3T5XA

Pcid2:dss1 structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
195
structure length
195
Chain Sequence
STAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PCI domain-containing protein 2
publication title Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 66
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01399 PCI PCI domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t5xA02
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3t5xA01
2PMHA 2BE5F 1UHWA 2QBYB 1QQIA 2W25A 1XMKA 2P4WA 3DXJF 3E3VA 3QU3A 2F2EA 1P2FA 4EJOA 3CUOA 1KYWA 4NHJA 1Z7UA 4WCGA 2IJLA 2CWEA 4O5VA 4MEXF 4UVCA 2YU3A 1Z91A 4HDUA 1H9GA 1TTYA 2GA2A 4BHCA 3E6CC 3T1BA 2O0YA 2KRFA 2FU4A 2MA3A 2FMLA 2FNPA 2DU9A 1YTYA 1T6SA 1FX7A 4CHUA 2A5YB 3OOPA 2A69F 5D5WB 5E1WA 2Q2EA 3ECHA 3E5UA 1FSEA 2IPQX 3IRRA 3WTUC 1TW3A 4YFKF 1STZA 1IN4A 4WXDA 1OPCA 5D5VB 1GVJA 4EGYA 1XSDA 2PEXA 5CYVA 1P92A 3QAHA 4A6DA 1HW2A 3B73A 4BYYA 1FNNA 3R0JA 1Y0UA 3PQJA 4RB1A 1KA8A 4GO1A 3DPLC 1T98A 3ERED 2EV5A 3VFZA 1JE8A 2HOEA 3M1EA 4XSZF 5LHHA 4BHPA 5DD4A 2HYGD 2F5FA 1SD5A 4CYDA 4QWQA 3MAJA 1DP7P 2VBWA 2AS5F 3BPVA 1IRGA 4B09A 1MGTA 2R7FA 3T0YA 1O7FA 1UFMA 3I64A 5D5XB 4HZFA 4KA4A 2OU2A 1MKMA 3M8EA 1GXPA 3I5UA 2OD5A 5F6FA 3JAMK 4ESFA 3MQ0A 3RYPA 4I98B 4LG0A 3FHZA 3BP8A 2FQ3A 1O7LA 4JQFA 3E97A 4G94A 1XB4A 3R6SA 4HA8A 2A6HF 3C7JA 5JI6A 3VODA 3TO7A 3R60A 4EQQA 3JCKC 1R1VA 3D0SA 5HS9A 1MJBA 4ZYHA 2O61A 1G3SA 3L00A 1ZREA 1YYVA 1KU7A 4IRIA 2XRNA 3M7GA 1R00A 5HS7A 4EM1A 2F5CA 2ISZA 3HRTA 2COMA 2CYYA 3D5LA 4EMSA 3BJOA 3C18A 4GXOA 1ZRDA 3IKTA 2RV8A 4BHBA 3CO7C 1XN7A 1J9IA 2HQNA 1GXQA 2R7DA 4U88A 4EM0B 1YIOA 3O6BB 4ZYEA 1U5TA 3CUQC 2OZUA 3VEPA 3TOAA 1ZG1A 2KIFA 2DPDA 3EETA 2JPCA 3WGGA 1O3SA 1BI2A 4PGHA 2M5WA 1KU2A 3KP5A 2QWWA 2PN6A 3U1DA 3COAC 3KEOA 4I09A 4LK0F 4HDVA 2Q0OA 3CDHA 1RNLA 2B0LA 1RIOH 4RGUA 5FFXA 1IXSB 3DEUA 2HEOA 5HDNA 1HSTA 4IVNA 4M6XA 1ZGAA 3FWEA 1YLFA 4YFNF 3TQNA 2HR3A 2QUFA 1U2WA 4AWXB 1B1BA 2KJBA 3HSEA 4LG0B 3DFGA 1XSXA 4DQ2A 3F8CA 2MD5A 1GHCA 3GFMA 1OMIA 5D5UB 2KIMA 1W7PD 2RKHA 1ZYRF 3H3UA 5H6QA 4KDPA 1DUXC 2VE8A 1YQAA 2HFHA 3RDIA 5FO5A 2E1NA 2JTVA 1O57A 4U7DA 3BWGA 4HW0A 4G7HF 4FX4A 1I5ZA 4Q5SF 4Q4ZF 2STTA 4RB2C 4I0AA 1SD7A 5DEQA 3P9CA 2ZNYA 2FEZA 1J0RA 3WTVC 1WWXA 3I4PA 4UXNA 3RJPA 1B59A 3DV8A 3SXYA 4KICA 3EUHA 2FXAA 4IRGA 5FD6A 1U5TB 4U0YA 1TQIA 2ZO4A 2M8EA 1S29A 1G3TA 2GQQA 5HOOA 2QQ9A 4EGZA 5LLQA 4JBAA 3QOPA 5ICCA 5EEHA 1DPUA 3GFLA 1HKTA 1IZ1A 3JTGA 1BBYA 2VOPA 1BIAA 3GW2A 1J2XA 4K2EA 2D2WA 4CICA 4ON0A 2MLGA 2XAQA 4B8XA 2PBIA 5E1XA 4O3MA 2VC1A 3HYIA 4AIKA 1LEAA 4A12A 3IWZA 3KLNA 4ENKA 5L3EA 3KE2A 3TKYA 4P96A 4M73A 1PUEE 1LNWA 4WXHA 1O3RA 2L02A 3E5QA 4UV8A 1XCVA 1S7AA 1ZG3A 4A5NA 2GAUA 6PAXA 3IWFA 3RTRA 5D6EA 1D5VA 5HVQC 4OMZA 2NS0A 1FLIA 4UNOA 2HWVA 5FLXK 2DFIA 2W85A 1OKRA 3KEQA 3M9AA 1BOAA 1FP2A 5IT9K 2WWYA 1XMAA 2QYOA 3L2CA 5A2QZ 1I27A 4WWCA 4AVPA 5L3DA 2C6YA 3F3XA 4HOBA 3WTWC 1FBQA 2LKPA 1LDJA 1BN5A 2VODA 3HTSB 1IAWA 2P7CB 3HSFA 2E7WA 2FNAA 3SQNA 1K7AA 1VTNC 1BI0A 3ECOA 3ELKA 2DK8A 2L4AA 4Z2YA 2YPRA 3J81Z 3JW4A 4IXAA 4KMUX 1PDNC 4M9SA 2FMYA 5ED4A 2MBFA 1IN8A 4LLNA 2K7LA 3K0LA 3CLOA 1E2XA 2ZJ2A 1G3YA 1OR7A 5JR3A 3E6DA 1S7OA 1TW2A 4ZYDA 2O3FA 5LBQA 1TLHB 5TJJA 4WK8F 4Y17A 1DPRA 1KQ8A 1IN5A 4PDKA 2EV6A 3HRUA 4P55A 5K1YA 2FSWA 3EQLF 2IW5A 5LEKA 2OA4A 2Q8KA 3CTAA 4YIFA 1AWCA 2W84A 1USTA 5KVRA 3MFKA 4KFCA 2G7UA 4L5JA 1FT9A 4UHTA 3V7SA 1FYLA 3H92A 4ASNA 3CO6C 3F8BA 3WTZA 1FPQA 3CJNA 4KT5C 4M9ZA 4HQEA 2VC0A 1R23A 1P6RA 1Z9CA 1F1ZA 1FOKA 1YG2A 2MRIA 2H6CA 2XROA 2IP2A 4OOIA 2VE9A 4N0BA 4OIPF 3RKYA 1S8NA 5ILSA 2M30A 4BXUA 3T8TA 4HLXA 2MH9A 2MH2A 3FMRA 1YS6A 2LF7A 3PFIA 4HX8A 2IT0A 2QM3A 3O3KA 3ZMDA 1LB2A 1IN6A 4BH9A 1JGSA 3SFZA 3JTHA 5LGNA 3BZ6A 4UUVA 5BS6A 3P7NA 3LQQA 2NYXA 4HX7A 4A2UA 1CF7A 4ZH4F 2ZBKA 5HS8A 4HYEA 1KU9A 2ESHA 2HZTA 3LFKA 2W57A 1WRJA 4S05A 5AIQA 2HKOA 4OU0A 2GZWA 3QP6A 5D8KB 2VBYA 4GYGA 3VOEA 1MJAA 3F6OA 3HOTA 2EFNA 2K27A 4IHSA 3TDZC 3WU0A 3LQRA 4ENNA 1R1UA 3GWZA 2M87A 2LDUA 2CQKA 3WE2A 1R7JA 2Y75A 2H94A 2EFQA 2D1VA 1K78A 5CVUA 3TGNA 2EA4A 1HW5A 2BV6A 4M9XA 3MEXA 1IUYA 1BC8C 2A6EF 2VT3A 4CDGA 5BQTA 3MCZA 1FZPB 3V7RA 4L0YB 4KIFA 5HDGA 4YIIA 2M1BA 1UHMA 5E8IA 3V8LA 3DP7A 3Q9SA 3C3WA 4P9UA 3CUQA 5CVJA 2PJPA 3LWFA 2LSOA 3AAFA 4GGGA 4I7HA 2PFBA 4NQWA 4I02A 3WGIA 3TO6A 1D8KA 1QO0D 2XKPA 5K5QA 4LB6B 3KZZA 2V6CA 2HTJA 2FBHA 4U0VA 3HIFA 5LGTA 1O3QA 2XASA 2PI0A 4KMFA 3HHGA 2F5EA 1RUOA 3J80K 1QNTA 2QQAA 2TDXA 3ML6A 1XCBA 1CF7B 1R58A 2XGXA 3BOQA 3K2ZA 1XGMA 1Z1DA 2HTSA 1TNTA 2EFOA 3B02A 4MNUA 2CO5A 4RB3C 3K1NA 4I0BA 4ZZDA 2PLYA 1LDKB 2STWA 4DNCA 5D4SA 3GYHX 3KP6A 3TOBA 5ILVA 2DQRA 1J59A 1B9MA 2V79A 3KCCA 2FOKA 3ZP5A 1H0MA 5J8FA 2BBYA 3U9GA 1W7PA 5L3CA 2ACJA 2K02A 2JSCA 3WTYC 1Z6RA 2H6BA 2V1UA 1K78B 2DLLA 3ZMTA 2FE3A 4OIQF 2A07F 2G9WA 3DKWA 1FSHA 3OV8A 1J5YA 3L7WA 2GA1A 4CO8A 3CHMA 3G73A 2XAGA 1KYZA 1K6OA 2EFPA 1T2KA 4RS8A 4Y13A 5DDGA 1HSJA 2RNJA 3GEZA 2QZ8A 4MTEA 1YW9A 2JRTA 3H3ZA 4ESJA 4WF2A 3CUQB 3RYRA 1V4RA 3IHUA 4U7BA 1X3UA 3NRVA 2IA0A 3N97A 1JHHA 2P5VA 3GUDA 3WTXC 3RI4A 1S6LA 4RB0A 4H0EA 4HQMA 5DCMA 4KUMA 2XVCA 2XAJA 4NB5A 4L0ZB 4MQVA 5D8LB 4RAZA 5L3FA 2K86A 3I71A 3ULQB 1FYMA 4Q48A 4GYIA 4XBFA 1BJAA 3GF2A 4OIRF 2X0LA 2J5PA 4RAYA 4ESBA 2VT2A 2A61A 4S04A 4ENMA 4MHGA 1BI1A 2DK5A 1EH6A 1OYWA 5HDKA 5IT3A 4BNCA 3HRSA 5DUKA 3ROUA 4KIGA 3BY6A 1TQPA 1V3FA 2YSRA 5DYMA 3SZTA 1W7PB 2VONA 2FF4A 4UVAA 4CXFA 1ZG5A 1KU3A 5EEGA 2D45A 3IL2A 4LCTA 1XGNA 3E5XA 2HDCA 2RVCA 3F23A 1R5GA 4QLCU 1MDMA 1BIBA 4XRFA 2O6GE 2A68F 1F5TA 1ZARA 2QLZA 5JHUA 3P9KA 3ZPLA 2OQRA 2RDPA 4UV9A 1FBSA 1ZN2A 5FFZA 3MZYA 4PGGA 1ZH5A 2YX7A 1JHFA 4A0XA 3KFWX 1P4WA 2HKXA 1SD4A 3JAMZ 1ON1A 1T39A 4FHTA 1I1SA 1IXRC 2WTEA 5D6FA 2BYVE 4D0PA 5HLHA 2M45A 2AXLA 4TV7A 2RC4A 4L18B 3WU1B 2F5DA 4MQ9F 1JXSA 5DCMB 1QPMA 1SFXA 1PP7U 2H27A 2JT1A 3I54A 2L3DA 3FZVA 3F72A 2DPUA 2ETHA 4M72A 3FF5A 2XKOA 1HW1A 5F64A 4LFUA 2W24A 2A3SA 4L9TA 3MZHA 2DAOA 1WQ2A 4AIHA 4EVIA 3GO5A 3MWMA 2O8XA 3F8MA 4HF0A 1SMTA 1DDNA 1XGSA 4HF1A 2UXNA 1FC3A 2GIVA 4A0ZA 2XHKA 5DV5A 3FM3A 3WTTC 2QENA 3V8JA 4G6QA 4XSXF 3F8NA 3QU6A 1QZYA 4L9JA 5CLSA 2Z33A 5LHIA 4L5IA 2RQPA 1ZLJA 1S3JA 4AIJA 3GX4X 5LRRA 2J5OA 3FMSA 4U0WA 1D8JA 5LRSA 5LHGA 1BI3A 3N4MA 3FXQA 1MDMB 4G6DA 5BMZA 4R79A 2E7XA 3T5XA 2L4MA 5D4RA 1BC7C 3ABTA 1KGSA 3ISPA 2GXBA 1EH8A 2HGCA 3G3ZA 3K1PA 4EJTA 2UWMA 4RGSA 2FBIA 4I01A 2L01A 2NAZA 5AIPA 1KQ0A 2VBZA 2PG4A 1FP1D 3ZQ7A 3GLXA 3HTUA 3J7AO 3P9IA 2DO7A 1J75A 5L3BA 2RN7A 2PMUA 5E20A 5ICFA 1SAXA 3QRFF 2P6SA 4JK1X 5ICGA 4G7OF 1IRFA 2GXGA 3RKXA 5J6XA 1XDUA 3ZN0A 4HAMA 3LSTA 4L9NA 1YS7A 1U78A 4EJWA 2KKOA 3JSPA 5E17F 4ENJA 2ESNA 4LJZF 1XSVA 1Z6TA 5BOXA 1LVAA 2JZYA 1IF1A 3WG9A 3E6BA 3V7CA 3LA7A 1Z05A 4LD5A 4LGWA 1REPC 2NNYA 1OYIA 2NNNA 3KP2A 2Y0MA 1KQ9A 3BDDA 4HF2A 2FRHA 1YW7A 3C1DA 1U3EM 1H9TA 3ZMZA 2PQ8A 2ZMEA 1IXCA 5H6RA 3SZPA 5TRDA 2G7HA 1G3WA 3KP3A 4A6EA 3V8KA 3GVAA 2KJCA 1SFEA 3SHFA 3K69A 2Y48A 1UB9A 1B9NA 4M6YA 3KETA 5FB2A 3HSRA 4EM2A 4FT8A 4G9YA 1T38A 3M8FA 3I59A 3KLOA 1C0WA 1MD0A 2BEOA 5ERIA 3DF8A 4XLPF 2R3SA 1F9NA 1L0OC 1Q1HA 5CVIA 1W5TA 4RGRA 2EJRA 2OAZA 4I2OA 1SMYF 1A04A 4OMYA 3ZN1A 3U2RA 3QPTA 3GFIA 1IN7A 2DW4A 2ZCWA 3FXUA 1LJ9A 5J8CA 1ZRCA 4R1HA 2QVOA 3JSOA 4IF4A 5FLXZ 1B4AA 4FX0A 4O6JA 1WI9A 2CW0F 3EDPA 1HXDA 1LDDA 2ZKZA 1ON2A 2V9VA 2CSOA 5K5OA 1QZZA 1L3LA 4BAYA 1LEBA 4MTDA 1R5HA 5IT9Z 2CFXA 3LAJA 3RKWA 4Y15A 4G7ZF 2WV0A 1FBUA 4IRHA 1ZRFA 4EJUA 1G6NA 4KIBA 1YO5C 2ZNZA 2JPBA 3NEUA 3E6MA 4LLGF 4IJAA 5A2QK 5DUIA 2D1HA 4D10C 4KYWA 2QQBA 3K9TA 3DPTA 3WGHA 4KNYA 3TDUC 1R1TA 3QPHA 2KIUA 5JVTA 1ODDA 1XDSA 5FGMA 3O2PE 1YFHA 4WX9A 2EK5A 2Z99A 4AD9A 3J81K 4P9FA 4PCQA 1MJ9A 2ZMEB 1WKMA 2O03A 2EB7A 5ICEA 4KN4X 2Z9OA 4EJVA 5AONA 5E18F 2XAFA 2UZKA 2IA2A 1SFUA 1G4DA 1K79A 4LLLA 1P4AA 3RIRA 3FM5A 1HKSA 2Z3YA 2IRFG 2XIGA 2WC2A 4F7ZA 2FA5A 5JFRA 3I59B 3WODF 3F6VA 5CVVA 1XGOA 1D3YA 2UXXA 3S2WA 3Q5FA 4L9VA 4A0YA 3IRQA 1P4XA 1U5TC 4OIOF 2DBBA 2XV4S 4IPAA 4UVBA 2V1XA 3K1MA 1OYYA 5K5RA 3QP5A 4RGXA 2P8TA 5DD8A 4IHTA 2E1CA 4MGRA 2YX4A 1RUNA 2OZ6A 3ZMVA 1NHAA 1QGPA 2HS5A 3LAPA 4A5MA 2OQGA 2DI3A 5DCFA 3HOSA 3BPXA 2DT5A 3WE3A 3R0AA 4CZZA 3FMQA 4ZYGA 1R36A 1U8RA 3I58A 3VB2A 1O3TA 4KN7X 1WSUA 4HV6A 2EFWA 2FBKA 3F22A 3GZ5A 3HUGA 1RZ4A 2ZXJA 5BPDA 4OINF 2XUBA 1LQ1A 1HBXG 4ETSA 2BGCA 5KK1A 3KP4A 3R61A 1ZGJA 3R4KA 2H09A 1W5SA 1AOYA 5CVRA 2CG4A 3FX3A 4P5OA 3RPUA 4Q47A 1ULYA 4LMYA 3RPQA 1TQMA 1TNSA 5LEJA 1USSA 2IVMA 3LA3A 1IW7F 2HYFA 3F21A 3LA2A 4GCVA 2LNBA 1J7KA 2L54A 2DTRA 4XLNF 3REOA 2VXZA 2GWRA 5HLIA 5FD5A 1SD6A 3GZ6A 2ZFWA 3I0TA 2ISYA 4N9IA 4YFXF 2ADUA 1FYKA 5LGUA 4PZJA 4MEYF 1B6AA 4BQAA 3WTSC 3DQVC 2CGPA 1BM9A 3EYIA 1U6GA 2EV0A 3W6JB 2MC3A 2P7VB 3W6KB 5E1ZB 1I6XA 3HHHA 5BPIA 2VBXA 2QBYA 4G8XA 1XD7A 2P5KA 3IKVA 4ZZLA 3TXNA 2K4BA 2VOOA 3TXMA 2K4JA 2P5LC 3T8RA 4LK1F 1FY7A 1FWZA 4M71A 1HKQA 4E70A 4HLYA 2IA1A 3BJ6A 4M74A 3ZMSA 3PQKA 3V4GA 1ZLKA 4WXCA 3BROA 5F1RA 4R8HA 1W4MA 4EV0A 1ZHFA 2NRAC 5L3GA 2HQRA 2VN2A 1F4KA 3GFJA 5E8GA 1PP8F 1UCRA 2YR2A 2OBPA 1QBJA 3Q9VA 3J80Z 1MZBA 4HBLA 1TBXA 3L09A 3I53A 2MLKA 3BJAA 1RI7A 2Z5UA 4CGZA 1T0FA 1ONVA 3ABUA 4N9HA 1EV7A 4HV5A 1E17A 1R22A 4YG2F 3IC7A 5H20A 1ZAOA 3KZYA 2EA2A 4LB5A 3ZMUA 2XAHA 3L9FA 5HLGA 2P6TA 1CGPA 2LF8A 2RGVA 3EYYA 3NQOA 2V1DA 2X4HA 1I1GA 2DQLA 3FXRA 4HX4A 1HQCA 5CJ9A 3TO9A 3F8FA 1YW8A 3HRMA 3GXOA 2ELHA 1EH7A 2EWNA 3KP7A 5ILUA
chains in the Genus database with same CATH superfamily
3TWRA 2PMHA 3S7DA 2BE5F 1UHWA 1A17A 2PM6A 2QBYB 1QQIA 2W25A 5HNHA 5C3EJ 2CHZA 1XMKA 4TXQA 1MMGA 2P4WA 3CHOA 2JEKA 3DXJF 4W1UA 1A35A 4C0EA 3E3VA 2PM7A 3QU3A 1P5QA 3SFYA 2F2EA 2XPZA 1P2FA 3LY9A 2Y4UA 1IHGA 4C30A 4EJOA 4PJMA 4JXTA 3CUOA 2AXTC 3TBIA 4F1PA 3CHSA 1YITI 1KYWA 2E5ZA 4NHJA 2JA5J 3OYIA 2E36A 1UN9A 3EHMA 2BVLA 3OYGA 4ABNA 1Z7UA 3FU6A 3KYCB 4WCGA 1OR7C 3C3QA 1H2VC 2IJLA 4TXRA 3SNXA 3BEEA 2Y9YA 4WWPA 4ITVA 3K4BA 2CWEA 1QNFA 1GV5A 4O5VA 4UVCA 4MEXF 5EILA 2YU3A 3VSLA 1Z91A 4BEHA 3I4GA 3PREA 3D1NI 3ZCOA 4HDUA 1MNMC 2CV0A 3GZ1A 1H9GA 2H8RA 3FUMA 3FU5A 4GTQA 1HFAA 4BGDA 1TTYA 2GA2A 4BHCA 3PL8A 4E7LA 3CHQA 4CDMA 3PNTB 4J8FA 4RM3A 3E6CC 5AENA 4IOAF 3T1BA 2WB1N 2O0YA 2KRFA 3CDIA 1FJLA 2C0MA 2VJJA 2R03A 3SGHA 1MBKA 1TNOA 1Z67A 2FU4A 2MA3A 1I6HJ 1BI7B 3DBLB 2FMLA 4JHJA 2FNPA 2J9QA 2DU9A 2VGYA 3AS4A 4XLEA 1YTYA 1S0PA 1LFPA 1T6SA 1FX7A 4CHUA 2VSNA 3E30A 4BX8A 3DSUA 4A63B 2A5YB 4G23A 3V30A 3DU6A 3OOPA 5GTIC 2A69F 3ZW3A 1YE9A 1E7VA 3ASFA 3OL3A 3KYDB 3HVEB 4A3TA 5AIJA 3L6AA 3GTJJ 4PJLA 5D5WB 1UW4B 4XKVA 1T33A 2Y9ZA 3MMYB 5E1WA 4D5CA 2Q2EA 5D66A 4EHMA 2K85A 3Q0UA 2HXIA 2QF7A 3ECHA 2I1KA 4HXIA 1MH4A 4AVZA 1LFUP 3D3MA 3E5UA 3N71A 3ML8A 3CVVA 1FSEA 1U8BA 2OV8A 2IPQX 3SEZA 2KCKA 4XKWA 3SFIA 2XPIA 4X0GA 2BW3B 3HXEA 4I6GA 4BBRJ 5ITZF 3IRRA 3WTUC 1O1TA 1TW3A 4YFKF 5KJLA 3LSMA 3RSEG 1STZA 4ZTJA 3WG7H 5KJKA 1IN4A 4WXDA 4PS3A 3EUKL 3FXLA 3NAWA 4BT9A 1OPCA 3B95A 4O1OA 5KBAA 1D0XA 4LNBA 5D5VB 3HOWJ 1GVJA 1OT8A 3L17A 5FWQA 4EGYA 3DEWA 5FLMJ 1XSDA 4WWNA 2PEXA 5CYVA 3B7RL 1P92A 3QAHA 4BWRA 4NBQA 4XEIG 3I3NA 2ZJPF 4A6DA 1OY3D 3MX3A 3OYFA 1VQ9I 4ABZA 1HW2A 3B73A 3ZNGA 5E3LA 4BYYA 1N9AA 4J7WA 1FNNA 3R0JA 2Z16A 1Y0UA 3PQJA 4Y4RA 4RB1A 1KA8A 3KSQA 3IP4B 4GO1A 3DPLC 3QJZA 1OCTC 1T98A 2VGXA 5EZHA 2WXIA 4J19A 3FUIA 3ERED 4RG9A 5CCMA 3CVNA 3UIPC 1X58A 2EV5A 3VFZA 4JEUA 3TAXA 1JE8A 2HOEA 1HU3A 1V5FA 3M1EA 4XSZF 2O7OA 3U21A 1K1BA 2GRLA 4XORA 2DTZA 2RREA 4MKTA 4UB6C 5LHHA 4BHPA 5DD4A 1GV2A 2HYGD 5AQ9A 2F5FA 1YI2I 1SD5A 2K9LA 3FU3A 4AY5A 3W2WA 4CYDA 3CQGB 3RKVA 3I4RB 1ELWA 1W0UA 3ASOH 3C3RA 1MBHA 4QWQA 2O8KA 1BI8B 3MAJA 1DP7P 2VBWA 2AS5F 3MGBA 3BPVA 1RKTA 2BY3A 4B09A 1IRGA 2CW8A 3DSWA 1IQUA 4IHXA 1MGTA 2E2EA 1MHQA 5CBNA 4YVOA 2R7FA 3T0YA 3CP2A 1QBQA 2XEEA 2QSFX 1O7FA 1UFMA 3I64A 5AJDA 5D5XB 3FUFA 3FH5A 4HZFA 4KA4A 3GMEA 2CUJA 2OCEA 2OU2A 3PZ4A 3K4LA 2B9SA 2FJ1A 3G71I 3CK7A 3Q7FA 1WVRA 4DX5D 1MKMA 4BEHB 3QOUA 1Z21A 3M8EA 4QPOA 3Q3SA 3ZUVB 1GXPA 3I5UA 1N0RA 3W9FA 2OD5A 3ABLH 2WB2A 5F6FA 1G2HA 1FVFA 3JAMK 4GU5A 4ESFA 4I43A 3MQ0A 5IY5H 3VYTB 1XGWA 3RYPA 4I98B 4LG0A 3FHZA 4Z68A 3OIOA 3H5RA 4HSRA 3BP8A 1LD7A 2FQ3A 1MX2A 3UXGA 4DBRA 3CJRB 2BY1A 1O7LA 5E3NA 3L16A 2OEVA 3A1YA 1V54E 1EF4A 3G2VA 4JQFA 1TEZA 3E97A 3PUBA 4G94A 3U64A 2HVQA 1XB4A 3R6SA 4HQDA 3RO3A 5C4JJ 3S17J 3BTJA 4HA8A 3D9MA 4BJ6C 2A6HF 3C7JA 3VODA 5JI6A 3TO7A 2ZXWH 2VJ5A 3R60A 4EQQA 2BF0X 4HBDA 3TWQA 3F0CA 1U9OA 5JJ6A 3JCKC 4JEHA 1R1VA 3D0SA 5HS9A 1MJBA 4ZYHA 2HOAA 2O61A 1G3SA 2X85A 3L00A 3ZVVA 1NG7A 1DNPA 2Q2EB 1ZREA 5FRMA 1YYVA 2WVIA 4EZLA 1BU9A 3K4MA 5G2NA 3CCJI 1KU7A 3CVWA 4IRIA 1IV6A 4BDZA 2BZTA 3PSIA 4FLHA 2R4GA 2XRNA 1ETYA 3TL4X 4L9PA 2X1CA 2CFZA 2C2LA 3M7GA 4PUSA 1R00A 5HS7A 4II3A 4EM1A 2F5CA 4BU2A 2ISZA 4LERA 4LNGA 5CRUA 3HRTA 1YMPA 3PEUB 2COMA 3S3NA 2XF7A 2CYYA 2NOGA 4J0UA 3D5LA 5HQ8A 4EMSA 1GUUA 2CW7A 5DS9A 3HOYJ 3EHQA 2WY8Q 3BJOA 3UT7A 3C18A 3ZYQA 4UWKA 1QHHD 4GXOA 4M3GA 3TP0A 1ZRDA 3IKTA 5D2MC 1OUVA 3FTWA 4YDOA 4BT8A 1UJKA 2RV8A 4BHBA 5FZSA 3ZHEA 3CO7C 1XN7A 1J9IA 2LOOA 3H5NA 5FQ7A 4FC8A 2HQNA 1GXQA 2V9KA 2R7DA 3MN2A 4U88A 4EM0B 5G04J 2HDDA 2JQ7A 2R59A 4JD2G 1YIOA 5M3MJ 1Z3XA 1S7EA 4BE0A 3O6BB 1K8KG 3RRMB 4ZYEA 1T95A 1U5TA 1AU7A 1T08B 3TWWA 4BESA 1LFBA 4NDLA 3BLYA 4UI9J 1INZA 2JVHA 1UOHA 1QPIA 3CUQC 2OZUA 3VEPA 1FPPA 2LKXA 2M7AA 4EEFG 3TOAA 3S1MJ 2FOWA 4DX7D 2DYRH 1ZG1A 3CV0A 2KIFA 2DPDA 3EETA 2JPCA 2VGXB 3WGGA 3FH8A 3R7QA 1O3SA 2NC9A 1BI2A 4PGHA 3B7SA 3SFXA 2ZGGA 2M5WA 4BETA 1KU2A 3KP5A 2QWWA 2PN6A 1WJEA 3MD2A 2XZTG 2ETAA 1MMDA 4GMJA 4ME2A 3U1DA 2M9HA 3HB9A 5EG0A 1XPXA 1UHSA 3COAC 2JMWA 3KEOA 4I09A 4LK0F 3RZDJ 3W2AA 4HDVA 2Q0OA 3EUVA 4N5CA 3CDHA 2YS9A 2DDBA 4Y3OA 3BTCA 3DPDA 1RNLA 2JABA 4JC8A 5LCWJ 2H6GA 2B0LA 3ZQLA 1RIOH 3CCMI 2CQXA 4RGUA 1EA3A 1JTYA 1EDUA 2MSYA 5FFXA 3HDXA 5JHBA 2GBYA 1IXSB 2ZXIA 1IRZA 3DEUA 2HEOA 4DLOA 2M63A 4I99C 3ESLA 2F0YA 2OF7A 3S7JA 5HDNA 3UT4A 5G55A 2LUHA 1HSTA 4HPQA 4CA0A 1BPOA 4IVNA 4M6XA 2KM4A 1ZGAA 4BFRA 5EZGA 1FTZA 1MZCA 2WXFA 2RNGA 4HI9A 3FWEA 2AVPA 1OWMA 4ILIA 2CUZA 1ACIA 4UQZA 1YLFA 4N4NB 3VLDA 5BW8C 4YFNF 3JRAA 4H7XA 3TQNA 2HR3A 2QUFA 2ZC2A 1U2WA 4AWXB 1B1BA 2KJBA 3HSEA 4LG0B 3AU5A 3UIOC 3DFGA 2OUMA 1XSXA 4DQ2A 3F8CA 4OAZA 2ZJQF 4F53A 5BXOA 4CGWA 1U3DA 3BG0B 2MD5A 5J4YA 4E7SA 3ONLA 1GHCA 3KX2A 4J01A 3GFMA 1CQTA 5E3MA 2IQCA 5E75A 5HKPA 4F91B 1ORKA 1OMIA 3MKRA 3DTKA 4XONA 5D5UB 2KIMA 1W7PD 2RKHA 1ZYRF 2X9DA 3H3UA 2TCTA 5H6QA 1R49A 1VQ4I 2JA8J 4KDPA 2HYZA 4XN3A 2RQQA 3V31A 3G4SI 4ZFHA 3LSPA 1DUXC 2B0OE 2V7FA 2VE8A 5EX3A 1YQAA 2HFHA 3RDIA 2E0IA 2R17C 1TWHJ 5FO5A 5BV0A 3CIAA 1U2VG 3IXEA 2K9MA 3D9NA 2WBMA 3V2OA 2ELJA 2E1NA 2UV1A 2JTVA 1O57A 2K40A 4U7DA 1S70B 3BWGA 4HW0A 4G7HF 4FX4A 1I5ZA 2M0MA 1TR4A 1JKPC 4Q5SF 4Q4ZF 2DCEA 1DP3A 4DW6A 2KZVA 2M7BA 4GMRA 4U96D 3LSGA 2STTA 3FIWA 4QIWN 1TYQG 1BW5A 1S63A 4RB2C 4XI9A 4I6ZA 4I0AA 1SD7A 2MGQA 3S1RJ 5DEQA 5CEDB 3P9CA 5IP7J 3RK6A 2ZNYA 3KIOA 2FEZA 4DJAA 3AG4E 1J0RA 2Z2SB 4A93J 4ILHB 2O5RA 3A01A 2V1NA 3WTVC 1WWXA 2EIMH 3I4PA 1FTTA 3S7BA 1ETWA 3HM5A 3ZQCA 1QQEA 4U7EB 1W1WE 5HNFA 4UWFA 5CBOA 2LREA 2W48A 4UXNA 4DBQA 3RJPA 1IC8A 3APFA 1B59A 4HSTA 3DV8A 2EBIA 4PSWA 5F04A 4DYQA 3ZHEB 3IBEA 3HZJA 2KPMA 3SXYA 2BEDA 2RAEA 1Q1VA 3G2UA 4KICA 3EUHA 4XL9A 4ZDLA 4IQJA 3JRIA 1YA0A 2FXAA 4CZCA 3FBIB 3ISMC 3WHCA 3JRFA 3LCAA 4IRGA 5D0QD 5FD6A 3UT8A 3LVQE 1U5TB 1OCCH 1YX5A 3O8HA 4U0YA 1WCMJ 1TNUA 3QYFA 3MZLB 2M4GA 2XPVA 5ANLA 1AP7A 2AXZA 1TQIA 1XMXA 2ZO4A 4A3BJ 2DVWA 2M8EA 1S29A 1SEUA 1G3TA 1GW6A 4C0MA 2GQQA 5HOOA 3GTOJ 2QQ9A 4EGZA 2QC9A 2R7QA 4GA2A 3DEEA 5LLQA 4JBAA 3QOPA 3RSNA 4ZDPA 5ICCA 4BTBA 2XAUA 5EEHA 1DPUA 4UWHA 5HS0A 2GRMA 3E32A 2GLOA 3GFLA 1U9NA 1VQOI 3M07A 4ZJZA 1BL0A 1HKTA 2NXNB 5GTHC 4HS2A 4B44A 5EG0B 4K0RA 1IZ1A 3JTGA 1BBYA 4AV7A 3M4OJ 1ZTRA 3CCVI 2VOPA 1BIAA 3GW2A 5LOZA 3ASOE 1J2XA 3ZXSA 4K2EA 1N4QA 2D2WA 2P58C 4CICA 3ZFWA 1MNDA 2ID3A 2IXSA 4ON0A 3PVLA 2KDOA 2MLGA 1MQSA 1HH8A 1P7IA 2R5YA 3LJ3A 4Y6WA 2M4KA 4A3VA 1ZK8A 2B7EA 3HGYA 3UI2A 1EKEA 2XAQA 4F52A 1HA8A 2ILRA 2J4BA 5C1DA 3TWUA 4I9EA 5EX0A 4B8XA 3HPGA 3JRHA 3CVQA 2PBIA 2Y4TA 3LJNA 1D1BA 3MA5A 4HNTA 1JCRA 2Y1LE 5AARA 3MJWA 3C72A 4PH4B 5E1XA 5CCLA 4O3MA 2VC1A 3CDLA 2QFCA 5J90A 3HYIA 4AIKA 4ANXA 1LEAA 2OPTA 4A12A 2CMPA 1NK2P 3IWZA 3KLNA 4N5QA 4ENKA 2DN0A 1AKHA 3CKCA 2V26A 3CCUI 4AJWA 5L3EA 2ZISA 4MBGA 4GB9A 1AA7A 3BC8A 2XZDG 5FQ4A 3KE2A 3TKYA 4A3DJ 4BY1J 4P96A 1WDYA 2CQNA 4M73A 1PUEE 2VLAA 4A3JJ 3S1NJ 2Q7FA 4AM9A 5AN8A 1WJBA 1QVTA 2XPUA 4DPRA 3DBRB 1LNWA 4WXHA 5F27A 4F55A 2UY1A 1O3RA 4U63A 2R7XA 4GTRA 3UM1A 2L02A 3E5QA 4UV8A 2DMPA 1XCVA 3ASDA 1S7AA 1ZG3A 4XK4A 4A5NA 2GAUA 2AQFA 3NBNB 1WJAA 6PAXA 1E3PA 3IWFA 3FXMA 2NVYJ 5D6EA 3RTRA 1D5VA 2GOMA 5T3RA 2MABA 1K6YA 1N75A 3AL0B 4PJNA 5BPPA 5HVQC 1UZCA 4OMZA 2W7NA 3UM3A 1WH5A 2NS0A 3HKZN 1FLIA 4UNOA 2HWVA 5FLXK 2KL4A 4AP2A 1DGRM 2DFIA 1ELKA 2W85A 1OKRA 4BDYA 1I3QJ 1O4XA 1NA0A 4R7LA 1YYHA 3Q0VA 3L2WA 4ANWA 3L08A 3KEQA 1HC8A 3T8MA 1NZNA 3M9AA 1BOAA 4EZJA 3H0DA 1FP2A 4LSZE 5IT9K 2JSPA 3HOVJ 2WWYA 1XMAA 3D9OA 3Q15A 3A01B 5IPAA 4A3EJ 3T9KA 2QYOA 3SF4A 2H6HA 3L2CA 1IHBA 5M5XJ 5A2QZ 4G12A 1I27A 4J8EA 1NP7A 4WWCA 2KRHA 3JQ0A 4AVPA 2VSXE 2YHCA 4NNJA 5L3DA 2C6YA 3F3XA 4HB5A 4UI9K 5FJYA 4HOBA 3WTWC 3UX4A 1IXVA 2DBAA 2IF4A 1FBQA 3CD6I 2LKPA 1LDJA 1BN5A 1LE8A 3FUEA 2VODA 3HL2A 3AS5A 3HTSB 3RO2A 3E4BA 4KISA 1WZ2A 4I17A 1IAWA 2P9LG 2P7CB 3DSXA 1FMWA 3ENEA 2LVSA 2XS1A 3HSFA 2E7WA 2FNAA 3SQNA 1K7AA 1VTNC 2LXMA 5HODA 3PE4A 1BI0A 4UI9C 3S32A 3ECOA 3ELKA 4WNDA 1GVDA 2DK8A 4F93B 4EBAA 1DCEA 4HFGA 3QDNA 2XSDC 3J7YJ 2L4AA 3QWVA 4E7JA 3CVLA 3CVXA 4Z2YA 4IHVA 2YPRA 2DODA 3J81Z 3FH7A 3JW4A 2K9SA 4IXAA 4KMUX 1PDNC 3JREA 1V55E 4M9SA 4X1EA 2XGOA 1IO2A 3HOZJ 2WXRA 2FMYA 5ED4A 4KJZA 2ELKA 2MBFA 1KZPA 3R7RA 3I3LA 3Q5MA 2W1OA 1IN8A 1FOYA 4LLNA 3ZIMA 1OWPA 2P0WA 4GZCA 2K7LA 3BCAA 1LPQA 3E7LA 3K0LA 2QZAA 2WXQA 2QSGX 5B1BH 3CLOA 1ZU2A 2R5YB 2A5WA 4GTSA 1E2XA 4FULA 2BHYA 2ZJ2A 4JA9A 2DMTA 1G3YA 1OR7A 5JR3A 2X6WA 5IP6A 1WG0A 3Q9NC 3K7AJ 1IDYA 3E6DA 1S7OA 4ANJA 1I3AA 4UUTA 1TW2A 4ZYDA 2O3FA 3KEZA 5LBQA 4HOTA 1TLHB 5EKQD 3OXLA 3BZKA 3EJNA 1ITYA 1D1AA 5TJJA 4WK8F 2L7FP 2VPRA 1TL8A 1N4PA 2O9LA 2DYSE 4F1SA 4Y17A 1AKHB 1N4SA 4B8AA 3A2KA 1DPRA 1KQ8A 1YIJI 5J47A 3Q78A 3ASGA 1IN5A 3BG3A 5CPRB 3OS0A 5FKMA 4PDKA 3MV2B 4GZDA 2EV6A 3HRUA 3LOCA 4P55A 3W6VA 2IS1A 2LFBA 1R4NB 1ZBPA 3FTYA 3FUHA 1Z77A 5K1YA 5CMYA 2FSWA 2YQ8A 2ZIRA 2IEJA 1Y39A 3D9JA 5JA4D 3EQLF 2AO9A 1V5EA 3E0JB 2EZHA 2IW5A 2NOJB 2UY1B 5LEKA 2I1JA 2AW6A 2R5SA 5CECB 4ZTFA 2IY0C 2DMUA 2OA4A 2Q8KA 1OJLA 3CTAA 1TJFA 1U3CA 1WJ5A 4YIFA 2RG8A 3SZ7A 3DBHB 1U0JA 1AWCA 2W84A 2XPYA 1USTA 5KVRA 3I55I 1HS6A 3ZQGA 3LY7A 3TWVA 3MFKA 4KFCA 3KPHA 2G7UA 4L5JA 1UN8A 1FT9A 3S15J 4UHTA 3V7SA 4DLQA 4GYYA 4RG6A 1FYLA 1G8XA 1VI0A 3H92A 3ESWB 1FIPA 2WA0A 5IYDJ 4KVMA 4ASNA 3DSVA 1KZHA 1ZR2A 3CO6C 3TW7A 3S7FA 3P1UA 5GAHJ 2XEHA 2I8DA 3OXFA 2DT7B 3F8BA 3MVPA 4LG3A 4CCKA 4CH7A 3C3OA 3DBSA 3W2VA 2EIME 2DA7A 4LITA 5LX8A 1OWLA 3WTZA 3JRDA 1FPQA 1WJDA 3CJNA 4KT5C 4M9ZA 4HQEA 4L1BA 2VC0A 3CVUA 4I1AA 1R23A 1P6RA 1Z9CA 4DK5A 1F1ZA 1K4TA 4HRIA 1FOKA 3L1PA 1YG2A 2XGSA 1MNEA 2MRIA 4JW1A 2H6CA 3G6EI 2IGKA 2XROA 2LC2A 4LNUD 5ENOD 2IP2A 4OOIA 3JR9A 2MD0A 2A5UA 3ZN3A 4Y52J 4U0UA 3L2UA 2VE9A 5EEAA 1OCCE 5K7HA 1MSFC 1A36A 2P2CP 4N0BA 4JX5A 4OIPF 3RKYA 5HI7A 2ONDA 1LE8B 5T4YA 4ZHBA 1S8NA 2IGMA 2J08A 3WXXA 4WUYA 2R7SA 2HNHA 3PSFA 4RLFA 3K4NA 5ILSA 4JHRA 4RVBA 2M30A 4G8KA 4BXUA 2I9CA 4CRWA 5F08A 3T8TA 4HLXA 2MH9A 2I5UA 2MOWA 2MH2A 2HPIA 1E96B 2EILH 3FMRA 4GA1A 3H3VK 1YS6A 1MJ0A 2LF7A 3G2BA 3P5JA 3IHVA 3PFIA 4HX8A 2IT0A 1ETXA 2FUG2 2QM3A 3HG0D 2DA4A 4CGVA 4Q96A 3U66A 3AG4H 3O3KA 3S2HJ 4OVUA 3ZMDA 1BOBA 4GCNA 3CJTB 1LB2A 1IN6A 4BH9A 1JGSA 1JT6A 3SFZA 2L9SA 3OYNA 1PAQA 3JTHA 3TMOA 5LGNA 4I9CA 3BZ6A 2MW8A 2X1DA 4UUVA 5BS6A 3P7NA 2LKSA 3M8JA 3LQQA 4JHKA 2NYXA 4AIFA 3RCOA 1JWGA 1X1PA 1EPUA 3NWSA 4HX7A 2E19A 2UUZA 9ANTA 3HGGA 2W4SA 3HOUJ 1LTXA 2R02A 4UUSA 2VUMJ 4A2UA 3BR6A 3UQ3A 1CF7A 3DRAA 4OYSA 1TNYA 4ZH4F 2IOLA 4Y7NJ 3QKYA 2YUSA 2ZBKA 5HS8A 3LSHA 4X8QA 4LIVA 4HYEA 3OYDA 4AEZC 3DKYA 1KU9A 3J5QB 3SD5A 2ESHA 2HZTA 4B3XA 3FP3A 5KJMA 3LFKA 3CKBA 4HNUA 3CF5F 1HDDC 4DZPA 5FLVA 4LUNU 4QQIA 3CCSI 4GZ5A 2KLOA 5DM7F 5KJNA 2W57A 1WRJA 1G59A 1JUPA 5AIQA 2HKOA 4S05A 2J09A 3FXKA 1VF9A 4OU0A 4JX4A 1SA4A 3JXJA 3PUJA 5FT9A 1DU0A 2GZWA 3QP6A 2P9KG 2LRDA 4IX7A 2BXYA 3DTEA 4IEJA 5D8KB 2VBYA 4GYGA 3TP3A 1VQ5I 4J8DA 3VOEA 1X4OA 1MJAA 2QGUA 3F6OA 3HOTA 1JKQC 1A6IA 4CCOA 3O48A 2EFNA 3CMMA 2KDZA 4AYBA 4WAFA 2K27A 1FT2A 4IHSA 3TDZC 4BJ5C 4TXPA 1ZKGA 1MW7A 3WU0A 3LQRA 2VKHA 1R1UA 4ENNA 2UWJG 2IONA 3GWZA 4U0ZA 4UUCA 5ENSD 2WXHA 2FI7A 3OR2C 4L2YA 3SDBA 2M87A 2LDUA 5KAIC 3FFLA 4BSXA 4GZ3A 2CQKA 2L7MP 3WE2A 3G2TA 3HG9A 4HRNA 1AWCB 1R7JA 3ZQQA 4PS8A 3DSTA 4XOPA 2Y75A 4XRSG 2H1KA 4I2ZA 2JUGA 2H94A 5FROA 2XCBA 2EFQA 2D1VA 3UR3C 5B1AE 4DOZA 3SQVA 1Y0NA 2X48A 3MZ8A 4BY7J 2ZMEC 3I56I 2E5NA 5M3FJ 1K78A 5CVUA 5J1UA 2EA4A 3TGNA 4F6RD 1HW5A 2BV6A 3QARA 4XLHA 4M9XA 2JLBA 2XHEA 4G2VA 3LNQA 1BR4A 4BKXA 4FE7A 3MEXA 1XG1A 3G1LA 1IUYA 3DEOA 1H89C 1BC8C 3ERMA 2OV7A 1Z5SC 2LNIA 3LVRE 2A6EF 4B43A 2VT3A 3EUAA 4CDGA 5BQTA 5EF6A 1HDPA 3R9AB 4C48B 3MCZA 3CCQI 1FZPB 3CQCB 3EU9A 4XRSA 3IHYA 3V7RA 3GYZA 4L0YB 2LMDA 3FKIJ 4KIFA 5HDGA 4YIIA 3HEFA 3GZ2A 2DOAA 2AHQA 2M1BA 1UHMA 1OCOH 4M3FA 2QYUA 5E8IA 3OIQA 4QTRA 4BSZB 3V8LA 1NA3A 3CESA 3DP7A 3OXGA 1R5ID 2XF6A 3Q9SA 3JQ1A 3C3WA 4P9UA 5CRVA 5EYRA 3CGHA 1UG3A 3CUQA 5CVJA 2YHEA 2JWTA 4N3CA 2PJPA 2V8SE 3LWFA 2LSOA 2L0KA 1UJJA 2N8GA 3AAFA 4GGGA 4I7HA 1X3WB 2PFBA 4NQWA 4I02A 1WY6A 2GRPB 3BG5A 3WGIA 1KT0A 3SBSA 3TO6A 2PJRA 2X6OA 1D8KA 4J6IA 1QO0D 2XKPA 2KATA 1N52A 1R6RA 5K5QA 2CG3A 3RU0A 3VLEA 4LB6B 4BX9A 3KZZA 2X6XA 2V6CA 2HTJA 2FBHA 4U0VA 3HIFA 3RRNB 2KFDA 5LGTA 3C2GA 1O3QA 2YNQA 4EECA 2XASA 4IN3B 2M0CA 2PI0A 3Q75A 2ME0A 2GM4A 4KMFA 5KHDA 3CCEI 1VQLI 2G0EA 2XGDA 1SVMA 1VFCA 3HHGA 3B6AA 4DUIA 2WXGA 1VQNI 2X6JA 2XRZA 2F5EA 3K10A 1RKWA 2I10A 3L54A 4BE2A 4LG6A 1RUOA 3J80K 1HG2A 1QNTA 3H9GA 2QQAA 4JP0A 1EYHA 2TDXA 5B1BE 2VB6A 1N94A 3NARA 3ULQA 4DX1A 1OISA 2MC4A 4UUSB 3ML6A 1XCBA 4Z6YA 4F3QA 1MH3A 1CF7B 2L9BA 3KZIC 3QPSA 3VYRB 1OCPA 3QOEA 4B4CA 1E8ZA 1R58A 5EN5D 2XGXA 3ASNE 1X3ZB 3BOQA 1N11A 2VGEA 1GDTA 3AJIA 3K2ZA 4HRLA 2P9NG 5BNWA 2PL2A 3OYMA 1XGMA 1Z1DA 2HTSA 5FINA 5J08A 1LVKA 1TNTA 2EFOA 3B02A 1JTXA 2CO5A 4MNUA 4RB3C 3K1NA 4I0BA 4ZZDA 3GTPJ 4S0HB 5GP9A 2PLYA 1LDKB 2AXVA 3TWTA 2WXLA 2STWA 2EQRA 4DNCA 1MMSA 3LDZA 4JX6A 5D4SA 4PK4A 3GYHX 3A0HC 2X3MA 3AAAC 2Y0BG 4IULA 2KZGA 3NAUA 3CQZJ 3D5RC 4W9RA 4AYBN 3VTYA 3AFHA 1V55H 1RPWA 2TRTA 3KP6A 1L5JA 3TOBA 5ILVA 1P7JA 2FO1E 2DQRA 2J49A 1J59A 1B9MA 2V79A 5IYCJ 3KCCA 2FOKA 3ZP5A 1H0MA 5J8FA 2V0PA 3JUEA 5JVGF 4YDYA 2VTBA 4U07A 2BBYA 2XB0X 2IS4A 2LSVA 4YDEA 4HG2A 3LMMA 2XS8A 3U9GA 2GXAA 1W7PA 2F8XK 4A3GJ 3FULA 5FKNA 2WV1A 3VTXA 2ZU6B 5L3CA 4GTTA 2ACJA 2K02A 2JSCA 3WTYC 3FK6A 1DVPA 5CMWA 1Z6RA 3LSIA 4FHJA 3RQ4A 3CSTA 3AG2H 1R71A 1JKOC 3OS1A 4J8YA 3I4MJ 1D0ZA 4L2LA 2CQQA 2KP6A 2M3AA 2H6BA 2H8WA 3S3OA 5J1YA 4NURA 2V1UA 3M1CA 4UY8I 1NTCA 1K78B 2DYSH 1OLTA 2DLLA 2FE3A 3ZMTA 5EYLA 4DX6D 4OIQF 2LSUA 1TC3C 1E8WA 2A07F 1Z3YA 2G9WA 3OIPA 3DKWA 4EZKA 1FSHA 1MSEC 2Y0SN 4D7NA 1G3NB 3D9LA 2A4ZA 1HE8A 2XCCA 1WJCA 3OV8A 1J5YA 3L7WA 2VQ2A 2GA1A 2GRQB 2K5CA 4CO8A 2EQXA 3CHMA 2EH3A 2GRRB 3HYMB 3HXFA 3G73A 3LXUX 2XAGA 2GGFA 1KONA 1KYZA 4E7HA 1K6OA 1S9HA 3L13A 2EFPA 2OEWA 1T2KA 1W5CC 3ASHA 4RS8A 1QZ2A 4Y13A 1X1BA 1KLXA 1TN6A 2PMZN 3LEWA 5DDGA 1Y1WJ 1HSJA 2RNJA 3IAM2 3B6CA 3GEZA 2QZ8A 2GIZA 3NF1A 4MTEA 1OXJA 5D0OD 1TWAJ 2ZSIB 2I2OA 1YW9A 2JRTA 1QU3A 2QSHX 3V42A 3FDYA 3H3ZA 2XGEA 4ESJA 2LG4A 3MEKA 3ML9A 1ZB1A 2CHWA 4WF2A 4NC8A 3OYCA 3CUQB 2PNNA 3RYRA 1V4RA 1W0TA 4ACKA 3S8PA 2FO7A 3J7AY 3DTIA 3IHUA 4U7BA 5T8IA 1X3UA 3NRVA 3S2AA 2EILE 3PO2J 3HKZA 2IA0A 1BR2A 4NQWB 3N97A 2WXMA 1JHHA 2PJRB 2P5VA 1MX6A 4B94A 3GUDA 3WTXC 2LD5A 3RI4A 1S6LA 1VQ8I 2Y69E 4RB0A 4H0EA 3PIOF 2K3FA 3MKLA 2VJIA 4HQMA 4A1GA 5DCMA 1XS9A 4KUMA 2NVTJ 2XVCA 2XAJA 4NB5A 4L0ZB 3FISA 2KBXA 3PDNA 4CCAA 4MQVA 3B7UX 2E35A 3K9IA 1D8EA 1IV8A 3AKZA 2QCOA 5D8LB 3B7BA 4RQIA 2XEVA 1D8DA 4RAZA 5ENRD 4PJJA 3FK7A 3TEDA 3FY4A 5L3FA 1IDZA 3IH2A 2K86A 4WNEA 3IAS2 3I71A 2OCCH 2Y2ZA 3Q0WA 5F0HA 3ULQB 3KYLA 1FYMA 2IO3C 4IHYA 4Q48A 5J1RA 4GYIA 1J09A 4XBFA 1BJAA 3L2QA 1H2UA 2ZJRF 3GF2A 3MKZA 3QNKA 3IV0A 3BG9A 3E34A 4OIRF 3L82A 4OAVB 4TRQA 2X0LA 5G05C 2WMOA 2J5PA 4RAYA 2XSJC 2OTLI 3C5RA 3G1MA 3HBLA 3QYBA 4ESBA 3S14J 2VT2A 4KZ0A 3APDA 1X19A 4V2GA 2A61A 2OJED 4S04A 3AS8A 4CT0A 4ENMA 4J00A 5JJTA 1HCRA 3K4JA 3HJEA 4MHGA 4BE1A 3QYEA 1BI1A 2DK5A 3SDGA 1EH6A 3FUJA 1OYWA 5HDKA 2F4IA 2YINA 3IKOB 4KYOB 4EATA 3ZYLA 3BUAA 5IT3A 3CHPA 3SBTB 1FT1A 3S3MA 4BNCA 2GOXB 3HRSA 5DUKA 4PS7A 4G11A 3OR1C 3ROUA 3OOUA 2QA4I 4KIGA 3BY6A 1K4SA 1TQPA 4BERA 2HQ5A 2FD5A 1ZR4A 3BQZA 2R05A 2WXKA 2VTBB 1SA5A 1V3FA 4XLCA 2YSRA 3SEQA 3DLLF 3E37A 5DYMA 3SZTA 2R2LA 1W7PB 2VONA 2FF4A 2V4JC 4UVAA 4CXFA 1ZG5A 3FUDA 4MRUA 4KITB 1KU3A 2AXUA 2WADA 5IOYA 5EEGA 5DIZA 2D45A 5KAFC 3IL2A 4LCTA 4D5FA 4NRHB 1XGNA 3E5XA 4V19K 4V3IA 4JPSA 3K70C 1SC7A 2Y3AA 3K70D 2D5VA 3CMAI 2OTJI 2HDCA 2RVCA 1T8IA 3F23A 1M1EB 2J07A 4Y33A 3MYVA 1R5GA 4QLCU 5FKKA 4YVQC 1MDMA 1JCSA 1Y8RB 1BIBA 1BR1A 4XRFA 3RKQA 3UM0A 2LYCA 3J5PA 5CHEE 1PVEA 2VKDA 2O6GE 1FEXA 2WQ6A 4WNGA 2A68F 3LS8A 1O5MA 2EIJH 3H35A 4ZC3A 2R92J 1TT0A 1Y1VJ 2IOSA 4GTPA 3RPUD 1F5TA 4C3HJ 1ZARA 2QLZA 4CDNA 5JHUA 1FVHA 3ZYMA 3P9KA 5FTPA 4KZCA 3ZPLA 1R4MB 1E8XA 1UMQA 2OQRA 2RDPA 4UV9A 2IFUA 4PJ0C 1FBSA 1I39A 1ZN2A 3H1CA 5FFZA 3OTNA 3MZYA 1OCOE 3FTVA 4PGGA 1ELRA 4XIDA 2WXOA 5M72A 4URKA 1ZH5A 3E1SA 3GZNB 2YX7A 1JHFA 4A0XA 3OYKA 3R9MA 3KFWX 1P4WA 2HKXA 1SD4A 3JAMZ 1ON1A 1T39A 4FHTA 2AJAA 3ZYKA 1BJZA 1OFCX 1LD8A 1I1SA 1IXRC 3FWVA 4IRUA 1YJNI 1H2TC 2E1MC 5M5YJ 1KT1A 4D9JA 3DXMG 4JVSA 5HLTA 1IYGA 2WTEA 3H36A 1Q2ZA 5B1AH 2J8SD 5D6FA 2BYVE 4D0PA 4N3BA 2F5VA 5HLHA 2M45A 1DCQA 4OWRB 1N95A 2AXLA 2H6IA 2L5QA 4TV7A 2RC4A 3BG7A 4L18B 2PQRA 3WU1B 2NXPA 2CFOA 2P81A 2Z1DA 5IP9J 4YRVA 2F5DA 4MQ9F 1JXSA 3O4ZA 4TUMA 5DCMB 3A03A 5GAEJ 1QPMA 1RR7A 4BXFA 2XQ0A 1SFXA 3GTLJ 1A5EA 4RDUA 1JCQA 1PP7U 4EBAG 2H27A 4AXHA 2JT1A 3QQAA 3HRAA 3I54A 4TUUA 2L3DA 3FZVA 3BU8A 3F72A 4A3KJ 2ETHA 2DPUA 3Q7AA 4PUCA 1DC2A 1X4PA 1X1DA 4M72A 3ULYA 3PIPF 3FF5A 1E0EA 2XKOA 1HW1A 2AWIA 3H9JA 5F64A 2XGCA 2K9QA 4LFUA 1IKND 4FISA 3PO3J 1X81A 1ETOA 4U87A 2EZLA 1K1AA 2LO6A 3DKXA 3OYJA 2L7ZA 1SVLA 2W24A 1TN7A 1GT0C 2A3SA 1UELB 2L9NA 4L9TA 3MZHA 3OWTA 1B8IA 2DAOA 1WQ2A 3BR0A 2IBDA 3PNLB 4E6HA 2AQEA 4AIHA 4TV3A 3DWLG 1NFIE 3GLLA 3OSGA 4A3MJ 2X6IA 2IU1A 3B13A 3I4NJ 4EVIA 3GO5A 1S5LC 3PE3A 1V5GA 2MG4A 3MWMA 2O8XA 3F8MA 4HF0A 5ENTD 4CYMD 3HXBA 1SMTA 1DDNA 1XGSA 4HF1A 4OVVA 1NG6A 2UXNA 1E3HA 1FC3A 2DJNA 2LK2A 3DLAA 4GCOA 2HU9A 5AJLA 2GIVA 1FCHA 1O1RA 4FU3A 4A0ZA 1MBGA 2CJJA 2XHKA 5DV5A 3FM3A 3WTTC 2QENA 2WAQN 1POGA 3V8JA 4G6QA 4XSXF 2NVUB 3F8NA 4DZJA 4CDRA 2DFEA 2CU7A 3QU6A 1QZYA 4L9JA 5GADJ 3E33A 5CLSA 2Z33A 2EZIA 5LHIA 2R7ZJ 2DT6A 1H6PA 4AC0A 3BZCA 4XRMA 4L5IA 2I6HA 2RFAA 3UPVA 2VQCA 4APOA 2RQPA 1ZLJA 1S3JA 4AIJA 4OAUC 3AG2E 1E90A 4II2A 2W82A 3ASNH 3GX4X 3GTGJ 5ANRA 1UG0A 4G1TA 5E3OA 5LRRA 1AHDP 4L7TA 2L2OA 4LOCA 4N39A 4A69C 2E71A 2J5OA 5KNLA 3FMSA 4U0WA 3ZPJA 1D8JA 2EINE 5LRSA 4UQYA 3K2AA 5LHGA 1SW6A 1BI3A 3N4MA 2VL8A 2CFUA 3FXQA 1A31A 3P2BA 1MDMB 4F7AA 3LY8A 4YELA 2V4HC 4G6DA 4GPKA 1XTAA 4BL0B 1TWGJ 1PUFA 5BMZA 4R79A 5FIOA 2E7XA 4A3CJ 1E8YA 3T5XA 4N2SA 3UM2A 2ID6A 2L4MA 2LY9A 3CMEI 3AG1H 5D4RA 1BC7C 2A5EA 3FXOA 4NUBA 2KHMA 2VKEA 4E7ZA 3D9HA 5B3SE 3ABTA 1DGWY 3FBNB 3BCBA 3X2QH 1MBFA 1KGSA 4JB8P 3ISPA 2GXBA 1T0FC 1YX3A 4DRXE 4HOUA 2HXOA 3V2XA 4Q69A 1EH8A 4RBOA 3PS6A 2XC7A 3FTXA 2JK3A 2HGCA 3G3ZA 2J4DA 1H88C 3FTUA 3K1PA 4EJTA 2UWMA 4RGSA 2FBIA 3CSFA 3A0BC 1N0QA 4I01A 1F36A 2IGNA 3FUNA 2L01A 2DWZA 3BR2A 2NAZA 5AIPA 1KQ0A 4BACA 3EPZA 2VBZA 2PG4A 2WMNA 2L7KA 2LH9A 2DDAA 2LTPA 1RRJA 2C0LA 3KEAA 4A55A 1FP1D 3ZQ7A 2X6HA 3GLXA 3CVPA 2QQ8A 3HTUA 2L0TB 4NACA 5EGOA 3OYBA 5H2FC 1OWNA 2F37A 3JYSA 4Q94A 3J7AO 2MYSA 3P9IA 3U3WA 4FHKA 3K4KA 2DO7A 1J75A 2FQ4A 4GFBA 3Q73A 3UTMA 2WAFA 2KRCA 5L3BA 2RN7A 2PMUA 4AU7A 2R7RA 5E20A 2CV2A 3V79K 5ICFA 1SAXA 3QRFF 2X38A 4B1RA 1JPLA 1MBEA 4J8SA 5ENQD 4RA2A 2P6SA 4CCNA 3KAEA 5FQ8A 3TJPA 4JK1X 2L9RA 5JHFA 5FKLA 5ICGA 4G7OF 3HOXJ 5IYBJ 4KVOA 3TGOA 3K6GA 2KT0A 1IRFA 4BJTA 3PZ3A 2R5ZA 2GXGA 1HF0A 2VASA 5AQAA 3BR1A 5BT1A 4KXKB 4AY6A 4FCYA 2HVSA 4IHWA 2DA6A 1JGGA 2OCCE 3DEPA 3RKXA 5J6XA 1XDUA 2E2IJ 3D9IA 3ZN0A 4HAMA 3LSTA 4L9NA 3PRZA 1YS7A 2B6CA 1U78A 4M3DA 4EJWA 3CCRI 3LKUA 5EYPF 2KKOA 3JSPA 2BY2A 5E17F 4I2WA 4M3EA 1SANA 4ENJA 4HVBA 2ESNA 4PDXA 4ANUA 1IJWC 1QA6A 2IGOA 3GW4A 1B8IB 2OVFA 4LJZF 3QK0A 1Y6IA 2PZIA 2HVRA 2CUFA 2CUEA 2L6JA 3HDDA 3CC7I 1XSVA 1Z0XA 3EIQC 5ARGA 1RETA 2Y69H 3NQPA 4JYKA 1Z6TA 2DCPA 3C98A 1TWCJ 4K5CA 5AQBA 2CRGA 4DIQA 5BOXA 4CYCA 1LVAA 2JZYA 1IF1A 1T56A 1GLNA 3FDHA 5CEAA 3WG9A 3E6BA 3ONQA 3VWBA 1JWFA 4AVXA 3V7CA 2CS3A 4FETA 3ZQHA 2QEXI 4P1WA 4IOCF 3LA7A 4XLFA 1ETKA 4MO7A 3F6QA 1Z05A 3LPZA 2KISA 4LD5A 3H9QA 4LGWA 1REPC 4FA6A 2XRYA 2IAIA 3IEGA 4EQFA 2K3PA 2XENA 4GMLA 2VQGA 1WGXA 2NNYA 4UWLA 3ESKA 1OYIA 3FXJA 2NNNA 5LP0A 3T8KA 4U0SA 4MIMA 5CQGA 3KP2A 3ABKH 5G05J 2NYJA 4A1SA 1E3OC 2Y0MA 3PZDA 3IUOA 3BR5A 4XZ4A 1KQ9A 3BDDA 4PFPA 4ATZD 1K83J 5H7PA 5CERB 4FTHA 2FX0A 2HPMA 5F1JA 4XI0A 3DSSA 3DWLE 1NH3A 2VJ4A 4M7CA 2KXPC 1WH7A 4HF2A 2FRHA 1YW7A 3C1DA 1U3EM 1H9TA 3ZMZA 5AQ7A 4FLBA 1UAAA 2PQ8A 2ZMEA 1HOMA 5JMND 5FQ6A 5K7ZA 4WNFA 1IXCA 3T5VA 2HOSA 4XM3A 5H6RA 2OOEA 3SZPA 1X1AA 5TRDA 5FJ8J 2G7HA 1G3WA 1VQ7I 3KP3A 1EF1C 2ECBA 2EIJE 4A6EA 1OCRH 3LSJA 3V8KA 3GVAA 3QWPA 4DI4A 2KJCA 1PUFB 1SFEA 2WY7Q 3SHFA 3K69A 3SZGA 4B47A 3MV3B 4UWGA 2WQ7A 3PJRA 2Y48A 1UB9A 5E79C 2M34A 1JJ8C 1B9NA 5DBKA 4M6YA 3KETA 3U1KA 5FB2A 2VJ8A 5BXUA 4GTOA 3HSRA 3CCYA 3OAWA 4EM2A 4FT8A 3S1QJ 4G9YA 3ZQIA 3M8FA 4JOMA 1T38A 5HRYA 1WPKA 2VI6A 3I59A 5TISC 5AYWD 3DPUA 3ZXPA 3KLOA 1C0WA 2YU9J 1MD0A 1TT5B 5B66C 4O1PA 2JA2A 2BEOA 2XB5A 3HXLA 4XN0A 2LP0A 1VQPI 1IUFA 3SYTA 5ERIA 3VYSB 4IKFA 5KNHD 2LXLA 4XKCA 2MHKA 2DXIA 2ETCA 1FMVA 3ZEFA 4MS6A 2GRNB 3ZKJA 3G1OA 3DF8A 4XLPF 4K5BA 2R3SA 5C2YA 3IH3A 3LFUA 2R7VA 1F9NA 2KZTA 4U04A 5JHAA 3Q47B 3SI5A 4C9BB 1MMAA 1L0OC 1Q1HA 5JJ7A 2JJ7A 1VDYA 4DYRA 5CVIA 3VYUB 1W5TA 4RGRA 5J40A 3L2VA 1O1SA 2EJRA 5EGOB 5B5EC 3APCA 3LYAA 2QYJA 1HXIA 2NSZA 2NS7A 5E76A 2CHXA 2OAZA 3CZ6A 4I2OA 1SMYF 3A02A 5FKOA 2ME6A 3RJVA 1A04A 2WXNA 3FU0A 5K7FA 4OMYA 3URZA 4BTAA 2MYOA 3ZR8X 3ZN1A 4GTVA 2Y0SA 3U2RA 3QPTA 3VSKA 3GFIA 1IN7A 4XQFA 2HE0A 3HXDA 3UKUG 1Y56A 2DW4A 2WPVA 4U8HA 4EPZA 5JLXA 4A3FJ 1D1CA 3OYLA 2NVQJ 2ZCWA 3FXUA 1LJ9A 5J8CA 3OSFA 4Y6CA 4ACLA 1ZRCA 4R1HA 2QVOA 3JSOA 2R5ZB 1ERDA 3DCFA 3FEXA 1TZLA 4IF4A 1B4AA 5FLXZ 2L6BA 4FX0A 4O6JA 1WI9A 2CW0F 2DMNA 3MKYB 3EDPA 3QWLA 2WAEA 1HXDA 1LDDA 2ZKZA 2PMZA 5AAOA 1ON2A 2V9VA 2CSOA 5EDNA 1HO8A 2HR2A 4RSYA 1TNBA 4RLYA 5K5OA 1QZZA 3F9KA 3NWTA 4G26A 2V9PA 1L3LA 4BAYA 1LEBA 4C2UA 4MTDA 4XR6A 1R5HA 4BQNA 1OCZH 2R7WA 1ETVA 5IT9Z 3ABMH 5FZQA 2CFXA 3LAJA 3RKWA 3H0GJ 4Y15A 1N77A 4G7ZF 3OS2A 4B89A 2X6YA 2DJIA 3EIJA 2WV0A 1FBUA 4IRHA 1ZRFA 2DOFA 3CC2I 4UQXA 4EJUA 1H6KA 4YNDA 1G6NA 4KIBA 1YO5C 1VQ6I 1WI3A 2ZNZA 4CUGA 2HM8A 4CT4A 2JPBA 3NEUA 3TG5A 5LD2C 5A6CA 1LUJB 4ZYAA 2WM9A 3E6MA 4B3AA 4LLGF 4IJAA 5A2QK 1F43A 3MCXA 5DUIA 4CYCB 2D1HA 2M2EA 1MBJA 1HX8A 1DU6A 3UINC 4KT6A 4NC6A 1QYMA 4D10C 4KYWA 2QQBA 4I1OB 3BG6A 3DPYA 1VQMI 3K9TA 1HLVA 3DPTA 3FTSA 3WGHA 4KNYA 4I1MA 3TDUC 1UG2A 2ICWG 3RQIA 1R1TA 3G2SA 3QPHA 2KIUA 1JUQA 4C3IJ 3IV5A 1X5BA 2OVBA 5JVTA 1ODDA 1XDSA 2V5QC 5FGMA 2DOEA 2LLKA 3CK9A 3O2PE 1YCSB 4FE4A 5EIBE 1RESA 3L2RA 1YFHA 2XF5A 4WX9A 4HLLA 2EK5A 4NQ0A 2JUCA 2QKLB 4RLQA 2Z99A 2E2HJ 3QC1A 3VDXA 2BTDA 3OMYA 3OYAA 4AD9A 3J81K 1SVXA 1JUSA 1SFOJ 4P9FA 4RAFA 4G25A 3TL5A 4CCJA 1YHQI 2V6EA 3AG3H 4PCQA 1D0YA 1MJ9A 3VLFA 4F3VA 2DIWA 2ZMEB 3OL4A 2KIQA 1WKMA 1RW2A 2O03A 2EB7A 5ICEA 4BXXJ 3DU5A 4GRIA 4KN4X 5M5WJ 2Z9OA 2R93J 4HNAD 4O60A 4EJVA 2EIKH 1MX4A 2BUGA 5KNGA 1WAO1 5AONA 2M8GX 2W00A 5E18F 4DX2A 2DA2A 2EPFA 1A5JA 4JA7A 1P9QC 2E1OA 4CSWA 4I76A 2CV1A 3AG1E 3B7TA 4O6FA 5F0FA 2XAFA 2UZKA 2VSYA 4QFVA 2IA2A 3O8GA 3KEYA 1SFUA 1Y8QB 3MKQA 2VQLA 3PZ1A 2JRMA 3QAQA 1H0AA 3X2QE 1G4DA 5J3LA 1K79A 4LLLA 4X6AJ 4N2QA 3RAUA 1P4AA 3D5SC 3RIRA 3FM5A 1HKSA 2Z3YA 2IRFG 2XIGA 2WC2A 3QB2A 4F7ZA 1H8AC 2FA5A 5JFRA 4C9YA 3CJQB 1QRYA 3I59B 3GZSA 4GPMA 3WODF 5BV1A 4OAYA 4H7YA 2MFZA 4FP7A 1WJFA 2PX9A 3F6VA 5CQEA 5CVVA 4M3BA 4BUPA 1XGOA 1D3YA 3BG1B 2UXXA 3S2WA 3Q5FA 4L9VA 2RFMA 2A6TA 2EINH 2DMQA 4A0YA 2KCLA 3IRQA 5ENPD 2KZTB 4IL6C 1P4XA 1U5TC 5J4VA 4OIOF 2DBBA 5C44J 1WHUA 3W9GA 4U8VD 2XV4S 3Q4AB 1X1CA 4G6TB 2ZFUA 5KWDA 2Y31A 4IPAA 4UVBA 2V1XA 3K1MA 3RZOJ 1YRNA 1OYYA 3PM1A 1JJ6C 3KS2A 3S2DJ 3N05A 2X6FA 3JCUC 3TG4A 4CEMA 2JA7J 1LF8A 5K5RA 3QP5A 2P9IG 4RGXA 5B3SH 3JRBA 4LEUA 4C2MJ 4F92B 2P8TA 1YJWI 5DD8A 3G2WA 4IHTA 2E1CA 1XNFA 4MGRA 2YX4A 2F4OB 2RD0A 1RUNA 2OZ6A 3ZMVA 2IS2A 3PEVB 1TN8A 2VYIA 4G24A 4AOFA 4FJYA 2WXPA 2CH0A 4N4OB 2LBFA 4BS9A 1NHAA 1QGPA 2GW1A 4JZYA 2HS5A 3LAPA 4I6JA 4A5MA 5DM6F 3L22A 2ETBA 1EJ9A 2OQGA 4UB8C 3HPHA 3CMYA 1H6OA 3NZUA 2DI3A 4FJZA 1KZOA 5DCFA 3CK8A 3S16J 5A23A 1LKXA 3GTKJ 3RIBA 1IQRA 3HOSA 3BPXA 3EHRA 3SO8A 3KSLA 2DT5A 4IQ4A 5GPCA 3GTMJ 1HG5A 1VNDA 1S64A 4HI8A 3HHMA 4XOTA 3WE3A 3R0AA 1QZEA 4H4KC 3FMQA 4CZZA 4E7IA 3GTQJ 4PFOA 1B72A 4ZYGA 1R36A 3J7ZI 1U8RA 3I58A 4E4HA 3H5AA 3VB2A 5A7DB 4E6KG 4KT6B 1O3TA 4KN7X 1WSUA 2K9NA 4HV6A 2R7TA 2EFWA 4GDFA 2FBKA 3F22A 3ZRHA 1ETQA 2KCVA 3GZ5A 2BHZA 5TGTA 2DZOA 4RMNA 1FOWA 3HUGA 1RZ4A 4XMYA 3S93A 3C2HA 4FADA 1TWFJ 4GYWA 3ABKE 3WG7E 1SQMA 4APFA 2ZXJA 5BPDA 1E7UA 2H1LA 1WM5A 4K03A 2BKGA 2F6CA 4OINF 2XUBA 1LQ1A 2LY1A 1HBXG 4E85A 4ETSA 1H19A 2V4LA 1ZGWA 3DXKG 2BGCA 4BQQA 1FOXA 3TW6A 3BT9A 3CLJA 3TWXA 4L23A 5KK1A 5EIDA 2DA5A 3KP4A 3R61A 4NC7A 1N78A 4HORA 1N54A 1ZGJA 5BNGA 3R4KA 4C2TA 4KBQA 3FKJA 2H09A 3VPRA 3U4TA 1W5SA 3AL0C 1FIAA 2H6FA 3EHNA 1AOYA 1OCRE 5BUZA 2HQAA 5CVRA 3BTIA 5GAGJ 2CG4A 3CF2A 4ZDOA 2XGMA 3FX3A 1BLXB 4I6EA 4C3JJ 4U95D 4P5OA 3RPUA 3WU2C 2P9UG 4Q47A 2IEKA 4MLPA 1ULYA 3MKQB 3PNYA 4LMYA 3RPQA 3CVYA 1TQMA 3ZRGA 1TNSA 2VPLA 1XC5A 2OC6A 5LEJA 1TJCA 4YDWA 3UMVA 2WAQA 4XE0A 4AIDA 2LAHA 4ILGA 1USSA 2VXDA 2IVMA 4NIKA 2QY7A 4XX5A 3UKRG 3LA3A 4FASD 1IW7F 2HYFA 3HC7A 4KMOA 4BEPA 3F21A 3LSKA 3LA2A 4GCVA 2HDWA 1RC9A 2LNBA 1J7KA 1JUMA 3JRCA 4MFDA 3LL7A 2L54A 5FRNA 5C4XJ 1A6QA 2DTRA 1OWOA 1XX5A 1SVOA 4XLNF 1JKRC 3REOA 2PQNA 4XKBA 4HNVA 1R9TJ 3HXCA 2V5FA 3SJMA 5F0CA 1VQKI 1N4RA 2VXZA 2GWRA 3EUHC 5HLIA 1RR8C 2FBNA 5FD5A 1Z7LA 3FTZA 1SD6A 3FEYA 5EDSA 1PJRA 3GZ6A 2VQHA 2ZFWA 3I0TA 2ISYA 4N9IA 4GAAA 3K4CA 4HEA2 4B93B 1BW6A 4YEJA 2BVMA 5GPAA 4YFXF 1SFKA 2ADUA 1FYKA 2VIXA 3D9PA 1ENHA 2HO1A 4GZ6A 4IYPA 1YJ9I 1YRNB 1BA5A 2F8YA 2P9SG 3M3YJ 5LGUA 3W3CA 4PZJA 2GROB 3Q79A 4MEYF 1B6AA 4BQAA 3NZSA 3WTSC 5EJCA 3MKWB 1NI1A 3DQVC 4LRZA 2R7UA 2CGPA 2ZXHA 2Q1ZB 1BM9A 3JXIA 2DFFA 3CCLI 3EYIA 3ABLE 1U6GA 4MLOA 4K5AB 3CR3A 2EV0A 3W6JB 4U8YD 1SAUA 3PZ2A 5IY5E 2MC3A 2P7VB 3UKGA 3W6KB 4LIUA 5E1ZB 3FUKA 1I6XA 2CQ7A 3HHHA 5BPIA 1HF8A 2JN6A 2VBXA 4XLAA 2QBYA 4G8XA 1W3BA 1XD7A 5JLWA 2CG2A 4ATGA 2P5KA 2LBFB 3IKVA 4ZZLA 2VSOE 3TXNA 2K4BA 3WHBA 2L9VA 4P29A 2VOOA 3CHRA 3ZGKA 1HZ4A 2WXJA 3NOGD 1IG7A 1OCZE 3JUIA 2VKVA 4MFEA 3ABME 2P9PG 2HOTA 1Y8MA 1MIJA 1WFXA 3CEQA 1PYVA 2E2JJ 4HOQA 2E34A 2WQHA 3TXMA 2ZXWE 2K4JA 2X6KA 3ZQFA 2NS8A 2P5LC 3GCMA 3T8RA 2LAIA 4DI3A 4LK1F 2QKMB 1SZ9A 2DA1A 4QPQA 4PSXA 5DTDA 4DYCA 4HLEA 1FY7A 1FWZA 4M71A 4W97A 1HKQA 1NL4A 3ZGQA 4E70A 4YIRX 4RAGA 4GA0A 1QHGA 2HZDA 2IA1A 4QSHA 3BJ6A 4HLYA 1OQYA 1B72B 3Q9UC 4M74A 1MYOA 3ZMSA 5ENNA 1APLC 3C2BA 3AU4A 3PQKA 3FHNA 2E60A 2BKKB 3ZU7B 2HI3A 1QVUA 3PNTA 4ANVA 2F4MB 3RRUA 3UNGC 4B8CB 3V4GA 4AUXA 1ZLKA 2JVGA 4E7KA 2ZGDA 4WXCA 3BROA 2ZSHB 5F1RA 1NK3P 2IO2C 4R8HA 2IS6A 2BOLA 3BTLA 4L5EA 3HIZA 3HUGB 1K3ZD 3CP8A 1W4MA 4XNFA 2X51A 4CCMA 1ZHFA 4EV0A 5L3GA 1JT0A 2NRAC 5ARFA 3QWWA 2Y30A 2HQRA 2VN2A 2WB1A 1PC2A 2RKKA 2A05A 1PY1A 2IJGX 1V54H 4RM2A 1F4KA 3CC4I 4XICA 2X1EA 3GFJA 5E8GA 4IO9F 3PUKA 1PP8F 2KC7A 1UCRA 1W36C 2YR2A 2OBPA 1QBJA 2BY0A 1W36D 1UJ8A 3GBGA 4A3IJ 1TNZA 4V2FA 3AG3E 3IH4A 3HVEA 3KD7A 3L9TA 3ULEG 4M3OA 5IOZA 1YOVB 4AM3A 1KPSB 3FHEA 2LR8A 3Q9VA 2EZKA 1BD8A 2EIKE 2DZNA 3I9V2 4BQOA 3TWSA 3J80Z 1MZBA 4HBLA 4HRMB 5G04C 3U9WA 4B0ZA 1TBXA 2LY2A 4WWOA 2ZB9A 4JL0A 3A4CA 3BR3A 2DYRE 2F48A 3L09A 4BY6A 3I53A 2MLKA 3NOCD 3UUXA 2BW3A 3BJAA 1RI7A 2KMUA 3SY2A 1ZELA 2Z5UA 1ZQ3P 1DQUA 2BXZA 4CGZA 4BBSJ 1SZAA 1MMNA 3PH0C 5KCMA 1IGNA 4A3LJ 1T0FA 1ONVA 2KQRA 3ABUA 4IZZA 1B89A 1N25A 4XIFA 2ECCA 2COBA 4N9HA 3ONKA 1EV7A 3LSRA 4HV5A 3OYHA 3QPLA 1I50J 1E17A 1R22A 5CKTA 2R0QC 1K61A 4YG2F 1S72I 2XPWA 1D5YA 4HOSA 3IC7A 5H20A 4GTMA 1VZ0A 1X2MA 1X2NA 1ZAOA 5LFAA 3OY9A 2B63J 3D9KA 4N3AA 3BQYA 3PUFA 3KZYA 2E1MB 2R7OA 2L0IA 2EA2A 3PNVA 4CCLA 4D1QA 4LB5A 3ZOBA 3JRGA 3ZMUA 2XAHA 2DFHA 3Q49B 3L9FA 5HLGA 5LCWC 2P6TA 2XRLA 4FQGA 1IRXA 1CGPA 5FZRA 2LF8A 2RGVA 2XDVA 3QODA 3EYYA 3BQOA 4G8LA 3NQOA 2JA6J 3NB2A 2V1DA 2X4HA 2NVXJ 4GYOA 1I1GA 2DQLA 3FXRA 4HX4A 1JI8A 3I5PA 4CZ2D 1HQCA 2HYJA 5CJ9A 3F8FA 3TO9A 2DA3A 3EDTB 1YW8A 3HRMA 3PFYA 4D7MA 3CLQA 3GXOA 2ELHA 1EH7A 3EU5A 1D9SA 2EWNA 4M6VA 3KP7A 1TP4A 3OYEA 5ILUA 4B48A 2FULA 4DGWB
chains in the Genus database with same CATH topology
2PMHA 3S7DA 2BE5F 1UHWA 1A17A 2PM6A 2QBYB 1QQIA 2W25A 2CHZA 1XMKA 3CHOA 2P4WA 2JEKA 3DXJF 4C0EA 3E3VA 2PM7A 3QU3A 1P5QA 2F2EA 2XPZA 1P2FA 3LY9A 2Y4UA 1IHGA 4EJOA 4JXTA 3CUOA 3CHSA 3KAEA 1KYWA 4NHJA 1UN9A 3EHMA 4ABNA 1Z7UA 3FU6A 4WCGA 1H2VC 2IJLA 3SNXA 3BEEA 4WWPA 1QNFA 2CWEA 4O5VA 4MEXF 4UVCA 2YU3A 3I4GA 1Z91A 3PREA 4HDUA 3GZ1A 1H9GA 3FUMA 3FU5A 1HFAA 1TTYA 2GA2A 4BHCA 3CHQA 4CDMA 3PNTB 4J8FA 3E6CC 5AENA 3T1BA 2O0YA 2KRFA 2C0MA 3SGHA 2FU4A 2MA3A 2FMLA 4JHJA 2FNPA 2J9QA 2DU9A 2VGYA 3AS4A 1YTYA 1S0PA 2VSNA 1T6SA 1FX7A 4CHUA 4BX8A 2A5YB 4G23A 3OOPA 2A69F 3ZW3A 1E7VA 3ASFA 3HVEB 4A3TA 5AIJA 3L6AA 5D5WB 1UW4B 5E1WA 2Q2EA 3ECHA 2I1KA 4HXIA 3D3MA 3E5UA 3N71A 3ML8A 3CVVA 1FSEA 2OV8A 2IPQX 2KCKA 2XPIA 4I6GA 3IRRA 3WTUC 1TW3A 4YFKF 5KJLA 1STZA 5KJKA 1IN4A 4WXDA 4PS3A 1OPCA 5D5VB 1GVJA 3L17A 5FWQA 4EGYA 1XSDA 4WWNA 2PEXA 5CYVA 3B7RL 1P92A 3QAHA 4BWRA 3I3NA 4A6DA 3MX3A 1HW2A 3B73A 4BYYA 1FNNA 3R0JA 1Y0UA 3PQJA 4RB1A 1KA8A 4GO1A 3DPLC 3QJZA 2VGXA 1T98A 2WXIA 3FUIA 4RG9A 3ERED 5CCMA 3CVNA 2EV5A 3VFZA 4JEUA 3TAXA 1JE8A 2HOEA 1HU3A 3M1EA 4XSZF 2GRLA 4MKTA 5LHHA 4BHPA 5DD4A 2HYGD 5BPPA 2F5FA 3FU3A 1SD5A 4AY5A 4CYDA 3CQGB 3I4RB 1ELWA 4QWQA 3MAJA 1DP7P 2VBWA 2AS5F 3MGBA 3BPVA 1IRGA 4B09A 1IQUA 1MGTA 2E2EA 1MHQA 4YVOA 2R7FA 3T0YA 1O7FA 1UFMA 3I64A 5AJDA 5D5XB 3FUFA 3FH5A 4HZFA 4KA4A 2OU2A 3CK7A 1MKMA 3QOUA 3M8EA 1GXPA 3I5UA 2OD5A 2WB2A 5F6FA 1FVFA 3JAMK 4GU5A 4ESFA 4I43A 3MQ0A 1XGWA 3RYPA 4I98B 4LG0A 3FHZA 3BP8A 2FQ3A 1O7LA 3L16A 3G2VA 4JQFA 1TEZA 3E97A 4G94A 3U64A 3RO3A 1XB4A 3R6SA 4HA8A 3D9MA 2A6HF 3C7JA 5JI6A 3VODA 3TO7A 3R60A 4EQQA 2BF0X 5JJ6A 3JCKC 4JEHA 1R1VA 3D0SA 5HS9A 1MJBA 4ZYHA 2O61A 1G3SA 3L00A 3ZVVA 1DNPA 1ZREA 1YYVA 2WVIA 5G2NA 1KU7A 3CVWA 4IRIA 4FLHA 2XRNA 2CFZA 2C2LA 3M7GA 1R00A 5HS7A 4EM1A 4LERA 2F5CA 2ISZA 3HRTA 3PEUB 2COMA 2CYYA 4J0UA 3D5LA 5HQ8A 4EMSA 3BJOA 3UT7A 3C18A 3ZYQA 4UWKA 4GXOA 1ZRDA 3IKTA 1OUVA 3FTWA 4BT8A 1UJKA 2RV8A 4BHBA 5FZSA 3ZHEA 3CO7C 1XN7A 1J9IA 5FQ7A 4FC8A 2HQNA 1GXQA 2R7DA 4U88A 4EM0B 5G04J 2R59A 1YIOA 3RRMB 1Z3XA 3O6BB 4ZYEA 1U5TA 4UI9J 1INZA 3CUQC 2OZUA 3VEPA 3TOAA 1ZG1A 3CV0A 2KIFA 2DPDA 3EETA 2JPCA 2VGXB 3WGGA 3FH8A 3R7QA 1O3SA 2NC9A 1BI2A 4PGHA 3B7SA 2M5WA 1KU2A 3KP5A 2QWWA 2PN6A 4ME2A 4GMJA 3U1DA 3COAC 3KEOA 4I09A 4LK0F 4HDVA 2Q0OA 4N5CA 3CDHA 3DPDA 4JC8A 1RNLA 5LCWJ 2B0LA 1RIOH 4RGUA 1EDUA 5FFXA 3HDXA 5JHBA 1IXSB 3DEUA 2HEOA 4DLOA 2M63A 3ESLA 3S7JA 3UT4A 5HDNA 5G55A 1HSTA 1BPOA 4IVNA 4M6XA 2KM4A 1ZGAA 4BFRA 2WXFA 3FWEA 2AVPA 1OWMA 4ILIA 4UQZA 1YLFA 3VLDA 5BW8C 4YFNF 4H7XA 3TQNA 2HR3A 2QUFA 1U2WA 4AWXB 1B1BA 2KJBA 3HSEA 4LG0B 3AU5A 3DFGA 1XSXA 4DQ2A 3F8CA 4CGWA 4F53A 1U3DA 3BG0B 2MD5A 3ONLA 1GHCA 3GFMA 2IQCA 5E75A 1OMIA 3MKRA 5D5UB 2KIMA 1W7PD 2RKHA 1ZYRF 3H3UA 2HYZA 5H6QA 4KDPA 1DUXC 5EX3A 2VE8A 1YQAA 2HFHA 3RDIA 2E0IA 2R17C 5FO5A 5BV0A 3CIAA 3D9NA 2E1NA 2JTVA 1O57A 4U7DA 3BWGA 4HW0A 4G7HF 4FX4A 1I5ZA 4Q5SF 4Q4ZF 2STTA 4RB2C 4XI9A 4I0AA 1SD7A 5DEQA 3P9CA 3RK6A 2ZNYA 4ILHB 2FEZA 4DJAA 4EZLA 1J0RA 3WTVC 1WWXA 3I4PA 3S7BA 1QQEA 4UWFA 4UXNA 3RJPA 3APFA 1B59A 3DV8A 3ZHEB 3IBEA 3SXYA 3G2UA 4KICA 3EUHA 1YA0A 2FXAA 3LCAA 4IRGA 5D0QD 5FD6A 3UT8A 3LVQE 1U5TB 4U0YA 3MZLB 5ANLA 2AXZA 1TQIA 2ZO4A 2M8EA 1S29A 1GW6A 1G3TA 4C0MA 2GQQA 5HOOA 2QQ9A 4EGZA 4GA2A 5LLQA 4JBAA 3QOPA 5ICCA 4BTBA 5EEHA 1DPUA 4UWHA 2GRMA 3GFLA 1HKTA 4HS2A 4K0RA 1IZ1A 3JTGA 1BBYA 4AV7A 2VOPA 1BIAA 3GW2A 5LOZA 1J2XA 3ZXSA 4K2EA 2P58C