2IY0C

Senp1 (mutant) sumo1 rangap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
total genus 57
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2iy0C00
3UIOC 2IY0C 1KPSB 2GRNB 2GRPB 2GROB 2GRRB 2GRQB 1Z5SC 5D2MC 3UIPC 3UINC 2IO3C 2IO2C
chains in the Genus database with same CATH superfamily
3G2VA 1N4QA 2XPIA 3ESKA 2V4LA 3ABLE 4HFGA 4FLBA 1SZ9A 1LTXA 2CG3A 4BEPA 3QAQA 3BUAA 4JC8A 2CG2A 4UI9K 2EINE 5ENOD 5LCWC 2DYSE 1N54A 1SQMA 2J4DA 4GCNA 3MEKA 4RQIA 1HZ4A 3C98A 3KSQA 4A1GA 2EIJE 3MZLB 5C2YA 4MKTA 4A3VA 3E37A 2PL2A 3R7RA 1JCQA 4KMOA 4ANXA 3CKCA 4LNGA 4ZHBA 3JYSA 5JHBA 3ONKA 2BKKB 4Z68A 3Q7AA 3S7JA 3MX3A 5T3RA 4DK5A 4HB5A 1E8YA 3FH8A 3ISMC 4FP7A 3IEGA 3FTZA 3SY2A 3FUHA 3TAXA 3SFYA 4DJAA 3PE3A 3B7TA 3ONLA 4G23A 4HQDA 1MX2A 4HOSA 4TXQA 3FUKA 3KEZA 3ZPJA 1H2UA 4BFRA 3L17A 3UTMA 4MLPA 1TR4A 5CEDB 2AXZA 5BUZA 3RAUA 3HXFA 3I4RB 3Q47B 4CDMA 3EHMA 3FFLA 4UWFA 4XEIG 5ARFA 2MYOA 2MOWA 4M3OA 1JWGA 3ML9A 5BPPA 3QKYA 5JJ6A 2IJGX 5AQ7A 3FTVA 3Q75A 3FHEA 2MHKA 1Z5SC 2P58C 2DZNA 4WNDA 3SO8A 1HE8A 3PZ4A 1NP7A 4J8SA 3MKQA 2HR2A 3QJZA 3CGHA 3O48A 1JCRA 3FU3A 5H7PA 4JHJA 3HXBA 2J4BA 3B7UX 3EHNA 5D0OD 4F1PA 4QQIA 1TNUA 4IYPA 1N11A 4I1AA 3PEVB 5J08A 3VTXA 3FUEA 2R5SA 4I9EA 5CCMA 3RRUA 4YDWA 4IN3B 4DLQA 3P2BA 2ZGGA 3LS8A 4UI9C 5CBOA 3R9AB 3V30A 4G25A 5JA4D 3AS5A 4GYYA 1OWPA 1D8DA 2WXRA 3PZ2A 3RO3A 4DX6D 5BV0A 4JA9A 4WAFA 2WXGA 4XIFA 3LY7A 3NQPA 2NSZA 1BPOA 4AXHA 1O1SA 2P9NG 1WDYA 3MCXA 1IHGA 3LJ3A 3DXKG 3L9TA 2YQ8A 2L0IA 4J8DA 1NA3A 3FU0A 3C3OA 1Z6TA 3ASHA 1PC2A 2FO1E 4N2SA 4TXPA 3QDNA 4ILHB 4HORA 4FLHA 2X38A 1HO8A 4GTVA 2XGMA 3PZDA 1IKND 2IFUA 3MKRA 2PNNA 3K9IA 4GPMA 3CQGB 1Z3XA 2KBXA 3UT8A 3DSVA 3ZNGA 3TWTA 5EIDA 4AEZC 2Y4UA 1DC2A 3I5PA 4H7YA 3EJNA 3Q15A 4DX7D 4B93B 4LG6A 2P9IG 1QZ2A 3CVPA 4YVOA 5AIJA 3LY8A 4GTPA 3SI5A 3T5XA 2V5FA 3V2OA 1Y8MA 3CR3A 3CHOA 3CHSA 2QYJA 1TN7A 2Q7FA 3FUJA 4ATGA 4ATZD 3RJVA 2J8SD 2FI7A 3VLFA 1JWFA 2JLBA 2WXNA 2VGXA 4GMJA 1OCCE 3ZHEA 2M63A 5ENQD 1IQRA 1N4PA 4MBGA 3Q79A 1EPUA 5CHEE 1O1RA 4O6FA 3EHRA 5A7DB 3NZSA 2VJ8A 3D9HA 4N5CA 4Q96A 5FZSA 1BI7B 4EZJA 3L82A 1TNYA 2RFAA 2RFMA 5ENPD 3PH0C 2YINA 2P2CP 2OCCE 2YNQA 3RK6A 2RD0A 1KZOA 3AJIA 3WG7E 2ETBA 4F53A 4JD2G 3KEAA 1KPSB 4TV3A 4C48B 1UN8A 4BT8A 3PS6A 4D10C 2WXIA 1NFIE 2IQCA 3T8MA 2X3MA 1H0AA 4PS8A 3TWWA 2DIWA 3PNTB 2GW1A 2L9BA 3IBEA 2GRMA 4BT9A 2LXLA 4GA0A 5HKPA 4AVXA 1DNPA 1MX4A 5FQ6A 5BNWA 4XE0A 3I4GA 2NC9A 5BW8C 1TEZA 2WQ6A 3KSLA 4NRHB 1D8EA 3GYZA 3UM2A 3APFA 2ONDA 2A4ZA 4OYSA 3FTUA 1XNFA 4JHKA 4KVMA 4X8QA 3D9LA 4APOA 2XRZA 2WVIA 2WXLA 2KCLA 4K0RA 1E8ZA 3SHFA 3ZW3A 2ZU6B 4LNUD 4DLOA 3DEPA 3SBSA 4LERA 5CMYA 4FHJA 3LVRE 3EIQC 1IHBA 2PM7A 5KBAA 3CHMA 3UMVA 3BG0B 3ASDA 4UWKA 1MZCA 4LUNU 3LCAA 3MKQB 2CHXA 1ZBPA 4FHKA 2F8YA 4U0UA 1OCZE 3JQ0A 1IQUA 2AXVA 3IV0A 4B8AA 4J8EA 3ZXSA 3CVXA 3PREA 3NBNB 2VTBA 4G11A 3FTYA 1ELKA 2OOEA 2VSYA 3NOGD 2XPYA 3QARA 4HOUA 3UM0A 2J09A 1HG5A 4I2ZA 1KT1A 3RU0A 3FUMA 1BI8B 3I3NA 4A55A 4KZ0A 3TWUA 2R02A 2XEEA 1SA5A 2XQ0A 4CDRA 3QOUA 4U7EB 2QFCA 3D9JA 1MHQA 2J07A 5G2NA 4DPRA 4CT4A 2GRPB 2C0MA 3R9MA 3BG1B 1SZAA 4HBDA 3ZN3A 3G2UA 5CMWA 3AS8A 4WWPA 4J7WA 3ZEFA 4BESA 3JUEA 4AV7A 3ZRHA 1UOHA 5EX3A 3FEXA 1MQSA 4WUYA 3CVVA 3TG5A 4ANVA 4YNDA 1O5MA 4K03A 3OXLA 4TRQA 1K1BA 4GPKA 5AJDA 2C2LA 4HNAD 2NXPA 4Q94A 4I17A 3ABME 4HRLA 5G55A 5B1BE 5E75A 1HX8A 3ASFA 4U07A 3UKRG 2J08A 4Y6CA 3CVWA 4OAUC 3BEEA 4L7TA 3TXMA 4ACKA 3TWQA 3UM3A 4GZ3A 4JVSA 3B95A 1DCEA 3ZHEB 2P9UG 3DSXA 4TXRA 5CEAA 3ASNE 2FF4A 3EDTB 4FA6A 3PEUB 3UPVA 2GRQB 1TJFA 4WNGA 5B1AE 1K3ZD 1SA4A 2UY1A 3JUIA 5EIBE 2X6HA 2HM8A 2LAIA 4UQYA 2BEDA 4XZ4A 1L5JA 2OEVA 3UT4A 3ZYMA 2H6IA 4AJWA 4LSZE 4GTMA 1JCSA 5FWQA 4GAAA 4BWRA 4JL0A 3FY4A 3Q7FA 5T4YA 3JXIA 1OWLA 3CEQA 3ZYLA 2OV8A 3N71A 2ZXWE 4A63B 2J49A 2VSOE 5EILA 1OY3D 4HOTA 1MX6A 4N3AA 4ACLA 3EU9A 4L23A 3DSWA 4BTAA 5CRVA 5HQ8A 3SF4A 2F8XK 1UG3A 3U3WA 3URZA 3TG4A 4NIKA 2XCBA 2DYRE 3L22A 3CHRA 2IO2C 3RSEG 5AQ9A 5EYLA 1IYGA 4U0SA 2ZGDA 2IOLA 1QNFA 2WMNA 4L1BA 1ZU2A 2IU1A 2H6HA 3TWSA 1N0RA 5A6CA 4GB9A 2UY1B 5ENNA 1H6OA 4KXKB 4J6IA 4U8HA 2VTBB 1N94A 3PVLA 4GMLA 3TWXA 3HVEA 2KC7A 4U95D 5HRYA 4MS6A 3AAAC 5FIOA 4I1MA 3CK9A 3Q49B 3B7SA 1U3CA 3LYAA 2L6JA 3SZ7A 5FT9A 1W3BA 4CDNA 4GTTA 5EX0A 2ZISA 4MRUA 2H6GA 3UKUG 1U2VG 1QBQA 1WAO1 3ZXPA 3KD7A 2WM9A 1B89A 3ZIMA 3D9KA 1EF1C 5D2MC 4GYOA 4I6JA 5ENSD 4HVBA 4L2YA 2I9CA 2GRNB 4J8FA 4N3BA 2HE0A 4BSZB 1PAQA 1TJCA 1BLXB 2XPZA 4O60A 3PNLB 5LP0A 1K8KG 3HIZA 5G04C 4I6EA 2P9PG 3QWVA 3EIJA 2QZAA 3RRNB 3F6QA 3T9KA 1S0PA 4L2LA 4QFVA 5ANLA 1YCSB 3ULYA 4AIFA 3V31A 4JA7A 3E32A 4PS7A 3IKOB 3PUJA 2R2LA 2R59A 1N9AA 4JHRA 2LNIA 3T8KA 2IOSA 4UWHA 2Y69E 4JXTA 5AN8A 2AVPA 1OWMA 1YA0A 2R03A 3FU6A 3D9NA 3FWVA 5EDSA 2OVBA 1QYMA 5HI7A 5FQ8A 2DCPA 3D3MA 3UUXA 4Y6WA 4OVVA 1KLXA 1HS6A 4K5BA 5D0QD 3E34A 4AY6A 2YHEA 3L6AA 1IXVA 2VGXB 4CYMD 1HG2A 1KZPA 4GTRA 3D9OA 3TL5A 4RG9A 3FUNA 4GZCA 4UI9J 1UN9A 4J8YA 3SFXA 4HOQA 2WQHA 3PZ3A 3JXJA 2V0PA 4WNFA 5IY5E 4YVQC 1SW6A 2ETCA 3IXEA 3U9WA 1ELRA 4O1OA 1AP7A 3DEOA 5ARGA 3DSSA 4BERA 3J5PA 2X6IA 4UWLA 4WWOA 3VLEA 4A3TA 3BU8A 3UINC 1TNOA 3QNKA 5AQBA 4GMRA 4G8LA 3DSUA 5B3SE 2LO6A 3S7DA 2R17C 3HYMB 3UIOC 5LX8A 4DRXE 3ZFWA 3E33A 2WXMA 2P9KG 2I1JA 2EIKE 3D9MA 4N3CA 5JJ7A 3B13A 4RVBA 1PY1A 3ASOE 4R7LA 1OXJA 1ZB1A 4JEHA 3LVQE 4N5QA 3G2WA 4YDYA 1FVHA 3FEYA 3OXFA 1X81A 4LEUA 3LEWA 3ML8A 3UT7A 4GZ5A 3NZUA 3RIBA 4F3VA 1OCOE 1AWCB 4XX5A 4HLEA 4GTSA 5DBKA 4XKBA 1WY6A 3TWRA 2L0TB 2HYZA 1WG0A 2XENA 2P9LG 4GCOA 3UQ3A 3CV0A 4NURA 4EHMA 3HXDA 3Q5MA 4G26A 3NAWA 1UW4B 3ESLA 2VSNA 3FTXA 4AP2A 3ZU7B 1Y6IA 2UWJG 1MYOA 2XGOA 3CHPA 2CHWA 3IHVA 4G24A 3AG4E 4RG6A 3GZSA 3CKBA 2PM6A 3MYVA 4U96D 4GZ6A 4P29A 3NB2A 2VSXE 4A1SA 4DUIA 3ULQA 1A17A 3CSFA 1LD8A 4F1SA 2CFZA 4WWNA 2JEKA 3PZ1A 4HI8A 4BSXA 3AG3E 4C0EA 3G2SA 4FJZA 2ILRA 3ULEG 3O4ZA 4AOFA 4B8CB 3APCA 4JEUA 2OVFA 3S7FA 1TN6A 5BT1A 2F0YA 5FINA 4EECA 5J90A 4G2VA 2KATA 4F6RD 3APDA 4N2QA 3TWVA 5HS0A 3G2TA 4LNBA 1OUVA 5FTPA 3KAEA 4ABNA 5KJMA 4U8VD 2RG8A 3ZYQA 4FC8A 1N4RA 1S70B 2QY7A 1U3DA 5DIZA 4BY6A 5CERB 3QC1A 5A23A 4ANWA 2E2EA 4EBAG 4XI9A 5BXOA 3LPZA 5AAOA 3V2XA 3CIAA 1K1AA 1X5BA 4FU3A 3LKUA 3HDXA 4DX1A 3QWWA 3B7RL 2IY0C 3KS2A 3LDZA 1N4SA 3JCKC 3T5VA 2NYJA 4UUCA 3QWPA 3GZ1A 1HH8A 2DWZA 2XHEA 3EHQA 5LCWJ 3U66A 3ASGA 3AU5A 4I6GA 4BX8A 4ME2A 3P1UA 3IHYA 5ENRD 3Q78A 4JZYA 2BKGA 1KT0A 5AQAA 3AG1E 4H7XA 1TNBA 5KWDA 4DX2A 4FJYA 2BUGA 2WXHA 1E7UA 4DI3A 1N52A 5G04J 2ZIRA 3RO2A 1V55E 3FUIA 2WXKA 3ABKE 4I9CA 2AW6A 4AM9A 2LAHA 3DBSA 1ELWA 4E85A 2A5EA 3QK0A 2GRRB 1BD8A 4CRWA 5FQ4A 3TJPA 5KNGA 3Q73A 4EZKA 5FZRA 2GRLA 4EQFA 1TNZA 3W9FA 1FVFA 3AG2E 4W9RA 2WMOA 1H6KA 4XI0A 3C3RA 2VYIA 3DXMG 4KBQA 4IRUA 3Q9UC 5ANRA 4CGVA 5EKQD 4PDXA 3J5QB 5CBNA 3C72A 4BETA 2DZOA 5ENTD 3CVUA 5FZQA 5AJLA 4IULA 1H2TC 4YDEA 2QYUA 1E7VA 2B6CA 1XGWA 1E96B 1NI1A 1E90A 2CFUA 4OAVB 2QC9A 4N39A 1Z3YA 5JJTA 1H6PA 4U63A 3Q4AB 4APFA 1TYQG 1HFAA 2WXOA 3Q9NC 2XS8A 3ZUVB 2EIME 3FH5A 3EU5A 4HLLA 1VDYA 4GZDA 4NACA 4KYOB 5KCMA 2Y3AA 2CHZA 4U8YD 3CVQA 3LY9A 2E0IA 3PDNA 3OXGA 4F7AA 2P9SG 3S2AA 2KZTB 3C3QA 1UJJA 3MJWA 4C9BB 2YHCA 3FTSA 4GU5A 3FULA 4FADA 2V8SE 4O1PA 4ZFHA 4TUUA 5CCLA 3SNXA 3CVYA 3HHMA 3FTWA 2PQRA 4PH4B 4UWGA 4XKCA 4YDOA 2FEZA 2IF4A 4EPZA 3DPYA 5D66A 5ITZF 3NF1A 4I43A 1HF8A 4M7CA 4DX5D 5AYWD 2C0LA 3CLJA 3CVLA 3DWLG 3FH7A 2PZIA 4V3IA 1OT8A 3SBTB 4CEMA 1N95A 1LD7A 3S7BA 2WXQA 3L08A 4RLYA 2Y1LE 3LJNA 3OTNA 1H2VC 3CVNA 4Q69A 4ANUA 4ILGA 4GYWA 4CZ2D 3FUFA 5E76A 5KJNA 3EUVA 3HXCA 2L6BA 4PUCA 2KXPC 3L54A 1H19A 2FULA 1GW6A 2XEVA 4K5AB 4JPSA 1RZ4A 1P5QA 2XRYA 2I2OA 4GTOA 1TN8A 4EZLA 4RSYA 4BX9A 3DPDA 2PQNA 1EDUA 2BTDA 5EYPF 1SVXA 4CGWA 2I6HA 5LOZA 2OEWA 3U4TA 4HRNA 3HVEB 3CK7A 1INZA 3B7BA 3UX4A 2B0OE 2WXPA 3ZYKA 1A5EA 3UXGA 4HXIA 1V54E 4HS2A 4DI4A 3L13A 4GTQA 2EILE 2LXMA 2AXUA 3ENEA 3L16A 2X6KA 3SD5A 5CRUA 3ZKJA 2GROB 3D9IA 1S64A 5T8IA 2WPVA 5EN5D 1NZNA 3GW4A 2XS1A 5BXUA 2WB2A 3OAWA 4I1OB 1N0QA 5G05C 1MJ0A 4JB8P 2HO1A 2J9QA 2DVWA 3E4BA 3MA5A 1NL4A 1S63A 3RRMB 3C5RA 3VLDA 3TGOA 3QB2A 1OCRE 4K5CA 2KCVA 4LRZA 4U0ZA 1E8WA 3E30A 3BQOA 5AARA 3DRAA 4HI9A 2V4HC 2LSUA 4URKA 1EYHA 1E8XA 2XZDG 2VQ2A 3CQCB 2IONA 4ILIA 2I1KA 1LF8A 4PS3A 4UQXA 1JPLA 4G1TA 4E6HA 2RKKA 2DBAA 4J0UA 3U64A 2BF0X 4JW1A 3HG0D 5C1DA 2XCCA 3FU5A 4OVUA 4FULA 2ETAA 3FUDA 1FT2A 2A5UA 3VTYA 5JHAA 2AWIA 2F37A 3PE4A 1WM5A 2EQXA 5JMND 4LCTA 1QQEA 3SQVA 1RW2A 2VGEA 3MGBA 2JABA 3WXXA 4GA2A 3UI2A 4CCAA 2MRIA 2X6FA 3DSTA 3X2QE 2XZTG 4L9PA 3FP3A 4BTBA 3SFZA 3PUKA 3FDHA 4AY5A 1FPPA 3MV2B 4KVOA 2XEHA 3UIPC 4NQ0A 3UM1A 3MV3B 4WNEA 4I2WA 4KT6B 3RKVA 2WXFA 1FT1A 2VGYA 2FO7A 4UQZA 2KZTA 1UJKA 2Y4TA 3HRAA 1NA0A 4U04A 1BU9A 1OWOA 1YMPA 3AU4A 3TXNA 4CT0A 5CECB 2GGFA 1JUQA 2WXJA 1HXIA 5AENA 2IO3C 2AJAA 1DCQA 2KM4A 2H6FA 3HXEA 4C0MA 3CK8A 1G3NB 4TUMA 2LUHA 3R7QA 2LSVA 3CSTA 1HU3A 1Q2ZA 2Y0BG 5M72A 4GA1A 3AS4A 4B89A 2XGSA 2FBNA 3LXUX 4G8KA 2IEJA 1DVPA 3GZ2A 3CHQA 5KJKA 3ZGQA 1FCHA 4EBAA 5LFAA 3V79K 2R05A 4HRMB 3ZVVA 5KNHD 3JQ1A 3NOCD 4B94A 2WQ7A 3D9PA 5FJYA 3PRZA 5FQ7A 1O1TA 2X6JA 2V5QC 3W9GA 4B0ZA 1D9SA 2KCKA 1YYHA 4KZCA 5G05J 3SGHA 1OWNA 5BV1A 5KJLA
chains in the Genus database with same CATH topology
3UIOC 2IY0C 1KPSB 2GRNB 2GRPB 2GROB 2GRRB 2GRQB 1Z5SC 5D2MC 3UIPC 3UINC 2IO3C 2IO2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIO C;  2IY0 C;  1KPS B;  2GRN B;  2GRP B;  2GRO B;  2GRR B;  2GRQ B;  1Z5S C;  5D2M C;  3UIP C;  3UIN C;  2IO3 C;  2IO2 C; 
#chains in the Genus database with same CATH topology
 3G2V A;  1N4Q A;  2XPI A;  3ESK A;  2V4L A;  3ABL E;  4HFG A;  4FLB A;  1SZ9 A;  1LTX A;  2CG3 A;  4BEP A;  3QAQ A;  3BUA A;  4JC8 A;  2CG2 A;  4UI9 K;  2EIN E;  5ENO D;  5LCW C;  2DYS E;  1N54 A;  1SQM A;  2J4D A;  4GCN A;  3MEK A;  4RQI A;  1HZ4 A;  3C98 A;  3KSQ A;  4A1G A;  2EIJ E;  3MZL B;  5C2Y A;  4MKT A;  4A3V A;  3E37 A;  2PL2 A;  3R7R A;  1JCQ A;  4KMO A;  4ANX A;  3CKC A;  4LNG A;  4ZHB A;  3JYS A;  5JHB A;  3ONK A;  2BKK B;  4Z68 A;  3Q7A A;  3S7J A;  3MX3 A;  5T3R A;  4DK5 A;  4HB5 A;  1E8Y A;  3FH8 A;  3ISM C;  4FP7 A;  3IEG A;  3FTZ A;  3SY2 A;  3FUH A;  3TAX A;  3SFY A;  4DJA A;  3PE3 A;  3B7T A;  3ONL A;  4G23 A;  4HQD A;  1MX2 A;  4HOS A;  4TXQ A;  3FUK A;  3KEZ A;  3ZPJ A;  1H2U A;  4BFR A;  3L17 A;  3UTM A;  4MLP A;  1TR4 A;  5CED B;  2AXZ A;  5BUZ A;  3RAU A;  3HXF A;  3I4R B;  3Q47 B;  4CDM A;  3EHM A;  3FFL A;  4UWF A;  4XEI G;  5ARF A;  2MYO A;  2MOW A;  4M3O A;  1JWG A;  3ML9 A;  5BPP A;  3QKY A;  5JJ6 A;  2IJG X;  5AQ7 A;  3FTV A;  3Q75 A;  3FHE A;  2MHK A;  1Z5S C;  2P58 C;  2DZN A;  4WND A;  3SO8 A;  1HE8 A;  3PZ4 A;  1NP7 A;  4J8S A;  3MKQ A;  2HR2 A;  3QJZ A;  3CGH A;  3O48 A;  1JCR A;  3FU3 A;  5H7P A;  4JHJ A;  3HXB A;  2J4B A;  3B7U X;  3EHN A;  5D0O D;  4F1P A;  4QQI A;  1TNU A;  4IYP A;  1N11 A;  4I1A A;  3PEV B;  5J08 A;  3VTX A;  3FUE A;  2R5S A;  4I9E A;  5CCM A;  3RRU A;  4YDW A;  4IN3 B;  4DLQ A;  3P2B A;  2ZGG A;  3LS8 A;  4UI9 C;  5CBO A;  3R9A B;  3V30 A;  4G25 A;  5JA4 D;  3AS5 A;  4GYY A;  1OWP A;  1D8D A;  2WXR A;  3PZ2 A;  3RO3 A;  4DX6 D;  5BV0 A;  4JA9 A;  4WAF A;  2WXG A;  4XIF A;  3LY7 A;  3NQP A;  2NSZ A;  1BPO A;  4AXH A;  1O1S A;  2P9N G;  1WDY A;  3MCX A;  1IHG A;  3LJ3 A;  3DXK G;  3L9T A;  2YQ8 A;  2L0I A;  4J8D A;  1NA3 A;  3FU0 A;  3C3O A;  1Z6T A;  3ASH A;  1PC2 A;  2FO1 E;  4N2S A;  4TXP A;  3QDN A;  4ILH B;  4HOR A;  4FLH A;  2X38 A;  1HO8 A;  4GTV A;  2XGM A;  3PZD A;  1IKN D;  2IFU A;  3MKR A;  2PNN A;  3K9I A;  4GPM A;  3CQG B;  1Z3X A;  2KBX A;  3UT8 A;  3DSV A;  3ZNG A;  3TWT A;  5EID A;  4AEZ C;  2Y4U A;  1DC2 A;  3I5P A;  4H7Y A;  3EJN A;  3Q15 A;  4DX7 D;  4B93 B;  4LG6 A;  2P9I G;  1QZ2 A;  3CVP A;  4YVO A;  5AIJ A;  3LY8 A;  4GTP A;  3SI5 A;  3T5X A;  2V5F A;  3V2O A;  1Y8M A;  3CR3 A;  3CHO A;  3CHS A;  2QYJ A;  1TN7 A;  2Q7F A;  3FUJ A;  4ATG A;  4ATZ D;  3RJV A;  2J8S D;  2FI7 A;  3VLF A;  1JWF A;  2JLB A;  2WXN A;  2VGX A;  4GMJ A;  1OCC E;  3ZHE A;  2M63 A;  5ENQ D;  1IQR A;  1N4P A;  4MBG A;  3Q79 A;  1EPU A;  5CHE E;  1O1R A;  4O6F A;  3EHR A;  5A7D B;  3NZS A;  2VJ8 A;  3D9H A;  4N5C A;  4Q96 A;  5FZS A;  1BI7 B;  4EZJ A;  3L82 A;  1TNY A;  2RFA A;  2RFM A;  5ENP D;  3PH0 C;  2YIN A;  2P2C P;  2OCC E;  2YNQ A;  3RK6 A;  2RD0 A;  1KZO A;  3AJI A;  3WG7 E;  2ETB A;  4F53 A;  4JD2 G;  3KEA A;  1KPS B;  4TV3 A;  4C48 B;  1UN8 A;  4BT8 A;  3PS6 A;  4D10 C;  2WXI A;  1NFI E;  2IQC A;  3T8M A;  2X3M A;  1H0A A;  4PS8 A;  3TWW A;  2DIW A;  3PNT B;  2GW1 A;  2L9B A;  3IBE A;  2GRM A;  4BT9 A;  2LXL A;  4GA0 A;  5HKP A;  4AVX A;  1DNP A;  1MX4 A;  5FQ6 A;  5BNW A;  4XE0 A;  3I4G A;  2NC9 A;  5BW8 C;  1TEZ A;  2WQ6 A;  3KSL A;  4NRH B;  1D8E A;  3GYZ A;  3UM2 A;  3APF A;  2OND A;  2A4Z A;  4OYS A;  3FTU A;  1XNF A;  4JHK A;  4KVM A;  4X8Q A;  3D9L A;  4APO A;  2XRZ A;  2WVI A;  2WXL A;  2KCL A;  4K0R A;  1E8Z A;  3SHF A;  3ZW3 A;  2ZU6 B;  4LNU D;  4DLO A;  3DEP A;  3SBS A;  4LER A;  5CMY A;  4FHJ A;  3LVR E;  3EIQ C;  1IHB A;  2PM7 A;  5KBA A;  3CHM A;  3UMV A;  3BG0 B;  3ASD A;  4UWK A;  1MZC A;  4LUN U;  3LCA A;  3MKQ B;  2CHX A;  1ZBP A;  4FHK A;  2F8Y A;  4U0U A;  1OCZ E;  3JQ0 A;  1IQU A;  2AXV A;  3IV0 A;  4B8A A;  4J8E A;  3ZXS A;  3CVX A;  3PRE A;  3NBN B;  2VTB A;  4G11 A;  3FTY A;  1ELK A;  2OOE A;  2VSY A;  3NOG D;  2XPY A;  3QAR A;  4HOU A;  3UM0 A;  2J09 A;  1HG5 A;  4I2Z A;  1KT1 A;  3RU0 A;  3FUM A;  1BI8 B;  3I3N A;  4A55 A;  4KZ0 A;  3TWU A;  2R02 A;  2XEE A;  1SA5 A;  2XQ0 A;  4CDR A;  3QOU A;  4U7E B;  2QFC A;  3D9J A;  1MHQ A;  2J07 A;  5G2N A;  4DPR A;  4CT4 A;  2GRP B;  2C0M A;  3R9M A;  3BG1 B;  1SZA A;  4HBD A;  3ZN3 A;  3G2U A;  5CMW A;  3AS8 A;  4WWP A;  4J7W A;  3ZEF A;  4BES A;  3JUE A;  4AV7 A;  3ZRH A;  1UOH A;  5EX3 A;  3FEX A;  1MQS A;  4WUY A;  3CVV A;  3TG5 A;  4ANV A;  4YND A;  1O5M A;  4K03 A;  3OXL A;  4TRQ A;  1K1B A;  4GPK A;  5AJD A;  2C2L A;  4HNA D;  2NXP A;  4Q94 A;  4I17 A;  3ABM E;  4HRL A;  5G55 A;  5B1B E;  5E75 A;  1HX8 A;  3ASF A;  4U07 A;  3UKR G;  2J08 A;  4Y6C A;  3CVW A;  4OAU C;  3BEE A;  4L7T A;  3TXM A;  4ACK A;  3TWQ A;  3UM3 A;  4GZ3 A;  4JVS A;  3B95 A;  1DCE A;  3ZHE B;  2P9U G;  3DSX A;  4TXR A;  5CEA A;  3ASN E;  2FF4 A;  3EDT B;  4FA6 A;  3PEU B;  3UPV A;  2GRQ B;  1TJF A;  4WNG A;  5B1A E;  1K3Z D;  1SA4 A;  2UY1 A;  3JUI A;  5EIB E;  2X6H A;  2HM8 A;  2LAI A;  4UQY A;  2BED A;  4XZ4 A;  1L5J A;  2OEV A;  3UT4 A;  3ZYM A;  2H6I A;  4AJW A;  4LSZ E;  4GTM A;  1JCS A;  5FWQ A;  4GAA A;  4BWR A;  4JL0 A;  3FY4 A;  3Q7F A;  5T4Y A;  3JXI A;  1OWL A;  3CEQ A;  3ZYL A;  2OV8 A;  3N71 A;  2ZXW E;  4A63 B;  2J49 A;  2VSO E;  5EIL A;  1OY3 D;  4HOT A;  1MX6 A;  4N3A A;  4ACL A;  3EU9 A;  4L23 A;  3DSW A;  4BTA A;  5CRV A;  5HQ8 A;  3SF4 A;  2F8X K;  1UG3 A;  3U3W A;  3URZ A;  3TG4 A;  4NIK A;  2XCB A;  2DYR E;  3L22 A;  3CHR A;  2IO2 C;  3RSE G;  5AQ9 A;  5EYL A;  1IYG A;  4U0S A;  2ZGD A;  2IOL A;  1QNF A;  2WMN A;  4L1B A;  1ZU2 A;  2IU1 A;  2H6H A;  3TWS A;  1N0R A;  5A6C A;  4GB9 A;  2UY1 B;  5ENN A;  1H6O A;  4KXK B;  4J6I A;  4U8H A;  2VTB B;  1N94 A;  3PVL A;  4GML A;  3TWX A;  3HVE A;  2KC7 A;  4U95 D;  5HRY A;  4MS6 A;  3AAA C;  5FIO A;  4I1M A;  3CK9 A;  3Q49 B;  3B7S A;  1U3C A;  3LYA A;  2L6J A;  3SZ7 A;  5FT9 A;  1W3B A;  4CDN A;  4GTT A;  5EX0 A;  2ZIS A;  4MRU A;  2H6G A;  3UKU G;  1U2V G;  1QBQ A;  1WAO 1;  3ZXP A;  3KD7 A;  2WM9 A;  1B89 A;  3ZIM A;  3D9K A;  1EF1 C;  5D2M C;  4GYO A;  4I6J A;  5ENS D;  4HVB A;  4L2Y A;  2I9C A;  2GRN B;  4J8F A;  4N3B A;  2HE0 A;  4BSZ B;  1PAQ A;  1TJC A;  1BLX B;  2XPZ A;  4O60 A;  3PNL B;  5LP0 A;  1K8K G;  3HIZ A;  5G04 C;  4I6E A;  2P9P G;  3QWV A;  3EIJ A;  2QZA A;  3RRN B;  3F6Q A;  3T9K A;  1S0P A;  4L2L A;  4QFV A;  5ANL A;  1YCS B;  3ULY A;  4AIF A;  3V31 A;  4JA7 A;  3E32 A;  4PS7 A;  3IKO B;  3PUJ A;  2R2L A;  2R59 A;  1N9A A;  4JHR A;  2LNI A;  3T8K A;  2IOS A;  4UWH A;  2Y69 E;  4JXT A;  5AN8 A;  2AVP A;  1OWM A;  1YA0 A;  2R03 A;  3FU6 A;  3D9N A;  3FWV A;  5EDS A;  2OVB A;  1QYM A;  5HI7 A;  5FQ8 A;  2DCP A;  3D3M A;  3UUX A;  4Y6W A;  4OVV A;  1KLX A;  1HS6 A;  4K5B A;  5D0Q D;  3E34 A;  4AY6 A;  2YHE A;  3L6A A;  1IXV A;  2VGX B;  4CYM D;  1HG2 A;  1KZP A;  4GTR A;  3D9O A;  3TL5 A;  4RG9 A;  3FUN A;  4GZC A;  4UI9 J;  1UN9 A;  4J8Y A;  3SFX A;  4HOQ A;  2WQH A;  3PZ3 A;  3JXJ A;  2V0P A;  4WNF A;  5IY5 E;  4YVQ C;  1SW6 A;  2ETC A;  3IXE A;  3U9W A;  1ELR A;  4O1O A;  1AP7 A;  3DEO A;  5ARG A;  3DSS A;  4BER A;  3J5P A;  2X6I A;  4UWL A;  4WWO A;  3VLE A;  4A3T A;  3BU8 A;  3UIN C;  1TNO A;  3QNK A;  5AQB A;  4GMR A;  4G8L A;  3DSU A;  5B3S E;  2LO6 A;  3S7D A;  2R17 C;  3HYM B;  3UIO C;  5LX8 A;  4DRX E;  3ZFW A;  3E33 A;  2WXM A;  2P9K G;  2I1J A;  2EIK E;  3D9M A;  4N3C A;  5JJ7 A;  3B13 A;  4RVB A;  1PY1 A;  3ASO E;  4R7L A;  1OXJ A;  1ZB1 A;  4JEH A;  3LVQ E;  4N5Q A;  3G2W A;  4YDY A;  1FVH A;  3FEY A;  3OXF A;  1X81 A;  4LEU A;  3LEW A;  3ML8 A;  3UT7 A;  4GZ5 A;  3NZU A;  3RIB A;  4F3V A;  1OCO E;  1AWC B;  4XX5 A;  4HLE A;  4GTS A;  5DBK A;  4XKB A;  1WY6 A;  3TWR A;  2L0T B;  2HYZ A;  1WG0 A;  2XEN A;  2P9L G;  4GCO A;  3UQ3 A;  3CV0 A;  4NUR A;  4EHM A;  3HXD A;  3Q5M A;  4G26 A;  3NAW A;  1UW4 B;  3ESL A;  2VSN A;  3FTX A;  4AP2 A;  3ZU7 B;  1Y6I A;  2UWJ G;  1MYO A;  2XGO A;  3CHP A;  2CHW A;  3IHV A;  4G24 A;  3AG4 E;  4RG6 A;  3GZS A;  3CKB A;  2PM6 A;  3MYV A;  4U96 D;  4GZ6 A;  4P29 A;  3NB2 A;  2VSX E;  4A1S A;  4DUI A;  3ULQ A;  1A17 A;  3CSF A;  1LD8 A;  4F1S A;  2CFZ A;  4WWN A;  2JEK A;  3PZ1 A;  4HI8 A;  4BSX A;  3AG3 E;  4C0E A;  3G2S A;  4FJZ A;  2ILR A;  3ULE G;  3O4Z A;  4AOF A;  4B8C B;  3APC A;  4JEU A;  2OVF A;  3S7F A;  1TN6 A;  5BT1 A;  2F0Y A;  5FIN A;  4EEC A;  5J90 A;  4G2V A;  2KAT A;  4F6R D;  3APD A;  4N2Q A;  3TWV A;  5HS0 A;  3G2T A;  4LNB A;  1OUV A;  5FTP A;  3KAE A;  4ABN A;  5KJM A;  4U8V D;  2RG8 A;  3ZYQ A;  4FC8 A;  1N4R A;  1S70 B;  2QY7 A;  1U3D A;  5DIZ A;  4BY6 A;  5CER B;  3QC1 A;  5A23 A;  4ANW A;  2E2E A;  4EBA G;  4XI9 A;  5BXO A;  3LPZ A;  5AAO A;  3V2X A;  3CIA A;  1K1A A;  1X5B A;  4FU3 A;  3LKU A;  3HDX A;  4DX1 A;  3QWW A;  3B7R L;  2IY0 C;  3KS2 A;  3LDZ A;  1N4S A;  3JCK C;  3T5V A;  2NYJ A;  4UUC A;  3QWP A;  3GZ1 A;  1HH8 A;  2DWZ A;  2XHE A;  3EHQ A;  5LCW J;  3U66 A;  3ASG A;  3AU5 A;  4I6G A;  4BX8 A;  4ME2 A;  3P1U A;  3IHY A;  5ENR D;  3Q78 A;  4JZY A;  2BKG A;  1KT0 A;  5AQA A;  3AG1 E;  4H7X A;  1TNB A;  5KWD A;  4DX2 A;  4FJY A;  2BUG A;  2WXH A;  1E7U A;  4DI3 A;  1N52 A;  5G04 J;  2ZIR A;  3RO2 A;  1V55 E;  3FUI A;  2WXK A;  3ABK E;  4I9C A;  2AW6 A;  4AM9 A;  2LAH A;  3DBS A;  1ELW A;  4E85 A;  2A5E A;  3QK0 A;  2GRR B;  1BD8 A;  4CRW A;  5FQ4 A;  3TJP A;  5KNG A;  3Q73 A;  4EZK A;  5FZR A;  2GRL A;  4EQF A;  1TNZ A;  3W9F A;  1FVF A;  3AG2 E;  4W9R A;  2WMO A;  1H6K A;  4XI0 A;  3C3R A;  2VYI A;  3DXM G;  4KBQ A;  4IRU A;  3Q9U C;  5ANR A;  4CGV A;  5EKQ D;  4PDX A;  3J5Q B;  5CBN A;  3C72 A;  4BET A;  2DZO A;  5ENT D;  3CVU A;  5FZQ A;  5AJL A;  4IUL A;  1H2T C;  4YDE A;  2QYU A;  1E7V A;  2B6C A;  1XGW A;  1E96 B;  1NI1 A;  1E90 A;  2CFU A;  4OAV B;  2QC9 A;  4N39 A;  1Z3Y A;  5JJT A;  1H6P A;  4U63 A;  3Q4A B;  4APF A;  1TYQ G;  1HFA A;  2WXO A;  3Q9N C;  2XS8 A;  3ZUV B;  2EIM E;  3FH5 A;  3EU5 A;  4HLL A;  1VDY A;  4GZD A;  4NAC A;  4KYO B;  5KCM A;  2Y3A A;  2CHZ A;  4U8Y D;  3CVQ A;  3LY9 A;  2E0I A;  3PDN A;  3OXG A;  4F7A A;  2P9S G;  3S2A A;  2KZT B;  3C3Q A;  1UJJ A;  3MJW A;  4C9B B;  2YHC A;  3FTS A;  4GU5 A;  3FUL A;  4FAD A;  2V8S E;  4O1P A;  4ZFH A;  4TUU A;  5CCL A;  3SNX A;  3CVY A;  3HHM A;  3FTW A;  2PQR A;  4PH4 B;  4UWG A;  4XKC A;  4YDO A;  2FEZ A;  2IF4 A;  4EPZ A;  3DPY A;  5D66 A;  5ITZ F;  3NF1 A;  4I43 A;  1HF8 A;  4M7C A;  4DX5 D;  5AYW D;  2C0L A;  3CLJ A;  3CVL A;  3DWL G;  3FH7 A;  2PZI A;  4V3I A;  1OT8 A;  3SBT B;  4CEM A;  1N95 A;  1LD7 A;  3S7B A;  2WXQ A;  3L08 A;  4RLY A;  2Y1L E;  3LJN A;  3OTN A;  1H2V C;  3CVN A;  4Q69 A;  4ANU A;  4ILG A;  4GYW A;  4CZ2 D;  3FUF A;  5E76 A;  5KJN A;  3EUV A;  3HXC A;  2L6B A;  4PUC A;  2KXP C;  3L54 A;  1H19 A;  2FUL A;  1GW6 A;  2XEV A;  4K5A B;  4JPS A;  1RZ4 A;  1P5Q A;  2XRY A;  2I2O A;  4GTO A;  1TN8 A;  4EZL A;  4RSY A;  4BX9 A;  3DPD A;  2PQN A;  1EDU A;  2BTD A;  5EYP F;  1SVX A;  4CGW A;  2I6H A;  5LOZ A;  2OEW A;  3U4T A;  4HRN A;  3HVE B;  3CK7 A;  1INZ A;  3B7B A;  3UX4 A;  2B0O E;  2WXP A;  3ZYK A;  1A5E A;  3UXG A;  4HXI A;  1V54 E;  4HS2 A;  4DI4 A;  3L13 A;  4GTQ A;  2EIL E;  2LXM A;  2AXU A;  3ENE A;  3L16 A;  2X6K A;  3SD5 A;  5CRU A;  3ZKJ A;  2GRO B;  3D9I A;  1S64 A;  5T8I A;  2WPV A;  5EN5 D;  1NZN A;  3GW4 A;  2XS1 A;  5BXU A;  2WB2 A;  3OAW A;  4I1O B;  1N0Q A;  5G05 C;  1MJ0 A;  4JB8 P;  2HO1 A;  2J9Q A;  2DVW A;  3E4B A;  3MA5 A;  1NL4 A;  1S63 A;  3RRM B;  3C5R A;  3VLD A;  3TGO A;  3QB2 A;  1OCR E;  4K5C A;  2KCV A;  4LRZ A;  4U0Z A;  1E8W A;  3E30 A;  3BQO A;  5AAR A;  3DRA A;  4HI9 A;  2V4H C;  2LSU A;  4URK A;  1EYH A;  1E8X A;  2XZD G;  2VQ2 A;  3CQC B;  2ION A;  4ILI A;  2I1K A;  1LF8 A;  4PS3 A;  4UQX A;  1JPL A;  4G1T A;  4E6H A;  2RKK A;  2DBA A;  4J0U A;  3U64 A;  2BF0 X;  4JW1 A;  3HG0 D;  5C1D A;  2XCC A;  3FU5 A;  4OVU A;  4FUL A;  2ETA A;  3FUD A;  1FT2 A;  2A5U A;  3VTY A;  5JHA A;  2AWI A;  2F37 A;  3PE4 A;  1WM5 A;  2EQX A;  5JMN D;  4LCT A;  1QQE A;  3SQV A;  1RW2 A;  2VGE A;  3MGB A;  2JAB A;  3WXX A;  4GA2 A;  3UI2 A;  4CCA A;  2MRI A;  2X6F A;  3DST A;  3X2Q E;  2XZT G;  4L9P A;  3FP3 A;  4BTB A;  3SFZ A;  3PUK A;  3FDH A;  4AY5 A;  1FPP A;  3MV2 B;  4KVO A;  2XEH A;  3UIP C;  4NQ0 A;  3UM1 A;  3MV3 B;  4WNE A;  4I2W A;  4KT6 B;  3RKV A;  2WXF A;  1FT1 A;  2VGY A;  2FO7 A;  4UQZ A;  2KZT A;  1UJK A;  2Y4T A;  3HRA A;  1NA0 A;  4U04 A;  1BU9 A;  1OWO A;  1YMP A;  3AU4 A;  3TXN A;  4CT0 A;  5CEC B;  2GGF A;  1JUQ A;  2WXJ A;  1HXI A;  5AEN A;  2IO3 C;  2AJA A;  1DCQ A;  2KM4 A;  2H6F A;  3HXE A;  4C0M A;  3CK8 A;  1G3N B;  4TUM A;  2LUH A;  3R7Q A;  2LSV A;  3CST A;  1HU3 A;  1Q2Z A;  2Y0B G;  5M72 A;  4GA1 A;  3AS4 A;  4B89 A;  2XGS A;  2FBN A;  3LXU X;  4G8K A;  2IEJ A;  1DVP A;  3GZ2 A;  3CHQ A;  5KJK A;  3ZGQ A;  1FCH A;  4EBA A;  5LFA A;  3V79 K;  2R05 A;  4HRM B;  3ZVV A;  5KNH D;  3JQ1 A;  3NOC D;  4B94 A;  2WQ7 A;  3D9P A;  5FJY A;  3PRZ A;  5FQ7 A;  1O1T A;  2X6J A;  2V5Q C;  3W9G A;  4B0Z A;  1D9S A;  2KCK A;  1YYH A;  4KZC A;  5G05 J;  3SGH A;  1OWN A;  5BV1 A;  5KJL A; 
#chains in the Genus database with same CATH homology
 3UIO C;  2IY0 C;  1KPS B;  2GRN B;  2GRP B;  2GRO B;  2GRR B;  2GRQ B;  1Z5S C;  5D2M C;  3UIP C;  3UIN C;  2IO3 C;  2IO2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...