2IY0C

Senp1 (mutant) sumo1 rangap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
total genus 57
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2iy0C00
2GRNB 3UINC 1KPSB 1Z5SC 2GRQB 3UIOC 2IY0C 5D2MC 3UIPC 2GRRB 2GRPB 2GROB 2IO2C 2IO3C
chains in the Genus database with same CATH superfamily
3SNXA 2GRLA 4N2SA 4EHMA 3C3QA 4BERA 5JJTA 3LPZA 5EIDA 2OV8A 3G2VA 3LKUA 5KJMA 3ZYQA 4DLOA 5LCWC 4OVUA 4RSYA 3VTYA 3DSVA 4GZDA 1UN9A 1OWOA 3EIQC 2I1JA 3AU4A 3FULA 4GCNA 3ABKE 2YQ8A 2AW6A 3IHVA 3X2QE 4AXHA 4GTSA 3PZ3A 3CR3A 3ULQA 2LO6A 4D10C 5B3SE 3ZGQA 3HIZA 3VLDA 4C0MA 3OAWA 4EZKA 1SZ9A 4Q94A 3ABME 4DJAA 1NL4A 2ZISA 2KCVA 3CKBA 1WAO1 3SFZA 3KSLA 3RU0A 4B8CB 1E8WA 2EINE 4WNFA 3TAXA 3FU0A 2PM6A 4ACKA 4JL0A 1YCSB 3EJNA 3ENEA 2A4ZA 5AQBA 1N0QA 4U0SA 3PUJA 1N4RA 3HXDA 4GB9A 3B7UX 1WM5A 4JD2G 4UWFA 1O1SA 3CKCA 4WNDA 3UT4A 4DK5A 4HOTA 1OCRE 4LNGA 3UT7A 2FBNA 4GU5A 1QZ2A 1U3DA 1H6OA 4TXQA 2X6IA 3HRAA 1E8XA 2FEZA 2P9NG 5EILA 2J09A 3AG4E 2J8SD 4APFA 3B7SA 1Q2ZA 4XE0A 3PREA 5EX3A 2EIME 4I6EA 1ZU2A 3FUHA 2P9UG 1EDUA 4BTAA 3BQOA 2EIJE 1OWLA 1JPLA 4AY5A 3V2OA 2DZNA 4HLEA 3HXFA 4ILHB 5BXOA 4M3OA 4FP7A 1H6KA 4JXTA 1Z6TA 2Y3AA 4N5CA 3EHMA 3B13A 2M63A 4J8SA 3S2AA 5JHAA 1S70B 4DUIA 5CRVA 3DSUA 2MYOA 4J7WA 4O1OA 3CVXA 2OOEA 1L5JA 2PM7A 5G05J 4YDEA 4JEHA 2C2LA 3LEWA 1ELKA 4NQ0A 5BW8C 5AAOA 4CT0A 1S63A 3S7JA 2KZTA 1KZOA 4U63A 1Z3YA 3V30A 3AS4A 3AU5A 3L54A 3LCAA 3SBSA 4Q96A 1WDYA 2NXPA 2J4DA 5BXUA 2P9SG 5BNWA 3ONLA 4NIKA 3CQCB 3DPDA 3FDHA 4FHJA 3AS8A 5J90A 4XKBA 3Q5MA 5J08A 2CHZA 2NSZA 3DSXA 3GZ2A 4J6IA 3E33A 3W9FA 4IYPA 4EBAG 3CVWA 4TUMA 4N3AA 2Y0BG 4XI0A 2RD0A 5FQ6A 1HH8A 2J4BA 3NAWA 4XIFA 3LYAA 2IY0C 2L0IA 4JPSA 3ASNE 3SGHA 2GRQB 5ENTD 3I3NA 2LSVA 3J5PA 1SQMA 5D0OD 3DSWA 4GTVA 2FULA 3Q75A 5AARA 2ONDA 1NFIE 2X38A 4GZCA 2MRIA 2WVIA 1HU3A 2WXFA 3HXEA 5ENNA 3ZNGA 2V5QC 4K03A 2BKKB 5JMND 3Q4AB 4BEPA 2IONA 4G1TA 3G2WA 1OCZE 3E4BA 3LVQE 4C48B 4XX5A 4B94A 5T4YA 2VSYA 1N4PA 1MZCA 4K5BA 3R7QA 4LRZA 5KJLA 3GYZA 4H7YA 4HS2A 3EHNA 2VGXB 2XZTG 4YNDA 1OY3D 3IKOB 2PQRA 1TEZA 4AIFA 4IRUA 1N4QA 5ENQD 3TWUA 4KYOB 3J5QB 1OWMA 2DZOA 4KT6B 1UN8A 3B95A 1INZA 1SW6A 3QJZA 4G23A 3LY7A 5T3RA 3CLJA 2RFAA 4FA6A 3ASFA 2XGMA 3G2SA 4PS8A 4GTQA 2VQ2A 5CEDB 4U8HA 3K9IA 1HF8A 1SA5A 3FU6A 4DX5D 5E75A 4BY6A 1XGWA 4RG9A 4O1PA 5BUZA 2J49A 5KCMA 5CERB 3RO3A 3SQVA 3GZSA 2CG2A 1H6PA 4DX6D 4JC8A 4FHKA 4PDXA 4I2WA 4KVOA 3C3OA 4RG6A 3CK8A 1X81A 1LD7A 3LY9A 4UWGA 4AEZC 3FH8A 4HNAD 4HQDA 3EDTB 3PNTB 2L0TB 4F1PA 2YINA 2BEDA 2GRPB 3FUDA 4H7XA 4MKTA 5ENSD 5D2MC 1P5QA 2FF4A 4RQIA 3HDXA 3JXJA 1K1BA 4PH4B 4B93B 5EYPF 5BPPA 3FTVA 4N3CA 5AJLA 3DEOA 4RVBA 3ZEFA 2R03A 3ZPJA 5HQ8A 1N95A 2KC7A 1N54A 4GPMA 3HXCA 3CEQA 2ETBA 4HLLA 1YYHA 4L23A 4IULA 4JVSA 4O6FA 3MGBA 2R05A 3FU3A 2WXNA 3PZ2A 2IQCA 3I4RB 3V79K 1PY1A 2LAIA 3OXLA 4HVBA 1PC2A 2HO1A 3QAQA 4JHJA 3F6QA 4F53A 1UOHA 2XEEA 3AG3E 4ACLA 3TG5A 2V4HC 2H6GA 1UW4B 1NZNA 1MX4A 3SO8A 4GTTA 3CVPA 4JB8P 1Y6IA 2XRZA 2R02A 1D9SA 2V0PA 2VGEA 3EU5A 4F6RD 1JCQA 1DCQA 4DI4A 4K5CA 1WY6A 1ELWA 2AXUA 3AAAC 5CHEE 2E2EA 3ESKA 1N4SA 4LNUD 2RFMA 4APOA 4L9PA 4QFVA 2NC9A 3W9GA 1SVXA 2I1KA 2ZU6B 3D9MA 3RAUA 3ULYA 3HHMA 1TR4A 2KCLA 3Q15A 3CVLA 5AJDA 3FWVA 3FUEA 3CVYA 5LFAA 2B0OE 5CMWA 3FUFA 4X8QA 3CGHA 1QQEA 1X5BA 3JQ0A 1N9AA 5FT9A 2J07A 2I2OA 4BSXA 1KPSB 4YVOA 3C72A 3CSFA 3TGOA 1E8ZA 2XS8A 4A1SA 1TN6A 2P9KG 4K0RA 2XGSA 2WXOA 1JCRA 4RLYA 1NP7A 3HXBA 5FTPA 1H0AA 5KWDA 2AXVA 2OEWA 1MX6A 3SFXA 4F1SA 5AQ7A 1E7UA 4GAAA 1HG5A 3DEPA 4U7EB 2VGYA 5HS0A 1V54E 1RZ4A 2WXPA 4LCTA 4QQIA 2PZIA 3CSTA 3UM0A 4Y6CA 5H7PA 4UI9J 3RKVA 2Y4UA 5FIOA 1OUVA 4GMLA 3Q49B 3L22A 3D9LA 3OXFA 3ML8A 4Y6WA 3EHQA 3PZDA 5EYLA 4GZ5A 4YDWA 3TG4A 4ANXA 1DVPA 1AWCB 4N2QA 1LTXA 4C9BB 3UIPC 3QKYA 4A1GA 3T8MA 3QNKA 1D8DA 4L7TA 4BETA 4GPKA 3SZ7A 4A55A 5G05C 1MQSA 1ZBPA 3ZHEA 3MV2B 2XEVA 4UI9K 1H2UA 4OVVA 5A7DB 2FO7A 2VGXA 4ME2A 5CCLA 3SY2A 3G2TA 3HVEB 4BTBA 4UQXA 3IV0A 2A5EA 2VJ8A 1A17A 5JJ7A 1E90A 2QZAA 3CVVA 2WXQA 4DX2A 3O4ZA 4B89A 2XENA 2RG8A 2EIKE 3KSQA 4R7LA 1SZAA 4OYSA 2LUHA 3QDNA 4YDYA 2XRYA 5FQ4A 3CVQA 3D9OA 2L9BA 4KZ0A 4BT9A 4DRXE 4ATGA 3C5RA 3NOCD 3PE4A 3ZW3A 4U8YD 1TNYA 1TNUA 3SFYA 1N52A 2P58C 2ZGGA 3LJ3A 3FTZA 3RRUA 2WB2A 4U0UA 5AIJA 3N71A 1QNFA 1IKND 1EYHA 3FU5A 1MX2A 2WXHA 4DPRA 2R2LA 4LERA 4HFGA 1KZPA 4EPZA 4GA1A 5AQAA 3FUJA 4FLBA 3KD7A 3VLFA 3ZYLA 5EIBE 2WXGA 4BWRA 3FTUA 2KBXA 1DC2A 1FCHA 3UINC 1V55E 4N39A 2QYUA 3I5PA 4DLQA 2P2CP 2VSNA 5EN5D 4L2YA 5D0QD 3U4TA 4Q69A 4HRNA 2OCCE 1MJ0A 1E8YA 4U8VD 1TJCA 3D9NA 4I1OB 4A63B 4I1MA 2I9CA 2GW1A 2JEKA 2IO3C 3UX4A 3Q7AA 2KCKA 3CIAA 3L17A 4HORA 4J8FA 3V2XA 3E34A 1OXJA 3CHPA 3MX3A 1TYQG 3TWQA 3ABLE 3JYSA 3TWVA 2DIWA 4W9RA 4A3VA 4AOFA 3CHQA 2XCBA 4GYWA 2XPIA 1HFAA 4CCAA 1E7VA 2DYSE 4G25A 3JUEA 2MOWA 3CHMA 3D3MA 4EQFA 2OEVA 4LEUA 4O60A 3PZ1A 3PS6A 4BFRA 2WXKA 3P2BA 2F8XK 2Q7FA 1HS6A 5LOZA 4G8KA 2PNNA 3ZHEB 3IEGA 2WMNA 3QWVA 3FH7A 4XEIG 5B1BE 2WXLA 4CYMD 3KAEA 1H2VC 3GZ1A 3AJIA 4TUUA 3UI2A 3D9KA 3DXMG 4AVXA 2R17C 4B0ZA 3C98A 1O1TA 2KATA 2VYIA 5CEAA 4GMRA 3MZLB 1HG2A 2F8YA 4BX9A 2P9PG 4FADA 2VTBA 2PL2A 2HYZA 4BSZB 2HM8A 1FPPA 2DWZA 1UJJA 3FEXA 1KT1A 3TXMA 4OAUC 2CFZA 4FU3A 4WNGA 4PUCA 4CEMA 2LXMA 2E0IA 4EECA 4U95D 3PVLA 2JABA 1YMPA 4JW1A 5EX0A 3D9PA 1TNOA 3TXNA 5DIZA 1W3BA 3L9TA 2YNQA 2QYJA 2HE0A 5LX8A 3RIBA 4FULA 3UM2A 3L82A 3PEVB 3CHSA 4KZCA 4DX1A 1TNZA 3FTXA 4GZ3A 1HE8A 2WQ6A 2LAHA 3ZN3A 4EZJA 5E76A 2V4LA 3R7RA 1PAQA 3CV0A 2DVWA 3IXEA 4MBGA 4G11A 3NB2A 4CT4A 4WWOA 2XHEA 2OVFA 4NRHB 4TXRA 2YHEA 1YA0A 2LSUA 1HO8A 3O48A 2H6HA 1KT0A 4P29A 2ZIRA 5FZRA 1TN7A 4HRMB 4KMOA 3BG0B 1NA0A 3TJPA 4U0ZA 3DRAA 4I6JA 4TRQA 2B6CA 4JHRA 3C3RA 3IBEA 1QYMA 2WXMA 1OWPA 4JA9A 5HKPA 2H6FA 2BF0X 3FUNA 1Y8MA 3ONKA 4HOSA 2CHWA 3GW4A 2WQ7A 4HRLA 3QWWA 4HBDA 3E32A 4V3IA 3CVNA 5KNGA 3KEAA 5FZSA 5JHBA 4WUYA 3HVEA 2GRNB 4E6HA 3S7DA 2GROB 3CHRA 2ILRA 1BU9A 4KBQA 2QC9A 4CDMA 2QFCA 2WXRA 4FC8A 3QB2A 4E85A 4URKA 4KVMA 5C1DA 3TWSA 5BV1A 2XS1A 3L13A 3PZ4A 4U04A 4U96D 2DYRE 4I2ZA 4F3VA 1IHGA 2VSXE 3TWWA 2EQXA 4UI9C 1JWGA 4EBAA 3LS8A 4GYYA 3APCA 2VTBB 5G2NA 4L2LA 3DXKG 1HXIA 2KM4A 5BV0A 3ESLA 1OCOE 1S64A 3MA5A 4I17A 4UUCA 5HI7A 4JZYA 2OVBA 1OT8A 4NURA 3U9WA 2IF4A 1FVFA 3WG7E 4FJZA 1WG0A 3LY8A 4BX8A 1K3ZD 4TV3A 1BI7B 3PUKA 4N3BA 3RRNB 3FFLA 4MS6A 4A3TA 2X6JA 4IN3B 3UT8A 3DBSA 3ZXPA 3UUXA 4HI8A 5A6CA 3I4GA 3HG0D 2V5FA 3ZYMA 4AJWA 2IO2C 1BPOA 2IOLA 3CK9A 5FQ7A 1SA4A 3PNLB 1NA3A 1E96B 5FJYA 3Q9NC 4I9CA 3S7BA 1KLXA 5FZQA 5DBKA 2WMOA 3NQPA 2AJAA 4UWLA 3FUIA 4CZ2D 4G2VA 2X6FA 3RRMB 2GGFA 5T8IA 4HOUA 4J8YA 4I9EA 2Y1LE 3U3WA 4ATZD 2VSOE 3L16A 2V8SE 3BU8A 3SD5A 3UMVA 5JJ6A 3NOGD 4UWHA 1OCCE 3UXGA 3D9HA 1H19A 4I1AA 3VTXA 2GRRB 2WM9A 1QBQA 2X6KA 3MKRA 1TJFA 3U66A 1HZ4A 2UY1B 5ENOD 4JA7A 3L08A 3SF4A 5IY5E 4F7AA 4MLPA 1OWNA 5JA4D 4HI9A 1AP7A 5AQ9A 3BEEA 3PDNA 3EIJA 3E37A 5C2YA 2EILE 2L6JA 3T5VA 4WNEA 1K1AA 4I6GA 4LNBA 4GTPA 3QOUA 2AWIA 3P1UA 3OTNA 5LCWJ 3EUVA 2LNIA 4EZLA 3V31A 4L1BA 2WQHA 3SBTB 2CG3A 1ELRA 1A5EA 2MHKA 2IU1A 2AXZA 3DSSA 5KBAA 3B7RL 2XPZA 2UWJG 3SHFA 3MEKA 4LSZE 3CHOA 3UM1A 5ENRD 2AVPA 3LDZA 2X3MA 5CECB 1EPUA 4C0EA 3ASGA 3TWTA 3T9KA 4NACA 1UG3A 3CQGB 4U07A 2XPYA 3VLEA 2IEJA 1Z3XA 2FO1E 1XNFA 1IHBA 1N11A 4CDRA 4TXPA 3ZVVA 3CK7A 3PH0C 2WPVA 5CRUA 3JUIA 2Y69E 3ISMC 4CRWA 5AYWD 5G04C 4HOQA 2ZGDA 3LXUX 4GCOA 4DX7D 5CBNA 3SI5A 2BUGA 1HX8A 3JCKC 2XQ0A 5A23A 4XKCA 2CHXA 2DBAA 5M72A 5FINA 5CBOA 2YHCA 1RW2A 3ZXSA 2GRMA 2FI7A 2IOSA 5EDSA 3ZIMA 2C0LA 3ML9A 3D9JA 4GZ6A 3KEZA 4KXKB 4GTRA 4UQYA 3UPVA 3Q73A 5LP0A 2R5SA 4PS7A 4ZFHA 1FT1A 2ZXWE 1BD8A 2C0MA 5HRYA 2F37A 3BG1B 3PEUB 3FTWA 3DWLG 2IJGX 3JQ1A 3TL5A 2Y4TA 4K5AB 4LG6A 2H6IA 3AG2E 3APDA 1JWFA 3DPYA 3ZKJA 4JEUA 3UIOC 5ARGA 1JCSA 4GMJA 5ARFA 3ZU7B 1S0PA 3R9AB 3Q78A 1ZB1A 5B1AE 2DCPA 3FH5A 3FUMA 3JXIA 4G8LA 3T5XA 4GYOA 3EU9A 2IFUA 5G04J 3NZUA 3FTYA 2HR2A 3UM3A 1IQUA 3AG1E 3UTMA 4ANVA 3MKQA 1IQRA 3Q9UC 2CFUA 3ASHA 4YVQC 3LVRE 5FWQA 3URZA 3MYVA 3MJWA 3MV3B 1TN8A 3RK6A 3UKRG 4ANWA 1VDYA 3ZYKA 2WXIA 2I6HA 4ANUA 3QARA 3E30A 4MRUA 3ZFWA 1D8EA 2X6HA 4AP2A 2JLBA 2QY7A 4UWKA 3KS2A 2ETAA 2ETCA 4WWPA 2NYJA 5AENA 1LF8A 3RO2A 3AS5A 3FP3A 4BESA 3G2UA 5KJNA 1FT2A 3ASDA 2A5UA 4FJYA 3ULEG 4XI9A 2LXLA 5D66A 3Q47B 4OAVB 1NI1A 4N5QA 1B89A 2R59A 2P9LG 3LJNA 4B8AA 1O5MA 3FEYA 3OXGA 5G55A 3B7TA 3NF1A 5ITZF 5ANLA 4WWNA 1U2VG 3RSEG 4WAFA 2KZTB 1BI8B 3NZSA 4ILIA 3ZRHA 4JHKA 1IYGA 1K8KG 4AV7A 4AY6A 4YDOA 4AM9A 4UQZA 2F0YA 4G26A 5ANRA 4CGVA 1MYOA 2PQNA 2UY1A 4GTMA 1G3NB 5AN8A 5ENPD 4BT8A 4ZHBA 3BUAA 3PE3A 2L6BA 3MCXA 1H2TC 3UQ3A 3IHYA 4CDNA 2BKGA 1FVHA 3QK0A 4I43A 2XCCA 2XGOA 2P9IG 5CCMA 3R9MA 1EF1C 1GW6A 1TNBA 3QC1A 3FUKA 3D9IA 3RJVA 1O1RA 3FTSA 1N94A 2RKKA 3QWPA 4XZ4A 4PS3A 3PRZA 1LD8A 4CGWA 3ASOE 4J0UA 4J8EA 4LUNU 2J08A 5EKQD 4HXIA 2XEHA 5KJKA 3S7FA 4FLHA 4GTOA 2WXJA 3MKQB 4G24A 3ZUVB 3B7BA 3WXXA 1DCEA 2XZDG 4HB5A 3FY4A 1IXVA 1BLXB 2J9QA 5BT1A 2BTDA 3Q79A 5CMYA 4J8DA 4Z68A 5FQ8A 3U64A 1DNPA 3TWRA 4DI3A 3UKUG 3HYMB 4GA0A 4ABNA 1Z5SC 3TWXA 1JUQA 3CVUA 3FHEA 3APFA 3L6AA 3NBNB 4GA2A 1MHQA 1UJKA 3Q7FA 3T8KA 4M7CA 4ILGA 5KNHD 1U3CA 1N0RA 3DSTA 2KXPC 3EHRA
chains in the Genus database with same CATH topology
2GRNB 3UINC 1KPSB 1Z5SC 2GRQB 3UIOC 2IY0C 5D2MC 3UIPC 2GRRB 2GRPB 2GROB 2IO2C 2IO3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRN B;  3UIN C;  1KPS B;  1Z5S C;  2GRQ B;  3UIO C;  2IY0 C;  5D2M C;  3UIP C;  2GRR B;  2GRP B;  2GRO B;  2IO2 C;  2IO3 C; 
#chains in the Genus database with same CATH topology
 3SNX A;  2GRL A;  4N2S A;  4EHM A;  3C3Q A;  4BER A;  5JJT A;  3LPZ A;  5EID A;  2OV8 A;  3G2V A;  3LKU A;  5KJM A;  3ZYQ A;  4DLO A;  5LCW C;  4OVU A;  4RSY A;  3VTY A;  3DSV A;  4GZD A;  1UN9 A;  1OWO A;  3EIQ C;  2I1J A;  3AU4 A;  3FUL A;  4GCN A;  3ABK E;  2YQ8 A;  2AW6 A;  3IHV A;  3X2Q E;  4AXH A;  4GTS A;  3PZ3 A;  3CR3 A;  3ULQ A;  2LO6 A;  4D10 C;  5B3S E;  3ZGQ A;  3HIZ A;  3VLD A;  4C0M A;  3OAW A;  4EZK A;  1SZ9 A;  4Q94 A;  3ABM E;  4DJA A;  1NL4 A;  2ZIS A;  2KCV A;  3CKB A;  1WAO 1;  3SFZ A;  3KSL A;  3RU0 A;  4B8C B;  1E8W A;  2EIN E;  4WNF A;  3TAX A;  3FU0 A;  2PM6 A;  4ACK A;  4JL0 A;  1YCS B;  3EJN A;  3ENE A;  2A4Z A;  5AQB A;  1N0Q A;  4U0S A;  3PUJ A;  1N4R A;  3HXD A;  4GB9 A;  3B7U X;  1WM5 A;  4JD2 G;  4UWF A;  1O1S A;  3CKC A;  4WND A;  3UT4 A;  4DK5 A;  4HOT A;  1OCR E;  4LNG A;  3UT7 A;  2FBN A;  4GU5 A;  1QZ2 A;  1U3D A;  1H6O A;  4TXQ A;  2X6I A;  3HRA A;  1E8X A;  2FEZ A;  2P9N G;  5EIL A;  2J09 A;  3AG4 E;  2J8S D;  4APF A;  3B7S A;  1Q2Z A;  4XE0 A;  3PRE A;  5EX3 A;  2EIM E;  4I6E A;  1ZU2 A;  3FUH A;  2P9U G;  1EDU A;  4BTA A;  3BQO A;  2EIJ E;  1OWL A;  1JPL A;  4AY5 A;  3V2O A;  2DZN A;  4HLE A;  3HXF A;  4ILH B;  5BXO A;  4M3O A;  4FP7 A;  1H6K A;  4JXT A;  1Z6T A;  2Y3A A;  4N5C A;  3EHM A;  3B13 A;  2M63 A;  4J8S A;  3S2A A;  5JHA A;  1S70 B;  4DUI A;  5CRV A;  3DSU A;  2MYO A;  4J7W A;  4O1O A;  3CVX A;  2OOE A;  1L5J A;  2PM7 A;  5G05 J;  4YDE A;  4JEH A;  2C2L A;  3LEW A;  1ELK A;  4NQ0 A;  5BW8 C;  5AAO A;  4CT0 A;  1S63 A;  3S7J A;  2KZT A;  1KZO A;  4U63 A;  1Z3Y A;  3V30 A;  3AS4 A;  3AU5 A;  3L54 A;  3LCA A;  3SBS A;  4Q96 A;  1WDY A;  2NXP A;  2J4D A;  5BXU A;  2P9S G;  5BNW A;  3ONL A;  4NIK A;  3CQC B;  3DPD A;  3FDH A;  4FHJ A;  3AS8 A;  5J90 A;  4XKB A;  3Q5M A;  5J08 A;  2CHZ A;  2NSZ A;  3DSX A;  3GZ2 A;  4J6I A;  3E33 A;  3W9F A;  4IYP A;  4EBA G;  3CVW A;  4TUM A;  4N3A A;  2Y0B G;  4XI0 A;  2RD0 A;  5FQ6 A;  1HH8 A;  2J4B A;  3NAW A;  4XIF A;  3LYA A;  2IY0 C;  2L0I A;  4JPS A;  3ASN E;  3SGH A;  2GRQ B;  5ENT D;  3I3N A;  2LSV A;  3J5P A;  1SQM A;  5D0O D;  3DSW A;  4GTV A;  2FUL A;  3Q75 A;  5AAR A;  2OND A;  1NFI E;  2X38 A;  4GZC A;  2MRI A;  2WVI A;  1HU3 A;  2WXF A;  3HXE A;  5ENN A;  3ZNG A;  2V5Q C;  4K03 A;  2BKK B;  5JMN D;  3Q4A B;  4BEP A;  2ION A;  4G1T A;  3G2W A;  1OCZ E;  3E4B A;  3LVQ E;  4C48 B;  4XX5 A;  4B94 A;  5T4Y A;  2VSY A;  1N4P A;  1MZC A;  4K5B A;  3R7Q A;  4LRZ A;  5KJL A;  3GYZ A;  4H7Y A;  4HS2 A;  3EHN A;  2VGX B;  2XZT G;  4YND A;  1OY3 D;  3IKO B;  2PQR A;  1TEZ A;  4AIF A;  4IRU A;  1N4Q A;  5ENQ D;  3TWU A;  4KYO B;  3J5Q B;  1OWM A;  2DZO A;  4KT6 B;  1UN8 A;  3B95 A;  1INZ A;  1SW6 A;  3QJZ A;  4G23 A;  3LY7 A;  5T3R A;  3CLJ A;  2RFA A;  4FA6 A;  3ASF A;  2XGM A;  3G2S A;  4PS8 A;  4GTQ A;  2VQ2 A;  5CED B;  4U8H A;  3K9I A;  1HF8 A;  1SA5 A;  3FU6 A;  4DX5 D;  5E75 A;  4BY6 A;  1XGW A;  4RG9 A;  4O1P A;  5BUZ A;  2J49 A;  5KCM A;  5CER B;  3RO3 A;  3SQV A;  3GZS A;  2CG2 A;  1H6P A;  4DX6 D;  4JC8 A;  4FHK A;  4PDX A;  4I2W A;  4KVO A;  3C3O A;  4RG6 A;  3CK8 A;  1X81 A;  1LD7 A;  3LY9 A;  4UWG A;  4AEZ C;  3FH8 A;  4HNA D;  4HQD A;  3EDT B;  3PNT B;  2L0T B;  4F1P A;  2YIN A;  2BED A;  2GRP B;  3FUD A;  4H7X A;  4MKT A;  5ENS D;  5D2M C;  1P5Q A;  2FF4 A;  4RQI A;  3HDX A;  3JXJ A;  1K1B A;  4PH4 B;  4B93 B;  5EYP F;  5BPP A;  3FTV A;  4N3C A;  5AJL A;  3DEO A;  4RVB A;  3ZEF A;  2R03 A;  3ZPJ A;  5HQ8 A;  1N95 A;  2KC7 A;  1N54 A;  4GPM A;  3HXC A;  3CEQ A;  2ETB A;  4HLL A;  1YYH A;  4L23 A;  4IUL A;  4JVS A;  4O6F A;  3MGB A;  2R05 A;  3FU3 A;  2WXN A;  3PZ2 A;  2IQC A;  3I4R B;  3V79 K;  1PY1 A;  2LAI A;  3OXL A;  4HVB A;  1PC2 A;  2HO1 A;  3QAQ A;  4JHJ A;  3F6Q A;  4F53 A;  1UOH A;  2XEE A;  3AG3 E;  4ACL A;  3TG5 A;  2V4H C;  2H6G A;  1UW4 B;  1NZN A;  1MX4 A;  3SO8 A;  4GTT A;  3CVP A;  4JB8 P;  1Y6I A;  2XRZ A;  2R02 A;  1D9S A;  2V0P A;  2VGE A;  3EU5 A;  4F6R D;  1JCQ A;  1DCQ A;  4DI4 A;  4K5C A;  1WY6 A;  1ELW A;  2AXU A;  3AAA C;  5CHE E;  2E2E A;  3ESK A;  1N4S A;  4LNU D;  2RFM A;  4APO A;  4L9P A;  4QFV A;  2NC9 A;  3W9G A;  1SVX A;  2I1K A;  2ZU6 B;  3D9M A;  3RAU A;  3ULY A;  3HHM A;  1TR4 A;  2KCL A;  3Q15 A;  3CVL A;  5AJD A;  3FWV A;  3FUE A;  3CVY A;  5LFA A;  2B0O E;  5CMW A;  3FUF A;  4X8Q A;  3CGH A;  1QQE A;  1X5B A;  3JQ0 A;  1N9A A;  5FT9 A;  2J07 A;  2I2O A;  4BSX A;  1KPS B;  4YVO A;  3C72 A;  3CSF A;  3TGO A;  1E8Z A;  2XS8 A;  4A1S A;  1TN6 A;  2P9K G;  4K0R A;  2XGS A;  2WXO A;  1JCR A;  4RLY A;  1NP7 A;  3HXB A;  5FTP A;  1H0A A;  5KWD A;  2AXV A;  2OEW A;  1MX6 A;  3SFX A;  4F1S A;  5AQ7 A;  1E7U A;  4GAA A;  1HG5 A;  3DEP A;  4U7E B;  2VGY A;  5HS0 A;  1V54 E;  1RZ4 A;  2WXP A;  4LCT A;  4QQI A;  2PZI A;  3CST A;  3UM0 A;  4Y6C A;  5H7P A;  4UI9 J;  3RKV A;  2Y4U A;  5FIO A;  1OUV A;  4GML A;  3Q49 B;  3L22 A;  3D9L A;  3OXF A;  3ML8 A;  4Y6W A;  3EHQ A;  3PZD A;  5EYL A;  4GZ5 A;  4YDW A;  3TG4 A;  4ANX A;  1DVP A;  1AWC B;  4N2Q A;  1LTX A;  4C9B B;  3UIP C;  3QKY A;  4A1G A;  3T8M A;  3QNK A;  1D8D A;  4L7T A;  4BET A;  4GPK A;  3SZ7 A;  4A55 A;  5G05 C;  1MQS A;  1ZBP A;  3ZHE A;  3MV2 B;  2XEV A;  4UI9 K;  1H2U A;  4OVV A;  5A7D B;  2FO7 A;  2VGX A;  4ME2 A;  5CCL A;  3SY2 A;  3G2T A;  3HVE B;  4BTB A;  4UQX A;  3IV0 A;  2A5E A;  2VJ8 A;  1A17 A;  5JJ7 A;  1E90 A;  2QZA A;  3CVV A;  2WXQ A;  4DX2 A;  3O4Z A;  4B89 A;  2XEN A;  2RG8 A;  2EIK E;  3KSQ A;  4R7L A;  1SZA A;  4OYS A;  2LUH A;  3QDN A;  4YDY A;  2XRY A;  5FQ4 A;  3CVQ A;  3D9O A;  2L9B A;  4KZ0 A;  4BT9 A;  4DRX E;  4ATG A;  3C5R A;  3NOC D;  3PE4 A;  3ZW3 A;  4U8Y D;  1TNY A;  1TNU A;  3SFY A;  1N52 A;  2P58 C;  2ZGG A;  3LJ3 A;  3FTZ A;  3RRU A;  2WB2 A;  4U0U A;  5AIJ A;  3N71 A;  1QNF A;  1IKN D;  1EYH A;  3FU5 A;  1MX2 A;  2WXH A;  4DPR A;  2R2L A;  4LER A;  4HFG A;  1KZP A;  4EPZ A;  4GA1 A;  5AQA A;  3FUJ A;  4FLB A;  3KD7 A;  3VLF A;  3ZYL A;  5EIB E;  2WXG A;  4BWR A;  3FTU A;  2KBX A;  1DC2 A;  1FCH A;  3UIN C;  1V55 E;  4N39 A;  2QYU A;  3I5P A;  4DLQ A;  2P2C P;  2VSN A;  5EN5 D;  4L2Y A;  5D0Q D;  3U4T A;  4Q69 A;  4HRN A;  2OCC E;  1MJ0 A;  1E8Y A;  4U8V D;  1TJC A;  3D9N A;  4I1O B;  4A63 B;  4I1M A;  2I9C A;  2GW1 A;  2JEK A;  2IO3 C;  3UX4 A;  3Q7A A;  2KCK A;  3CIA A;  3L17 A;  4HOR A;  4J8F A;  3V2X A;  3E34 A;  1OXJ A;  3CHP A;  3MX3 A;  1TYQ G;  3TWQ A;  3ABL E;  3JYS A;  3TWV A;  2DIW A;  4W9R A;  4A3V A;  4AOF A;  3CHQ A;  2XCB A;  4GYW A;  2XPI A;  1HFA A;  4CCA A;  1E7V A;  2DYS E;  4G25 A;  3JUE A;  2MOW A;  3CHM A;  3D3M A;  4EQF A;  2OEV A;  4LEU A;  4O60 A;  3PZ1 A;  3PS6 A;  4BFR A;  2WXK A;  3P2B A;  2F8X K;  2Q7F A;  1HS6 A;  5LOZ A;  4G8K A;  2PNN A;  3ZHE B;  3IEG A;  2WMN A;  3QWV A;  3FH7 A;  4XEI G;  5B1B E;  2WXL A;  4CYM D;  3KAE A;  1H2V C;  3GZ1 A;  3AJI A;  4TUU A;  3UI2 A;  3D9K A;  3DXM G;  4AVX A;  2R17 C;  4B0Z A;  3C98 A;  1O1T A;  2KAT A;  2VYI A;  5CEA A;  4GMR A;  3MZL B;  1HG2 A;  2F8Y A;  4BX9 A;  2P9P G;  4FAD A;  2VTB A;  2PL2 A;  2HYZ A;  4BSZ B;  2HM8 A;  1FPP A;  2DWZ A;  1UJJ A;  3FEX A;  1KT1 A;  3TXM A;  4OAU C;  2CFZ A;  4FU3 A;  4WNG A;  4PUC A;  4CEM A;  2LXM A;  2E0I A;  4EEC A;  4U95 D;  3PVL A;  2JAB A;  1YMP A;  4JW1 A;  5EX0 A;  3D9P A;  1TNO A;  3TXN A;  5DIZ A;  1W3B A;  3L9T A;  2YNQ A;  2QYJ A;  2HE0 A;  5LX8 A;  3RIB A;  4FUL A;  3UM2 A;  3L82 A;  3PEV B;  3CHS A;  4KZC A;  4DX1 A;  1TNZ A;  3FTX A;  4GZ3 A;  1HE8 A;  2WQ6 A;  2LAH A;  3ZN3 A;  4EZJ A;  5E76 A;  2V4L A;  3R7R A;  1PAQ A;  3CV0 A;  2DVW A;  3IXE A;  4MBG A;  4G11 A;  3NB2 A;  4CT4 A;  4WWO A;  2XHE A;  2OVF A;  4NRH B;  4TXR A;  2YHE A;  1YA0 A;  2LSU A;  1HO8 A;  3O48 A;  2H6H A;  1KT0 A;  4P29 A;  2ZIR A;  5FZR A;  1TN7 A;  4HRM B;  4KMO A;  3BG0 B;  1NA0 A;  3TJP A;  4U0Z A;  3DRA A;  4I6J A;  4TRQ A;  2B6C A;  4JHR A;  3C3R A;  3IBE A;  1QYM A;  2WXM A;  1OWP A;  4JA9 A;  5HKP A;  2H6F A;  2BF0 X;  3FUN A;  1Y8M A;  3ONK A;  4HOS A;  2CHW A;  3GW4 A;  2WQ7 A;  4HRL A;  3QWW A;  4HBD A;  3E32 A;  4V3I A;  3CVN A;  5KNG A;  3KEA A;  5FZS A;  5JHB A;  4WUY A;  3HVE A;  2GRN B;  4E6H A;  3S7D A;  2GRO B;  3CHR A;  2ILR A;  1BU9 A;  4KBQ A;  2QC9 A;  4CDM A;  2QFC A;  2WXR A;  4FC8 A;  3QB2 A;  4E85 A;  4URK A;  4KVM A;  5C1D A;  3TWS A;  5BV1 A;  2XS1 A;  3L13 A;  3PZ4 A;  4U04 A;  4U96 D;  2DYR E;  4I2Z A;  4F3V A;  1IHG A;  2VSX E;  3TWW A;  2EQX A;  4UI9 C;  1JWG A;  4EBA A;  3LS8 A;  4GYY A;  3APC A;  2VTB B;  5G2N A;  4L2L A;  3DXK G;  1HXI A;  2KM4 A;  5BV0 A;  3ESL A;  1OCO E;  1S64 A;  3MA5 A;  4I17 A;  4UUC A;  5HI7 A;  4JZY A;  2OVB A;  1OT8 A;  4NUR A;  3U9W A;  2IF4 A;  1FVF A;  3WG7 E;  4FJZ A;  1WG0 A;  3LY8 A;  4BX8 A;  1K3Z D;  4TV3 A;  1BI7 B;  3PUK A;  4N3B A;  3RRN B;  3FFL A;  4MS6 A;  4A3T A;  2X6J A;  4IN3 B;  3UT8 A;  3DBS A;  3ZXP A;  3UUX A;  4HI8 A;  5A6C A;  3I4G A;  3HG0 D;  2V5F A;  3ZYM A;  4AJW A;  2IO2 C;  1BPO A;  2IOL A;  3CK9 A;  5FQ7 A;  1SA4 A;  3PNL B;  1NA3 A;  1E96 B;  5FJY A;  3Q9N C;  4I9C A;  3S7B A;  1KLX A;  5FZQ A;  5DBK A;  2WMO A;  3NQP A;  2AJA A;  4UWL A;  3FUI A;  4CZ2 D;  4G2V A;  2X6F A;  3RRM B;  2GGF A;  5T8I A;  4HOU A;  4J8Y A;  4I9E A;  2Y1L E;  3U3W A;  4ATZ D;  2VSO E;  3L16 A;  2V8S E;  3BU8 A;  3SD5 A;  3UMV A;  5JJ6 A;  3NOG D;  4UWH A;  1OCC E;  3UXG A;  3D9H A;  1H19 A;  4I1A A;  3VTX A;  2GRR B;  2WM9 A;  1QBQ A;  2X6K A;  3MKR A;  1TJF A;  3U66 A;  1HZ4 A;  2UY1 B;  5ENO D;  4JA7 A;  3L08 A;  3SF4 A;  5IY5 E;  4F7A A;  4MLP A;  1OWN A;  5JA4 D;  4HI9 A;  1AP7 A;  5AQ9 A;  3BEE A;  3PDN A;  3EIJ A;  3E37 A;  5C2Y A;  2EIL E;  2L6J A;  3T5V A;  4WNE A;  1K1A A;  4I6G A;  4LNB A;  4GTP A;  3QOU A;  2AWI A;  3P1U A;  3OTN A;  5LCW J;  3EUV A;  2LNI A;  4EZL A;  3V31 A;  4L1B A;  2WQH A;  3SBT B;  2CG3 A;  1ELR A;  1A5E A;  2MHK A;  2IU1 A;  2AXZ A;  3DSS A;  5KBA A;  3B7R L;  2XPZ A;  2UWJ G;  3SHF A;  3MEK A;  4LSZ E;  3CHO A;  3UM1 A;  5ENR D;  2AVP A;  3LDZ A;  2X3M A;  5CEC B;  1EPU A;  4C0E A;  3ASG A;  3TWT A;  3T9K A;  4NAC A;  1UG3 A;  3CQG B;  4U07 A;  2XPY A;  3VLE A;  2IEJ A;  1Z3X A;  2FO1 E;  1XNF A;  1IHB A;  1N11 A;  4CDR A;  4TXP A;  3ZVV A;  3CK7 A;  3PH0 C;  2WPV A;  5CRU A;  3JUI A;  2Y69 E;  3ISM C;  4CRW A;  5AYW D;  5G04 C;  4HOQ A;  2ZGD A;  3LXU X;  4GCO A;  4DX7 D;  5CBN A;  3SI5 A;  2BUG A;  1HX8 A;  3JCK C;  2XQ0 A;  5A23 A;  4XKC A;  2CHX A;  2DBA A;  5M72 A;  5FIN A;  5CBO A;  2YHC A;  1RW2 A;  3ZXS A;  2GRM A;  2FI7 A;  2IOS A;  5EDS A;  3ZIM A;  2C0L A;  3ML9 A;  3D9J A;  4GZ6 A;  3KEZ A;  4KXK B;  4GTR A;  4UQY A;  3UPV A;  3Q73 A;  5LP0 A;  2R5S A;  4PS7 A;  4ZFH A;  1FT1 A;  2ZXW E;  1BD8 A;  2C0M A;  5HRY A;  2F37 A;  3BG1 B;  3PEU B;  3FTW A;  3DWL G;  2IJG X;  3JQ1 A;  3TL5 A;  2Y4T A;  4K5A B;  4LG6 A;  2H6I A;  3AG2 E;  3APD A;  1JWF A;  3DPY A;  3ZKJ A;  4JEU A;  3UIO C;  5ARG A;  1JCS A;  4GMJ A;  5ARF A;  3ZU7 B;  1S0P A;  3R9A B;  3Q78 A;  1ZB1 A;  5B1A E;  2DCP A;  3FH5 A;  3FUM A;  3JXI A;  4G8L A;  3T5X A;  4GYO A;  3EU9 A;  2IFU A;  5G04 J;  3NZU A;  3FTY A;  2HR2 A;  3UM3 A;  1IQU A;  3AG1 E;  3UTM A;  4ANV A;  3MKQ A;  1IQR A;  3Q9U C;  2CFU A;  3ASH A;  4YVQ C;  3LVR E;  5FWQ A;  3URZ A;  3MYV A;  3MJW A;  3MV3 B;  1TN8 A;  3RK6 A;  3UKR G;  4ANW A;  1VDY A;  3ZYK A;  2WXI A;  2I6H A;  4ANU A;  3QAR A;  3E30 A;  4MRU A;  3ZFW A;  1D8E A;  2X6H A;  4AP2 A;  2JLB A;  2QY7 A;  4UWK A;  3KS2 A;  2ETA A;  2ETC A;  4WWP A;  2NYJ A;  5AEN A;  1LF8 A;  3RO2 A;  3AS5 A;  3FP3 A;  4BES A;  3G2U A;  5KJN A;  1FT2 A;  3ASD A;  2A5U A;  4FJY A;  3ULE G;  4XI9 A;  2LXL A;  5D66 A;  3Q47 B;  4OAV B;  1NI1 A;  4N5Q A;  1B89 A;  2R59 A;  2P9L G;  3LJN A;  4B8A A;  1O5M A;  3FEY A;  3OXG A;  5G55 A;  3B7T A;  3NF1 A;  5ITZ F;  5ANL A;  4WWN A;  1U2V G;  3RSE G;  4WAF A;  2KZT B;  1BI8 B;  3NZS A;  4ILI A;  3ZRH A;  4JHK A;  1IYG A;  1K8K G;  4AV7 A;  4AY6 A;  4YDO A;  4AM9 A;  4UQZ A;  2F0Y A;  4G26 A;  5ANR A;  4CGV A;  1MYO A;  2PQN A;  2UY1 A;  4GTM A;  1G3N B;  5AN8 A;  5ENP D;  4BT8 A;  4ZHB A;  3BUA A;  3PE3 A;  2L6B A;  3MCX A;  1H2T C;  3UQ3 A;  3IHY A;  4CDN A;  2BKG A;  1FVH A;  3QK0 A;  4I43 A;  2XCC A;  2XGO A;  2P9I G;  5CCM A;  3R9M A;  1EF1 C;  1GW6 A;  1TNB A;  3QC1 A;  3FUK A;  3D9I A;  3RJV A;  1O1R A;  3FTS A;  1N94 A;  2RKK A;  3QWP A;  4XZ4 A;  4PS3 A;  3PRZ A;  1LD8 A;  4CGW A;  3ASO E;  4J0U A;  4J8E A;  4LUN U;  2J08 A;  5EKQ D;  4HXI A;  2XEH A;  5KJK A;  3S7F A;  4FLH A;  4GTO A;  2WXJ A;  3MKQ B;  4G24 A;  3ZUV B;  3B7B A;  3WXX A;  1DCE A;  2XZD G;  4HB5 A;  3FY4 A;  1IXV A;  1BLX B;  2J9Q A;  5BT1 A;  2BTD A;  3Q79 A;  5CMY A;  4J8D A;  4Z68 A;  5FQ8 A;  3U64 A;  1DNP A;  3TWR A;  4DI3 A;  3UKU G;  3HYM B;  4GA0 A;  4ABN A;  1Z5S C;  3TWX A;  1JUQ A;  3CVU A;  3FHE A;  3APF A;  3L6A A;  3NBN B;  4GA2 A;  1MHQ A;  1UJK A;  3Q7F A;  3T8K A;  4M7C A;  4ILG A;  5KNH D;  1U3C A;  1N0R A;  3DST A;  2KXP C;  3EHR A; 
#chains in the Genus database with same CATH homology
 2GRN B;  3UIN C;  1KPS B;  1Z5S C;  2GRQ B;  3UIO C;  2IY0 C;  5D2M C;  3UIP C;  2GRR B;  2GRP B;  2GRO B;  2IO2 C;  2IO3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...