2IY0C

Senp1 (mutant) sumo1 rangap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase activator
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2iy0C00
1KPSB 2GRQB 2IY0C 3UIOC 3UIPC 2GRPB 2GRNB 3UINC 2GROB 2IO3C 2IO2C 5D2MC 2GRRB 1Z5SC
chains in the Genus database with same CATH superfamily
2LSUA 3NF1A 5A6CA 2AWIA 3UM1A 2MYOA 2YQ8A 1JWGA 2AXZA 3UT7A 2PQNA 1U3DA 4CDRA 2VGXA 3G2VA 4U7EB 4KVMA 3JUIA 1ZU2A 2XQ0A 2P2CP 2GRNB 3JQ1A 4B8AA 4UWKA 4RVBA 1OY3D 3LPZA 1A5EA 5ENTD 4HI8A 3RRUA 2H6GA 4ANUA 3MJWA 1ELKA 3KSLA 1D9SA 5FQ8A 3CVPA 4GMLA 4CYMD 3ASGA 4BT9A 2IY0C 2P9LG 4YNDA 4GTPA 2KATA 4O60A 5EDSA 4GPMA 5BUZA 5ENRD 5LCWJ 2IOLA 3CQGB 3ZYLA 1NZNA 4C48B 3E33A 5EYPF 4OVVA 4F7AA 5BXOA 1OCCE 4FU3A 4G8KA 3T5XA 3KS2A 3NAWA 1QNFA 4CT4A 3UKUG 4NRHB 5CCLA 3JUEA 3CR3A 3G2SA 1TN8A 5LOZA 1ELRA 2J8SD 2KBXA 3CVWA 4TUUA 1QBQA 4UQYA 1TYQG 2GRPB 3FFLA 4PS7A 3GZ1A 5KJMA 5B3SE 2ETCA 4GMJA 1E8ZA 1W3BA 2CHXA 2VTBB 3ABME 4FJZA 3AG3E 2C2LA 3HYMB 3FU0A 5BV1A 1BI8B 4U8YD 1HG2A 2R03A 3FY4A 3RO2A 1YA0A 3ABLE 4PS3A 5C1DA 5T8IA 2ZGGA 1LF8A 2CG2A 4KZ0A 4BSXA 5EN5D 4CRWA 2GRRB 4NIKA 5AQ9A 1N4SA 2H6HA 1NA3A 4GTVA 3SFXA 3UUXA 3W9FA 1KZPA 3SFZA 3U4TA 4U0ZA 2V4LA 3CHMA 3FU5A 5FZSA 4ANXA 3HDXA 2XCCA 3EHRA 3TGOA 4JA7A 3KEZA 5D0OD 3FHEA 2EINE 1OT8A 3Q75A 1ZB1A 2H6IA 2IO2C 2ZISA 1YCSB 3D9KA 4BT8A 2EIJE 1K1AA 3FDHA 2WQ6A 2WXKA 5ARFA 2L0IA 4HLLA 3UMVA 4LG6A 3ML8A 1N94A 3ZPJA 4DX5D 1DCEA 4O1OA 4OAUC 2VSXE 4I9EA 1HZ4A 2HE0A 4CEMA 3NOGD 3P2BA 4UWHA 4RG6A 4TXPA 4J6IA 1JUQA 4A55A 1MZCA 5A23A 3HXCA 2DBAA 4OAVB 3EHNA 3IV0A 3S7BA 1Z3XA 4V3IA 2XPIA 3TAXA 3TG4A 3PE3A 3NZSA 5AYWD 2P9IG 1SW6A 3UIOC 4FULA 1HF8A 3C72A 1DNPA 3EUVA 3E32A 1IQRA 4LUNU 3L22A 3FUFA 1MX6A 3EU5A 3RIBA 4GCNA 1UOHA 3T9KA 3Q47B 5AJDA 3CQCB 2GRLA 1HO8A 2F37A 3LDZA 4YVQC 3ZFWA 1KT1A 2I6HA 2NC9A 1YMPA 3CV0A 5BXUA 1TNZA 3HRAA 2WVIA 1OCOE 1V55E 3HVEA 5M72A 1FVFA 4BX9A 1JCQA 2DZNA 1UN9A 4A1GA 4ANVA 2XRYA 1HG5A 3PVLA 4M7CA 4JL0A 4YDWA 4HRNA 1K1BA 4GYWA 4NQ0A 1BPOA 3ASFA 1O5MA 5KWDA 4JZYA 4N2QA 5CMYA 4L7TA 1N0QA 3TWVA 2A5EA 3UM2A 5G2NA 3RRNB 4WWNA 3IEGA 1TNBA 3S7JA 3GZSA 2WMOA 4YDOA 5ENSD 3Q15A 4APFA 3AG2E 1KT0A 4RG9A 3W9GA 4PUCA 4KMOA 4GTOA 2WXQA 4WNEA 4N2SA 2FO1E 4LNUD 1N9AA 3ZHEB 5DIZA 4DUIA 3CVLA 2DWZA 1D8EA 4HOUA 2WPVA 2DIWA 3WG7E 3D9IA 1KLXA 3ABKE 5AAOA 1Z6TA 4MBGA 4BSZB 3MEKA 3AS4A 3CSTA 4TXQA 2AJAA 4LNBA 5AIJA 3S7FA 4TXRA 2XS8A 2CG3A 5D0QD 4Q69A 4B0ZA 3QWWA 3TWXA 3VTYA 3MZLB 3FUNA 1SVXA 2VGEA 3J5PA 3TG5A 4B8CB 1N54A 3ZU7B 3ZVVA 3CHQA 3TWSA 4AY5A 4CCAA 2J9QA 2OVBA 2ZGDA 2CHZA 1TJFA 3BG1B 2KXPC 1NI1A 1E7VA 2QYUA 5FIOA 5FQ7A 1DVPA 5CRVA 5ENPD 4DX6D 3NB2A 4GZCA 4JEUA 5EILA 3LXUX 4GZ3A 3CKBA 3MA5A 1P5QA 3AG1E 3PZ1A 4W9RA 3D9HA 3KSQA 5FZQA 2WXNA 2UY1B 4EQFA 4FC8A 3D9MA 2YINA 5A7DB 1UW4B 3HIZA 2RFMA 2R02A 5BPPA 3HXEA 5DBKA 4Z68A 3Q4AB 5JA4D 3Q5MA 5BT1A 2WQ7A 5J90A 1N52A 3MV2B 2XEVA 2XRZA 3ZNGA 4DX2A 1Y6IA 4OYSA 1SZ9A 1E8XA 1SZAA 3ULQA 2NSZA 3D3MA 3SI5A 4G25A 3ZYMA 5T3RA 4CT0A 4WUYA 2XPZA 3OXFA 4N3BA 3T8MA 5LX8A 1S63A 4E6HA 3SF4A 1RW2A 5G04J 1U2VG 4PH4B 3E34A 4JB8P 2FO7A 3FU3A 4A3VA 3S2AA 3SGHA 4OVUA 1OWMA 4P29A 3TXNA 4GZDA 4I9CA 3RRMB 4PDXA 4UI9J 4N3AA 3TJPA 5LCWC 4EBAA 2P9UG 4JVSA 2V5QC 5G55A 3QDNA 4U96D 1HX8A 4LRZA 2WXRA 1MHQA 1QZ2A 3C3OA 3V79K 3MKQA 3IXEA 2HO1A 5G05J 4FLHA 2A5UA 3SO8A 2WXOA 3MYVA 4N5CA 3DSXA 3AU4A 3FTXA 3PEVB 1IYGA 3CHOA 3I3NA 3ESLA 5AQ7A 1RZ4A 4L1BA 4AIFA 2PQRA 1FVHA 5E75A 4C0MA 3TWQA 4GZ5A 2OVFA 3L9TA 4CGVA 2RG8A 4G8LA 3RSEG 4L2LA 3WXXA 2P58C 2FI7A 4K0RA 1TJCA 2Y4UA 4NACA 4J0UA 4WWPA 4GA2A 2C0MA 4U07A 1VDYA 4TUMA 5JHBA 4WWOA 2GROB 1SQMA 3LY7A 4AXHA 4MLPA 1INZA 4HNAD 4LEUA 3U64A 2XGSA 1SA5A 2VGXB 1SA4A 5KCMA 2XZTG 1E8YA 4GYOA 2VJ8A 5HKPA 5CERB 1V54E 3PH0C 5AENA 5D66A 4BFRA 1GW6A 3R7RA 4GA0A 2FF4A 3IHVA 5EIDA 3L6AA 4C0EA 3PDNA 4BWRA 5KJNA 4N39A 3T5VA 2R2LA 2B0OE 1TNYA 2WXHA 3UT8A 1Z3YA 3UTMA 3ESKA 3GZ2A 4CDMA 4WNDA 5JJ6A 3UM0A 1O1TA 1H2UA 3DSWA 3T8KA 1UJJA 2GGFA 1FT2A 5J08A 4JW1A 4A63B 2XEHA 2XEEA 3CHSA 4HFGA 4WNGA 1X5BA 1HXIA 3G2TA 2XS1A 3PS6A 3ML9A 2LO6A 4RQIA 1BI7B 2EQXA 3MX3A 3UIPC 4D10C 3FTYA 3EJNA 4BTAA 4GYYA 2JLBA 1IHGA 4URKA 1OWNA 1G3NB 2Y0BG 3BQOA 4EZJA 2GW1A 1Y8MA 2IQCA 4FLBA 2YHEA 1Q2ZA 3QK0A 4XEIG 1MYOA 4ILGA 3Q78A 2KM4A 4JXTA 1MX2A 3LJ3A 3RO3A 2WMNA 4HI9A 4YVOA 3CKCA 4KBQA 3QWPA 3MCXA 1HFAA 3LJNA 3TWWA 3ASNE 4EZLA 3L82A 4JHKA 1JPLA 2PL2A 2KCKA 1E7UA 4AP2A 3UM3A 1Z5SC 4GZ6A 4Q96A 4I6EA 4J8EA 1WG0A 4GPKA 2VQ2A 4U0UA 4FJYA 2IONA 3JXJA 4DPRA 4H7XA 4ATZD 4ANWA 3B7UX 5HRYA 4FADA 3ZGQA 2M63A 3UKRG 5KJLA 3DSVA 2ONDA 3R9MA 1OWOA 1IQUA 4L2YA 3AS5A 4I17A 1DCQA 3I5PA 3FP3A 1LTXA 3IKOB 1MJ0A 3ONKA 4GB9A 2EILE 2WB2A 2HM8A 2J09A 3DEOA 2QYJA 3ASHA 4GCOA 2DCPA 4HLEA 1OUVA 5JHAA 5JJTA 3HHMA 1AWCB 5CBOA 3QKYA 2KZTA 4G26A 2Q7FA 2VGYA 3Q7AA 4X8QA 2GRQB 2LXMA 4U0SA 4Q94A 4U8VD 2VSOE 3L16A 2P9SG 3LVRE 4U8HA 4YDYA 3AJIA 4IULA 4IYPA 2VSYA 3MV3B 1BLXB 2E2EA 3V2OA 4G24A 4AEZC 3I4RB 4J7WA 2RFAA 3Q79A 1BD8A 3FUIA 5BV0A 3G2UA 2EIME 2ZIRA 3SQVA 3DEPA 4BY6A 5HQ8A 4J8SA 2YNQA 1HE8A 1PAQA 2I1KA 4HRMB 2LXLA 3L17A 4XI0A 2MRIA 4DJAA 5HS0A 3FTUA 3ZYKA 4A3TA 4WAFA 3V31A 1K8KG 5FQ4A 4LERA 4APOA 3FU6A 1E96B 3KEAA 3I4GA 1BU9A 4HORA 1K3ZD 4NURA 1E8WA 3CK9A 3CSFA 3PNLB 2PNNA 2J4DA 3AS8A 3BG0B 4RLYA 4BX8A 3R7QA 4HBDA 2PM7A 2KCLA 3HVEB 4Y6CA 1XGWA 5CRUA 3TWTA 1MQSA 4U04A 2L6BA 4LSZE 3SBTB 1A17A 1WY6A 5ANLA 1PC2A 1UG3A 2CFZA 2IFUA 2QZAA 3JXIA 3TWUA 3JYSA 1WM5A 2OV8A 4UQXA 5JMND 3APDA 3L08A 1X81A 2QY7A 4CDNA 4DK5A 3HG0D 4DX7D 3RU0A 3AU5A 5CMWA 3PNTB 3CHPA 1N4PA 4EBAG 4LNGA 2PZIA 3F6QA 2P9NG 2B6CA 3UXGA 4M3OA 3B7TA 3R9AB 3CVXA 4I43A 2WXMA 4XKBA 2V8SE 2VYIA 5AJLA 3TXMA 1O1RA 5H7PA 4PS8A 3SNXA 3ASOE 2X38A 3D9OA 2LUHA 2LAHA 4N5QA 4XE0A 4Y6WA 4RSYA 1EPUA 3LEWA 5BW8C 5G04C 1XNFA 2C0LA 2XPYA 3ULYA 4DX1A 3PE4A 2L9BA 4E85A 4EZKA 3L54A 4DRXE 2BEDA 2Y69E 3ZW3A 3O48A 3PZ3A 2NXPA 4HS2A 3UPVA 2KC7A 1N4RA 5D2MC 4UI9K 3B7BA 4N3CA 4O6FA 3DRAA 4F1SA 3PZDA 4F1PA 4UI9C 4DI3A 4XZ4A 2XGMA 3Q9NC 2OCCE 3CIAA 4UWLA 4TV3A 5CCMA 3HXBA 3D9PA 1KZOA 2WXJA 4U63A 3ENEA 4A1SA 1HH8A 5G05C 1S70B 3CVQA 4BTBA 5KBAA 5FQ6A 3DWLG 2H6FA 3PEUB 4WNFA 5AARA 3AAAC 1JCSA 3LY8A 3DXMG 2OEVA 3SD5A 4QQIA 3Q9UC 3CLJA 3D9JA 3PREA 2R59A 1HU3A 2VTBA 3DXKG 5LFAA 5BNWA 2MHKA 5CEAA 1B89A 1EF1C 3JQ0A 5AQBA 5FINA 1KPSB 2OEWA 3FUMA 2ZXWE 2HR2A 3Q7FA 4I6JA 4BERA 2JABA 3FH8A 1TN7A 4HRLA 3RJVA 3DBSA 1H6KA 5FWQA 2X6KA 3EIJA 3EU9A 4DLOA 1U3CA 2UWJG 2LAIA 2ZU6B 5EIBE 3CVNA 1DC2A 3BUAA 4CZ2D 3ONLA 3V30A 4B89A 3ZIMA 4KVOA 2EIKE 1N11A 1OXJA 3B95A 4QFVA 2XZDG 1UJKA 4BEPA 3ZUVB 3FTVA 4XKCA 4MRUA 4AOFA 2X6JA 3HXFA 3B7SA 4ILIA 3BEEA 3NOCD 4HOSA 5ITZF 3G2WA 3DSSA 4H7YA 4L9PA 2CHWA 4FHKA 4F6RD 2WXGA 5ANRA 4FHJA 1TR4A 3OAWA 1S0PA 4ZHBA 3TL5A 4B94A 3SY2A 4F3VA 2DYRE 3MKQB 4JHRA 2BKKB 2A4ZA 3EDTB 3VTXA 4HVBA 5CHEE 5CBNA 4I6GA 2AVPA 2J4BA 3E4BA 1AP7A 1N4QA 1N95A 2X6FA 4GTMA 4K5AB 3RKVA 4HOTA 2JEKA 3OXLA 1JCRA 2X6HA 3ZRHA 2R05A 4I2ZA 2FBNA 4BETA 4KZCA 2I2OA 3C98A 2I9CA 2V5FA 4KYOB 1TEZA 1NA0A 2XENA 2R17C 3Q73A 5EKQD 3C5RA 4GTSA 5FT9A 3GYZA 4XX5A 5ENQD 4K5BA 2E0IA 3IBEA 3N71A 3RAUA 4ZFHA 4J8YA 3QARA 4IRUA 1EYHA 4K03A 3FTWA 3NZUA 3PUKA 4XI9A 3LS8A 3D9NA 1OCRE 2V0PA 4HOQA 3UINC 3U3WA 4G11A 2LNIA 1WDYA 3CK8A 2WQHA 2Y3AA 4CGWA 3JCKC 2J07A 3CVYA 3U9WA 5AN8A 2I1JA 2FEZA 1TNOA 3OXGA 3ZEFA 3FUKA 2IF4A 1D8DA 5FTPA 1TNUA 4HXIA 3KD7A 4BESA 3MGBA 4TRQA 4AM9A 2MOWA 5EX0A 5CECB 1N0RA 2WXLA 2IO3C 1OWPA 1FT1A 5B1AE 4JPSA 2PM6A 3ISMC 2GRMA 4IN3B 1TN6A 2DYSE 4O1PA 3BU8A 2RD0A 4ME2A 3HXDA 1ZBPA 4EECA 1UN8A 4G2VA 3D9LA 4L23A 3LYAA 4MKTA 3ZHEA 1H6PA 4AY6A 3LY9A 2L6JA 3EHMA 3ASDA 3LKUA 2WM9A 3LVQE 4GTQA 5IY5E 1PY1A 3QB2A 4DI4A 3ZYQA 3FTSA 3L13A 1JWFA 3FEYA 3NBNB 3PZ4A 2IEJA 1WAO1 4AJWA 1NL4A 3OTNA 3DSUA 1HS6A 3QOUA 3E30A 3IHYA 4B93B 3FH7A 4YDEA 3ULEG 2QC9A 2OOEA 2NYJA 4GU5A 1L5JA 2AW6A 2J49A 4K5CA 4KXKB 2BUGA 3QC1A 3UI2A 2V4HC 3PRZA 5HI7A 3VLDA 5KJKA 3FUDA 2WXIA 3ZN3A 4GMRA 4UWGA 4GTTA 2VSNA 3PUJA 5FJYA 1EDUA 3SZ7A 4EHMA 5JJ7A 4C9BB 2BTDA 4UWFA 4FP7A 5ENNA 3V2XA 2F0YA 2UY1A 4KT6B 1H0AA 3U66A 3K9IA 3P1UA 3B13A 4JA9A 5T4YA 3ZXPA 2BKGA 5ENOD 1QYMA 3APCA 1MX4A 3Q49B 4I1OB 3UQ3A 3EIQC 1O1SA 2X3MA 2IU1A 3FTZA 2KZTB 3VLFA 4G1TA 2WXPA 4ACLA 1IHBA 1LD7A 1NP7A 5EYLA 4ABNA 4UUCA 4EPZA 1YYHA 4I2WA 3KAEA 3X2QE 3C3QA 3CVUA 4ILHB 5AQAA 2P9PG 2XGOA 3QWVA 2IJGX 3FUEA 1OCZE 2Y1LE 4JC8A 4GTRA 4JEHA 2CFUA 4ACKA 4I1MA 3FUHA 4AVXA 4J8DA 3SFYA 2FULA 2AXUA 3FH5A 1H19A 2P9KG 4FA6A 3FULA 2Y4TA 5EX3A 1NFIE 2R5SA 2XCBA 3APFA 2DVWA 2ETBA 3DSTA 2LSVA 4ATGA 1S64A 3C3RA 4JHJA 3URZA 4UQZA 3NQPA 3PZ2A 4R7LA 5B1BE 4G23A 5LP0A 2RKKA 3CVVA 1H6OA 1H2VC 4AV7A 5KNGA 4F53A 2AXVA 3MKRA 1ELWA 1E90A 2ETAA 3RK6A 3J5QB 3SBSA 2DZOA 1FPPA 1LD8A 2QFCA 3QNKA 4U95D 3DPYA 1IXVA 1FCHA 4HQDA 2YHCA 3SHFA 1IKND 3GW4A 3ZKJA 3FUJA 3VLEA 3AG4E 4LCTA 4I1AA 3B7RL 4GA1A 5CEDB 4DLQA 2HYZA 3CHRA 4XIFA 2L0TB 3QAQA 2F8YA 3FEXA 3CGHA 3S7DA 3UT4A 3EHQA 3TWRA 2J08A 2F8XK 5FZRA 3UX4A 2KCVA 4MS6A 5KNHD 1H2TC 1OWLA 2WXFA 5ARGA 3DPDA 4JD2G 3LCAA 2BF0X 5C2YA 2IOSA 4HB5A 5E76A 1QQEA 3CEQA 3QJZA 2XHEA 3FWVA 3E37A 3CK7A 3ZXSA 3O4ZA 4J8FA 2X6IA 2ILRA 4GAAA
chains in the Genus database with same CATH topology
1KPSB 2GRQB 2IY0C 3UIOC 3UIPC 2GRPB 2GRNB 3UINC 2GROB 2IO3C 2IO2C 5D2MC 2GRRB 1Z5SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KPS B;  2GRQ B;  2IY0 C;  3UIO C;  3UIP C;  2GRP B;  2GRN B;  3UIN C;  2GRO B;  2IO3 C;  2IO2 C;  5D2M C;  2GRR B;  1Z5S C; 
#chains in the Genus database with same CATH topology
 2LSU A;  3NF1 A;  5A6C A;  2AWI A;  3UM1 A;  2MYO A;  2YQ8 A;  1JWG A;  2AXZ A;  3UT7 A;  2PQN A;  1U3D A;  4CDR A;  2VGX A;  3G2V A;  4U7E B;  4KVM A;  3JUI A;  1ZU2 A;  2XQ0 A;  2P2C P;  2GRN B;  3JQ1 A;  4B8A A;  4UWK A;  4RVB A;  1OY3 D;  3LPZ A;  1A5E A;  5ENT D;  4HI8 A;  3RRU A;  2H6G A;  4ANU A;  3MJW A;  1ELK A;  3KSL A;  1D9S A;  5FQ8 A;  3CVP A;  4GML A;  4CYM D;  3ASG A;  4BT9 A;  2IY0 C;  2P9L G;  4YND A;  4GTP A;  2KAT A;  4O60 A;  5EDS A;  4GPM A;  5BUZ A;  5ENR D;  5LCW J;  2IOL A;  3CQG B;  3ZYL A;  1NZN A;  4C48 B;  3E33 A;  5EYP F;  4OVV A;  4F7A A;  5BXO A;  1OCC E;  4FU3 A;  4G8K A;  3T5X A;  3KS2 A;  3NAW A;  1QNF A;  4CT4 A;  3UKU G;  4NRH B;  5CCL A;  3JUE A;  3CR3 A;  3G2S A;  1TN8 A;  5LOZ A;  1ELR A;  2J8S D;  2KBX A;  3CVW A;  4TUU A;  1QBQ A;  4UQY A;  1TYQ G;  2GRP B;  3FFL A;  4PS7 A;  3GZ1 A;  5KJM A;  5B3S E;  2ETC A;  4GMJ A;  1E8Z A;  1W3B A;  2CHX A;  2VTB B;  3ABM E;  4FJZ A;  3AG3 E;  2C2L A;  3HYM B;  3FU0 A;  5BV1 A;  1BI8 B;  4U8Y D;  1HG2 A;  2R03 A;  3FY4 A;  3RO2 A;  1YA0 A;  3ABL E;  4PS3 A;  5C1D A;  5T8I A;  2ZGG A;  1LF8 A;  2CG2 A;  4KZ0 A;  4BSX A;  5EN5 D;  4CRW A;  2GRR B;  4NIK A;  5AQ9 A;  1N4S A;  2H6H A;  1NA3 A;  4GTV A;  3SFX A;  3UUX A;  3W9F A;  1KZP A;  3SFZ A;  3U4T A;  4U0Z A;  2V4L A;  3CHM A;  3FU5 A;  5FZS A;  4ANX A;  3HDX A;  2XCC A;  3EHR A;  3TGO A;  4JA7 A;  3KEZ A;  5D0O D;  3FHE A;  2EIN E;  1OT8 A;  3Q75 A;  1ZB1 A;  2H6I A;  2IO2 C;  2ZIS A;  1YCS B;  3D9K A;  4BT8 A;  2EIJ E;  1K1A A;  3FDH A;  2WQ6 A;  2WXK A;  5ARF A;  2L0I A;  4HLL A;  3UMV A;  4LG6 A;  3ML8 A;  1N94 A;  3ZPJ A;  4DX5 D;  1DCE A;  4O1O A;  4OAU C;  2VSX E;  4I9E A;  1HZ4 A;  2HE0 A;  4CEM A;  3NOG D;  3P2B A;  4UWH A;  4RG6 A;  4TXP A;  4J6I A;  1JUQ A;  4A55 A;  1MZC A;  5A23 A;  3HXC A;  2DBA A;  4OAV B;  3EHN A;  3IV0 A;  3S7B A;  1Z3X A;  4V3I A;  2XPI A;  3TAX A;  3TG4 A;  3PE3 A;  3NZS A;  5AYW D;  2P9I G;  1SW6 A;  3UIO C;  4FUL A;  1HF8 A;  3C72 A;  1DNP A;  3EUV A;  3E32 A;  1IQR A;  4LUN U;  3L22 A;  3FUF A;  1MX6 A;  3EU5 A;  3RIB A;  4GCN A;  1UOH A;  3T9K A;  3Q47 B;  5AJD A;  3CQC B;  2GRL A;  1HO8 A;  2F37 A;  3LDZ A;  4YVQ C;  3ZFW A;  1KT1 A;  2I6H A;  2NC9 A;  1YMP A;  3CV0 A;  5BXU A;  1TNZ A;  3HRA A;  2WVI A;  1OCO E;  1V55 E;  3HVE A;  5M72 A;  1FVF A;  4BX9 A;  1JCQ A;  2DZN A;  1UN9 A;  4A1G A;  4ANV A;  2XRY A;  1HG5 A;  3PVL A;  4M7C A;  4JL0 A;  4YDW A;  4HRN A;  1K1B A;  4GYW A;  4NQ0 A;  1BPO A;  3ASF A;  1O5M A;  5KWD A;  4JZY A;  4N2Q A;  5CMY A;  4L7T A;  1N0Q A;  3TWV A;  2A5E A;  3UM2 A;  5G2N A;  3RRN B;  4WWN A;  3IEG A;  1TNB A;  3S7J A;  3GZS A;  2WMO A;  4YDO A;  5ENS D;  3Q15 A;  4APF A;  3AG2 E;  1KT0 A;  4RG9 A;  3W9G A;  4PUC A;  4KMO A;  4GTO A;  2WXQ A;  4WNE A;  4N2S A;  2FO1 E;  4LNU D;  1N9A A;  3ZHE B;  5DIZ A;  4DUI A;  3CVL A;  2DWZ A;  1D8E A;  4HOU A;  2WPV A;  2DIW A;  3WG7 E;  3D9I A;  1KLX A;  3ABK E;  5AAO A;  1Z6T A;  4MBG A;  4BSZ B;  3MEK A;  3AS4 A;  3CST A;  4TXQ A;  2AJA A;  4LNB A;  5AIJ A;  3S7F A;  4TXR A;  2XS8 A;  2CG3 A;  5D0Q D;  4Q69 A;  4B0Z A;  3QWW A;  3TWX A;  3VTY A;  3MZL B;  3FUN A;  1SVX A;  2VGE A;  3J5P A;  3TG5 A;  4B8C B;  1N54 A;  3ZU7 B;  3ZVV A;  3CHQ A;  3TWS A;  4AY5 A;  4CCA A;  2J9Q A;  2OVB A;  2ZGD A;  2CHZ A;  1TJF A;  3BG1 B;  2KXP C;  1NI1 A;  1E7V A;  2QYU A;  5FIO A;  5FQ7 A;  1DVP A;  5CRV A;  5ENP D;  4DX6 D;  3NB2 A;  4GZC A;  4JEU A;  5EIL A;  3LXU X;  4GZ3 A;  3CKB A;  3MA5 A;  1P5Q A;  3AG1 E;  3PZ1 A;  4W9R A;  3D9H A;  3KSQ A;  5FZQ A;  2WXN A;  2UY1 B;  4EQF A;  4FC8 A;  3D9M A;  2YIN A;  5A7D B;  1UW4 B;  3HIZ A;  2RFM A;  2R02 A;  5BPP A;  3HXE A;  5DBK A;  4Z68 A;  3Q4A B;  5JA4 D;  3Q5M A;  5BT1 A;  2WQ7 A;  5J90 A;  1N52 A;  3MV2 B;  2XEV A;  2XRZ A;  3ZNG A;  4DX2 A;  1Y6I A;  4OYS A;  1SZ9 A;  1E8X A;  1SZA A;  3ULQ A;  2NSZ A;  3D3M A;  3SI5 A;  4G25 A;  3ZYM A;  5T3R A;  4CT0 A;  4WUY A;  2XPZ A;  3OXF A;  4N3B A;  3T8M A;  5LX8 A;  1S63 A;  4E6H A;  3SF4 A;  1RW2 A;  5G04 J;  1U2V G;  4PH4 B;  3E34 A;  4JB8 P;  2FO7 A;  3FU3 A;  4A3V A;  3S2A A;  3SGH A;  4OVU A;  1OWM A;  4P29 A;  3TXN A;  4GZD A;  4I9C A;  3RRM B;  4PDX A;  4UI9 J;  4N3A A;  3TJP A;  5LCW C;  4EBA A;  2P9U G;  4JVS A;  2V5Q C;  5G55 A;  3QDN A;  4U96 D;  1HX8 A;  4LRZ A;  2WXR A;  1MHQ A;  1QZ2 A;  3C3O A;  3V79 K;  3MKQ A;  3IXE A;  2HO1 A;  5G05 J;  4FLH A;  2A5U A;  3SO8 A;  2WXO A;  3MYV A;  4N5C A;  3DSX A;  3AU4 A;  3FTX A;  3PEV B;  1IYG A;  3CHO A;  3I3N A;  3ESL A;  5AQ7 A;  1RZ4 A;  4L1B A;  4AIF A;  2PQR A;  1FVH A;  5E75 A;  4C0M A;  3TWQ A;  4GZ5 A;  2OVF A;  3L9T A;  4CGV A;  2RG8 A;  4G8L A;  3RSE G;  4L2L A;  3WXX A;  2P58 C;  2FI7 A;  4K0R A;  1TJC A;  2Y4U A;  4NAC A;  4J0U A;  4WWP A;  4GA2 A;  2C0M A;  4U07 A;  1VDY A;  4TUM A;  5JHB A;  4WWO A;  2GRO B;  1SQM A;  3LY7 A;  4AXH A;  4MLP A;  1INZ A;  4HNA D;  4LEU A;  3U64 A;  2XGS A;  1SA5 A;  2VGX B;  1SA4 A;  5KCM A;  2XZT G;  1E8Y A;  4GYO A;  2VJ8 A;  5HKP A;  5CER B;  1V54 E;  3PH0 C;  5AEN A;  5D66 A;  4BFR A;  1GW6 A;  3R7R A;  4GA0 A;  2FF4 A;  3IHV A;  5EID A;  3L6A A;  4C0E A;  3PDN A;  4BWR A;  5KJN A;  4N39 A;  3T5V A;  2R2L A;  2B0O E;  1TNY A;  2WXH A;  3UT8 A;  1Z3Y A;  3UTM A;  3ESK A;  3GZ2 A;  4CDM A;  4WND A;  5JJ6 A;  3UM0 A;  1O1T A;  1H2U A;  3DSW A;  3T8K A;  1UJJ A;  2GGF A;  1FT2 A;  5J08 A;  4JW1 A;  4A63 B;  2XEH A;  2XEE A;  3CHS A;  4HFG A;  4WNG A;  1X5B A;  1HXI A;  3G2T A;  2XS1 A;  3PS6 A;  3ML9 A;  2LO6 A;  4RQI A;  1BI7 B;  2EQX A;  3MX3 A;  3UIP C;  4D10 C;  3FTY A;  3EJN A;  4BTA A;  4GYY A;  2JLB A;  1IHG A;  4URK A;  1OWN A;  1G3N B;  2Y0B G;  3BQO A;  4EZJ A;  2GW1 A;  1Y8M A;  2IQC A;  4FLB A;  2YHE A;  1Q2Z A;  3QK0 A;  4XEI G;  1MYO A;  4ILG A;  3Q78 A;  2KM4 A;  4JXT A;  1MX2 A;  3LJ3 A;  3RO3 A;  2WMN A;  4HI9 A;  4YVO A;  3CKC A;  4KBQ A;  3QWP A;  3MCX A;  1HFA A;  3LJN A;  3TWW A;  3ASN E;  4EZL A;  3L82 A;  4JHK A;  1JPL A;  2PL2 A;  2KCK A;  1E7U A;  4AP2 A;  3UM3 A;  1Z5S C;  4GZ6 A;  4Q96 A;  4I6E A;  4J8E A;  1WG0 A;  4GPK A;  2VQ2 A;  4U0U A;  4FJY A;  2ION A;  3JXJ A;  4DPR A;  4H7X A;  4ATZ D;  4ANW A;  3B7U X;  5HRY A;  4FAD A;  3ZGQ A;  2M63 A;  3UKR G;  5KJL A;  3DSV A;  2OND A;  3R9M A;  1OWO A;  1IQU A;  4L2Y A;  3AS5 A;  4I17 A;  1DCQ A;  3I5P A;  3FP3 A;  1LTX A;  3IKO B;  1MJ0 A;  3ONK A;  4GB9 A;  2EIL E;  2WB2 A;  2HM8 A;  2J09 A;  3DEO A;  2QYJ A;  3ASH A;  4GCO A;  2DCP A;  4HLE A;  1OUV A;  5JHA A;  5JJT A;  3HHM A;  1AWC B;  5CBO A;  3QKY A;  2KZT A;  4G26 A;  2Q7F A;  2VGY A;  3Q7A A;  4X8Q A;  2GRQ B;  2LXM A;  4U0S A;  4Q94 A;  4U8V D;  2VSO E;  3L16 A;  2P9S G;  3LVR E;  4U8H A;  4YDY A;  3AJI A;  4IUL A;  4IYP A;  2VSY A;  3MV3 B;  1BLX B;  2E2E A;  3V2O A;  4G24 A;  4AEZ C;  3I4R B;  4J7W A;  2RFA A;  3Q79 A;  1BD8 A;  3FUI A;  5BV0 A;  3G2U A;  2EIM E;  2ZIR A;  3SQV A;  3DEP A;  4BY6 A;  5HQ8 A;  4J8S A;  2YNQ A;  1HE8 A;  1PAQ A;  2I1K A;  4HRM B;  2LXL A;  3L17 A;  4XI0 A;  2MRI A;  4DJA A;  5HS0 A;  3FTU A;  3ZYK A;  4A3T A;  4WAF A;  3V31 A;  1K8K G;  5FQ4 A;  4LER A;  4APO A;  3FU6 A;  1E96 B;  3KEA A;  3I4G A;  1BU9 A;  4HOR A;  1K3Z D;  4NUR A;  1E8W A;  3CK9 A;  3CSF A;  3PNL B;  2PNN A;  2J4D A;  3AS8 A;  3BG0 B;  4RLY A;  4BX8 A;  3R7Q A;  4HBD A;  2PM7 A;  2KCL A;  3HVE B;  4Y6C A;  1XGW A;  5CRU A;  3TWT A;  1MQS A;  4U04 A;  2L6B A;  4LSZ E;  3SBT B;  1A17 A;  1WY6 A;  5ANL A;  1PC2 A;  1UG3 A;  2CFZ A;  2IFU A;  2QZA A;  3JXI A;  3TWU A;  3JYS A;  1WM5 A;  2OV8 A;  4UQX A;  5JMN D;  3APD A;  3L08 A;  1X81 A;  2QY7 A;  4CDN A;  4DK5 A;  3HG0 D;  4DX7 D;  3RU0 A;  3AU5 A;  5CMW A;  3PNT B;  3CHP A;  1N4P A;  4EBA G;  4LNG A;  2PZI A;  3F6Q A;  2P9N G;  2B6C A;  3UXG A;  4M3O A;  3B7T A;  3R9A B;  3CVX A;  4I43 A;  2WXM A;  4XKB A;  2V8S E;  2VYI A;  5AJL A;  3TXM A;  1O1R A;  5H7P A;  4PS8 A;  3SNX A;  3ASO E;  2X38 A;  3D9O A;  2LUH A;  2LAH A;  4N5Q A;  4XE0 A;  4Y6W A;  4RSY A;  1EPU A;  3LEW A;  5BW8 C;  5G04 C;  1XNF A;  2C0L A;  2XPY A;  3ULY A;  4DX1 A;  3PE4 A;  2L9B A;  4E85 A;  4EZK A;  3L54 A;  4DRX E;  2BED A;  2Y69 E;  3ZW3 A;  3O48 A;  3PZ3 A;  2NXP A;  4HS2 A;  3UPV A;  2KC7 A;  1N4R A;  5D2M C;  4UI9 K;  3B7B A;  4N3C A;  4O6F A;  3DRA A;  4F1S A;  3PZD A;  4F1P A;  4UI9 C;  4DI3 A;  4XZ4 A;  2XGM A;  3Q9N C;  2OCC E;  3CIA A;  4UWL A;  4TV3 A;  5CCM A;  3HXB A;  3D9P A;  1KZO A;  2WXJ A;  4U63 A;  3ENE A;  4A1S A;  1HH8 A;  5G05 C;  1S70 B;  3CVQ A;  4BTB A;  5KBA A;  5FQ6 A;  3DWL G;  2H6F A;  3PEU B;  4WNF A;  5AAR A;  3AAA C;  1JCS A;  3LY8 A;  3DXM G;  2OEV A;  3SD5 A;  4QQI A;  3Q9U C;  3CLJ A;  3D9J A;  3PRE A;  2R59 A;  1HU3 A;  2VTB A;  3DXK G;  5LFA A;  5BNW A;  2MHK A;  5CEA A;  1B89 A;  1EF1 C;  3JQ0 A;  5AQB A;  5FIN A;  1KPS B;  2OEW A;  3FUM A;  2ZXW E;  2HR2 A;  3Q7F A;  4I6J A;  4BER A;  2JAB A;  3FH8 A;  1TN7 A;  4HRL A;  3RJV A;  3DBS A;  1H6K A;  5FWQ A;  2X6K A;  3EIJ A;  3EU9 A;  4DLO A;  1U3C A;  2UWJ G;  2LAI A;  2ZU6 B;  5EIB E;  3CVN A;  1DC2 A;  3BUA A;  4CZ2 D;  3ONL A;  3V30 A;  4B89 A;  3ZIM A;  4KVO A;  2EIK E;  1N11 A;  1OXJ A;  3B95 A;  4QFV A;  2XZD G;  1UJK A;  4BEP A;  3ZUV B;  3FTV A;  4XKC A;  4MRU A;  4AOF A;  2X6J A;  3HXF A;  3B7S A;  4ILI A;  3BEE A;  3NOC D;  4HOS A;  5ITZ F;  3G2W A;  3DSS A;  4H7Y A;  4L9P A;  2CHW A;  4FHK A;  4F6R D;  2WXG A;  5ANR A;  4FHJ A;  1TR4 A;  3OAW A;  1S0P A;  4ZHB A;  3TL5 A;  4B94 A;  3SY2 A;  4F3V A;  2DYR E;  3MKQ B;  4JHR A;  2BKK B;  2A4Z A;  3EDT B;  3VTX A;  4HVB A;  5CHE E;  5CBN A;  4I6G A;  2AVP A;  2J4B A;  3E4B A;  1AP7 A;  1N4Q A;  1N95 A;  2X6F A;  4GTM A;  4K5A B;  3RKV A;  4HOT A;  2JEK A;  3OXL A;  1JCR A;  2X6H A;  3ZRH A;  2R05 A;  4I2Z A;  2FBN A;  4BET A;  4KZC A;  2I2O A;  3C98 A;  2I9C A;  2V5F A;  4KYO B;  1TEZ A;  1NA0 A;  2XEN A;  2R17 C;  3Q73 A;  5EKQ D;  3C5R A;  4GTS A;  5FT9 A;  3GYZ A;  4XX5 A;  5ENQ D;  4K5B A;  2E0I A;  3IBE A;  3N71 A;  3RAU A;  4ZFH A;  4J8Y A;  3QAR A;  4IRU A;  1EYH A;  4K03 A;  3FTW A;  3NZU A;  3PUK A;  4XI9 A;  3LS8 A;  3D9N A;  1OCR E;  2V0P A;  4HOQ A;  3UIN C;  3U3W A;  4G11 A;  2LNI A;  1WDY A;  3CK8 A;  2WQH A;  2Y3A A;  4CGW A;  3JCK C;  2J07 A;  3CVY A;  3U9W A;  5AN8 A;  2I1J A;  2FEZ A;  1TNO A;  3OXG A;  3ZEF A;  3FUK A;  2IF4 A;  1D8D A;  5FTP A;  1TNU A;  4HXI A;  3KD7 A;  4BES A;  3MGB A;  4TRQ A;  4AM9 A;  2MOW A;  5EX0 A;  5CEC B;  1N0R A;  2WXL A;  2IO3 C;  1OWP A;  1FT1 A;  5B1A E;  4JPS A;  2PM6 A;  3ISM C;  2GRM A;  4IN3 B;  1TN6 A;  2DYS E;  4O1P A;  3BU8 A;  2RD0 A;  4ME2 A;  3HXD A;  1ZBP A;  4EEC A;  1UN8 A;  4G2V A;  3D9L A;  4L23 A;  3LYA A;  4MKT A;  3ZHE A;  1H6P A;  4AY6 A;  3LY9 A;  2L6J A;  3EHM A;  3ASD A;  3LKU A;  2WM9 A;  3LVQ E;  4GTQ A;  5IY5 E;  1PY1 A;  3QB2 A;  4DI4 A;  3ZYQ A;  3FTS A;  3L13 A;  1JWF A;  3FEY A;  3NBN B;  3PZ4 A;  2IEJ A;  1WAO 1;  4AJW A;  1NL4 A;  3OTN A;  3DSU A;  1HS6 A;  3QOU A;  3E30 A;  3IHY A;  4B93 B;  3FH7 A;  4YDE A;  3ULE G;  2QC9 A;  2OOE A;  2NYJ A;  4GU5 A;  1L5J A;  2AW6 A;  2J49 A;  4K5C A;  4KXK B;  2BUG A;  3QC1 A;  3UI2 A;  2V4H C;  3PRZ A;  5HI7 A;  3VLD A;  5KJK A;  3FUD A;  2WXI A;  3ZN3 A;  4GMR A;  4UWG A;  4GTT A;  2VSN A;  3PUJ A;  5FJY A;  1EDU A;  3SZ7 A;  4EHM A;  5JJ7 A;  4C9B B;  2BTD A;  4UWF A;  4FP7 A;  5ENN A;  3V2X A;  2F0Y A;  2UY1 A;  4KT6 B;  1H0A A;  3U66 A;  3K9I A;  3P1U A;  3B13 A;  4JA9 A;  5T4Y A;  3ZXP A;  2BKG A;  5ENO D;  1QYM A;  3APC A;  1MX4 A;  3Q49 B;  4I1O B;  3UQ3 A;  3EIQ C;  1O1S A;  2X3M A;  2IU1 A;  3FTZ A;  2KZT B;  3VLF A;  4G1T A;  2WXP A;  4ACL A;  1IHB A;  1LD7 A;  1NP7 A;  5EYL A;  4ABN A;  4UUC A;  4EPZ A;  1YYH A;  4I2W A;  3KAE A;  3X2Q E;  3C3Q A;  3CVU A;  4ILH B;  5AQA A;  2P9P G;  2XGO A;  3QWV A;  2IJG X;  3FUE A;  1OCZ E;  2Y1L E;  4JC8 A;  4GTR A;  4JEH A;  2CFU A;  4ACK A;  4I1M A;  3FUH A;  4AVX A;  4J8D A;  3SFY A;  2FUL A;  2AXU A;  3FH5 A;  1H19 A;  2P9K G;  4FA6 A;  3FUL A;  2Y4T A;  5EX3 A;  1NFI E;  2R5S A;  2XCB A;  3APF A;  2DVW A;  2ETB A;  3DST A;  2LSV A;  4ATG A;  1S64 A;  3C3R A;  4JHJ A;  3URZ A;  4UQZ A;  3NQP A;  3PZ2 A;  4R7L A;  5B1B E;  4G23 A;  5LP0 A;  2RKK A;  3CVV A;  1H6O A;  1H2V C;  4AV7 A;  5KNG A;  4F53 A;  2AXV A;  3MKR A;  1ELW A;  1E90 A;  2ETA A;  3RK6 A;  3J5Q B;  3SBS A;  2DZO A;  1FPP A;  1LD8 A;  2QFC A;  3QNK A;  4U95 D;  3DPY A;  1IXV A;  1FCH A;  4HQD A;  2YHC A;  3SHF A;  1IKN D;  3GW4 A;  3ZKJ A;  3FUJ A;  3VLE A;  3AG4 E;  4LCT A;  4I1A A;  3B7R L;  4GA1 A;  5CED B;  4DLQ A;  2HYZ A;  3CHR A;  4XIF A;  2L0T B;  3QAQ A;  2F8Y A;  3FEX A;  3CGH A;  3S7D A;  3UT4 A;  3EHQ A;  3TWR A;  2J08 A;  2F8X K;  5FZR A;  3UX4 A;  2KCV A;  4MS6 A;  5KNH D;  1H2T C;  1OWL A;  2WXF A;  5ARG A;  3DPD A;  4JD2 G;  3LCA A;  2BF0 X;  5C2Y A;  2IOS A;  4HB5 A;  5E76 A;  1QQE A;  3CEQ A;  3QJZ A;  2XHE A;  3FWV A;  3E37 A;  3CK7 A;  3ZXS A;  3O4Z A;  4J8F A;  2X6I A;  2ILR A;  4GAA A; 
#chains in the Genus database with same CATH homology
 1KPS B;  2GRQ B;  2IY0 C;  3UIO C;  3UIP C;  2GRP B;  2GRN B;  3UIN C;  2GRO B;  2IO3 C;  2IO2 C;  5D2M C;  2GRR B;  1Z5S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...