3T5XA

Pcid2:dss1 structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
195
structure length
195
Chain Sequence
STAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PCI domain-containing protein 2
publication title Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 66
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01399 PCI PCI domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t5xA02
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3t5xA01
1FZPB 3BZ6A 4O6JA 4EM1A 2VXZA 1JGSA 3WTSC 3JTGA 3HOTA 2O8XA 4O5VA 2PLYA 2MLKA 2GXGA 4OINF 4R1HA 1BM9A 2D1VA 1FNNA 3FWEA 1P4AA 5DV5A 5L3CA 5ILUA 2DU9A 3MZYA 3WGHA 1Q1HA 3CLOA 1IN7A 3KE2A 4UVBA 1FP1D 3IWZA 5LHIA 2JPCA 2A07F 2STTA 4P96A 3LAJA 2ADUA 3I64A 3I53A 5L3EA 1ON2A 3FXUA 3IWFA 4RGRA 2DT5A 4WCGA 3IL2A 3EYYA 3JSOA 4BNCA 1D3YA 4FT8A 3V7CA 4O3MA 3K0LA 2LKPA 3KCCA 4MEXF 5CVUA 5E1XA 3EETA 1SD7A 5ILVA 3GVAA 3E3VA 2ISYA 2L3DA 4EVIA 3REOA 4EGYA 4MQ9F 2CG4A 1W4MA 4UXNA 3KFWX 1R1UA 1OPCA 3C3WA 5FLXK 3ISPA 2A68F 3H3ZA 3FF5A 2AXLA 1SFXA 2HWVA 3V8JA 1HSJA 2E1NA 2Z5UA 2MD5A 2D1HA 5TJJA 3GO5A 3KEQA 3K1NA 5A2QK 1BC7C 1B9NA 3IC7A 4E70A 4EJUA 3T8RA 1UB9A 3HHGA 2GZWA 1BJAA 1TTYA 4QLCU 5DUKA 4GYGA 3BJ6A 1R1TA 4LLNA 2VBYA 3KLOA 2PJPA 1J5YA 1YS7A 2XVCA 2E1CA 4LCTA 4OOIA 2IA2A 1K7AA 1HKSA 2HKXA 2MA3A 1FBSA 2YU3A 2STWA 3CJNA 3GX4X 1ZH5A 1FYKA 3KP4A 1LEBA 2RC4A 3ZMUA 1P2FA 3ML6A 3VFZA 2XKPA 3P9CA 2IVMA 1R36A 4S05A 3V7RA 3F8CA 2ZCWA 3GWZA 3PQKA 3I71A 5H6QA 2XV4S 2H94A 4A0XA 2H6BA 3C1DA 2ZKZA 3F21A 4AIJA 2RN7A 2VODA 4BYYA 2QYOA 5L3FA 1FSEA 2K86A 2HFHA 1QQIA 1YTYA 1FT9A 2OQRA 4K2EA 2UWMA 4ENKA 4NHJA 4Q47A 3GFLA 3HTSB 1MDMB 4JK1X 2DQLA 3F23A 3RI4A 2P7CB 2QBYB 4HDVA 3QRFF 1YLFA 4RB2C 4P9UA 2EFQA 4ZZDA 4DNCA 1MZBA 2DBBA 5CYVA 4RB1A 1MJAA 3GXOA 2JTVA 5FD6A 4YIIA 1BOAA 5BPIA 4G6QA 2ESHA 1YG2A 3F22A 2LF7A 2J5OA 4ASNA 1FBUA 1K78B 2WC2A 2W85A 2DPUA 1I1GA 1XGSA 5ED4A 2PQ8A 4EQQA 4IJAA 3W6JB 1TNSA 3WTWC 3Q5FA 3AAFA 2XIGA 4H0EA 2FSWA 3I54A 1D8KA 2GA2A 2BV6A 1IN8A 2EV5A 2CYYA 1G6NA 1RIOH 5HS9A 2F2EA 3ECHA 1XD7A 5JVTA 1RZ4A 1REPC 2QQAA 4KYWA 2LF8A 1JXSA 4OIQF 4HV5A 1LNWA 2F5CA 3U2RA 1HKTA 2VT3A 1D8JA 3ZN0A 2V6CA 1XGOA 1AOYA 3KLNA 2VOPA 3GZ5A 5E1ZB 3RPQA 2EFOA 3BROA 3TDZC 2FNPA 2VE8A 4BHBA 1FOKA 2R7FA 3FM3A 3KP3A 3DEUA 5IT9K 3O6BB 3KP2A 1MDMA 4UVCA 4A6EA 1R5HA 2ZNYA 4QWQA 3LQRA 4LFUA 2JT1A 3CHMA 3SFZA 2HDCA 3RTRA 3GZ6A 4HLYA 5CVRA 5K5RA 4Q5SF 1QO0D 2EFNA 1JHHA 3DP7A 2VBXA 3QP6A 1J59A 1GHCA 4ESFA 4BQAA 3QU3A 4GGGA 3OV8A 2EJRA 3R61A 3SQNA 3ZMVA 3MAJA 4L5JA 4CO8A 1FX7A 3WTUC 1R7JA 1JE8A 5E18F 3J80Z 1IXSB 3KETA 4U7BA 1GXPA 2QVOA 4OU0A 2M87A 5HLGA 4XSZF 3ZMSA 4M6XA 3JW4A 1IUYA 4Y15A 2C6YA 4A6DA 4P5OA 3ZQ7A 4U7DA 4XRFA 4LB6B 3L9FA 1QNTA 4MTEA 2FBIA 1SMYF 5D4RA 2K4BA 1BI1A 3Q9SA 1KQ9A 1XSVA 4YG2F 4LLGF 4UHTA 5CVIA 2XAGA 2NNNA 3FMQA 4FHTA 3J7AO 4U0VA 1S6LA 4EM0B 4G8XA 3WU0A 2XGXA 4G7OF 1G4DA 2O3FA 3SHFA 3WTXC 3BJOA 1USTA 3GW2A 4RGUA 4IRIA 2FU4A 3K69A 4ZZLA 1KU2A 5ICGA 1FC3A 1IN4A 1U78A 1QZYA 2B0LA 1IN5A 1U5TC 2L4AA 2J5PA 1HW1A 3ERED 4A12A 1ZARA 3P7NA 3O2PE 5E8IA 2HQNA 3CUQA 3F3XA 3B73A 3FMSA 5KVRA 3D5LA 2OZ6A 2BEOA 4L18B 4NB5A 1OMIA 2WV0A 1O7FA 2X0LA 4EGZA 1XB4A 3OOPA 2XRNA 5HVQC 1DUXC 2OU2A 4ETSA 3U9GA 4WXDA 3RYRA 1UHMA 1SFEA 4LLLA 3HRMA 3RKXA 1W7PD 1YQAA 2BGCA 5ERIA 3E5QA 3G3ZA 1LDDA 2EV0A 4CXFA 1Z9CA 3EUHA 3KP5A 2QUFA 5DEQA 2DPDA 1R00A 1QZZA 4KFCA 3WODF 1JHFA 1KGSA 3IKVA 1OYIA 2H6CA 3HRUA 2CWEA 2QM3A 3SXYA 2Z9OA 2COMA 2FEZA 3V8LA 4I0AA 5DCFA 4L9VA 1YYVA 1XCVA 1ONVA 3LA2A 2HYGD 4MTDA 2L4MA 4IRGA 2PMUA 1ZRFA 1AWCA 4EM2A 3CUOA 1YW7A 1E17A 1MJ9A 1ZHFA 4KNYA 5DYMA 4UV8A 1J75A 4ESBA 1BI3A 3P9IA 2HKOA 2NRAC 3FM5A 4HF0A 2HEOA 2QQBA 2MC3A 3R6SA 2Z33A 2IT0A 4HQEA 1HW2A 2F5DA 4EMSA 4PGGA 3FXQA 2ISZA 3K1MA 3EDPA 2QZ8A 3QPHA 2DK5A 2F5EA 1O3QA 1ZGAA 5FB2A 2FMYA 4OMYA 5HOOA 1FYLA 4I02A 3WU1B 2PI0A 4AVPA 5CLSA 4IRHA 1IRFA 5JR3A 3JTHA 2FA5A 4HDUA 5ICEA 2FQ3A 4WX9A 4A0ZA 2VE9A 5TRDA 5LGUA 1B9MA 2TDXA 2EK5A 3GFMA 4LMYA 4HQMA 4N0BA 1C0WA 1PUEE 5D8KB 1ULYA 4HX4A 4UV9A 1Z1DA 5DCMB 4KMFA 2GXBA 2P8TA 2VT2A 3ZMTA 3E6CC 3VOEA 4WXCA 5JHUA 4LG0B 3WG9A 4MGRA 4CHUA 3BPVA 4M71A 4R8HA 1K6OA 3TGNA 2IPQX 4BHPA 1SMTA 1CF7B 2JSCA 2NNYA 1HBXG 2M8EA 1TW3A 3R0JA 3ZMZA 2ZXJA 1Z05A 3E97A 1ZYRF 1A04A 3U1DA 5HS8A 2PG4A 3MWMA 4MNUA 1J9IA 2O0YA 4KUMA 2JPBA 1RUOA 1FY7A 4BH9A 2FE3A 1LQ1A 4YIFA 2RQPA 3TO9A 5LGTA 2QLZA 4HX8A 2UZKA 5E20A 4KICA 2ELHA 3L7WA 2M30A 4L5IA 3WTZA 1XDSA 4NQWA 2M5WA 3D0SA 4AIHA 3C18A 4N9HA 1I27A 1HQCA 5LLQA 5J6XA 3NQOA 2UXXA 3VEPA 3KEOA 2H27A 3VB2A 3BWGA 4D0PA 3HTUA 1IRGA 1KU9A 5ICCA 3MFKA 2ZBKA 5FGMA 2P7VB 1O57A 3BJAA 4M72A 1J7KA 1OKRA 5LEJA 1UCRA 1WQ2A 5HLHA 2R7DA 2ZO4A 4LGWA 3QPTA 2A61A 1SD5A 4UNOA 3ECOA 2XROA 4N9IA 1TQIA 1P4WA 4GYIA 1MJBA 1T38A 3LA7A 2WTEA 4RB0A 1OR7A 3T0YA 1CF7A 2HQRA 3GEZA 2EA4A 5F64A 4JBAA 4Q48A 4GCVA 5LHHA 5ILSA 3I5UA 1IF1A 3F6OA 2Q8KA 3TXMA 3WE3A 2G7UA 4I2OA 2ZNZA 4ZYHA 3BY6A 1G3TA 2R3SA 3DXJF 2P5KA 2KIFA 2O03A 1DDNA 3ZN1A 1E2XA 4LD5A 2V79A 4BXUA 2VN2A 2D45A 2XKOA 2Q2EA 3DV8A 4WK8F 3KZYA 3P9KA 1YIOA 3LA3A 1HSTA 3JAMZ 3GYHX 2NYXA 4HZFA 4PZJA 3RPUA 2JRTA 3GLXA 1TQMA 2YR2A 2KIMA 1XN7A 1YS6A 2QBYA 4KIGA 1H9TA 3M9AA 5E8GA 1T0FA 2GIVA 1R22A 5BOXA 1BI0A 1I6XA 3ZMDA 4FX0A 3WTTC 3R0AA 1ZRDA 3QP5A 3HHHA 3HSRA 5KK1A 2FBKA 1P92A 1K78A 4RGXA 5K5QA 4L0YB 3I0TA 1O3RA 3QAHA 1IAWA 2ACJA 4UVAA 4A5MA 1MD0A 1LDJA 2VC0A 3LQQA 4KIBA 3K9TA 2M45A 1B4AA 2XHKA 1OYWA 5BS6A 4XLNF 1YO5C 1STZA 4LJZF 1TBXA 3L2CA 1W5TA 1WSUA 3IRQA 1PP8F 5DD4A 1ZLJA 3JSPA 5HDGA 1I1SA 2V1DA 3W6KB 1KU7A 3IRRA 5H6RA 3MQ0A 1X3UA 2Z3YA 4G9YA 1TLHB 3N4MA 4IHTA 1BI2A 4RB3C 4IPAA 4PGHA 1S8NA 2E7WA 2OBPA 1R5GA 1DPRA 3M8EA 3GFJA 4I98B 5CJ9A 1J0RA 5D5XB 1NHAA 1KU3A 2Q0OA 1WWXA 1ZG1A 1SD4A 1DP7P 3ROUA 6PAXA 2ZFWA 5JFRA 3BP8A 1LEAA 3J80K 5D6EA 3LSTA 1T2KA 1HKQA 4TV7A 2OZUA 2PBIA 3KZZA 4Y17A 1TQPA 2P6TA 1R1VA 3E6BA 3VODA 1MKMA 2XAHA 5HDKA 1U5TB 1R23A 5BQTA 4XSXF 2G9WA 2VC1A 3RYPA 2PMHA 4XLPF 2MLGA 1P6RA 4S04A 1KQ0A 5D5WB 5HDNA 3FMRA 4OIRF 5L3GA 1ON1A 1B59A 2KIUA 2F5FA 1YW9A 5K1YA 5JI6A 2GQQA 5L3DA 3TDUC 5BPDA 3TOAA 1BBYA 2VOOA 2KJBA 2XUBA 4ENMA 1LB2A 1LVAA 5H20A 4BAYA 1USSA 2V1XA 2HTSA 2OD5A 4CZZA 2OA4A 1Y0UA 3RJPA 2XASA 5J8CA 3SZPA 5HLIA 2EV6A 2FXAA 2LDUA 4KN4X 4YFKF 2DFIA 2P5VA 5K5OA 1PP7U 2EA2A 4LK0F 2P4WA 4KMUX 1T98A 4EJTA 2FRHA 2BE5F 3S2WA 1ZG5A 3JCKC 3RIRA 5IT3A 1XMKA 5FLXZ 4YFXF 2NAZA 3K2ZA 4ZYDA 1FSHA 4AIKA 1XCBA 4Z2YA 2DO7A 2DLLA 5A2QZ 1GVJA 2PN6A 2E7XA 1R58A 4D10C 1U5TA 2CW0F 3DPTA 2QQ9A 4RS8A 2ESNA 2FMLA 4M74A 1ZREA 4L9NA 4MEYF 4EV0A 4L0ZB 3ZPLA 1PDNC 4ZYGA 1U6GA 4I09A 5DDGA 3L00A 2L02A 3TKYA 2OAZA 5CVJA 4WXHA 1S7OA 3LAPA 1F9NA 2DK8A 3WE2A 2W84A 1OYYA 2W25A 4M9XA 5J8FA 1WRJA 5LRRA 2HZTA 2O6GE 3FXRA 1UFMA 3MEXA 5ICFA 1ODDA 1L3LA 2IW5A 1V3FA 1TW2A 1QPMA 1FLIA 2FBHA 4KIFA 4P55A 1V4RA 4OIOF 3V4GA 4OIPF 4ON0A 4DQ2A 3V8KA 3ABUA 4KT5C 5FFXA 5L3BA 1FWZA 1Z7UA 1QGPA 2MBFA 2V9VA 1KYWA 3DQVC 3E5UA 5FD5A 5FO5A 2D2WA 4HF1A 1FYMA 1XGNA 4G6DA 1FPQA 1G3SA 1CGPA 4ENJA 3R4KA 1EH6A 3H3UA 2K4JA 2Y48A 3MCZA 3FX3A 1XGMA 1F1ZA 4EJOA 1G3YA 3F72A 4F7ZA 1Z91A 4L9JA 1O3TA 4LB5A 1VTNC 2EFPA 1P4XA 1S29A 1G3WA 1MGTA 1U8RA 1LJ9A 4A0YA 3FHZA 2CO5A 2MRIA 3BOQA 2YX7A 4RAYA 1Z6RA 2P5LC 1XDUA 3MZHA 2CFXA 1HXDA 3T1BA 4I01A 3I59B 3B02A 1YFHA 2EFWA 2M1BA 1U3EM 3T5XA 5AIPA 2X4HA 1HW5A 5D5UB 3DPLC 1RNLA 3KP6A 2G7HA 2Y0MA 2RV8A 2IRFG 2HTJA 4M73A 4ZYEA 2RKHA 4GO1A 3WTVC 4KA4A 3IHUA 5E17F 4CICA 2CSOA 2QWWA 4IF4A 1SAXA 4I0BA 3J81Z 5AONA 2K7LA 3TO6A 3H92A 4RGSA 4UUVA 3HIFA 2VONA 5DCMA 4HF2A 1F5TA 4EJVA 1B1BA 2GWRA 2L01A 2MH9A 4LG0A 2DTRA 1BN5A 4AD9A 1ZN2A 2RVCA 4HYEA 5CVVA 4G7HF 5DD8A 2MH2A 1W7PB 3HYIA 5F6FA 3EYIA 2DI3A 2PEXA 1KQ8A 4HW0A 3PQJA 2DQRA 5IT9Z 1XMAA 4HLXA 1IXCA 2K02A 1LDKB 4HV6A 5DUIA 2NS0A 3ELKA 1F4KA 4U88A 4MQVA 3CO7C 4A2UA 3TO7A 1ZRCA 2YX4A 4G94A 1KA8A 4L9TA 3IKTA 3F8NA 2YSRA 4CDGA 2HGCA 3COAC 3L09A 2KJCA 3R60A 4HAMA 1W5SA 1UHWA 2K27A 3F6VA 3M8FA 1BC8C 4JQFA 1FBQA 5D8LB 1IW7F 4A5NA 3J81K 3HSFA 4LK1F 2RDPA 5D6FA 4MHGA 4P9FA 3RKWA 4R79A 1IN6A 5D4SA 1IZ1A 4CGZA 3I59A 5EEGA 5LHGA 2KKOA 1XSXA 1EH7A 3DFGA 4ESJA 1BIBA 2OQGA 2IP2A 1Z6TA 3E5XA 2GA1A 3M1EA 3CUQC 1T39A 3QU6A 3EQLF 3K1PA 2ZJ2A 3C7JA 4U0WA 4OMZA 2V1UA 3NRVA 1DPUA 1U2WA 5BMZA 3T8TA 2Y75A 4Y13A 2XAJA 1BIAA 1XSDA 4U0YA 1ZAOA 2A69F 2CQKA 3HSEA 3CUQB 4EJWA 1SFUA 2LSOA 4HBLA 2AS5F 1S3JA 1B6AA 1J2XA 2W57A 2EB7A 2O61A 3FZVA 1EH8A 3PFIA 3I58A 1ZG3A 2LNBA 4IXAA 4M9ZA 2BYVE 1L0OC 1W7PA 3JAMK 2XAFA 4B09A 1KYZA 1RUNA 1O3SA 3RKYA 3N97A 4HX7A 3WGIA 5LRSA 5D5VB 3GFIA 2HYFA 3KP7A 3NEUA 2IJLA 2ZMEB 1ZGJA 5E1WA 1QBJA 3Q9VA 2HS5A 3ULQB 3F8FA 5F1RA 3TQNA 2BBYA 4G7ZF 3TXNA 4WWCA 3HOSA 4ENNA 3F8MA 4YFNF 2A3SA 2ETHA 3V7SA 4XBFA 2P6SA 4M9SA 1I5ZA 2CGPA 2KRFA 3ZP5A 1T6SA 2L54A 3WGGA 2DW4A 3LWFA 3O3KA 5HS7A 3CDHA 3E6MA 3SZTA 1S7AA 4PDKA 3BDDA 2PFBA 1WI9A 1EV7A 3F8BA 2HR3A 5LGNA 2JZYA 4GXOA 4Q4ZF 4KDPA 1H9GA 2FNAA 3CO6C 2A6EF 4WF2A 2EWNA 4IHSA 4HA8A 3M7GA 5AIQA 2H09A 4BHCA 4FX4A 1GXQA 3WTYC 3HRSA 3RDIA 1IXRC 2WWYA 1K79A 2A5YB 4PCQA 4M6YA 1RI7A 3ABTA 3QOPA 2RGVA 3HRTA 3GF2A 1D5VA 2VBWA 5FFZA 5EEHA 2W24A 2FF4A 3I4PA 3CTAA 4IVNA 2RNJA 4ZH4F 2VBZA 2Z99A 1ZLKA 2IA0A 1YW8A 3GUDA 4CYDA 3DF8A 3DKWA 5LEKA 1H0MA 2UXNA 3HUGA 2YPRA 4B8XA 4RAZA 5LBQA 4I7HA 3G73A 1FP2A 4KN7X 2FOKA 2GAUA 1TNTA 2ZMEA 3TOBA 3E6DA 2XAQA 4AWXB 1SD6A 2QENA 2HOEA 1O7LA 2DAOA 1WKMA 3LFKA 2IA1A 3BPXA 4HOBA 2A6HF
chains in the Genus database with same CATH superfamily
1FZPB 2KRHA 3BZ6A 4O6JA 4EM1A 3PJRA 2VXZA 2I1KA 2CQ7A 1R9TJ 4C2MJ 2ID6A 1JGSA 1I50J 2VPRA 1H2UA 1BU9A 3WTSC 1VQLI 3JQ1A 2WXPA 3M07A 3JTGA 3LCAA 3HOTA 2O8XA 3WHCA 1NG7A 3S3NA 4ZTFA 2L7MP 4O5VA 2PLYA 2JUCA 3CHQA 2OCCE 1XPXA 2MLKA 2LG4A 3GTJJ 2GGFA 2J4BA 3FU3A 4WNDA 2GXGA 4OINF 2CW8A 3H9JA 4R1HA 2V0PA 1BM9A 4MFEA 3AL0B 3OYIA 2D1VA 1FNNA 3FWEA 3ZRGA 1P4AA 4F7AA 2R2LA 5DV5A 3KSQA 5L3CA 2ZJPF 2VSNA 5ILUA 2DU9A 3MZYA 2V8SE 2V4JC 1QBQA 4RG9A 3R7RA 4IRUA 3WGHA 4A1GA 3MYVA 1Q1HA 3CLOA 3IEGA 1IN7A 5CERB 1KZHA 2BKGA 2Q7FA 3H5AA 1VQOI 5F04A 2MG4A 1JKQC 3KE2A 5FINA 4PK4A 3Q78A 1TR4A 3Q9NC 4UVBA 2EZHA 4YDWA 3RU0A 4CT0A 4MKTA 3GTPJ 1FP1D 2L9BA 2HXOA 4RAFA 3L82A 4A3MJ 4B3XA 3IWZA 3NZSA 1MBKA 5A7DB 5LHIA 2JPCA 2L9RA 4L7TA 2A07F 2STTA 4LG3A 4P96A 3FHNA 4QTRA 1SVOA 5E3MA 3LAJA 2WB1A 2ADUA 4OWRB 3I64A 4DOZA 3L1PA 1XS9A 2E71A 3I53A 5L3EA 1DGWY 1ON2A 4CCJA 1Y8RB 3UINC 3FXUA 2DA5A 2UUZA 3IWFA 4RGRA 2ZU6B 4Y6WA 1R71A 3VLDA 5KJLA 4RSYA 2DT5A 3JRAA 4WCGA 3IL2A 1INZA 3MV3B 2VKHA 3EYYA 3JSOA 2HXIA 2UY1A 4BNCA 5BV0A 1D3YA 4FT8A 3UT4A 4LOCA 3DSTA 2KP6A 3V7CA 1YIJI 4O3MA 3Q47B 3TL5A 4RM2A 3K0LA 4BDYA 4BJTA 1IO2A 4KZ0A 5AQBA 2LKPA 3KCCA 4MEXF 5CVUA 3U1KA 5E1XA 2XEHA 2R59A 4IHWA 4Y33A 4M3FA 1PY1A 3ASFA 4KJZA 5JMND 3CC7I 4E7LA 3EETA 4PJJA 1S7EA 4XKVA 3EHRA 1SD7A 3M4OJ 4H7YA 3C2BA 5ANLA 5ILVA 3MKLA 2VSOE 2ETCA 5FLVA 2WPVA 1MNEA 3GVAA 4FTHA 2O9LA 2R7TA 2V5FA 4EPZA 4YEJA 1QYMA 3PZ1A 5J4VA 3E3VA 2ISYA 3LEWA 3PNLB 2BVLA 3AG4H 2VTBB 2L3DA 1YRNB 1Q1VA 4EVIA 3REOA 4EGYA 3KYLA 1YOVB 2VQLA 3FISA 4MQ9F 3FH7A 2CG4A 1R49A 2R7QA 4I2WA 4BWRA 1W4MA 4UXNA 3B7BA 3KFWX 1R1UA 3VWBA 2CMPA 3DBSA 2PJRA 1OPCA 3C3WA 1ZQ3P 1Y0NA 3ISPA 5FLXK 5IYDJ 2A68F 4PS3A 3H3ZA 3FF5A 4GTTA 3SBTB 2AXLA 4E4HA 1SFXA 4OAVB 2K40A 2HWVA 2E1OA 3HOZJ 4MFDA 3V8JA 3HOUJ 4A3CJ 4C0MA 1HSJA 2E1NA 2Z5UA 2DCPA 2MD5A 1P7JA 3ZXSA 1HOMA 2D1HA 5TJJA 3BG1B 3GO5A 2L9NA 3KEQA 3D9OA 3D9JA 2M9HA 3K1NA 2PMZA 3OWTA 4CEMA 4NC7A 3OIOA 3PH0C 5A2QK 3L54A 1BC7C 1B9NA 3IC7A 2R92J 4DW6A 4E70A 4EJUA 3S2DJ 1SVXA 3BCBA 3OYBA 3HXBA 1A5EA 5K7FA 4J7WA 1CQTA 4BSXA 1X3WB 3T8RA 2OCCH 3DU6A 2J4DA 3KPHA 1E3HA 1UB9A 3HHGA 4RM3A 3OY9A 2GZWA 2X38A 1AHDP 1BJAA 4B1RA 5EYLA 1TTYA 3SY2A 4QLCU 4HNUA 5DUKA 4GYGA 1OR7C 4FASD 5ENNA 4WAFA 2JABA 4V3IA 3ZW3A 5IYCJ 3BJ6A 4DLOA 1R1TA 4LLNA 1S70B 2JUGA 4LSZE 2VBYA 3KLOA 4PFPA 4BBSJ 3GBGA 2HE0A 2PJPA 3CDLA 1J5YA 2XF6A 2QFCA 1YS7A 4NBQA 2R7SA 2XZTG 2XVCA 2E1CA 4HRNA 1Y6IA 1TNUA 4LCTA 5AQ7A 4OOIA 1TJCA 2IA2A 2VKVA 2XB0X 1K7AA 4XE0A 3ZRHA 3B7TA 1HKSA 3MCXA 3IH2A 2HKXA 2MA3A 3MEKA 4CDMA 1FBSA 3OS2A 2YU3A 2STWA 1IYGA 3RRMB 3EU9A 3CJNA 3GX4X 1ZH5A 3TAXA 1T08B 1ETYA 1FYKA 4LERA 5B1AH 2RD0A 3BQOA 3H36A 3KP4A 3PO2J 1LEBA 3D1NI 2RC4A 3ZMUA 4QSHA 4CCAA 3JRGA 1P2FA 4ANUA 3ML6A 3VFZA 2XKPA 5EILA 3P9CA 4UWFA 4ACLA 2IVMA 4GMLA 1R36A 1SAUA 4DYQA 4S05A 1YX5A 3V7RA 3LL7A 3F8CA 2ZCWA 4J01A 5FZQA 3CCLI 4IOCF 4NC6A 2DZOA 1SANA 4U63A 2P9PG 4ATZD 3GWZA 3BR0A 3PQKA 3TBIA 3I71A 4BJ5C 1YE9A 2DMPA 4PJLA 3E32A 3G4SI 5C2YA 5H6QA 2XV4S 4ITVA 5LX8A 2H94A 4HRIA 1R5ID 2ZSHB 3E1SA 2KZTA 3SQVA 3FUHA 4A0XA 2H6BA 3C1DA 2ZKZA 3F21A 4HOUA 5FZSA 4AIJA 4GA0A 4GA1A 4XQFA 2BHYA 2R4GA 1IXVA 2RN7A 3GLLA 1BL0A 2VODA 4BYYA 2QYOA 3UNGC 1T0FC 2Y1LE 3S7FA 3QB2A 5L3FA 3CF5F 4JPSA 2BXYA 3CHRA 2VYIA 4PS8A 1FSEA 2W00A 2VJ8A 2Q2EB 2K86A 4JOMA 4C9BB 2HFHA 2H6HA 1DC2A 1QQIA 2ZXWE 1YTYA 4A3GJ 2WXJA 1Z3YA 3UX4A 1FT9A 2OQRA 4K2EA 1IG7A 2UWMA 3HXEA 3ZPJA 4ENKA 2QGUA 4UUSB 4BS9A 1YRNA 2VTBA 3DBRB 4M3GA 4NHJA 3FXMA 4Q47A 1WPKA 4WNEA 3GFLA 3HTSB 3A03A 2DMQA 1E7UA 2YNQA 4ZFHA 1SEUA 1MDMB 3K9IA 4BEHB 4RQIA 4JK1X 2DQLA 3F23A 3RI4A 2P7CB 4U07A 5T3RA 1NG6A 4OYSA 4DX5D 2QBYB 3M1CA 4HDVA 1JGGA 3QRFF 4GPMA 1Y1VJ 1GT0C 5CCLA 4V2GA 1YLFA 4RB2C 2ZISA 3SGHA 3APCA 2BKKB 5J1YA 1TT5B 3HYMB 3K4CA 3QJZA 3PRZA 4P9UA 4C3JJ 3QQAA 4G11A 4K5AB 2EFQA 3NOGD 3KYCB 2DFEA 2P58C 1ETQA 1YYHA 4ZZDA 3D9IA 1IV6A 4DNCA 3ZFWA 1MZBA 2DBBA 5CYVA 2JRMA 4IKFA 2YHCA 3FTWA 3LSHA 3L17A 4RB1A 4YDOA 1MJAA 3DKXA 3GXOA 2A4ZA 2JTVA 2P0WA 2FI7A 5M72A 5FD6A 5JJTA 2QA4I 4YIIA 2RREA 1BOAA 3HG9A 5DS9A 3TGOA 5BPIA 4G6QA 3PE3A 2ESHA 1YG2A 3F22A 2JSPA 2LF7A 4WWNA 1HA8A 2J5OA 4ASNA 3AG2E 3CHSA 1DCEA 1H0AA 1HE8A 3L22A 1FBUA 3LSJA 3D5SC 4PJMA 1K78B 2WC2A 1UJKA 2W85A 1N25A 1T8IA 3TW6A 2DPUA 1I1GA 1XGSA 3BR6A 3LSKA 5ED4A 2PQ8A 4ABZA 4EQQA 4IJAA 3W6JB 1TNSA 3WTWC 2KISA 3WXXA 4GFBA 5ITZF 3FUIA 3Q5FA 3AAFA 3VTXA 2XIGA 3HVEB 4H0EA 3T9KA 2FSWA 3I54A 2PQNA 2BY1A 4AJWA 4GCOA 1D8KA 1IKND 1PVEA 2GA2A 5FQ6A 3PNTA 2BV6A 1IN8A 2A5EA 2GW1A 3S7JA 4O6FA 2E1MC 2EV5A 3GTLJ 3VSLA 2CYYA 1G6NA 1RIOH 5HS9A 3ASHA 2WAFA 5J1UA 2HPMA 2KBXA 2F2EA 3LJNA 3ECHA 3NB2A 3DRAA 5G2NA 1XD7A 1Z0XA 1XC5A 5M5XJ 1LKXA 1RZ4A 5JVTA 1LFUP 3S32A 1REPC 2QQAA 2X85A 4N3AA 4UWLA 3ZIMA 3SJMA 1D0YA 4KYWA 2LF8A 3CCYA 3SFXA 2XENA 1T95A 1JXSA 3BR1A 4IO9F 1H2VC 2XRLA 2HVSA 4OIQF 2ZXHA 3IAS2 4LIUA 3ZGKA 3EUVA 3D3MA 3PNVA 4HV5A 4OVUA 5AJLA 1LNWA 4HI8A 4RMNA 2F8YA 2F5CA 3U2RA 4DPRA 2E0IA 2E1MB 3D9HA 2CUEA 5GAEJ 4FADA 1HKTA 2VT3A 1D8JA 4W9RA 1AA7A 3ZN0A 2V6CA 2F4MB 2WV1A 1Q2ZA 3APDA 1XGOA 1AOYA 1O1TA 4HI9A 2BUGA 2XGSA 4HEA2 3K4MA 3KLNA 5GTIC 3OSGA 2GLOA 2B7EA 3S3OA 2FQ4A 2C0MA 5E76A 2LC2A 2VOPA 3JXIA 4N3CA 5CECB 2K9SA 3GZ5A 4YELA 4FQGA 2PX9A 5E1ZB 1BR4A 4J8DA 2WQ7A 3OAWA 1B72B 3EHMA 4HNTA 2L0TB 1MNDA 3RPQA 2EFOA 3CP8A 4M3DA 4CGWA 3CJRB 4GTMA 3BROA 3BR2A 3TDZC 4WWOA 5AARA 2FNPA 2VE8A 3BG5A 2MOWA 3FFLA 4BHBA 1ZKGA 1FOKA 4DYRA 1KT0A 3HDDA 2Z2SB 3CQZJ 2ZXWH 2PNNA 4HRMB 3GTOJ 5CMYA 5FIOA 2R7FA 3FM3A 3KP3A 4CDNA 2H1LA 3OYLA 4UUSA 1LD7A 3R9AB 3FTSA 3W9FA 2CFZA 3DEUA 5IT9K 2XRZA 4B8CB 3O6BB 4RLQA 4BETA 3KP2A 1MDMA 4UVCA 2GRNB 3ZR8X 4A6EA 3G71I 4NDLA 4UY8I 3EJNA 1R5HA 1FT2A 4HRLA 2ZNYA 4QWQA 3S1NJ 4EZJA 2DIWA 2GRRB 3LQRA 4LFUA 3DPDA 2BHZA 2IBDA 2JT1A 1DVPA 3CHMA 3ONKA 3Q73A 2IGNA 3AFHA 4AY6A 3SFZA 2VQCA 2HDCA 2IEKA 4UQXA 2XPIA 5M5WJ 3RTRA 1KT1A 3GZ6A 2DZNA 5KAFC 4HLYA 2DOEA 2DDAA 5CVRA 5K5RA 2E2HJ 1QO0D 4Q5SF 1BI7B 4JEHA 3MKWB 5FTPA 4I6ZA 4JB8P 2EFNA 3G1OA 4FETA 5EG0A 3C72A 1JHHA 3DP7A 2L5QA 2VBXA 3QP6A 1UG0A 1J59A 1GHCA 4ESFA 2GROB 4G1TA 5ENRD 1JCQA 4HSTA 2CH0A 4JHKA 4BFRA 1MBHA 4BQAA 4HFGA 4GYYA 3JCUC 3D9MA 1YA0A 4Z6YA 1ELWA 5FT9A 3RAUA 3QU3A 4GGGA 3OIQA 4UB8C 1SA4A 3OV8A 5LFAA 1WY6A 4HLEA 2EJRA 4JA7A 4A93J 3R61A 3SQNA 4RBOA 3FUNA 3ZMVA 2ZGDA 4U8HA 1DQUA 2O7OA 4EZKA 2ME0A 1NFIE 3HVEA 3MAJA 4L5JA 4JHRA 3CCEI 3ZQCA 2DA7A 2LXLA 4CO8A 3BEEA 2JQ7A 1FX7A 2MFZA 3WTUC 2V7FA 2DMUA 1R7JA 2M8GX 4RG6A 3UM2A 3APFA 5K7ZA 1JE8A 1OCZE 5IY5E 5E18F 3BG0B 4EEFG 3J80Z 3CCRI 2OTLI 2I1JA 1IXSB 3KETA 4OAUC 3IHVA 4U7BA 4CRWA 3ABMH 4DBQA 1GXPA 2C2LA 4C3HJ 3PIOF 3LY7A 2QVOA 2P9SG 3FXLA 3DCFA 4OU0A 3ZQLA 2TRTA 2M87A 5BT1A 5HLGA 4XSZF 5ARGA 3ZMSA 4M6XA 2R05A 3I4RB 5KBAA 4RLYA 3TWXA 3ESKA 3JW4A 3BTIA 1HX8A 3P2BA 3MKYB 1IUYA 2YHEA 3IV5A 4ME2A 4AVZA 4FP7A 3EDTB 4I1OB 4Y15A 4YNDA 2C6YA 4A6DA 4ILIA 4P5OA 1RKWA 3ZQ7A 1OWPA 4A3IJ 3C3OA 1M1EB 2LO6A 3K6GA 4HLLA 4U7DA 3L2RA 4E7JA 4XRFA 1RR7A 4LB6B 4IZZA 1X3ZB 3OYMA 1JTYA 3ONLA 3L9FA 1QNTA 3PFYA 2GOMA 4MTEA 1W0UA 4B93B 4BEPA 3ZQHA 2FBIA 3H1CA 3CVYA 1SMYF 5D4RA 1PUFB 2K4BA 1BI1A 2ID3A 2CV1A 2V5QC 3Q9SA 3W2WA 3MKZA 2AXZA 4J8FA 4K0RA 3TWTA 4N2SA 2BTDA 1KQ9A 1XSVA 4YG2F 3B13A 4LLGF 4UHTA 5CVIA 1TWAJ 2X48A 2XAGA 4F3VA 2NNNA 3FMQA 4FHTA 3J7AO 4U0VA 4IN3B 2F0YA 3Q3SA 3LNQA 3TWVA 3VLEA 3BZCA 1S6LA 4EM0B 3BG3A 3CIAA 3OL4A 4G25A 1MH3A 3U9WA 2FD5A 2VKDA 1OCTC 4G8XA 3ZVVA 5CEAA 2BW3B 4E6KG 4G2VA 4IX7A 3WU0A 2XGXA 2NVYJ 1EJ9A 4G7OF 3MKQB 3QDNA 3FK7A 4G8KA 5B1BE 4DI4A 2Y3AA 3MJWA 1G4DA 1VQ7I 2O3FA 3SHFA 3D5RC 1NP7A 3WTXC 3BJOA 1USTA 2FOWA 1TL8A 3GW2A 3PSFA 4RGUA 2ECBA 4B8AA 4YDYA 3UMVA 4IRIA 2FU4A 3K69A 1MX4A 2F8XK 4ZZLA 3CK9A 1KU2A 4EZLA 1IJWC 3QNKA 5ICGA 1FC3A 1X81A 1IN4A 4JX6A 1U78A 3DEPA 3LY8A 1QZYA 3NZUA 2B0LA 1YMPA 4JW1A 4GDFA 2WXGA 3LSPA 4V19K 4CH7A 2IS6A 1IN5A 4W1UA 1U5TC 1ERDA 3CVPA 3N71A 2L4AA 1TJFA 5JHAA 2KDOA 2J5PA 2LK2A 1HW1A 5EF6A 2VPLA 2OOEA 1AWCB 4II3A 1TWHJ 2KPMA 4GZ5A 4QIWN 2HR2A 3A0HC 3ERED 4A12A 2IS4A 1ZARA 4L5EA 1X1CA 3QOUA 4IL6C 3P7NA 5FJ8J 3O2PE 3QWLA 1DP3A 5E8IA 3J5QB 2HDWA 3UKGA 2HQNA 2LNIA 1KPSB 1MW7A 5KNLA 3RKQA 3CUQA 2CQNA 2OEVA 5JHBA 2JVHA 3B73A 3F3XA 1GV2A 3FMSA 5KVRA 5DTDA 2KCVA 3D5LA 5GAHJ 1A17A 2EIKE 3IUOA 1H8AC 3SDGA 3O8GA 2OZ6A 2BEOA 3FH5A 4L18B 2MSYA 3ENEA 1R4NB 1N4SA 4IULA 3ZHEB 4F52A 4N39A 4DX1A 4NB5A 4NUBA 1OMIA 5J1RA 2WV0A 1UW4B 1O7FA 3DEEA 3BZKA 1HS6A 2X0LA 1WCMJ 4X1EA 2RG8A 4G8LA 3B7SA 4EGZA 1WDYA 1XB4A 4EQFA 3OOPA 2LBFB 3FTVA 3QWVA 1OCZH 2XRNA 5HVQC 3EHNA 1W1WE 1DUXC 2OU2A 3O4ZA 4ETSA 5C3EJ 3U9GA 4ANJA 4D7MA 1OWOA 3RO3A 4WXDA 4AU7A 4GB9A 3RYRA 4C2TA 3T5VA 2KCKA 1UHMA 4EECA 3MD2A 1SFEA 4LLLA 4BX9A 3ULQA 3CVVA 2Y30A 1NK3P 3I55I 2HM8A 3LS8A 3MX3A 1X19A 3HRMA 4BQNA 2C0LA 4NRHB 3RKXA 4AEZC 1W7PD 1YQAA 2BGCA 5ERIA 2DODA 3E5QA 3G3ZA 1LDDA 2EV0A 5IPAA 4M7CA 3LKUA 4CXFA 1VQKI 4G26A 1DCQA 4F53A 3OSFA 3DPYA 1ETKA 1HXIA 4KVOA 2OV7A 1Y1WJ 3FULA 2KDZA 2KHMA 1Z9CA 3EUHA 4RLFA 3EPZA 2EIME 2I6HA 3KP5A 1H19A 2QUFA 5DEQA 4J0UA 2W7NA 2DPDA 2AW6A 1R00A 1XMXA 3CC2I 4WUYA 1QZZA 3HKZA 2CRGA 4KFCA 2P9UG 3NOCD 1PUFA 3RRNB 1ETXA 3Q9UC 5CPRB 3JRCA 3WODF 3JREA 1JHFA 3PEUB 4E7IA 2DA3A 1KGSA 3IKVA 2DVWA 2LREA 1OYIA 2H6CA 1ETOA 2WXFA 3NAWA 3QWWA 3BT9A 3HRUA 4PUCA 4XKBA 2CWEA 3LSGA 2DYRE 3HM5A 2QM3A 3SXYA 2Z9OA 2COMA 4BY1J 1Z21A 4CT4A 3FTUA 3CVQA 3CF2A 3U3WA 5GP9A 1N54A 2GBYA 2F48A 2BW3A 1WI3A 1JKPC 1JPLA 4D1QA 1MBEA 3MKQA 2FEZA 1O1SA 2ZB9A 3RKVA 2CHWA 3FEXA 3V8LA 4I0AA 3S2AA 2CV0A 2VQ2A 4AYBA 5DCFA 4B47A 2ZGGA 2IS1A 4DK5A 2Y69H 1WJ5A 1S72I 5EEAA 4L9VA 5F0CA 1YYVA 2WXQA 2F6CA 1XCVA 1ONVA 3A01A 3K4JA 1LPQA 5FRMA 4OAYA 2CQQA 3OL3A 3LA2A 1WH5A 2HYGD 1G3NB 3E30A 2M0MA 4BT8A 1O4XA 4M3EA 4MTDA 4PJ0C 2L4MA 5TGTA 4IRGA 1B8IB 2PMUA 5FLMJ 1ZRFA 5E3OA 4FHJA 1E7VA 3ZQGA 2H6GA 4TUUA 4XZ4A 4UWHA 1AWCA 4EM2A 4FC8A 3CUOA 1YW7A 3WHBA 1EPUA 1E17A 1MJ9A 3RZOJ 3ZXPA 1ZHFA 4KNYA 2LY2A 4UUTA 5DYMA 2X6OA 1IC8A 3HXLA 3GZ1A 2HO1A 5HQ8A 4MLOA 4UV8A 1J75A 4ESBA 1EKEA 3A4CA 1BI3A 3P9IA 1JJ8C 2HKOA 2WAEA 3BG7A 3WU2C 3ZCOA 4XKWA 2R0QC 2NRAC 5GADJ 1MX6A 4X8QA 2EIKH 1HG5A 5IP6A 3VYTB 3FM5A 4HF0A 3TWUA 2E60A 1RR8C 1N0RA 4HOTA 4I99C 4G24A 2HEOA 2QQBA 2Y4UA 2MC3A 3R6SA 1KLXA 1KZOA 3K2AA 1D0XA 2Z33A 1OCCE 2IT0A 2OVBA 2PQRA 4HQEA 1HW2A 2F5DA 3NBNB 4EMSA 4PGGA 4H7XA 1ZR4A 3TMOA 3FXQA 2ISZA 2PM6A 5FQ7A 1V5EA 3K1MA 3C3QA 4O60A 2HI3A 3EDPA 3TW7A 2QZ8A 3DBLB 2FO7A 4G6TB 4JX4A 3QPHA 3ISMC 2DK5A 1MMAA 2F5EA 3SO8A 1UJJA 1O3QA 1ZGAA 5FB2A 4P29A 2FMYA 4OMYA 3RSNA 5HOOA 3CDIA 4AM9A 1OQYA 1FYLA 3S7DA 5AAOA 4I02A 3WU1B 2PI0A 1UN9A 3LXUX 4NQWB 2IU1A 2IOSA 2DJNA 4UI9J 4AVPA 2P81A 5CLSA 3QODA 4IRHA 3CP2A 3H35A 1IRFA 1G8XA 5JR3A 3CEQA 2YQ8A 4I6JA 3JTHA 2FA5A 4HDUA 5ICEA 3GCMA 2DA2A 5LD2C 3ASOE 3J5PA 5IOZA 4F93B 2FQ3A 2A5WA 4XORA 4WX9A 2VLAA 3Q15A 3KIOA 4A0ZA 2VE9A 3UT8A 5TRDA 5LGUA 3V2XA 4QFVA 3CVUA 4GZ3A 1TT0A 1HFAA 1D5YA 1OWLA 1YX3A 1B9MA 1TWGJ 2TDXA 4R7LA 1Y8QB 2EK5A 4E7HA 3GFMA 3LSRA 2LKSA 5F0HA 4ZC3A 3OYJA 4KXKB 4LMYA 4XLHA 4HQMA 4N0BA 3JYSA 1X2NA 2JJ7A 3LOCA 1C0WA 2WM9A 1OXJA 5EZGA 4ZJZA 2BY2A 3U64A 4C0EA 1IHBA 1PUEE 3RZDJ 3W2AA 3CKBA 2WY7Q 3G2SA 2FX0A 4L1BA 5D0QD 3ZGQA 1BLXB 3Q49B 4XR6A 4OAZA 2QYUA 2QYJA 5D8KB 3BTCA 1ULYA 3MZLB 3CQGB 5KJKA 4HX4A 4UV9A 4YDEA 5FQ8A 4A1SA 1Z1DA 2EIJE 5DCMB 5E3LA 4KMFA 2GXBA 2P8TA 2UV1A 3BCAA 1MBGA 3F9KA 2B9SA 4L23A 1RRJA 2VT2A 1MMGA 1SVLA 2KLOA 3ZMTA 2R7WA 5GPCA 5AIJA 4XK4A 3E6CC 2Y0SA 3VOEA 3I56I 3H3VK 2UWJG 4WXCA 1JUMA 2COBA 2JK3A 5JHUA 2MW8A 2GM4A 4LG0B 1TYQG 3FTXA 3WG9A 4MGRA 4CHUA 1V55E 3BPVA 3IP4B 5DIZA 4M71A 3KEAA 4Y4RA 5LP0A 3RSEG 2VKEA 4R8HA 1K6OA 2X6IA 3D9NA 2W48A 4BUPA 3TGNA 2IPQX 4BHPA 1GUUA 1SMTA 3OMYA 3G2VA 4XLEA 1CF7B 2NSZA 2JSCA 1A6QA 2NNYA 2EINE 1HBXG 2M8EA 1B8IA 4Y52J 5JJ6A 3G2BA 1TW3A 3R0JA 4BE2A 3ZMZA 3FUFA 3ZYLA 2I2OA 2VQHA 4B44A 2ZXJA 1N9AA 1YJNI 4FU3A 3SNXA 1P5QA 4I6EA 2HOTA 1Z05A 3OXFA 3DEWA 3FBNB 4F92B 3PVLA 3G1MA 3DLLF 3PUJA 5ARFA 1SZAA 2AXUA 5EIBE 2VGXB 4PDXA 1AU7A 2FBNA 1JI8A 3E97A 4Z68A 1ZYRF 3FXOA 1RC9A 1A04A 1I3AA 3U1DA 5HS8A 3UM3A 1JUQA 1H6PA 4K5CA 1AP7A 4S0HB 1QU3A 2XCCA 5DM7F 1IUFA 2ELJA 2PG4A 3I3LA 3MWMA 4MNUA 1J9IA 3B95A 2L6BA 3LJ3A 2O0YA 1YHQI 5KJNA 1FOYA 2W82A 3FHEA 2XPWA 2R7VA 2BY3A 4KUMA 2JA7J 2NVQJ 2JPBA 1RUOA 4IHVA 4NACA 1FY7A 1SW6A 1OCCH 1POGA 4BH9A 1Z3XA 2FE3A 1LQ1A 4YIFA 2WY8Q 5FRNA 1QZEA 2E2JJ 4CUGA 2RQPA 5T4YA 3HGGA 3TO9A 1VQ4I 1HH8A 5LGTA 3PIPF 1HLVA 3AAAC 2QLZA 4A69C 4Q94A 3CD6I 1HF0A 4HX8A 3UIPC 2FO1E 3BQYA 1VQ5I 4IHYA 2UZKA 5E20A 4KICA 4KBQA 1LFBA 2L6JA 2ELHA 2IGOA 5EKQD 1ETWA 2I5UA 3FXJA 2Y0BG 5ANRA 1E8XA 5J08A 3L7WA 2M30A 4L5IA 3WTZA 3K10A 1XDSA 4NQWA 2M5WA 3D0SA 2OV8A 1QVUA 4AIHA 3OTNA 3C18A 4N9HA 1I27A 1YJ9I 1MQSA 4O1OA 4O1PA 2VGYA 1HQCA 1N4RA 4C9YA 5F27A 2J9QA 1F43A 3ZU7B 2H8RA 2EBIA 5LLQA 3Q79A 3PS6A 2BXZA 3TP3A 5J6XA 4E6HA 3NQOA 4U7EB 2CUFA 1SVMA 3ASOH 1E90A 2LAHA 1VF9A 2AO9A 2UXXA 3OYGA 1TNBA 3VEPA 3KEOA 5BXOA 2H27A 4BESA 3VB2A 3BWGA 4D0PA 3BG6A 2V26A 4J19A 1FCHA 9ANTA 3CJTB 3FUJA 4N4NB 3CV0A 3HXCA 3HTUA 4BKXA 2XHEA 4CDRA 3HB9A 1IRGA 1KU9A 5ICCA 3CVWA 3HXFA 3S7BA 3MFKA 1JCSA 2ZBKA 3OXGA 1TEZA 1FJLA 2WVIA 1VFCA 2XGMA 3ZYMA 3PSIA 4ANXA 5FGMA 1WAO1 2P7VB 1O57A 3BJAA 2LAIA 2WXHA 4M72A 5EGOB 2ZJRF 1QZ2A 3VPRA 2CV2A 3UXGA 1J7KA 3DEOA 1OKRA 2NYJA 4GTQA 3OYDA 5LEJA 3FU5A 4C48B 3LSIA 1UCRA 1WQ2A 1MMSA 1WM5A 5HLHA 5EN5D 5LCWJ 2R7DA 1IRZA 3E4BA 3Q7FA 1OLTA 2EIJH 3PREA 2ZO4A 3CHOA 3AS4A 2CFOA 1HDPA 2F4OB 4JYKA 2KC7A 1UAAA 4GZCA 3FBIB 5FKKA 5BXUA 4LGWA 3HC7A 1EF1C 2DWZA 2OUMA 3ZEFA 3QPTA 2QKMB 2XEEA 2BVMA 5HNHA 2A61A 4P1WA 3L2VA 1OCRE 4GAAA 4Q69A 1SD5A 1V55H 1JT6A 4UNOA 2E36A 2M7AA 3ECOA 3HEFA 2XROA 2XPZA 3CVNA 3FDHA 4BE1A 4N9IA 1TQIA 1P4WA 2JA6J 4GYIA 1MJBA 1T38A 1NI1A 4GZDA 3LA7A 4URKA 3QPLA 5JA4D 2WTEA 4RB0A 2MYOA 1OR7A 4DX6D 2V4LA 1KZPA 3T0YA 1CF7A 2EINH 2KL4A 3CHPA 3E37A 4B0ZA 2DYSE 2CFUA 4XN0A 1W3BA 3GZSA 2HQRA 4CYCB 3QARA 3GEZA 2EA4A 3BR5A 1VNDA 2KZGA 5G05J 5F64A 3QAQA 3SBSA 4JBAA 4Q48A 4GCVA 1Y8MA 1YCSB 4HG2A 5LHHA 2R03A 1TC3C 4B94A 4JP0A 2VGXA 5KWDA 1J09A 5ILSA 1VQNI 3Q5MA 3I5UA 1IF1A 3AG3E 3HG0D 1E8WA 2W1OA 3F6OA 2Q8KA 1RW2A 3TXMA 3L2QA 3WE3A 5E3NA 2G7UA 4I2OA 2ZNZA 3K4NA 4ZYHA 3BY6A 1G3TA 2R3SA 2WAQN 1W36D 2FULA 3DSVA 3HHMA 3LPZA 3DXJF 3NF1A 2P5KA 3ERMA 4XLCA 5IP9J 2KIFA 2NXPA 2O03A 5TISC 4A3FJ 1H6OA 2MABA 4Y7NJ 3L13A 3UKUG 1DDNA 3ZN1A 1QA6A 1E2XA 2OVFA 4LD5A 3L16A 2L2OA 2V79A 2DTZA 3E0JB 5BV1A 1Z67A 4LG6A 2WQHA 4DX7D 4BXUA 2VN2A 4I1MA 3GZNB 4FISA 5IYBJ 2D45A 2XKOA 4PFOA 1O5MA 3V79K 1SQMA 2Q2EA 3DV8A 4ZDLA 4WK8F 4JC8A 3KZYA 2K5CA 1YIOA 3LA3A 3P9KA 3LVQE 1HSTA 2G0EA 1VQ8I 3JAMZ 3GYHX 1E0EA 3D9KA 5KNHD 1D8EA 4B3AA 1S9HA 1N11A 3DXKG 4I2ZA 4HSRA 1UHSA 4WNGA 2NYXA 4HZFA 3S1RJ 4PZJA 4J6IA 3RPUA 2JRTA 3CCVI 3MGBA 1X4OA 3HZJA 3GLXA 1TQMA 2YR2A 4BEHA 3CMAI 2KIMA 1XN7A 2HYJA 4KT6B 2JA2A 2LSVA 4QQIA 2JLBA 5A6CA 1YS6A 2QBYA 3IV0A 5J40A 2VJIA 3FP3A 4KIGA 4FJYA 1H9TA 3FU6A 4UUCA 1H88C 3QKYA 4FA6A 3M9AA 5E8GA 1ZBPA 4CCNA 1MMNA 1T0FA 4YIRX 3EUKL 4ANVA 2XSJC 2WXNA 1WJDA 2GIVA 1R22A 5BOXA 1BI0A 1I6XA 1LE8B 1WHUA 3ZMDA 1I3QJ 2YS9A 1BW5A 2DT6A 3O48A 1ITYA 4FX0A 2AVPA 2VGEA 3BU8A 3WTTC 3R0AA 3FTZA 3I5PA 3FIWA 4PSWA 1ZRDA 2L7FP 3QP5A 2V4HC 2XCBA 3HHHA 3H5RA 3Q0WA 3TL4X 3HSRA 3S2HJ 1LTXA 4K5BA 1W5CC 4B48A 3AG2H 5KK1A 5J90A 3ZN3A 2HVQA 3E7LA 2FBKA 4N5CA 4I6GA 1P92A 1K78A 4E85A 3S3MA 1N95A 2K9QA 3UTMA 4RGXA 5K5QA 4L0YB 3I0TA 1QQEA 5EGOA 1ZB1A 1R6RA 1O3RA 2KXPC 3QAHA 3ZKJA 1IAWA 3C5RA 2ACJA 4UVAA 4A5MA 1MD0A 1LDJA 2VC0A 3LQQA 3ZQIA 2PL2A 4KIBA 1A31A 3K9TA 2M45A 2IO3C 1B4AA 2VJ4A 2XHKA 1OYWA 5BS6A 1WJCA 2ZMEC 3FKJA 1VDYA 3SFYA 1MZCA 5CRUA 4EHMA 1K1BA 4XLNF 1YO5C 2XQ0A 1OJLA 3ASDA 4TXRA 1WGXA 1UN8A 4XX5A 3CR3A 4L9PA 1ACIA 3B6AA 3QYFA 1HCRA 1STZA 1VI0A 4LJZF 4BU2A 3TG5A 3C2HA 4A55A 3Q0VA 4BT9A 2B0OE 3S16J 3ASGA 3HUGB 4CA0A 2QC9A 5C4JJ 3UR3C 1SFKA 1MSEC 1TBXA 5LCWC 3L2CA 1W5TA 5CHEE 4GTOA 1WSUA 1N75A 1QRYA 2OCEA 3IRQA 1PP8F 2WB2A 2ZJQF 4CCLA 5DD4A 1ZLJA 1D8DA 3JRBA 1K83J 2KMUA 5KCMA 3JSPA 4GCNA 3VTYA 2DYSH 2XGDA 5HDGA 4CCOA 1I1SA 2V1DA 2K9LA 3W6KB 4B4CA 2V9KA 2DOAA 1KU7A 3IRRA 2DA4A 1DGRM 4C3IJ 1GW6A 1FIAA 1ENHA 1X58A 1X3UA 3MQ0A 5H6RA 5GTHC 2QZAA 2Z3YA 4G9YA 1TLHB 4RA2A 3N4MA 4II2A 2H1KA 1FT1A 4IHTA 1BI2A 4B43A 4RB3C 2EQXA 4IPAA 2HQ5A 3BQZA 2IO2C 3TP0A 3Q75A 3JRHA 4PGHA 1S8NA 4J8YA 5EX3A 2E7WA 2DXIA 2OBPA 3B6CA 1R5GA 3FUDA 3L08A 2GOXB 1DPRA 1P9QC 3GFJA 3M8EA 3VSKA 2KM4A 4FHKA 4I98B 4ACKA 5CJ9A 5G05C 2X6KA 2R93J 1B72A 1J0RA 1ZK8A 5D5XB 3U66A 3OYEA 1NHAA 1KU3A 1APLC 4J8SA 2DBAA 3DWLG 5CEDB 2Q0OA 4BY6A 3PUFA 3LSMA 5J4YA 2X9DA 2FJ1A 2M34A 1WWXA 4HORA 1ZG1A 2VB6A 3KEZA 1WJEA 1LVKA 4XLAA 2KCLA 3UUXA 3DTIA 3N05A 1SD4A 3V31A 3M8JA 3NARA 1DP7P 3ROUA 6PAXA 1OCPA 2ZFWA 5JFRA 3HOXJ 1WH7A 3BP8A 1LEAA 4KT6A 3J80K 4DJAA 4DI3A 5D6EA 3LSTA 4UB6C 1JUSA 4CZCA 1FTTA 1T2KA 3FK6A 1MYOA 1SC7A 5JHFA 2XPYA 1HKQA 3EIJA 2NC9A 4BERA 3OYAA 4TV7A 2WXRA 3LY9A 2F4IA 1XX5A 2XF5A 5HNFA 2GRLA 4V2FA 4DIQA 3JXJA 4LIVA 2OZUA 1IRXA 2KQRA 1LE8A 4OVVA 3CKCA 2PBIA 3CK7A 2OPTA 4X6AJ 3KZZA 4KMOA 3V2OA 1A36A 4Y17A 1GLNA 2XGEA 1ZGWA 1QHGA 1JJ6C 4D5FA 4L2YA 3HOYJ 2M7BA 1TQPA 4BSZB 5CMWA 3GMEA 2P6TA 1R1VA 3K7AJ 1UJ8A 3E6BA 3MZ8A 1UMQA 4GRIA 3VODA 1MKMA 2XAHA 4ILGA 2CU7A 4NQ0A 5HDKA 4ANWA 1N0QA 2XGOA 4X0GA 3JUEA 1U5TB 1QNFA 2VJJA 3LFUA 1R23A 5BQTA 2HOSA 4TV3A 3QYEA 4XSXF 2G9WA 2VC1A 3K70D 2IJGX 2UY1B 1HF8A 2WADA 1IDYA 2HPIA 3RYPA 1JTXA 1D9SA 1D1AA 2PMHA 3JRIA 5CQEA 4XLPF 4DZPA 2MLGA 1P6RA 2OC6A 1IQUA 4S04A 1KQ0A 2EQRA 5D5WB 5HDNA 2J07A 2E35A 2LVSA 3G6EI 3FY4A 3HDXA 3FMRA 3KD7A 1BOBA 4OIRF 2LOOA 5L3GA 3LDZA 3ZYKA 2IF4A 1ON1A 2VSYA 1B59A 2KIUA 2F5FA 3IKOB 4L2LA 5BW8C 3JQ0A 3CCSI 1YW9A 1DU6A 5K1YA 2RQQA 3S15J 5JI6A 1ORKA 1K3ZD 2DOFA 4ZTJA 3SF4A 1MBFA 2GQQA 3Q0UA 3MMYB 1PC2A 2OJED 3IBEA 2Y4TA 2K9MA 4I1AA 3SDBA 3MA5A 5L3DA 3TDUC 3KS2A 4A3KJ 5ENQD 2VUMJ 1XG1A 5BPDA 2W4SA 1MH4A 4YRVA 3TOAA 4C2UA 3AU5A 3PZ4A 2N8GA 1BBYA 1BR2A 2VOOA 2WXOA 2XAUA 3FUEA 2DJIA 2KJBA 4PSXA 1T33A 2XUBA 4ENMA 4BX8A 4K03A 1LB2A 1IDZA 1LVAA 2DMNA 3SEZA 5H20A 3AS8A 2R7RA 4I9EA 3AL0C 4BAYA 1FVHA 5C44J 5FKOA 3D9PA 4C30A 3VYRB 1USSA 2V1XA 3CMYA 1K4TA 2HTSA 2L9VA 4G23A 2BY0A 2OD5A 3K4BA 4CZZA 3ZOBA 3UM0A 2OA4A 2YUSA 1Y0UA 1EYHA 3RJPA 2GRQB 2XASA 2BZTA 5J8CA 2ICWG 3SZPA 5HLIA 4CGVA 2EV6A 2FXAA 2EZIA 2LDUA 3ULYA 4GPKA 4KN4X 4YFKF 3PE4A 3KZIC 1JT0A 4D7NA 2DFIA 2QSFX 2P5VA 3C2GA 2H6FA 3DSUA 3JUIA 4U96D 1SFOJ 4ZYAA 5K5OA 4YVQC 1PP7U 1I39A 1U9NA 3F6QA 3ABLE 3BLYA 2EA2A 4LK0F 3LMMA 2P4WA 4HPQA 2VQGA 4KMUX 5B1BH 5M3FJ 4AM3A 2RFAA 2WXIA 5CCMA 1LF8A 2KT0A 1T98A 2CG2A 4JEUA 4MO7A 1FTZA 3FTYA 3PZDA 4GMRA 1OFCX 2FRHA 2LYCA 4EJTA 2P9NG 5D2MC 3TWWA 3HBLA 2BE5F 3S2WA 2IY0C 4U95D 1V54E 1W36C 4LRZA 3TJPA 2CJJA 2R5ZB 1ZG5A 3FKIJ 3OYFA 4F6RD 5H7PA 2NVTJ 2XS1A 2DT7B 3W6VA 1JUPA 3DWLE 1OY3D 2WMNA 1PJRA 3HPGA 2J8SD 4BL0B 1QPIA 3JCKC 2OF7A 4AC0A 3A0BC 3RIRA 3I4GA 5IT3A 1XMKA 1BI8B 2XS8A 5CBOA 5FLXZ 2EZLA 2NAZA 4YFXF 1FOWA 3K2ZA 3I4NJ 4AV7A 5C4XJ 4HNAD 4ZYDA 5B1AE 3DPUA 3A1YA 2E19A 1FSHA 3DTEA 3VYSB 3CCUI 3QC1A 2XPUA 2RNGA 4AIKA 4A3DJ 1XCBA 5AQAA 4Z2YA 2DO7A 4EBAG 2DLLA 4AXHA 5A2QZ 2WXLA 2VI6A 5AN8A 4UQZA 1GVJA 5FWQA 2PN6A 2E7XA 4FLBA 3OR2C 5C1DA 4UI9K 3H5NA 1R58A 1UOHA 1HC8A 3K4LA 4D10C 4BACA 3Q7AA 1U5TA 2CW0F 3ZHEA 3J7AY 4I17A 5ENOD 1X1BA 3G1LA 3DPTA 4MBGA 4BQQA 1V5FA 2QQ9A 3UIOC 1N94A 2MD0A 3CC4I 2GRMA 4QPOA 4RS8A 5F1JA 1ZTRA 2ESNA 4XN3A 4CCMA 2FMLA 3PM1A 2KZTB 4RAGA 4M74A 5ENTD 1ZREA 2HYZA 2LBFA 4L9NA 4MEYF 4XOPA 4XRSG 2K3FA 3LVRE 2EPFA 2LKXA 2L7KA 3O8HA 2CUJA 4EV0A 4L0ZB 1Z77A 3ZPLA 2ILRA 4DX2A 3CCMI 1BA5A 1D1BA 2VSXE 3H9QA 1PDNC 2P2CP 1X1PA 1UELB 4ZYGA 2ZFUA 3CESA 1U6GA 3DBHB 1H6KA 3FUKA 1X5BA 3HXDA 4I09A 4IEJA 5DDGA 3L00A 4DYCA 3OOUA 2L02A 1F36A 2PM7A 4JVSA 3UM1A 3TKYA 2OAZA 5CVJA 2JMWA 4WXHA 1KONA 2LLKA 5HKPA 1S7OA 3LAPA 1F9NA 1OCOE 1HG2A 2DK8A 3I9V2 3RQ4A 3RQIA 5HI7A 3WE2A 2EIMH 5M5YJ 3A2KA 2ETBA 2W84A 2HNHA 2LY9A 3HIZA 1E3OC 4CZ2D 3HPHA 1OYYA 3AS5A 5D0OD 2W25A 3I3NA 4M9XA 4I9CA 5J8FA 1WRJA 1K61A 2O8KA 4FJZA 4MIMA 4AY5A 2HOAA 4G12A 1A5JA 5LRRA 4GMJA 2WXKA 1MIJA 2HZTA 4E7KA 2DDBA 4XONA 2O6GE 3FXRA 5JLWA 5JVGF 2NVUB 1UFMA 4J00A 2DN0A 3MEXA 5ICFA 1K4SA 1ODDA 2DYRH 1L3LA 2IW5A 3DXMG 4IQJA 1V3FA 1BPOA 1TW2A 1IHGA 2XF7A 1WJFA 4LNGA 1YI2I 1FMWA 3BUAA 1QPMA 1FLIA 4AIFA 2FBHA 5CQGA 5JJ7A 1E8ZA 3ABLH 4KIFA 4P55A 2AXVA 3FUMA 1BW6A 4A3JJ 4ATGA 1V4RA 1VZ0A 4OIOF 2E2EA 2R7OA 3V4GA 4OIPF 2X1EA 3KAEA 4GZ6A 4ON0A 4DQ2A 3V8KA 4PS7A 3ABUA 4KT5C 3RRUA 5FFXA 5L3BA 1FWZA 1Z7UA 1QGPA 2MBFA 1V54H 2X1CA 1MX2A 3URZA 4A3VA 3SYTA 2V9VA 3ZQFA 2R5ZA 1KYWA 3DQVC 3E5UA 5FD5A 5FO5A 2D2WA 4HF1A 2XGCA 1FYMA 3W9GA 2IGKA 1XGNA 1MMDA 4BTBA 3RO2A 1FPPA 4G6DA 3ONQA 1FPQA 1G3SA 3WG7E 4CYMD 4XM3A 3W3CA 5KHDA 1CGPA 2JN6A 3PNTB 3FDYA 5KAIC 1I6HJ 2MGQA 4F55A 4HOQA 3OYCA 4A3LJ 4ENJA 3R4KA 3U21A 3ML9A 2WMOA 5EYPF 2CW7A 1SZ9A 1EH6A 3H3UA 2IEJA 5AJDA 2K4JA 2Y48A 3MCZA 1OUVA 4PH4B 5FQ4A 3FX3A 1XGMA 4BXXJ 1F1ZA 4U8YD 5CBNA 4EJOA 1G3YA 3F72A 2R5SA 2LXMA 4F7ZA 4MS6A 2A5UA 4BQOA 4ILHB 4AIDA 3SD5A 1Z91A 2V1NA 2JA8J 3G2UA 3PL8A 4L9JA 1IGNA 1O3TA 3OS1A 4LB5A 1VTNC 3B7RL 4KYOB 4APFA 4F1SA 2NXNB 2EFPA 4A3TA 1P4XA 4XLFA 3EUAA 4I76A 3DKYA 1S29A 4DGWB 2Z16A 1X2MA 2ME6A 1S0PA 2ZSIB 2KATA 4A3BJ 2DCEA 1BJZA 1G3WA 2E5ZA 1MGTA 4LITA 1LJ9A 4NNJA 3SZGA 4A0YA 3FHZA 1U8RA 1NH3A 4U0UA 2CO5A 2MRIA 1MHQA 5F0FA 1OISA 2OEWA 3JRFA 3CLJA 3BOQA 4NURA 1TN6A 2M4GA 2YX7A 4RAYA 4ZHBA 1Z6RA 4F91B 2P5LC 5B3SE 3X2QE 1XDUA 4D5CA 1A6IA 1TN8A 4JD2G 4LNBA 3H0DA 5AENA 1FMVA 2QSHX 4F3QA 3MZHA 2NS7A 3HOVJ 1JWGA 4XL9A 2CFXA 1WFXA 3VLFA 3TEDA 4LUNU 4EBAA 3ESWB 2BEDA 1MBJA 3EU5A 3G2WA 1HXDA 3T1BA 4GA2A 1Z5SC 2AQEA 2QY7A 4I01A 1XNFA 3I59B 3B02A 1YFHA 4LNUD 2EFWA 4BY7J 1TWFJ 2HZDA 1B89A 2NVXJ 3K70C 2EH3A 2K85A 2M1BA 5EYRA 3OIPA 4BGDA 1U3EM 3ABKE 3L9TA 4TXPA 4WNFA 4XEIG 3T5XA 5AYWD 3S14J 5AIPA 2X4HA 2WXMA 1HW5A 3T8MA 4RDUA 3IXEA 5D5UB 1TP4A 3NWTA 3ZQQA 3DPLC 1VQ6I 1E96B 1RNLA 1MNMC 3KP6A 2G7HA 4XIFA 3M3YJ 2Y2ZA 1OCOH 2Y0MA 1HZ4A 3HJEA 4XRSA 4XIDA 4YVOA 2CQXA 2RV8A 2IRFG 2B63J 2HTJA 4GTSA 1X4PA 3E33A 4F1PA 4M73A 4ZYEA 1NA0A 4DRXE 2RKHA 3T8KA 1V5GA 3MKRA 3UT7A 4GO1A 1E8YA 2X6HA 4UI9C 3WTVC 4KA4A 3HOWJ 2P9IG 1QHHD 2MC4A 1W0TA 2R17C 2BOLA 3SI5A 3D9LA 5D66A 2GIZA 3H9GA 2Y31A 3IHUA 5E17F 1RESA 2LUHA 2R02A 4XICA 3DU5A 4CICA 4MRUA 4N2QA 2CSOA 3W2VA 3UQ3A 4QPQA 3LYAA 4LEUA 2QWWA 3KEYA 4IF4A 1SAXA 1N4PA 2MHKA 5M3MJ 4I0BA 3J81Z 5AONA 2K7LA 2HVRA 3TO6A 1WG0A 3H92A 4RGSA 4UUVA 3HIFA 5J3LA 2VONA 1O1RA 4M3BA 5DCMA 3GTQJ 5AQ9A 5EG0B 4HF2A 2PZIA 1F5TA 2KZVA 4EJVA 2IONA 5BNWA 1TN7A 1B1BA 4FCYA 2GWRA 4KITB 2L01A 3L2WA 1QVTA 2DMTA 2MH9A 1HDDC 5LOZA 4LG0A 2DTRA 4XI0A 1BN5A 4IQ4A 4AD9A 2D5VA 2CHXA 1ZN2A 4GYWA 3OYKA 1IQRA 1ETVA 2RVCA 4HYEA 5CVVA 5DD8A 5FKMA 4ZDPA 4G7HF 1U8BA 1DU0A 1N78A 2XSDC 4U0ZA 2MH2A 5E79C 4IOAF 3A02A 1W7PB 3HYIA 5F6FA 3EYIA 2DI3A 2PEXA 1KQ8A 3EHQA 4HW0A 3FXKA 1R4MB 2AJAA 3ML8A 2ZC2A 3SZ7A 3PQJA 3HL2A 2QEXI 4H4KC 2DQRA 1UG3A 3KX2A 3WG7H 3DSWA 5KJMA 5IT9Z 3BG9A 3RIBA 1XMAA 4NIKA 2Z1DA 4HLXA 1IXCA 2K02A 4JX5A 1EA3A 1UZCA 3RCOA 1LDKB 4HV6A 4XOTA 3L2UA 5DUIA 5EZHA 2NS0A 2R7XA 3ABME 3ELKA 1F4KA 2EZKA 4U88A 4MQVA 3CO7C 1LD8A 3R7QA 3BR3A 4A2UA 2QQ8A 3TO7A 1ZRCA 3CCQI 4U0SA 1LUJB 2YX4A 1Y39A 2XB5A 3ASNE 4HQDA 3UKRG 4G94A 1KA8A 4L9TA 4JXTA 3IKTA 3HRAA 3F8NA 3BTLA 4N3BA 5KNGA 2LMDA 2YSRA 2X1DA 3QYBA 3PUKA 4CDGA 2HGCA 5F08A 1G2HA 1VQ9I 4M6VA 3DSSA 3COAC 3L09A 2KJCA 1OT8A 3MV2B 2HU9A 3DTKA 3R60A 4HAMA 2R5YB 1W5SA 3H0GJ 1UHWA 1G59A 2Y9YA 4D9JA 3PEVB 2K27A 1WVRA 4BBRJ 2EILE 3F6VA 4IHXA 1AKHB 3QPSA 3JR9A 3M8FA 2JEKA 5B3SH 3X2QH 4JQFA 1FBQA 5D8LB 1IW7F 1BC8C 2HDDA 1PAQA 5HRYA 3JRDA 4A5NA 3J81K 3HSFA 2QF7A 4LK1F 2RDPA 2VIXA 3S1QJ 5D6FA 4GU5A 4MHGA 4P9FA 3RKWA 4R79A 5K7HA 1JKRC 3GTKJ 4DBRA 2CUZA 2I9CA 3CVXA 1IN6A 2O5RA 3E34A 2M4KA 2X3MA 2CS3A 3AG1E 5D4SA 1IZ1A 4CGZA 2XPVA 3I59A 3CZ6A 1BD8A 3KYDB 3PNYA 5EEGA 5JLXA 1P7IA 2GXAA 1FOXA 5DBKA 1MSFC 5LHGA 2XEVA 2KKOA 3GTGJ 3L6AA 2M2EA 4BXFA 3C3RA 4HVBA 1XSXA 3HKZN 1EH7A 3ABKH 3DFGA 1RKTA 3CCJI 4ESJA 2X6FA 1BIBA 2OQGA 2IP2A 1Z6TA 2KIQA 3CLQA 3E5XA 4KZCA 2YINA 3S1MJ 2GA1A 3EIQC 2E34A 4FLHA 3M1EA 2Y9ZA 4GTRA 3CUQC 1T39A 5GPAA 4GTPA 3QK0A 3QU6A 4PUSA 4I43A 3GTMJ 3EQLF 4XI9A 2LSUA 3K1PA 2M63A 2CHZA 3AJIA 4TXQA 5G55A 4APOA 5EDSA 2K3PA 1NK2P 4JL0A 2ZJ2A 4AP2A 3NWSA 3C7JA 3IAM2 4U0WA 2DFHA 4OMZA 1Z7LA 1WJAA 3RK6A 3OR1C 2V1UA 4HOSA 3NRVA 1S64A 2XZDG 1DPUA 1HU3A 1U2WA 2VXDA 5H2FC 5BMZA 1EF4A 1T56A 3T8TA 4W97A 5EJCA 4AYBN 2AQFA 3DLAA 2V6EA 2LP0A 5FZRA 2Y75A 3CVLA 3ZYQA 1D1CA 4Y13A 2XAJA 2LH9A 3CGHA 1BIAA 1XSDA 3V30A 4U0YA 4UWGA 5G04J 4AOFA 1ZAOA 2A69F 2CQKA 1ZR2A 3G2TA 4HXIA 2WB1N 3HSEA 3DSXA 3J7ZI 3CUQB 4EJWA 3C98A 4IYPA 3QOEA 3UPVA 1N77A 1SFUA 2LSOA 4HBLA 4UQYA 1GVDA 4ABNA 2AS5F 2IOLA 1LFPA 1S3JA 4AUXA 2I10A 4DUIA 1B6AA 1J2XA 2JA5J 1UG2A 2EB7A 2W57A 5EDNA 2O61A 1OCRH 3FZVA 3MN2A 1GV5A 1OWNA 3TWQA 5IY5H 4XKCA 1EH8A 1TZLA 2WBMA 3I58A 3IH3A 3PFIA 4HBDA 4BE0A 1TNOA 2JVGA 1U2VG 1ZG3A 2LNBA 3FEYA 3TG4A 1D0ZA 4IXAA 4M9ZA 4XNFA 2BYVE 1L0OC 1W7PA 3JAMK 2XAFA 1H2TC 2AWIA 4B09A 3CK8A 3GW4A 4MLPA 5GAGJ 5EIDA 1Y56A 2X51A 3VDXA 2DFFA 5ENSD 4CSWA 1KYZA 1RUNA 1O3SA 5B66C 4BDZA 3RKYA 2WQ6A 4HX7A 3N97A 3EUHC 5LRSA 3WGIA 3B7UX 3S8PA 3CJQB 3AU4A 5D5VB 2X6WA 2HYFA 3GFIA 4TUMA 3KP7A 3MVPA 4CYCA 3NEUA 3BTJA 3CQCB 3QWPA 1TWCJ 2IJLA 2ZMEB 1NZNA 3Q4AB 1ZGJA 4CCKA 1ZU2A 5E1WA 1QBJA 4U87A 3Q9VA 4U8VD 2HS5A 3P5JA 2M3AA 3ULQB 5FROA 2AHQA 2IS2A 1NL4A 3PDNA 4KVMA 3F8FA 1FIPA 5F1RA 2X6XA 4TRQA 2ZIRA 3ASNH 3NQPA 3J7YJ 3SFIA 1NA3A 4B89A 3AG3H 3TQNA 2WA0A 2BBYA 4G7ZF 3P1UA 1K8KG 5ENPD 3TXNA 4WWCA 3HOSA 4ENNA 4A63B 3F8MA 4FE7A 4YFNF 2LD5A 5HODA 2RKKA 4Y6CA 2A3SA 2ETHA 2M0CA 5J47A 3V7SA 1K1AA 4Y3OA 4XBFA 2P6SA 3ESLA 4M9SA 3TWRA 3CSFA 2J49A 2F5VA 4NC8A 1I5ZA 2DA1A 2XC7A 1WZ2A 2CGPA 2R5YA 3FH8A 2KRFA 3ZP5A 2J09A 5BPPA 4FULA 1IV8A 4E7SA 5IOYA 3HGYA 1T6SA 4A3EJ 2IXSA 5E75A 2L54A 3WGGA 4HB5A 2DW4A 2EILH 3LWFA 3O3KA 3AKZA 4BTAA 5IP7J 1AKHA 3ULEG 2E2IJ 4GYOA 5HS7A 4HNVA 2IQCA 1E3PA 2QCOA 3NAUA 4GTVA 2LTPA 2JWTA 2ETAA 2AXTC 2XDVA 3CDHA 3E6MA 5A23A 2H8WA 3SZTA 1S7AA 2PMZN 4PDKA 5FKLA 3KSLA 2L7ZA 2TCTA 3GZ2A 3BDDA 1WJBA 2PFBA 1WI9A 3AG1H 2BF0X 2GRPB 2HQAA 1K6YA 2P9LG 2J08A 2L0IA 3TWSA 1FEXA 1EV7A 1N4QA 1ZELA 3F8BA 4EATA 2DA6A 2HR3A 3F0CA 2JZYA 5LGNA 4GXOA 2VJ5A 4Q4ZF 3OYHA 4BJ6C 4KDPA 1H9GA 2FNAA 1JCRA 1L5JA 1N52A 1S63A 3CO6C 2A6EF 4WF2A 5T8IA 2LRDA 2EWNA 4IHSA 2Y69E 4HA8A 3CMMA 2KRCA 1U3DA 3BC8A 3M7GA 2RAEA 5AIQA 2H09A 4BHCA 3A01B 3FU0A 4RVBA 3K4KA 4FX4A 4N4OB 2LR8A 1GXQA 1EDUA 3WTYC 1H89C 3HRSA 3RDIA 1ELKA 3RPUD 5DM6F 4PJNA 1GDTA 1RETA 4ZDOA 4JZYA 1RPWA 3ZNGA 1IXRC 2WWYA 5CKTA 1K79A 3VYUB 3OYNA 2A5YB 3R9MA 1TNZA 4PCQA 5EX0A 4M6YA 1RI7A 3ABTA 3QOPA 5B5EC 2RGVA 3PZ3A 4N5QA 4WWPA 3ZUVB 4DZJA 2Y0SN 3HRTA 3PO3J 3GF2A 1D5VA 2VBWA 5FFZA 4M3OA 5EEHA 2W24A 1JWFA 2FF4A 4Q96A 2LFBA 3I4PA 4XRMA 2OTJI 1SA5A 3CTAA 4IVNA 2K9NA 3I4MJ 2F37A 2ZXIA 2QSGX 1FVFA 2X6JA 2FUG2 3CSTA 2RNJA 2V9PA 3PUBA 3PZ2A 4ZH4F 2IAIA 2NS8A 2QKLB 2VBZA 2VL8A 2Z99A 1OWMA 2I8DA 2B6CA 3OS0A 1ZLKA 2LY1A 1DNPA 3SEQA 2IA0A 4UWKA 1YITI 1YW8A 4AVXA 1PYVA 2MYSA 3GUDA 4CYDA 1VQMI 3DF8A 3DKWA 1XGWA 3U4TA 4J8EA 5LEKA 1S5LC 1HO8A 2H6IA 2A6TA 1H0MA 2IFUA 2UXNA 4E7ZA 1MJ0A 1NTCA 2NOGA 2KFDA 5CRVA 2ELKA 3HUGA 2YPRA 5G04C 4B8XA 3IHYA 2E5NA 5HLTA 2R7UA 2CG3A 4JHJA 4DLQA 4RAZA 1XTAA 1YJWI 5LBQA 4I7HA 4FE4A 2NOJB 1A35A 2XRYA 2VASA 3G73A 1FP2A 3CMEI 2R7ZJ 2WAQA 4KN7X 3S93A 1TNYA 3OXLA 3AG4E 4HS2A 3UI2A 2ECCA 3GYZA 1U9OA 2FOKA 4KISA 2GAUA 1U0JA 2IGMA 2ONDA 1TNTA 2Q1ZB 2ZMEA 3TOBA 3E6DA 4JA9A 5FJYA 2A05A 2XAQA 1JKOC 1U3CA 5HS0A 1VQPI 4XMYA 4AWXB 2PJRB 3S17J 2RFMA 1ELRA 1SD6A 3V42A 5BUZA 2QENA 2HOEA 3RJVA 1O7LA 2DAOA 1WKMA 3LFKA 2YU9J 2IA1A 2X6YA 1X1DA 1X1AA 2L0KA 3IH4A 4U04A 1BR1A 2L9SA 5FKNA 3BPXA 5BNGA 4HOBA 2P9KG 3FWVA 2A6HF
chains in the Genus database with same CATH topology
1FZPB 3BZ6A 4O6JA 4EM1A 2VXZA 2I1KA 1JGSA 1H2UA 3WTSC 3JQ1A 2WXPA 3JTGA 3LCAA 3HOTA 2O8XA 4O5VA 2PLYA 3CHQA 2MLKA 2GGFA 2J4BA 3FU3A 4WNDA 2GXGA 4OINF 4R1HA 2V0PA 1BM9A 2D1VA 1FNNA 3FWEA 1P4AA 4F7AA 5DV5A 5L3CA 2VSNA 5ILUA 2DU9A 3MZYA 2V8SE 4RG9A 3R7RA 4IRUA 3WGHA 4A1GA 3MYVA 1Q1HA 3CLOA 3IEGA 1IN7A 2Q7FA 3KE2A 3RU0A 4CT0A 4UVBA 4MKTA 2L9BA 1FP1D 3IWZA 3NZSA 5A7DB 5LHIA 2JPCA 4L7TA 2A07F 2STTA 4P96A 3LAJA 2ADUA 3I64A 3I53A 5L3EA 1ON2A 3FXUA 3IWFA 4RGRA 2ZU6B 4Y6WA 5KJLA 3VLDA 4RSYA 2DT5A 4WCGA 3IL2A 3MV3B 3EYYA 3JSOA 2UY1A 4BNCA 5BV0A 1D3YA 4FT8A 3UT4A 3V7CA 4O3MA 3TL5A 3Q47B 3K0LA 4KZ0A 2LKPA 3KCCA 4MEXF 5CVUA 5E1XA 2R59A 1PY1A 3ASFA 3EETA 1SD7A 4H7YA 5ANLA 5ILVA 2VSOE 2WPVA 3GVAA 4EPZA 2V5FA 3E3VA 2ISYA 3LEWA 3PNLB 2VTBB 2L3DA 4EVIA 3REOA 4EGYA 4MQ9F 3FH7A 2CG4A 4I2WA 4BWRA 1W4MA 4UXNA 3KFWX 1R1UA 3DBSA 1OPCA 3C3WA 5FLXK 3ISPA 5E75A 2A68F 4PS3A 3H3ZA 3FF5A 3SBTB 2AXLA 1SFXA 2HWVA 4C0MA 3V8JA 1HSJA 2E1NA 2Z5UA 2DCPA 2MD5A 3ZXSA 2D1HA 5TJJA 3BG1B 3GO5A 3KEQA 3D9OA 3D9JA 3K1NA 4CEMA 3PH0C 5A2QK 3L54A 1BC7C 1B9NA 3IC7A 4E70A 4EJUA 4BSXA 3T8RA 2J4DA 1UB9A 3HHGA 2X38A 2GZWA 1BJAA 1TTYA 4QLCU 5DUKA 4GYGA 5ENNA 4WAFA 4V3IA 3ZW3A 3BJ6A 4DLOA 1R1TA 4LLNA 2VBYA 3KLOA 2PJPA 1J5YA 2QFCA 1YS7A 2XVCA 2E1CA 4LCTA 1Y6IA 4OOIA 1TJCA 2IA2A 1K7AA 4XE0A 3ZRHA 3B7TA 1HKSA 3MCXA 2HKXA 2MA3A 3MEKA 4CDMA 1FBSA 2YU3A 2STWA 1IYGA 3RRMB 3TAXA 3CJNA 3GX4X 1ZH5A 1FYKA 4LERA 2RD0A 3KP4A 1LEBA 2RC4A 3ZMUA 4CCAA 1P2FA 4ANUA 3ML6A 3VFZA 2XKPA 3P9CA 4UWFA 2IVMA 4GMLA 1R36A 4S05A 3V7RA 3F8CA 2ZCWA 5FZQA 4U63A 3GWZA 3PQKA 3I71A 5C2YA 5H6QA 2XV4S 2H94A 2KZTA 3FUHA 4A0XA 2H6BA 3C1DA 2ZKZA 3F21A 4HOUA 5FZSA 4AIJA 4GA0A 4GA1A 2RN7A 2VODA 4BYYA 2QYOA 3S7FA 3QB2A 5L3FA 4JPSA 3CHRA 2VYIA 4PS8A 1FSEA 2VJ8A 2K86A 4C9BB 2HFHA 1QQIA 1YTYA 2WXJA 3UX4A 1Z3YA 1FT9A 2OQRA 4K2EA 2UWMA 3ZPJA 4ENKA 2VTBA 4NHJA 4Q47A 4WNEA 3GFLA 3HTSB 1E7UA 2YNQA 1MDMB 3K9IA 4JK1X 2DQLA 3F23A 3RI4A 2P7CB 4U07A 5T3RA 4OYSA 2QBYB 4HDVA 3QRFF 5CCLA 1YLFA 4RB2C 3SGHA 3APCA 3HYMB 3QJZA 3PRZA 4P9UA 4G11A 2EFQA 2P58C 4ZZDA 3D9IA 4DNCA 3ZFWA 1MZBA 2DBBA 5CYVA 2YHCA 3FTWA 3L17A 4RB1A 1MJAA 3GXOA 2A4ZA 2JTVA 2FI7A 5M72A 5FD6A 5JJTA 4YIIA 1BOAA 3TGOA 5BPIA 4G6QA 3PE3A 2ESHA 1YG2A 3F22A 2LF7A 4WWNA 2J5OA 4ASNA 3CHSA 1HE8A 1H0AA 3L22A 1FBUA 1K78B 2WC2A 1UJKA 2W85A 2DPUA 1I1GA 1XGSA 5ED4A 2PQ8A 4EQQA 4IJAA 3W6JB 1TNSA 3WTWC 3WXXA 3FUIA 3Q5FA 3AAFA 3VTXA 2XIGA 3HVEB 4H0EA 2FSWA 3I54A 2PQNA 4AJWA 4GCOA 1D8KA 2GA2A 5FQ6A 2BV6A 1IN8A 2GW1A 3S7JA 4O6FA 2EV5A 2CYYA 1G6NA 1RIOH 5HS9A 3ASHA 2F2EA 3ECHA 5G2NA 1XD7A 5JVTA 1RZ4A 1REPC 2QQAA 4N3AA 4UWLA 3ZIMA 4KYWA 2LF8A 1JXSA 1H2VC 4OIQF 3D3MA 4OVUA 4HV5A 5AJLA 1LNWA 2F5CA 3U2RA 4DPRA 2E0IA 4FADA 1HKTA 2VT3A 1D8JA 4W9RA 3ZN0A 2V6CA 3APDA 1XGOA 1AOYA 2BUGA 2XGSA 3KLNA 2C0MA 5E76A 2VOPA 4N3CA 3GZ5A 5E1ZB 4J8DA 2WQ7A 3OAWA 3EHMA 2L0TB 4CGWA 3RPQA 2EFOA 3BROA 3TDZC 4WWOA 2FNPA 2VE8A 2MOWA 3FFLA 4BHBA 1FOKA 1KT0A 5CMYA 4CDNA 2R7FA 3FM3A 3KP3A 3R9AB 3FTSA 2CFZA 3DEUA 5IT9K 2XRZA 4B8CB 3O6BB 3KP2A 1MDMA 4UVCA 4A6EA 3EJNA 1R5HA 2ZNYA 4QWQA 4EZJA 2DIWA 3LQRA 4LFUA 3DPDA 1DVPA 2JT1A 3CHMA 3ONKA 4AY6A 3SFZA 2HDCA 4UQXA 2XPIA 3RTRA 1KT1A 3GZ6A 4HLYA 5CVRA 5K5RA 4Q5SF 1QO0D 5FTPA 4JEHA 2EFNA 1JHHA 3DP7A 5LX8A 2VBXA 3QP6A 1J59A 1GHCA 4G1TA 4ESFA 4JHKA 4BFRA 4HFGA 4BQAA 4GYYA 3D9MA 1YA0A 1ELWA 5FT9A 3QU3A 4GGGA 3OV8A 1WY6A 5LFAA 4HLEA 2EJRA 4JA7A 3R61A 3SQNA 3FUNA 3ZMVA 4U8HA