP A;  4ATZ D;  2VSY A;  2VTB B;  3CHO A;  3SD5 A;  1H2T C;  5BV0 A;  2I1K A;  5G2N A;  4JD2 G;  4DX2 A;  3ZUV B;  5CMW A;  3DPY A;  5ANR A;  3B7U X;  4YND A;  2XS8 A;  4CGV A;  3CHR A;  4UWF A;  1D8D A;  3T8M A;  1SW6 A;  5AQ9 A;  3TWU A;  4BET A;  2CHX A;  2UY1 B;  4AXH A;  3ESK A;  5LFA A;  4JEU A;  4C0M A;  5KJL A;  4JXT A;  1LD8 A;  5ENR D;  1N94 A;  1ZB1 A;  4U07 A;  1PY1 A;  5D2M C;  2XRY A;  3QKY A;  4RVB A;  2LNI A;  2DIW A;  3ABL E;  1N4S A;  3RIB A;  3I4G A;  2NSZ A;  4FLB A;  3AG4 E;  3ZVV A;  5BV1 A;  4DRX E;  2Y4T A;  4XE0 A;  1UJK A;  2PM7 A;  5ARG A;  2Y1L E;  3RO3 A;  1BLX B;  3LY8 A;  2PQR A;  3FTZ A;  4UWH A;  1FCH A;  4J8F A;  1DC2 A;  4KT6 B;  4NQ0 A;  5FQ8 A;  2I9C A;  2CHZ A;  4KVO A;  4GTP A;  4GA2 A;  1H2V C;  4J8E A;  3FUM A;  1O5M A;  2R2L A;  3LY9 A;  4L1B A;  3ZYM A;  5HQ8 A;  5FT9 A;  4JA7 A;  1IKN D;  2IFU A;  4ABN A;  4N2S A;  2GRO B;  4I1A A;  3PDN A;  3HXE A;  2F0Y A;  4G26 A;  4Q94 A;  4EBA A;  5CRU A;  1OCC E;  3LEW A;  3ABK E;  5BPP A;  4B8A A;  3CHM A;  4RG9 A;  4EBA G;  3GW4 A;  4F53 A;  5E76 A;  2ZIR A;  2HE0 A;  3ZYK A;  3VLD A;  4I9C A;  4F1S A;  3DWL G;  2WXJ A;  2L0I A;  4GTO A;  4Z68 A;  4U8Y D;  3QWP A;  4NUR A;  1XNF A;  2R02 A;  3CVP A;  3JQ1 A;  3FTW A;  4I2W A;  2PM6 A;  1SA4 A;  4EEC A;  4FAD A;  1IQU A;  3JXJ A;  3E4B A;  1DCE A;  2LO6 A;  5HRY A;  1N4P A;  5AQB A;  1BU9 A;  3MKR A;  1OUV A;  2V8S E;  2PQN A;  4YDE A;  4BT8 A;  1IYG A;  4N39 A;  1UN9 A;  1LTX A;  1O1R A;  2VGY A;  1KLX A;  3J5P A;  2M63 A;  5JHB A;  2IOS A;  4AVX A;  4GTT A;  3NZS A;  1QBQ A;  2DCP A;  4EZJ A;  2P9K G;  5KCM A;  1OY3 D;  1S64 A;  1E96 B;  2Y69 E;  1K1B A;  3FUI A;  4GZ3 A;  5FZQ A;  5CRV A;  4L2L A;  2IEJ A;  1TNY A;  4WAF A;  2ZGD A;  3HXF A;  3DEO A;  3KSQ A;  1Q2Z A;  4GTQ A;  3TAX A;  4WUY A;  4JVS A;  1MYO A;  4K0R A;  3NF1 A;  1S63 A;  4AIF A;  4CYM D;  3U4T A;  4DK5 A;  2VTB A;  4I2Z A;  1EPU A;  4H7Y A;  2XCB A;  2GRQ B;  3CVV A;  3FTY A;  3LXU X;  4M7C A;  5CMY A;  4AOF A;  4URK A;  4G24 A;  4HOU A;  3D9O A;  3FTV A;  3JUE A;  3NOC D;  3U66 A;  2LUH A;  3B7S A;  5J08 A;  3TWQ A;  2EIM E;  2WXR A;  3APF A;  3I4R B;  2WXH A;  4Q69 A;  4UI9 J;  2KBX A;  3L08 A;  2YQ8 A;  3JQ0 A;  3RSE G;  1E90 A;  2LXL A;  2P9U G;  3VTX A;  4BES A;  1IQR A;  3D9N A;  4MRU A;  4A3T A;  2A5U A;  3L54 A;  4Y6W A;  4WWN A;  3RO2 A;  4QFV A;  3L16 A;  5B1B E;  3E32 A;  2AW6 A;  4K5A B;  4BFR A;  3URZ A;  3ZXS A;  2Y4U A;  2WXN A;  1N52 A;  4ZHB A;  3NAW A;  3PE3 A;  3W9G A;  3ENE A;  4EQF A;  3UXG A;  2XEH A;  3NZU A;  5AIJ A;  2OCC E;  1VDY A;  2B6C A;  3HHM A;  3CVX A;  1NP7 A;  5G05 J;  3UI2 A;  3FUN A;  2X3M A;  3SF4 A;  3WG7 E;  4G25 A;  3SI5 A;  1A17 A;  3LS8 A;  3E30 A;  4G1T A;  2KCL A;  3APD A;  3LVQ E;  1N0R A;  4F7A A;  1YMP A;  3QWW A;  4I43 A;  3V2X A;  3BEE A;  2V4L A;  2ZXW E;  3G2T A;  4WNG A;  2V5F A;  4HVB A;  1RZ4 A;  4LCT A;  2HO1 A;  3FH5 A;  2P9I G;  3ZIM A;  2WXQ A;  4DPR A;  5BXU A;  3ML9 A;  2XCC A;  4BER A;  1NA3 A;  3RRM B;  3DSX A;  1E8W A;  4JHR A;  3CHQ A;  5EID A;  3CVU A;  2LXM A;  2H6I A;  5CHE E;  3PNT B;  1UJJ A;  3UKR G;  2LSV A;  1U2V G;  3LKU A;  5AJD A;  4DJA A;  4TV3 A;  1BI8 B;  1O1T A;  3LYA A;  5FQ4 A;  2CFZ A;  2WVI A;  3LDZ A;  3V30 A;  3CK9 A;  4GYW A;  3ULQ A;  3AJI A;  4LG6 A;  1NL4 A;  1FPP A;  4FLH A;  3ZEF A;  2KCK A;  2HYZ A;  3ONL A;  3SHF A;  2NXP A;  4WWP A;  1OCR E;  3LPZ A;  3SQV A;  4W9R A;  1Z3Y A;  3CVQ A;  3FUL A;  3PNL B;  3JCK C;  1FT2 A;  4L9P A;  3CQG B;  5JJ7 A;  2YNQ A;  4BWR A;  4GMR A;  2VQ2 A;  4AY6 A;  3APC A;  1JCS A;  4IN3 B;  4JHJ A;  3FUH A;  2PZI A;  3L13 A;  1TYQ G;  4HB5 A;  3PZ1 A;  4LUN U;  4JEH A;  2WXP A;  2GW1 A;  4TRQ A;  1E7U A;  2R59 A;  1EDU A;  4C48 B;  4PDX A;  1RW2 A;  1HS6 A;  4NAC A;  1ZBP A;  3KS2 A;  4DLQ A;  1HU3 A;  4N2Q A;  5ENT D;  3EU9 A;  1TJF A;  3DSV A;  3CVL A;  2J4B A;  3HXC A;  2IF4 A;  4GZD A;  4KBQ A;  3LJN A;  2I1J A;  4U7E B;  5LP0 A;  1B89 A;  2IJG X;  5JHA A;  4ZFH A;  2RFM A;  2L0T B;  4BTB A;  2J4D A;  3CEQ A;  2DWZ A;  2KM4 A;  3PUK A;  1HO8 A;  1JWF A;  5CED B;  3CVN A;  1TNU A;  5ENN A;  3UIP C;  1HFA A;  2ION A;  3CST A;  3D9M A;  3Q15 A;  3SNX A;  4HOQ A;  5KJN A;  1E8Y A;  4AP2 A;  2GRR B;  3EDT B;  3GZS A;  2BKK B;  3ZHE A;  4CGW A;  4LEU A;  2WPV A;  3BG0 B;  3SO8 A;  4GPK A;  3B7B A;  5KJM A;  3DST A;  3SZ7 A;  3EHR A;  3D9H A;  4KXK B;  2Q7F A;  2WXF A;  4JHK A;  2Y3A A;  4GZ5 A;  4H7X A;  1H2U A;  3MCX A;  1K8K G;  4XI9 A;  2GRM A;  3DSS A;  4XX5 A;  3PS6 A;  1H6P A;  4J0U A;  4U8V D;  4B93 B;  2PL2 A;  2FO1 E;  4ME2 A;  1HG5 A;  4ILH B;  1WM5 A;  3GYZ A;  3AG3 E;  4AEZ C;  5EN5 D;  2OEW A;  4KYO B;  2I6H A;  4DX7 D;  2EIJ E;  5H7P A;  3IHV A;  1QYM A;  4BX9 A;  3CVY A;  2QFC A;  5M72 A;  2XPI A;  4BSZ B;  4CZ2 D;  3TWX A;  3HVE A;  3AS4 A;  4U0U A;  1Y6I A;  2CFU A;  1EYH A;  1MQS A;  3FP3 A;  4DX6 D;  4CRW A;  3T8K A;  2WXG A;  3FTX A;  4I6E A;  4JL0 A;  5G55 A;  3Q7A A;  3D9I A;  4O1O A;  5EYL A;  3GZ1 A;  3SBS A;  3FUJ A;  1E8Z A;  1X5B A;  3CKC A;  3FUD A;  3ML8 A;  2KXP C;  4D10 C;  3TWS A;  4N3A A;  3EJN A;  1KT1 A;  2ZGG A;  3SBT B;  1L5J A;  3CIA A;  5ENO D;  3UKU G;  5ANL A;  5EDS A;  2ZU6 B;  3EU5 A;  3UPV A;  3BQO A;  4HLE A;  3EUV A;  3PRZ A;  4HI8 A;  5D66 A;  4ANW A;  1OWN A;  3U9W A;  4P29 A;  4OAU C;  4QQI A;  4OAV B;  4GML A;  3TL5 A;  4A63 B;  2VSX E;  3CK8 A;  3TWW A;  1MHQ A;  1H6K A;  4R7L A;  4JC8 A;  5CBN A;  5AAR A;  3TGO A;  4HRN A;  1JCQ A;  2XGO A;  2QY7 A;  3UT7 A;  2YIN A;  3MV3 B;  4B94 A;  3AS5 A;  3HDX A;  5BXO A;  1D8E A;  4EZL A;  2R5S A;  4MLP A;  3UQ3 A;  2JAB A;  3QDN A;  4UI9 K;  1LF8 A;  2DVW A;  3S7D A;  3FUK A;  2XS1 A;  1KPS B;  3P2B A;  3RKV A;  3LY7 A;  4ACK A;  2H6H A;  3FTU A;  4HNA D;  1AP7 A;  3LVR E;  1OWM A;  2RG8 A;  3CSF A;  4I17 A;  4GU5 A;  3FEY A;  1QNF A;  3IV0 A;  5AYW D;  1X81 A;  3CV0 A;  1TNZ A;  3L9T A;  5FQ6 A;  4YDY A;  1S0P A;  2BTD A;  3HXB A;  1K1A A;  3RRU A;  3T5X A;  2IU1 A;  4KMO A;  3RK6 A;  4U0Z A;  3FU5 A;  3VLE A;  2BF0 X;  3Q7F A;  2EQX A;  2EIK E;  4JB8 P;  1DVP A;  4BSX A;  5EYP F;  2WQH A;  3VLF A;  3VTY A;  1IXV A;  3UM0 A;  5JMN D;  4J7W A;  5KWD A;  4U8H A;  3KSL A;  2F8X K;  3CHP A;  3G2V A;  1INZ A;  5CER B;  3PZ3 A;  3AS8 A;  1JCR A;  4TXQ A;  5BW8 C;  3Q75 A;  4LSZ E;  3QNK A;  3LJ3 A;  4HQD A;  4O60 A;  2MOW A;  4TUU A;  3AAA C;  1N4R A;  3TWR A;  4CDM A;  3ZXP A;  3R9M A;  2WMN A;  4GA1 A;  1ELW A;  1MZC A;  1QQE A;  3OXL A;  2IO3 C;  4BT9 A;  3O4Z A;  3UM3 A;  5EX3 A;  4EZK A;  5IY5 E;  1TNB A;  1WG0 A;  4GZC A;  1E7V A;  2IY0 C;  4MKT A;  1SQM A;  3ZFW A;  2C0M A;  3B7T A;  3V31 A;  5KNH D;  3ZHE B;  3FTS A;  1YYH A;  3ESL A;  4MBG A;  4O6F A;  2GRN B;  2WQ6 A;  3FY4 A;  2V5Q C;  2J09 A;  2ETC A;  1MX4 A;  2V4H C;  4L7T A;  4ANV A;  2AWI A;  1N4Q A;  4C9B B;  1BI7 B;  2OV8 A;  3X2Q E;  2L9B A;  2JEK A;  2F8Y A;  1JWG A;  2KAT A;  3E34 A;  3F6Q A;  2P9S G;  4N3B A;  3PE4 A;  5KJK A;  3R7Q A;  3S7J A;  2XEV A;  5EIB E;  3KD7 A;  3CK7 A;  3FWV A;  1V54 E;  1P5Q A;  2C0L A;  5LCW J;  4I6J A;  4WNF A;  3JYS A;  3DRA A;  2J9Q A;  4GCN A;  1NA0 A;  1YA0 A;  2RFA A;  4JA9 A;  3ZYL A;  5BT1 A;  2RKK A;  1PAQ A;  3PVL A;  2WXL A;  3JUI A;  2AXZ A;  4J6I A;  1SZA A;  2FUL A;  5EX0 A;  1Z5S C;  4ILG A;  3HVE B;  3DXK G;  3ASN E;  1EF1 C;  3TG4 A;  1U3D A;  3PH0 C;  4XZ4 A;  3JXI A;  4XEI G;  3FUF A;  3R7R A;  4U63 A;  5D0Q D;  4GTM A;  3ASO E;  2XZD G;  4HOR A;  5ENP D;  4UQX A;  4RSY A;  3J5Q B;  3ZRH A;  1OXJ A;  4DX5 D;  2R03 A;  2DBA A;  4HS2 A;  3FUE A;  1SVX A;  4N5Q A;  3MJW A;  2P9L G;  5CCL A;  4UQY A;  2WXM A;  4PUC A;  3ULY A;  5ARF A;  5FTP A;  1AWC B;  3ABM E;  3DBS A;  4TXP A;  2WM9 A;  3L22 A;  3PZ2 A;  1NFI E;  1W3B A;  2QYU A;  4LNG A;  2RD0 A;  4UWL A;  3C3R A;  1SZ9 A;  5B3S E;  2A5E A;  2B0O E;  4KZ0 A;  3MKQ A;  2DYR E;  4LNU D;  2WQ7 A;  4GYO A;  4IUL A;  1MJ0 A;  5FZR A;  3Q47 B;  3KEZ A;  2X6F A;  4I1M A;  2X6H A;  2IO2 C;  1N54 A;  2QC9 A;  1KZO A;  4ANU A;  5G05 C;  4GTS A;  2VJ8 A;  3CHS A;  3UTM A;  2X6J A;  4IRU A;  4PS7 A;  1WDY A;  4M3O A;  2KCV A;  4YDW A;  3C3Q A;  2FO7 A;  3SFX A;  4FHJ A;  3NQP A;  1BD8 A;  3ULE G;  4JPS A;  4LRZ A;  1N0Q A;  3QK0 A;  1DCQ A;  4EHM A;  1TN6 A;  5A7D B;  1D9S A;  4J8S A;  4F3V A;  5A6C A;  5FIO A;  3TJP A;  1ZU2 A;  2WXK A;  3S2A A;  4CEM A;  1UG3 A;  3BG1 B;  3ZYQ A;  1JUQ A;  3EIJ A;  4B0Z A;  4ATG A;  4UQZ A;  5T4Y A;  1O1S A;  1S70 B;  5ENQ D;  2OVF A;  3ISM C;  2VGX A;  3R9A B;  3Q9U C;  3PEV B;  3Q49 B;  2J8S D;  3ZPJ A;  2CG2 A;  1E8X A;  3KEA A;  3EHN A;  3TWT A;  5E75 A;  1Z6T A;  3FU0 A;  3QJZ A;  4UWG A;  3UX4 A;  3S7F A;  3MZL B;  2J49 A;  1TJC A;  4RLY A;  3ZGQ A;  4I9E A;  3D9K A;  3NOG D;  4FA6 A;  4WND A;  2KC7 A;  3UM1 A;  2HR2 A;  5EKQ D;  2CHW A;  2DYS E;  3B7R L;  3P1U A;  3TXM A;  2AXU A;  3TWV A;  2A4Z A;  5B1A E;  2KZT A;  5T8I A;  5FZS A;  1OWL A;  1OT8 A;  2P9P G;  2FBN A;  4AY5 A;  2HM8 A;  3PUJ A;  2V0P A;  5G04 C;  4HFG A;  3L6A A; 
#chains in the Genus database with same CATH homology
 1OWM A;  3MV2 B;  3IKO B;  4XIF A;  2RG8 A;  4MS6 A;  2VYI A;  3CSF A;  4QFV A;  5BUZ A;  3L16 A;  2MRI A;  4PH4 B;  4I17 A;  2AW6 A;  3G2U A;  1BPO A;  1HG2 A;  4BFR A;  4GU5 A;  3MYV A;  3FEY A;  1QNF A;  3URZ A;  4G11 A;  2IQC A;  3ZXS A;  4XKB A;  4NRH B;  5LCW C;  2Y4U A;  3IV0 A;  2WXN A;  1N52 A;  5AYW D;  4C0E A;  2YHE A;  3CV0 A;  4GZ6 A;  3ONK A;  3MGB A;  3PE3 A;  3ENE A;  5G04 J;  4EQF A;  1HH8 A;  3QAQ A;  2X6I A;  3U3W A;  3RRN B;  5FQ6 A;  3NZU A;  1S0P A;  2BTD A;  2JLB A;  4ACL A;  4HOS A;  2ILR A;  3CLJ A;  3G2W A;  3RRU A;  3T5X A;  2J07 A;  3PEU B;  5FJY A;  5AIJ A;  1VDY A;  2IU1 A;  3KAE A;  4KMO A;  3HHM A;  3CVX A;  3RK6 A;  3QC1 A;  1NP7 A;  4U0Z A;  3FU5 A;  5FWQ A;  5G05 J;  4I6G A;  2X38 A;  3FUN A;  3VLE A;  2X3M A;  3SF4 A;  2BF0 X;  4APF A;  3N71 A;  3QWV A;  4G25 A;  3SI5 A;  1A17 A;  2EQX A;  3LS8 A;  5T3R A;  3O48 A;  4CDR A;  4G1T A;  1DVP A;  4BSX A;  2KCL A;  3APD A;  3MX3 A;  2WQH A;  2BUG A;  3SFZ A;  2MHK A;  3VLF A;  3LVQ E;  2WXO A;  3VTY A;  5JJ6 A;  4AJW A;  4F7A A;  1FVH A;  3QWW A;  4I43 A;  4U8H A;  3Q4A B;  1PC2 A;  3CHP A;  3FEX A;  2R17 C;  3AU4 A;  4XKC A;  3OTN A;  3G2V A;  1INZ A;  2E2E A;  5D0O D;  3I3N A;  4G2V A;  3AU5 A;  3BEE A;  3TG5 A;  2V4L A;  3AS8 A;  3G2T A;  4WNG A;  2V5F A;  4HVB A;  4LCT A;  2HO1 A;  3FH5 A;  2FEZ A;  3U64 A;  4BY6 A;  4OVV A;  3ZIM A;  5BW8 C;  3UT8 A;  5LOZ A;  3QNK A;  3C98 A;  2WXQ A;  3CVW A;  3LCA A;  4DPR A;  5DBK A;  3LJ3 A;  3ML9 A;  4Y6W A;  2XCC A;  1NA3 A;  3RRM B;  2MOW A;  1E8W A;  4JHR A;  4TUU A;  4G23 A;  3CHQ A;  4HXI A;  4IYP A;  3FDH A;  4GCO A;  4A1S A;  4AM9 A;  2LAI A;  4FC8 A;  3RU0 A;  4CDM A;  3CVU A;  3D3M A;  4DLO A;  3PRE A;  4OVU A;  3IHY A;  3IBE A;  1WY6 A;  5CHE E;  2NC9 A;  2J08 A;  2WMN A;  5LX8 A;  3PNT B;  4GA1 A;  1UJJ A;  4V3I A;  2XRZ A;  2LAH A;  1ELW A;  4E85 A;  2LSV A;  1QQE A;  3OXL A;  4BT9 A;  2X6K A;  3LKU A;  3O4Z A;  4GMJ A;  5AJD A;  4DJA A;  5EX3 A;  1UW4 B;  4KVM A;  4FU3 A;  3PZD A;  4FUL A;  4TV3 A;  3ASF A;  4EZK A;  4K03 A;  3LYA A;  5FQ4 A;  2CFZ A;  5C1D A;  3GZ2 A;  1HZ4 A;  2WVI A;  3LDZ A;  4GZC A;  1JPL A;  1ELR A;  1E7V A;  5A23 A;  5J90 A;  4FHK A;  3CK9 A;  4MKT A;  5FQ7 A;  1Z3X A;  4GYW A;  2FF4 A;  1QZ2 A;  1SQM A;  3FHE A;  3RJV A;  3S7B A;  3ULQ A;  3G2S A;  3ZFW A;  4A55 A;  2C0M A;  1U3C A;  3B7T A;  3ZHE B;  4FLH A;  3ZEF A;  3FTS A;  2VSY A;  2VTB B;  3CHO A;  2KCK A;  3SD5 A;  3WXX A;  1H2T C;  5BV0 A;  2HYZ A;  3ONL A;  3ESL A;  3SHF A;  2I1K A;  4O6F A;  4WWO A;  3Q5M A;  2NXP A;  4N5C A;  3CR3 A;  5G2N A;  4WWP A;  4ANX A;  2WQ6 A;  3FY4 A;  2J09 A;  4Q96 A;  3LPZ A;  5CMW A;  4W9R A;  5ANR A;  3B7U X;  3FH7 A;  4L7T A;  1Z3Y A;  4YND A;  2AWI A;  2XGS A;  4ANV A;  3CVQ A;  3FUL A;  4C9B B;  4GYY A;  3CHR A;  2OV8 A;  3I5P A;  4UWF A;  4CGV A;  4FP7 A;  3ASG A;  1IHG A;  2L9B A;  3T8M A;  4B8C B;  3PNL B;  2IOL A;  3JCK C;  4HOT A;  4XI0 A;  1XGW A;  3CQG B;  2OVB A;  3K9I A;  2JEK A;  2WB2 A;  5JJ7 A;  1JWG A;  2KAT A;  2YNQ A;  4BWR A;  2CHX A;  2UY1 B;  2VQ2 A;  4N3B A;  4AXH A;  3PE4 A;  3UUX A;  4B89 A;  4AY6 A;  5KJK A;  3R7Q A;  3S7J A;  3ESK A;  5LFA A;  3APC A;  2XEV A;  3D9L A;  4IN3 B;  4JHJ A;  4JEU A;  3KD7 A;  3FUH A;  2PZI A;  4C0M A;  3L13 A;  5KJL A;  4JXT A;  1HXI A;  3CK7 A;  3FWV A;  1HF8 A;  3QOU A;  4LUN U;  1P5Q A;  2C0L A;  3OXG A;  4U07 A;  5LCW J;  5AEN A;  4JEH A;  1PY1 A;  2WXP A;  2GW1 A;  2XRY A;  4DI4 A;  3QKY A;  2GRL A;  4I6J A;  3JYS A;  4L2Y A;  4TRQ A;  4WNF A;  3MKQ B;  1E7U A;  2J9Q A;  2R59 A;  4GCN A;  1EDU A;  3QB2 A;  1NA0 A;  4RVB A;  2XGM A;  4E6H A;  4EPZ A;  1YA0 A;  4PDX A;  4JA9 A;  4JW1 A;  3ZYL A;  3EIQ C;  1HS6 A;  2LNI A;  1PAQ A;  3PVL A;  2DIW A;  5BT1 A;  2WXL A;  3JUI A;  3FFL A;  3RIB A;  3I4G A;  4NAC A;  3FH8 A;  2AXZ A;  1ZBP A;  2NSZ A;  1Y8M A;  3KS2 A;  4FLB A;  4DLQ A;  3QAR A;  1HU3 A;  4J6I A;  3CKB A;  4N2Q A;  1SZA A;  2FUL A;  5EX0 A;  3ZVV A;  3TXN A;  5BV1 A;  2Y4T A;  4XE0 A;  4ILG A;  1TJF A;  4DI3 A;  1UJK A;  1HX8 A;  3HVE B;  3DPD A;  3CVL A;  2J4B A;  2PM7 A;  4ILI A;  2IF4 A;  5ARG A;  4GZD A;  3RO3 A;  3HYM B;  3LY8 A;  4KBQ A;  2PQR A;  4CCA A;  3FTZ A;  4UWH A;  5DIZ A;  1FCH A;  2I1J A;  4N3C A;  4J8F A;  4UWK A;  1EF1 C;  5LP0 A;  4KT6 B;  4A3V A;  4NQ0 A;  1B89 A;  2IJG X;  5FQ8 A;  3TG4 A;  2I9C A;  5JHA A;  2WMO A;  1U3D A;  2CHZ A;  4KVO A;  3PH0 C;  2L0T B;  4XZ4 A;  4A1G A;  4BTB A;  4GA2 A;  3CEQ A;  2J4D A;  2KM4 A;  4CT0 A;  3FUF A;  3PUK A;  3R7R A;  1H2V C;  1HO8 A;  4J8E A;  4U63 A;  3UT4 A;  3FUM A;  5D0Q D;  1JWF A;  3FU3 A;  3D9P A;  3LY9 A;  4L1B A;  3CVN A;  2FI7 A;  3ZYM A;  5HQ8 A;  5FT9 A;  4AV7 A;  1KT0 A;  5ENN A;  4HOR A;  4UQX A;  4JA7 A;  1HFA A;  2ION A;  3CST A;  4RSY A;  3D9M A;  2IFU A;  4ABN A;  3ZRH A;  3Q15 A;  3UMV A;  4N2S A;  3SNX A;  4HOQ A;  4I1A A;  5KJN A;  1E8Y A;  3PDN A;  4AP2 A;  2DBA A;  4HS2 A;  3FUE A;  5AJL A;  3ASH A;  1UN8 A;  3EDT B;  4G26 A;  4Q94 A;  3GZS A;  4I1O B;  3ZHE A;  4EBA A;  4CGW A;  1ELK A;  3LEW A;  2VGX B;  4LEU A;  2WPV A;  3MJW A;  3BG0 B;  5BPP A;  2XHE A;  4B8A A;  5CCL A;  2P58 C;  3CHM A;  4GPK A;  2GGF A;  4UQY A;  3ASD A;  2WXM A;  4RG9 A;  5KJM A;  4PUC A;  4EBA G;  5ARF A;  4GA0 A;  3GW4 A;  2WXI A;  5C2Y A;  5FTP A;  4F53 A;  5E76 A;  3SZ7 A;  3ZYK A;  4KXK B;  3VLD A;  3DBS A;  4I9C A;  4F1S A;  2WM9 A;  2WXJ A;  2L0I A;  2Q7F A;  3L22 A;  2WXF A;  4JHK A;  2Y3A A;  2UY1 A;  1W3B A;  3IEG A;  1H0A A;  4GZ5 A;  2RD0 A;  3QWP A;  4H7X A;  1H2U A;  4NUR A;  1XNF A;  3T5V A;  3MCX A;  4UWL A;  4XI9 A;  2GRM A;  3CVP A;  4XX5 A;  3PS6 A;  3JQ1 A;  2YHC A;  3B13 A;  1H19 A;  3FTW A;  4J0U A;  4I2W A;  2PM6 A;  1SZ9 A;  2I2O A;  2PL2 A;  4FJY A;  4KZ0 A;  4EEC A;  4FAD A;  3MKQ A;  4ME2 A;  3CGH A;  4J8D A;  1HG5 A;  1IQU A;  4ILH B;  1WM5 A;  2XPZ A;  3CQC B;  3GYZ A;  4AEZ C;  2WQ7 A;  4GYO A;  4KYO B;  4IUL A;  4L23 A;  3E4B A;  5FZR A;  3Q47 B;  2I6H A;  3UQ3 A;  4BX8 A;  2LO6 A;  3KEZ A;  2X6F A;  3IHV A;  4I1M A;  2KZT B;  2X6H A;  4JZY A;  1N54 A;  4OYS A;  4Y6C A;  3MKR A;  4BX9 A;  3CVY A;  2QFC A;  4ANU A;  5M72 A;  1NZN A;  1OUV A;  2XPI A;  3D9J A;  5G05 C;  2V8S E;  4PS3 A;  2PQN A;  2VJ8 A;  2XQ0 A;  3CHS A;  2X6J A;  3HVE A;  4FJZ A;  4IRU A;  3L17 A;  4BT8 A;  1OWP A;  2OND A;  1IYG A;  4CDN A;  4N39 A;  3AS4 A;  1UN9 A;  3ZW3 A;  4U0U A;  1Y6I A;  2VGY A;  4PS7 A;  1KLX A;  2CFU A;  1EYH A;  1MQS A;  3FP3 A;  4M3O A;  2M63 A;  4CRW A;  2KCV A;  2WXG A;  2FO7 A;  3FTX A;  4I6E A;  5JHB A;  2IOS A;  3OXF A;  4JL0 A;  4FHJ A;  4LER A;  4AVX A;  3NQP A;  5G55 A;  2C2L A;  2VSO E;  3D9I A;  3GZ1 A;  4JPS A;  3FUJ A;  4LRZ A;  2L6J A;  1E8Z A;  3SBS A;  4RG6 A;  3QK0 A;  1X5B A;  3NZS A;  2UWJ G;  3CKC A;  2DCP A;  3FUD A;  3ML8 A;  4D10 C;  5A7D B;  4EZJ A;  4N3A A;  2LSU A;  3EJN A;  1KT1 A;  5KCM A;  2E0I A;  4J8S A;  4F3V A;  4KZC A;  5A6C A;  1E96 B;  3TJP A;  1ZU2 A;  4U0S A;  3SBT B;  2WXK A;  1L5J A;  3CIA A;  3S2A A;  4CEM A;  3FUI A;  1UG3 A;  3BG1 B;  4GZ3 A;  5FZQ A;  3ZYQ A;  1JUQ A;  4L2L A;  3EIJ A;  4B0Z A;  5ANL A;  5EDS A;  4WAF A;  4ATG A;  2ZU6 B;  4UQZ A;  3UPV A;  1OWO A;  4HLE A;  5T4Y A;  3PRZ A;  2AXV A;  3MA5 A;  2OVF A;  2VGX A;  4U04 A;  3R9A B;  4ANW A;  1OWN A;  3U9W A;  3PEV B;  3TAX A;  4WUY A;  4P29 A;  3Q49 B;  2AVP A;  4JVS A;  2OOE A;  5HI7 A;  2CG3 A;  1HE8 A;  4K0R A;  3ZPJ A;  5JJT A;  3NF1 A;  4BTA A;  2CG2 A;  1E8X A;  3HIZ A;  4GML A;  4AIF A;  3EHN A;  3U4T A;  3TL5 A;  4DK5 A;  2VTB A;  1WAO 1;  4GB9 A;  5E75 A;  1Z6T A;  3FU0 A;  4I2Z A;  2VSX E;  3CK8 A;  3QJZ A;  1MHQ A;  2VSN A;  1GW6 A;  4UWG A;  1H6K A;  4R7L A;  4JC8 A;  3UX4 A;  4YVO A;  3MZL B;  3S7F A;  1EPU A;  3TGO A;  2J49 A;  4H7Y A;  4WNE A;  1TJC A;  4YVQ C;  2XCB A;  3ZGQ A;  4APO A;  1FVF A;  4UI9 C;  4I9E A;  3CVV A;  3FTY A;  3LXU X;  2XGO A;  4GAA A;  3D9K A;  4FA6 A;  4WND A;  5CMY A;  4AOF A;  4URK A;  2QY7 A;  4G24 A;  4HOU A;  3D9O A;  3FTV A;  4WWN A;  2YIN A;  3UT7 A;  3ZN3 A;  3MV3 B;  2KC7 A;  2HR2 A;  5EKQ D;  2CHW A;  4CT4 A;  3EHM A;  3B7R L;  4B94 A;  5CCM A;  3P1U A;  3AS5 A;  3B7S A;  3HDX A;  3SGH A;  3U66 A;  3TXM A;  4EZL A;  5J08 A;  2AXU A;  2R5S A;  2WXR A;  3APF A;  3OAW A;  3MEK A;  3I4R B;  4MLP A;  2WXH A;  4Q69 A;  4PS8 A;  4UI9 J;  2A4Z A;  2KZT A;  5T8I A;  3QDN A;  4UI9 K;  5FZS A;  1LF8 A;  1OWL A;  2YQ8 A;  3FU6 A;  1E90 A;  3JQ0 A;  3L08 A;  3VTX A;  3S7D A;  2FBN A;  4AY5 A;  3FUK A;  2HM8 A;  3RKV A;  3P2B A;  1IQR A;  3D9N A;  3LY7 A;  3PUJ A;  4MRU A;  4A3T A;  4ACK A;  2V0P A;  3FTU A;  5G04 C;  2A5U A;  1DNP A;  1TEZ A;  2XPY A;  5BNW A;  3L54 A;  4HFG A;  3LVR E;  3L6A A;  3RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...