2IY0C

Senp1 (mutant) sumo1 rangap
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase activator
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
total genus 57
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2iy0C00
2GRRB 5D2MC 2GRPB 2GRQB 3UIPC 3UIOC 2GRNB 2IO2C 2GROB 1KPSB 3UINC 2IY0C 2IO3C 1Z5SC
chains in the Genus database with same CATH superfamily
4M3OA 3FUEA 2BF0X 3IBEA 3QWPA 3ZPJA 3JQ1A 3L82A 3FULA 2GRLA 4BEPA 2IO3C 5HQ8A 1NA0A 3J5PA 5AQAA 4N3AA 1ZU2A 3UM3A 3G2UA 2JABA 2X38A 3MKQB 3JUIA 4OAVB 4LNBA 3U66A 3QWWA 3ZXPA 3MX3A 2CHZA 4GTOA 5ENQD 3UUXA 3NZUA 4KZCA 4UI9J 4BTAA 2GRPB 2VGXA 2Y4UA 3AJIA 2I9CA 3UM2A 1WDYA 4XI9A 3FU5A 2ZGGA 3FDHA 1DVPA 4XEIG 4ILHB 4DLOA 1SZ9A 3DPYA 2Y0BG 3L16A 2P9NG 2JEKA 1D8EA 2EIKE 1SA5A 4DX6D 3OTNA 4K03A 1FVHA 3VTXA 4RVBA 3HXEA 1FT2A 2PZIA 3QAQA 4B8CB 3FTXA 4J6IA 2WXPA 4A63B 1JPLA 2IONA 4I6EA 4NRHB 2WXOA 5AQ9A 3S7DA 1HZ4A 4BSZB 1S64A 1UOHA 2DBAA 3LPZA 3RRMB 4G24A 3HXFA 3L54A 4HRLA 3FUHA 2HE0A 2FBNA 3HVEB 1E8WA 1NZNA 3FU0A 3L6AA 1HFAA 3LCAA 4LUNU 1OCZE 2P2CP 4C0MA 3RO3A 2R02A 4BX8A 2GGFA 4OVVA 1IQUA 5CCLA 4RQIA 5CRVA 4K5CA 1U3DA 5D0QD 5ENOD 3AG4E 4Y6WA 5AN8A 4F53A 3K9IA 2B6CA 1SQMA 3LVQE 1QBQA 4TXRA 1OCCE 4DRXE 4JXTA 3FHEA 5LFAA 3OXLA 1X5BA 5EN5D 1HO8A 3SZ7A 4G8LA 4AIFA 4CZ2D 2PM7A 2YQ8A 5CCMA 2FO1E 2C0LA 2FF4A 2WVIA 4HI9A 4PS8A 4B89A 1IKND 3MV2B 3U3WA 4O60A 4N39A 3ABME 1N4PA 1U2VG 2F37A 3PEUB 4WUYA 3ZN3A 4JL0A 3JXIA 4Q69A 3TG5A 1S70B 3UM1A 4U8HA 3UINC 3DSVA 1O1SA 4FC8A 3AAAC 5G04C 3AG1E 2IF4A 3PUKA 2XGSA 3PE3A 3ABKE 3WXXA 4IN3B 4XX5A 1QQEA 3FUDA 5EILA 3HRAA 2FO7A 4FLBA 3CVPA 2NXPA 3FH5A 4AVXA 1N4SA 2EIME 1OXJA 4KVMA 2BEDA 4DX1A 4TXPA 1LTXA 3PZ3A 3L13A 3GZ2A 3ML8A 4FHJA 4Q94A 3ULEG 4ZHBA 2DZOA 2FI7A 4PS7A 3ULYA 2GRNB 4N2SA 3NF1A 4BERA 1H2UA 3V31A 4L2LA 1H0AA 3LS8A 3RJVA 2KCVA 4KBQA 5AQ7A 4KZ0A 4A55A 4XIFA 4JEHA 2BTDA 4GZDA 3IXEA 1WG0A 3TWTA 2X6JA 5FIOA 2A5EA 4IYPA 3Q75A 3CVUA 3PE4A 1AP7A 5E75A 1TN8A 3OAWA 4LG6A 2VSYA 2XPZA 3EIJA 3QDNA 4G25A 4HOSA 3QKYA 2V8SE 2PL2A 3D9JA 1H6OA 1MX6A 4YDOA 3LY8A 1K1AA 3T5VA 5KBAA 3NOGD 3JXJA 2IU1A 3NAWA 5BPPA 3Q9UC 2IOLA 2VGXB 3BEEA 3C3RA 3KD7A 4GAAA 2WQ6A 4I6JA 3WG7E 2F8XK 4DX5D 3CQGB 2XHEA 3HIZA 2V4HC 1OY3D 3RU0A 4B93B 3AU4A 2J9QA 5EYLA 5BXOA 3MKRA 5AIJA 4RG9A 3PZDA 2IJGX 4DX2A 4TV3A 2GROB 4B0ZA 3V79K 4O1PA 4HVBA 4AXHA 5IY5E 3T9KA 2V4LA 2R17C 1W3BA 1KZOA 5KJMA 4GA0A 3R9AB 3QJZA 4TRQA 3CVLA 1IXVA 1PY1A 3TWUA 3VLDA 4AY6A 1TYQG 3ZFWA 5LCWC 3ZHEA 3RK6A 2Y69E 4ATGA 4WNDA 2BUGA 4XKCA 3MGBA 1SVXA 3JUEA 4HFGA 2R5SA 3LKUA 1OWMA 2DYRE 5DIZA 1ZB1A 4GB9A 4U95D 3G2WA 1ELWA 2LO6A 2XZDG 3IEGA 5DBKA 4H7XA 5CMWA 4G26A 2XEVA 5JJ6A 4ANWA 5BT1A 5JJ7A 5J90A 3B7TA 4U07A 3CLJA 1OUVA 4HORA 2A4ZA 3U9WA 1H6PA 4MKTA 3C5RA 1UN8A 3D9NA 3TWQA 4NACA 2BKKB 3T8KA 1NA3A 2WXHA 1Q2ZA 3Q9NC 3CR3A 3NQPA 5FZRA 3N71A 5EKQD 3FTYA 3FUNA 3CK8A 4I1OB 1JCSA 3CVNA 4KXKB 2E0IA 4A3TA 4CEMA 3ASNE 1IQRA 4U8VD 1OCRE 4GMJA 3UIOC 4K5AB 4HB5A 2H6HA 1BPOA 2UWJG 5FINA 1N4QA 1HU3A 3ASGA 1S0PA 4HI8A 5D0OD 2YINA 3S2AA 2R03A 5JJTA 3ZEFA 4UWGA 4JB8P 3E30A 3JCKC 4EZLA 4JD2G 4CDRA 3SBTB 3HYMB 5A7DB 2JLBA 5EDSA 5CHEE 3LJ3A 2MOWA 4L23A 4JW1A 4GA2A 4GTQA 3PNTB 3ENEA 3C72A 4U8YD 4KMOA 4O6FA 3P2BA 4GU5A 3URZA 3SNXA 4N3CA 5B3SE 4D10C 4Q96A 4J0UA 1BI7B 3FEYA 3UT8A 3F6QA 3TXMA 4HRMB 4J8EA 4K0RA 3CQCB 3CHQA 5M72A 2HO1A 3UKRG 4F7AA 4J8FA 4GTTA 4JPSA 4U04A 3FTVA 4ANXA 3QOUA 4GMLA 2R59A 2J4BA 4LNGA 1A17A 4A1SA 1TN7A 3PDNA 4V3IA 4PS3A 5KWDA 1QYMA 4X8QA 2A5UA 2LAHA 2NSZA 5B1BE 2RKKA 2XGOA 4CYMD 4EQFA 5BW8C 3AG3E 3FH8A 2WXLA 3BQOA 3CIAA 3O4ZA 3SY2A 3ESLA 4IULA 3EIQC 3DSTA 3Q79A 3PREA 4JHRA 4B8AA 4BX9A 3FU3A 4CGWA 2F0YA 3JQ0A 2GRMA 2RFAA 1HG5A 3EJNA 4UQYA 4JA7A 4I2WA 2AVPA 3TWVA 4YVQC 2P9PG 3TAXA 3U64A 1HF8A 1XGWA 4GMRA 5G2NA 5FQ8A 2KM4A 1N54A 3DSXA 4I9CA 2I1JA 2KC7A 5C2YA 4QFVA 3Q78A 3I4GA 3ASFA 1YA0A 3EU5A 3PVLA 2ZIRA 1TN6A 5JA4D 3G2VA 3DSUA 1E7UA 5FJYA 2J07A 4FLHA 3OXGA 4ME2A 3ZKJA 2XCCA 2DIWA 2QYUA 3APDA 1E8YA 2AXUA 3CHPA 5JMND 4XE0A 3P1UA 3ASDA 3S7JA 5AJDA 3AS8A 3CHRA 4AV7A 5EX3A 3RIBA 3VLEA 3DEPA 4GZCA 3D9LA 2YNQA 4I2ZA 4DI3A 2M63A 2RG8A 3ZVVA 1OWLA 1OWPA 1TNOA 1G3NB 2VGEA 3IHYA 1NL4A 4BY6A 3ZYMA 1N95A 2F8YA 4UUCA 2EILE 3D9OA 1H2VC 3FP3A 3D3MA 3NOCD 3VTYA 4DPRA 3D9MA 1ZBPA 2CFZA 1OT8A 3FU6A 1WY6A 2BKGA 5C1DA 2OVFA 3B95A 2EINE 1D9SA 3PS6A 2FEZA 3KAEA 4L7TA 1B89A 2P9UG 4DX7D 4B94A 1IHGA 3FUJA 4LERA 2XPYA 3RRUA 2P58C 3MKQA 3E32A 3TWRA 4GPKA 1ELKA 2ZU6B 3HXBA 2ETBA 1HH8A 3RO2A 1OCOE 2VTBB 3ONLA 2ZXWE 3I5PA 3ISMC 2OOEA 3Q4AB 1MHQA 2VJ8A 3ZIMA 3LY9A 4URKA 5JHBA 3NZSA 3FUKA 4EECA 3MZLB 2WXFA 4AM9A 1K8KG 5KJLA 2OV8A 3CKCA 1L5JA 2UY1A 1JWGA 3KSLA 3DSWA 3CVXA 3LDZA 3SF4A 3TWSA 3FUMA 4NURA 4ANVA 3ASHA 2WXMA 2X6IA 3D9PA 3CSFA 2AXZA 4CRWA 2H6IA 3J5QB 3QNKA 4TUUA 4BETA 4I43A 4YNDA 4DK5A 1DNPA 2LXLA 1TNUA 2LUHA 3DSSA 3IV0A 2LXMA 2HM8A 1MX4A 3B13A 5FQ6A 2WXQA 4EHMA 2PQNA 3I4RB 3E33A 4C48B 2WMOA 4I1MA 3LXUX 4CDNA 1PC2A 3SFXA 1EYHA 2V5FA 5D2MC 2L6JA 2Y4TA 1RZ4A 2LNIA 4G23A 1JWFA 1MJ0A 3HVEA 4HOUA 4N3BA 2VGYA 2WM9A 1TNBA 2PM6A 3EHQA 3Q7FA 4JHJA 3APCA 3V2OA 2J09A 3IKOB 1BI8B 3PZ1A 4HOTA 1YYHA 4NIKA 1N11A 5LX8A 1YMPA 3ML9A 1DCQA 1E8XA 1UJJA 3QARA 4HXIA 2EQXA 1BLXB 5CERB 1Z6TA 2IO2C 2WXGA 4U96D 3BG0B 3FTSA 4F3VA 2IEJA 5FTPA 1FT1A 4YDWA 1UW4B 5H7PA 3D9HA 4DUIA 5CECB 4LNUD 4I17A 3FY4A 3ASOE 4ANUA 4OYSA 3RAUA 2L6BA 3EHNA 3EHRA 4JA9A 4BSXA 4FULA 1EF1C 1VDYA 2RD0A 1N9AA 3UKUG 2KCKA 1JCQA 4WAFA 4RLYA 4HBDA 3S7FA 2I6HA 3QK0A 4N5CA 4EBAG 3QC1A 1KZPA 4JHKA 3ZNGA 2R2LA 3DXKG 5ENTD 1D8DA 5FT9A 4ILIA 5FQ4A 3CEQA 3B7UX 3UQ3A 3TGOA 3FTZA 4N5QA 3PNLB 4WNFA 4RG6A 4YVOA 3HG0D 3TWWA 3SBSA 4HRNA 4UQXA 3UIPC 3QB2A 1U3CA 4F1PA 1TNZA 2J8SD 1E90A 4ATZD 4C0EA 5ARFA 2FULA 4HNAD 3ZW3A 4GTRA 3UPVA 2DCPA 3CSTA 2WQ7A 1O1RA 1V54E 1NFIE 4XKBA 4K5BA 1MQSA 3KEZA 3ZYKA 1WAO1 5BNWA 1EDUA 5T8IA 4GTVA 1K3ZD 3L22A 2ILRA 2XRYA 3SGHA 2WXKA 1TEZA 3L17A 2XS8A 2L9BA 3Q47B 1TJFA 5KJKA 2Y3AA 4ABNA 4JZYA 1INZA 1HS6A 4UQZA 4AEZC 1MZCA 5ANLA 2V5QC 2VSXE 3BU8A 5FZQA 4LCTA 2LSUA 4HLEA 2QY7A 4QQIA 3B7BA 1H6KA 2VYIA 2YHEA 1FPPA 4RSYA 3FTUA 4I1AA 4E6HA 3OXFA 3CVVA 1LD7A 2H6FA 3EDTB 2WB2A 5KNHD 1P5QA 3UM0A 5JHAA 4I9EA 1X81A 3AG2E 3CVWA 2P9KG 1LD8A 2C0MA 4KYOB 1Y6IA 4L2YA 3ZU7B 3NB2A 4HLLA 5G04J 4CCAA 4BTBA 3CV0A 2I1KA 3ONKA 4GZ3A 3MV3B 5KCMA 1KT0A 3RRNB 3E37A 4NQ0A 3CHMA 2AJAA 5BUZA 4FU3A 3G2SA 3E34A 1N0RA 5KNGA 3W9FA 4L1BA 3GYZA 2ZISA 4JC8A 5EIBE 2I2OA 1GW6A 1V55E 2VQ2A 1MX2A 3TXNA 4P29A 4UI9K 4AJWA 2E2EA 1HX8A 1O5MA 5CBOA 3LY7A 2AXVA 5CBNA 4FJZA 2OVBA 4FA6A 4G8KA 4WWNA 2J49A 5ENPD 1TJCA 2X6HA 2C2LA 2HYZA 3MA5A 3B7SA 5HRYA 3APFA 1KPSB 2RFMA 2WXRA 3ABLE 4C9BB 3RKVA 2X6FA 3V30A 1AWCB 4AY5A 1N0QA 3SO8A 1FCHA 2WXNA 4YDEA 1HE8A 2GW1A 5AJLA 2IY0C 4GZ5A 3UI2A 2DVWA 3CGHA 3ULQA 3FH7A 3CHOA 4GPMA 4J8DA 4H7YA 4PUCA 4WNGA 5ARGA 1N52A 2ETAA 4ILGA 3R9MA 3JYSA 1KLXA 1XNFA 3RSEG 2QZAA 5G05C 3E4BA 3ZUVB 3ZHEB 1SZAA 1MYOA 2XCBA 4WWOA 3MYVA 4DLQA 5ENNA 2WPVA 1HXIA 5ENSD 5EIDA 4AOFA 3Q49B 2P9LG 3O48A 3ESKA 2LSVA 2ONDA 4A3VA 2XZTG 3FTWA 1IYGA 1DC2A 5BXUA 3C98A 3GZSA 2X6KA 3ZGQA 4F6RD 4LSZE 4I6GA 2CG3A 3Q73A 4ACLA 2VSNA 3AU5A 2KZTB 3LYAA 2XRZA 2CHWA 5G05J 3R7QA 4EZJA 3FWVA 1E96B 4J8SA 3UTMA 5HKPA 3UX4A 5FWQA 2P9SG 4ZFHA 3PEVB 4M7CA 4GA1A 3KS2A 1DCEA 4PDXA 5BV0A 2HR2A 4O1OA 3BG1B 3X2QE 4G2VA 2MRIA 4CT0A 2Q7FA 5ITZF 4ACKA 3TG4A 2P9IG 2XGMA 2J4DA 2XEHA 3HHMA 5T3RA 1BD8A 3CVYA 4GTSA 4FADA 3FUFA 2MHKA 4GTMA 5KJNA 1JUQA 3DEOA 4APOA 4TUMA 3AS4A 3KSQA 1Z3YA 5B1AE 1E7VA 1H19A 4E85A 4JVSA 3EHMA 4XI0A 5J08A 4WWPA 2KCLA 3D9IA 1BU9A 4U0SA 2YHCA 3DRAA 4R7LA 3CK7A 3LVRE 1QNFA 2NC9A 4LEUA 5CMYA 4AP2A 5A6CA 2IFUA 1Z5SC 4XZ4A 5D66A 4WNEA 4UWKA 4UWLA 4J7WA 1N94A 4YDYA 3CVQA 2L0TB 4DI4A 1WM5A 3GW4A 4UWHA 2IQCA 2Y1LE 2ETCA 4PH4B 2KZTA 4OAUC 1SW6A 1E8ZA 4APFA 5ANRA 4HS2A 3T8MA 3MCXA 3U4TA 3Q7AA 2QFCA 4GYOA 4BT9A 2OCCE 5T4YA 5AAOA 4CDMA 3CK9A 3L08A 3R7RA 5CEAA 2CHXA 3GZ1A 3UMVA 3EUVA 4MS6A 4DJAA 3DPDA 2UY1B 3SFYA 1UG3A 2X3MA 2GRQB 1TNYA 4TXQA 4IRUA 3FEXA 2V0PA 4GYWA 3SQVA 3VLFA 4JEUA 4BT8A 4CGVA 3BUAA 4KVOA 3PH0C 4U7EB 2AWIA 4MLPA 4BFRA 1OWOA 3W9GA 4BESA 2XENA 4UI9C 5CEDB 5AENA 4U0ZA 4FP7A 1UJKA 2AW6A 3T5XA 4L9PA 1ELRA 2H6GA 4HOQA 5HI7A 1QZ2A 1YCSB 1N4RA 2VSOE 2OEVA 3HXDA 3MEKA 4GCOA 2XPIA 3TJPA 2B0OE 5AARA 3S7BA 3Q15A 4N2QA 3LJNA 1HG2A 5ENRD 5HS0A 4CT4A 3SFZA 3PZ4A 3SI5A 2WQHA 4G1TA 4GTPA 1NI1A 2EIJE 3L9TA 3TWXA 2QYJA 2L0IA 2ZGDA 2PNNA 3LEWA 3QWVA 3AS5A 3D9KA 3SD5A 1SA4A 2R05A 2WXJA 1Z3XA 3C3OA 2QC9A 4U0UA 3CHSA 2XEEA 5LOZA 2PQRA 1RW2A 2WXIA 3ZYQA 4GYYA 5LCWJ 1TR4A 4FHKA 1IHBA 5G55A 1LF8A 3I3NA 3B7RL 5AQBA 3C3QA 2KBXA 5AYWD 2CFUA 2VTBA 3ZYLA 3TL5A 3HXCA 1NP7A 5BV1A 3ZXSA 3ZRHA 3NBNB 5E76A 3HDXA 2OEWA 3G2TA 4BWRA 2LAIA 4HQDA 1PAQA 5CRUA 2MYOA 4EPZA 1KT1A 1EPUA 3IHVA 4J8YA 3PZ2A 5EX0A 1JCRA 4UWFA 4KT6B 3KEAA 1UN9A 5A23A 5EYPF 3PUJA 2GRRB 2XQ0A 3CKBA 4MRUA 4Y6CA 2J08A 3FFLA 4Z68A 1OWNA 4W9RA 3PRZA 4EZKA 3UT7A 4GZ6A 2NYJA 3SHFA 4FJYA 4F1SA 2IOSA 1FVFA 5LP0A 3UXGA 4OVUA 2KATA 1Y8MA 5FZSA 3MJWA 3UT4A 1A5EA 3DWLG 4EBAA 1H2TC 3V2XA 2DZNA 4LRZA 2WMNA 4MBGA 4A1GA 1O1TA 3EU9A 2CG2A 3DBSA 2DWZA 3FUIA 3Q5MA 4U63A 5FQ7A 2DYSE 3DXMG 1K1BA 2XS1A 1S63A 2KXPC 4G11A 4GCNA
chains in the Genus database with same CATH topology
2GRRB 5D2MC 2GRPB 2GRQB 3UIPC 3UIOC 2GRNB 2IO2C 2GROB 1KPSB 3UINC 2IY0C 2IO3C 1Z5SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRR B;  5D2M C;  2GRP B;  2GRQ B;  3UIP C;  3UIO C;  2GRN B;  2IO2 C;  2GRO B;  1KPS B;  3UIN C;  2IY0 C;  2IO3 C;  1Z5S C; 
#chains in the Genus database with same CATH topology
 4M3O A;  3FUE A;  2BF0 X;  3IBE A;  3QWP A;  3ZPJ A;  3JQ1 A;  3L82 A;  3FUL A;  2GRL A;  4BEP A;  2IO3 C;  5HQ8 A;  1NA0 A;  3J5P A;  5AQA A;  4N3A A;  1ZU2 A;  3UM3 A;  3G2U A;  2JAB A;  2X38 A;  3MKQ B;  3JUI A;  4OAV B;  4LNB A;  3U66 A;  3QWW A;  3ZXP A;  3MX3 A;  2CHZ A;  4GTO A;  5ENQ D;  3UUX A;  3NZU A;  4KZC A;  4UI9 J;  4BTA A;  2GRP B;  2VGX A;  2Y4U A;  3AJI A;  2I9C A;  3UM2 A;  1WDY A;  4XI9 A;  3FU5 A;  2ZGG A;  3FDH A;  1DVP A;  4XEI G;  4ILH B;  4DLO A;  1SZ9 A;  3DPY A;  2Y0B G;  3L16 A;  2P9N G;  2JEK A;  1D8E A;  2EIK E;  1SA5 A;  4DX6 D;  3OTN A;  4K03 A;  1FVH A;  3VTX A;  4RVB A;  3HXE A;  1FT2 A;  2PZI A;  3QAQ A;  4B8C B;  3FTX A;  4J6I A;  2WXP A;  4A63 B;  1JPL A;  2ION A;  4I6E A;  4NRH B;  2WXO A;  5AQ9 A;  3S7D A;  1HZ4 A;  4BSZ B;  1S64 A;  1UOH A;  2DBA A;  3LPZ A;  3RRM B;  4G24 A;  3HXF A;  3L54 A;  4HRL A;  3FUH A;  2HE0 A;  2FBN A;  3HVE B;  1E8W A;  1NZN A;  3FU0 A;  3L6A A;  1HFA A;  3LCA A;  4LUN U;  1OCZ E;  2P2C P;  4C0M A;  3RO3 A;  2R02 A;  4BX8 A;  2GGF A;  4OVV A;  1IQU A;  5CCL A;  4RQI A;  5CRV A;  4K5C A;  1U3D A;  5D0Q D;  5ENO D;  3AG4 E;  4Y6W A;  5AN8 A;  4F53 A;  3K9I A;  2B6C A;  1SQM A;  3LVQ E;  1QBQ A;  4TXR A;  1OCC E;  4DRX E;  4JXT A;  3FHE A;  5LFA A;  3OXL A;  1X5B A;  5EN5 D;  1HO8 A;  3SZ7 A;  4G8L A;  4AIF A;  4CZ2 D;  2PM7 A;  2YQ8 A;  5CCM A;  2FO1 E;  2C0L A;  2FF4 A;  2WVI A;  4HI9 A;  4PS8 A;  4B89 A;  1IKN D;  3MV2 B;  3U3W A;  4O60 A;  4N39 A;  3ABM E;  1N4P A;  1U2V G;  2F37 A;  3PEU B;  4WUY A;  3ZN3 A;  4JL0 A;  3JXI A;  4Q69 A;  3TG5 A;  1S70 B;  3UM1 A;  4U8H A;  3UIN C;  3DSV A;  1O1S A;  4FC8 A;  3AAA C;  5G04 C;  3AG1 E;  2IF4 A;  3PUK A;  2XGS A;  3PE3 A;  3ABK E;  3WXX A;  4IN3 B;  4XX5 A;  1QQE A;  3FUD A;  5EIL A;  3HRA A;  2FO7 A;  4FLB A;  3CVP A;  2NXP A;  3FH5 A;  4AVX A;  1N4S A;  2EIM E;  1OXJ A;  4KVM A;  2BED A;  4DX1 A;  4TXP A;  1LTX A;  3PZ3 A;  3L13 A;  3GZ2 A;  3ML8 A;  4FHJ A;  4Q94 A;  3ULE G;  4ZHB A;  2DZO A;  2FI7 A;  4PS7 A;  3ULY A;  2GRN B;  4N2S A;  3NF1 A;  4BER A;  1H2U A;  3V31 A;  4L2L A;  1H0A A;  3LS8 A;  3RJV A;  2KCV A;  4KBQ A;  5AQ7 A;  4KZ0 A;  4A55 A;  4XIF A;  4JEH A;  2BTD A;  4GZD A;  3IXE A;  1WG0 A;  3TWT A;  2X6J A;  5FIO A;  2A5E A;  4IYP A;  3Q75 A;  3CVU A;  3PE4 A;  1AP7 A;  5E75 A;  1TN8 A;  3OAW A;  4LG6 A;  2VSY A;  2XPZ A;  3EIJ A;  3QDN A;  4G25 A;  4HOS A;  3QKY A;  2V8S E;  2PL2 A;  3D9J A;  1H6O A;  1MX6 A;  4YDO A;  3LY8 A;  1K1A A;  3T5V A;  5KBA A;  3NOG D;  3JXJ A;  2IU1 A;  3NAW A;  5BPP A;  3Q9U C;  2IOL A;  2VGX B;  3BEE A;  3C3R A;  3KD7 A;  4GAA A;  2WQ6 A;  4I6J A;  3WG7 E;  2F8X K;  4DX5 D;  3CQG B;  2XHE A;  3HIZ A;  2V4H C;  1OY3 D;  3RU0 A;  4B93 B;  3AU4 A;  2J9Q A;  5EYL A;  5BXO A;  3MKR A;  5AIJ A;  4RG9 A;  3PZD A;  2IJG X;  4DX2 A;  4TV3 A;  2GRO B;  4B0Z A;  3V79 K;  4O1P A;  4HVB A;  4AXH A;  5IY5 E;  3T9K A;  2V4L A;  2R17 C;  1W3B A;  1KZO A;  5KJM A;  4GA0 A;  3R9A B;  3QJZ A;  4TRQ A;  3CVL A;  1IXV A;  1PY1 A;  3TWU A;  3VLD A;  4AY6 A;  1TYQ G;  3ZFW A;  5LCW C;  3ZHE A;  3RK6 A;  2Y69 E;  4ATG A;  4WND A;  2BUG A;  4XKC A;  3MGB A;  1SVX A;  3JUE A;  4HFG A;  2R5S A;  3LKU A;  1OWM A;  2DYR E;  5DIZ A;  1ZB1 A;  4GB9 A;  4U95 D;  3G2W A;  1ELW A;  2LO6 A;  2XZD G;  3IEG A;  5DBK A;  4H7X A;  5CMW A;  4G26 A;  2XEV A;  5JJ6 A;  4ANW A;  5BT1 A;  5JJ7 A;  5J90 A;  3B7T A;  4U07 A;  3CLJ A;  1OUV A;  4HOR A;  2A4Z A;  3U9W A;  1H6P A;  4MKT A;  3C5R A;  1UN8 A;  3D9N A;  3TWQ A;  4NAC A;  2BKK B;  3T8K A;  1NA3 A;  2WXH A;  1Q2Z A;  3Q9N C;  3CR3 A;  3NQP A;  5FZR A;  3N71 A;  5EKQ D;  3FTY A;  3FUN A;  3CK8 A;  4I1O B;  1JCS A;  3CVN A;  4KXK B;  2E0I A;  4A3T A;  4CEM A;  3ASN E;  1IQR A;  4U8V D;  1OCR E;  4GMJ A;  3UIO C;  4K5A B;  4HB5 A;  2H6H A;  1BPO A;  2UWJ G;  5FIN A;  1N4Q A;  1HU3 A;  3ASG A;  1S0P A;  4HI8 A;  5D0O D;  2YIN A;  3S2A A;  2R03 A;  5JJT A;  3ZEF A;  4UWG A;  4JB8 P;  3E30 A;  3JCK C;  4EZL A;  4JD2 G;  4CDR A;  3SBT B;  3HYM B;  5A7D B;  2JLB A;  5EDS A;  5CHE E;  3LJ3 A;  2MOW A;  4L23 A;  4JW1 A;  4GA2 A;  4GTQ A;  3PNT B;  3ENE A;  3C72 A;  4U8Y D;  4KMO A;  4O6F A;  3P2B A;  4GU5 A;  3URZ A;  3SNX A;  4N3C A;  5B3S E;  4D10 C;  4Q96 A;  4J0U A;  1BI7 B;  3FEY A;  3UT8 A;  3F6Q A;  3TXM A;  4HRM B;  4J8E A;  4K0R A;  3CQC B;  3CHQ A;  5M72 A;  2HO1 A;  3UKR G;  4F7A A;  4J8F A;  4GTT A;  4JPS A;  4U04 A;  3FTV A;  4ANX A;  3QOU A;  4GML A;  2R59 A;  2J4B A;  4LNG A;  1A17 A;  4A1S A;  1TN7 A;  3PDN A;  4V3I A;  4PS3 A;  5KWD A;  1QYM A;  4X8Q A;  2A5U A;  2LAH A;  2NSZ A;  5B1B E;  2RKK A;  2XGO A;  4CYM D;  4EQF A;  5BW8 C;  3AG3 E;  3FH8 A;  2WXL A;  3BQO A;  3CIA A;  3O4Z A;  3SY2 A;  3ESL A;  4IUL A;  3EIQ C;  3DST A;  3Q79 A;  3PRE A;  4JHR A;  4B8A A;  4BX9 A;  3FU3 A;  4CGW A;  2F0Y A;  3JQ0 A;  2GRM A;  2RFA A;  1HG5 A;  3EJN A;  4UQY A;  4JA7 A;  4I2W A;  2AVP A;  3TWV A;  4YVQ C;  2P9P G;  3TAX A;  3U64 A;  1HF8 A;  1XGW A;  4GMR A;  5G2N A;  5FQ8 A;  2KM4 A;  1N54 A;  3DSX A;  4I9C A;  2I1J A;  2KC7 A;  5C2Y A;  4QFV A;  3Q78 A;  3I4G A;  3ASF A;  1YA0 A;  3EU5 A;  3PVL A;  2ZIR A;  1TN6 A;  5JA4 D;  3G2V A;  3DSU A;  1E7U A;  5FJY A;  2J07 A;  4FLH A;  3OXG A;  4ME2 A;  3ZKJ A;  2XCC A;  2DIW A;  2QYU A;  3APD A;  1E8Y A;  2AXU A;  3CHP A;  5JMN D;  4XE0 A;  3P1U A;  3ASD A;  3S7J A;  5AJD A;  3AS8 A;  3CHR A;  4AV7 A;  5EX3 A;  3RIB A;  3VLE A;  3DEP A;  4GZC A;  3D9L A;  2YNQ A;  4I2Z A;  4DI3 A;  2M63 A;  2RG8 A;  3ZVV A;  1OWL A;  1OWP A;  1TNO A;  1G3N B;  2VGE A;  3IHY A;  1NL4 A;  4BY6 A;  3ZYM A;  1N95 A;  2F8Y A;  4UUC A;  2EIL E;  3D9O A;  1H2V C;  3FP3 A;  3D3M A;  3NOC D;  3VTY A;  4DPR A;  3D9M A;  1ZBP A;  2CFZ A;  1OT8 A;  3FU6 A;  1WY6 A;  2BKG A;  5C1D A;  2OVF A;  3B95 A;  2EIN E;  1D9S A;  3PS6 A;  2FEZ A;  3KAE A;  4L7T A;  1B89 A;  2P9U G;  4DX7 D;  4B94 A;  1IHG A;  3FUJ A;  4LER A;  2XPY A;  3RRU A;  2P58 C;  3MKQ A;  3E32 A;  3TWR A;  4GPK A;  1ELK A;  2ZU6 B;  3HXB A;  2ETB A;  1HH8 A;  3RO2 A;  1OCO E;  2VTB B;  3ONL A;  2ZXW E;  3I5P A;  3ISM C;  2OOE A;  3Q4A B;  1MHQ A;  2VJ8 A;  3ZIM A;  3LY9 A;  4URK A;  5JHB A;  3NZS A;  3FUK A;  4EEC A;  3MZL B;  2WXF A;  4AM9 A;  1K8K G;  5KJL A;  2OV8 A;  3CKC A;  1L5J A;  2UY1 A;  1JWG A;  3KSL A;  3DSW A;  3CVX A;  3LDZ A;  3SF4 A;  3TWS A;  3FUM A;  4NUR A;  4ANV A;  3ASH A;  2WXM A;  2X6I A;  3D9P A;  3CSF A;  2AXZ A;  4CRW A;  2H6I A;  3J5Q B;  3QNK A;  4TUU A;  4BET A;  4I43 A;  4YND A;  4DK5 A;  1DNP A;  2LXL A;  1TNU A;  2LUH A;  3DSS A;  3IV0 A;  2LXM A;  2HM8 A;  1MX4 A;  3B13 A;  5FQ6 A;  2WXQ A;  4EHM A;  2PQN A;  3I4R B;  3E33 A;  4C48 B;  2WMO A;  4I1M A;  3LXU X;  4CDN A;  1PC2 A;  3SFX A;  1EYH A;  2V5F A;  5D2M C;  2L6J A;  2Y4T A;  1RZ4 A;  2LNI A;  4G23 A;  1JWF A;  1MJ0 A;  3HVE A;  4HOU A;  4N3B A;  2VGY A;  2WM9 A;  1TNB A;  2PM6 A;  3EHQ A;  3Q7F A;  4JHJ A;  3APC A;  3V2O A;  2J09 A;  3IKO B;  1BI8 B;  3PZ1 A;  4HOT A;  1YYH A;  4NIK A;  1N11 A;  5LX8 A;  1YMP A;  3ML9 A;  1DCQ A;  1E8X A;  1UJJ A;  3QAR A;  4HXI A;  2EQX A;  1BLX B;  5CER B;  1Z6T A;  2IO2 C;  2WXG A;  4U96 D;  3BG0 B;  3FTS A;  4F3V A;  2IEJ A;  5FTP A;  1FT1 A;  4YDW A;  1UW4 B;  5H7P A;  3D9H A;  4DUI A;  5CEC B;  4LNU D;  4I17 A;  3FY4 A;  3ASO E;  4ANU A;  4OYS A;  3RAU A;  2L6B A;  3EHN A;  3EHR A;  4JA9 A;  4BSX A;  4FUL A;  1EF1 C;  1VDY A;  2RD0 A;  1N9A A;  3UKU G;  2KCK A;  1JCQ A;  4WAF A;  4RLY A;  4HBD A;  3S7F A;  2I6H A;  3QK0 A;  4N5C A;  4EBA G;  3QC1 A;  1KZP A;  4JHK A;  3ZNG A;  2R2L A;  3DXK G;  5ENT D;  1D8D A;  5FT9 A;  4ILI A;  5FQ4 A;  3CEQ A;  3B7U X;  3UQ3 A;  3TGO A;  3FTZ A;  4N5Q A;  3PNL B;  4WNF A;  4RG6 A;  4YVO A;  3HG0 D;  3TWW A;  3SBS A;  4HRN A;  4UQX A;  3UIP C;  3QB2 A;  1U3C A;  4F1P A;  1TNZ A;  2J8S D;  1E90 A;  4ATZ D;  4C0E A;  5ARF A;  2FUL A;  4HNA D;  3ZW3 A;  4GTR A;  3UPV A;  2DCP A;  3CST A;  2WQ7 A;  1O1R A;  1V54 E;  1NFI E;  4XKB A;  4K5B A;  1MQS A;  3KEZ A;  3ZYK A;  1WAO 1;  5BNW A;  1EDU A;  5T8I A;  4GTV A;  1K3Z D;  3L22 A;  2ILR A;  2XRY A;  3SGH A;  2WXK A;  1TEZ A;  3L17 A;  2XS8 A;  2L9B A;  3Q47 B;  1TJF A;  5KJK A;  2Y3A A;  4ABN A;  4JZY A;  1INZ A;  1HS6 A;  4UQZ A;  4AEZ C;  1MZC A;  5ANL A;  2V5Q C;  2VSX E;  3BU8 A;  5FZQ A;  4LCT A;  2LSU A;  4HLE A;  2QY7 A;  4QQI A;  3B7B A;  1H6K A;  2VYI A;  2YHE A;  1FPP A;  4RSY A;  3FTU A;  4I1A A;  4E6H A;  3OXF A;  3CVV A;  1LD7 A;  2H6F A;  3EDT B;  2WB2 A;  5KNH D;  1P5Q A;  3UM0 A;  5JHA A;  4I9E A;  1X81 A;  3AG2 E;  3CVW A;  2P9K G;  1LD8 A;  2C0M A;  4KYO B;  1Y6I A;  4L2Y A;  3ZU7 B;  3NB2 A;  4HLL A;  5G04 J;  4CCA A;  4BTB A;  3CV0 A;  2I1K A;  3ONK A;  4GZ3 A;  3MV3 B;  5KCM A;  1KT0 A;  3RRN B;  3E37 A;  4NQ0 A;  3CHM A;  2AJA A;  5BUZ A;  4FU3 A;  3G2S A;  3E34 A;  1N0R A;  5KNG A;  3W9F A;  4L1B A;  3GYZ A;  2ZIS A;  4JC8 A;  5EIB E;  2I2O A;  1GW6 A;  1V55 E;  2VQ2 A;  1MX2 A;  3TXN A;  4P29 A;  4UI9 K;  4AJW A;  2E2E A;  1HX8 A;  1O5M A;  5CBO A;  3LY7 A;  2AXV A;  5CBN A;  4FJZ A;  2OVB A;  4FA6 A;  4G8K A;  4WWN A;  2J49 A;  5ENP D;  1TJC A;  2X6H A;  2C2L A;  2HYZ A;  3MA5 A;  3B7S A;  5HRY A;  3APF A;  1KPS B;  2RFM A;  2WXR A;  3ABL E;  4C9B B;  3RKV A;  2X6F A;  3V30 A;  1AWC B;  4AY5 A;  1N0Q A;  3SO8 A;  1FCH A;  2WXN A;  4YDE A;  1HE8 A;  2GW1 A;  5AJL A;  2IY0 C;  4GZ5 A;  3UI2 A;  2DVW A;  3CGH A;  3ULQ A;  3FH7 A;  3CHO A;  4GPM A;  4J8D A;  4H7Y A;  4PUC A;  4WNG A;  5ARG A;  1N52 A;  2ETA A;  4ILG A;  3R9M A;  3JYS A;  1KLX A;  1XNF A;  3RSE G;  2QZA A;  5G05 C;  3E4B A;  3ZUV B;  3ZHE B;  1SZA A;  1MYO A;  2XCB A;  4WWO A;  3MYV A;  4DLQ A;  5ENN A;  2WPV A;  1HXI A;  5ENS D;  5EID A;  4AOF A;  3Q49 B;  2P9L G;  3O48 A;  3ESK A;  2LSV A;  2OND A;  4A3V A;  2XZT G;  3FTW A;  1IYG A;  1DC2 A;  5BXU A;  3C98 A;  3GZS A;  2X6K A;  3ZGQ A;  4F6R D;  4LSZ E;  4I6G A;  2CG3 A;  3Q73 A;  4ACL A;  2VSN A;  3AU5 A;  2KZT B;  3LYA A;  2XRZ A;  2CHW A;  5G05 J;  3R7Q A;  4EZJ A;  3FWV A;  1E96 B;  4J8S A;  3UTM A;  5HKP A;  3UX4 A;  5FWQ A;  2P9S G;  4ZFH A;  3PEV B;  4M7C A;  4GA1 A;  3KS2 A;  1DCE A;  4PDX A;  5BV0 A;  2HR2 A;  4O1O A;  3BG1 B;  3X2Q E;  4G2V A;  2MRI A;  4CT0 A;  2Q7F A;  5ITZ F;  4ACK A;  3TG4 A;  2P9I G;  2XGM A;  2J4D A;  2XEH A;  3HHM A;  5T3R A;  1BD8 A;  3CVY A;  4GTS A;  4FAD A;  3FUF A;  2MHK A;  4GTM A;  5KJN A;  1JUQ A;  3DEO A;  4APO A;  4TUM A;  3AS4 A;  3KSQ A;  1Z3Y A;  5B1A E;  1E7V A;  1H19 A;  4E85 A;  4JVS A;  3EHM A;  4XI0 A;  5J08 A;  4WWP A;  2KCL A;  3D9I A;  1BU9 A;  4U0S A;  2YHC A;  3DRA A;  4R7L A;  3CK7 A;  3LVR E;  1QNF A;  2NC9 A;  4LEU A;  5CMY A;  4AP2 A;  5A6C A;  2IFU A;  1Z5S C;  4XZ4 A;  5D66 A;  4WNE A;  4UWK A;  4UWL A;  4J7W A;  1N94 A;  4YDY A;  3CVQ A;  2L0T B;  4DI4 A;  1WM5 A;  3GW4 A;  4UWH A;  2IQC A;  2Y1L E;  2ETC A;  4PH4 B;  2KZT A;  4OAU C;  1SW6 A;  1E8Z A;  4APF A;  5ANR A;  4HS2 A;  3T8M A;  3MCX A;  3U4T A;  3Q7A A;  2QFC A;  4GYO A;  4BT9 A;  2OCC E;  5T4Y A;  5AAO A;  4CDM A;  3CK9 A;  3L08 A;  3R7R A;  5CEA A;  2CHX A;  3GZ1 A;  3UMV A;  3EUV A;  4MS6 A;  4DJA A;  3DPD A;  2UY1 B;  3SFY A;  1UG3 A;  2X3M A;  2GRQ B;  1TNY A;  4TXQ A;  4IRU A;  3FEX A;  2V0P A;  4GYW A;  3SQV A;  3VLF A;  4JEU A;  4BT8 A;  4CGV A;  3BUA A;  4KVO A;  3PH0 C;  4U7E B;  2AWI A;  4MLP A;  4BFR A;  1OWO A;  3W9G A;  4BES A;  2XEN A;  4UI9 C;  5CED B;  5AEN A;  4U0Z A;  4FP7 A;  1UJK A;  2AW6 A;  3T5X A;  4L9P A;  1ELR A;  2H6G A;  4HOQ A;  5HI7 A;  1QZ2 A;  1YCS B;  1N4R A;  2VSO E;  2OEV A;  3HXD A;  3MEK A;  4GCO A;  2XPI A;  3TJP A;  2B0O E;  5AAR A;  3S7B A;  3Q15 A;  4N2Q A;  3LJN A;  1HG2 A;  5ENR D;  5HS0 A;  4CT4 A;  3SFZ A;  3PZ4 A;  3SI5 A;  2WQH A;  4G1T A;  4GTP A;  1NI1 A;  2EIJ E;  3L9T A;  3TWX A;  2QYJ A;  2L0I A;  2ZGD A;  2PNN A;  3LEW A;  3QWV A;  3AS5 A;  3D9K A;  3SD5 A;  1SA4 A;  2R05 A;  2WXJ A;  1Z3X A;  3C3O A;  2QC9 A;  4U0U A;  3CHS A;  2XEE A;  5LOZ A;  2PQR A;  1RW2 A;  2WXI A;  3ZYQ A;  4GYY A;  5LCW J;  1TR4 A;  4FHK A;  1IHB A;  5G55 A;  1LF8 A;  3I3N A;  3B7R L;  5AQB A;  3C3Q A;  2KBX A;  5AYW D;  2CFU A;  2VTB A;  3ZYL A;  3TL5 A;  3HXC A;  1NP7 A;  5BV1 A;  3ZXS A;  3ZRH A;  3NBN B;  5E76 A;  3HDX A;  2OEW A;  3G2T A;  4BWR A;  2LAI A;  4HQD A;  1PAQ A;  5CRU A;  2MYO A;  4EPZ A;  1KT1 A;  1EPU A;  3IHV A;  4J8Y A;  3PZ2 A;  5EX0 A;  1JCR A;  4UWF A;  4KT6 B;  3KEA A;  1UN9 A;  5A23 A;  5EYP F;  3PUJ A;  2GRR B;  2XQ0 A;  3CKB A;  4MRU A;  4Y6C A;  2J08 A;  3FFL A;  4Z68 A;  1OWN A;  4W9R A;  3PRZ A;  4EZK A;  3UT7 A;  4GZ6 A;  2NYJ A;  3SHF A;  4FJY A;  4F1S A;  2IOS A;  1FVF A;  5LP0 A;  3UXG A;  4OVU A;  2KAT A;  1Y8M A;  5FZS A;  3MJW A;  3UT4 A;  1A5E A;  3DWL G;  4EBA A;  1H2T C;  3V2X A;  2DZN A;  4LRZ A;  2WMN A;  4MBG A;  4A1G A;  1O1T A;  3EU9 A;  2CG2 A;  3DBS A;  2DWZ A;  3FUI A;  3Q5M A;  4U63 A;  5FQ7 A;  2DYS E;  3DXM G;  1K1B A;  2XS1 A;  1S63 A;  2KXP C;  4G11 A;  4GCN A; 
#chains in the Genus database with same CATH homology
 2GRR B;  5D2M C;  2GRP B;  2GRQ B;  3UIP C;  3UIO C;  2GRN B;  2IO2 C;  2GRO B;  1KPS B;  3UIN C;  2IY0 C;  2IO3 C;  1Z5S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...