3DXKG

Structure of bos taurus arp2/3 complex with bound inhibitor ck0944636
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
134
Chain Sequence
ARFRKVDVGEYDENKFVDGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 43
structure length 134
sequence length 143
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3dxkG00
4JD2G 3RSEG 3DXKG 2P9UG 1K8KG 1U2VG 2P9NG 1TYQG 2P9KG 2P9SG 2P9IG 3UKUG 3DXMG 3DWLG 3UKRG 2P9PG 4XEIG 2P9LG 3ULEG
chains in the Genus database with same CATH superfamily
3UQ3A 3DBSA 4QQIA 3CKBA 4C48B 4ANUA 2WQ7A 3ESKA 3FUMA 4ACLA 1SW6A 2QZAA 3VLEA 3C98A 4FC8A 3CVQA 4AEZC 2VGYA 1VDYA 3NQPA 5DIZA 3I4GA 3ZNGA 3FTYA 4GTOA 3CGHA 1OCRE 2WQHA 4A1GA 2HYZA 4AOFA 3WXXA 3ULQA 3I3NA 4Z68A 3D9JA 3GW4A 1EPUA 4GA0A 2GRPB 2KATA 2ETAA 3W9GA 1TEZA 3JYSA 4YDYA 4FP7A 2WXIA 3VLDA 5G05J 3QDNA 1E96B 3DXMG 2R03A 4B8CB 3OTNA 1Z3XA 3JQ1A 4FHJA 2OOEA 3UMVA 4HI8A 1OCOE 2P9SG 1EDUA 1KLXA 3U66A 1N0QA 1D8EA 5CEAA 2VYIA 3RKVA 3LY8A 3IHVA 3MA5A 4CCAA 2FO7A 3BEEA 4BT9A 1UOHA 2R2LA 4BERA 4JW1A 1ZBPA 1LD7A 2YNQA 3MGBA 4KMOA 3QJZA 3TJPA 5EX0A 1SA4A 3QARA 2PNNA 2OEWA 4XKBA 4A1SA 1RZ4A 3X2QE 2R05A 2AVPA 1OUVA 2OV8A 4G8KA 2P58C 4JD2G 4EECA 3QK0A 1NI1A 1JCQA 2Y4UA 2IU1A 3CQCB 2CFZA 4ANVA 2ETCA 4I6JA 3FUDA 3CEQA 3QOUA 2WMNA 4BFRA 3J5QB 3FTUA 1JWGA 2QFCA 3DEPA 3E32A 4JHRA 4QFVA 2J4DA 2CHXA 4P29A 5J90A 1N11A 5A6CA 2PM7A 2EILE 4I6GA 3B95A 4JEHA 4BTBA 5EKQD 3V30A 4MKTA 3Q78A 3PUKA 2WXJA 1A5EA 3UT8A 1RW2A 1SVXA 3NZSA 4DX7D 4CRWA 4DPRA 3RIBA 4KBQA 3HIZA 4Q94A 1JWFA 1H6OA 1SA5A 2H6IA 5HKPA 3FY4A 4DRXE 5IY5E 3NOGD 4K03A 4OAVB 3GZ2A 3ONKA 1YMPA 4RG9A 2DYRE 2I1JA 3KSLA 2FBNA 4GZ6A 3ZYQA 4V3IA 5ARGA 3JUIA 3L54A 1EF1C 2KCVA 1MYOA 3MKQB 3APDA 5BV0A 3V31A 3APCA 4UQXA 5KCMA 3AG2E 4A55A 4ABNA 4HOTA 1N4QA 3DXKG 3LYAA 4U96D 4HFGA 3SI5A 4R7LA 2I9CA 3ZYKA 2XQ0A 2VSOE 2XEEA 2WXOA 4TUUA 2BKKB 4AM9A 5AJLA 3MCXA 3SFYA 1SZAA 3ZIMA 1WM5A 2AXUA 2VSXE 3HXBA 3NBNB 5AJDA 4RLYA 2Y4TA 4YDOA 3GZSA 4MBGA 3FUIA 4GYWA 3UUXA 2KZTA 1TNOA 1U3CA 3R9AB 3S2AA 4K5AB 5AIJA 1TJFA 3C72A 4UQZA 1E8ZA 1G3NB 1N54A 4I17A 1DCEA 3V2OA 2CG2A 5CMYA 5T4YA 5ENQD 3MX3A 3NB2A 3TGOA 1QZ2A 2X6KA 4U04A 2F0YA 2BUGA 4PUCA 4XZ4A 2E0IA 3D9OA 1DC2A 3RU0A 3EHQA 4EPZA 4ANXA 2P9KG 1IXVA 3DWLG 3RRMB 4J8FA 2VSYA 1KZPA 4UWHA 3KAEA 2ZGDA 1OY3D 3ONLA 4U8VD 2NC9A 4FHKA 3FWVA 4MS6A 5CBOA 3FUNA 2HO1A 2PM6A 3SGHA 3Q9NC 4JC8A 3RK6A 2X6FA 2UY1B 4GMRA 1LF8A 4BX9A 2LSVA 4M3OA 5EIDA 1FPPA 5ENPD 3HVEB 5EDSA 1BPOA 1O1RA 4HOSA 2AJAA 4UQYA 3CK9A 4DX5D 2IY0C 3HXEA 4U07A 3L6AA 1K1BA 4XKCA 1NA3A 2VGXB 3N71A 3LPZA 2B6CA 4BWRA 4LERA 3R9MA 4XX5A 5JHBA 3D9LA 4Y6CA 3UINC 2XENA 3D9NA 1QBQA 4CGVA 3CSFA 3AS5A 4NURA 5KNGA 2R17C 1BI8B 2J09A 3QAQA 1TYQG 3ZYMA 3S7DA 4FU3A 4KT6B 3AG3E 3ML8A 4N2SA 3PRZA 3KEZA 5JA4D 2PQRA 3URZA 3IBEA 3EU9A 3PH0C 3AU5A 3G2VA 3LXUX 5KJNA 2PZIA 4N39A 3LVRE 1O1SA 4U63A 2R59A 2XRYA 3LS8A 3L08A 2EINE 2FI7A 2WB2A 3ZRHA 1HH8A 3E4BA 5A7DB 4GYOA 4YNDA 5BW8C 2XPZA 3FU5A 2JEKA 3PZ1A 4JPSA 4LNBA 4ZHBA 4CEMA 3Q4AB 4EZKA 2QYUA 3KEAA 5EYPF 1TN8A 5CCLA 2XRZA 5BUZA 1TNYA 4EBAG 2AXZA 1HXIA 2VGEA 2C0MA 1NZNA 4GU5A 3VTXA 1K3ZD 2GRNB 5JJTA 2XZDG 2JLBA 1HO8A 3ZW3A 4IYPA 4HS2A 3T8KA 3QWPA 2VTBA 4J8DA 1N4RA 4RSYA 1Y8MA 2XS8A 4NQ0A 3HG0D 4FADA 5LP0A 1WG0A 1HX8A 4KYOB 5H7PA 2J4BA 4I9EA 3O48A 3G2TA 4CDMA 1UN9A 1HE8A 4GPKA 1LD8A 1YA0A 5JHAA 1Z6TA 4G24A 3I5PA 3UKUG 4Q69A 2WXKA 5ENNA 4GMLA 3CLJA 2L9BA 4M7CA 2KCLA 3E37A 4F7AA 2GGFA 1N4SA 1Q2ZA 4GPMA 3QWWA 2I1KA 4LG6A 3MJWA 3HXFA 3R7RA 2C2LA 2DBAA 3UTMA 4FA6A 2QY7A 3TG5A 4AV7A 1BLXB 4ANWA 1OWPA 3FEYA 2AWIA 2P9UG 3JXIA 4KXKB 5FQ8A 5AARA 1FVFA 4CZ2D 3EDTB 1DCQA 3I4RB 1SZ9A 1MX2A 4UI9C 2ZGGA 4JHKA 4XIFA 4I1MA 3AG4E 2HM8A 2P9LG 3LEWA 2XCCA 5C1DA 3CVPA 2V8SE 3K9IA 4I6EA 3QB2A 5FINA 3TWXA 4KVMA 2H6HA 1SQMA 4WNGA 4XI0A 3SFXA 4IRUA 4K5BA 3BQOA 2CHZA 3TWUA 3NOCD 4G1TA 4BSZB 3ASNE 3CKCA 5M72A 3HXDA 5JJ7A 2FEZA 4GZ3A 3RSEG 1TJCA 2GRRB 4O1PA 2XHEA 3CVUA 1PAQA 4G11A 2NXPA 5EIBE 4B8AA 1OCCE 3TWVA 2IFUA 4GZDA 3JCKC 4I2ZA 2NSZA 3LDZA 1MHQA 1BU9A 4JHJA 4BSXA 2BKGA 2FF4A 2XS1A 3PEUB 2J9QA 1X5BA 5B1AE 4EZLA 2GROB 5LCWJ 4OYSA 3CVVA 2LNIA 1Z5SC 4NIKA 3Q5MA 1E8WA 2L6BA 4G26A 3QKYA 2VJ8A 3LY7A 3FUEA 4A63B 4ACKA 2V5FA 4ILHB 3UI2A 2B0OE 5CEDB 4WNDA 1LTXA 1E8XA 5G04C 3FUKA 3MKQA 2IQCA 3IKOB 4TXQA 3S7FA 3PZ2A 3FTVA 2XPIA 2X6HA 3ASDA 4APOA 3D9KA 3Q75A 5CERB 2IO2C 5EX3A 2ZIRA 3Q73A 5FZQA 1NL4A 5ENSD 2Q7FA 4K5CA 4OVUA 3IHYA 3DPYA 4DX1A 3PZ4A 3L9TA 3HRAA 2ZXWE 4YDWA 2KCKA 2DZNA 3S7JA 2IF4A 3L22A 4UI9K 3AAAC 3PE4A 3TWQA 4A3TA 5EYLA 2CG3A 3ENEA 2EIKE 1MZCA 4HXIA 3CHRA 3PZDA 3BG1B 2H6FA 4TV3A 1FT2A 3FDHA 2VQ2A 3FTWA 1MQSA 3EUVA 3ZXPA 3ML9A 3D9IA 5ENTD 3CR3A 5FWQA 3RO3A 2J8SD 2V5QC 3CSTA 4GB9A 3ASFA 3B7RL 3D3MA 4G25A 4IULA 5D66A 1IHBA 3MYVA 3SF4A 5LOZA 3G2SA 2KBXA 3AS4A 5CBNA 3RJVA 2XGMA 5AENA 4GTPA 5D0QD 3DSXA 2X3MA 2IOLA 1WAO1 1WY6A 4KVOA 1H2VC 4ILIA 4A3VA 2J49A 2OVFA 4GMJA 4N3BA 1V54E 1QYMA 4B93B 4EQFA 3ULYA 2A4ZA 1Y6IA 4HRLA 1ELKA 2WXFA 2Y0BG 5G55A 1DNPA 3IV0A 2BTDA 5ANRA 1V55E 3Q47B 4FULA 1N95A 5T8IA 3TWSA 5E76A 3UPVA 3FP3A 3FTZA 2M63A 1IHGA 3E33A 1OWOA 2DVWA 2ONDA 1OWLA 4C0MA 5BXUA 3LKUA 3P2BA 3CIAA 3OAWA 2VGXA 1H6PA 3ZVVA 3UM3A 2GW1A 4LNUD 3NZUA 3ZPJA 4JB8P 4K0RA 4RVBA 5C2YA 5KJKA 1H0AA 4TUMA 3OXLA 1KPSB 3UT4A 4CT0A 2JABA 3ASHA 3QWVA 3ZN3A 4LEUA 4J8SA 3PS6A 4TXPA 2WXMA 3V2XA 4L1BA 2WMOA 4DLQA 5CCMA 3FHEA 3PDNA 5G05C 4GTTA 4I1AA 3SY2A 1FVHA 3TWRA 3O4ZA 4WNFA 3FULA 1ELRA 4L23A 3ULEG 2CFUA 3ABKE 2MHKA 1A17A 3AS8A 1JCRA 3HHMA 4N5CA 3SBSA 1E8YA 3EHRA 3CVNA 4I1OB 5CRVA 5ARFA 5FQ6A 3ZHEA 4C0EA 4AY6A 4U7EB 1HZ4A 3BUAA 3FEXA 4RG6A 4ILGA 4WWNA 2F37A 3VTYA 3MEKA 4J8YA 2WVIA 4PH4B 1DVPA 3SD5A 4BX8A 4L9PA 3UKRG 4YVOA 3DSTA 4ATZD 1U2VG 4FLHA 1MX6A 2RD0A 4UWKA 1QQEA 3EU5A 1S63A 4CDRA 5D0OD 1TNZA 2A5UA 5JMND 3Q9UC 3CV0A 3V79K 1H6KA 1YCSB 3CHPA 3FH8A 3ZFWA 2CHWA 3NF1A 3B7SA 3UM1A 1FT1A 2A5EA 1S70B 4YDEA 3HDXA 4ME2A 3FTSA 1S64A 3EHMA 3T5XA 3B7UX 4UWFA 1Z3YA 3CVXA 3LVQE 3LJNA 3CVYA 4U95D 3TWWA 3UM0A 3FUJA 1MX4A 2IOSA 3UT7A 4JXTA 4J6IA 1TNUA 3G2UA 3PEVB 2IEJA 4UWGA 3J5PA 4O1OA 4LRZA 4HB5A 5ENRD 4W9RA 2FO1E 3ASGA 3GYZA 3FU3A 3B13A 4AJWA 4HOQA 2YQ8A 4GAAA 2GRQB 3TXNA 4GCOA 3JQ0A 5AQAA 3MV2B 4Q96A 4MLPA 2KC7A 1HG5A 4UWLA 5BXOA 5KJMA 2WXHA 4GYYA 4U0SA 3FUHA 4BETA 3BG0B 1O1TA 4AIFA 5CECB 1N94A 1TR4A 2FULA 5B1BE 4HLEA 4AP2A 2VTBB 5HI7A 5AQ7A 4ATGA 4XEIG 4HRMB 3SZ7A 4PS3A 3DSVA 1ZB1A 2R5SA 3CHQA 2XPYA 4OAUC 4HI9A 4APFA 4DI3A 3DSWA 5CMWA 2I6HA 5A23A 5KJLA 1L5JA 4ZFHA 3SBTB 4AY5A 3SNXA 3TXMA 3ZUVB 2WQ6A 1OCZE 3RRUA 3C3OA 4L2LA 1OT8A 4JZYA 1E7UA 4AXHA 4J7WA 2HE0A 4BY6A 5BNWA 1UW4B 5J08A 5FZSA 3DEOA 4JA9A 3VLFA 3RRNB 2OVBA 1HU3A 5ANLA 3EJNA 3CK7A 2XEVA 5FQ7A 2WXNA 4O60A 3PREA 3L13A 2DCPA 2YINA 1XNFA 3LY9A 3NAWA 4E6HA 2WXRA 4DX2A 3CVLA 1H19A 4DLOA 3DPDA 1NFIE 3R7QA 1N0RA 2R02A 4CYMD 4H7XA 4Y6WA 1IQUA 2LAIA 4UUCA 3JUEA 3PUJA 3L17A 4XI9A 1YYHA 3CK8A 3EIQC 3PNTB 2RG8A 2F8YA 3KS2A 1U3DA 5CHEE 3CVWA 3OXGA 4JL0A 4GTRA 3Q7FA 3FTXA 3PNLB 4WNEA 3UX4A 4BT8A 1D9SA 3TL5A 4B94A 2H6GA 4GA1A 3FU0A 3JXJA 3AJIA 2ZISA 4GTMA 3ZYLA 3ABME 3F6QA 3C5RA 1N4PA 5FIOA 5AQBA 3UIOC 2LUHA 1N9AA 4I2WA 1TN7A 2DYSE 3ZEFA 3L82A 1BI7B 1JUQA 1HF8A 1S0PA 3C3QA 1B89A 3DRAA 4YVQC 3U64A 4J0UA 2PL2A 4DI4A 3FFLA 4KZ0A 2X6IA 4GA2A 4F6RD 5D2MC 5LX8A 4URKA 2RKKA 2KXPC 2XGOA 2DWZA 5AYWD 1E90A 2XGSA 4PDXA 2X38A 2OCCE 4EZJA 3T8MA 1UJJA 4TXRA 2QC9A 2IJGX 5BV1A 2KM4A 3UXGA 1INZA 1OWNA 4WWPA 4F3VA 4HLLA 3Q79A 3ZKJA 1N52A 3C3RA 3D9MA 2V4LA 5EILA 1AP7A 3LJ3A 3LCAA 3BU8A 3KSQA 4PS8A 2V4HC 5CRUA 4U0ZA 4F1SA 1IYGA 1E7VA 3HYMB 4GZCA 1PC2A 4FJYA 2IO3C 4DJAA 2L0TB 4B89A 2LXMA 2UWJG 3U3WA 4KZCA 3MV3B 5HRYA 2WM9A 2BEDA 4E85A 4EHMA 4OVVA 4WUYA 1O5MA 2AXVA 5LFAA 1UJKA 3DSSA 4UI9J 2LSUA 4GTQA 2J07A 5BT1A 2WXGA 4JEUA 2ZU6B 2XCBA 4F53A 4HRNA 3QC1A 5FJYA 4G23A 3AU4A 3PVLA 4GTSA 2UY1A 2WPVA 3U4TA 3S7BA 4FLBA 4J8EA 3HVEA 3E30A 2GRLA 5HS0A 2MOWA 5E75A 3PE3A 1UN8A 4GZ5A 4CDNA 5ENOD 4D10C 2WXPA 4CT4A 4HQDA 3SHFA 1IKND 1D8DA 2KZTB 3QNKA 4DK5A 2PQNA 2P9NG 3B7TA 4XE0A 2RFMA 4L7TA 3ZXSA 2DZOA 5AN8A 2ILRA 5HQ8A 1WDYA 1UG3A 2EQXA 3Q49B 4IN3B 1HFAA 3UIPC 2XEHA 4WWOA 2NYJA 2Y3AA 3APFA 2LO6A 5FQ4A 3T5VA 3IEGA 3D9PA 4B0ZA 3EHNA 1BD8A 1W3BA 2DIWA 2P9IG 5B3SE 3RAUA 3SO8A 4N3CA 2P9PG 3HXCA 4RQIA 4HBDA 5AAOA 4DUIA 3ZGQA 5T3RA 4EBAA 3ZU7B 4TRQA 2XZTG 3MKRA 4X8QA 2Y1LE 2AW6A 3CHOA 4G2VA 1MJ0A 1OXJA 3D9HA 1X81A 4MRUA 3ABLE 2J08A 1KT1A 2LXLA 3TWTA 5ITZF 3UM2A 2YHEA 1HG2A 2Y69E 3AG1E 1JPLA 5G04J 1OWMA 3L16A 5KWDA 5AQ9A 3FH5A 4GTVA 2HR2A 2V0PA 1AWCB 2C0LA 1ZU2A 1FCHA 1K1AA 4BEPA 4F1PA 2X6JA 5FZRA 2QYJA 4DX6D 2BF0X 2LAHA 2L0IA 4HOUA 3G2WA 1TN6A 3W9FA 4JVSA 3FUFA 5DBKA 5LCWC 3CHMA 5KBAA 1HS6A 1PY1A 4GCNA 2OEVA 3T9KA 1H2UA 4BESA 3ZHEB 3ASOE 4O6FA 3E34A 3FU6A 5KNHD 2GRMA 4HNAD 4HVBA 2E2EA 4AVXA 2EIJE 1KT0A 4NRHB 3SQVA 1TNBA 4LNGA 2MRIA 3IXEA 4U8HA 1H2TC 2ETBA 4JA7A 3ESLA 2IONA 2WXQA 3TG4A 4WAFA 2EIME 4NACA 4N2QA 5G2NA 1NP7A 5BPPA 3CHSA 4I9CA 4G8LA 4LSZE 1JCSA 4U8YD 3DSUA 2F8XK 3GZ1A 3ISMC 3P1UA 4N5QA 4CGWA 4C9BB 1K8KG 3SFZA 3OXFA 1GW6A 3B7BA 4LUNU 4PS7A 1KZOA 4HORA 1QNFA 4BTAA 3KD7A 4FJZA 2RFAA 4H7YA 3WG7E 3FH7A 1NA0A 2I2OA 3U9WA 1XGWA 3PZ3A 3Q15A 1ELWA 3RO2A 5FTPA 4LCTA 3TAXA 1EYHA 3EIJA 4L2YA 5EN5D 1P5QA 2VSNA 2WXLA 4U0UA 2P2CP 2YHCA 2MYOA 3MZLB 4N3AA 1IQRA 3CQGB 5JJ6A 5FT9A 2L6JA 4I43A 3Q7AA
chains in the Genus database with same CATH topology
4JD2G 3RSEG 3DXKG 2P9UG 1K8KG 1U2VG 2P9NG 1TYQG 2P9KG 2P9SG 2P9IG 3UKUG 3DXMG 3DWLG 3UKRG 2P9PG 4XEIG 2P9LG 3ULEG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JD2 G;  3RSE G;  3DXK G;  2P9U G;  1K8K G;  1U2V G;  2P9N G;  1TYQ G;  2P9K G;  2P9S G;  2P9I G;  3UKU G;  3DXM G;  3DWL G;  3UKR G;  2P9P G;  4XEI G;  2P9L G;  3ULE G; 
#chains in the Genus database with same CATH topology
 3UQ3 A;  3DBS A;  4QQI A;  3CKB A;  4C48 B;  4ANU A;  2WQ7 A;  3ESK A;  3FUM A;  4ACL A;  1SW6 A;  2QZA A;  3VLE A;  3C98 A;  4FC8 A;  3CVQ A;  4AEZ C;  2VGY A;  1VDY A;  3NQP A;  5DIZ A;  3I4G A;  3ZNG A;  3FTY A;  4GTO A;  3CGH A;  1OCR E;  2WQH A;  4A1G A;  2HYZ A;  4AOF A;  3WXX A;  3ULQ A;  3I3N A;  4Z68 A;  3D9J A;  3GW4 A;  1EPU A;  4GA0 A;  2GRP B;  2KAT A;  2ETA A;  3W9G A;  1TEZ A;  3JYS A;  4YDY A;  4FP7 A;  2WXI A;  3VLD A;  5G05 J;  3QDN A;  1E96 B;  3DXM G;  2R03 A;  4B8C B;  3OTN A;  1Z3X A;  3JQ1 A;  4FHJ A;  2OOE A;  3UMV A;  4HI8 A;  1OCO E;  2P9S G;  1EDU A;  1KLX A;  3U66 A;  1N0Q A;  1D8E A;  5CEA A;  2VYI A;  3RKV A;  3LY8 A;  3IHV A;  3MA5 A;  4CCA A;  2FO7 A;  3BEE A;  4BT9 A;  1UOH A;  2R2L A;  4BER A;  4JW1 A;  1ZBP A;  1LD7 A;  2YNQ A;  3MGB A;  4KMO A;  3QJZ A;  3TJP A;  5EX0 A;  1SA4 A;  3QAR A;  2PNN A;  2OEW A;  4XKB A;  4A1S A;  1RZ4 A;  3X2Q E;  2R05 A;  2AVP A;  1OUV A;  2OV8 A;  4G8K A;  2P58 C;  4JD2 G;  4EEC A;  3QK0 A;  1NI1 A;  1JCQ A;  2Y4U A;  2IU1 A;  3CQC B;  2CFZ A;  4ANV A;  2ETC A;  4I6J A;  3FUD A;  3CEQ A;  3QOU A;  2WMN A;  4BFR A;  3J5Q B;  3FTU A;  1JWG A;  2QFC A;  3DEP A;  3E32 A;  4JHR A;  4QFV A;  2J4D A;  2CHX A;  4P29 A;  5J90 A;  1N11 A;  5A6C A;  2PM7 A;  2EIL E;  4I6G A;  3B95 A;  4JEH A;  4BTB A;  5EKQ D;  3V30 A;  4MKT A;  3Q78 A;  3PUK A;  2WXJ A;  1A5E A;  3UT8 A;  1RW2 A;  1SVX A;  3NZS A;  4DX7 D;  4CRW A;  4DPR A;  3RIB A;  4KBQ A;  3HIZ A;  4Q94 A;  1JWF A;  1H6O A;  1SA5 A;  2H6I A;  5HKP A;  3FY4 A;  4DRX E;  5IY5 E;  3NOG D;  4K03 A;  4OAV B;  3GZ2 A;  3ONK A;  1YMP A;  4RG9 A;  2DYR E;  2I1J A;  3KSL A;  2FBN A;  4GZ6 A;  3ZYQ A;  4V3I A;  5ARG A;  3JUI A;  3L54 A;  1EF1 C;  2KCV A;  1MYO A;  3MKQ B;  3APD A;  5BV0 A;  3V31 A;  3APC A;  4UQX A;  5KCM A;  3AG2 E;  4A55 A;  4ABN A;  4HOT A;  1N4Q A;  3DXK G;  3LYA A;  4U96 D;  4HFG A;  3SI5 A;  4R7L A;  2I9C A;  3ZYK A;  2XQ0 A;  2VSO E;  2XEE A;  2WXO A;  4TUU A;  2BKK B;  4AM9 A;  5AJL A;  3MCX A;  3SFY A;  1SZA A;  3ZIM A;  1WM5 A;  2AXU A;  2VSX E;  3HXB A;  3NBN B;  5AJD A;  4RLY A;  2Y4T A;  4YDO A;  3GZS A;  4MBG A;  3FUI A;  4GYW A;  3UUX A;  2KZT A;  1TNO A;  1U3C A;  3R9A B;  3S2A A;  4K5A B;  5AIJ A;  1TJF A;  3C72 A;  4UQZ A;  1E8Z A;  1G3N B;  1N54 A;  4I17 A;  1DCE A;  3V2O A;  2CG2 A;  5CMY A;  5T4Y A;  5ENQ D;  3MX3 A;  3NB2 A;  3TGO A;  1QZ2 A;  2X6K A;  4U04 A;  2F0Y A;  2BUG A;  4PUC A;  4XZ4 A;  2E0I A;  3D9O A;  1DC2 A;  3RU0 A;  3EHQ A;  4EPZ A;  4ANX A;  2P9K G;  1IXV A;  3DWL G;  3RRM B;  4J8F A;  2VSY A;  1KZP A;  4UWH A;  3KAE A;  2ZGD A;  1OY3 D;  3ONL A;  4U8V D;  2NC9 A;  4FHK A;  3FWV A;  4MS6 A;  5CBO A;  3FUN A;  2HO1 A;  2PM6 A;  3SGH A;  3Q9N C;  4JC8 A;  3RK6 A;  2X6F A;  2UY1 B;  4GMR A;  1LF8 A;  4BX9 A;  2LSV A;  4M3O A;  5EID A;  1FPP A;  5ENP D;  3HVE B;  5EDS A;  1BPO A;  1O1R A;  4HOS A;  2AJA A;  4UQY A;  3CK9 A;  4DX5 D;  2IY0 C;  3HXE A;  4U07 A;  3L6A A;  1K1B A;  4XKC A;  1NA3 A;  2VGX B;  3N71 A;  3LPZ A;  2B6C A;  4BWR A;  4LER A;  3R9M A;  4XX5 A;  5JHB A;  3D9L A;  4Y6C A;  3UIN C;  2XEN A;  3D9N A;  1QBQ A;  4CGV A;  3CSF A;  3AS5 A;  4NUR A;  5KNG A;  2R17 C;  1BI8 B;  2J09 A;  3QAQ A;  1TYQ G;  3ZYM A;  3S7D A;  4FU3 A;  4KT6 B;  3AG3 E;  3ML8 A;  4N2S A;  3PRZ A;  3KEZ A;  5JA4 D;  2PQR A;  3URZ A;  3IBE A;  3EU9 A;  3PH0 C;  3AU5 A;  3G2V A;  3LXU X;  5KJN A;  2PZI A;  4N39 A;  3LVR E;  1O1S A;  4U63 A;  2R59 A;  2XRY A;  3LS8 A;  3L08 A;  2EIN E;  2FI7 A;  2WB2 A;  3ZRH A;  1HH8 A;  3E4B A;  5A7D B;  4GYO A;  4YND A;  5BW8 C;  2XPZ A;  3FU5 A;  2JEK A;  3PZ1 A;  4JPS A;  4LNB A;  4ZHB A;  4CEM A;  3Q4A B;  4EZK A;  2QYU A;  3KEA A;  5EYP F;  1TN8 A;  5CCL A;  2XRZ A;  5BUZ A;  1TNY A;  4EBA G;  2AXZ A;  1HXI A;  2VGE A;  2C0M A;  1NZN A;  4GU5 A;  3VTX A;  1K3Z D;  2GRN B;  5JJT A;  2XZD G;  2JLB A;  1HO8 A;  3ZW3 A;  4IYP A;  4HS2 A;  3T8K A;  3QWP A;  2VTB A;  4J8D A;  1N4R A;  4RSY A;  1Y8M A;  2XS8 A;  4NQ0 A;  3HG0 D;  4FAD A;  5LP0 A;  1WG0 A;  1HX8 A;  4KYO B;  5H7P A;  2J4B A;  4I9E A;  3O48 A;  3G2T A;  4CDM A;  1UN9 A;  1HE8 A;  4GPK A;  1LD8 A;  1YA0 A;  5JHA A;  1Z6T A;  4G24 A;  3I5P A;  3UKU G;  4Q69 A;  2WXK A;  5ENN A;  4GML A;  3CLJ A;  2L9B A;  4M7C A;  2KCL A;  3E37 A;  4F7A A;  2GGF A;  1N4S A;  1Q2Z A;  4GPM A;  3QWW A;  2I1K A;  4LG6 A;  3MJW A;  3HXF A;  3R7R A;  2C2L A;  2DBA A;  3UTM A;  4FA6 A;  2QY7 A;  3TG5 A;  4AV7 A;  1BLX B;  4ANW A;  1OWP A;  3FEY A;  2AWI A;  2P9U G;  3JXI A;  4KXK B;  5FQ8 A;  5AAR A;  1FVF A;  4CZ2 D;  3EDT B;  1DCQ A;  3I4R B;  1SZ9 A;  1MX2 A;  4UI9 C;  2ZGG A;  4JHK A;  4XIF A;  4I1M A;  3AG4 E;  2HM8 A;  2P9L G;  3LEW A;  2XCC A;  5C1D A;  3CVP A;  2V8S E;  3K9I A;  4I6E A;  3QB2 A;  5FIN A;  3TWX A;  4KVM A;  2H6H A;  1SQM A;  4WNG A;  4XI0 A;  3SFX A;  4IRU A;  4K5B A;  3BQO A;  2CHZ A;  3TWU A;  3NOC D;  4G1T A;  4BSZ B;  3ASN E;  3CKC A;  5M72 A;  3HXD A;  5JJ7 A;  2FEZ A;  4GZ3 A;  3RSE G;  1TJC A;  2GRR B;  4O1P A;  2XHE A;  3CVU A;  1PAQ A;  4G11 A;  2NXP A;  5EIB E;  4B8A A;  1OCC E;  3TWV A;  2IFU A;  4GZD A;  3JCK C;  4I2Z A;  2NSZ A;  3LDZ A;  1MHQ A;  1BU9 A;  4JHJ A;  4BSX A;  2BKG A;  2FF4 A;  2XS1 A;  3PEU B;  2J9Q A;  1X5B A;  5B1A E;  4EZL A;  2GRO B;  5LCW J;  4OYS A;  3CVV A;  2LNI A;  1Z5S C;  4NIK A;  3Q5M A;  1E8W A;  2L6B A;  4G26 A;  3QKY A;  2VJ8 A;  3LY7 A;  3FUE A;  4A63 B;  4ACK A;  2V5F A;  4ILH B;  3UI2 A;  2B0O E;  5CED B;  4WND A;  1LTX A;  1E8X A;  5G04 C;  3FUK A;  3MKQ A;  2IQC A;  3IKO B;  4TXQ A;  3S7F A;  3PZ2 A;  3FTV A;  2XPI A;  2X6H A;  3ASD A;  4APO A;  3D9K A;  3Q75 A;  5CER B;  2IO2 C;  5EX3 A;  2ZIR A;  3Q73 A;  5FZQ A;  1NL4 A;  5ENS D;  2Q7F A;  4K5C A;  4OVU A;  3IHY A;  3DPY A;  4DX1 A;  3PZ4 A;  3L9T A;  3HRA A;  2ZXW E;  4YDW A;  2KCK A;  2DZN A;  3S7J A;  2IF4 A;  3L22 A;  4UI9 K;  3AAA C;  3PE4 A;  3TWQ A;  4A3T A;  5EYL A;  2CG3 A;  3ENE A;  2EIK E;  1MZC A;  4HXI A;  3CHR A;  3PZD A;  3BG1 B;  2H6F A;  4TV3 A;  1FT2 A;  3FDH A;  2VQ2 A;  3FTW A;  1MQS A;  3EUV A;  3ZXP A;  3ML9 A;  3D9I A;  5ENT D;  3CR3 A;  5FWQ A;  3RO3 A;  2J8S D;  2V5Q C;  3CST A;  4GB9 A;  3ASF A;  3B7R L;  3D3M A;  4G25 A;  4IUL A;  5D66 A;  1IHB A;  3MYV A;  3SF4 A;  5LOZ A;  3G2S A;  2KBX A;  3AS4 A;  5CBN A;  3RJV A;  2XGM A;  5AEN A;  4GTP A;  5D0Q D;  3DSX A;  2X3M A;  2IOL A;  1WAO 1;  1WY6 A;  4KVO A;  1H2V C;  4ILI A;  4A3V A;  2J49 A;  2OVF A;  4GMJ A;  4N3B A;  1V54 E;  1QYM A;  4B93 B;  4EQF A;  3ULY A;  2A4Z A;  1Y6I A;  4HRL A;  1ELK A;  2WXF A;  2Y0B G;  5G55 A;  1DNP A;  3IV0 A;  2BTD A;  5ANR A;  1V55 E;  3Q47 B;  4FUL A;  1N95 A;  5T8I A;  3TWS A;  5E76 A;  3UPV A;  3FP3 A;  3FTZ A;  2M63 A;  1IHG A;  3E33 A;  1OWO A;  2DVW A;  2OND A;  1OWL A;  4C0M A;  5BXU A;  3LKU A;  3P2B A;  3CIA A;  3OAW A;  2VGX A;  1H6P A;  3ZVV A;  3UM3 A;  2GW1 A;  4LNU D;  3NZU A;  3ZPJ A;  4JB8 P;  4K0R A;  4RVB A;  5C2Y A;  5KJK A;  1H0A A;  4TUM A;  3OXL A;  1KPS B;  3UT4 A;  4CT0 A;  2JAB A;  3ASH A;  3QWV A;  3ZN3 A;  4LEU A;  4J8S A;  3PS6 A;  4TXP A;  2WXM A;  3V2X A;  4L1B A;  2WMO A;  4DLQ A;  5CCM A;  3FHE A;  3PDN A;  5G05 C;  4GTT A;  4I1A A;  3SY2 A;  1FVH A;  3TWR A;  3O4Z A;  4WNF A;  3FUL A;  1ELR A;  4L23 A;  3ULE G;  2CFU A;  3ABK E;  2MHK A;  1A17 A;  3AS8 A;  1JCR A;  3HHM A;  4N5C A;  3SBS A;  1E8Y A;  3EHR A;  3CVN A;  4I1O B;  5CRV A;  5ARF A;  5FQ6 A;  3ZHE A;  4C0E A;  4AY6 A;  4U7E B;  1HZ4 A;  3BUA A;  3FEX A;  4RG6 A;  4ILG A;  4WWN A;  2F37 A;  3VTY A;  3MEK A;  4J8Y A;  2WVI A;  4PH4 B;  1DVP A;  3SD5 A;  4BX8 A;  4L9P A;  3UKR G;  4YVO A;  3DST A;  4ATZ D;  1U2V G;  4FLH A;  1MX6 A;  2RD0 A;  4UWK A;  1QQE A;  3EU5 A;  1S63 A;  4CDR A;  5D0O D;  1TNZ A;  2A5U A;  5JMN D;  3Q9U C;  3CV0 A;  3V79 K;  1H6K A;  1YCS B;  3CHP A;  3FH8 A;  3ZFW A;  2CHW A;  3NF1 A;  3B7S A;  3UM1 A;  1FT1 A;  2A5E A;  1S70 B;  4YDE A;  3HDX A;  4ME2 A;  3FTS A;  1S64 A;  3EHM A;  3T5X A;  3B7U X;  4UWF A;  1Z3Y A;  3CVX A;  3LVQ E;  3LJN A;  3CVY A;  4U95 D;  3TWW A;  3UM0 A;  3FUJ A;  1MX4 A;  2IOS A;  3UT7 A;  4JXT A;  4J6I A;  1TNU A;  3G2U A;  3PEV B;  2IEJ A;  4UWG A;  3J5P A;  4O1O A;  4LRZ A;  4HB5 A;  5ENR D;  4W9R A;  2FO1 E;  3ASG A;  3GYZ A;  3FU3 A;  3B13 A;  4AJW A;  4HOQ A;  2YQ8 A;  4GAA A;  2GRQ B;  3TXN A;  4GCO A;  3JQ0 A;  5AQA A;  3MV2 B;  4Q96 A;  4MLP A;  2KC7 A;  1HG5 A;  4UWL A;  5BXO A;  5KJM A;  2WXH A;  4GYY A;  4U0S A;  3FUH A;  4BET A;  3BG0 B;  1O1T A;  4AIF A;  5CEC B;  1N94 A;  1TR4 A;  2FUL A;  5B1B E;  4HLE A;  4AP2 A;  2VTB B;  5HI7 A;  5AQ7 A;  4ATG A;  4XEI G;  4HRM B;  3SZ7 A;  4PS3 A;  3DSV A;  1ZB1 A;  2R5S A;  3CHQ A;  2XPY A;  4OAU C;  4HI9 A;  4APF A;  4DI3 A;  3DSW A;  5CMW A;  2I6H A;  5A23 A;  5KJL A;  1L5J A;  4ZFH A;  3SBT B;  4AY5 A;  3SNX A;  3TXM A;  3ZUV B;  2WQ6 A;  1OCZ E;  3RRU A;  3C3O A;  4L2L A;  1OT8 A;  4JZY A;  1E7U A;  4AXH A;  4J7W A;  2HE0 A;  4BY6 A;  5BNW A;  1UW4 B;  5J08 A;  5FZS A;  3DEO A;  4JA9 A;  3VLF A;  3RRN B;  2OVB A;  1HU3 A;  5ANL A;  3EJN A;  3CK7 A;  2XEV A;  5FQ7 A;  2WXN A;  4O60 A;  3PRE A;  3L13 A;  2DCP A;  2YIN A;  1XNF A;  3LY9 A;  3NAW A;  4E6H A;  2WXR A;  4DX2 A;  3CVL A;  1H19 A;  4DLO A;  3DPD A;  1NFI E;  3R7Q A;  1N0R A;  2R02 A;  4CYM D;  4H7X A;  4Y6W A;  1IQU A;  2LAI A;  4UUC A;  3JUE A;  3PUJ A;  3L17 A;  4XI9 A;  1YYH A;  3CK8 A;  3EIQ C;  3PNT B;  2RG8 A;  2F8Y A;  3KS2 A;  1U3D A;  5CHE E;  3CVW A;  3OXG A;  4JL0 A;  4GTR A;  3Q7F A;  3FTX A;  3PNL B;  4WNE A;  3UX4 A;  4BT8 A;  1D9S A;  3TL5 A;  4B94 A;  2H6G A;  4GA1 A;  3FU0 A;  3JXJ A;  3AJI A;  2ZIS A;  4GTM A;  3ZYL A;  3ABM E;  3F6Q A;  3C5R A;  1N4P A;  5FIO A;  5AQB A;  3UIO C;  2LUH A;  1N9A A;  4I2W A;  1TN7 A;  2DYS E;  3ZEF A;  3L82 A;  1BI7 B;  1JUQ A;  1HF8 A;  1S0P A;  3C3Q A;  1B89 A;  3DRA A;  4YVQ C;  3U64 A;  4J0U A;  2PL2 A;  4DI4 A;  3FFL A;  4KZ0 A;  2X6I A;  4GA2 A;  4F6R D;  5D2M C;  5LX8 A;  4URK A;  2RKK A;  2KXP C;  2XGO A;  2DWZ A;  5AYW D;  1E90 A;  2XGS A;  4PDX A;  2X38 A;  2OCC E;  4EZJ A;  3T8M A;  1UJJ A;  4TXR A;  2QC9 A;  2IJG X;  5BV1 A;  2KM4 A;  3UXG A;  1INZ A;  1OWN A;  4WWP A;  4F3V A;  4HLL A;  3Q79 A;  3ZKJ A;  1N52 A;  3C3R A;  3D9M A;  2V4L A;  5EIL A;  1AP7 A;  3LJ3 A;  3LCA A;  3BU8 A;  3KSQ A;  4PS8 A;  2V4H C;  5CRU A;  4U0Z A;  4F1S A;  1IYG A;  1E7V A;  3HYM B;  4GZC A;  1PC2 A;  4FJY A;  2IO3 C;  4DJA A;  2L0T B;  4B89 A;  2LXM A;  2UWJ G;  3U3W A;  4KZC A;  3MV3 B;  5HRY A;  2WM9 A;  2BED A;  4E85 A;  4EHM A;  4OVV A;  4WUY A;  1O5M A;  2AXV A;  5LFA A;  1UJK A;  3DSS A;  4UI9 J;  2LSU A;  4GTQ A;  2J07 A;  5BT1 A;  2WXG A;  4JEU A;  2ZU6 B;  2XCB A;  4F53 A;  4HRN A;  3QC1 A;  5FJY A;  4G23 A;  3AU4 A;  3PVL A;  4GTS A;  2UY1 A;  2WPV A;  3U4T A;  3S7B A;  4FLB A;  4J8E A;  3HVE A;  3E30 A;  2GRL A;  5HS0 A;  2MOW A;  5E75 A;  3PE3 A;  1UN8 A;  4GZ5 A;  4CDN A;  5ENO D;  4D10 C;  2WXP A;  4CT4 A;  4HQD A;  3SHF A;  1IKN D;  1D8D A;  2KZT B;  3QNK A;  4DK5 A;  2PQN A;  2P9N G;  3B7T A;  4XE0 A;  2RFM A;  4L7T A;  3ZXS A;  2DZO A;  5AN8 A;  2ILR A;  5HQ8 A;  1WDY A;  1UG3 A;  2EQX A;  3Q49 B;  4IN3 B;  1HFA A;  3UIP C;  2XEH A;  4WWO A;  2NYJ A;  2Y3A A;  3APF A;  2LO6 A;  5FQ4 A;  3T5V A;  3IEG A;  3D9P A;  4B0Z A;  3EHN A;  1BD8 A;  1W3B A;  2DIW A;  2P9I G;  5B3S E;  3RAU A;  3SO8 A;  4N3C A;  2P9P G;  3HXC A;  4RQI A;  4HBD A;  5AAO A;  4DUI A;  3ZGQ A;  5T3R A;  4EBA A;  3ZU7 B;  4TRQ A;  2XZT G;  3MKR A;  4X8Q A;  2Y1L E;  2AW6 A;  3CHO A;  4G2V A;  1MJ0 A;  1OXJ A;  3D9H A;  1X81 A;  4MRU A;  3ABL E;  2J08 A;  1KT1 A;  2LXL A;  3TWT A;  5ITZ F;  3UM2 A;  2YHE A;  1HG2 A;  2Y69 E;  3AG1 E;  1JPL A;  5G04 J;  1OWM A;  3L16 A;  5KWD A;  5AQ9 A;  3FH5 A;  4GTV A;  2HR2 A;  2V0P A;  1AWC B;  2C0L A;  1ZU2 A;  1FCH A;  1K1A A;  4BEP A;  4F1P A;  2X6J A;  5FZR A;  2QYJ A;  4DX6 D;  2BF0 X;  2LAH A;  2L0I A;  4HOU A;  3G2W A;  1TN6 A;  3W9F A;  4JVS A;  3FUF A;  5DBK A;  5LCW C;  3CHM A;  5KBA A;  1HS6 A;  1PY1 A;  4GCN A;  2OEV A;  3T9K A;  1H2U A;  4BES A;  3ZHE B;  3ASO E;  4O6F A;  3E34 A;  3FU6 A;  5KNH D;  2GRM A;  4HNA D;  4HVB A;  2E2E A;  4AVX A;  2EIJ E;  1KT0 A;  4NRH B;  3SQV A;  1TNB A;  4LNG A;  2MRI A;  3IXE A;  4U8H A;  1H2T C;  2ETB A;  4JA7 A;  3ESL A;  2ION A;  2WXQ A;  3TG4 A;  4WAF A;  2EIM E;  4NAC A;  4N2Q A;  5G2N A;  1NP7 A;  5BPP A;  3CHS A;  4I9C A;  4G8L A;  4LSZ E;  1JCS A;  4U8Y D;  3DSU A;  2F8X K;  3GZ1 A;  3ISM C;  3P1U A;  4N5Q A;  4CGW A;  4C9B B;  1K8K G;  3SFZ A;  3OXF A;  1GW6 A;  3B7B A;  4LUN U;  4PS7 A;  1KZO A;  4HOR A;  1QNF A;  4BTA A;  3KD7 A;  4FJZ A;  2RFA A;  4H7Y A;  3WG7 E;  3FH7 A;  1NA0 A;  2I2O A;  3U9W A;  1XGW A;  3PZ3 A;  3Q15 A;  1ELW A;  3RO2 A;  5FTP A;  4LCT A;  3TAX A;  1EYH A;  3EIJ A;  4L2Y A;  5EN5 D;  1P5Q A;  2VSN A;  2WXL A;  4U0U A;  2P2C P;  2YHC A;  2MYO A;  3MZL B;  4N3A A;  1IQR A;  3CQG B;  5JJ6 A;  5FT9 A;  2L6J A;  4I43 A;  3Q7A A; 
#chains in the Genus database with same CATH homology
 4JD2 G;  3RSE G;  3DXK G;  2P9U G;  1K8K G;  1U2V G;  2P9N G;  1TYQ G;  2P9K G;  2P9S G;  2P9I G;  3UKU G;  3DXM G;  3DWL G;  3UKR G;  2P9P G;  4XEI G;  2P9L G;  3ULE G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...