3T5XA

Pcid2:dss1 structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
195
structure length
195
Chain Sequence
STAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PCI domain-containing protein 2
total genus 66
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01399 PCI PCI domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t5xA02
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3t5xA01
4KMUX 1ZG1A 1FWZA 1W7PD 5LHIA 1J75A 1BC8C 4ZYEA 3KFWX 5H6RA 1STZA 4B09A 3ML6A 1PDNC 4RB1A 3W6KB 2JRTA 1K7AA 2MA3A 3BJAA 2HYFA 3RJPA 4N0BA 2V1DA 2HGCA 1KA8A 3E3VA 2KRFA 2ZMEB 4EQQA 4EM2A 1LEAA 4OIRF 2KIUA 3RYPA 2L4MA 4M73A 4MGRA 1ZG5A 3GLXA 2C6YA 1TQPA 2EV5A 1LEBA 2QLZA 1ULYA 2BBYA 2M45A 1DUXC 4WXCA 3E97A 3K1PA 5ILVA 4WXDA 4XSZF 4M9ZA 3LQRA 1H9TA 4GXOA 2QM3A 4L9JA 5HS8A 5L3DA 1GXQA 4G9YA 3V7SA 1KQ8A 4OINF 3ROUA 4HYEA 5FGMA 2L54A 4CZZA 3HTUA 2HFHA 5HOOA 1EH6A 2QZ8A 3KZZA 4LB6B 2H09A 3BROA 2MD5A 4HX7A 2HKXA 4TV7A 1HXDA 2LDUA 2O6GE 1UB9A 3TDUC 3NQOA 2MLKA 3I53A 3D0SA 1FSHA 2CSOA 1LB2A 1TW3A 3GF2A 2LKPA 5E1WA 3DKWA 4EMSA 1Q1HA 1T98A 3U9GA 3RI4A 2ZO4A 4ETSA 2DTRA 3KP4A 3JSOA 1RIOH 2M30A 2F2EA 1TNSA 4I02A 1R22A 4P55A 1S7AA 3K1MA 3K0LA 3RKXA 1XSXA 1ZGAA 2ZCWA 5ICGA 4U0YA 3EETA 2KJBA 1OPCA 1WWXA 1UCRA 3HOTA 5K5QA 5A2QZ 4FHTA 2O3FA 4IVNA 2LF7A 2ZBKA 3L00A 2ESHA 3ISPA 2XUBA 3G73A 5LEJA 4MQVA 2VBZA 5HDGA 4LG0A 4I2OA 5FB2A 5HLGA 1FPQA 3CUQB 4ZYHA 5JI6A 5L3BA 1TTYA 1B6AA 2V9VA 1O57A 1SAXA 1IZ1A 4Z2YA 5TRDA 4NB5A 3QU3A 4I0AA 3J7AO 3ZN0A 1SMYF 1Z7UA 2DT5A 1H0MA 2K7LA 3DEUA 4ON0A 2NNNA 2XRNA 3J81Z 2NRAC 1SD6A 4IRIA 4O6JA 1GHCA 5D5VB 1YG2A 2FOKA 3BP8A 3HRTA 2E1CA 3ERED 2CFXA 4KT5C 4R79A 1O7FA 2STWA 1U5TB 4ENMA 2Z33A 4H0EA 5FD5A 3WGGA 5E1ZB 4CXFA 2YX7A 3WE3A 3LA2A 2CO5A 3GFIA 1O7LA 4I01A 4CICA 5J6XA 2EA4A 3OV8A 3TGNA 5E8GA 1IRFA 4L9TA 2Y75A 3QP6A 4M6YA 3LFKA 2XIGA 4BQAA 1QPMA 1ZH5A 3N97A 4Y17A 1FYLA 2O61A 4XLPF 2CW0F 3TXMA 1XD7A 1B59A 3FM3A 1FBSA 1KQ9A 1GXPA 4I98B 4L18B 2BYVE 4I0BA 3LAJA 3CTAA 2VE8A 1BI1A 5LLQA 1G3SA 2MH2A 4BHCA 4ESBA 4AIKA 3I71A 2KKOA 1ZYRF 3E6CC 2DK5A 3EYIA 3BY6A 4M9XA 3F6VA 1ZRFA 4UHTA 2L3DA 2O03A 1ZGJA 5HLIA 2G9WA 2RN7A 2PEXA 2D45A 5ED4A 4HQMA 3GUDA 1HKQA 1KYZA 3MWMA 5D4SA 1S29A 3TO7A 2ZKZA 2FRHA 3Q9SA 4PZJA 2IT0A 2QQ9A 3GVAA 2ISZA 4KN7X 1U5TC 5D8KB 3HSEA 2H94A 5L3CA 3IHUA 3RKYA 3K9TA 3ABTA 2MLGA 1IUYA 3HOSA 4GGGA 4P5OA 1O3QA 2XV4S 5ICFA 1IXRC 1R5GA 5KK1A 1IW7F 1IN7A 2GIVA 1IXSB 3GXOA 5CVUA 2EV6A 1FLIA 1CF7A 2DAOA 1XCVA 2GA2A 3IRQA 4HDUA 5BOXA 2A61A 3WU1B 4YFNF 4EGZA 1HW5A 1LQ1A 2TDXA 5DDGA 4MHGA 2MC3A 1DDNA 3JW4A 4P96A 4LFUA 3BDDA 4JK1X 4IHSA 1P4AA 3GO5A 2PG4A 2FMLA 4LCTA 2JZYA 1Z6RA 1MDMB 1XGMA 2ELHA 3HYIA 1MJBA 2AS5F 3IRRA 5HDNA 3WGIA 1F9NA 3ZMTA 3TDZC 4EGYA 3GFJA 1GVJA 3BJOA 4E70A 1S3JA 2GQQA 4AWXB 4OIOF 2QBYA 5IT9K 3R0JA 1S7OA 1FSEA 4HLYA 2P5KA 1JXSA 2HQRA 2VOOA 2HYGD 3R61A 3FHZA 2CGPA 3GFLA 1YW7A 2HTSA 4PCQA 1U2WA 1OYYA 3FM5A 4FX4A 2FF4A 3B73A 4S05A 2DFIA 4A0ZA 1RI7A 3C18A 2PQ8A 5HS7A 4OIPF 3JTHA 1IXCA 4KIGA 4WWCA 3GZ6A 1CF7B 1LNWA 2BE5F 1C0WA 1B9NA 2DBBA 1G4DA 1IF1A 3DF8A 2CWEA 4RGRA 4HQEA 3MCZA 2AXLA 3HRUA 3E6MA 4P9UA 3EDPA 1KU2A 1USSA 2O0YA 1HKSA 2IJLA 1EH7A 2Q8KA 1EH8A 2QENA 4K2EA 1U78A 2GWRA 3CO6C 2H6CA 2L02A 2DPDA 4LG0B 1XB4A 5LHHA 3T8RA 1Z05A 3ZMVA 1TQMA 2DW4A 2D1VA 2QBYB 3DFGA 4A5MA 2L01A 3VOEA 5E18F 1T0FA 4RB3C 1BC7C 2A6HF 3EQLF 1FT9A 1ZRDA 2WV0A 3V7CA 5K5RA 2HTJA 2MH9A 4XSXF 4L0ZB 3HTSB 2QQBA 3AAFA 1XMAA 2HS5A 4CO8A 3W6JB 3JAMZ 4U88A 4HZFA 3P9IA 3SHFA 3VODA 2EFOA 3KP6A 2EFNA 3CHMA 1B4AA 3KP7A 2EA2A 3KLOA 2GA1A 5F1RA 2OZUA 3MZHA 1BIBA 1KU3A 2V1XA 2VONA 3I59A 2PMUA 5CVRA 3P7NA 1FZPB 5HLHA 4HAMA 1MKMA 2RDPA 1R23A 2FNAA 4IF4A 4UV8A 1YW8A 2J5OA 4Q5SF 4IJAA 4BHPA 5DEQA 2V6CA 1L3LA 3RPUA 4A0XA 1R58A 4HV5A 2COMA 3J80Z 2F5EA 2FMYA 4HDVA 3WG9A 3P9CA 2JTVA 4LJZF 2GAUA 5LGUA 4ASNA 1BI2A 3Q9VA 4RGSA 3WTUC 4AIJA 1IN6A 1R1VA 3QU6A 4U7BA 2M5WA 4S04A 3GEZA 1IN4A 5D4RA 1YFHA 3GYHX 4UXNA 2FU4A 1BOAA 4Y15A 3B02A 4BXUA 2JT1A 3K2ZA 1E2XA 4MNUA 3COAC 2MBFA 2XAHA 2VE9A 3MAJA 2D2WA 4M71A 5LRRA 3EUHA 1XN7A 4G6DA 4M74A 1TBXA 1YLFA 3WTSC 1XDSA 3L09A 2PJPA 4RGXA 4D10C 2IA0A 1T6SA 1WKMA 3K1NA 4AVPA 2ESNA 4IXAA 1U3EM 4M72A 4WF2A 3RPQA 2PBIA 3HSFA 2STTA 2EJRA 3FXUA 3FMSA 1BI0A 1MJ9A 5IT9Z 3M8EA 1BM9A 4KN4X 3MQ0A 2XAFA 2G7UA 1FYMA 5E17F 4EV0A 1FBUA 4RGUA 3U1DA 1XGNA 4EJTA 1W7PB 2HOEA 5BMZA 3T8TA 1R5HA 2CQKA 3H3ZA 4LB5A 1F4KA 1P4WA 2EWNA 2E1NA 2EB7A 1MD0A 1SFEA 2ZXJA 3CUQA 1S8NA 3WE2A 3I64A 1IN5A 2P6SA 3SZPA 1R1UA 5F6FA 2UXXA 1FYKA 3M8FA 5CYVA 3F3XA 4IRGA 4M9SA 3WU0A 1YS7A 3TOBA 2V79A 4KIBA 1XCBA 3WTZA 2DPUA 1FOKA 2QWWA 2VN2A 3KP3A 3T0YA 4CHUA 1ON1A 1KU7A 2IA2A 1DP7P 4OIQF 1I1SA 1HSTA 2P7VB 5E8IA 4LLLA 5EEGA 1B9MA 4Q48A 1LDDA 1O3RA 2D1HA 4WK8F 4RB0A 3DPTA 3FMRA 4CDGA 1XGSA 3CUQC 3BPXA 5CJ9A 4CGZA 1D5VA 1ZAOA 4I7HA 2F5DA 4O5VA 4U0WA 3VEPA 3KP5A 3ZMDA 3IKTA 4Q47A 3I4PA 1YO5C 1KGSA 5BPDA 1UFMA 4G8XA 4U0VA 3TOAA 3JSPA 2Q2EA 3H3UA 4LMYA 5HVQC 5JR3A 5TJJA 2OD5A 5D5UB 1SFXA 3F8BA 5LBQA 5BPIA 4R8HA 1G3TA 2WC2A 5E1XA 3EYYA 1B1BA 4I09A 2H6BA 2MRIA 2Z3YA 2P5LC 2JPBA 3FXRA 1DPUA 3ULQB 1HSJA 5DD8A 1NHAA 2JPCA 3CDHA 1SD4A 5L3EA 4HA8A 3IWZA 1HW2A 2OQRA 1LJ9A 1HBXG 3FWEA 2O8XA 3O2PE 4UUVA 5AIQA 2VXZA 3FXQA 2NNYA 4LGWA 1ZG3A 4EJOA 2L4AA 2Z99A 5FD6A 4MTEA 5LGNA 2M1BA 4CYDA 2IPQX 1TLHB 3DXJF 1IAWA 1FBQA 4YIIA 2DLLA 3E6BA 1Z91A 2F5CA 4P9FA 4IHTA 3ZMSA 3V8KA 3KETA 1U5TA 4ENJA 2XAJA 4UVCA 4QWQA 4BYYA 3F8MA 3M7GA 4MEXF 1EV7A 4AIHA 1K79A 4MEYF 5DV5A 3D5LA 2FXAA 1U8RA 2A69F 4G7HF 1RUOA 5D5WB 1G3WA 1I5ZA 1YS6A 2P4WA 5DUKA 3ZPLA 4HF0A 3L9FA 3R6SA 3HIFA 4ESJA 2LSOA 1ZARA 1V4RA 4YG2F 3BWGA 1J0RA 3IKVA 4KIFA 1F1ZA 1BIAA 2ZNZA 5ICCA 1TQIA 3IC7A 2R3SA 3I54A 5HDKA 1AOYA 2Z9OA 3G3ZA 3F6OA 4HOBA 3HSRA 1J5YA 4RS8A 4DNCA 1G6NA 2PMHA 2BEOA 4Y13A 3LA3A 3M9AA 5D8LB 3E5UA 1VTNC 1IN8A 4D0PA 2ACJA 2XKOA 4G7ZF 4A2UA 5BQTA 2NS0A 1J2XA 2K4JA 3DQVC 3DP7A 1JHHA 2PN6A 3F21A 3F8CA 3KEQA 2R7FA 2HR3A 2K4BA 3JTGA 2YR2A 4HX4A 1ZLJA 3Q5FA 1R7JA 1I27A 3PQJA 5JHUA 2BGCA 4U7DA 1I1GA 4KUMA 4WCGA 3I58A 3TO6A 3BPVA 4A12A 3N4MA 3WTTC 4B8XA 4G7OF 1QBJA 1R36A 2HQNA 1RNLA 3E5QA 1YQAA 5CLSA 1W5TA 3VB2A 4ZZLA 1P92A 2P8TA 1Y0UA 1KYWA 2P5VA 3I5UA 4KFCA 3SQNA 1LVAA 3KZYA 3WTVC 2EFQA 3ABUA 2E7XA 3V8JA 3GX4X 3NRVA 5K5OA 5D5XB 2OAZA 3LA7A 2VBXA 5AONA 2HEOA 3BZ6A 1O3SA 5H20A 4KICA 1RUNA 1D8JA 4KYWA 3QPHA 4LLGF 3F72A 2DQLA 3KE2A 1HQCA 3ZMZA 4PGGA 1FY7A 2YX4A 4O3MA 3FF5A 3S2WA 5J8FA 1ZREA 1YYVA 4LLNA 1T2KA 3DPLC 4GYIA 3V7RA 2YU3A 5EEHA 1KU9A 2QVOA 5ERIA 3RDIA 3HHHA 2RQPA 2OBPA 3ECOA 4JQFA 5JVTA 4A5NA 4HF1A 1OYIA 2IA1A 2RKHA 2DU9A 5E20A 1SD5A 2M8EA 2XGXA 3V4GA 3J80K 2VT3A 2QUFA 3O3KA 2CG4A 1T39A 4IRHA 3WODF 4MTDA 1SFUA 2XHKA 1P6RA 4L0YB 4A0YA 2E7WA 4DQ2A 2DK8A 3REOA 2XROA 2VC1A 1ON2A 4HBLA 5CVJA 2UZKA 4GO1A 2XAGA 4L5IA 2A5YB 1P4XA 4ESFA 1YIOA 3ELKA 1H9GA 1WQ2A 4M6XA 1MGTA 2V1UA 1ZN2A 4F7ZA 2VBWA 2KJCA 5FFZA 1KQ0A 4A6EA 6PAXA 5A2QK 3ZMUA 3RKWA 4WXHA 3U2RA 4EJVA 2FEZA 4LK0F 5L3GA 2Q0OA 3CLOA 1JHFA 3T1BA 3K69A 1QZYA 2X4HA 1J9IA 2QYOA 3GWZA 3QRFF 4BH9A 4RAZA 4WX9A 1F5TA 2W25A 2J5PA 1FP2A 2OU2A 3QPTA 2PI0A 3RIRA 1SD7A 2LF8A 2A07F 1XDUA 2ZMEA 2FBHA 3TQNA 3C7JA 4EM0B 4KA4A 1ZLKA 1PP8F 3TO9A 3NEUA 5DCMA 4BNCA 5ILUA 2OQGA 2M87A 3F8NA 1JGSA 4XBFA 1USTA 4NQWA 2RNJA 2GXGA 4EM1A 4UV9A 1TW2A 4N9HA 4XLNF 4YIFA 1L0OC 4YFXF 4EJUA 3H92A 1J59A 4FT8A 1JE8A 3CO7C 3MZYA 1FP1D 2VC0A 4XRFA 1BBYA 1LDKB 2CYYA 4R1HA 5CVIA 3SZTA 2ADUA 1ZRCA 3QP5A 1D8KA 2QQAA 2W85A 2XVCA 1YW9A 3J81K 3C3WA 4ZYGA 1QO0D 1UHWA 4KMFA 3SFZA 2A3SA 2XASA 2ZFWA 4OOIA 1OMIA 3HRMA 2P7CB 3KLNA 2A6EF 4YFKF 4BHBA 2IW5A 4ENKA 3PFIA 3CJNA 3LSTA 4UNOA 4RB2C 1AWCA 1QGPA 4IPAA 2A68F 4N9IA 5J8CA 1T38A 2VBYA 3HUGA 3WTXC 1PP7U 3L7WA 3LWFA 3KCCA 1Z1DA 4UVBA 1WRJA 3QAHA 2P6TA 3MEXA 3E6DA 1W5SA 4HV6A 2PFBA 5ICEA 1HKTA 1QNTA 2FNPA 1IRGA 4MQ9F 2BV6A 4BAYA 2FBKA 2EFPA 1OYWA 3WTYC 1MJAA 1W7PA 3R60A 2KIFA 2R7DA 2RVCA 2EFWA 2IVMA 1V3FA 3WTWC 2DI3A 2VODA 1BI3A 3T5XA 4UVAA 3KEOA 5AIPA 3KP2A 4OMYA 3I0TA 4EVIA 3R0AA 4HLXA 1TNTA 3L2CA 2W57A 5D6FA 5DUIA 5IT3A 4OMZA 4GYGA 3LQQA 4A6DA 4PDKA 3GFMA 3QOPA 2FQ3A 2K86A 1XMKA 3FMQA 2ISYA 3ZP5A 3RYRA 1PUEE 1U6GA 1D3YA 3P9KA 3JCKC 5FLXK 3CUOA 3JAMK 1G3YA 1ZHFA 2K27A 2WTEA 5CVVA 4EJWA 2RV8A 4QLCU 2B0LA 5H6QA 4HX8A 2HWVA 3F23A 3R4KA 4ZYDA 1HW1A 5KVRA 1LDJA 5DCMB 5L3FA 3OOPA 1P2FA 3M1EA 4JBAA 3E5XA 3FZVA 2ZNYA 1Z9CA 2Y48A 4AD9A 1MDMA 2XAQA 3VFZA 1OR7A 2LNBA 4RAYA 1FX7A 4L9NA 5FLXZ 3F22A 3BOQA 2K02A 3RTRA 1RZ4A 1O3TA 1WI9A 4HW0A 5FFXA 1YTYA 1S6LA 3F8FA 1UHMA 4FX0A 1I6XA 2OA4A 2GXBA 3BJ6A 2ETHA 3IWFA 2H27A 5LHGA 2Z5UA 3TXNA 2HZTA 1R1TA 2IRFG 2ZJ2A 5LGTA 4Q4ZF 2NYXA 2Y0MA 4PGHA 2EK5A 2FSWA 2HDCA 2UWMA 4ENNA 4ZZDA 3ZN1A 4ZH4F 2KIMA 3C1DA 4G6QA 3GW2A 1K78A 1W4MA 3GZ5A 1XSVA 1DPRA 5FO5A 2OZ6A 4OU0A 2X0LA 2VT2A 4LK1F 4GCVA 2JSCA 1BN5A 3ECHA 3HHGA 1XSDA 3V8LA 3ZQ7A 5LEKA 4KNYA 2UXNA 3FX3A 1X3UA 3I59B 1CGPA 2FBIA 1QQIA 3TKYA 2YPRA 3IL2A 4G94A 1E17A 2DQRA 1R00A 5D6EA 2W84A 1MZBA 1SMTA 1FC3A 1WSUA 1A04A 2NAZA 2HKOA 2IP2A 1Z6TA 3LAPA 3PQKA 2GZWA 2G7HA 5DD4A 2FA5A 2WWYA 4HF2A 5DYMA 1J7KA 2XKPA 3O6BB 4LD5A 2RC4A 2EV0A 1FNNA 5LRSA 2PLYA 2W24A 4L9VA 2VOPA 3SXYA 3WGHA 5K1YA 2FE3A 3DV8A 4L5JA 1OKRA 2DO7A 3MFKA 5JFRA 4KDPA 1QZZA 1XGOA 5DCFA 5ILSA 1BJAA 1K6OA 2YSRA 5F64A 5HS9A 1ONVA 2F5FA 2RGVA 1ODDA 1K78B 5BS6A 4NHJA 1REPC 3HRSA
chains in the Genus database with same CATH superfamily
4KMUX 1ZG1A 1N4RA 5B5EC 5JJ7A 4C0EA 2ME0A 1ZR2A 2ILRA 2P9LG 3JCUC 1TR4A 4DBQA 1FWZA 1W7PD 2JQ7A 4UB8C 5LHIA 3VTYA 1J75A 1BC8C 3JRFA 5HQ8A 4ZYEA 5F0HA 3KFWX 2J49A 2ZIRA 3S1NJ 5H6RA 4Y7NJ 1N9AA 2P9KG 4PSXA 3TWXA 1STZA 1V54E 4B09A 2VI6A 3ML6A 2V5FA 2WXGA 1QQEA 1PDNC 4RB1A 3W6KB 3UM3A 2JRTA 4A93J 1K7AA 2MA3A 4BJTA 1OCOH 2ZJRF 3BJAA 3KSQA 2HYFA 3RJPA 2W00A 4N0BA 2GGFA 2L0KA 2R7QA 5FJ8J 2V1DA 2HGCA 3H36A 1MSEC 4KYOB 1KA8A 2O5RA 2RREA 1NTCA 3E3VA 4XZ4A 1HF0A 2IFUA 3MGBA 2KRFA 3FK6A 3SGHA 5J08A 2ZMEB 4EQQA 4XM3A 4GCNA 2DZOA 1Q1VA 4BQOA 4EM2A 2Y0SA 2ETBA 5C4JJ 1FPPA 3ASFA 4PUCA 2WM9A 1RW2A 1LEAA 5FQ8A 4ANXA 1X81A 4OIRF 3W9GA 2KIUA 2L9NA 3L1PA 3RYPA 2L4MA 3PRZA 3ZKJA 3I3NA 1D1BA 3E0JB 2P9PG 4CT4A 4M73A 3OOUA 2I2OA 4MGRA 1ZG5A 3GLXA 1SAUA 4PK4A 4DI3A 4G11A 2WA0A 2NYJA 2C6YA 1TQPA 3SD5A 4P1WA 3HG9A 2EV5A 1LEBA 2QLZA 3OSGA 1ULYA 2BBYA 1DQUA 2M45A 3G6EI 3Q9UC 1R49A 3D5SC 1DUXC 4WXCA 1BR2A 4N39A 3E97A 3K1PA 3D9HA 1V5FA 3FTVA 5ILVA 2EQXA 5DBKA 4WXDA 3L54A 2WAFA 4XSZF 2R59A 4M9ZA 3LQRA 1H9TA 1VDYA 1E7VA 4GXOA 3VLFA 1IDYA 4UI9J 1S9HA 3J7ZI 4IO9F 3GTKJ 2QM3A 4L9JA 5HS8A 4E7KA 5L3DA 1GXQA 4UUSA 1SA4A 4G9YA 3V7SA 1FJLA 2OCEA 1KQ8A 1BLXB 3LKUA 2ZFUA 5CHEE 5FZQA 4AY6A 3OR1C 1XPXA 1WHUA 3E37A 3HPGA 1H2UA 4OINF 3ROUA 4HYEA 3UNGC 3JUEA 5FGMA 2IGOA 2L54A 5EJCA 4CZZA 3HTUA 2HFHA 3BG3A 1EH6A 5HOOA 2Y9ZA 2QZ8A 3S16J 1H19A 3KZZA 3PUBA 4LB6B 4HOTA 3CJRB 3G2SA 2H09A 1KT0A 3BROA 2WQHA 2MD5A 4HX7A 2B6CA 4AJWA 2L6BA 2HKXA 4TV7A 1PC2A 1WCMJ 1HXDA 4HB5A 2LDUA 3C5RA 2O6GE 1UB9A 3TDUC 2N8GA 1ELWA 2CG3A 3HEFA 3CC2I 2IGKA 3K9IA 3C98A 3NQOA 2MLKA 3I53A 3D0SA 1FSHA 4FASD 1OLTA 2AO9A 4HRLA 2CSOA 1LB2A 1TW3A 3GF2A 2BF0X 1WI3A 3RIBA 2LKPA 2VKDA 1MMNA 5E1WA 3DKWA 2QKLB 4EMSA 2R05A 2Y69E 2OCCE 1Q1HA 5FQ4A 3WG7E 3FXJA 2V4HC 4B1RA 3IH4A 1T98A 4XONA 3MKYB 1Z3YA 3U9GA 1N4SA 3RI4A 3W6VA 2ZO4A 3UM0A 4ETSA 4BACA 2CHZA 1BI8B 4D5CA 4BY6A 2DTRA 1OWMA 3T5VA 2J4DA 4XOPA 2AXVA 3KP4A 3JSOA 4JB8P 5ANLA 4DI4A 4HNTA 1RIOH 2M30A 2F2EA 3LSRA 1TNSA 2CH0A 4A1SA 5ARGA 4WNDA 3X2QH 4I02A 2NXNB 4A3GJ 5IOYA 3CF5F 1R22A 4P55A 1S7AA 4GZCA 2FO1E 3K1MA 4LITA 4L5EA 3O8GA 3K0LA 4WWNA 3RKXA 1JKRC 1XSXA 1NG6A 4RQIA 1LFBA 1ZGAA 2CRGA 2ZCWA 5ICGA 1FIPA 4JC8A 1NI1A 4U0YA 1JUQA 2JWTA 3EETA 3BTJA 2CUFA 2Y69H 4K0RA 2KJBA 1WZ2A 1OPCA 1HDPA 3B13A 3J5PA 3QNKA 3ZYMA 1WWXA 4B8AA 4BU2A 2JLBA 1UCRA 3HOTA 3BT9A 3DU5A 3KYDB 5K5QA 2NVQJ 3B6CA 4PFOA 5A2QZ 4FHTA 2O3FA 4IVNA 2GXAA 2Q2EB 3HXLA 4IHWA 1K1AA 4GTRA 2ECCA 2W48A 2LF7A 4MS6A 4G12A 4NACA 2ZSIB 2ZBKA 3L00A 2ESHA 1TP4A 5FINA 2BKGA 2J9QA 4J8YA 3CCRI 3ISPA 2XUBA 2LUHA 4JEUA 3G73A 5LEJA 3S3MA 3LSKA 4MQVA 4F6RD 1N75A 2VBZA 2XZDG 3LPZA 4G1TA 2QKMB 5HDGA 4G6TB 1Y8QB 2X6XA 4N4NB 5AJLA 3JXJA 2EIME 5CCMA 4CH7A 5DM7F 2P0WA 4F91B 4LG0A 4I2OA 5FB2A 5HLGA 3DBLB 2J8SD 1FPQA 4WAFA 3CUQB 3R7RA 3DTIA 4ZYHA 2OUMA 3JREA 1DVPA 5JI6A 4KZCA 5L3BA 2LBFA 2XRYA 2PM6A 1TTYA 1B6AA 2V9VA 3LMMA 3LSGA 2X85A 3GZSA 3L13A 3H3VK 1O57A 1SAXA 1IZ1A 5M5WJ 1OCOE 3IKOB 4Z2YA 3DXMG 1ZKGA 5TRDA 4IOCF 1VQLI 1BW6A 3QWLA 4NB5A 3O8HA 1LKXA 3ABME 3QU3A 4JW1A 3TWWA 4ACKA 4B3AA 3C72A 4BEPA 3AG2H 3PSFA 4I0AA 3J7AO 1M1EB 2CS3A 2ONDA 4C3IJ 3BTLA 2P9IG 2PNNA 3GTOJ 1E3HA 4DW6A 3HYMB 2KT0A 3RKVA 3DPUA 1ZR4A 1T95A 2EIJH 2WB1N 4YEJA 4MRUA 3FBNB 5JLXA 5J4VA 3OYHA 1ETKA 4HEA2 3ZN0A 2NXPA 1SMYF 3CVXA 1Z7UA 2AXTC 3G1OA 2DT5A 3UM2A 1H0MA 3NQPA 2YINA 4A1GA 2K7LA 3DEUA 3CHOA 3B6AA 4ON0A 2BUGA 2OC6A 2NNNA 2XRNA 3J81Z 4GTPA 3OYDA 2GOXB 1JWGA 3TW6A 3S7FA 3IUOA 2NRAC 4I2WA 3HVEB 2K9SA 5CRUA 3ZUVB 1SD6A 5LFAA 4IRIA 2L0IA 2VQCA 4O6JA 3FHEA 5J90A 5CKTA 3URZA 1ERDA 1GHCA 5D5VB 4P29A 4DRXE 2YHCA 1YG2A 3V31A 3IHYA 2FOKA 3BP8A 1N52A 2EIKE 2BZTA 3HRTA 2E1CA 3B7RL 3HG0D 3ERED 1VQ9I 2BY1A 2CFXA 3MYVA 3JRGA 1JGGA 3E4BA 4KT5C 2PMZN 4R79A 5HNHA 1EJ9A 1O7FA 4H4KC 1N0QA 1QYMA 4UUTA 2STWA 1U5TB 4AVXA 3SZGA 4ENMA 2Z33A 4XR6A 1AU7A 2I1JA 3CIAA 4CDRA 3I4MJ 5IOZA 2RNGA 4TXQA 4H0EA 4LG3A 4XNFA 1JT0A 5FD5A 4M3DA 3WGGA 1HFAA 3BG1B 2ELJA 1YHQI 1TWCJ 5E1ZB 1XTAA 2VGXA 3FUMA 4LERA 4CXFA 2YX7A 2UY1B 4CCKA 3WE3A 2FBNA 3CP8A 3TWQA 4IEJA 1LVKA 3FXOA 2IS4A 3LA2A 4HLLA 2CO5A 4RLYA 3GFIA 2M34A 5IYDJ 1O7LA 4CEMA 2RQQA 4I01A 2K9NA 4UQXA 4FETA 3TWRA 4CCAA 4CICA 2LXLA 5J6XA 2QCOA 2JA5J 3S1RJ 2EA4A 3OV8A 2AQEA 4A3KJ 2NC9A 1OCRH 1W0UA 2L0TB 2L7MP 3BZCA 5E8GA 1IRFA 3TGNA 1NH3A 4I17A 4L9TA 2R7ZJ 4YDYA 5AQ9A 2Y75A 3QP6A 4M6YA 4UQZA 2VSYA 3S93A 1AWCB 3S17J 1N11A 2HM8A 2R03A 3LFKA 2XIGA 2DXIA 4BQAA 1TNOA 4FJZA 3UI2A 1QPMA 4RM2A 1ZH5A 4EECA 4F1PA 1XX5A 3CVLA 3N97A 3I3LA 4N2QA 2CUEA 4Y17A 4B8CB 4FC8A 1FYLA 4MFDA 3H0DA 2DA2A 2O61A 2AW6A 2MC4A 4XLPF 3KSLA 3PNVA 2JVGA 4LNBA 2CW0F 2OTLI 3TXMA 1XD7A 1B59A 3FM3A 3NWTA 1FBSA 3S8PA 3SJMA 1KQ9A 1UMQA 2A05A 4I98B 1GXPA 4DX5D 4CRWA 5FZSA 4L18B 4G23A 4F93B 4YDEA 4GB9A 2BYVE 4DLOA 4I0BA 1F36A 2ZMEC 3LAJA 5CECB 3CVYA 3CTAA 2WXMA 2VE8A 1BI1A 1UELB 5LLQA 1G3SA 3CV0A 4CSWA 2MH2A 3FIWA 3DCFA 4BHCA 2CQXA 4ESBA 4RDUA 2JMWA 3I71A 4AIKA 1WM5A 2KKOA 4XX5A 3SQVA 2X6JA 3FH5A 1ZYRF 3E6CC 1MMDA 3Q0WA 3LY9A 2ETAA 2VKEA 2JABA 4TV3A 2DK5A 4BSXA 1OCRE 5IP9J 3UQ3A 3R9AB 3S2AA 1MW7A 3TWVA 3EYIA 1H6KA 2X6IA 4RM3A 3BY6A 2IQCA 3I56I 1WJAA 4GZ3A 2H8RA 4M9XA 4XI0A 3F6VA 1ZRFA 5BUZA 3ERMA 3A01A 5F0FA 2HXOA 2DTZA 4UHTA 4X1EA 2L3DA 2Z1DA 3Q0VA 3K4BA 3UKGA 2F37A 2OOEA 4EQFA 1D8DA 2WAQN 3M8JA 4GTOA 2O03A 3I4NJ 1O1RA 3TBIA 2GLOA 1BOBA 1ZGJA 5HLIA 4M6VA 1HO8A 2M0MA 4W1UA 3D9MA 3DXKG 4GTTA 2G9WA 4MFEA 2RN7A 2PEXA 5M3MJ 4AIDA 4ZDOA 3TWSA 1W3BA 2D45A 2E19A 4Q69A 5ED4A 1LPQA 3L08A 4BX8A 4HQMA 2ID6A 4K03A 4GA2A 3VTXA 3GUDA 1HKQA 2O8KA 3FUDA 1S64A 3CLQA 1KYZA 3E34A 3MWMA 4DX2A 4ILHB 5D4SA 1S29A 3TO7A 3D9LA 2HOSA 2VSOE 2ZKZA 2PJRA 4N5CA 1EKEA 2FRHA 4GZ5A 2EINH 3Q9SA 4PZJA 3CCJI 3PO2J 5G2NA 3FDYA 2IT0A 2IY0C 2Y0SN 1WH5A 2QQ9A 3GVAA 4A3JJ 3ULYA 2LR8A 2ISZA 3W2VA 4IQ4A 2QYUA 5H7PA 4KN7X 4XKBA 1U5TC 4E6KG 1MIJA 5D8KB 3HSEA 2H94A 5L3CA 3DLLF 3SBSA 2KZGA 2VPRA 3IHUA 3RKYA 4M3GA 1A31A 2R5SA 3U1KA 4KT6A 4NDLA 3K9TA 1MSFC 2R92J 4U7EB 3ABTA 4AOFA 2MLGA 1IUYA 3HOSA 3EIQC 3ABKE 3AFHA 4GGGA 3PSIA 2GRNB 1Y6IA 4P5OA 1KZHA 3EHNA 1X4OA 4UI9C 4BE1A 4M3BA 3MA5A 1KT1A 4JPSA 1O3QA 2XV4S 1AP7A 5ICFA 1IXRC 3SDGA 4HRIA 3UT7A 2V1NA 3NB2A 1IQUA 1R5GA 5FRNA 3CESA 3H35A 3PJRA 1Z21A 3H0GJ 1TN7A 3S2HJ 5FKLA 3PNTA 1NL4A 5KK1A 1YJ9I 1IW7F 3PS6A 1IN7A 2GIVA 2CHWA 1IXSB 4KITB 4E6HA 2KP6A 3J7AY 1GT0C 3GXOA 1X1AA 5CVUA 1VQKI 4RAFA 5ANRA 2EV6A 2F4MB 1FLIA 2XPYA 1CF7A 4AY5A 1TEZA 1QVTA 3G1MA 1ORKA 2L9VA 2CMPA 4IQJA 2XGSA 2DAOA 1XCVA 1R4NB 5EYPF 2GA2A 3CMMA 4A3TA 3IRQA 1TJCA 1YYHA 1A6IA 4HDUA 1B8IB 4TXPA 3OYKA 5BOXA 3TP0A 4JYKA 2A61A 2DMTA 4YFNF 3WU1B 1IGNA 2E1OA 1PAQA 3CJTB 2JVHA 3JRHA 4EGZA 2QYJA 1HW5A 1LQ1A 2F0YA 2TDXA 5CEDB 5DDGA 4MHGA 2MC3A 1DDNA 1R6RA 3JW4A 2CG2A 3J5QB 4OVUA 1ACIA 3L9TA 3DLAA 4P96A 3CC4I 4LFUA 5D66A 3BDDA 1H88C 2EH3A 1X5BA 4JK1X 1YIJI 4I6ZA 1P4AA 4IHSA 2E5NA 3SO8A 2JN6A 2PG4A 3GO5A 5AQAA 3B7BA 2B9SA 2FMLA 3BQYA 2LD5A 3IV5A 2X1DA 2DVWA 4I1OB 3A1YA 4LCTA 5ARFA 2X1CA 3W3CA 2JZYA 1Z6RA 3OS0A 1LFUP 2R7SA 5F08A 1MDMB 2XCCA 1PY1A 4MLPA 1XGMA 2BHZA 2ELHA 3UT8A 1D1CA 2PJRB 1DC2A 1H6PA 3OTNA 3OXFA 3HYIA 1V5GA 1MJBA 3P2BA 2AS5F 3IRRA 2O9LA 2IBDA 5HDNA 3LEWA 4J7WA 3WGIA 2XCBA 1F9NA 3DSXA 2RD0A 3H9GA 4L1BA 3ZMTA 2VUMJ 3TDZC 2KPMA 4EGYA 3AG1E 3D5RC 3HXFA 3GFJA 1GVJA 2LKSA 1X1PA 3BJOA 1S3JA 2GQQA 3ZR8X 4E70A 3FBIB 5FLVA 4AWXB 4OIOF 4C3HJ 2QBYA 1VI0A 3R0JA 5IT9K 5EYLA 3ZYQA 1S7OA 1FSEA 2JUCA 2XHEA 5CEAA 4HLYA 3MV2B 4DLQA 3Q3SA 3ZCOA 2TCTA 4KT6B 2P5KA 2NSZA 1ELRA 3HHMA 1JXSA 2HQRA 3DTKA 3EHRA 1AA7A 2VOOA 2HYGD 3GLLA 4F3QA 3MZ8A 3R61A 3FHZA 2CGPA 3K6GA 3GFLA 2XAUA 1H89C 5BPPA 1YW7A 2HTSA 4PCQA 1U2WA 1OYYA 1TC3C 3CDIA 3FM5A 1LF8A 4FX4A 3MJWA 4PUSA 4X8QA 4BT8A 4W97A 1YITI 2FF4A 3B73A 3EHMA 3DRAA 4FADA 4S05A 2DFIA 4V2GA 4A0ZA 5E3NA 5EKQD 1RI7A 2YS9A 3BC8A 3C18A 2PX9A 1T08B 3QDNA 2RFMA 3CEQA 4N2SA 4FHJA 1R71A 4HRMB 2LH9A 5LCWC 2PQ8A 5HS7A 4ANJA 3MN2A 3PFYA 4OIPF 3JTHA 1IXCA 4KIGA 4DYCA 2CFUA 1B8IA 4WWCA 3QARA 2HXIA 3GZ6A 5FT9A 5IYBJ 4PJ0C 4D9JA 2DWZA 2OV8A 3RKQA 3NF1A 1CF7B 4UUSB 1MNMC 3CHSA 5G04C 4IL6C 1OQYA 4N3CA 3RQ4A 1LNWA 2BE5F 2ICWG 1IJWC 1C0WA 1B9NA 2DBBA 1G4DA 4F52A 4PFPA 1S70B 4OAYA 2P9UG 1OWNA 2A5UA 3AG4E 4IX7A 1IF1A 2XSJC 1JCRA 3DF8A 1MBEA 2R7OA 4OAZA 2R5YA 2M63A 2EINE 3H1CA 5A23A 4DX1A 2CWEA 4RGRA 2KZVA 4HQEA 3ZQHA 2DYRH 1W1WE 3MCZA 2E35A 3VLEA 4A3CJ 3QODA 2AXLA 2JA2A 2P58C 3HRUA 3E6MA 4P9UA 3EDPA 1KU2A 4JX5A 1USSA 1Z7LA 2O0YA 3UIOC 2MFZA 4GZDA 3VYSB 2DBAA 1HKSA 3APFA 2IJLA 1EH7A 4KJZA 2IO2C 3I4GA 2I9CA 4J8SA 3QWWA 2Q8KA 3LNQA 2AVPA 2DZNA 1EH8A 2QENA 3NAUA 4K2EA 1U78A 2R93J 2GWRA 4B3XA 3CVQA 3CO6C 4EBAG 2Z2SB 2ZU6B 4HS2A 2H6CA 1GUUA 2L02A 5EYRA 2DPDA 4IKFA 4LG0B 1FVHA 2P9SG 3EU5A 4BE0A 3L16A 5CBNA 1XB4A 5LHHA 4ZC3A 4I9EA 3V79K 3LJNA 2R17C 2R2LA 3OYJA 2KCLA 3HZJA 4JHKA 3E33A 2IJGX 3FH8A 4FP7A 1QNFA 3T8RA 2GBYA 1XGWA 4WNFA 1Z05A 3ZMVA 1TQMA 2DW4A 3NBNB 1FTZA 2D1VA 5F04A 2QBYB 1KPSB 3DFGA 3BG6A 2XS1A 4A5MA 4DK5A 3JRDA 2L01A 2KZTA 3CVVA 2K85A 3VOEA 5E18F 1U2VG 4FISA 2QC9A 3U21A 1T0FA 4RB3C 1BC7C 2CV2A 2A6HF 4G26A 3EQLF 1FT9A 1ZRDA 2V4LA 1DGRM 2WV0A 4HPQA 5GAGJ 3V7CA 5K5RA 2DODA 3TL4X 5ENQD 2HTJA 2MH9A 3CKBA 4AIFA 1OCZE 3A0HC 2LY1A 4XSXF 4L0ZB 3HTSB 3U66A 3FU6A 3IEGA 2DA5A 3W2WA 4AVZA 2QQBA 4J8EA 3AAFA 3FH7A 2X6KA 4GRIA 3APCA 4QPOA 4RAGA 4HNUA 5J3LA 3PUKA 1XMAA 3HVEA 3V30A 5GAEJ 4HI9A 2HS5A 3Q47B 2BEDA 3CD6I 1BR4A 4BETA 3DU6A 4CO8A 1R4MB 2X6FA 2EZHA 4CA0A 1OWOA 3LYAA 4ABNA 3W6JB 3S1MJ 3M07A 5TGTA 3JAMZ 2XPZA 2EZIA 4U88A 2HQ5A 4HZFA 3Q49B 4GCOA 4K5BA 3P9IA 3SHFA 3VODA 3AS5A 2EFOA 3KP6A 3LL7A 2R7RA 2LY2A 2EFNA 2P9NG 4R7LA 4JA7A 3BCBA 5FJYA 4D5FA 2PM7A 3AL0C 3QB2A 3CHMA 2G0EA 1B4AA 1Y8RB 2HE0A 3KP7A 2EA2A 3PVLA 3KLOA 2L9BA 2GA1A 2VJ5A 5F1RA 2OZUA 2IS1A 4GAAA 2KMUA 3MZHA 4BEHB 1BIBA 1KU3A 2V1XA 2VONA 5C4XJ 2J4BA 2R7WA 1HH8A 1ZGWA 3EDTB 3I59A 3KYLA 4NIKA 2PMUA 5CVRA 2LP0A 2BVMA 4XMYA 3GTLJ 3P7NA 1FZPB 3DSTA 3JUIA 4ILGA 5DTDA 4OVVA 5HLHA 4HAMA 1MKMA 2RDPA 2X9DA 2OEWA 2L9RA 2XPUA 3LFUA 4I6GA 2DCPA 3L2QA 3D9OA 1R23A 2IEKA 3VLDA 2FNAA 4IF4A 2LO6A 3JQ1A 4UV8A 1YW8A 4RVBA 2J5OA 4BE2A 4Q5SF 2CUZA 4IJAA 3ISMC 3LS8A 3HL2A 4GYOA 4HI8A 4NUBA 3VDXA 3EU9A 4BHPA 3FY4A 3IP4B 5DEQA 2V6CA 4ANUA 2DA6A 5HLTA 2F5VA 2GRMA 1MBGA 1L3LA 2ETCA 4JL0A 3UR3C 3RPUA 3SBTB 3VWBA 4A0XA 1QRYA 2XQ0A 4ANVA 3JXIA 1R58A 4HV5A 2COMA 2JEKA 1MMAA 2M7AA 4BJ6C 9ANTA 4XORA 3J80Z 3PZ2A 4HQDA 4YIRX 1DNPA 5ENSD 2E0IA 4CZ2D 2IF4A 2C0LA 3S7JA 3AS4A 5H2FC 3RK6A 2F5EA 5IP7J 2FMYA 3QQAA 1BA5A 1OISA 2M2EA 2WXNA 4HDVA 1HG5A 3WG9A 2OF7A 2JTVA 3P9CA 4LJZF 2GAUA 2QSFX 5LGUA 3L17A 2C0MA 4ASNA 4WUYA 5D0OD 1BI2A 1I3AA 4U96D 1A36A 2FX0A 2H1LA 4Z6YA 5CERB 4D1QA 4XN0A 3Q9VA 4FQGA 3TAXA 4RGSA 3WTUC 4AIJA 4I9CA 1IN6A 1H2TC 1R1VA 3AG4H 3QU6A 3O4ZA 5BW8C 1DCEA 3C2BA 4IHYA 3E1SA 4U7BA 2M5WA 4IRUA 2WXKA 1JUMA 1U3CA 4J8DA 1N25A 5GAHJ 5IPAA 4S04A 2A5WA 2DYRE 4BGDA 3GEZA 1IN4A 5D4RA 3L2VA 2M4KA 1YFHA 4IHXA 3PUJA 3MKLA 3GYHX 2WADA 1QZEA 4UXNA 2FU4A 1BOAA 1QHGA 5AIJA 4G24A 3V2XA 1FIAA 3OL4A 5CQEA 4Y15A 3MKQB 3B02A 4BXUA 2JT1A 1ITYA 3AAAC 3K2ZA 1YX3A 2WXHA 4OWRB 3G2BA 3ZFWA 1E2XA 4MNUA 2QSHX 3RSNA 2WAEA 1KLXA 3COAC 2KISA 2E2JJ 1UJJA 1TWFJ 3QYEA 2MBFA 2XAHA 3CCMI 1JTXA 3C2HA 4II2A 2VE9A 3MAJA 2D2WA 4M71A 5LRRA 3DSVA 3AG2E 1ZELA 3EUHA 3OYLA 1XN7A 4G6DA 5GADJ 2HOTA 4M74A 4BTAA 4WNGA 1V54H 2VSNA 1TBXA 2E2HJ 4QTRA 5AJDA 1BI7B 1YLFA 1FMWA 3A02A 1I39A 3WTSC 3S1QJ 2HDWA 2IONA 1XDSA 3NOGD 1OWPA 4N3BA 3L09A 2NVYJ 2PJPA 3JRIA 4GYWA 4RGXA 3VPRA 4GZ6A 1SVXA 4D10C 2IA0A 4APOA 4GTSA 2AJAA 4LIUA 1T6SA 1WKMA 3K1NA 4XRSA 1HA8A 4NQ0A 2XS8A 3CVUA 5CPRB 4AVPA 2DFFA 1QU3A 1HG2A 2ESNA 4IXAA 4DZJA 4L2LA 3ZQQA 2OEVA 1U3EM 4M72A 4WF2A 5GP9A 3OYGA 3FHNA 3S32A 4FCYA 1HU3A 4YELA 2PBIA 3RPQA 2QZAA 1X3ZB 3HSFA 2WXPA 2STTA 4GPMA 2EJRA 3FXUA 1DCQA 4M3OA 3FMSA 4Y6CA 5BNGA 2QA4I 2IGMA 2KL4A 4AYBA 4E7HA 3B7UX 2B7EA 3Q73A 1BI0A 1MJ9A 1OCZH 1S72I 5IT9Z 2VIXA 3M8EA 2DMUA 1BM9A 3AG3H 4KN4X 4XLEA 5K7ZA 3MQ0A 2HYZA 2XAFA 3IH3A 4PJJA 4BBRJ 4XIDA 4XK4A 2FULA 4OYSA 2G7UA 3BU8A 2F8YA 1FYMA 3JYSA 2LSVA 4HLEA 5E17F 4FJYA 4CDNA 3MMYB 5E3OA 2R7TA 5GTIC 2R7VA 2XZTG 3AU5A 2XGCA 3KIOA 4B43A 1KZOA 3O48A 4DGWB 4A3DJ 4EV0A 1NA3A 4XEIG 4F1SA 1FBUA 4CYMD 4RGUA 3U1DA 1UAAA 4N4OB 1XGNA 1VZ0A 4EJTA 2R7UA 1RC9A 2L2OA 1W7PB 2HOEA 3TP3A 1E8YA 2NVUB 5E76A 4Y52J 1D9SA 4XOTA 2AQFA 4RA2A 5E79C 5BMZA 4C9YA 3LSJA 3T8TA 4E7ZA 4CYCB 2E34A 4BY1J 3GZ1A 5DS9A 5BT1A 1R5HA 2CQKA 1WJEA 1N4PA 3H3ZA 2KCVA 4LB5A 1Y0NA 3FUIA 3BG9A 1F4KA 1P4WA 2EWNA 2E1NA 2EB7A 1QPIA 5KNHD 1MD0A 3ESWB 3B7TA 5KJNA 3L2RA 3FTXA 2GOMA 1S7EA 4KMOA 4C2TA 3G2VA 1SFEA 5GPCA 1VFCA 2V8SE 1NA0A 3CUQA 2ZXJA 1S8NA 3HDDA 3WE2A 4D7MA 3I64A 2JRMA 2V7FA 2GIZA 3D9PA 1WH7A 2J07A 5JJTA 1IN5A 4JHRA 1X2NA 2A6TA 2B0OE 2P6SA 2IXSA 1KONA 4JD2G 3FFLA 3SZPA 2IEJA 1R1UA 4A3FJ 2AXUA 5F6FA 2UXXA 5F27A 1FYKA 1EA3A 3M8FA 1E8XA 3K7AJ 5CYVA 3F3XA 5BV1A 4G8KA 2F4IA 4IRGA 4ZDLA 3K4KA 4M9SA 5J40A 1WJBA 3KX2A 4K5CA 3AKZA 3KZIC 3T8MA 1IRXA 1P9QC 3GMEA 1Z77A 5J1YA 3WU0A 2LK2A 3CVWA 3QYFA 1PVEA 1UHSA 2XRLA 1ENHA 5AAOA 1YS7A 3TOBA 2V79A 5KJKA 4KIBA 3UIPC 1XCBA 1HS6A 1DU6A 5E75A 1Y8MA 5LP0A 2HOAA 4NC7A 4FHKA 2XRZA 1X1CA 3WTZA 4J00A 1O1SA 2WPVA 3FDHA 4LOCA 4AM9A 3CK9A 2DPUA 3LSPA 2VJJA 1FOKA 1D0YA 1TT5B 4J6IA 3ZQIA 3FUEA 2WV1A 3UT4A 2ZXWE 4A3VA 1BJZA 4BKXA 2DCEA 2QWWA 2WBMA 2VN2A 3RJVA 3KP3A 3T0YA 4HSTA 4CHUA 4TUUA 1ON1A 1SC7A 5G05J 2KATA 3EUVA 1YE9A 3LJ3A 1KU7A 2Z16A 3FXLA 2MG4A 2Y30A 1RR7A 1MYOA 2IA2A 4DOZA 3L2WA 1TNBA 1DP7P 4XIFA 5KNLA 4OIQF 1I1SA 3IXEA 3Q15A 1TJFA 2MHKA 1HSTA 3GTPJ 2P7VB 1E0EA 3F6QA 3MV3B 5HI7A 5E8IA 4LLLA 4XLFA 5EEGA 1B9MA 3DBSA 4Q48A 5F0CA 1IC8A 1LDDA 1YRNA 1UOHA 1O3RA 2D1HA 2LFBA 5HS0A 5BXOA 1JUSA 4WK8F 4RB0A 3DPTA 3PEVB 3FMRA 4CDGA 1XGSA 3KD7A 2R02A 4XKWA 3CUQC 2DYSH 3OIQA 5J1UA 3BPXA 1IV8A 5CJ9A 4CGZA 2XENA 1D5VA 1ZAOA 3D9IA 3RRUA 4I7HA 2DA1A 4LSZE 2F5DA 4GFBA 1A17A 4O5VA 2KRCA 4U0WA 3ZQLA 1RR8C 3BR1A 3CQZJ 3VEPA 2IGNA 2Y4TA 3ABKH 3KP5A 3HDXA 2LY9A 3HRAA 1VQ5I 2F6CA 2LKXA 3MKWB 3ZMDA 4E4HA 1ETXA 1IDZA 3IKTA 4Q47A 1D8EA 3T8KA 3I4PA 1YO5C 1IXVA 2LG4A 4FLHA 1KGSA 4Y3OA 5BPDA 2P81A 2HPMA 2L6JA 1UFMA 3MKRA 2CQQA 3U9WA 4G8XA 4U0VA 3TOAA 3ML8A 1IUFA 3EUHC 4QFVA 4APFA 3JSPA 2BY0A 1SA5A 2Q2EA 3H3UA 2XC7A 4I1MA 2LAHA 4LRZA 3T9KA 3MKQA 2EIMH 4LMYA 5HVQC 3CVPA 5EX3A 5JR3A 5TJJA 2DDBA 2OD5A 1UJ8A 1SZAA 1XG1A 5D5UB 4U0ZA 1SFXA 3F8BA 1S0PA 5LBQA 3P1UA 2LOOA 1SANA 4FLBA 5BPIA 2KLOA 4R8HA 1G3TA 2WC2A 5E1XA 3EYYA 5E3LA 3LY8A 1B1BA 4I09A 4KISA 5AENA 2H6BA 2K5CA 2MRIA 1WGXA 2Z3YA 2JPBA 5KCMA 3VYTB 2P5LC 3PUFA 1VQMI 4HNAD 1U8BA 4IN3B 4UWGA 2BXZA 1AKHB 2RKKA 3FXRA 3ONQA 1YJNI 1DPUA 4MO7A 3G2WA 3ULQB 1HSJA 3FXKA 1NHAA 2JPCA 3OIOA 5DD8A 1OWLA 3CDHA 1UG3A 2ZC2A 4XLAA 1SD4A 5L3EA 3LXUX 3H5AA 4UWHA 2FOWA 4JP0A 4N5QA 3PZDA 1GLNA 4HA8A 4HOUA 4B89A 1EDUA 4B48A 3IWZA 5EGOA 1LD7A 4ME2A 4F55A 1HW2A 1ZU2A 4C48B 3GTJJ 3ONKA 5JHAA 2OQRA 2GRRB 4PS3A 3L22A 4ZYAA 1TN6A 1LJ9A 5AQBA 5AQ7A 1HBXG 3FWEA 2O8XA 3O2PE 3A01B 1ZQ3P 4HG2A 4LEUA 4UUVA 5AIQA 2VXZA 3BR0A 3ZNGA 3FXQA 1RETA 2NNYA 2IOLA 3CC7I 4B93B 3AG1H 3K70C 3TL5A 3UUXA 4J0UA 5AARA 2LVSA 1ZG3A 4LGWA 1LE8B 1OR7C 3FXMA 4BBSJ 4EJOA 1GDTA 1YCSB 3DWLG 4HOSA 3Q9NC 5BV0A 2L4AA 4J8FA 2Z99A 3EUAA 3HOVJ 1XNFA 2HO1A 1BR1A 3CCYA 4MTEA 3VSKA 5FD6A 5LGNA 3I5PA 3SYTA 4I6EA 4U0SA 4YNDA 4CGWA 2M1BA 4E7JA 4CYDA 2IPQX 1TLHB 2M8GX 3DXJF 2ZXHA 1IAWA 1D5YA 1FBQA 3APDA 4YIIA 3M1CA 2DLLA 1MHQA 1G59A 3E6BA 1Z91A 5B3SH 1QBQA 4X6AJ 3E30A 3BTIA 4AV7A 1U0JA 4Q96A 2F5CA 4ATZD 3CMAI 1FOYA 4P9FA 2R4GA 4F3VA 2X51A 4IHTA 2EBIA 2BXYA 1VQ8I 3TG5A 5FKKA 3ZMSA 2WXLA 3V8KA 3J7YJ 5KBAA 3ZIMA 2EPFA 3KETA 3MX3A 5LCWJ 5TISC 2K9LA 1MBJA 3Q78A 2E36A 1OT8A 1U5TA 5EF6A 2XAJA 4ENJA 1RRJA 3OAWA 4GU5A 4UVCA 1MH3A 4QWQA 3HOUJ 3EUKL 4BYYA 3F8MA 3M7GA 3B7SA 2DMNA 4MEXF 5LD2C 2XF6A 1Y1WJ 3DTEA 1EV7A 3AU4A 2VGXB 2BVLA 2L9SA 3CDLA 2BTDA 1E8ZA 2VB6A 2I6HA 4AIHA 3HOXJ 2LLKA 1JWFA 1K79A 5B1BE 2VJIA 4MEYF 5DV5A 1BL0A 2JA8J 2K40A 1IQRA 1TNYA 1Y56A 3D5LA 3ULEG 3F0CA 3K4CA 4MBGA 2FXAA 4V19K 4ATGA 1U8RA 5JMND 2A69F 2DIWA 1RKTA 4G7HF 1K1BA 5FIOA 2LXMA 4GTMA 2MW8A 4Q94A 2LMDA 1RUOA 5JA4D 3E7LA 5D5WB 2V5QC 3DSSA 3Q7FA 1G3WA 2LRDA 1I5ZA 4EEFG 2B63J 3PNTB 2E60A 1YS6A 3Q75A 2P4WA 2EILH 1HDDC 3GTGJ 5DUKA 3ZPLA 5EG0A 3FUHA 3FUFA 3U64A 3CCEI 4HF0A 1SW6A 3L9FA 3R6SA 3HIFA 2R5ZA 2V4JC 4ESJA 3ZU7B 2LSOA 1JCSA 3IAM2 1YOVB 1ZARA 1V4RA 4YG2F 1HOMA 3BWGA 3RCOA 1J0RA 2JJ7A 3D9NA 2XSDC 1DGWY 3IKVA 2ZISA 1WAO1 4HVBA 1XS9A 4KIFA 2COBA 2WB2A 3FULA 4GTVA 1F1ZA 1V5EA 2RAEA 1BIAA 4YRVA 4QIWN 5LX8A 2L7ZA 5KNGA 3OYNA 1NK2P 2ZNZA 4PS7A 5T8IA 3S7BA 3OXLA 2HVQA 3FUNA 5CQGA 5ICCA 1GVDA 1TQIA 3M3YJ 2Y2ZA 3IC7A 2NS8A 3QOUA 2R3SA 3D1NI 2DN0A 4GA1A 3DEOA 3I54A 2DA4A 3HJEA 5HDKA 4FTHA 1AOYA 2Z9OA 3G3ZA 3OIPA 3F6OA 3HGYA 4HOBA 1VF9A 3DEWA 4A63B 3V42A 3HSRA 5FWQA 1J5YA 4ZJZA 5EDNA 4RS8A 4BESA 4EHMA 2X1EA 4DNCA 2WY8Q 5KAIC 2VYIA 4FU3A 4UQYA 1WFXA 1OXJA 1G6NA 5A7DB 2PMHA 1W36C 2BEOA 1AHDP 3DSUA 3PM1A 4Y13A 3LA3A 1PUFA 3M9AA 5D8LB 3HM5A 2LSUA 4GTQA 3E5UA 3P5JA 2VJ8A 1VTNC 1IN8A 4D0PA 2ACJA 1DP3A 2VSXE 5ENPD 3BG7A 2XKOA 3I9V2 4PSWA 5JHFA 5ENRD 3UTMA 2BKKB 5EZHA 3FEXA 2R0QC 1Y1VJ 5K7FA 2WVIA 3SY2A 2I5UA 4G7ZF 2VQHA 2NVXJ 4CDMA 2KHMA 3I4RB 1B89A 5B1AH 2AXZA 4A2UA 5FQ7A 5BQTA 2GM4A 3F9KA 1D1AA 2MD0A 1WJ5A 2NS0A 1J2XA 3S3OA 2VL8A 4W9RA 4BXXJ 5HKPA 2E1MC 2K4JA 3DQVC 1P7JA 5T4YA 3DP7A 1JHHA 2PN6A 3GYZA 1MNEA 4IOAF 2BW3B 3F21A 4WWOA 3LSMA 3CLJA 3FP3A 1QHHD 3F8CA 4L23A 3KEQA 5D2MC 2R7FA 2LNIA 1INZA 4HFGA 2CFOA 2HR3A 2K4BA 2YR2A 3BR3A 3HBLA 4HX4A 3JTGA 2JA7J 3SFYA 1WJDA 4ACLA 1ZLJA 1JTYA 5EGOB 4V3IA 3Q5FA 1E3OC 4PDXA 1R7JA 1I27A 4CCLA 2R7XA 1BD8A 3PQJA 5JHUA 4RG9A 1B72A 3AG3E 3FTWA 3QWPA 2BGCA 4U7DA 1I1GA 4KUMA 2UY1A 4WCGA 5EZGA 2BY2A 3I58A 1XMXA 1IKND 3TO6A 3CHPA 2W4SA 3BPVA 4A12A 2XPWA 3PIOF 4BX9A 1TL8A 5B1AE 3ZQCA 3C3OA 5HNFA 2WXFA 3VYUB 2Y4UA 1T56A 3N4MA 2XEEA 4G2VA 2PQNA 4ZTFA 5J4YA 1JKOC 4U63A 3WTTC 4DJAA 4B8XA 2KCKA 2ECBA 5FLMJ 4G7OF 4C2UA 1QBJA 4F92B 1R36A 2HQNA 1RNLA 3E5QA 2EZKA 2VASA 2YHEA 4A69C 4HXIA 4U95D 3K10A 1FT2A 3K70D 1X2MA 1YQAA 4ITVA 2HVSA 5CLSA 1W5TA 1YX5A 1UG0A 4FE4A 1FTTA 3PE4A 2DA3A 3H9JA 3VB2A 1N77A 4ZZLA 4NRHB 1SVLA 4CCMA 2DA7A 3HXCA 4NNJA 3W2AA 1P92A 5FRMA 4BERA 2WY7Q 2VLAA 5G55A 3PH0C 4WWPA 1IYGA 4C9BB 2DFHA 4TRQA 4C2MJ 2P8TA 4KXKB 5C1DA 4E7SA 4IULA 1Y0UA 2ZB9A 1JKQC 2OVBA 1KYWA 3MZLB 3QJZA 2P5VA 2W1OA 3S2DJ 3I5UA 4C0MA 1NK3P 3FU3A 3ZHEA 4KFCA 3HXEA 3SQNA 3CQCB 2VJ4A 3FKIJ 1LVAA 5B66C 1H0AA 3KZYA 2QEXI 3WTVC 1O5MA 3CK8A 3E32A 2CUJA 2EFQA 3JRCA 3ABUA 2E7XA 4BUPA 3CCLI 3UINC 4DPRA 3V8JA 5G04J 1EPUA 2VKVA 3VYRB 2A4ZA 3PDNA 3OWTA 2W82A 3NRVA 3GX4X 3QOEA 3OXGA 3GW4A 5K5OA 4RMNA 4TXRA 2PMZA 4PJNA 5D5XB 2OAZA 3ASHA 3U3WA 2WXJA 3LA7A 3OYEA 1E3PA 2VBXA 2X38A 4ILIA 5AONA 4AUXA 1GV2A 3FUJA 2JUGA 2HEOA 1SVOA 2DOEA 3BZ6A 3ZPJA 2ZSHB 4I76A 1E8WA 1O3SA 4YVOA 3QYBA 5H20A 1Q2ZA 4PS8A 1K8KG 4KICA 1MX6A 2KBXA 2PQRA 1RUNA 4BFRA 1D8JA 4KYWA 4UI9K 3QPHA 4LLGF 1WY6A 3F72A 4N3AA 2DQLA 4PJLA 3KE2A 3HC7A 4BJ5C 4MIMA 1HQCA 3ZMZA 1FT1A 3ZW3A 5JVGF 1DU0A 5CCLA 3QPSA 4PGGA 2CU7A 1TWGJ 1FY7A 4I6JA 4UUCA 2YX4A 4O3MA 1N0RA 2HZDA 3FF5A 4HOQA 4U04A 3W9FA 3S2WA 3SFIA 1OUVA 5J8FA 1ZREA 1YYVA 4LLNA 2LAIA 4XL9A 1T2KA 1VQNI 3Q0UA 2D5VA 4L9PA 4V2FA 3DPLC 3FK7A 2ME6A 1MNDA 2UV1A 4GYIA 2LTPA 4U8HA 3MVPA 3V7RA 3TW7A 2YU3A 5EEHA 3WU2C 1KU9A 2QVOA 1OCCE 4Y6WA 2X6WA 2TRTA 2X6YA 5ERIA 3RDIA 4K5AB 1H2VC 3HHHA 3HOZJ 2RQPA 1BW5A 3ZEFA 3GCMA 1TYQG 2OBPA 3FTYA 3CKCA 2QQ8A 4DBRA 5C3EJ 1SZ9A 3ECOA 4JQFA 4RLQA 5JVTA 4BTBA 3DPDA 3EPZA 3R9MA 2IO3C 4JOMA 1H6OA 2DFEA 3ASNE 4A5NA 4HF1A 1OYIA 3CMYA 2IA1A 2RKHA 2X3MA 2DU9A 5E20A 2EQRA 1SD5A 2P2CP 2M8EA 5EN5D 2XGXA 2VKHA 4D7NA 3V4GA 2HNHA 3J80K 3HOWJ 3TWTA 1K83J 2K9QA 1PYVA 2XGDA 2F4OB 5F1JA 2VT3A 4E7IA 2L7FP 1S63A 3CZ6A 2QUFA 3O3KA 1UN9A 2XEVA 4URKA 3MKZA 2CG4A 1MBFA 5ENNA 1T39A 5KJMA 1UN8A 1AKHA 4IRHA 2WXOA 3EIJA 4F7AA 3WODF 4MTDA 1K4SA 1SFUA 2XHKA 1A35A 1P6RA 1OCCH 4L0YB 4A0YA 2E7WA 1JJ6C 4DQ2A 4PH4B 2WAQA 2DK8A 3JRAA 5M5YJ 3D9JA 3REOA 2K3FA 1OFCX 3NWSA 2XROA 3L2UA 3PL8A 4QPQA 2VC1A 1ON2A 4UY8I 5LOZA 5KJLA 3LOCA 4HBLA 4XN3A 5CVJA 4GO1A 2XAGA 2UZKA 4GMLA 4YVQC 4L5IA 3UMVA 2A5YB 3K4LA 2M7BA 1WG0A 1P4XA 4CCJA 3CCSI 4ESFA 2FJ1A 1YIOA 4NC8A 4U87A 3ELKA 3ASOH 4CYCA 1H9GA 1WQ2A 4M6XA 1MGTA 2V1UA 2OVFA 1PUFB 1ZN2A 4F7ZA 2VBWA 2MOWA 2KJCA 2IAIA 2CHXA 5FFZA 3RZDJ 3AL0B 1A5JA 4II3A 5EDSA 2ID3A 3KPHA 1KQ0A 2KM4A 3ABLE 1WDYA 3D9KA 4A6EA 1IRZA 1SFKA 4DX7D 6PAXA 2HYJA 1RESA 2MSYA 2YU9J 5A2QK 3ZRGA 4GMJA 1VQPI 3ZMUA 3RKWA 4WXHA 3U2RA 4EJVA 3JQ0A 2FEZA 2GRLA 4LK0F 1FVFA 4ANWA 1HC8A 5L3GA 3GTMJ 2Q0OA 3CLOA 1MJ0A 3Q7AA 4O1OA 1JI8A 3SF4A 2WMNA 1JHFA 3T1BA 3K69A 3K4NA 2W7NA 1FOXA 4YDWA 3DEEA 1X58A 3HKZN 2HVRA 5CMYA 1TZLA 4JA9A 5FKMA 1VNDA 4LG6A 2FQ4A 2Q7FA 1QZYA 2X4HA 1J9IA 3LSIA 1E96B 5EILA 2QYOA 3PZ4A 1UJKA 3GWZA 3QRFF 4ZFHA 3ASOE 4S0HB 4BH9A 3VSLA 5C2YA 1HLVA 1EYHA 4RAZA 3S14J 5HRYA 2VQLA 4C30A 1ZK8A 1JJ8C 1B72B 4A55A 4WX9A 3QKYA 1F5TA 2W25A 1X19A 3ZQGA 2J5PA 4A3BJ 5M72A 2LBFB 1H8AC 1ELKA 1N54A 3WXXA 1FP2A 2DDAA 3DSWA 2OU2A 3QPTA 3UKRG 4E85A 2H1KA 3HB9A 2PI0A 3JR9A 5BNWA 3RIRA 2DT6A 2OV7A 2MGQA 1SD7A 2LF8A 2A07F 4MKTA 3R7QA 1XDUA 4BDZA 2ZMEA 3H5NA 2FBHA 3OS2A 2DOFA 4RBOA 3TQNA 3C7JA 3TJPA 3BCAA 1ETYA 4AU7A 4DYRA 4EM0B 1P5QA 1SVMA 4KA4A 1FEXA 2I8DA 2M9HA 1HE8A 3PEUB 1ZLKA 2UWJG 4CCOA 5AYWD 4CZCA 2K9MA 4ZDPA 1UZCA 1PP8F 3TO9A 3FISA 4J01A 3NEUA 1O1TA 4G8LA 5DCMA 1U9NA 4BNCA 5ILUA 3QC1A 4NURA 2M4GA 2OQGA 1P7IA 1K61A 3FTSA 1I6HJ 3KEZA 3BUAA 3M4OJ 3G2UA 2CW8A 3TGOA 2M87A 1Z0XA 2OPTA 1YJWI 2KC7A 3F8NA 3CP2A 2YUSA 3A2KA 1JGSA 3C3RA 4XBFA 3LSHA 4CUGA 4X0GA 3CMEI 2NS7A 1OCPA 4OAVB 1TNUA 2V6EA 1MX4A 3ULQA 1YRNB 1USTA 3KS2A 1S5LC 4NQWA 2RNJA 2GXGA 4TUMA 4EM1A 4UV9A 4XRSG 4BXFA 2RG8A 2R5YB 3QWVA 4Z68A 1X3WB 1TW2A 4N9HA 3S3NA 4XLNF 3SZ7A 4YIFA 1L0OC 4FULA 4YFXF 4EJUA 2E2IJ 5FZRA 3H92A 2QY7A 1LD8A 3CGHA 4M3EA 1ZBPA 3HIZA 3KAEA 1J59A 5T3RA 4FT8A 1JE8A 4IZZA 3ZN3A 3CO7C 3WHCA 3MZYA 1FP1D 2VC0A 4XRFA 2KQRA 1BBYA 1LDKB 2CYYA 3X2QE 1TT0A 4R1HA 5CVIA 3SZTA 4B44A 2ADUA 4U07A 4BY7J 1ZRCA 4XRMA 3QP5A 5FQ6A 1D8KA 2QQAA 2W85A 1ETQA 2CW7A 3HKZA 4YDOA 2XVCA 1YW9A 3J81K 3ASGA 3B95A 4NBQA 4XKVA 1N78A 4J19A 3C3WA 3NAWA 1NG7A 4CCNA 1LUJB 4ZYGA 1QO0D 5EIBE 3FEYA 3K4JA 2VTBB 1UHWA 4KMFA 5KHDA 3SFZA 2A3SA 2CV0A 1TWAJ 2XASA 2A5EA 5BXUA 3GZNB 1R5ID 1OCTC 4EZJA 2CJJA 3QPLA 4AXHA 2ZFWA 1UG2A 3CCUI 1EF4A 1QZ2A 2H6HA 4OOIA 3U4TA 2XF5A 1OMIA 3ZXPA 3HRMA 2P7CB 3S15J 1PJRA 2V0PA 4RG6A 5DIZA 3N71A 3KLNA 2E5ZA 5JLWA 4B47A 2A6EF 1JUPA 3OYBA 3CVNA 2KFDA 1SFOJ 4JX4A 4BHBA 4YFKF 2IW5A 4ENKA 3ASNH 1MX2A 3PFIA 3Q5MA 2HU9A 3CJNA 5CMWA 2LC2A 1TN8A 3LSTA 2HQAA 3WHBA 2VXDA 3FU5A 4I1AA 4UNOA 4O6FA 4RB2C 1AWCA 1QGPA 3L82A 2EZLA 3UPVA 4IYPA 4IPAA 5J1RA 3BR6A 2A68F 5K7HA 4N9IA 1ETWA 5J8CA 2Y9YA 4AEZC 2X6OA 5FKNA 1T38A 1G3NB 2VBYA 4RLFA 3OYFA 3HUGA 3WTXC 1PP7U 3L7WA 3LWFA 1HCRA 3DWLE 3KCCA 2VGEA 1MBHA 1Z1DA 4UVBA 3IHVA 1WRJA 3QAHA 1WPKA 2P6TA 1L5JA 2XGMA 3MEXA 3E6DA 1MQSA 2HR2A 1F43A 3OYAA 1W5SA 1QVUA 4HV6A 2X48A 4BQQA 2DJIA 2E71A 4Y33A 1W0TA 1GW6A 1HX8A 3TWUA 3UXGA 2PFBA 5ICEA 1HKTA 1QNTA 2FNPA 4BQNA 1IRGA 3ESKA 4MQ9F 1IO2A 1XC5A 2BV6A 4BAYA 2X6HA 4GPKA 2FBKA 3K4MA 5HODA 1X1BA 4CGVA 5EG0B 5M5XJ 2IS2A 2EFPA 1OYWA 3WTYC 1MZCA 3OYIA 3H5RA 3OR2C 4JEHA 5E3MA 1MJAA 1W7PA 3OY9A 3LVQE 3NOCD 2KZTB 3EHQA 3R60A 4PJMA 4MLOA 2KIFA 2R7DA 2RVCA 2XDVA 3A0BC 2IVMA 4XLCA 5J47A 2EFWA 1T0FC 1WJCA 1X4PA 2V9PA 3OSFA 5D0QD 1D0XA 1V3FA 2H8WA 3WTWC 4KZ0A 3FWVA 2DI3A 2VODA 1APLC 1BI3A 3T5XA 2BW3A 4UVAA 3DEPA 5ENOD 3KEOA 3G4SI 3CSFA 3TMOA 5ENTD 5AIPA 3BG5A 3ZQFA 2YQ8A 3KP2A 3OMYA 3CJQB 2NOGA 3I0TA 4OMYA 3FUKA 3BEEA 4ABZA 1J09A 4GDFA 3FU0A 2MYSA 4F53A 3RSEG 4EVIA 2K3PA 1U3DA 3R0AA 1ZTRA 2DT7B 5KWDA 4HLXA 2WQ6A 2V26A 1TNTA 1W5CC 1LTXA 3H9QA 3L2CA 2W57A 3RQIA 1E90A 3ENEA 2VTBA 3BTCA 3BG0B 1LFPA 5D6FA 5DUIA 1V55H 2MABA 2PZIA 1ETVA 5IT3A 4OMZA 3G71I 2LREA 2YNQA 4GYGA 4KVMA 3SDBA 1HXIA 3LQQA 4A6DA 3GFMA 4PDKA 3QOPA 2FQ3A 2K86A 1XMKA 3FMQA 3HOYJ 3ZYLA 3CCVI 3ZVVA 4H7YA 1WVRA 2ISYA 1MMSA 4KVOA 3HXBA 5KAFC 3RO2A 2QSGX 2BHYA 3ZP5A 2CQ7A 2HI3A 3RYRA 4XI9A 1I50J 4BEHA 1PUEE 3LY7A 4BL0B 1U6GA 1D3YA 2L7KA 2HDDA 3P9KA 2KDZA 1JPLA 3C2GA 4ZHBA 3CSTA 3JCKC 5IP6A 2H6FA 5FLXK 3CUOA 3KYCB 3JAMK 1EF1C 1I3QJ 2QGUA 2IS6A 1G3YA 1ZHFA 2K27A 2WXQA 2WTEA 4GMRA 3PREA 4WNEA 3ZOBA 3MD2A 5CVVA 4QSHA 4EJWA 4I43A 2RV8A 3SFXA 3ZHEB 4QLCU 2DJNA 2B0LA 3PIPF 2KDOA 5H6QA 5C44J 1BU9A 1T33A 2HWVA 4HX8A 3F23A 3TG4A 3SEZA 3S7DA 4HORA 3D3MA 3FKJA 3CK7A 3R4KA 3I55I 4ZYDA 1FOWA 3ASDA 3RAUA 3CF2A 5CRVA 3GZ2A 1UW4B 1HW1A 5EIDA 5KVRA 2KXPC 4RSYA 1LDJA 5DCMB 2DMPA 3IH2A 4M3FA 5L3FA 3L6AA 2ZGDA 4JX6A 3DBRB 3SI5A 3OOPA 5EX0A 2BOLA 1P2FA 3RO3A 3M1EA 4JBAA 3NZSA 3E5XA 4B4CA 2F8XK 2MYOA 3FZVA 3TEDA 2ZNYA 3SEQA 2DYSE 1MBKA 1Z9CA 4JHJA 1VQ6I 4XQFA 2Y48A 4AD9A 2FUG2 2XAQA 1MDMA 2GRQB 3VFZA 1YMPA 4GA0A 4DX6D 1T8IA 4EPZA 1E7UA 1OR7A 2LNBA 4RAYA 2E2EA 1FX7A 4M7CA 4L9NA 3JRBA 3ONLA 2HPIA 5FLXZ 1A6QA 3F22A 2H6GA 4G25A 4XLHA 5AN8A 1VQ7I 3ABMH 3GBGA 4NQWB 3BOQA 2K02A 3RTRA 1RZ4A 4C3JJ 1ETOA 1RPWA 1Z3XA 1O4XA 1O3TA 5DM6F 4HNVA 4FE7A 3A4CA 1WI9A 4HW0A 5FFXA 2Y0BG 3MCXA 1YTYA 1S6LA 1Z67A 1IHBA 2VQ2A 5G05C 2EIJE 4HSRA 4E7LA 4A3LJ 3HXDA 2J08A 3F8FA 1UHMA 2WXIA 4FX0A 4H7XA 2XPVA 4UWKA 3QAQA 4NC6A 3ZYKA 4EBAA 1I6XA 2KIQA 2OA4A 3CHQA 2DMQA 2GXBA 3BJ6A 5FKOA 3CR3A 3Q4AB 2CQNA 3OYMA 2ETHA 5IYCJ 3HUGB 2XB0X 3PZ1A 3IWFA 2AWIA 2RFAA 3CHRA 2GW1A 1GV5A 2H27A 3PZ3A 1POGA 3RU0A 5LHGA 4BS9A 2Z5UA 4XICA 3LDZA 3TXNA 2HZTA 1R1TA 4A3IJ 3V2OA 3ZXSA 2E1MB 5EEAA 4A3MJ 2FI7A 2IRFG 2VPLA 5JHBA 2ZJ2A 2Y31A 5LGTA 4Q4ZF 2XEHA 2OJED 2EIKH 4LIVA 4DYQA 2NYXA 5M3FJ 1SEUA 3G1LA 1K6YA 1JCQA 2GROB 4EATA 1Y39A 3K2AA 1W36D 1TNZA 2Y1LE 2Y0MA 2OTJI 2IOSA 3UM1A 4PGHA 5IY5E 4JZYA 2ZJPF 4IHVA 2LYCA 3A03A 3AS8A 3UKUG 4OAUC 3BLYA 2JSPA 4LNGA 3UX4A 3SNXA 2EK5A 4U8VD 1K4TA 2FSWA 3PNYA 4BWRA 1TWHJ 1IG7A 2HDCA 2UWMA 4ENNA 4O60A 3DKYA 1QA6A 2WMOA 4ZZDA 3IBEA 3ZN1A 4ZH4F 4A3EJ 2WB1A 2KIMA 3C1DA 2NVTJ 4U0UA 5CBOA 1K3ZD 1KZPA 4G6QA 3GW2A 1K78A 1W4MA 1ZB1A 3GZ5A 1G8XA 2V9KA 1XSVA 5GPAA 3AJIA 4L2YA 3ZGKA 1NZNA 2FD5A 1DPRA 5FO5A 3FTZA 2OZ6A 2O7OA 5GTHC 4OU0A 2L5QA 1IHGA 2ZJQF 2X0LA 2VT2A 4LNUD 2KRHA 3Q79A 4LK1F 1RKWA 4GCVA 2JK3A 1OY3D 2XGOA 3KEAA 2JSCA 5A6CA 1Z5SC 1BN5A 2I10A 1NP7A 3LVRE 1X1DA 3ECHA 2XB5A 3HHGA 1V55E 1XSDA 2GRPB 1MMGA 2F48A 2XGEA 3V8LA 3OS1A 3ZQ7A 5LEKA 1JT6A 5FTPA 1U9OA 4Y4RA 5IY5H 2ZGGA 4HBDA 4UWLA 2AHQA 2UXNA 3FX3A 4KNYA 1X3UA 3I59B 3ZGQA 1CGPA 2FBIA 3N05A 1QQIA 4AYBN 3TKYA 2YPRA 3ABLH 2ZXWH 1WJFA 3DBHB 3IL2A 4XKCA 3IV0A 4G94A 1YI2I 1YA0A 2C2LA 1R9TJ 3CCQI 1E17A 4BT9A 3NZUA 3GTQJ 2PL2A 2DQRA 1R00A 5D6EA 2W84A 1MZBA 1SMTA 1A5EA 1FC3A 1WSUA 2XPIA 1A04A 4AC0A 4AM3A 2NAZA 3QK0A 1FMVA 2WXRA 1VQOI 4I2ZA 2HKOA 3DPYA 4U8YD 2Q1ZB 2I1KA 2IP2A 1Z6TA 2J09A 2ZXIA 3IAS2 3LAPA 1MH4A 1CQTA 2OCCH 3WG7H 3PQKA 4O1PA 5B3SE 2GZWA 3RRMB 1N95A 3KEYA 2G7HA 5DD4A 3ML9A 3HPHA 2FA5A 3OL3A 2QF7A 2WWYA 1HF8A 3RPUD 4LUNU 4HF2A 5DYMA 4UB6C 1J7KA 2CFZA 4JVSA 2XKPA 3O6BB 2BY3A 3BR2A 3OYCA 4BDYA 1IV6A 2IU1A 4LD5A 2DOAA 2RC4A 2EV0A 1D0ZA 1FNNA 2JA6J 4GYYA 4XE0A 1N94A 5LRSA 2H6IA 1BPOA 2W24A 4L9VA 2PLYA 3RZOJ 2VOPA 3PE3A 5ITZF 3SXYA 3WGHA 3ESLA 5K1YA 1SQMA 3DV8A 2FE3A 4B0ZA 4KBQA 4DUIA 5B1BH 2QFCA 2NOJB 4UWFA 2M3AA 3DKXA 3HGGA 4L5JA 2Y3AA 1OKRA 1OJLA 2DO7A 3ZRHA 3MFKA 3PNLB 5JFRA 2FO7A 3BZKA 4KDPA 2VGYA 4AP2A 4EZKA 1G2HA 1QZZA 1XGOA 4QQIA 5JJ6A 3LCAA 2VQGA 4I99C 4L7TA 5DCFA 4FA6A 1N4QA 4HRNA 5ILSA 1BJAA 1K6OA 3BQOA 4BSZB 2M0CA 2CV1A 3PO3J 2YSRA 5F64A 1LE8A 1NFIE 1FCHA 3BQZA 5FROA 4DZPA 3C3QA 1VQ4I 3G2TA 3CQGB 1JKPC 2UUZA 3BR5A 5HS9A 3NARA 2EILE 1ONVA 2F5FA 2XF7A 4EZLA 2R5ZB 4JXTA 3FTUA 3RRNB 2RGVA 4CT0A 3EJNA 1ODDA 1HZ4A 1K78B 3MEKA 2WQ7A 5BS6A 2ELKA 4B94A 4ZTJA 4NHJA 1REPC 4DIQA 3HRSA
chains in the Genus database with same CATH topology
4KMUX 1ZG1A 5JJ7A 4C0EA 2ILRA 1FWZA 1W7PD 5HQ8A 5LHIA 3VTYA 1J75A 1BC8C 4ZYEA 3KFWX 2J49A 5H6RA 1STZA 4B09A 3ML6A 2V5FA 2WXGA 1QQEA 1PDNC 4RB1A 3W6KB 2JRTA 1K7AA 2MA3A 3BJAA 2HYFA 3RJPA 4N0BA 2GGFA 2V1DA 2HGCA 4KYOB 1KA8A 3E3VA 4XZ4A 2IFUA 3MGBA 2KRFA 3SGHA 2ZMEB 4EQQA 4GCNA 4EM2A 3ASFA 4PUCA 2WM9A 1LEAA 5FQ8A 4ANXA 4OIRF 2KIUA 3PRZA 3RYPA 2L4MA 3I3NA 4CT4A 4M73A 2I2OA 4MGRA 1ZG5A 3GLXA 4DI3A 4G11A 2C6YA 1TQPA 3SD5A 2EV5A 1LEBA 2QLZA 1ULYA 2BBYA 2M45A 1DUXC 4WXCA 4N39A 3E97A 3K1PA 3FTVA 5ILVA 2EQXA 5DBKA 4WXDA 3L54A 4XSZF 2R59A 4M9ZA 3LQRA 1H9TA 1VDYA 1E7VA 4GXOA 3VLFA 4UI9J 2QM3A 4L9JA 5HS8A 5L3DA 1GXQA 4G9YA 3V7SA 4AY6A 1KQ8A 3LKUA 5FZQA 5CHEE 1H2UA 4OINF 3ROUA 4HYEA 5FGMA 2L54A 4CZZA 3HTUA 2HFHA 5HOOA 1EH6A 1H19A 2QZ8A 3KZZA 4LB6B 4HOTA 3G2SA 2H09A 1KT0A 3BROA 2WQHA 2MD5A 4HX7A 4AJWA 2HKXA 4TV7A 1PC2A 1HXDA 2LDUA 2O6GE 1UB9A 3TDUC 1ELWA 2CG3A 3K9IA 3C98A 3NQOA 2MLKA 3I53A 3D0SA 1FSHA 2CSOA 1LB2A 1TW3A 3GF2A 2BF0X 3RIBA 2LKPA 5E1WA 3DKWA 4EMSA 5FQ4A 1Q1HA 1T98A 1Z3YA 3U9GA 3RI4A 2ZO4A 4ETSA 2CHZA 4BY6A 2DTRA 1OWMA 3T5VA 2J4DA 4DI4A 2AXVA 3KP4A 3JSOA 5ANLA 1RIOH 2M30A 2F2EA 1TNSA 4A1SA 5ARGA 4WNDA 4I02A 1R22A 4P55A 1S7AA 4GZCA 3K1MA 3K0LA 4WWNA 3RKXA 1XSXA 1ZGAA 2ZCWA 5ICGA 4JC8A 4U0YA 1JUQA 3EETA 4K0RA 2KJBA 1OPCA 3B13A 3QNKA 3ZYMA 1WWXA 4B8AA 2JLBA 1UCRA 3HOTA 5K5QA 5A2QZ 4FHTA 2O3FA 4IVNA 2LF7A 4MS6A 4NACA 2ZBKA 3L00A 2ESHA 2J9QA 3ISPA 2XUBA 4JEUA 3G73A 5LEJA 4MQVA 2VBZA 3LPZA 4G1TA 5HDGA 5AJLA 5CCMA 4LG0A 4I2OA 5FB2A 5HLGA 1FPQA 4WAFA 3CUQB 3R7RA 4ZYHA 1DVPA 5JI6A 4KZCA 5L3BA 2XRYA 2PM6A 1TTYA 1B6AA 2V9VA 3GZSA 3L13A 1O57A 1SAXA 1IZ1A 3IKOB 4Z2YA 5TRDA 4JW1A 4NB5A 3QU3A 4ACKA 4I0AA 3J7AO 2ONDA 3HYMB 3RKVA 4MRUA 2NXPA 3ZN0A 1SMYF 3CVXA 1Z7UA 2DT5A 1H0MA 3NQPA 2YINA 4A1GA 2K7LA 3DEUA 3CHOA 4ON0A 2BUGA 2NNNA 2XRNA 3J81Z 1JWGA 3S7FA 2NRAC 4I2WA 3HVEB 1SD6A 4IRIA 2L0IA 3FHEA 5LFAA 4O6JA 5J90A 3URZA 1GHCA 5D5VB 4P29A 2YHCA 1YG2A 3IHYA 2FOKA 3BP8A 1N52A 3HRTA 2E1CA 3B7RL 3ERED 2CFXA 3MYVA 3E4BA 4KT5C 4R79A 1O7FA 2STWA 1U5TB 4AVXA 4ENMA 2Z33A 2I1JA 4CDRA 3CIAA 4H0EA 5FD5A 3WGGA 1HFAA 3BG1B 5E1ZB 2VGXA 4LERA 4CXFA 2YX7A 2UY1B 3WE3A 2FBNA 3LA2A 2CO5A 3GFIA 1O7LA 4CEMA 4I01A 4UQXA 4CCAA 4CICA 5J6XA 2EA4A 3OV8A 2NC9A 2L0TB 3TGNA 5E8GA 1IRFA 4I17A 4L9TA 2Y75A 3QP6A 4M6YA 4UQZA 2VSYA 4WWPA 2HM8A 3LFKA 2XIGA 4BQAA 4FJZA 4EECA 1QPMA 1ZH5A 3CVLA 3N97A 4N2QA 4Y17A 4B8CB 4FC8A 1FYLA 2O61A 2AW6A 4XLPF 2CW0F 3TXMA 1XD7A 1B59A 3FM3A 1FBSA 1KQ9A 1GXPA 4I98B 4CRWA 5FZSA 4L18B 4G23A 4GB9A 2BYVE 4DLOA 4I0BA 3LAJA 3CVYA 3CTAA 2WXMA 2VE8A 1BI1A 5LLQA 3CV0A 1G3SA 2MH2A 4BHCA 4XX5A 4ESBA 1WM5A 4AIKA 3TJPA 3I71A 5J08A 2KKOA 2X6JA 3FH5A 1ZYRF 3E6CC 3LY9A 4TV3A 2DK5A 4BSXA 3UQ3A 3R9AB 3S2AA 3EYIA 1H6KA 2X6IA 2IQCA 3BY6A 4GZ3A 4M9XA 4XI0A 3F6VA 1ZRFA 5BUZA 4UHTA 2L3DA 2OOEA 4EQFA 2O03A 1ZGJA 1HO8A 5HLIA 3ZPJA 3D9MA 2G9WA 2RN7A 2PEXA 1W3BA 2D45A 4Q69A 5ED4A 3L08A 4BX8A 4HQMA 4K03A 4GA2A 3VTXA 3GUDA 1HKQA 3FUDA 1KYZA 3MWMA 4ILHB 5D4SA 1S29A 3TO7A 3D9LA 2VSOE 2ZKZA 4N5CA 2FRHA 4GZ5A 5G2NA 3Q9SA 4PZJA 2IT0A 2QQ9A 3GVAA 2ISZA 4KN7X 4XKBA 1U5TC 5D8KB 3HSEA 2H94A 5L3CA 3SBSA 3IHUA 3RKYA 2R5SA 3K9TA 4AOFA 3ABTA 2MLGA 1IUYA 3HOSA 3EIQC 4GGGA 4P5OA 1Y6IA 3EHNA 4UI9C 4JPSA 3MA5A 1KT1A 1O3QA 2XV4S 5ICFA 1IXRC 3UT7A 1IQUA 1R5GA 5KK1A 1IW7F 3PS6A 1IN7A 2GIVA 2CHWA 1IXSB 4E6HA 3GXOA 5CVUA 5ANRA 2EV6A 1FLIA 2XPYA 4AY5A 1CF7A 1TEZA 2XGSA 2DAOA 1XCVA 2GA2A 4A3TA 3IR