3DXKG

Structure of bos taurus arp2/3 complex with bound inhibitor ck0944636
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
134
Chain Sequence
b'ARFRKVDVGEYDENKFVDGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 43
structure length 134
sequence length 143
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3dxkG00
2P9PG 3ULEG 1U2VG 3DXMG 3RSEG 2P9SG 3UKRG 1TYQG 1K8KG 2P9UG 2P9KG 3UKUG 2P9NG 3DXKG 2P9LG 3DWLG 2P9IG 4JD2G 4XEIG
chains in the Genus database with same CATH superfamily
3IKOB 3Q79A 1E96B 4ANXA 4JHKA 4HQDA 4OAUC 3K9IA 3OXGA 1O1RA 2BTDA 1K3ZD 3LEWA 5B1AE 3T9KA 1SQMA 4DX1A 2ZIRA 5ENPD 2L6BA 2X6JA 3P2BA 3MGBA 1NZNA 4TUMA 4BY6A 4HRMB 3UM1A 5LOZA 4AY6A 4GZ5A 4OVUA 4A1GA 1ZBPA 4FULA 1NFIE 5G05C 2M63A 4F6RD 4QQIA 5A7DB 3E4BA 2LAHA 3CVPA 3D9NA 1MZCA 5J08A 4G1TA 5HRYA 3LXUX 2XS1A 3TJPA 5E76A 3UMVA 3NOGD 4GA1A 3LPZA 3QKYA 3ISMC 2I1JA 1UJJA 2JABA 3GZSA 3ULYA 3SD5A 4ABNA 4DI3A 3FTSA 5FQ6A 3VTXA 2KZTB 5T4YA 3P1UA 4L2YA 1JWFA 4A63B 2EIJE 1U3DA 5G04C 3CHOA 3FTYA 2P58C 2Y3AA 2XQ0A 3ASNE 1PAQA 4BT8A 3HXDA 3FTWA 4XE0A 2AW6A 4JXTA 5IY5E 3JQ0A 2EIME 4O6FA 3TWTA 3ZVVA 1W3BA 3B7RL 2VSYA 2IF4A 2HYZA 5BPPA 2BKKB 1EYHA 4HRNA 1YYHA 2V5FA 3T5VA 3U3WA 4YNDA 2VGEA 3FUHA 2JLBA 1K1BA 4FP7A 5A23A 1DCQA 3FH8A 4PS8A 1NP7A 3T8MA 3TXNA 1TYQG 3PZ4A 2VYIA 1N11A 3G2VA 3ABKE 2VSOE 4EHMA 4AV7A 3FH7A 3PNTB 1SZAA 1NL4A 4DI4A 4RG6A 2UWJG 3UINC 4N5QA 2XPYA 1SZ9A 4UWHA 4CGVA 4V3IA 5J90A 3ZUVB 2L0TB 4EZJA 3ONLA 3AG2E 3DPDA 3CVVA 1E8ZA 1HG2A 4LG6A 3I3NA 5KJKA 1YA0A 2GRQB 2GRLA 3PS6A 1X5BA 3B13A 3PRZA 2WXKA 4I6EA 3B7UX 2FBNA 5BXOA 2XRZA 1YMPA 1MHQA 4AIFA 1HO8A 2YINA 2WXLA 3R7QA 2GROB 5D0OD 1X81A 1TNYA 1DVPA 3OTNA 3APFA 3UT7A 3QARA 1MX6A 5AENA 4ANWA 4GTSA 4CEMA 4U7EB 3ABLE 3ESLA 2XGOA 2WXJA 3DSXA 3PE4A 2VTBB 4GA2A 4GYWA 1HG5A 1UN9A 3CV0A 1MYOA 3HXCA 1H2TC 4G2VA 3FY4A 3PZDA 2P9IG 1OWPA 2EINE 1QNFA 3TWSA 2QFCA 1UN8A 1BI8B 2WB2A 5BXUA 1LD8A 3CHQA 3AS8A 4C0EA 4BWRA 2CG3A 3NQPA 4Y6CA 4DX5D 1TNZA 3TG4A 5FQ7A 1H6PA 3RRNB 3D3MA 3QC1A 4UI9K 3AS4A 1H0AA 4FJYA 5E75A 2XGMA 4J6IA 2R17C 3Q49B 3TL5A 3D9MA 5LP0A 3I4RB 2E2EA 2QZAA 3T5XA 2GW1A 4FLBA 3ML9A 2OVFA 3W9FA 3V2XA 3GZ2A 4NQ0A 4J8EA 2GRMA 1OCCE 3UKRG 2MOWA 3MJWA 4UUCA 2XCCA 3LJ3A 3GZ1A 4YVOA 2R5SA 3EIJA 1L5JA 3LKUA 3BEEA 1OCRE 4LNGA 5HS0A 1O5MA 3CVUA 4A3TA 3DSTA 3FUDA 3JQ1A 1JUQA 4N3AA 2F8XK 4N3BA 1PY1A 2WXIA 2ETAA 4RVBA 4I2ZA 1DNPA 4JL0A 4GTVA 4AVXA 4LNBA 3SF4A 3RAUA 5LX8A 2YHCA 4UWFA 5AARA 1IKND 1IQUA 2LNIA 4BESA 4YDWA 1Z3YA 3CQGB 2DBAA 2P9KG 2NC9A 1HH8A 1GW6A 2VGXA 4AP2A 3DRAA 3CR3A 2P9SG 1BI7B 3DBSA 2IOLA 1YCSB 2XPIA 4GYYA 3RRMB 1N9AA 5JJ7A 1XGWA 3BQOA 4HBDA 3EU5A 3HIZA 3FWVA 4U0SA 3DPYA 3MKQB 2J49A 5LCWC 2R02A 4U63A 2V4LA 4HI8A 2JEKA 4GMRA 1OWNA 3CVNA 3NBNB 3JYSA 5HQ8A 5CBNA 4GMJA 2J4DA 3RU0A 4XIFA 3Q7FA 4WNGA 4C9BB 2OEVA 4HVBA 1JCSA 3ZN3A 4Q69A 4U8VD 3C3QA 3AG3E 2XHEA 2I9CA 3VLFA 1Z3XA 2ZXWE 2AXZA 3U64A 2LSUA 5CBOA 4ATGA 2BUGA 1D8EA 3FULA 3TXMA 3DXKG 4JVSA 3U9WA 3TWUA 3PZ2A 3TGOA 4F3VA 3UX4A 3OXFA 5AYWD 3SFYA 3RO3A 2L9BA 2X6HA 1OWLA 2J9QA 4M7CA 1OCZE 2QYJA 3F6QA 2WMOA 1BPOA 2DVWA 1JWGA 2XPZA 5KJMA 4I2WA 1FPPA 1UW4B 3C5RA 4J8FA 4WNEA 5CCMA 3Q78A 1N0RA 3G2UA 4GAAA 3L08A 3FU5A 2L0IA 3JXIA 2A5UA 4U0ZA 1N95A 4A55A 4XI0A 2PZIA 1OCOE 2UY1B 2XS8A 5D66A 5G2NA 1JCRA 3RO2A 1A5EA 2LSVA 3V79K 4ZFHA 4I6JA 4JB8P 3PE3A 2OVBA 4NACA 2X6KA 4C0MA 4EPZA 2OV8A 2L6JA 4MBGA 4W9RA 3ZXSA 4DX7D 3SBTB 3Q47B 4WWPA 1RW2A 2H6FA 5KJNA 4MRUA 3QWVA 1H2VC 5FTPA 2XZDG 1DCEA 2R03A 3PH0C 3V2OA 4BEPA 4HLEA 4PS7A 4AOFA 4GTPA 3NF1A 2XZTG 4KMOA 3VTYA 3IBEA 5FQ4A 5BW8C 5FINA 5ENQD 5EIDA 1LTXA 4DLOA 1VDYA 3FU0A 4RLYA 4JA7A 1B89A 3FTZA 3IXEA 2VJ8A 3C98A 3BUAA 3UM0A 3FUEA 3HDXA 2WM9A 4F1SA 5KCMA 4KVOA 3CVYA 1D8DA 3SY2A 3ULEG 2DWZA 3HVEA 2XEVA 2WXPA 1BLXB 3FEYA 2LAIA 1OWMA 3LVRE 4B8AA 3EHQA 4TXPA 2Q7FA 1SA4A 5JJTA 2J09A 4F7AA 3FUIA 5AAOA 3MV2B 3PVLA 3NOCD 3X2QE 4DRXE 2LUHA 2E0IA 5ITZF 3PZ1A 3IHVA 4N3CA 1KT1A 4JHRA 2Y4UA 4CT4A 2DIWA 4WUYA 4GZDA 4J8YA 4GZCA 1LF8A 3LDZA 3FEXA 4D10C 2WVIA 3L82A 2Y0BG 1AWCB 3CVXA 1SA5A 2FEZA 4K5BA 3D9LA 3JUIA 2AVPA 2WQ6A 2DYSE 3L16A 1HXIA 5DIZA 2I1KA 3ZEFA 1E7UA 3IHYA 4U07A 1N4PA 4TXRA 2WMNA 1TEZA 5EKQD 3Q9UC 3E32A 4KZ0A 2P2CP 4KZCA 2OCCE 1N4SA 1ZB1A 1XNFA 2HE0A 3S2AA 2H6GA 4UWGA 5HI7A 3EDTB 1P5QA 1H2UA 2CHXA 4EBAA 2IU1A 4UI9J 3S7DA 1HE8A 3L17A 4ME2A 3CLJA 5KBAA 1N94A 3RIBA 4J8SA 3TG5A 1K8KG 3FUKA 3FUJA 2CHZA 3EHRA 1S63A 4GCNA 3ZHEA 4G11A 3LCAA 2IY0C 2XEHA 4U0UA 5EIBE 1TNBA 3DSSA 2IQCA 1KZPA 2J4BA 4K5CA 2QC9A 3SZ7A 4FA6A 3DSUA 3CVLA 3CSTA 1QYMA 1FT1A 3MKRA 2BEDA 4GMLA 2WXMA 4PUCA 3UQ3A 4AEZC 4R7LA 4WNFA 5ANRA 5H7PA 2F8YA 2ZGDA 1JPLA 1IQRA 2KM4A 5JJ6A 3UT8A 5G05J 3DSWA 5AJDA 1N54A 4RG9A 4HB5A 5D0QD 4ACKA 2VQ2A 2YQ8A 2PQRA 3ZYLA 2YHEA 2AXVA 4K5AB 5EN5D 5KJLA 4H7XA 1IHBA 3BG1B 3CKCA 3KAEA 3S7FA 3KSQA 4LEUA 3CHMA 5FT9A 4ILHB 4YDYA 5C1DA 4IRUA 3RK6A 3LY9A 3ENEA 1E8WA 4U04A 2X3MA 3RJVA 5G04J 4URKA 2GRNB 4ANUA 2NYJA 1QQEA 2R2LA 3HXEA 1Z6TA 1KT0A 5EYLA 2LO6A 2P9UG 5AN8A 4K03A 2EIKE 2I6HA 1TN6A 4PH4B 3PDNA 4TV3A 4LUNU 4BERA 4GPKA 4I17A 2FI7A 3R9MA 2RKKA 2Y4TA 3APDA 1OY3D 2WXOA 5A6CA 3PNLB 3C72A 5KNHD 1OUVA 3KEAA 4HRLA 1HFAA 3EU9A 4GTMA 1E8XA 2P9LG 3FP3A 4N39A 4BFRA 1V54E 3S7BA 2XRYA 4FC8A 1JCQA 4I9EA 4LCTA 3CSFA 3PZ3A 5ENSD 3QWWA 2GRRB 5AQAA 2Y69E 2KZTA 4Y6WA 2V5QC 4MS6A 3UKUG 4FLHA 4F1PA 5EX0A 5CCLA 5JMND 4GPMA 5AQ9A 5FWQA 1Z5SC 1N0QA 3RKVA 3AS5A 3ZNGA 4BX8A 4U96D 2QYUA 3FU3A 3TAXA 2MHKA 3HYMB 4I9CA 3SFZA 2NSZA 3CKBA 2J08A 3ULQA 5EX3A 4WWOA 4XEIG 3L9TA 4I43A 1EF1C 4HOTA 4BT9A 2Y1LE 4X8QA 4NRHB 4CZ2D 3AG1E 3QAQA 5G55A 3LYAA 3WG7E 3MA5A 4M3OA 3WXXA 1HF8A 4HFGA 3HRAA 2OOEA 3MYVA 5EDSA 4CCAA 2BF0X 2MRIA 5EILA 2DZNA 2KC7A 4EZKA 3ZXPA 2B0OE 3D9IA 3MCXA 2A4ZA 4H7YA 4EZLA 1BU9A 3SGHA 3RSEG 4L1BA 5CERB 3DEPA 4ILIA 2LXMA 2V0PA 3B7BA 2XGSA 1E90A 3APCA 2GRPB 4ANVA 3Q15A 3LJNA 1QZ2A 3G2TA 1ZU2A 3HHMA 3IEGA 4CDMA 2P9PG 4I1MA 2YNQA 3NB2A 1WG0A 3DSVA 2WPVA 4UWKA 5EYPF 2WXQA 2WXGA 4BETA 5AIJA 4GYOA 4JA9A 3QWPA 3EHMA 4GU5A 4LSZE 3R7RA 4PS3A 4HI9A 4FU3A 5CMWA 2DYRE 4GTOA 2ETCA 4I1OB 2H6IA 3PEUB 4N2SA 4CRWA 3FUFA 3N71A 5CRVA 5CMYA 3MX3A 3QNKA 1TN7A 1H6OA 3AU5A 3D9JA 5LFAA 1NA0A 3CK7A 1MQSA 4UQYA 3NZUA 4P29A 2VTBA 1AP7A 1FCHA 3Q9NC 3AJIA 3AU4A 2ZU6B 3ZKJA 2OEWA 1PC2A 4ACLA 4CT0A 1IXVA 4DX2A 4E6HA 3CVWA 3UI2A 2PM6A 3EIQC 3O48A 4U8HA 3ESKA 5CEDB 4DK5A 4O1OA 2MYOA 2FF4A 2WQHA 1NA3A 2J8SD 2IEJA 3LVQE 2KATA 3Q4AB 5HKPA 4AY5A 4EQFA 4FJZA 5FQ8A 2CG2A 2EQXA 1ELRA 1Y8MA 4ZHBA 1UOHA 4DLQA 3TWWA 4XZ4A 5BV1A 4MKTA 3DEOA 4RQIA 4UI9C 3Q5MA 4LRZA 1TN8A 3EJNA 5ANLA 2AXUA 2X6IA 3CK8A 5ENNA 4GA0A 4KVMA 5ENOD 1MJ0A 4XKBA 1HX8A 4BTBA 3ML8A 5CHEE 4HXIA 5KWDA 2C2LA 3PUKA 3B7SA 4N2QA 3EHNA 3AAAC 4GTRA 5JHAA 4UQZA 2ONDA 3VLEA 3ZGQA 4DPRA 4B93B 3UT4A 1KLXA 4IULA 3I5PA 2FULA 4BTAA 5BNWA 3ZYKA 4WWNA 3SHFA 4JZYA 3TWVA 2ZISA 3JXJA 4CDRA 3U4TA 4XI9A 2KXPC 5BV0A 1IHGA 3AG4E 3URZA 3KS2A 3FTUA 1DC2A 4JPSA 5LCWJ 1EDUA 4KXKB 4BX9A 2X38A 1Y6IA 2PL2A 4QFVA 4GB9A 4IYPA 3KD7A 2C0MA 1E8YA 2IONA 1BD8A 1HU3A 5B3SE 1UJKA 3JUEA 4G23A 1INZA 2IJGX 2CFZA 2AWIA 5AQBA 4L9PA 2KCVA 2CFUA 4OYSA 3ZU7B 5AQ7A 3GYZA 3JCKC 2H6HA 1SW6A 5CRUA 1FVFA 3HG0D 3FTXA 3FUMA 5FZQA 3UXGA 3LY7A 2ZGGA 3L54A 3D9PA 4O60A 3J5QB 3NAWA 3ZYMA 3ZYQA 3MKQA 1S70B 1S0PA 5ENTD 5ENRD 4K0RA 4O1PA 1UG3A 3E33A 4NIKA 2FO7A 3CHPA 4OAVB 2KBXA 2VGXB 2DZOA 3SFXA 3HXBA 3I4GA 3ASFA 4JW1A 1IYGA 4XKCA 2XEEA 1H6KA 4GZ3A 1TJCA 4IN3B 4RSYA 4DUIA 4L23A 4WNDA 2DCPA 1QBQA 3ABME 4XX5A 3UIOC 3SBSA 1O1TA 2NXPA 4APFA 1A17A 1TNOA 4LNUD 3UIPC 2IO2C 3NZSA 4OVVA 5KNGA 5DBKA 4AM9A 3MEKA 2GGFA 4I6GA 1E7VA 2FO1E 3W9GA 2XCBA 2EILE 3FUNA 3IV0A 3SI5A 4EBAG 4GTQA 3FHEA 3CHSA 3QOUA 4HORA 4YDEA 5FZRA 1D9SA 3OXLA 3VLDA 3Q75A 3G2WA 4FADA 5JA4D 1S64A 1KZOA 4HOSA 3ZRHA 4EECA 4GZ6A 2UY1A 2XENA 1MX2A 3ZIMA 5D2MC 3S7JA 5BT1A 1N4RA 3FTVA 2RG8A 3ASOE 5FJYA 2PM7A 4NURA 3FDHA 1KPSB 2IOSA 2QY7A 4N5CA 4E85A 1TR4A 3U66A 3FU6A 2V8SE 4J7WA 4J0UA 2R05A 4ILGA 3J5PA 5ARGA 5T3RA 3RRUA 3UM2A 3CEQA 4BSXA 1OXJA 3CGHA 4APOA 3B95A 3L6AA 2J07A 3G2SA 4FHJA 1WDYA 3TWRA 2KCKA 4Z68A 4J8DA 4WAFA 4DJAA 3LS8A 3PUJA 4A3VA 5CECB 2CHWA 3DXMG 3L22A 1ELWA 3ASDA 3KSLA 4G25A 1O1SA 3R9AB 2PNNA 4UWLA 4ATZD 2R59A 3LY8A 3FH5A 3QB2A 2IO3C 4L2LA 1V55E 3C3RA 2PQNA 4I1AA 4B0ZA 2V4HC 3HXFA 3QJZA 4PDXA 3QDNA 1MX4A 1EPUA 1N52A 3CHRA 3ZFWA 3ASHA 3SQVA 4G8LA 4JEUA 4C48B 4TRQA 3ZW3A 4YVQC 4CGWA 5BUZA 2I2OA 4Q96A 3E34A 1N4QA 4B89A 3KEZA 2ILRA 4AXHA 3B7TA 2WQ7A 4JC8A 3ASGA 1SVXA 2HO1A 3L13A 4BSZB 4G24A 3UUXA 3EUVA 1HS6A 1OWOA 2WXFA 4LERA 5FZSA 3SO8A 1RZ4A 2X6FA 1U3CA 3TWQA 3T8KA 3UPVA 4L7TA 5FIOA 4DX6D 2VGYA 1K1AA 4HOUA 3QK0A 1LD7A 3HVEB 2B6CA 1H19A 4G8KA 3CIAA 3CK9A 4HOQA 2WXNA 4U95D 3CQCB 3C3OA 5T8IA 2ETBA 4MLPA 2VSNA 4JEHA 2F37A 1ELKA 4CDNA 2RFAA 3V31A 4Q94A 5M72A 5AJLA 4GTTA 1FT2A 2WXHA 1U2VG 3FFLA 4TUUA 3D9OA 1Q2ZA 4UQXA 4HLLA 3D9KA 2C0LA 2F0YA 4KYOB 3PEVB 3OAWA 4JD2G 4YDOA 3V30A 3Q73A 5JHBA 4G26A 1OT8A 3TWXA 3ONKA 1HZ4A 3O4ZA 5C2YA 1NI1A 2P9NG 4A1SA 3MV3B 2KCLA 4F53A 4B8CB 1WY6A 2RFMA 3D9HA 5CEAA 3ZHEB 2RD0A 1TJFA 4KT6B 3DWLG 3Q7AA 4FHKA 5ARFA 2HM8A 4KBQA 4JHJA 3SNXA 4HS2A 3UM3A 4GCOA 2VSXE 2LXLA 3ZPJA 4AJWA 2IFUA 3BU8A 1FVHA 3CVQA 3GW4A 4CYMD 3BG0B 2HR2A 1WAO1 4TXQA 1TNUA 5B1BE 4B94A 2AJAA 4U8YD 3MZLB 3PREA 4HNAD 3E37A 1WM5A 1G3NB 3E30A 3UTMA 2BKGA 2A5EA 2WXRA
chains in the Genus database with same CATH topology
2P9PG 3ULEG 1U2VG 3DXMG 3RSEG 2P9SG 3UKRG 1TYQG 1K8KG 2P9UG 2P9KG 3UKUG 2P9NG 3DXKG 2P9LG 3DWLG 2P9IG 4JD2G 4XEIG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P G;  3ULE G;  1U2V G;  3DXM G;  3RSE G;  2P9S G;  3UKR G;  1TYQ G;  1K8K G;  2P9U G;  2P9K G;  3UKU G;  2P9N G;  3DXK G;  2P9L G;  3DWL G;  2P9I G;  4JD2 G;  4XEI G; 
#chains in the Genus database with same CATH topology
 3IKO B;  3Q79 A;  1E96 B;  4ANX A;  4JHK A;  4HQD A;  4OAU C;  3K9I A;  3OXG A;  1O1R A;  2BTD A;  1K3Z D;  3LEW A;  5B1A E;  3T9K A;  1SQM A;  4DX1 A;  2ZIR A;  5ENP D;  2L6B A;  2X6J A;  3P2B A;  3MGB A;  1NZN A;  4TUM A;  4BY6 A;  4HRM B;  3UM1 A;  5LOZ A;  4AY6 A;  4GZ5 A;  4OVU A;  4A1G A;  1ZBP A;  4FUL A;  1NFI E;  5G05 C;  2M63 A;  4F6R D;  4QQI A;  5A7D B;  3E4B A;  2LAH A;  3CVP A;  3D9N A;  1MZC A;  5J08 A;  4G1T A;  5HRY A;  3LXU X;  2XS1 A;  3TJP A;  5E76 A;  3UMV A;  3NOG D;  4GA1 A;  3LPZ A;  3QKY A;  3ISM C;  2I1J A;  1UJJ A;  2JAB A;  3GZS A;  3ULY A;  3SD5 A;  4ABN A;  4DI3 A;  3FTS A;  5FQ6 A;  3VTX A;  2KZT B;  5T4Y A;  3P1U A;  4L2Y A;  1JWF A;  4A63 B;  2EIJ E;  1U3D A;  5G04 C;  3CHO A;  3FTY A;  2P58 C;  2Y3A A;  2XQ0 A;  3ASN E;  1PAQ A;  4BT8 A;  3HXD A;  3FTW A;  4XE0 A;  2AW6 A;  4JXT A;  5IY5 E;  3JQ0 A;  2EIM E;  4O6F A;  3TWT A;  3ZVV A;  1W3B A;  3B7R L;  2VSY A;  2IF4 A;  2HYZ A;  5BPP A;  2BKK B;  1EYH A;  4HRN A;  1YYH A;  2V5F A;  3T5V A;  3U3W A;  4YND A;  2VGE A;  3FUH A;  2JLB A;  1K1B A;  4FP7 A;  5A23 A;  1DCQ A;  3FH8 A;  4PS8 A;  1NP7 A;  3T8M A;  3TXN A;  1TYQ G;  3PZ4 A;  2VYI A;  1N11 A;  3G2V A;  3ABK E;  2VSO E;  4EHM A;  4AV7 A;  3FH7 A;  3PNT B;  1SZA A;  1NL4 A;  4DI4 A;  4RG6 A;  2UWJ G;  3UIN C;  4N5Q A;  2XPY A;  1SZ9 A;  4UWH A;  4CGV A;  4V3I A;  5J90 A;  3ZUV B;  2L0T B;  4EZJ A;  3ONL A;  3AG2 E;  3DPD A;  3CVV A;  1E8Z A;  1HG2 A;  4LG6 A;  3I3N A;  5KJK A;  1YA0 A;  2GRQ B;  2GRL A;  3PS6 A;  1X5B A;  3B13 A;  3PRZ A;  2WXK A;  4I6E A;  3B7U X;  2FBN A;  5BXO A;  2XRZ A;  1YMP A;  1MHQ A;  4AIF A;  1HO8 A;  2YIN A;  2WXL A;  3R7Q A;  2GRO B;  5D0O D;  1X81 A;  1TNY A;  1DVP A;  3OTN A;  3APF A;  3UT7 A;  3QAR A;  1MX6 A;  5AEN A;  4ANW A;  4GTS A;  4CEM A;  4U7E B;  3ABL E;  3ESL A;  2XGO A;  2WXJ A;  3DSX A;  3PE4 A;  2VTB B;  4GA2 A;  4GYW A;  1HG5 A;  1UN9 A;  3CV0 A;  1MYO A;  3HXC A;  1H2T C;  4G2V A;  3FY4 A;  3PZD A;  2P9I G;  1OWP A;  2EIN E;  1QNF A;  3TWS A;  2QFC A;  1UN8 A;  1BI8 B;  2WB2 A;  5BXU A;  1LD8 A;  3CHQ A;  3AS8 A;  4C0E A;  4BWR A;  2CG3 A;  3NQP A;  4Y6C A;  4DX5 D;  1TNZ A;  3TG4 A;  5FQ7 A;  1H6P A;  3RRN B;  3D3M A;  3QC1 A;  4UI9 K;  3AS4 A;  1H0A A;  4FJY A;  5E75 A;  2XGM A;  4J6I A;  2R17 C;  3Q49 B;  3TL5 A;  3D9M A;  5LP0 A;  3I4R B;  2E2E A;  2QZA A;  3T5X A;  2GW1 A;  4FLB A;  3ML9 A;  2OVF A;  3W9F A;  3V2X A;  3GZ2 A;  4NQ0 A;  4J8E A;  2GRM A;  1OCC E;  3UKR G;  2MOW A;  3MJW A;  4UUC A;  2XCC A;  3LJ3 A;  3GZ1 A;  4YVO A;  2R5S A;  3EIJ A;  1L5J A;  3LKU A;  3BEE A;  1OCR E;  4LNG A;  5HS0 A;  1O5M A;  3CVU A;  4A3T A;  3DST A;  3FUD A;  3JQ1 A;  1JUQ A;  4N3A A;  2F8X K;  4N3B A;  1PY1 A;  2WXI A;  2ETA A;  4RVB A;  4I2Z A;  1DNP A;  4JL0 A;  4GTV A;  4AVX A;  4LNB A;  3SF4 A;  3RAU A;  5LX8 A;  2YHC A;  4UWF A;  5AAR A;  1IKN D;  1IQU A;  2LNI A;  4BES A;  4YDW A;  1Z3Y A;  3CQG B;  2DBA A;  2P9K G;  2NC9 A;  1HH8 A;  1GW6 A;  2VGX A;  4AP2 A;  3DRA A;  3CR3 A;  2P9S G;  1BI7 B;  3DBS A;  2IOL A;  1YCS B;  2XPI A;  4GYY A;  3RRM B;  1N9A A;  5JJ7 A;  1XGW A;  3BQO A;  4HBD A;  3EU5 A;  3HIZ A;  3FWV A;  4U0S A;  3DPY A;  3MKQ B;  2J49 A;  5LCW C;  2R02 A;  4U63 A;  2V4L A;  4HI8 A;  2JEK A;  4GMR A;  1OWN A;  3CVN A;  3NBN B;  3JYS A;  5HQ8 A;  5CBN A;  4GMJ A;  2J4D A;  3RU0 A;  4XIF A;  3Q7F A;  4WNG A;  4C9B B;  2OEV A;  4HVB A;  1JCS A;  3ZN3 A;  4Q69 A;  4U8V D;  3C3Q A;  3AG3 E;  2XHE A;  2I9C A;  3VLF A;  1Z3X A;  2ZXW E;  2AXZ A;  3U64 A;  2LSU A;  5CBO A;  4ATG A;  2BUG A;  1D8E A;  3FUL A;  3TXM A;  3DXK G;  4JVS A;  3U9W A;  3TWU A;  3PZ2 A;  3TGO A;  4F3V A;  3UX4 A;  3OXF A;  5AYW D;  3SFY A;  3RO3 A;  2L9B A;  2X6H A;  1OWL A;  2J9Q A;  4M7C A;  1OCZ E;  2QYJ A;  3F6Q A;  2WMO A;  1BPO A;  2DVW A;  1JWG A;  2XPZ A;  5KJM A;  4I2W A;  1FPP A;  1UW4 B;  3C5R A;  4J8F A;  4WNE A;  5CCM A;  3Q78 A;  1N0R A;  3G2U A;  4GAA A;  3L08 A;  3FU5 A;  2L0I A;  3JXI A;  2A5U A;  4U0Z A;  1N95 A;  4A55 A;  4XI0 A;  2PZI A;  1OCO E;  2UY1 B;  2XS8 A;  5D66 A;  5G2N A;  1JCR A;  3RO2 A;  1A5E A;  2LSV A;  3V79 K;  4ZFH A;  4I6J A;  4JB8 P;  3PE3 A;  2OVB A;  4NAC A;  2X6K A;  4C0M A;  4EPZ A;  2OV8 A;  2L6J A;  4MBG A;  4W9R A;  3ZXS A;  4DX7 D;  3SBT B;  3Q47 B;  4WWP A;  1RW2 A;  2H6F A;  5KJN A;  4MRU A;  3QWV A;  1H2V C;  5FTP A;  2XZD G;  1DCE A;  2R03 A;  3PH0 C;  3V2O A;  4BEP A;  4HLE A;  4PS7 A;  4AOF A;  4GTP A;  3NF1 A;  2XZT G;  4KMO A;  3VTY A;  3IBE A;  5FQ4 A;  5BW8 C;  5FIN A;  5ENQ D;  5EID A;  1LTX A;  4DLO A;  1VDY A;  3FU0 A;  4RLY A;  4JA7 A;  1B89 A;  3FTZ A;  3IXE A;  2VJ8 A;  3C98 A;  3BUA A;  3UM0 A;  3FUE A;  3HDX A;  2WM9 A;  4F1S A;  5KCM A;  4KVO A;  3CVY A;  1D8D A;  3SY2 A;  3ULE G;  2DWZ A;  3HVE A;  2XEV A;  2WXP A;  1BLX B;  3FEY A;  2LAI A;  1OWM A;  3LVR E;  4B8A A;  3EHQ A;  4TXP A;  2Q7F A;  1SA4 A;  5JJT A;  2J09 A;  4F7A A;  3FUI A;  5AAO A;  3MV2 B;  3PVL A;  3NOC D;  3X2Q E;  4DRX E;  2LUH A;  2E0I A;  5ITZ F;  3PZ1 A;  3IHV A;  4N3C A;  1KT1 A;  4JHR A;  2Y4U A;  4CT4 A;  2DIW A;  4WUY A;  4GZD A;  4J8Y A;  4GZC A;  1LF8 A;  3LDZ A;  3FEX A;  4D10 C;  2WVI A;  3L82 A;  2Y0B G;  1AWC B;  3CVX A;  1SA5 A;  2FEZ A;  4K5B A;  3D9L A;  3JUI A;  2AVP A;  2WQ6 A;  2DYS E;  3L16 A;  1HXI A;  5DIZ A;  2I1K A;  3ZEF A;  1E7U A;  3IHY A;  4U07 A;  1N4P A;  4TXR A;  2WMN A;  1TEZ A;  5EKQ D;  3Q9U C;  3E32 A;  4KZ0 A;  2P2C P;  4KZC A;  2OCC E;  1N4S A;  1ZB1 A;  1XNF A;  2HE0 A;  3S2A A;  2H6G A;  4UWG A;  5HI7 A;  3EDT B;  1P5Q A;  1H2U A;  2CHX A;  4EBA A;  2IU1 A;  4UI9 J;  3S7D A;  1HE8 A;  3L17 A;  4ME2 A;  3CLJ A;  5KBA A;  1N94 A;  3RIB A;  4J8S A;  3TG5 A;  1K8K G;  3FUK A;  3FUJ A;  2CHZ A;  3EHR A;  1S63 A;  4GCN A;  3ZHE A;  4G11 A;  3LCA A;  2IY0 C;  2XEH A;  4U0U A;  5EIB E;  1TNB A;  3DSS A;  2IQC A;  1KZP A;  2J4B A;  4K5C A;  2QC9 A;  3SZ7 A;  4FA6 A;  3DSU A;  3CVL A;  3CST A;  1QYM A;  1FT1 A;  3MKR A;  2BED A;  4GML A;  2WXM A;  4PUC A;  3UQ3 A;  4AEZ C;  4R7L A;  4WNF A;  5ANR A;  5H7P A;  2F8Y A;  2ZGD A;  1JPL A;  1IQR A;  2KM4 A;  5JJ6 A;  3UT8 A;  5G05 J;  3DSW A;  5AJD A;  1N54 A;  4RG9 A;  4HB5 A;  5D0Q D;  4ACK A;  2VQ2 A;  2YQ8 A;  2PQR A;  3ZYL A;  2YHE A;  2AXV A;  4K5A B;  5EN5 D;  5KJL A;  4H7X A;  1IHB A;  3BG1 B;  3CKC A;  3KAE A;  3S7F A;  3KSQ A;  4LEU A;  3CHM A;  5FT9 A;  4ILH B;  4YDY A;  5C1D A;  4IRU A;  3RK6 A;  3LY9 A;  3ENE A;  1E8W A;  4U04 A;  2X3M A;  3RJV A;  5G04 J;  4URK A;  2GRN B;  4ANU A;  2NYJ A;  1QQE A;  2R2L A;  3HXE A;  1Z6T A;  1KT0 A;  5EYL A;  2LO6 A;  2P9U G;  5AN8 A;  4K03 A;  2EIK E;  2I6H A;  1TN6 A;  4PH4 B;  3PDN A;  4TV3 A;  4LUN U;  4BER A;  4GPK A;  4I17 A;  2FI7 A;  3R9M A;  2RKK A;  2Y4T A;  3APD A;  1OY3 D;  2WXO A;  5A6C A;  3PNL B;  3C72 A;  5KNH D;  1OUV A;  3KEA A;  4HRL A;  1HFA A;  3EU9 A;  4GTM A;  1E8X A;  2P9L G;  3FP3 A;  4N39 A;  4BFR A;  1V54 E;  3S7B A;  2XRY A;  4FC8 A;  1JCQ A;  4I9E A;  4LCT A;  3CSF A;  3PZ3 A;  5ENS D;  3QWW A;  2GRR B;  5AQA A;  2Y69 E;  2KZT A;  4Y6W A;  2V5Q C;  4MS6 A;  3UKU G;  4FLH A;  4F1P A;  5EX0 A;  5CCL A;  5JMN D;  4GPM A;  5AQ9 A;  5FWQ A;  1Z5S C;  1N0Q A;  3RKV A;  3AS5 A;  3ZNG A;  4BX8 A;  4U96 D;  2QYU A;  3FU3 A;  3TAX A;  2MHK A;  3HYM B;  4I9C A;  3SFZ A;  2NSZ A;  3CKB A;  2J08 A;  3ULQ A;  5EX3 A;  4WWO A;  4XEI G;  3L9T A;  4I43 A;  1EF1 C;  4HOT A;  4BT9 A;  2Y1L E;  4X8Q A;  4NRH B;  4CZ2 D;  3AG1 E;  3QAQ A;  5G55 A;  3LYA A;  3WG7 E;  3MA5 A;  4M3O A;  3WXX A;  1HF8 A;  4HFG A;  3HRA A;  2OOE A;  3MYV A;  5EDS A;  4CCA A;  2BF0 X;  2MRI A;  5EIL A;  2DZN A;  2KC7 A;  4EZK A;  3ZXP A;  2B0O E;  3D9I A;  3MCX A;  2A4Z A;  4H7Y A;  4EZL A;  1BU9 A;  3SGH A;  3RSE G;  4L1B A;  5CER B;  3DEP A;  4ILI A;  2LXM A;  2V0P A;  3B7B A;  2XGS A;  1E90 A;  3APC A;  2GRP B;  4ANV A;  3Q15 A;  3LJN A;  1QZ2 A;  3G2T A;  1ZU2 A;  3HHM A;  3IEG A;  4CDM A;  2P9P G;  4I1M A;  2YNQ A;  3NB2 A;  1WG0 A;  3DSV A;  2WPV A;  4UWK A;  5EYP F;  2WXQ A;  2WXG A;  4BET A;  5AIJ A;  4GYO A;  4JA9 A;  3QWP A;  3EHM A;  4GU5 A;  4LSZ E;  3R7R A;  4PS3 A;  4HI9 A;  4FU3 A;  5CMW A;  2DYR E;  4GTO A;  2ETC A;  4I1O B;  2H6I A;  3PEU B;  4N2S A;  4CRW A;  3FUF A;  3N71 A;  5CRV A;  5CMY A;  3MX3 A;  3QNK A;  1TN7 A;  1H6O A;  3AU5 A;  3D9J A;  5LFA A;  1NA0 A;  3CK7 A;  1MQS A;  4UQY A;  3NZU A;  4P29 A;  2VTB A;  1AP7 A;  1FCH A;  3Q9N C;  3AJI A;  3AU4 A;  2ZU6 B;  3ZKJ A;  2OEW A;  1PC2 A;  4ACL A;  4CT0 A;  1IXV A;  4DX2 A;  4E6H A;  3CVW A;  3UI2 A;  2PM6 A;  3EIQ C;  3O48 A;  4U8H A;  3ESK A;  5CED B;  4DK5 A;  4O1O A;  2MYO A;  2FF4 A;  2WQH A;  1NA3 A;  2J8S D;  2IEJ A;  3LVQ E;  2KAT A;  3Q4A B;  5HKP A;  4AY5 A;  4EQF A;  4FJZ A;  5FQ8 A;  2CG2 A;  2EQX A;  1ELR A;  1Y8M A;  4ZHB A;  1UOH A;  4DLQ A;  3TWW A;  4XZ4 A;  5BV1 A;  4MKT A;  3DEO A;  4RQI A;  4UI9 C;  3Q5M A;  4LRZ A;  1TN8 A;  3EJN A;  5ANL A;  2AXU A;  2X6I A;  3CK8 A;  5ENN A;  4GA0 A;  4KVM A;  5ENO D;  1MJ0 A;  4XKB A;  1HX8 A;  4BTB A;  3ML8 A;  5CHE E;  4HXI A;  5KWD A;  2C2L A;  3PUK A;  3B7S A;  4N2Q A;  3EHN A;  3AAA C;  4GTR A;  5JHA A;  4UQZ A;  2OND A;  3VLE A;  3ZGQ A;  4DPR A;  4B93 B;  3UT4 A;  1KLX A;  4IUL A;  3I5P A;  2FUL A;  4BTA A;  5BNW A;  3ZYK A;  4WWN A;  3SHF A;  4JZY A;  3TWV A;  2ZIS A;  3JXJ A;  4CDR A;  3U4T A;  4XI9 A;  2KXP C;  5BV0 A;  1IHG A;  3AG4 E;  3URZ A;  3KS2 A;  3FTU A;  1DC2 A;  4JPS A;  5LCW J;  1EDU A;  4KXK B;  4BX9 A;  2X38 A;  1Y6I A;  2PL2 A;  4QFV A;  4GB9 A;  4IYP A;  3KD7 A;  2C0M A;  1E8Y A;  2ION A;  1BD8 A;  1HU3 A;  5B3S E;  1UJK A;  3JUE A;  4G23 A;  1INZ A;  2IJG X;  2CFZ A;  2AWI A;  5AQB A;  4L9P A;  2KCV A;  2CFU A;  4OYS A;  3ZU7 B;  5AQ7 A;  3GYZ A;  3JCK C;  2H6H A;  1SW6 A;  5CRU A;  1FVF A;  3HG0 D;  3FTX A;  3FUM A;  5FZQ A;  3UXG A;  3LY7 A;  2ZGG A;  3L54 A;  3D9P A;  4O60 A;  3J5Q B;  3NAW A;  3ZYM A;  3ZYQ A;  3MKQ A;  1S70 B;  1S0P A;  5ENT D;  5ENR D;  4K0R A;  4O1P A;  1UG3 A;  3E33 A;  4NIK A;  2FO7 A;  3CHP A;  4OAV B;  2KBX A;  2VGX B;  2DZO A;  3SFX A;  3HXB A;  3I4G A;  3ASF A;  4JW1 A;  1IYG A;  4XKC A;  2XEE A;  1H6K A;  4GZ3 A;  1TJC A;  4IN3 B;  4RSY A;  4DUI A;  4L23 A;  4WND A;  2DCP A;  1QBQ A;  3ABM E;  4XX5 A;  3UIO C;  3SBS A;  1O1T A;  2NXP A;  4APF A;  1A17 A;  1TNO A;  4LNU D;  3UIP C;  2IO2 C;  3NZS A;  4OVV A;  5KNG A;  5DBK A;  4AM9 A;  3MEK A;  2GGF A;  4I6G A;  1E7V A;  2FO1 E;  3W9G A;  2XCB A;  2EIL E;  3FUN A;  3IV0 A;  3SI5 A;  4EBA G;  4GTQ A;  3FHE A;  3CHS A;  3QOU A;  4HOR A;  4YDE A;  5FZR A;  1D9S A;  3OXL A;  3VLD A;  3Q75 A;  3G2W A;  4FAD A;  5JA4 D;  1S64 A;  1KZO A;  4HOS A;  3ZRH A;  4EEC A;  4GZ6 A;  2UY1 A;  2XEN A;  1MX2 A;  3ZIM A;  5D2M C;  3S7J A;  5BT1 A;  1N4R A;  3FTV A;  2RG8 A;  3ASO E;  5FJY A;  2PM7 A;  4NUR A;  3FDH A;  1KPS B;  2IOS A;  2QY7 A;  4N5C A;  4E85 A;  1TR4 A;  3U66 A;  3FU6 A;  2V8S E;  4J7W A;  4J0U A;  2R05 A;  4ILG A;  3J5P A;  5ARG A;  5T3R A;  3RRU A;  3UM2 A;  3CEQ A;  4BSX A;  1OXJ A;  3CGH A;  4APO A;  3B95 A;  3L6A A;  2J07 A;  3G2S A;  4FHJ A;  1WDY A;  3TWR A;  2KCK A;  4Z68 A;  4J8D A;  4WAF A;  4DJA A;  3LS8 A;  3PUJ A;  4A3V A;  5CEC B;  2CHW A;  3DXM G;  3L22 A;  1ELW A;  3ASD A;  3KSL A;  4G25 A;  1O1S A;  3R9A B;  2PNN A;  4UWL A;  4ATZ D;  2R59 A;  3LY8 A;  3FH5 A;  3QB2 A;  2IO3 C;  4L2L A;  1V55 E;  3C3R A;  2PQN A;  4I1A A;  4B0Z A;  2V4H C;  3HXF A;  3QJZ A;  4PDX A;  3QDN A;  1MX4 A;  1EPU A;  1N52 A;  3CHR A;  3ZFW A;  3ASH A;  3SQV A;  4G8L A;  4JEU A;  4C48 B;  4TRQ A;  3ZW3 A;  4YVQ C;  4CGW A;  5BUZ A;  2I2O A;  4Q96 A;  3E34 A;  1N4Q A;  4B89 A;  3KEZ A;  2ILR A;  4AXH A;  3B7T A;  2WQ7 A;  4JC8 A;  3ASG A;  1SVX A;  2HO1 A;  3L13 A;  4BSZ B;  4G24 A;  3UUX A;  3EUV A;  1HS6 A;  1OWO A;  2WXF A;  4LER A;  5FZS A;  3SO8 A;  1RZ4 A;  2X6F A;  1U3C A;  3TWQ A;  3T8K A;  3UPV A;  4L7T A;  5FIO A;  4DX6 D;  2VGY A;  1K1A A;  4HOU A;  3QK0 A;  1LD7 A;  3HVE B;  2B6C A;  1H19 A;  4G8K A;  3CIA A;  3CK9 A;  4HOQ A;  2WXN A;  4U95 D;  3CQC B;  3C3O A;  5T8I A;  2ETB A;  4MLP A;  2VSN A;  4JEH A;  2F37 A;  1ELK A;  4CDN A;  2RFA A;  3V31 A;  4Q94 A;  5M72 A;  5AJL A;  4GTT A;  1FT2 A;  2WXH A;  1U2V G;  3FFL A;  4TUU A;  3D9O A;  1Q2Z A;  4UQX A;  4HLL A;  3D9K A;  2C0L A;  2F0Y A;  4KYO B;  3PEV B;  3OAW A;  4JD2 G;  4YDO A;  3V30 A;  3Q73 A;  5JHB A;  4G26 A;  1OT8 A;  3TWX A;  3ONK A;  1HZ4 A;  3O4Z A;  5C2Y A;  1NI1 A;  2P9N G;  4A1S A;  3MV3 B;  2KCL A;  4F53 A;  4B8C B;  1WY6 A;  2RFM A;  3D9H A;  5CEA A;  3ZHE B;  2RD0 A;  1TJF A;  4KT6 B;  3DWL G;  3Q7A A;  4FHK A;  5ARF A;  2HM8 A;  4KBQ A;  4JHJ A;  3SNX A;  4HS2 A;  3UM3 A;  4GCO A;  2VSX E;  2LXL A;  3ZPJ A;  4AJW A;  2IFU A;  3BU8 A;  1FVH A;  3CVQ A;  3GW4 A;  4CYM D;  3BG0 B;  2HR2 A;  1WAO 1;  4TXQ A;  1TNU A;  5B1B E;  4B94 A;  2AJA A;  4U8Y D;  3MZL B;  3PRE A;  4HNA D;  3E37 A;  1WM5 A;  1G3N B;  3E30 A;  3UTM A;  2BKG A;  2A5E A;  2WXR A; 
#chains in the Genus database with same CATH homology
 2P9P G;  3ULE G;  1U2V G;  3DXM G;  3RSE G;  2P9S G;  3UKR G;  1TYQ G;  1K8K G;  2P9U G;  2P9K G;  3UKU G;  2P9N G;  3DXK G;  2P9L G;  3DWL G;  2P9I G;  4JD2 G;  4XEI G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...