3T5XA

Pcid2:dss1 structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
195
structure length
195
Chain Sequence
STAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PCI domain-containing protein 2
total genus 66
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01399 PCI PCI domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t5xA02
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3t5xA01
1FBUA 1TQPA 3I59B 2P5VA 3KLNA 2LSOA 3S2WA 5K5RA 2ZXJA 3M1EA 3BROA 1W5SA 2CYYA 3JAMZ 1ZREA 2ZO4A 4IVNA 1L3LA 3F21A 1YQAA 1BBYA 2NRAC 3OV8A 3TKYA 4O5VA 2HTSA 1PP7U 4UVBA 3C7JA 3ELKA 4LCTA 1IRGA 2F5FA 1S29A 3ZMSA 2E1NA 2H6CA 5FLXZ 1EV7A 2MA3A 2EV5A 2OA4A 4BXUA 4LLNA 4A0XA 2EB7A 4LLGF 4N0BA 1ON2A 2VT3A 1F5TA 3HTUA 5DUKA 3IWZA 3V7SA 2C6YA 3KEQA 3GX4X 5CVJA 4M71A 5E1XA 4RS8A 2FBIA 5JR3A 2PMHA 1U8RA 2ESHA 5ERIA 1F9NA 4L0ZB 1OKRA 1PDNC 3LA3A 1UFMA 3K1NA 4LD5A 2K4JA 4YIFA 4ESFA 3WTYC 3SHFA 1IXRC 4RB2C 2BYVE 3F8NA 4MTDA 3I0TA 2D45A 1ULYA 1FPQA 4GO1A 3E3VA 4KYWA 2ZCWA 2ADUA 2WTEA 4B8XA 3JAMK 4O3MA 2A69F 2RKHA 2DQRA 4WXDA 3GO5A 1T6SA 1QGPA 1TBXA 1FZPB 3E5QA 1IN4A 4WF2A 2L3DA 3BPVA 5D5VB 2H6BA 2CWEA 2PEXA 2ELHA 2FNPA 5HLGA 5D6EA 1R23A 3HYIA 2V1DA 5JI6A 2G9WA 2FXAA 2GAUA 4L5JA 1ZRFA 3CHMA 4CDGA 4Q47A 1G3YA 2JPBA 1J7KA 5E20A 3ZN1A 4I09A 1JGSA 4MHGA 4BH9A 1SD7A 4P9UA 1XN7A 3J81Z 4PZJA 1S7AA 3P7NA 1IN8A 3TXMA 3E6BA 1XDUA 1I5ZA 1UHWA 3I58A 2QLZA 4EJUA 4GYGA 1P4WA 5HS9A 3QRFF 3JCKC 3KP5A 4A6EA 6PAXA 4N9HA 5D4RA 2P7VB 2F5EA 4GCVA 4DNCA 2NS0A 4MNUA 3FHZA 2HYGD 3RJPA 5LGTA 1BM9A 2IJLA 1Y0UA 1U5TB 2JT1A 4G94A 2QUFA 3JSPA 2EA2A 3EYIA 4LK0F 1FC3A 2ZJ2A 3TO7A 2PMUA 2QVOA 2QM3A 4O6JA 3QPHA 1CGPA 3KETA 2E7WA 4FX4A 4EVIA 1ZG1A 2CO5A 2VE8A 3R4KA 3GFIA 4L9TA 3R61A 2RC4A 3BPXA 3V8LA 1ZN2A 3CUQA 1V4RA 3MFKA 1Z6RA 3JW4A 1KU9A 1IXSB 2V79A 1Z6TA 2VOOA 2KRFA 1SAXA 3I59A 1TQIA 3P9KA 1SFUA 3Q9VA 2VXZA 2PQ8A 1YW7A 4JK1X 4YFNF 2XHKA 1OPCA 2QENA 4GGGA 2Q2EA 4UUVA 2EFQA 3MWMA 3FX3A 2FQ3A 3HSFA 4R79A 1LVAA 1XGNA 2EJRA 1J0RA 3V4GA 1D5VA 1A04A 1K78B 4I0AA 2ZFWA 4LG0A 4OIRF 2EK5A 4PGGA 1R00A 1S6LA 4HX8A 1YW9A 4KT5C 1MKMA 3J80K 2AXLA 1RI7A 3LFKA 2RGVA 2XAGA 1IUYA 2FOKA 5IT9Z 3WTSC 5JHUA 5LHGA 3CLOA 4Y13A 1Z1DA 3HIFA 2UWMA 3ULQB 2DBBA 2VC1A 2DT5A 1XMAA 3RTRA 1LQ1A 5CVRA 3SZTA 3ZP5A 2QQBA 4G7HF 1DP7P 1HXDA 4EM2A 1FBSA 1Z05A 1MJAA 3R6SA 1REPC 1HBXG 4FT8A 1GVJA 3RI4A 2B0LA 4G7ZF 5JVTA 5HDKA 2GWRA 2HYFA 3O3KA 3CUQB 1SD5A 1LDJA 5LRSA 2DLLA 1CF7B 1P92A 4ON0A 2CFXA 1IW7F 1MJ9A 2ZKZA 3RYRA 3WODF 5J8FA 1T39A 2P6SA 1J9IA 2YX4A 2JPCA 1R58A 4CO8A 4M6YA 2KIUA 3SZPA 1T98A 5ICEA 2X0LA 4Y17A 3FM3A 2XGXA 5LGNA 4ZH4F 4KIBA 4YFXF 1OYWA 2OBPA 2HR3A 1R5HA 4JBAA 2FBKA 2R3SA 1USTA 4KN4X 4HX7A 4BNCA 4RB3C 3J80Z 1GHCA 3E6DA 1ZGAA 1I1GA 1HKQA 5BPDA 2F5DA 3GVAA 5BOXA 1S7OA 2GA1A 1OYYA 1HSJA 1R1VA 5LEKA 5BPIA 2E1CA 4RGUA 4MTEA 1KU7A 5AIQA 3R0JA 1O3RA 4HDUA 2QZ8A 5LHHA 3V7CA 4U0YA 4M9ZA 2VBWA 4E70A 3CUOA 3R0AA 3FWEA 3FMQA 1S3JA 4BYYA 2L01A 2XKPA 4HV6A 3HOSA 1LEAA 1B6AA 5ICGA 4ASNA 4ESBA 4HF1A 2XAFA 5TJJA 2DPUA 1KYWA 3K2ZA 2YX7A 1LEBA 3RKWA 3C1DA 3C18A 1FP2A 4ZZLA 2FF4A 2FEZA 3KP3A 2CG4A 2XASA 1IZ1A 2FRHA 2NAZA 2FSWA 4NHJA 1BOAA 3F8MA 1ZARA 1XDSA 1XGMA 3RKYA 3CO6C 5L3GA 4OOIA 2X4HA 1KQ8A 1G6NA 2L54A 5E17F 5K1YA 3RYPA 3QAHA 3REOA 5JFRA 4L0YB 4S04A 5FO5A 2VODA 1EH8A 5L3BA 4A12A 1DPRA 3KEOA 2XVCA 1U3EM 3TDZC 3KP4A 4M73A 2HKXA 2M45A 3GZ6A 4OIQF 2Z99A 4S05A 1R7JA 1IAWA 3VOEA 3F6OA 1C0WA 4M74A 2Z9OA 3EYYA 2IRFG 4HYEA 1ON1A 3RPUA 4CZZA 4XSXF 2XUBA 1RNLA 3WTVC 1TW3A 4UXNA 4CYDA 4A2UA 4PCQA 3H92A 3BP8A 3SFZA 4Y15A 2GIVA 2EFPA 3WE3A 1H9GA 2W25A 3NEUA 2O0YA 4IRIA 2IA0A 2LNBA 5E8IA 1K78A 1U5TC 2D2WA 4G6QA 2M5WA 4U7BA 3HUGA 1TNSA 2FMLA 3L00A 2HWVA 1RZ4A 3DV8A 3OOPA 1T0FA 2CSOA 2MD5A 2ZBKA 2O3FA 5DD8A 2AS5F 4KICA 4GXOA 1ZLKA 5TRDA 4YG2F 2W57A 3IRQA 1FYLA 1FY7A 2QQAA 2A5YB 4ZZDA 4ZYGA 1WI9A 2VT2A 4L5IA 2MC3A 1HKSA 3I54A 3DPTA 1WQ2A 5IT3A 4BAYA 3U9GA 4H0EA 2MLKA 5CVVA 2H94A 5FLXK 2RN7A 2V6CA 3VODA 2YR2A 1L0OC 2GXGA 3HRTA 3IKTA 1R22A 3TGNA 1BI0A 2V1UA 2M30A 3T1BA 3G3ZA 4WWCA 2M87A 2FA5A 1VTNC 4MQVA 1YLFA 2G7UA 2Z5UA 3KLOA 1DPUA 2Q8KA 4MEYF 3WGHA 4XRFA 4RGXA 3KE2A 3CDHA 4ENKA 1K79A 1WSUA 2ZNZA 3JSOA 1D3YA 2O8XA 4WXCA 3V7RA 5ILUA 5HOOA 2A61A 1O3QA 1USSA 3VEPA 2STWA 1BI2A 2TDXA 5DYMA 1Z91A 2EV6A 4KMFA 2VBYA 4IRGA 2R7DA 1W7PB 1TLHB 1OYIA 1IXCA 3JTGA 3ERED 4U0WA 1YIOA 1QBJA 5A2QZ 4ENMA 1B1BA 1HSTA 4UVCA 1O7FA 2P5KA 2WC2A 5CVUA 4EM1A 3WGIA 3N97A 3K69A 2OQGA 2BV6A 3M8FA 3ABUA 3B02A 2A6EF 4LFUA 4EMSA 4UHTA 5LEJA 3T8TA 3QU6A 3LAJA 1F4KA 4IF4A 3CUQC 3O2PE 2NNNA 3F72A 4D10C 1MDMA 4M9SA 2HGCA 4WK8F 4I01A 4Q4ZF 1ZRDA 4K2EA 5HDGA 1MGTA 3CTAA 2DI3A 2ESNA 4LG0B 1G3WA 2EV0A 4HF0A 1K6OA 4AIHA 3H3ZA 4G8XA 3BY6A 1XSVA 5ICFA 4Q5SF 4UV9A 1V3FA 3KP7A 2LDUA 3DXJF 3TOBA 2IA1A 3NRVA 2P6TA 4KNYA 5E1WA 2L4MA 3LA7A 2RVCA 3WTWC 3O6BB 5F64A 2HQNA 4HX4A 3KP2A 5J6XA 1XCBA 4HLXA 1ZH5A 3TO6A 4QWQA 4R8HA 1IRFA 5A2QK 2P7CB 1W7PA 1HW2A 1ONVA 3HRUA 4LLLA 5DEQA 2DQLA 1QZZA 3DFGA 1YW8A 1D8JA 2DW4A 4KUMA 5FD6A 1YTYA 1HKTA 4LK1F 2UZKA 1P4XA 4L18B 1YFHA 1P6RA 3TO9A 3GF2A 2OQRA 1YO5C 2K86A 2O6GE 2QBYA 4A5MA 1SFEA 3ZMDA 4A5NA 1J2XA 2EWNA 4I7HA 5DUIA 2XAHA 3HTSB 1BI3A 4MEXF 1T38A 1JE8A 2ACJA 4L9JA 2EFOA 3FF5A 1TW2A 2OD5A 4AIJA 2O61A 3MQ0A 4A0YA 4RB0A 4XLNF 3QPTA 4MGRA 3K0LA 5FFXA 3CJNA 3VB2A 4AWXB 1BJAA 3GEZA 1BIBA 3E5XA 4CHUA 5EEGA 3EQLF 3DKWA 4Q48A 3E5UA 2BBYA 1U2WA 4ENJA 3MAJA 2XIGA 2D1VA 1HQCA 3C3WA 1KQ0A 3IHUA 2LF8A 1MZBA 5ICCA 3COAC 3LA2A 3DEUA 4HOBA 2Z33A 5D5XB 5LGUA 4RGSA 1WKMA 2VC0A 5FFZA 2XAJA 3Q5FA 4P96A 4AD9A 5IT9K 1R1TA 2JZYA 4UVAA 1FBQA 5AIPA 1ZLJA 4ENNA 1TQMA 3SXYA 2PJPA 3GWZA 1FP1D 4KA4A 4PGHA 2DTRA 4BHPA 4F7ZA 2JRTA 2M1BA 4EJTA 2DFIA 4LGWA 5D5WB 3WU1B 2EFNA 4BHCA 2FBHA 1FLIA 3FM5A 2K27A 2NYXA 3F8CA 5HLIA 5BMZA 2H27A 3F6VA 3BOQA 4OIPF 3DP7A 4G7OF 4HQEA 1X3UA 3GLXA 4WCGA 2R7FA 1RUNA 2W84A 2IP2A 4BHBA 4ZYHA 1Z9CA 5F6FA 3I71A 1I1SA 4HA8A 4M9XA 3RDIA 1XSDA 4KIGA 4EGYA 4OMYA 4XBFA 1O57A 1ZGJA 3I4PA 5F1RA 5D4SA 3WTXC 1WRJA 2QWWA 4U88A 3K1MA 5BS6A 4EQQA 5HVQC 2CGPA 5DCFA 3D0SA 2MRIA 5FGMA 2OZUA 2VONA 4YFKF 4HZFA 5CJ9A 3T8RA 5CVIA 3HHHA 5CLSA 1GXQA 1IN7A 1G3SA 3N4MA 3BJOA 3KCCA 4Z2YA 2DPDA 4WXHA 1XCVA 2RV8A 4I02A 5LRRA 1IN5A 1UHMA 4DQ2A 1O7LA 1D8KA 4P9FA 2L4AA 3ECHA 2VBZA 1OMIA 4ZYEA 4OU0A 3GFJA 4IJAA 4I0BA 1XSXA 3FMSA 2PG4A 1ZYRF 2RNJA 1I6XA 1P4AA 3GXOA 1JXSA 2DK5A 2IPQX 4A0ZA 5D6FA 1ZHFA 3DQVC 1W7PD 3MZHA 4OMZA 3J7AO 4WX9A 3K9TA 3FXUA 3WGGA 2QYOA 4M6XA 2GXBA 3KZYA 1UCRA 3IC7A 2YU3A 1H9TA 2BEOA 2QBYB 2GA2A 3ML6A 2PI0A 1Z7UA 2Q0OA 5D5UB 3ECOA 1Q1HA 4KN7X 3M9AA 5DCMB 4L9VA 5HDNA 2LKPA 3HOTA 4EJOA 2A6HF 1ZG5A 4LB6B 4UV8A 1KA8A 2WV0A 3FXRA 3HRMA 3Q9SA 3GFMA 3L9FA 4M72A 3HRSA 3I53A 2XV4S 5LBQA 4EGZA 2L02A 3IWFA 2PFBA 2NNYA 1U78A 3KP6A 2V9VA 4LMYA 4ESJA 1KU2A 1S8NA 2VBXA 3W6JB 1W5TA 3IL2A 3QOPA 3R60A 2KKOA 3HHGA 2STTA 2GQQA 3V8JA 3ZMVA 4A6DA 2W24A 3L09A 2XROA 2K4BA 3QP5A 2MH9A 3WU0A 2BE5F 1ZAOA 5K5QA 3I64A 1BN5A 2A07F 4AVPA 3RKXA 3DPLC 2F5CA 4NQWA 1T2KA 3W6KB 5L3EA 1CF7A 3TDUC 3WE2A 1I27A 4IHTA 2HZTA 2KIFA 1BIAA 5H6RA 1O3SA 3BJ6A 2V1XA 2UXNA 4R1HA 5CYVA 3LAPA 5H20A 1SMYF 3BWGA 1PUEE 2HEOA 2UXXA 2ETHA 1IN6A 1KU3A 1YYVA 1QZYA 1XGSA 1XGOA 3KFWX 4XLPF 3QP6A 4EJVA 4LJZF 3B73A 1FOKA 3TQNA 1U5TA 5LLQA 1FNNA 2D1HA 1J75A 5FB2A 5K5OA 2IVMA 2DO7A 2DAOA 3P9IA 3GZ5A 4EJWA 3AAFA 2JSCA 1KQ9A 2COMA 2LF7A 5L3CA 2OAZA 2G7HA 5D8LB 1YS7A 3ROUA 2Y48A 5ILVA 2VN2A 1QQIA 3HSEA 1MD0A 5E1ZB 2ZMEB 1XD7A 2XKOA 4RGRA 1SD6A 1SD4A 1P2FA 1TNTA 3DF8A 1SFXA 4IXAA 1B4AA 4HBLA 2ISZA 3E6CC 1FSHA 3E6MA 2YPRA 3EDPA 3GUDA 2Y0MA 3P9CA 4RB1A 1TTYA 5BQTA 2RDPA 3GW2A 3QU3A 1YS6A 2A3SA 2O03A 4KMUX 1EH6A 1O3TA 1NHAA 4ETSA 1EH7A 3NQOA 3FXQA 5LHIA 4B09A 3PQJA 5DD4A 2WWYA 3M8EA 2HOEA 2HKOA 3GYHX 2FE3A 2GZWA 2KJCA 4I2OA 5DCMA 3MCZA 3F8FA 3F8BA 2MBFA 2RQPA 3F23A 3LWFA 4EV0A 4QLCU 3CO7C 5EEHA 1JHFA 2OZ6A 4XSZF 3IRRA 1RIOH 1DDNA 1AWCA 2HFHA 3E97A 1J5YA 4NB5A 4UNOA 2K7LA 5L3DA 2F2EA 1QO0D 3IKVA 1E2XA 3TOAA 5KVRA 5HS7A 3I5UA 5HLHA 2EFWA 2DK8A 3ZMUA 3RIRA 5L3FA 1LNWA 3EETA 4HQMA 1LB2A 1XMKA 2OU2A 3LQRA 2CW0F 4P55A 4PDKA 3LSTA 5AONA 1H0MA 4LB5A 3L7WA 1YG2A 3T5XA 3BZ6A 2HDCA 1ODDA 3WTUC 1MDMB 4G6DA 1KGSA 2IW5A 5FD5A 4TV7A 3MZYA 4N9IA 4U7DA 2PLYA 4CXFA 1E17A 2CQKA 2YSRA 4IPAA 3MEXA 1BC8C 2QQ9A 4RAYA 1XB4A 2FU4A 2IA2A 1R1UA 3U1DA 4G9YA 4MQ9F 2E7XA 3SQNA 2XAQA 2J5PA 1MJBA 3ISPA 2IT0A 1U6GA 3LQQA 3M7GA 4GYIA 4D0PA 4HLYA 3WG9A 5DDGA 3WTTC 1W4MA 1OR7A 4FHTA 5KK1A 3V8KA 2PN6A 1QPMA 5ED4A 5E8GA 3ZN0A 2FNAA 3BJAA 1WWXA 3F3XA 3EUHA 2Y75A 1ZG3A 1HW1A 1LDKB 1GXPA 2J5OA 3PFIA 3FZVA 1FWZA 1QNTA 4KFCA 2A68F 4HV5A 1KYZA 1FX7A 1AOYA 2HTJA 2P4WA 4BQAA 4HW0A 4ZYDA 2H09A 2W85A 1RUOA 3G73A 4FX0A 4OIOF 4IRHA 2MH2A 3ZMTA 5E18F 4HAMA 1FT9A 3FMRA 3ZMZA 3U2RA 1UB9A 2PBIA 1FYMA 4YIIA 1BI1A 2Z3YA 3T0YA 4EM0B 1R36A 4HDVA 2MLGA 2P8TA 2VE9A 3J81K 2HQRA 2DU9A 3VFZA 2JTVA 5ILSA 1G4DA 2K02A 2P5LC 4L9NA 5J8CA 1J59A 4JQFA 3ZPLA 2ZNYA 3BDDA 3WTZA 1SMTA 1K7AA 4OINF 1B59A 3F22A 5DV5A 2KIMA 2VOPA 3H3UA 1FSEA 3KZZA 1G3TA 3RPQA 5H6QA 3L2CA 3HSRA 5D8KB 4CICA 3GFLA 3ZQ7A 3K1PA 1DUXC 1PP8F 4IHSA 2KJBA 2HS5A 1LJ9A 3ABTA 1R5GA 2ZMEA 1FYKA 1B9MA 2M8EA 4CGZA 1LDDA 3JTHA 2FMYA 4U0VA 2ISYA 4AIKA 1JHHA 4P5OA 1STZA 3PQKA 2EA4A 2XRNA 5HS8A 4RAZA 1F1ZA 1HW5A 1B9NA 3D5LA 1ZRCA 1BC7C 4I98B 4KIFA 4KDPA 3TXNA 2BGCA 1IF1A 4HF2A
chains in the Genus database with same CATH superfamily
2E2JJ 1FBUA 1U3CA 2VTBB 4A3JJ 1UZCA 3GZSA 1TQPA 4WWPA 3I5PA 3I59B 3BG1B 3DCFA 3DTKA 1HF8A 2P5VA 3KLNA 2LSOA 3S2WA 5K5RA 2ZXJA 3KEZA 3SO8A 2BUGA 4CGWA 2R7XA 1T33A 2ETCA 1PJRA 3M1EA 5EZHA 2EIME 1G8XA 1S63A 3B7BA 3BROA 1W5SA 3VWBA 4CGVA 2OCCH 3JRFA 3MGBA 2DCEA 2CYYA 2X1EA 3FTYA 3FXMA 1A31A 3JRDA 3JAMZ 1ZREA 2ZO4A 1T8IA 1FOXA 4IVNA 4LITA 1L3LA 1ZTRA 1Z0XA 1OWMA 3B7SA 2BY1A 2VASA 3F21A 3D9PA 4C2UA 1YJNI 4IZZA 1WJFA 1YQAA 3U9WA 3HG9A 1BBYA 2NRAC 1O1TA 4V19K 3OV8A 1K83J 3TKYA 4KT6A 3LKUA 1MBHA 4DX6D 4O5VA 2HTSA 1PP7U 1MNMC 2WADA 3U1KA 2MHKA 3UI2A 2CU7A 3ZFWA 1S5LC 4UVBA 4UWHA 3C7JA 3ELKA 4LCTA 5F0HA 1IRGA 1LTXA 4CEMA 3T8MA 2F5FA 2R93J 1S29A 3ZQGA 4GPMA 2VTBA 3J7AY 1ELRA 1ERDA 3ZMSA 2E1NA 2EINH 2H6CA 5FKOA 5FLXZ 2OJED 3KYLA 1EV7A 2MA3A 2AJAA 2DT7B 2EV5A 2OA4A 2ELJA 4BXUA 4A0XA 4LLNA 1IHGA 2EB7A 2I6HA 2J09A 3UM3A 2X3MA 4LLGF 2L6JA 4RA2A 3C5RA 2KISA 4MBGA 3IP4B 4N0BA 1ON2A 2VT3A 1F5TA 4BQOA 4FLHA 3CMAI 2DYRH 2X6XA 2OUMA 2NXPA 3GYZA 2V7FA 1ELWA 2QYUA 3HTUA 3ENEA 3CESA 5DUKA 2CRGA 3A01B 2FOWA 3IWZA 3V7SA 4PUCA 2C6YA 3KEQA 3KZIC 2Y0BG 3GX4X 1VQ7I 3K4LA 3MVPA 5CVJA 4M71A 3FUIA 4HOQA 1TNBA 1OXJA 5E1XA 5F0FA 1IKND 4RS8A 3CGHA 3MYVA 2FBIA 5JR3A 4GMJA 2PMHA 1D8EA 2XF7A 1U8RA 3CKBA 4XX5A 4ANXA 3FIWA 2DMPA 2ESHA 4D5CA 5ERIA 1F9NA 1QQEA 2R17C 4L0ZB 1OKRA 2PMZA 4NC6A 2EQRA 3TWUA 1PDNC 3DXMG 1DNPA 3LA3A 3VYTB 3A2KA 4XRMA 1UFMA 3K1NA 2KZVA 3ISMC 4LD5A 2VJIA 2K4JA 3G1OA 4YIFA 4ESFA 3WTYC 3HOVJ 2HYZA 2MOWA 3SHFA 3AJIA 3FULA 3P1UA 3UT4A 1IXRC 1X1AA 4RB2C 4K03A 1SANA 2GW1A 2B9SA 1Z3XA 2BYVE 3OSFA 3EUKL 1TEZA 5FQ8A 1INZA 2KZTB 4DYCA 4I1OB 3I4GA 3VYUB 2R5YB 3F8NA 4ANVA 1D5YA 5ENPD 2IOSA 3SJMA 1OCCE 3FUFA 4MTDA 3S7JA 1P7IA 4L7TA 3I0TA 4JA7A 2JA2A 3A4CA 2D45A 1ULYA 1N54A 1FPQA 2MG4A 4YDEA 3Q7FA 4GO1A 3E3VA 4KYWA 2V4HC 1BW6A 2ZCWA 2ADUA 1D0XA 2DODA 2PJRA 2KCKA 3FTSA 4F52A 3KSQA 3HZJA 2VSOE 4WUYA 4XI9A 3ZKJA 2MFZA 2P81A 2WTEA 4WNFA 4B8XA 3DTIA 3SDGA 1VZ0A 3IAM2 3OR1C 3OYKA 3JAMK 4O3MA 2DXIA 3EUVA 2EIKH 3EHMA 2A69F 2RKHA 5EGOA 4UUSB 1YA0A 3J7YJ 3DPYA 1YITI 4G23A 2I9CA 1X1PA 2DQRA 3JRGA 2Y9ZA 1MNDA 4BY1J 4WXDA 2ETAA 2VJ4A 3GZ1A 3GO5A 1A17A 3TWSA 2H6GA 1T6SA 3BTLA 3PSIA 4P29A 3EU5A 1QGPA 3OYBA 1TBXA 3AG2H 1S72I 1FZPB 2O9LA 3D9NA 1KPSB 1RESA 5LD2C 2VPLA 4GYWA 4JVSA 3VLFA 3ZYKA 4EATA 3OYIA 3E5QA 4EQFA 1H0AA 1YYHA 4O60A 1IN4A 4WF2A 2L3DA 1V55E 3BPVA 4H7XA 1T0FC 5D5VB 2XGEA 2B63J 4LNUD 2H6BA 2B7EA 3K6GA 4CRWA 5HKPA 2CWEA 1NH3A 4DX1A 2PEXA 3F9KA 4BQNA 4A3CJ 4XLFA 1SFOJ 1MBKA 2ELHA 2DFEA 3OS2A 4ZC3A 2HVRA 5ENOD 3LDZA 2FNPA 2FULA 5HLGA 5D6EA 1R23A 1TT5B 1XG1A 1X2MA 2DA4A 3HYIA 3FH8A 2V1DA 5JI6A 1L5JA 3AS4A 2G9WA 3LSRA 4UI9J 2KC7A 2FXAA 1MBJA 2CHWA 1OWNA 2GAUA 3HXBA 4L5JA 1ZRFA 3CHMA 5CRVA 3PRZA 2E2IJ 3D9OA 4TXPA 4CDGA 2IF4A 4Q47A 1G3YA 5IYCJ 2JPBA 3NZUA 5FTPA 1J7KA 5E20A 3UKRG 4JEHA 2J49A 2NVTJ 2LLKA 3CQZJ 4NUBA 5KJMA 2NVYJ 1MBGA 2L7MP 3LSJA 3ZN1A 2H6HA 3WG7H 1TWGJ 4I09A 5C2YA 1JGSA 4MHGA 4BH9A 1LPQA 1ZELA 4JHJA 2R7UA 4KVMA 3RO2A 2VJ8A 4I6JA 2WAQA 1SD7A 4IL6C 1S9HA 3ESKA 4P9UA 1XN7A 3J81Z 5ENTD 4B8AA 2HPIA 4PZJA 1S7AA 3P7NA 3HOWJ 4Y7NJ 1IN8A 3JR9A 3DWLG 4ZJZA 3E6BA 1VFCA 3TXMA 2QSHX 1XDUA 1I5ZA 1UHWA 1V55H 3WHCA 1MHQA 2BHYA 3I58A 2QLZA 4EJUA 2DFHA 4F53A 3AG3E 3BUAA 4D7MA 4GYGA 5CRUA 3IEGA 1WHUA 4PS8A 4BE1A 1JCSA 4PFPA 1P4WA 3S1QJ 3FXLA 2KDOA 4BFRA 3M8JA 5HS9A 1HCRA 3QRFF 4IULA 2HXOA 3HPGA 3JCKC 2DA1A 1MZCA 2KZGA 3KP5A 1JTYA 3HVEA 4A6EA 3PL8A 2E60A 2Z2SB 2OPTA 3H35A 3PIOF 3CD6I 3ZYLA 4BWRA 2IONA 3MKLA 5BV1A 3OS1A 1G3NB 3CZ6A 1YE9A 5EZGA 6PAXA 3SFXA 4N9HA 4HNTA 4GZ3A 5D4RA 1NA3A 2P7VB 2F5EA 4GCVA 2J8SD 2X6JA 3CHQA 3ASGA 3D1NI 4XNFA 4DNCA 2OC6A 1WJDA 2NS0A 4MNUA 4XOPA 4A3IJ 2X9DA 3FHZA 1AWCB 1KZOA 4ABNA 2HYGD 3CKCA 2DDBA 3RJPA 4EZKA 1BM9A 2IJLA 2ELKA 5LGTA 1JWGA 1K1BA 3CVPA 4C3IJ 1Y0UA 1U5TB 2F37A 2JT1A 4G94A 3ZGKA 2QUFA 1EJ9A 5KWDA 3JSPA 1X1DA 5AIJA 2EA2A 3TWWA 3TP0A 3EYIA 4LK0F 3PNLB 3WXXA 2R7ZJ 1FC3A 1EF1C 2IFUA 5JLXA 4BTBA 4IQ4A 1JGGA 2E5NA 3UX4A 4NC8A 4I17A 2ZJ2A 3TO7A 2PMUA 4YDYA 2QVOA 2QM3A 2Y9YA 2CJJA 4O6JA 4GDFA 3QPHA 3H5RA 1XMXA 2Z16A 1CGPA 2FD5A 3KETA 1WH5A 2J07A 5DM7F 1XPXA 2E7WA 2P58C 3E30A 1N77A 3PUFA 4FX4A 3FBIB 3UQ3A 1MNEA 4EVIA 2CO5A 4XICA 2K9NA 1ZG1A 2VE8A 1E3HA 1Z67A 3R4KA 3BTJA 5J1UA 3N05A 5FRMA 2LAIA 2M4GA 5EEAA 3GFIA 3CQGB 3JUEA 4L9TA 3R61A 4UI9C 2RC4A 1TNZA 3BPXA 3OYDA 3V8LA 2LMDA 4G11A 4B3AA 1RC9A 4J8DA 1ZN2A 4M3BA 4U8VD 5CBNA 2QSFX 4WNGA 2W7NA 2M63A 5BW8C 2P9IG 3CUQA 4A1SA 1E3PA 2AXVA 1V4RA 2IBDA 3MFKA 1Z6RA 3JW4A 4XQFA 2KHMA 3IXEA 1KU9A 1IXSB 2LSVA 3W9GA 3ZNGA 2V79A 3HOZJ 4APFA 4I1AA 3ZUVB 3ML9A 2VYIA 2OTJI 1G2HA 1Z6TA 1SVXA 2VOOA 5KBAA 3FTUA 4TXQA 4AP2A 3MV2B 1BA5A 1D1AA 2KRFA 1SAXA 1QA6A 1S64A 1ETKA 2M3AA 1TQIA 3ASNH 3I59A 2IU1A 3B7RL 2KMUA 2ECCA 1NZNA 3P9KA 4F7AA 2HI3A 3C72A 4HLEA 4Y4RA 2OOEA 3CCEI 5F0CA 2XGOA 3SBSA 2WQ7A 2XCCA 3M1CA 1HS6A 2DA6A 1SFUA 3Q4AB 2X51A 4UY8I 9ANTA 3PNYA 1FIAA 3Q9VA 4Q96A 2VXZA 2Y30A 1H2UA 5IYDJ 4RMNA 2PQ8A 1YW7A 4XLHA 1A6QA 4JK1X 2Y0SN 4YFNF 2V5QC 2XHKA 4A1GA 2C0LA 1OPCA 3NBNB 1TZLA 3OYAA 4BE0A 2QENA 4HG2A 3CHPA 4GGGA 2KFDA 2Q2EA 3H0DA 1Z3YA 1K1AA 1SQMA 4UUVA 2EFQA 1B72B 3MWMA 2V5FA 3FX3A 4I9CA 5DIZA 2P9UG 2FQ3A 1HA8A 5FQ4A 1D0ZA 3HSFA 4P1WA 4R79A 1FVFA 1R6RA 1LVAA 1XGNA 2EJRA 1QBQA 1J0RA 2LY2A 3V4GA 2WXOA 1D5VA 3VTXA 2IS6A 3ZHEB 2CMPA 1A04A 2M0MA 1K78B 4I0AA 4JZYA 2ZFWA 4LG0A 2E1MB 4OIRF 2DYSH 2XS8A 4JHRA 4AY5A 4TUUA 2EK5A 3FKJA 1R00A 4PGGA 1S6LA 2BY3A 1BU9A 4HX8A 1YW9A 2DOAA 1MKMA 4KT5C 3J80K 2AXLA 5B3SH 3VPRA 4HOUA 2X85A 2LBFA 3U21A 1RI7A 3LFKA 2CH0A 2RGVA 4L5EA 1ZR4A 2XAGA 3AU4A 4HRMB 1IUYA 2W00A 5IOYA 5FKLA 1QZEA 2FOKA 2X6KA 4Y6CA 3LSIA 3CC7I 3WHBA 5IT9Z 2OCCE 3B7UX 4N39A 1TWHJ 3WTSC 3HGGA 1OCRE 3K10A 1OWPA 3CMMA 4JC8A 5CEAA 5JHUA 2VKEA 4ZYAA 1B8IA 5LHGA 3CLOA 4Y13A 1MMGA 3QKYA 1Z1DA 3HIFA 1MBFA 2UWMA 5K7FA 2QYJA 3ULQB 4CA0A 4IOAF 2DBBA 4U0SA 3GZ2A 1NL4A 4XE0A 2RQQA 3OIPA 3DSSA 4I9EA 2Q2EB 5IYBJ 1FJLA 2VC1A 2V9PA 3VSLA 1H6KA 1OQYA 5CPRB 3JRIA 1N25A 5EYRA 2CUEA 2DT5A 2VUMJ 1XMAA 3RTRA 1LQ1A 4JYKA 3NOCD 2FI7A 1NTCA 1HX8A 3DPDA 2DBAA 2CV1A 3CVWA 5CVRA 3SZTA 4HNVA 2EIKE 3ZP5A 2NC9A 2ZISA 1LE8A 2ZB9A 2QQBA 1RR8C 2LP0A 4G7HF 1HXDA 1DP7P 3W2AA 4IKFA 2EIJH 4EM2A 1SFKA 1FBSA 2CUZA 3C3RA 1Z05A 1Y8RB 1MJAA 3S7FA 3EU9A 3R6SA 1REPC 4IEJA 4D9JA 1HBXG 1ZR2A 3CP2A 4FT8A 4AY6A 1MMDA 1PVEA 2L5QA 3PZ3A 1GVJA 2XGMA 2MC4A 2B0LA 2K5CA 3RI4A 1DCQA 4FQGA 4AIFA 4G7ZF 5JVTA 2DA3A 2F0YA 5HDKA 4Y33A 2GWRA 4E7IA 2JMWA 1SA4A 1Y6IA 2WMNA 3VLEA 1S70B 1JJ6C 2HYFA 1W5CC 3R9MA 2K85A 1BOBA 3MKZA 2JWTA 3O3KA 3CUQB 1SD5A 1LDJA 5LRSA 2DLLA 2IOLA 3HM5A 2XPIA 2HZDA 5EYPF 4DRXE 4R7LA 4N3BA 1CF7B 2GRRB 3ABKH 1P92A 1VNDA 3KX2A 4ON0A 2CFXA 1IW7F 1SZ9A 3LY8A 2JUCA 3BTCA 1NG6A 1MJ9A 2EH3A 3D9MA 2K9MA 2ZKZA 1HDPA 3RYRA 3WODF 5J8FA 1T39A 5D66A 2P6SA 1J9IA 3ZQCA 2YX4A 2IGOA 2YS9A 3X2QH 4CUGA 2JPCA 3GTGJ 2HOSA 1R5ID 1R58A 2WXPA 4CO8A 4M6YA 2KIUA 3SZPA 1T98A 4B44A 3BCBA 3VYRB 5ICEA 4XZ4A 2OV8A 4K5BA 3HKZN 3HHMA 4GMLA 1B89A 5HRYA 2X0LA 4X0GA 4Y17A 1I3AA 2XGXA 3FM3A 3RQ4A 3Q0VA 2R5SA 3PUKA 5A7DB 5LGNA 4ZH4F 4KIBA 3FXOA 4YFXF 5M5XJ 1OYWA 2OBPA 2HR3A 1JKOC 1R5HA 4G26A 4JBAA 2FBKA 1JJ8C 1W1WE 1USTA 2R3SA 4KN4X 3UT8A 2GLOA 2DOEA 4HX7A 5CQEA 1VQMI 4BNCA 1UN9A 4DW6A 3CC4I 4DK5A 4RB3C 3K4CA 1H89C 3J80Z 1I6HJ 1TN8A 3QOUA 3FUMA 3UPVA 2RNGA 3S7BA 1GHCA 3E6DA 4HNAD 1ZGAA 3ZCOA 3FBNB 4DBRA 1APLC 1I1GA 2KZTA 3KD7A 4RAFA 1HKQA 4JPSA 3V2XA 3AKZA 5BPDA 2F5DA 3S8PA 1A5JA 3FEYA 3GVAA 4LNBA 5BOXA 1JKPC 2I1JA 3LVRE 5E75A 1S7OA 2GXAA 2NS8A 4IHYA 2KATA 2GA1A 4WNDA 4GFBA 1OYYA 1HSJA 3H1CA 3ZVVA 3K4MA 1E7UA 4ANUA 1U9NA 4BDZA 4HXIA 2CFUA 3HB9A 5BNGA 4C3JJ 5K7HA 1P5QA 1T56A 3BR1A 2PL2A 3H5NA 2V8SE 1R1VA 3GTLJ 4G25A 3V2OA 2KIQA 2KQRA 4YEJA 4BE2A 1TJCA 4E6KG 3FK7A 4IO9F 3QWPA 4W9RA 5LEKA 5BPIA 2E1CA 1GDTA 2M8GX 4RGUA 4LEUA 4MTEA 1KU7A 3I9V2 5AIQA 3R0JA 1O3RA 4HDUA 1DCEA 1HXIA 1O1SA 1NG7A 2QZ8A 2QKLB 3RPUD 4FHJA 2F8YA 1K61A 2VQ2A 1A5EA 1V5GA 5LHHA 3V7CA 4U0YA 4UWFA 3CCMI 2X1CA 2UUZA 4M9ZA 2VBWA 4E70A 2WXIA 3CUOA 3FP3A 4BETA 2ZSIB 3R0AA 3ASDA 5T3RA 3OYHA 2HVSA 2WXKA 3SQVA 5EDSA 3FWEA 3FMQA 3CDIA 4JP0A 1S3JA 4BYYA 4YRVA 2L01A 2XKPA 3BCAA 4HV6A 3J7ZI 5JHFA 3HOSA 5ENNA 1LEAA 3CCSI 4RDUA 3V31A 5AAOA 4OAVB 1B6AA 3IUOA 1TR4A 5ICGA 1TT0A 3DBRB 4ASNA 3E0JB 3LSKA 4ESBA 2FO7A 3EHRA 4HF1A 3DLAA 3SGHA 1QVUA 4UUTA 4CDNA 1WPKA 2XAFA 5TJJA 2JA5J 3Q78A 2DPUA 1LUJB 2RD0A 1KYWA 3K2ZA 1HU3A 1IUFA 3B6CA 4E7KA 5KCMA 3L82A 2VKHA 3K70D 3AG4H 2ZJQF 2YX7A 1LEBA 3Q47B 3RKWA 3C1DA 2UY1A 1MJ0A 4BGDA 4D7NA 3TW6A 3C18A 5HS0A 5DS9A 1FP2A 4ZZLA 2FF4A 3CV0A 1T95A 4X6AJ 3BR5A 2FEZA 3KP3A 3FUKA 2CG4A 2XASA 1IZ1A 1MSEC 2FRHA 2NAZA 2KDZA 2ZGGA 3UT7A 2ZXWH 3FDYA 2FSWA 4NHJA 1QPIA 2I10A 1BOAA 3F8MA 1ZARA 1IRZA 3ABLH 3BZCA 1NK3P 1XDSA 1XGMA 2HU9A 4NACA 1QRYA 3RKYA 1FOYA 3CO6C 3JYSA 3CDLA 4XONA 5L3GA 3S1MJ 4KYOB 3HEFA 3RRNB 2XB5A 2VQHA 5AARA 3ZHEA 5BT1A 2W48A 1POGA 1OCPA 3T5VA 1BR2A 4Q94A 4OOIA 1FMWA 2X4HA 1G6NA 1KQ8A 2L54A 2KXPC 1UHSA 3QWLA 5E17F 4CDMA 3URZA 1SEUA 3JCUC 5K1YA 2CQXA 3RYPA 4IRUA 3ZIMA 2Y69H 3QAHA 3REOA 5J4VA 5JFRA 3DTEA 4L0YB 4S04A 5FO5A 2VODA 1EH8A 1J09A 5L3BA 4A12A 1OWOA 1DPRA 3KEOA 1QZ2A 2XVCA 4A3FJ 2WXHA 2ZJRF 1E8ZA 2H6FA 3PSFA 1U3EM 3RCOA 2QFCA 5FRNA 3JRBA 3TDZC 3A01A 2HO1A 2L0KA 3KP4A 1VQ5I 1H6PA 4XLEA 4BY6A 4M73A 2V0PA 4AJWA 2HKXA 4L2YA 1TN7A 2M45A 4XKWA 5FKKA 2Z99A 3GZ6A 4OIQF 4S05A 2XSDC 1R7JA 3RZDJ 1IAWA 3EIJA 2M7BA 5BXOA 3VOEA 3PS6A 4JA9A 3F6OA 2DYRE 2ZMEC 3L2QA 2E0IA 1K6YA 3GZNB 3G2TA 2AXUA 1C0WA 2WMOA 4M74A 2Z9OA 1TJFA 3EYYA 2IRFG 1K8KG 2YHEA 3E33A 2ZXWE 3OYNA 3CMYA 2ZXHA 4HYEA 4BJ5C 2GRQB 4LG3A 3CIAA 3W2WA 1ON1A 5J08A 5JJ7A 4AV7A 5BNWA 3HKZA 3RPUA 4CZZA 4XSXF 2E1MC 1RNLA 2XUBA 4ANJA 4DIQA 1CQTA 3HVEB 3UTMA 3WTVC 1X1BA 3LXUX 1TW3A 3QODA 4UXNA 3J5QB 2G0EA 4CYDA 2ME6A 5F27A 2PQRA 4V2GA 4A2UA 2CV2A 4PCQA 3H92A 4ZDOA 3BP8A 3SFZA 4ZFHA 1IO2A 4Y15A 2YNQA 2GIVA 2JRMA 1VQ8I 1ELKA 4JD2G 2EFPA 3CVXA 2XB0X 3OIOA 3WE3A 4HNUA 3UM2A 4HOSA 1H9GA 2W25A 2IAIA 3NEUA 2ICWG 2Y69E 3AS5A 4Y6WA 3QQAA 2LREA 5IP7J 2O0YA 4IRIA 1GLNA 3TJPA 2IA0A 3DSWA 4APOA 5E3NA 2LNBA 3FUHA 4RQIA 3U66A 5E8IA 1K78A 4EEFG 4B89A 1U5TC 3BQOA 2D2WA 3PZDA 2HNHA 4G6QA 4BU2A 4C2TA 4CCMA 2LH9A 4KMOA 2RREA 2R0QC 5ARFA 3PNTA 1KONA 3Q0WA 5C3EJ 2M5WA 4U7BA 2VSXE 2F6CA 1Y1VJ 3HUGA 4MO7A 1TNSA 2FMLA 5TISC 3L00A 2HWVA 4XN0A 3RSNA 1RZ4A 3S15J 4AC0A 3QK0A 1X4PA 3DV8A 3OOPA 3HOUJ 1T0FA 1YX3A 3E7LA 3CEQA 2CSOA 2MD5A 2KCVA 3APFA 3FUJA 1OCCH 4ZHBA 5IPAA 1TNUA 1XX5A 2ZBKA 4WNEA 2O3FA 3SFIA 2EIJE 3I4RB 5DD8A 1GVDA 2AS5F 2CFOA 1JTXA 2DDAA 4KICA 3TP3A 3IHYA 4LUNU 2XPWA 3CVYA 1BPOA 1HE8A 4F6RD 4GXOA 1K3ZD 1OFCX 1ZLKA 5TRDA 3TWRA 2VQCA 4ZDPA 2M0CA 4YG2F 2W57A 1YJWI 2V26A 3IRQA 1FYLA 3C3OA 4GTRA 4I2ZA 2Q1ZB 3CJQB 2JA6J 1FY7A 2QQAA 3P5JA 4M3EA 1JT0A 2VGXB 1Y56A 1E90A 5AQ7A 2LSUA 2A5YB 1YHQI 2WM9A 4C0EA 2LNIA 4ZZDA 4F1PA 3RRMB 1TN6A 4HORA 2ZIRA 3PNTB 4ZYGA 1WI9A 2PQNA 4AYBA 1HFAA 2VT2A 4L5IA 2MC3A 5IP9J 2I5UA 4FLBA 4W1UA 3ZQHA 2P9LG 4N4NB 1HKSA 3I54A 2LC2A 3FK6A 3DPTA 5GTHC 1WQ2A 1H8AC 5FJ8J 5IT3A 2AHQA 4BAYA 2PZIA 1VQOI 3U9GA 3OSGA 3ABKE 4H0EA 1YOVB 2MLKA 5CVVA 1OCOH 3BLYA 1ACIA 1JKRC 4PS3A 2H94A 4A3BJ 5FLXK 2VB6A 4BKXA 2RN7A 3LJNA 2RAEA 5G05C 5LCWC 2V6CA 3IH4A 4A69C 3UNGC 3VODA 2YR2A 1N52A 4XLAA 1L0OC 2GXGA 5HNHA 2CQNA 3SY2A 4J8FA 1ZBPA 3K9IA 2WBMA 3OYLA 4OWRB 4A3KJ 2H6IA 3HRTA 5EG0A 3IKTA 1R22A 3TGNA 2J4BA 1BI0A 3ULYA 4NQWB 4FJZA 3RJVA 2V1UA 1HF0A 4F3VA 2M30A 4GA0A 4KISA 3T1BA 4B8CB 2AWIA 3G6EI 1ETOA 3G3ZA 4WWCA 2M87A 2FA5A 3KIOA 1LFPA 1VTNC 4MQVA 2WXRA 2X38A 1P9QC 1YLFA 2G7UA 2Z5UA 3KLOA 2VIXA 1Q2ZA 1AP7A 1JKQC 1DPUA 4HB5A 5EIDA 3H3VK 2Q8KA 5H2FC 4MEYF 4XK4A 3WGHA 3CF5F 1MMSA 2RFAA 4XRFA 3R9AB 4RGXA 4DBQA 4GAAA 1LE8B 3KE2A 3RO3A 3CDHA 3KPHA 1MMNA 2V9KA 4ENKA 1Y39A 1K79A 3LY7A 1SAUA 1UJ8A 2MGQA 1WSUA 4BT8A 2ZNZA 3L6AA 2AO9A 4DX5D 3W6VA 5AQBA 1ETXA 5GAGJ 3FU6A 5H7PA 5HI7A 2IXSA 2QY7A 3H36A 2P9PG 3JSOA 4NIKA 3OAWA 3FFLA 1FCHA 5FQ7A 5B1BH 1S0PA 1D3YA 2O8XA 3QB2A 4WXCA 3V7RA 5ILUA 1O1RA 2KL4A 5HOOA 2A61A 4M3GA 3RAUA 1O3QA 5ANRA 2ZC2A 3G1LA 4WWOA 1USSA 2QSGX 4JHKA 3VEPA 3DRAA 1BI2A 2STWA 3AG1E 2TDXA 4I76A 2L7KA 5EDNA 4X8QA 5DYMA 1Z91A 3SZGA 2EV6A 4KMFA 4A63B 1PC2A 2VBYA 2B0OE 4FULA 4IRGA 2R7DA 3AU5A 2J9QA 1W7PB 3DKYA 1TLHB 3FUEA 1IJWC 1OYIA 5B66C 1LD8A 2R05A 3F0CA 3I3LA 3MV3B 3QARA 1P7JA 4OAYA 3L2WA 1IXCA 4G2VA 4WWNA 3JTGA 2BXYA 3S1NJ 3ERED 4U0WA 1YIOA 2GIZA 3CVQA 3SEZA 3HPHA 3QWWA 1QBJA 1OLTA 5M72A 4E7HA 5FJYA 1JUPA 1TL8A 5A2QZ 1NK2P 4ENMA 3CLQA 4K0RA 4IQJA 2GRLA 1W0TA 1B1BA 1HSTA 1FIPA 3C2BA 3FHNA 4UVCA 1O7FA 2P5KA 4K5CA 4HBDA 3ZQFA 2WC2A 5CVUA 4EM1A 4CCOA 3WGIA 1E96B 4DX7D 2DTZA 4I1MA 1IGNA 3GCMA 3N97A 2DMUA 4AM3A 2RFMA 5CKTA 3K69A 2KT0A 4BERA 4QTRA 2OQGA 5C1DA 5AJDA 1OCZE 2CQ7A 2BV6A 3M8FA 4CH7A 3ABUA 3B02A 3SZ7A 2A6EF 4V2FA 4A3VA 1KLXA 1MQSA 3S16J 1HG5A 4LFUA 4EMSA 4UHTA 3CK8A 4ACLA 1DC2A 5LEJA 3CHOA 5GAEJ 3T8TA 3S14J 3QU6A 3LAJA 1F4KA 3ULQA 4E85A 5F08A 3S93A 3S32A 4IF4A 3X2QE 2VI6A 1Q1VA 3CUQC 3O2PE 4BX9A 1E7VA 2NNNA 3CQCB 3F72A 4D10C 2WAFA 1MDMA 1JT6A 5J47A 2WXFA 4I6EA 4M9SA 1FT2A 4LG6A 4U8YD 2HGCA 2IEKA 4BQQA 4WK8F 2HOTA 4I01A 2WV1A 1VQ6I 2L7ZA 4BDYA 1SA5A 3FUDA 2DA5A 2ECBA 4EECA 4ILHB 4ILIA 3EJNA 5LP0A 2ONDA 4Q4ZF 1PY1A 1ETYA 2JABA 4A3EJ 1ZRDA 1W36C 4K2EA 3DEPA 5E79C 4U96D 5GTIC 5HDGA 3OYCA 1MGTA 3ASOH 3JRCA 2AW6A 2CW8A 3CTAA 2DI3A 3C2HA 2ESNA 2K3PA 1G3WA 3BG7A 4LG0B 4GYYA 4AOFA 2EV0A 4HF0A 4JX4A 4BL0B 1K6OA 3NARA 2H1LA 5CBOA 4UUCA 5AJLA 4AIHA 3H3ZA 1EPUA 2WB2A 3BT9A 1V5EA 4G8XA 3FTZA 3W2VA 4UWGA 3BY6A 5M5WJ 4DPRA 3D9IA 3SD5A 5KAFC 1FEXA 3V42A 1XSVA 3FH5A 5ICFA 4BY7J 4Q5SF 4UV9A 2LTPA 1V3FA 1OCZH 3KP7A 1MX4A 2LDUA 3DXJF 3TOBA 2IA1A 1FTZA 3S7DA 3P2BA 3NRVA 2P6TA 4OAUC 4KNYA 2LFBA 3ERMA 5E1WA 3RIBA 1X5BA 3QC1A 4O1PA 3B13A 2L4MA 3LA7A 2RVCA 3GW4A 1F36A 3WTWC 3O6BB 4ATZD 2HXIA 4FADA 4MFDA 5F64A 2NSZA 1U2VG 4C0MA 2HQNA 2WY7Q 2ZFUA 3NWSA 4HX4A 2WQHA 2GRNB 3TAXA 3V30A 2CS3A 4J00A 3TL4X 1UJJA 3KP2A 5J6XA 4M3DA 1XCBA 3HJEA 4HLXA 4UWKA 2O5RA 4JEUA 2XGSA 1X19A 1ZH5A 5ENQD 3TO6A 4QWQA 3TG4A 3LOCA 4R8HA 3MX3A 4DI4A 3IKOB 3T9KA 1Z7LA 1LVKA 1IRFA 5A2QK 2WPVA 2P7CB 3W3CA 3G2BA 1W7PA 3CK9A 4J8SA 1HW2A 1LFBA 1ONVA 1O4XA 2L2OA 3HRUA 1UMQA 1DGWY 3OWTA 4LLLA 3RKVA 5DEQA 2BZTA 2DQLA 2ID6A 4UB8C 3DLLF 1BJZA 5GPAA 3HC7A 2YUSA 4XEIG 1QZZA 2K9QA 2DN0A 4FTHA 5BV0A 2HDDA 1R71A 2PMZN 4KITB 2Y4TA 4CSWA 3DFGA 3DU6A 2F8XK 3UUXA 5CCLA 2OF7A 3FTVA 1YW8A 1D8JA 2DW4A 2EILH 4TRQA 4KUMA 2LUHA 1ETVA 5FD6A 1YTYA 5T8IA 3LEWA 1HKTA 1R4MB 3GTKJ 5BUZA 1IDZA 1VDYA 2OEVA 3TWQA 4LK1F 4BACA 1ZB1A 4F1SA 3QPLA 4FE4A 2UZKA 3G2VA 4WAFA 1P4XA 4PJNA 4OAZA 3TMOA 2DZOA 2XPYA 4DZPA 3UKGA 2LK2A 1YFHA 4L18B 4EZLA 1P6RA 2DMQA 3LSGA 3ONQA 3TO9A 1X1CA 3GF2A 2OQRA 5GAHJ 5JJ6A 5ITZF 3M3YJ 3BZKA 1IQUA 5DBKA 2NVXJ 2GOXB 2FJ1A 4AVZA 3G1MA 3G4SI 1YO5C 3MKQB 3TWXA 2F4OB 3G2UA 1TWAJ 4QIWN 3UIOC 4B43A 2A6TA 2K86A 2O6GE 2QBYA 2H8WA 4QFVA 4A5MA 5FIOA 1T08B 1SFEA 1IV8A 3ZMDA 1BI8B 5GP9A 2DVWA 1UG0A 2WQ6A 4A5NA 3QPSA 3RRUA 1J2XA 2EWNA 4A3TA 1MSFC 3HUGB 3D9KA 1YCSB 4XMYA 4I7HA 5DUIA 2XAHA 3HTSB 2L9SA 1BI3A 1MIJA 1PUFB 4MEXF 1T38A 2AQFA 2W4SA 4UQXA 4U87A 4E7ZA 1JE8A 2ACJA 2CFZA 5G04J 3PZ1A 2HM8A 4PSWA 4KT6B 4EHMA 4L9JA 1H2TC 2EFOA 3FF5A 4GTVA 1SZAA 2ME0A 1TW2A 2OD5A 4M3FA 4AIJA 3MA5A 2O61A 5KNGA 5C4XJ 3Q7AA 4RM2A 3D3MA 3MQ0A 1K4TA 2X1DA 4A0YA 3SF4A 1N4RA 4RB0A 4XLNF 4CZCA 3QPTA 2Y4UA 4MGRA 3K0LA 5FFXA 5IY5H 3CJNA 3OYFA 2YQ8A 4PDXA 1N11A 4MKTA 5JHBA 4BJ6C 2EZKA 4KJZA 3VB2A 4AWXB 2QC9A 1BJAA 2QKMB 4FETA 3GEZA 2LD5A 1BIBA 1ETQA 1I39A 5FT9A 3UIPC 3E5XA 4DOZA 4CHUA 5EEGA 3SDBA 4U7EB 3EQLF 4DGWB 1Y0NA 2X6FA 4FU3A 3PREA 3DKWA 4Q48A 3W9FA 3E5UA 1V54E 2IQCA 2BBYA 1U2WA 4GZCA 4DX2A 1UOHA 3S17J 5FKNA 1HO8A 4CYCB 2L9BA 4ENJA 3MAJA 3UMVA 2XIGA 3WG7E 2D1VA 3TEDA 4BSXA 2CG2A 5AENA 1HQCA 2XZTG 2L9VA 3C3WA 1JUMA 3CC2I 1W0UA 3DXKG 4F91B 1KQ0A 3IHUA 2LF8A 1MZBA 5ICCA 3COAC 1TWFJ 4RVBA 3LA2A 3JQ0A 3DEUA 3KS2A 2E1OA 1U9OA 1U0JA 1DP3A 4HOBA 4Z68A 2M2EA 2Z33A 2H8RA 2PJRB 2LO6A 5D5XB 4XORA 1MH4A 5LGUA 3Q5MA 4M3OA 2I8DA 1EA3A 4RGSA 4A55A 2LR8A 5B1BE 1WKMA 2VC0A 5FFZA 3GTQJ 2XAJA 3Q5FA 2O8KA 2LXMA 2GBYA 4P96A 3L2UA 4AD9A 4GTPA 2WXMA 2HDWA 2LKXA 3TG5A 2L0TB 5IT9K 1R1TA 2WAEA 2M4KA 2JZYA 1DU0A 4UVAA 2RG8A 1FBQA 1W36D 2E36A 5AIPA 5F04A 5KNLA 2CV0A 4F93B 1ZLJA 4PJMA 2V4JC 2KRCA 2YU9J 4CCLA 1N0RA 4ENNA 1TQMA 4ZTJA 2CQQA 2AVPA 3O4ZA 2VJ5A 4GA1A 3SXYA 5CERB 1U3DA 1KT1A 4XRSG 2PJPA 3GWZA 1FP1D 2DT6A 4KA4A 4PGHA 3PJRA 2QZAA 2R59A 3ULEG 2BVMA 2DTRA 4BHPA 5E3OA 2IY0C 4F7ZA 2JRTA 4LSZE 1BL0A 2IS2A 4PH4B 3EHQA 2M1BA 1RKWA 2ETBA 5G55A 2CG3A 2VXDA 4EJTA 5FZQA 4Z6YA 2DOFA 1WZ2A 2P9SG 5EN5D 2BXZA 4BBSJ 3ONLA 2DFIA 4OYSA 4C3HJ 4LGWA 5J1RA 3BG6A 5D5WB 2L0IA 3LMMA 3UKUG 4ABZA 1GV2A 3WU1B 2EFNA 3LCAA 4ATGA 2LRDA 4BHCA 4KXKB 2FBHA 1FLIA 3PUBA 3FM5A 2K27A 4E4HA 2R7OA 3Q79A 2NYXA 3F8CA 5HLIA 5BMZA 2GOMA 3BR3A 5JLWA 1D1CA 1U8BA 4XL9A 2H27A 3F6VA 3CP8A 2XSJC 3HDDA 3BOQA 3AG4E 1OCRH 4UI9K 3G71I 1V5FA 2FO1E 4OIPF 3PH0C 4QQIA 4DYRA 3DP7A 5LOZA 1EF4A 4G7OF 4HQEA 3B7TA 1X3UA 5EX0A 3AFHA 1TNYA 3GLXA 1IYGA 3DEEA 4WCGA 2R7FA 4CYCA 1YX5A 2BW3B 1RUNA 4UQYA 2FX0A 1AKHB 3CCRI 5KJKA 3CVVA 2W84A 3PDNA 3LNQA 3CCQI 1Y8QB 2IP2A 1H19A 4BHBA 1KZPA 4ZYHA 1WY6A 3CVLA 1E3OC 4JX5A 3FUNA 1Z9CA 4BT9A 4B94A 5F6FA 3I71A 1I1SA 1FMVA 4HA8A 4M9XA 4LIUA 4B4CA 3RDIA 4AU7A 3CMEI 1XSDA 1XS9A 3Q9UC 3OYEA 3GBGA 4KIGA 3O48A 1ETWA 4EGYA 4FC8A 4OMYA 3FXJA 4XBFA 2Y1LE 1O57A 1ZGJA 3BTIA 3I4PA 5F1RA 5D4SA 5B5EC 3WTXC 3CCLI 4FA6A 3IH3A 4F55A 3OMYA 1WRJA 3JRHA 2KP6A 2IS1A 1E0EA 4J7WA 3BQZA 2QWWA 4EZJA 4U88A 3K1MA 5BS6A 4GTMA 5KJNA 2A5WA 4EQQA 3C98A 3KYCB 3OXGA 2R5ZA 2NYJA 5FQ6A 5HVQC 2J08A 2CGPA 5DCFA 3DPUA 5CECB 5JHAA 3D0SA 4RG9A 2MRIA 3ZQQA 5FGMA 4AUXA 3MKWB 1WJ5A 2OZUA 3RQIA 3MKRA 3WU2C 1JI8A 1UELB 2VPRA 4BXXJ 2VONA 4YFKF 2IO3C 1IV6A 4HZFA 3PM1A 4G8KA 4HPQA 5CJ9A 2EBIA 3JXJA 1IG7A 1DQUA 1B72A 1WJEA 4DI3A 3AG3H 5IP6A 2XRYA 3T8RA 5CVIA 3HHHA 3Q0UA 4NRHB 5CLSA 4YVQC 1GXQA 1IN7A 1G3SA 4GRIA 3N4MA 3BJOA 3KCCA 2F5VA 1RPWA 4Z2YA 5FZRA 2E5ZA 2DPDA 4WXHA 4BEHA 1XCVA 1TYQG 4IN3B 1N4QA 2BTDA 4RBOA 2ZU6B 2PX9A 4E6HA 2RV8A 4PJ0C 3CSTA 4I02A 4J19A 3L9TA 5LRRA 1TWCJ 1IN5A 2FQ4A 4PSXA 1D9SA 4BX8A 1UHMA 4XR6A 4F3QA 3OL3A 4DQ2A 4A3DJ 2QEXI 1O7LA 1D8KA 3PFYA 1MH3A 1SVMA 4P9FA 2ZJPF 2K9LA 2L4AA 1BR4A 2QCOA 3CCVI 5EYLA 3ECHA 2HQAA 1WAO1 4YIRX 3IHVA 5J90A 3ASHA 2I1KA 2VBZA 1RETA 1OMIA 3LS8A 3TWVA 4CT0A 2WXJA 3NZSA 3Q15A 4ZYEA 4OU0A 1MX6A 5HODA 3E32A 3GFJA 2IS4A 4L23A 4IJAA 4I0BA 2PM7A 1XSXA 4G6TB 3A1YA 2E2HJ 1XTAA 3ZYMA 3FMSA 2PG4A 2NOGA 2EQXA 2XEVA 2R7SA 3Q49B 1VQPI 3OY9A 3HOYJ 3ESWB 1VF9A 1ZYRF 2EZIA 1I6XA 2RNJA 3DBHB 5G04C 4CCNA 2L6BA 4PJLA 3ZW3A 1P4AA 2XDVA 3D5RC 3GXOA 2DK5A 1JXSA 2DA2A 5FZSA 4PS7A 2IPQX 4XLCA 4A0ZA 3E4BA 5M3FJ 4IHXA 5D6FA 1ZHFA 4EBAG 3DQVC 3B95A 2JK3A 2HOAA 3LJ3A 5CMYA 3FKIJ 1JCQA 2ZGDA 1W7PD 3MZHA 4E7JA 2TRTA 2V6EA 3GLLA 4OMZA 4WX9A 3J7AO 2C0MA 3K9TA 3FXUA 5G2NA 3HBLA 3WGGA 5KNHD 3V79K 2QYOA 4BEHB 4M6XA 2GXBA 5C4JJ 4IX7A 3KZYA 1UCRA 3IC7A 2YU3A 1H9TA 3OYMA 3HRAA 2BEOA 2QBYB 2GA2A 2DMTA 3ML6A 4C2MJ 2PI0A 2EINE 1Z7UA 2JVGA 4TV3A 3M4OJ 1WH7A 5CHEE 5EF6A 2Q0OA 5D5UB 5AQAA 3NWTA 2VGYA 2K40A 1GV5A 3ECOA 3ASOE 2DJIA 1Q1HA 4LNGA 3ZEFA 4KN7X 3M9AA 1UN8A 5DCMB 4JW1A 3ZU7B 2VQLA 4DYQA 2Y31A 2N8GA 4L9VA 5HDNA 2LKPA 3PIPF 3OYGA 3HOTA 1HOMA 2WXNA 2YINA 1QYMA 4N5QA 4EJOA 2A6HF 5AYWD 3U4TA 1BLXB 3KSLA 2VQGA 3FTXA 3E37A 2P0WA 2KM4A 1ZG5A 2MSYA 5ARGA 1WVRA 4LB6B 4UV8A 1KA8A 3FXRA 2WV0A 1EYHA 3LVQE 3HRMA 3Q9SA 2R7VA 3KEAA 5IY5E 4UWLA 3GFMA 3ABME 5JA4D 3L9FA 3L1PA 3DEWA 4M72A 3MKYB 3HRSA 5FWQA 3HGYA 3I53A 4QSHA 1UG2A 2F4MB 2XV4S 4NBQA 3ZOBA 4ILGA 2BY0A 3OL4A 4XKBA 4FJYA 3ASFA 3TGOA 1PYVA 5LBQA 4EGZA 3OXLA 1X4OA 4Q69A 3I56I 3HXFA 5KHDA 4KZCA 2L02A 3IWFA 2I2OA 2PFBA 2NNYA 1U78A 3KP6A 2V9VA 4LMYA 2CUFA 3CHSA 4BSZB 4ESJA 2JUGA 1KU2A 1MBEA 3Q75A 5AN8A 2QQ8A 4NNJA 1S8NA 2VBXA 3W6JB 3E34A 4XOTA 4M7CA 1W5TA 1JUSA 3IL2A 2EPFA 2BF0X 4AEZC 4FHKA 3QOPA 3CCUI 1V54H 3R60A 4BS9A 2KKOA 3PVLA 1KZHA 4HOTA 3HHGA 1AKHA 3APCA 2STTA 2GQQA 2A5EA 4BJTA 3V8JA 4NURA 4B93B 3NQPA 4L1BA 3ZMVA 3ZN3A 4HI8A 2TCTA 3H9JA 3ZQIA 4A6DA 4AIDA 2W24A 4CYMD 1NFIE 3L09A 1SVOA 2XROA 4CT4A 2K4BA 5M3MJ 4L2LA 1X58A 3QP5A 2PNNA 2R7QA 4B47A 2MYOA 4U0ZA 2MH9A 3AG2E 5TGTA 3D9LA 4LRZA 5A23A 3WU0A 3D9JA 4ACKA 2BE5F 3S2HJ 1ZAOA 4LIVA 5K5QA 2JQ7A 3I64A 1BN5A 3OYJA 2A07F 3R7QA 4AVPA 4FISA 2M9HA 3AG1H 1BR1A 2LY1A 3RKXA 3F6QA 1DGRM 3DPLC 1R49A 3CVUA 2F5CA 4NQWA 3T8KA 5M5YJ 1T2KA 3W6KB 3OXFA 3RU0A 1YMPA 3K4JA 2R2LA 5L3EA 5CQGA 2GGFA 1CF7A 1OUVA 4B1RA 3TDUC 3WE2A 1I27A 1OJLA 1IC8A 2HZTA 2KIFA 4IHTA 3EHNA 4HQDA 5JMND 1F43A 5GADJ 1BIAA 3NAWA 4XM3A 3VLDA 3CF2A 5H6RA 3K70C 1O3SA 2JEKA 3BJ6A 2V1XA 2VSNA 3NF1A 2UXNA 2X48A 3ZR8X 1ENHA 4R1HA 3DSTA 4RLYA 5ENSD 2R7RA 3RKQA 3Q73A 4KZ0A 5LX8A 1QNFA 5CYVA 2HR2A 3LAPA 3TW7A 3K2AA 1FPPA 5H20A 2IGNA 2OCEA 1SMYF 2HVQA 2R03A 3AL0C 5EJCA 1QU3A 4AXHA 3BWGA 1IXVA 3IV5A 3CJRB 2UV1A 3JUIA 1PUEE 2HEOA 4YELA 2UXXA 2ETHA 4HSTA 1ZU2A 5JJTA 1Z77A 4PK4A 1IN6A 1KU3A 1WJBA 1YYVA 2XPVA 5DTDA 1QZYA 1XGSA 4HSRA 2EILE 3DEOA 5GPCA 1XGOA 3FU0A 5EIBE 2KRHA 1A6IA 4QPOA 3O8GA 3LPZA 3UM0A 3KFWX 4MLOA 4XLPF 4HFGA 2NOJB 4H7YA 2E34A 2WB1N 3QP6A 4N2SA 2AXTC 2X6IA 3NAUA 3O8HA 4EJVA 3AS8A 4LJZF 3G2SA 1HZ4A 1Y8MA 4NC7A 3B73A 2D5VA 1FOKA 3TQNA 2B6CA 2LVSA 3JQ1A 1ITYA 3DSVA 2WA0A 1U5TA 4ZTFA 1FT1A 5LLQA 1FNNA 2D1HA 1IRXA 5E3MA 2VKVA 3SEQA 3FH7A 1J75A 5FB2A 4IHWA 3UINC 4I6GA 5K5OA 3GMEA 2IVMA 2XF5A 4G24A 3JREA 2DO7A 3RSEG 2DAOA 2C2LA 3P9IA 2OVFA 3GZ5A 2WXLA 2E2EA 1H6OA 5CMWA 1WFXA 4GZDA 4XI0A 3E1SA 2JSPA 4EJWA 2LXLA 3FTWA 3FDHA 1XGWA 3AAFA 2JSCA 1UAAA 1KQ9A 4HEA2 2COMA 1OT8A 2L9NA 3CJTB 4G1TA 3DU5A 2WY8Q 1X81A 2HE0A 2FUG2 5BPPA 2LF7A 5L3CA 2OAZA 2G7HA 5D8LB 3GTMJ 2MYSA 3UR3C 1YS7A 3ROUA 2Y48A 2BKKB 2DIWA 3QDNA 4PFOA 2WVIA 2E19A 3ESLA 4MRUA 5ILVA 4L9PA 3CCYA 4HLLA 1SW6A 1MMAA 2VN2A 1QQIA 3MEKA 3HSEA 2X6YA 1MD0A 5T4YA 2X6OA 3B6AA 5IOZA 5K7ZA 3HIZA 5E1ZB 4HVBA 2ZMEB 4UQZA 3L22A 3S2DJ 2XRZA 1XD7A 2XKOA 4U07A 3K4KA 3GTPJ 3GTJJ 2O7OA 3LSMA 4ITVA 4IHVA 4GYOA 4RGRA 1SD6A 1SD4A 1VI0A 2CUJA 3MZ8A 1P2FA 1TNTA 4A3GJ 1XC5A 3DF8A 2COBA 1OCOE 1VQKI 2R92J 1RKTA 1SFXA 4IXAA 2ILRA 3EPZA 2AXZA 1B4AA 4HBLA 4JX6A 4GZ6A 4J0UA 3FISA 5E3LA 5EILA 3IBEA 2ISZA 1JUQA 4DLOA 3E6CC 2L9RA 2BW3A 1FSHA 1HH8A 3LY9A 3FU5A 3QNKA 4G12A 1WDYA 3ONKA 3E6MA 4JXTA 4HI9A 2YPRA 3EDPA 3GUDA 2Y0MA 4KVOA 5ANLA 3AAAC 2KBXA 3D5SC 3P9CA 5KAIC 1TTYA 4RB1A 1SC7A 2Q7FA 3MKQA 5BQTA 4W97A 2RDPA 3ZQLA 3GW2A 3I4MJ 3QU3A 1YS6A 2A3SA 2O03A 1SVLA 2MABA 4U8HA 2BY2A 4KMUX 1W3BA 1QVTA 2A4ZA 3L54A 2NVUB 3PEVB 1E8WA 1EH6A 2DCPA 2LOOA 1S7EA 1QHHD 1NHAA 1O3TA 4N5CA 4ETSA 4YDWA 1EH7A 2QF7A 3FXKA 3NQOA 3EUHC 4URKA 3MJWA 3BR0A 5BXUA 3I55I 1VQNI 3FXQA 4I2WA 3LL7A 4NQ0A 5LHIA 1LKXA 5EG0B 1FVHA 3S2AA 1YI2I 3OR2C 3ZYQA 4B09A 3PQJA 3QYBA 2IO2C 1VQ9I 5DD4A 2WWYA 3HYMB 1NA0A 4TXRA 3M8EA 1D1BA 1AU7A 2HOEA 4CCJA 1NI1A 2HKOA 2VGEA 3L13A 3BG5A 3NOGD 3GYHX 2FE3A 4GTQA 2R7WA 3HXDA 4J8YA 2JJ7A 4O6FA 2WAQN 4JOMA 1IHBA 1WG0A 2GZWA 3OOUA 3CR3A 1X3ZB 3U64A 2KJCA 3MD2A 5FROA 2QGUA 5DCMA 3C2GA 4I2OA 3MCZA 3L2VA 2GROB 2VSYA 1UG3A 4FE7A 3F8FA 4C9YA 1XNFA 3F8BA 2MBFA 1TC3C 1TP4A 2E71A 2RQPA 4Y52J 3OS0A 3F23A 2HPMA 1Y1WJ 4GCNA 3IH2A 3LWFA 2XZDG 2MD0A 4AM9A 4EV0A 4AVXA 4M6VA 2R7TA 2R4GA 4BUPA 1DVPA 4QLCU 3CO7C 5EEHA 1JHFA 2OZ6A 1RRJA 4XSZF 3IRRA 2NVQJ 3L17A 1RIOH 4OVUA 1DDNA 3HG0D 2P9KG 4J8EA 5CEDB 4S0HB 1AWCA 2HFHA 2DYSE 3E97A 1N9AA 1J5YA 4NB5A 2XF6A 2K7LA 4UNOA 2CHXA 1UJKA 3TWTA 1RR7A 2F2EA 5L3DA 4D1QA 1QO0D 1EKEA 3IKVA 5DM6F 2IGKA 3CLJA 1E2XA 3TOAA 3N71A 3DBLB 5LCWJ 2H1KA 1LF8A 5KVRA 5B1AE 2VKDA 5HS7A 1JWFA 3I5UA 2Y2ZA 2OVBA 1D8DA 5HLHA 2EFWA 2DWZA 2OTLI 1N4SA 2VL8A 4CDRA 2DK8A 3FWVA 2DMNA 1AHDP 2VJJA 2UWJG 4GZ5A 3JXIA 4J01A 4XKVA 3ZMUA 4K5AB 3RIRA 1QHGA 5L3FA 2XEEA 2BVLA 1WGXA 1LNWA 4CCAA 4KBQA 3HL2A 1VQ4I 5A6CA 1NP7A 3SYTA 3EETA 1BW5A 4HQMA 1LB2A 1XMKA 5FKMA 2OU2A 4I6ZA 2A5UA 2J4DA 3LQRA 1GUUA 2CW0F 4P55A 3LSTA 4PDKA 4X1EA 3BU8A 1ORKA 5AONA 2BEDA 4JB8P 1H0MA 2AQEA 4F92B 3K7AJ 4LB5A 2UY1B 3L7WA 2F4IA 1PAQA 5B3SE 1YG2A 3T5XA 1K4SA 2XRLA 4GPKA 3BZ6A 2ZXIA 2W1OA 3PO3J 2HDCA 3ASNE 4RG6A 1BD8A 4N2QA 1ODDA 2M34A 3J5PA 3WTUC 5EGOB 4UUSA 1MDMB 2IJGX 3EDTB 3L08A 3RK6A 3UM1A 4I99C 4G6DA 5C44J 1M1EB 3RZOJ 1KGSA 2M7AA 1R4NB 2CHZA 2V1NA 4HRIA 3QYFA 2IW5A 1E8YA 4RLQA 5FD5A 1WJAA 2XPUA 3H5AA 1DU6A 4TV7A 2X6HA 3MZYA 1N75A 4N9IA 4U7DA 3A03A 3KYDB 1GT0C 2PLYA 3FHEA 4CXFA 1E17A 2KPMA 3L2RA 2CQKA 2YSRA 5D0OD 1X2NA 2IGMA 4ZDLA 5EKQD 4IPAA 2R5YA 4GB9A 2XQ0A 4YDOA 4QPQA 2DA7A 3MEXA 2QA4I 1BC8C 3MZLB 4XIFA 2QQ9A 4GTTA 5G05J 4I43A 2DFFA 4RAYA 1XB4A 3DSUA 5CCMA 2FU4A 4DUIA 2IA2A 3APDA 1R1UA 4B48A 3U1DA 4G9YA 4MQ9F 2HYJA 1WJCA 3NB2A 2E7XA 3SQNA 2XAQA 5E76A 2PM6A 2J5PA 3CSFA 1MJBA 3ISPA 1YIJI 5FLMJ 3Q3SA 3S3NA 2IT0A 4II2A 1E8XA 5ENRD 4CCKA 5F1JA 1I3QJ 1U6GA 2ZSHB 3LQQA 3M7GA 3MN2A 5J1YA 4GYIA 2XAUA 4G8LA 3IV0A 1Z5SC 4D0PA 4HLYA 2LG4A 3WG9A 3ZXSA 5DDGA 3WTTC 1GW6A 3HOXJ 3CHRA 3DSXA 3UXGA 1W4MA 1OR7A 4FHTA 5KK1A 3VYSB 3V8KA 4FASD 1HC8A 4YNDA 2PN6A 3ZXPA 3BR2A 4YVOA 3VTYA 1QPMA 3LFUA 5ED4A 3FY4A 3JRAA 5E8GA 3QWVA 4NDLA 3ZN0A 2FNAA 3I3NA 2XGDA 3BJAA 4RM3A 1WWXA 4UB6C 3F3XA 2GRMA 4XN3A 3EUHA 2JA8J 2Y75A 3A0HC 4U0UA 1ZG3A 1HW1A 2F48A 4E7SA 3BQYA 3PE4A 5FINA 1LDKB 1GXPA 2J5OA 2JVHA 2R02A 1Z21A 3ZGQA 3PFIA 5HQ8A 3FZVA 1H2VC 2XPZA 3CVNA 2K9SA 3Q9NC 1FWZA 1QNTA 4ANWA 4KFCA 3ZRHA 1X3WB 3DWLE 3KAEA 2VGXA 2A68F 5LFAA 4GTOA 4HV5A 1KYZA 2EIMH 1FX7A 1H88C 5AQ9A 1AOYA 2YHCA 1WM5A 1BI7B 2BOLA 3HDXA 2HTJA 2LKSA 2P4WA 4BQAA 1MX2A 3SI5A 4GCOA 4HW0A 3VSKA 3FEXA 3EUAA 2X6WA 4ZYDA 1YRNA 1IQRA 3PEUB 1ZKGA 2H09A 4LOCA 3DKXA 3D9HA 2HQ5A 1UW4B 4E7LA 4CZ2D 1OCTC 5D0QD 2W85A 1RUOA 1D0YA 4XRSA 5HLTA 3LSPA 3PZ2A 3G73A 2RKKA 3VDXA 4FX0A 4OIOF 3TBIA 1JCRA 2NS7A 4IRHA 3BEEA 2MH2A 3U3WA 3ZMTA 5E18F 3OTNA 2E35A 4N3AA 4HAMA 4EPZA 2DZNA 1EDUA 5KJLA 1FT9A 3FMRA 4PJJA 3ZMZA 3U2RA 1UB9A 3A0BC 2XHEA 1OISA 3HXLA 1N4PA 3QOEA 4N4OB 4IOCF 2PBIA 1FYMA 3PNVA 4C30A 4YIIA 2CW7A 3I4NJ 4ME2A 1BI1A 1N78A 2Z3YA 3T0YA 4MIMA 3H0GJ 4AYBN 1AA7A 4EM0B 2LY9A 1B8IB 1KT0A 1R36A 2IEJA 4HDVA 2XCBA 2MLGA 2P8TA 2VE9A 4N3CA 4PUSA 3R7RA 3FU3A 3J81K 4DZJA 2WB1A 3OIQA 2ID3A 2MW8A 4MFEA 4RLFA 1N0QA 2HQRA 2VLAA 3IAS2 4GMRA 4GU5A 4TUMA 2DU9A 3VFZA 2JTVA 3BG3A 5ILSA 4GTSA 4U63A 4FCYA 3ABMH 3K4NA 1ZGWA 1G4DA 4C9BB 2EZLA 2LBFB 2K02A 2P5LC 1O5MA 4H4KC 4V3IA 4L9NA 5J8CA 1J59A 4JQFA 1PUFA 2BKGA 3ZPLA 2ZNYA 3BDDA 3BR6A 3WTZA 4XKCA 1A36A 4OVVA 2LYCA 1OWLA 2GM4A 1SMTA 4XIDA 3SBTB 3PO2J 3L16A 1R9TJ 3K4BA 3ZRGA 4II3A 3TL5A 1MW7A 1K7AA 2XENA 4OINF 3BC8A 3S3MA 5FLVA 4DJAA 4U95D 2WXQA 1A35A 1B59A 3F22A 5J4YA 5DV5A 4A3MJ 2LAHA 2KIMA 3A02A 1ZQ3P 2VOPA 2OEWA 4JL0A 3H3UA 2FBNA 3QYEA 1FSEA 3KZZA 1G3TA 3PZ4A 3MCXA 2XC7A 5JVGF 2A05A 3AL0B 4A3LJ 1IDYA 3RPQA 5H6QA 1FTTA 3ABLE 2EZHA 4GA2A 4RSYA 4U04A 3M07A 1HDDC 3SFYA 3L2CA 4A93J 3HSRA 5D8KB 4CICA 1LD7A 1MYOA 2P9NG 4O1OA 3GFLA 3ZQ7A 3K1PA 3G2WA 1DUXC 2JN6A 1PP8F 4IHSA 3H9GA 2KJBA 4D5FA 2V4LA 2GRPB 1G59A 2Y0SA 1LFUP 2BHZA 2KCLA 2HS5A 1RW2A 3S1RJ 1HLVA 1LJ9A 3S3OA 5J3LA 1YJ9I 3ABTA 2JA7J 4BXFA 2R5ZB 3QJZA 1R5GA 4EBAA 4MLPA 2WXGA 3ML8A 2ZMEA 3QAQA 4IYPA 1I50J 1B9MA 1FYKA 5D2MC 1TNOA 2KLOA 2L7FP 2Y3AA 2XGCA 1N95A 4BESA 1ZK8A 2M8EA 4Y3OA 4BBRJ 4CGZA 1LDDA 2JLBA 2W82A 2FMYA 3JTHA 4J6IA 2Z1DA 4RAGA 4U0VA 1VQLI 4B0ZA 2ISYA 3DBSA 4AIKA 4HRNA 1JHHA 4HRLA 4B3XA 4BEPA 1HG2A 1WCMJ 1N94A 4DLQA 5J40A 2NXNB 4FP7A 1FOWA 3BG9A 4MS6A 4P5OA 5HNFA 1STZA 4HS2A 3MMYB 1JPLA 3EIQC 3PQKA 2EA4A 2XS1A 2XRNA 5HS8A 2XEHA 4RAZA 3C3QA 1F1ZA 1HW5A 4LERA 1B9NA 3D5LA 3HXCA 4BTAA 3LYAA 1OY3D 2K3FA 2P2CP 1YRNB 1OR7C 5B1AH 3LSHA 1ZRCA 3KEYA 1BC7C 3PE3A 3ZPJA 2OV7A 3SNXA 1WI3A 3CCJI 4I98B 3GTOJ 4C48B 4KIFA 2DJNA 4KDPA 3BG0B 3H9QA 5EX3A 3CK7A 3TXNA 2BGCA 1IF1A 4HF2A 3HXEA 3PUJA
chains in the Genus database with same CATH topology
1FBUA 1U3CA 2VTBB 3GZSA 1TQPA 4WWPA 3I5PA 3I59B 3BG1B 1HF8A 2P5VA 3KLNA 2LSOA 3S2WA 5K5RA 2ZXJA 3KEZA 2BUGA 4CGWA 3M1EA 3BROA 1W5SA 4CGVA 3MGBA 2CYYA 3FTYA 3JAMZ 1ZREA 2ZO4A 4IVNA 1L3LA 1OWMA 3B7SA 3F21A 3D9PA 1YQAA 3U9WA 1BBYA 2NRAC 3OV8A 3TKYA 3LKUA 4O5VA 2HTSA 1PP7U 2MHKA 3ZFWA 4UVBA 4UWHA 3C7JA 3ELKA 4LCTA 1IRGA 4CEMA 3T8MA 2F5FA 1S29A 2VTBA 1ELRA 3ZMSA 2E1NA 2H6CA 5FLXZ 1EV7A 2MA3A 2EV5A 2OA4A 4BXUA 4LLNA 4A0XA 1IHGA 2I6HA 2EB7A 2J09A 2X3MA 4LLGF 2L6JA 4N0BA 1ON2A 2VT3A 1F5TA 4FLHA 2NXPA 3GYZA 1ELWA 3ENEA 3HTUA 5DUKA 3IWZA 3V7SA 4PUCA 2C6YA 3KEQA 3GX4X 5CVJA 4M71A 3FUIA 4HOQA 3CGHA 5E1XA 4RS8A 3MYVA 2FBIA 5JR3A 4GMJA 2PMHA 1U8RA 3CKBA 4XX5A 4ANXA 2ESHA 2R17C 5ERIA 1F9NA 1QQEA 4L0ZB 1OKRA 1PDNC 1DNPA 3LA3A 1UFMA 3K1NA 4LD5A 2K4JA 4YIFA 4ESFA 3WTYC 2HYZA 2MOWA 3SHFA 3FULA 3P1UA 3UT4A 1IXRC 4RB2C 4K03A 2GW1A 1Z3XA 2BYVE 1TEZA 5FQ8A 1INZA 2KZTB 4I1OB 3I4GA 3F8NA 4ANVA 2IOSA 3FUFA 4MTDA 3S7JA 4L7TA 3I0TA 4JA7A 2D45A 1N54A 1ULYA 1FPQA 4GO1A 3E3VA 4KYWA 2ZCWA 2ADUA 2KCKA 3FTSA 4WUYA 4XI9A 2VSOE 2WTEA 4WNFA 4B8XA 3JAMK 4O3MA 3EHMA 2A69F 2RKHA 1YA0A 4G23A 2I9CA 2DQRA 4WXDA 3GZ1A 3GO5A 1A17A 1T6SA 4P29A 1QGPA 1TBXA 1FZPB 3D9NA 4GYWA 4JVSA 3VLFA 3ZYKA 3E5QA 4EQFA 1H0AA 1IN4A 4WF2A 2L3DA 3BPVA 4H7XA 5D5VB 2H6BA 4CRWA 2CWEA 2PEXA 2ELHA 3LDZA 2FNPA 2FULA 5HLGA 5D6EA 1R23A 3HYIA 3FH8A 2V1DA 5JI6A 1L5JA 3AS4A 2G9WA 4UI9J 2KC7A 2FXAA 2CHWA 1OWNA 2GAUA 4L5JA 1ZRFA 3CHMA 3PRZA 3D9OA 4CDGA 2IF4A 4Q47A 1G3YA 2JPBA 3NZUA 5FTPA 1J7KA 5E20A 4JEHA 2J49A 5KJMA 5C2YA 3ZN1A 4I09A 1JGSA 4MHGA 4BH9A 4JHJA 4KVMA 3RO2A 2VJ8A 4I6JA 1SD7A 3ESKA 4P9UA 1XN7A 3J81Z 4B8AA 4PZJA 1S7AA 3P7NA 1IN8A 3TXMA 3E6BA 1XDUA 1I5ZA 1UHWA 1MHQA 3I58A 2QLZA 4EJUA 4F53A 4GYGA 3IEGA 4PS8A 1P4WA 4BFRA 5HS9A 3QRFF 4IULA 3JCKC 3HVEA 3KP5A 4A6EA 3ZYLA 4BWRA 2IONA 5BV1A 6PAXA 4N9HA 4GZ3A 5D4RA 1NA3A 2P7VB 2F5EA 4GCVA 2X6JA 3CHQA 3ASGA 4DNCA 2NS0A 4MNUA 3FHZA 4ABNA 2HYGD 3CKCA 3RJPA 4EZKA 5LGTA 1BM9A 2IJLA 1JWGA 3CVPA 1Y0UA 1U5TB 2JT1A 4G94A 2QUFA 3JSPA 5AIJA 2EA2A 3EYIA 3PNLB 4LK0F 3WXXA 1EF1C 1FC3A 2IFUA 4BTBA 3UX4A 4I17A 2ZJ2A 3TO7A 2PMUA 2QVOA 2QM3A 4O6JA 3QPHA 1CGPA 3KETA 2J07A 2E7WA 2P58C 4FX4A 3UQ3A 4EVIA 1ZG1A 2CO5A 2VE8A 3R4KA 2LAIA 3GFIA 3CQGB 4L9TA 3R61A 4UI9C 2RC4A 3BPXA 4G11A 3V8LA 4J8DA 1ZN2A 4WNGA 2M63A 5BW8C 4A1SA 3CUQA 2AXVA 4AM9A 1V4RA 3MFKA 4WNDA 1Z6RA 3JW4A 1KU9A 1IXSB 2LSVA 2V79A 4APFA 4I1AA 3ML9A 2VYIA 1Z6TA 2VOOA 3FTUA 4AP2A 3MV2B 2KRFA 1SAXA 3I59A 1TQIA 2IU1A 3B7RL 1NZNA 3P9KA 4F7AA 4HLEA 2OOEA 2XGOA 3SBSA 2WQ7A 2XCCA 1HS6A 1SFUA 3Q4AB 3Q9VA 4Q96A 2VXZA 1H2UA 2PQ8A 1YW7A 4JK1X 4YFNF 2XHKA 4A1GA 2C0LA 1OPCA 3CHPA 2QENA 4GGGA 2Q2EA 1SQMA 1Z3YA 4UUVA 2EFQA 3MWMA 2V5FA 3FX3A 4I9CA 5DIZA 2FQ3A 5FQ4A 3HSFA 4R79A 1FVFA 1LVAA 1XGNA 2EJRA 1J0RA 3V4GA 2WXOA 1D5VA 3VTXA 3ZHEB 1A04A 1K78B 4I0AA 4JZYA 2ZFWA 4LG0A 4JHRA 4OIRF 4AY5A 4TUUA 2EK5A 4PGGA 1R00A 1S6LA 4HX8A 1YW9A 4KT5C 1MKMA 3J80K 2AXLA 4HOUA 3U4TA 1RI7A 3LFKA 3AU4A 2RGVA 2XAGA 1IUYA 4Y6CA 2FOKA 2X6KA 5IT9Z 4N39A 3B7UX 3WTSC 1OWPA 4JC8A 5JHUA 5LHGA 3CLOA 4Y13A 3QKYA 1Z1DA 3HIFA 2UWMA 3ULQB 2DBBA 4U0SA 3GZ2A 4XE0A 4I9EA 2VC1A 1H6KA 2DT5A 1XMAA 3RTRA 1LQ1A 2FI7A 1HX8A 3DPDA 2DBAA 3CVWA 5CVRA 3SZTA 2NC9A 3ZP5A 2QQBA 4G7HF 1DP7P 1HXDA 4EM2A 1FBSA 1Z05A 1MJAA 3S7FA 3R6SA 1REPC 1HBXG 4FT8A 4AY6A 1GVJA 2XGMA 3RI4A 2B0LA 4AIFA 4G7ZF 5JVTA 5HDKA 2GWRA 1Y6IA 2WMNA 3VLEA 2HYFA 3O3KA 3CUQB 1SD5A 1LDJA 5LRSA 2DLLA 2IO