3T5XA

Pcid2:dss1 structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
195
structure length
195
Chain Sequence
STAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PCI domain-containing protein 2
publication title Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01399 PCI PCI domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t5xA02
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3t5xA01
4Q5SF 1R7JA 1JGSA 1R5HA 3KLNA 2A3SA 2GA2A 2Z33A 3KP2A 4GGGA 1K7AA 2RDPA 3ZN1A 2IJLA 1JHFA 4HOBA 4I7HA 2DQLA 4GO1A 1KU3A 2RC4A 4LLGF 3GVAA 5DCFA 5K5OA 2OQRA 2P5KA 2GQQA 1ZGJA 5HDNA 4WCGA 3QPHA 1TW3A 2YX7A 4LFUA 2P4WA 4ESJA 5DUKA 1H9TA 3RYRA 3I54A 3HSEA 2HOEA 3RIRA 4HQMA 2CO5A 2DLLA 3QU3A 3REOA 5DCMB 2HS5A 3COAC 2E1CA 3HTSB 2P8TA 1RUOA 4HLXA 2CW0F 1YW8A 3P7NA 3I59A 1K78B 2OQGA 2DU9A 3HHHA 3BROA 3FM3A 2YR2A 1L3LA 2YSRA 2HWVA 3SZTA 2FBHA 4Q48A 3IKVA 2MLGA 1W5SA 4O3MA 3FWEA 1EH7A 1XSDA 2O03A 3LWFA 1KQ0A 4RB0A 5HDKA 1J75A 2R3SA 3HHGA 3HRTA 2ADUA 1ONVA 4OOIA 1UHMA 3TOAA 3T8TA 4LB5A 4P9UA 1OYWA 3ZMZA 1OYIA 4A5MA 5HS7A 4IF4A 2PMHA 4WXCA 3CHMA 3E3VA 1Z9CA 3DXJF 3MCZA 1IXSB 2ACJA 2JTVA 3IC7A 1J7KA 1ZARA 1W7PB 5FFZA 4BXUA 4ESBA 3HRUA 5ICCA 1XN7A 1KGSA 4XLNF 1MZBA 4H0EA 4NB5A 5J8FA 2QUFA 2BE5F 3IL2A 4ESFA 1LQ1A 1G3SA 4HDVA 4G7HF 3LAPA 3GO5A 2HTSA 2A07F 3WTZA 1JXSA 3HOSA 3C1DA 3G3ZA 2M1BA 5E1ZB 5TRDA 1O7FA 2HEOA 2V1DA 3T1BA 4XSXF 2RQPA 2DO7A 3L2CA 5H6RA 3JAMZ 2XV4S 1CGPA 1USTA 3OOPA 4L5JA 3ZMSA 2L54A 2ZXJA 3BP8A 4EJUA 4AD9A 5ILUA 2G7HA 4M74A 4CICA 2MA3A 1B59A 3WTYC 5LBQA 4HYEA 2XIGA 1YO5C 2D1VA 4U0YA 1I5ZA 3FMRA 1QZYA 4PDKA 2H27A 5FGMA 2DW4A 3I59B 1USSA 3GFJA 1RIOH 5DUIA 5FD5A 3D5LA 1RZ4A 1TQIA 4LK0F 1OMIA 1I27A 4WX9A 1G4DA 5JR3A 4KDPA 1GVJA 3VB2A 4MQ9F 3V8JA 5EEGA 3GLXA 4OMYA 2Z3YA 1ZH5A 3NEUA 4UHTA 2XGXA 3VFZA 2UZKA 3CJNA 4K2EA 5HS8A 1P4WA 2H6BA 4FX4A 2PN6A 1YW7A 2VXZA 4IHSA 4RGRA 2FNPA 3M1EA 1O57A 1E17A 2VBXA 2R7DA 4HF0A 4BH9A 3GFIA 1BI1A 1U2WA 3DV8A 1FSEA 1S7OA 1H0MA 3BWGA 3J7AO 2O61A 1Y0UA 1BBYA 2XUBA 4EMSA 1WKMA 3K2ZA 4I0AA 1O7LA 1IF1A 3KP4A 5JVTA 4NHJA 3K1NA 4WXDA 1FOKA 2NNNA 3ML6A 1OYYA 4LLNA 5CVIA 3JTHA 4IRIA 1S8NA 2E7WA 2XROA 2EV0A 2ETHA 1FP2A 3IHUA 2P5VA 1XDSA 2EK5A 4A12A 4R8HA 3KZZA 2C6YA 2WV0A 2LKPA 5L3GA 3W6KB 3IRRA 2MD5A 1ZN2A 5HLGA 1UB9A 3QPTA 4HA8A 1YS6A 3KP6A 3ZP5A 2O3FA 4U7DA 2EFNA 3JSPA 4M72A 2FE3A 2JT1A 3GZ5A 4UV9A 2EFQA 3JAMK 4M9ZA 3E6CC 4Q4ZF 5ICEA 3T8RA 4A6DA 4GCVA 3P9KA 4ZZDA 4P55A 4G9YA 4N9IA 1TLHB 2ZNYA 5K5RA 3TQNA 4PGGA 4G94A 3HUGA 3GWZA 1QO0D 2KIFA 2OAZA 1IN8A 3KP7A 3F3XA 4EJTA 4D10C 2XAGA 3NQOA 3DEUA 1XMAA 2YX4A 3F6VA 4U0VA 4Y15A 1QPMA 2EFOA 3HYIA 4LG0B 1SD5A 4UNOA 1HXDA 2ZMEA 4EGYA 4HDUA 3GYHX 3TGNA 1MD0A 3K1PA 4OU0A 3GZ6A 4UVCA 2FNAA 2STTA 5DEQA 1FBQA 1NHAA 1HKQA 1WRJA 1XMKA 2MLKA 5E8IA 3QP5A 1IXRC 3BZ6A 3IWZA 2QZ8A 5D8LB 1UHWA 3F6OA 1RNLA 5BPIA 5H20A 4N0BA 1FZPB 3CUOA 3CTAA 3KETA 2EA4A 3VEPA 1LB2A 5L3EA 3R6SA 4QLCU 3O2PE 1J9IA 1XD7A 4ON0A 1FT9A 3GFLA 4RAZA 2F5EA 3L09A 2PEXA 1K79A 5IT9Z 1B4AA 5E17F 2OU2A 2KJBA 4XSZF 2XHKA 3K1MA 1DPUA 3BDDA 1D8KA 3CUQC 3WGGA 2OBPA 1AOYA 3DKWA 1C0WA 1R23A 3RKYA 2V9VA 4M71A 4B09A 5CVVA 1FSHA 1ZRFA 3E6BA 3FF5A 1FNNA 2UXNA 3GEZA 3M8EA 1HQCA 5ERIA 3WU1B 2HGCA 3DP7A 3QAHA 3MWMA 2GXGA 4G6QA 4N9HA 4HLYA 3TO9A 1QGPA 1HSTA 2CGPA 4AIHA 2FSWA 4HBLA 2RGVA 1TNSA 2UXXA 1PUEE 4P96A 3KEQA 2XAJA 1MGTA 2M30A 2LNBA 2NNYA 2QQAA 2QM3A 4A6EA 3CLOA 1Z7UA 3E6DA 1LJ9A 1YG2A 1ON2A 3LA2A 2HQRA 3L00A 1DUXC 2F2EA 4ZH4F 2VT3A 4EM2A 3ZPLA 1JE8A 5D4SA 1LEAA 5ED4A 1S6LA 4E70A 6PAXA 4I98B 2IA2A 4BAYA 3RDIA 1G3YA 1HBXG 4L9TA 3K0LA 4DNCA 2EA2A 4RB2C 3QP6A 1P2FA 1XB4A 1J59A 2ZMEB 1KYWA 2EFPA 2EWNA 3LA3A 2MH9A 2M45A 5HOOA 2PFBA 4XBFA 3ULQB 2YU3A 4GYGA 4PCQA 4EJOA 3ISPA 1H9GA 3WTXC 2XVCA 2FMYA 5HS9A 3H3ZA 2FMLA 2DTRA 2XAHA 3U1DA 3N97A 5BPDA 4XRFA 4MNUA 5HVQC 3K9TA 3T5XA 1XSVA 3MZYA 4LJZF 1B9NA 4YG2F 1U78A 3U2RA 2DT5A 2MRIA 1IN6A 3SFZA 4CDGA 3BJOA 4MQVA 4UVBA 2W85A 3F8BA 4BHPA 1IN5A 2QWWA 3FMQA 2M8EA 5IT9K 2M87A 5H6QA 4DQ2A 4Y13A 2VN2A 4ENMA 3GX4X 3QOPA 3KEOA 2X4HA 5DYMA 2O0YA 2V1UA 4EJWA 3V7CA 4ENNA 2FBIA 3V4GA 3LFKA 3P9IA 3KCCA 1L0OC 5D5XB 3GF2A 2L3DA 2W24A 2HDCA 1S29A 4G6DA 1I1SA 2PMUA 2XKPA 2QQBA 1J5YA 1DP7P 5FLXZ 3BY6A 1LDKB 4MGRA 4MEYF 3EYYA 1XDUA 5K1YA 3V8KA 5KVRA 3IKTA 1U5TA 4LGWA 4I09A 3FXUA 2HR3A 3GFMA 1T6SA 3RPQA 2BGCA 2XRNA 1BIAA 3S2WA 1T39A 2Z9OA 2CQKA 2VE9A 4KA4A 4OIOF 4WF2A 3U9GA 4O6JA 3TKYA 2BEOA 1PP8F 3I71A 1BN5A 4CO8A 4YIIA 4ASNA 4Y17A 4HX4A 3Q5FA 4WXHA 3IWFA 4MTDA 3ZMTA 2A69F 1Z91A 3W6JB 3MZHA 3JSOA 2GIVA 1I1GA 2IVMA 2PLYA 2ISZA 4KN7X 1FP1D 1FLIA 2QQ9A 3KP3A 2RN7A 1JHHA 2FRHA 5HLHA 4L18B 2LF8A 4LMYA 1Z05A 2P6TA 3HIFA 2FA5A 3WTWC 2Z99A 3DFGA 4RB1A 1BI2A 1VTNC 2VT2A 5F6FA 4KICA 1ULYA 2ELHA 4BQAA 1KU2A 2W57A 5LHHA 3WGIA 3ZMVA 2F5FA 1SD7A 1IRGA 5CVRA 4MTEA 2FOKA 3RTRA 3F8MA 4A5NA 2RV8A 2ESHA 4L5IA 5E1XA 3RYPA 4ZYDA 3ECHA 1TBXA 4HX7A 1T98A 4F7ZA 2EB7A 3VODA 2GZWA 1SFXA 1T2KA 4PGHA 2X0LA 1ZG3A 3NRVA 3DPTA 1UFMA 3ELKA 1G3TA 2HKOA 1XCVA 5LLQA 4HF1A 1OR7A 3GW2A 4RGXA 3WGHA 1T0FA 2XAQA 4JK1X 5BMZA 1OKRA 3CUQA 2ZNZA 3E5UA 3FXQA 3PFIA 3I4PA 1V3FA 3RI4A 4AWXB 4ZYEA 2E1NA 1HW2A 2PQ8A 2Q2EA 2OD5A 4XLPF 1GXPA 4IRGA 5FLXK 1I6XA 2IT0A 1HKTA 4LCTA 3ABUA 3R0AA 1FYLA 5ICGA 1ZAOA 4Z2YA 3TOBA 1U5TB 2R7FA 3TDZC 1S7AA 2P5LC 2NRAC 2F5CA 3ZMUA 4WWCA 2G9WA 2KRFA 1V4RA 5JHUA 4ZYHA 2A6HF 2FBKA 4KIBA 1SMYF 3DF8A 1BIBA 5L3DA 1STZA 2DK8A 4U7BA 5E18F 2VOOA 1LEBA 3WE2A 3MFKA 4IVNA 2H6CA 1W5TA 3B02A 2CG4A 4EM1A 5L3CA 3MAJA 1AWCA 1P4AA 2O8XA 2L02A 3FMSA 4P5OA 2WTEA 3DQVC 3TO7A 4S05A 4L0ZB 2Q0OA 5LEJA 1ZREA 3KZYA 3TXNA 4HX8A 2VC0A 1TTYA 1FWZA 4UXNA 4WK8F 1IUYA 4ZZLA 4EM0B 3OV8A 1IN4A 5E1WA 5D5VB 3H92A 3R60A 1RI7A 1K78A 3F8NA 3D0SA 1TQMA 4RAYA 2D2WA 1ON1A 1LNWA 3SXYA 3WTTC 2NAZA 3EUHA 2DAOA 4JBAA 4OIPF 1YYVA 2CWEA 2HZTA 1QZZA 5EEHA 4G7ZF 1F5TA 2HYFA 1HW5A 4ENKA 4EVIA 2QBYA 3LA7A 5E20A 2HQNA 3BJAA 5ILVA 1XCBA 3SQNA 2DI3A 3I64A 3MQ0A 2W25A 2E7XA 2EV6A 1IRFA 3M9AA 1WI9A 2F5DA 4IPAA 1BC7C 1KYZA 1Z6RA 3RPUA 1WQ2A 3HSFA 3IRQA 3J80Z 3V7RA 4U0WA 2K02A 4A0YA 2D45A 4IJAA 1R00A 4HF2A 4RGSA 2MBFA 3R4KA 1O3QA 1R1VA 2YPRA 4LLLA 4NQWA 5DV5A 1TQPA 3ZMDA 1W4MA 3E97A 2ZBKA 3DPLC 2VC1A 1EV7A 5LGNA 2V79A 4HAMA 5ILSA 4GXOA 2ZJ2A 2KIMA 1ZLKA 4RGUA 1UCRA 1R1UA 1BC8C 3J81Z 4M73A 3I5UA 2L4AA 2VBZA 2NS0A 1LVAA 2PBIA 2MC3A 1U8RA 3C3WA 4I01A 1BI0A 3ZN0A 3FM5A 3VOEA 3MEXA 5BQTA 3FZVA 4KMUX 4KUMA 4BHBA 1IXCA 2HFHA 3E5QA 1Q1HA 2JPCA 3E5XA 3EYIA 5J6XA 4ETSA 5KK1A 3WG9A 1ZG1A 2XAFA 2JRTA 3KFWX 1QBJA 4BYYA 5D6EA 4BHCA 3KLOA 2FQ3A 5HLIA 2JZYA 1P4XA 2GA1A 1J2XA 3ERED 3H3UA 3JTGA 3C18A 5LRRA 4P9FA 4UV8A 5CJ9A 2PG4A 1MJ9A 1ZGAA 3V7SA 2WWYA 2QLZA 2LDUA 1KQ8A 5JFRA 4HZFA 4UVAA 2VBWA 2DK5A 3QU6A 4U88A 4AVPA 5CVJA 2QBYB 5AIPA 1IAWA 2OA4A 3F21A 4KIFA 2IA0A 2L01A 4LD5A 1MJAA 2A61A 3RJPA 1IN7A 1HKSA 4S04A 2RKHA 2IA1A 2J5PA 5F64A 3J80K 2BV6A 2D1HA 2HKXA 2B0LA 2DBBA 1U3EM 1REPC 3RKXA 4QWQA 2K4JA 2RNJA 3E6MA 1R58A 2M5WA 5FB2A 3LQQA 2CFXA 3BJ6A 2GXBA 4B8XA 1TW2A 1SAXA 5DD4A 3SZPA 1KA8A 4TV7A 3CDHA 3KP5A 1D3YA 2A68F 1IZ1A 5LHGA 3HTUA 4M6XA 1IW7F 4OIQF 4YFXF 1KU7A 1YW9A 5D4RA 1G3WA 2WC2A 2EJRA 1ZRDA 2V6CA 5BOXA 5DD8A 5LRSA 1O3RA 2Z5UA 2JPBA 2IPQX 1YIOA 3WTSC 3O3KA 5K5QA 3T0YA 4CYDA 3GUDA 5ICFA 1FYKA 4KIGA 3BOQA 1SD4A 1MDMA 3CO7C 4EJVA 4YFNF 3ABTA 3CO6C 3J81K 3EDPA 3I53A 3AAFA 4D0PA 1BM9A 1R36A 2K27A 1GHCA 1F4KA 4CZZA 3WTVC 3TXMA 3PQJA 1D5VA 3EETA 4CGZA 1B1BA 1TNTA 2ZO4A 1CF7A 3RKWA 2A5YB 5DDGA 1RUNA 2W84A 1ZRCA 3I0TA 4L9NA 4LK1F 1FYMA 3TDUC 1EH6A 3FXRA 2OZ6A 3WU0A 2O6GE 1O3SA 1ODDA 1YTYA 1D8JA 5D8KB 4MHGA 2P6SA 5JI6A 2Q8KA 3BPXA 3F72A 3R0JA 1FPQA 2RVCA 4L0YB 3O6BB 1BOAA 4IRHA 1LDDA 4BNCA 1KU9A 5BS6A 2STWA 3GXOA 5TJJA 4Q47A 2H09A 1U6GA 2EFWA 3ROUA 4KNYA 2AS5F 1S3JA 4OMZA 2H94A 1SFEA 1FX7A 2A6EF 1X3UA 4FX0A 4CXFA 4M9XA 1R1TA 2QYOA 5LGUA 4CHUA 3WE3A 3EQLF 3G73A 4LG0A 4OIRF 3N4MA 2VBYA 3ZQ7A 2ZFWA 5CYVA 1P6RA 2FU4A 1ZHFA 4FT8A 1DPRA 5IT3A 2QENA 2J5OA 1XSXA 3HSRA 1SD6A 1E2XA 3ECOA 4I0BA 3WODF 4RS8A 4G7OF 1B9MA 2LF7A 1F9NA 2KKOA 3FX3A 4KYWA 2KIUA 5LEKA 2GWRA 5CVUA 1MJBA 2DPDA 4YIFA 2VONA 2K4BA 2P7VB 2VOPA 1YFHA 1HSJA 2TDXA 3LQRA 2V1XA 2L4MA 2FF4A 3P9CA 1OPCA 2PJPA 4R1HA 1FBSA 3V8LA 2K7LA 3LSTA 5FD6A 5D6FA 2NYXA 2K86A 2DPUA 1P92A 4KMFA 1G6NA 3JW4A 2QVOA 2IRFG 4EV0A 3C7JA 4OINF 2P7CB 4I2OA 2CYYA 5AIQA 4KFCA 2HTJA 5A2QZ 1MDMB 2ZCWA 3SHFA 4RB3C 3WTUC 4KN4X 3F22A 1MKMA 1BI3A 2VODA 3F23A 3HRSA 1KQ9A 4LB6B 2FEZA 1PDNC 2Y0MA 1QNTA 1XGSA 4MEXF 1CF7B 4O5VA 1U5TC 2ESNA 5D5UB 1T38A 5LGTA 1LDJA 4I02A 2CSOA 4HV5A 4L9VA 4IHTA 4R79A 3R61A 4AIJA 3M8FA 3I58A 1EH8A 1YQAA 4A2UA 3L7WA 4HQEA 1FBUA 2VE8A 3HRMA 2COMA 1R22A 2G7UA 1Z1DA 4HV6A 3L9FA 1XGNA 5HDGA 2DFIA 2Y48A 4YFKF 4ZYGA 3F8FA 3Q9VA 4FHTA 1ZG5A 5F1RA 5E8GA 5DCMA 3M7GA 5L3BA 1YLFA 4G8XA 3B73A 4EGZA 3QRFF 4A0XA 3Q9SA 2Y75A 5LHIA 1FY7A 2UWMA 4L9JA 3FHZA 1ZLJA 3KE2A 4KT5C 2FXAA 4EQQA 1QQIA 1GXQA 1XGMA 3BPVA 1W7PD 3JCKC 1SMTA 2JSCA 1FC3A 2XASA 2IW5A 1PP7U 1R5GA 1J0RA 4IXAA 3PQKA 1SFUA 4ENJA 3F8CA 2AXLA 2IP2A 2MH2A 2KJCA 5AONA 2OZUA 4M6YA 2PI0A 1ZYRF 4PZJA 4A0ZA 2LSOA 2ZKZA 1B6AA 1O3TA 4JQFA 3HOTA 1YS7A 1BJAA 2ISYA 1XGOA 4UUVA 1A04A 5FFXA 3CUQB 5J8CA 2EV5A 1F1ZA 2XKOA 3LAJA 3TO6A 1WWXA 2BBYA 2HYGD 5A2QK 4HW0A 1W7PA 2DQRA 1K6OA 4AIKA 1HW1A 4M9SA 5L3FA 4GYIA 2GAUA 3K69A 1WSUA 2BYVE 1DDNA 5CLSA 5D5WB 5FO5A 1Z6TA
chains in the Genus database with same CATH superfamily
2CJJA 4Q5SF 3CKCA 1H6PA 1R7JA 1JGSA 1R5HA 3KLNA 5JVGF 1VQLI 1H6KA 2DZNA 3MKYB 2A3SA 1QRYA 3CP8A 3D5SC 1IDZA 2M63A 3FTSA 4FHJA 2GA2A 2Z33A 1U9OA 3HXLA 3KP2A 4GGGA 1K7AA 3QC1A 3VYTB 2RDPA 1OXJA 3ZN1A 4A3BJ 2IO2C 3UI2A 4PDXA 2IJLA 4BEPA 4HOUA 4FC8A 1APLC 2FBNA 1JHFA 4HOBA 4F93B 2WPVA 4TUMA 1N0QA 3OL3A 4I7HA 2DQLA 4GO1A 1KU3A 2RC4A 3E7LA 1FEXA 3CCEI 1MIJA 4LLGF 5CCMA 1A5JA 2VUMJ 3TWWA 4UI9J 3GVAA 3HC7A 5HNFA 2CFZA 2BY1A 1O1TA 5DCFA 5K5OA 3A0BC 2C0LA 2CFUA 1YE9A 1ZTRA 2OQRA 2R02A 1TWAJ 2XRLA 3D1NI 1NA3A 3HOVJ 2P5KA 3BG9A 1HOMA 2GQQA 4BETA 1ZGJA 1ACIA 4BSZB 1X2NA 5HDNA 2VSOE 4LIUA 4WCGA 1JKOC 3QPHA 1TW3A 2YX7A 2A5WA 4LFUA 2P4WA 1TP4A 3HOZJ 2DCPA 3FUDA 3O4ZA 2OV8A 4EBAA 3FWVA 4ESJA 4BQQA 1D1BA 4PJNA 2M0MA 5DUKA 3QPSA 1H9TA 3CC2I 2B9SA 3RYRA 3FH8A 5ANRA 3QPLA 3OYIA 1VQ6I 4E6KG 3I54A 2FX0A 4RLFA 3HSEA 2ELJA 3L08A 4C9BB 2L2OA 2HOEA 2XEEA 3G2VA 3RRUA 3RIRA 2O8KA 4HQMA 1T95A 2CO5A 3K7AJ 2KRCA 3IEGA 2K9MA 1KZPA 1OCPA 1WFXA 3K4JA 4BBRJ 3CCMI 5FLVA 1SQMA 2DLLA 5JA4D 4PUCA 1NTCA 1NK3P 3HOWJ 4BDYA 3QU3A 3REOA 5DCMB 2CG3A 3HEFA 5KAIC 2HS5A 3COAC 2L9BA 4IULA 2E1CA 1S64A 3UIOC 1HF8A 2KMUA 4GB9A 1S0PA 4D9JA 2M0CA 2ZMEC 2JQ7A 4HRIA 1YMPA 3S7FA 3HTSB 1HH8A 2PM7A 1KT1A 1NH3A 3VSKA 3NQPA 2E35A 2P8TA 4MBGA 4BJ5C 1RUOA 2DOAA 4LNUD 4HLXA 1RW2A 2CW0F 4XLHA 1OISA 1YW8A 3P7NA 3I59A 1K78B 2HVSA 1H19A 2XPYA 2OQGA 1WH7A 2I2OA 2DU9A 3HHHA 4YVOA 3BROA 3FM3A 1UZCA 2YR2A 5EYLA 2O7OA 1L3LA 2YSRA 2HWVA 3SZTA 3JR9A 4LNBA 1ETVA 2W1OA 2P2CP 1E8WA 2HM8A 2FBHA 1RKWA 4Q48A 3FHNA 4HNUA 1RRJA 5B1AE 3CVYA 3IKVA 3EUHC 2CS3A 2F4IA 3C3RA 2MLGA 4J8YA 4E7LA 4Z6YA 2DOEA 5FROA 4B93B 4LSZE 3H3VK 5H2FC 2R7TA 1W5SA 3KZIC 4O3MA 3LYAA 3FWEA 1EH7A 4XNFA 1XSDA 2JN6A 2RREA 2DMUA 4W9RA 2O03A 5C2YA 3D9NA 1UJ8A 3LWFA 3DSTA 3BR5A 5K7ZA 2B63J 1JI8A 4HXIA 3OS1A 3BG1B 1KQ0A 3PUFA 4RB0A 2ME0A 4BQNA 2WM9A 2DYRE 5HDKA 5M5WJ 4CA0A 4D5CA 2R3SA 3BG6A 3FBNB 3HHGA 4RBOA 1J75A 2R17C 3HRTA 2OPTA 4L2LA 1WDYA 4ME2A 2ADUA 1ONVA 2W7NA 4GTVA 4OOIA 3ZQQA 3E4BA 1UHMA 1FMVA 3CF5F 2AXVA 1WJ5A 2V4JC 3TOAA 2E1MC 2J4DA 5EX0A 2CV2A 3D5RC 3T8TA 3WG7E 2P9UG 1W5CC 4LB5A 2LKXA 1QNFA 1QQEA 5AAOA 4P9UA 2E2IJ 3HXCA 1OYWA 3ZMZA 1R71A 4F3VA 1OYIA 3L2VA 4A5MA 4G8KA 4PFPA 1F43A 4U95D 5HS7A 5IP9J 4I9CA 2DYSE 3FU0A 4H4KC 3PZ4A 5KNGA 2BY3A 2EQRA 1N95A 1QZ2A 3ZGQA 4IF4A 2PMHA 4UUTA 4WXCA 2IEJA 3CHMA 3R9AB 1NL4A 4APOA 3E3VA 1Z9CA 3DXJF 1Y39A 3PVLA 5J90A 3MCZA 3OYDA 1IXSB 2ACJA 3S1QJ 4NURA 1D5YA 2VPRA 3SI5A 2ZJRF 1HXIA 3HDDA 4XIFA 2FO1E 2JTVA 3UM3A 2LD5A 3ENEA 3KSQA 3IC7A 1J7KA 2GLOA 5CBOA 1ZARA 1MH3A 1VQPI 1W7PB 4BX8A 5FFZA 3TW6A 3FTZA 2E34A 2W00A 3AG1H 2KL4A 3CK9A 3FEYA 5EYPF 4BL0B 4A3LJ 1MNMC 3I5PA 3ML9A 3S15J 2JA8J 4BXUA 4GA1A 2VYIA 4ABZA 4ESBA 3GMEA 3HRUA 5ICCA 2IS1A 1UAAA 2BY0A 4QIWN 1WJAA 1XN7A 4AC0A 3D9KA 2VQGA 3G1MA 1KGSA 2WXOA 4YRVA 2OTJI 4XLNF 1P7IA 1ITYA 1MZBA 2LFBA 3SO8A 4V19K 2CUEA 2VKHA 3OL4A 4DZPA 4H0EA 1A6IA 4NB5A 5J8FA 2KQRA 1VQ5I 3ASNE 2QSFX 4AU7A 1SC7A 2LXMA 4UWKA 2QUFA 2BE5F 1BR1A 4IRUA 3TWSA 1E3PA 3NF1A 1MHQA 2COBA 5EEAA 5KCMA 3IL2A 4JOMA 4BBSJ 1H6OA 3MX3A 2I6HA 3SY2A 4ESFA 4I1AA 1LQ1A 4C3JJ 2YHEA 1G3SA 4PUSA 4N5QA 1U0JA 3EUKL 4HDVA 4C0MA 2I1KA 3OR2C 3LAPA 4G7HF 3UXGA 3GO5A 5B1BE 2HTSA 3CCJI 2A07F 2PL2A 3UT4A 4DX7D 5B3SH 2OCCE 4RAGA 2ZFUA 3WTZA 2V4LA 1JXSA 3HOSA 4CT4A 4RLYA 3C1DA 1BR4A 2M1BA 3G3ZA 5E1ZB 5TRDA 1O7FA 2BXZA 2HEOA 1S9HA 2V1DA 3T1BA 3DPYA 1R6RA 2QCOA 4G1TA 4JC8A 2FD5A 4KJZA 4C0EA 5CBNA 4XSXF 2RQPA 5BXOA 2DO7A 4XOPA 4DBRA 2WXKA 3L2CA 4XRSA 3GBGA 3FXLA 5H6RA 2DBAA 4XX5A 3I9V2 3JAMZ 3CVWA 1PUFB 2XV4S 2ID6A 4FP7A 3BUAA 1CGPA 2IGKA 4X6AJ 1USTA 2L7ZA 3OOPA 3AG3E 4XONA 3CCVI 3B7TA 4OVVA 2LXLA 4L5JA 3ZMSA 3QB2A 5HODA 2L54A 2LR8A 5BT1A 2KLOA 2ZXJA 4Y4RA 3DKXA 3BP8A 2OUMA 2VI6A 4EJUA 1RR7A 4AD9A 2VKEA 3DWLE 2AQFA 3O8GA 3OIQA 4AYBA 2G7HA 5ILUA 1IHGA 2ETCA 3ONLA 4OWRB 5BV1A 5BW8C 4M74A 1UOHA 3B95A 4CICA 2IJGX 2MA3A 4FASD 2RAEA 1W1WE 4XORA 3GTJJ 1B59A 2L7FP 3WTYC 5LBQA 5FQ8A 4HYEA 1U8BA 5AYWD 2XIGA 1YO5C 2D1VA 4U8HA 4U0YA 1D9SA 1I5ZA 2W82A 3FMRA 3FUEA 2LG4A 2HYJA 4EECA 4ZYAA 1QZYA 3DTEA 4PDKA 4AVZA 4XOTA 4C2MJ 1TJCA 2KCKA 3G2UA 2ETBA 2LP0A 3QAQA 2H27A 3QWPA 1JPLA 2LREA 4U63A 5FGMA 2DW4A 4QPQA 3Q7AA 4XZ4A 1ETYA 3I59B 3LJNA 1USSA 4A1SA 3LVRE 1SFKA 5FJYA 5ENPD 3GFJA 2VKVA 4OAYA 5DUIA 1RIOH 2XS8A 3S7DA 5FD5A 2K40A 5D0QD 3D5LA 1RZ4A 1TQIA 4LK0F 2KDZA 1OMIA 1I27A 5F1JA 4WX9A 1G4DA 1WHUA 3CDIA 3APCA 5JR3A 3T5VA 2HZDA 1HCRA 1MBFA 3JRCA 2OEVA 4KDPA 3DSVA 3ESWB 2HOAA 1GVJA 3VB2A 4MQ9F 4BXFA 4HI8A 3TAXA 2CFOA 3V8JA 5EEGA 3GLXA 4YIRX 4OMYA 4I17A 2Z3YA 2GW1A 1ERDA 4NDLA 2WB1A 1IRXA 1ZH5A 2BEDA 2MC4A 3NEUA 4UHTA 2LO6A 5E76A 5AENA 4W97A 2ECCA 2XGXA 3VFZA 4HVBA 2VSXE 3BU8A 3VLEA 2UZKA 4BQOA 2QZAA 1DQUA 1BPOA 3ABMH 4AXHA 2LY2A 4GU5A 5EDSA 2ZXIA 3AS4A 3CJNA 1HC8A 3OSFA 4K2EA 5HS8A 1P4WA 2H6BA 1AU7A 4CZCA 4FX4A 2KM4A 3ASGA 2PN6A 1YW7A 2VXZA 5IP7J 4IHSA 2VTBA 3BG5A 4RGRA 4TXRA 2FNPA 2VQ2A 3GZSA 3M4OJ 2K9QA 3M1EA 4HS2A 1O57A 1E17A 2VBXA 2R7DA 4BTBA 4HF0A 3GTLJ 5FJ8J 3AL0B 5GTHC 4BH9A 3GFIA 4ATGA 1B72A 2GRQB 3X2QH 2Y1LE 2H1LA 4OVUA 5DIZA 4G12A 1HF0A 1XTAA 4I1MA 3UNGC 5EIDA 4XKVA 1BI1A 3PIPF 1U2WA 5FRNA 3DV8A 4Q94A 4BX9A 2WBMA 1FSEA 5IP6A 1S7OA 1L5JA 1EKEA 1H0MA 1XGWA 3BWGA 2HOSA 4U8YD 1XG1A 3J7AO 2O61A 5ENSD 3HL2A 1Y0UA 3GZ1A 2LBFA 1TR4A 3IH4A 1BBYA 2EIKH 2XUBA 3MV3B 2MW8A 4EMSA 3PFYA 3V42A 1WKMA 2VKDA 3OR1C 3BQZA 4E7KA 3K2ZA 3S7JA 3CJRB 1E8ZA 4I0AA 3QJZA 3RRMB 1O7LA 3S1MJ 4A93J 4JX4A 3ZQGA 1IF1A 2Y30A 2VASA 2FO7A 4BT9A 3KP4A 5JVTA 4NHJA 4UWHA 1TZLA 3K1NA 4HI9A 1DU6A 4WXDA 2KZTA 4G23A 1Y1VJ 1FOKA 3PS6A 2NNNA 3ML6A 5F0HA 1OYYA 4LLNA 4A3JJ 2L0IA 5FKMA 4F1PA 5CVIA 3JTHA 4IRIA 1S8NA 2E7WA 2XROA 2M3AA 2EV0A 2ETHA 3ESKA 1FP2A 2E60A 3IHUA 2VJ8A 2X6HA 3MKQA 3ZRHA 2KATA 2P5VA 3S1RJ 3SZGA 2DA4A 3CK7A 1XDSA 3J5PA 2EK5A 3GCMA 3VYSB 3CMAI 4A12A 4R8HA 1HFAA 2P58C 1WJEA 2A6TA 2QKMB 3KZZA 1IRZA 3SFIA 2EQXA 1INZA 5T4YA 2C6YA 3LSKA 1WAO1 3UT7A 5BV0A 5GADJ 2E19A 2WV0A 1DC2A 2LKPA 5L3GA 3CQCB 3W6KB 1V55H 4UWFA 3R9MA 4OAZA 4EZLA 3IRRA 2NVTJ 2DJIA 1HDPA 3FTWA 5CHEE 2MD5A 3B6AA 2JVGA 1ZN2A 4RLQA 2XGSA 3EIJA 5HLGA 1UB9A 3QPTA 3IUOA 1YS6A 3F0CA 3KP6A 4HA8A 3ZQLA 2JEKA 3ZP5A 2O3FA 2CQQA 4PFOA 4KVMA 4U7DA 4HOSA 1G8XA 2EFNA 3JSPA 2JLBA 1N77A 3ZHEA 4M72A 2FE3A 2JT1A 3GZ5A 3PNTA 3B7RL 4UV9A 5EJCA 3C2HA 2PQNA 2EFQA 3H0GJ 3W3CA 3JAMK 4M9ZA 3E6CC 5CRVA 2CMPA 5EZGA 4Q4ZF 1IO2A 5ICEA 4A3CJ 4HNTA 3W2WA 3HZJA 3HM5A 3D9HA 3BR0A 3D3MA 3T8RA 4A6DA 5CCLA 4FHKA 4BWRA 4GCVA 3P9KA 5FKKA 3CVLA 1KONA 3RRNB 5T8IA 3S14J 4ZZDA 4P55A 1UHSA 2OV7A 4G9YA 4KMOA 2F4MB 4N9IA 1TLHB 3A1YA 4NNJA 2NOJB 2ZNYA 3TEDA 3ZYKA 5K5RA 2KHMA 5FZQA 3TQNA 1LFPA 1WZ2A 2L7MP 4G94A 4PGGA 3D9JA 3CV0A 4X0GA 3QOUA 5M5XJ 3HUGA 2PMZN 4JYKA 5AJLA 1YX3A 1QO0D 3GWZA 5E3NA 2KIFA 1GT0C 1YA0A 1H2TC 2OAZA 1WCMJ 4RAFA 1IN8A 2ZGGA 3L16A 4WNGA 3KS2A 4F7AA 3KP7A 1W0TA 3ZYLA 3J5QB 3F3XA 4EJTA 4D10C 4J8DA 2WXPA 3JXJA 3TWTA 1Y56A 1IXVA 4DGWB 1SZ9A 3ASFA 3RCOA 1JCRA 2XAGA 1X58A 3NQOA 3DEUA 2QY7A 1XMAA 2YX4A 1YJNI 5E3LA 4KZ0A 2X51A 3UX4A 3F6VA 5FTPA 4JP0A 4J01A 4BE1A 3APDA 5HS0A 4U0VA 4Y15A 1QPMA 3RQ4A 2DMPA 2EFOA 3HYIA 3RPUD 4LG0B 3FY4A 4I2WA 1DGWY 1SD5A 4UNOA 5G04J 3CVPA 3DSWA 1HXDA 2MYOA 1X1PA 1MJ0A 2WXRA 3L2RA 3FUKA 4KBQA 2ZMEA 5FKLA 5JHAA 2MYSA 4EGYA 1LUJB 3GYHX 3TGNA 4HDUA 1MD0A 2QQ8A 2CHXA 2F8XK 3BR6A 3K1PA 4OU0A 3GZ6A 4HLLA 3LSJA 2BW3A 3FK7A 4UVCA 3J7AY 2AXUA 5FKNA 3MA5A 5G05C 5EIBE 1D1AA 2FNAA 3CJTB 3BG3A 1LKXA 3DKYA 3JRBA 2STTA 4XLCA 5DEQA 4I6ZA 1FBQA 1MNEA 3MGBA 5FQ6A 1NHAA 4A3FJ 1OCCH 3E33A 1HKQA 1WRJA 3Q7FA 4L1BA 4YNDA 1XMKA 1N78A 2NVUB 2MLKA 3MMYB 4HRLA 3NBNB 5E8IA 3OYCA 3QP5A 3TBIA 1SFOJ 3K4CA 2HOTA 3A01A 1IXRC 2HR2A 2Q7FA 3U9WA 3BZ6A 3IWZA 2Z1DA 1N0RA 4JZYA 3A4CA 3APFA 3FULA 2QZ8A 3W9FA 1X3ZB 5D8LB 2XGEA 4ZFHA 4TXQA 1FJLA 4DK5A 2QFCA 4KZCA 2HQ5A 5J4YA 1UHWA 1SVOA 5F0CA 2HDDA 3F6OA 1B72B 1RNLA 5BPIA 1N4PA 3U3WA 5H20A 4N0BA 4LUNU 2XC7A 2AWIA 3HPGA 5ENTD 1FZPB 2QYJA 3HXFA 3CUOA 3CTAA 4C9YA 3KETA 1IV8A 2EA4A 3LY7A 2R93J 3PNLB 3VEPA 4CEMA 5J08A 4AY6A 3ASDA 1LB2A 1UG0A 3ASOH 5L3EA 5CEDB 4CH7A 2Y69H 3R6SA 2J09A 4UQZA 4QLCU 2X6OA 3Q49B 3Q79A 2OC6A 4DX2A 3O2PE 1J9IA 3SQVA 1XD7A 3S3MA 2HXOA 4R7LA 2LBFB 4XE0A 1CQTA 5B1AH 3L2UA 4EZKA 4HLEA 2QYUA 2X48A 1OWLA 3LMMA 4ON0A 1FT9A 1OCOE 3S2AA 4X8QA 3GFLA 4RAZA 3DXMG 1QYMA 4JPSA 5FWQA 4NC8A 3CMEI 2F5EA 1OR7C 3L09A 2PEXA 2ZISA 3H9QA 3LNQA 1K79A 1T0FC 5IT9Z 1B4AA 1YI2I 5E17F 1FIAA 2OU2A 2KJBA 4II2A 4XSZF 2XHKA 2KZTB 2MABA 1RR8C 1X2MA 3VTYA 3K1MA 3D9LA 4DLOA 1DPUA 3BDDA 2H6GA 1D8KA 3CUQC 3WGGA 3OYKA 4DUIA 2OBPA 2R5ZA 2Z16A 1Y1WJ 1EJ9A 1AOYA 4B94A 3DKWA 1C0WA 5EYRA 1R23A 3CQZJ 4HOTA 1X1BA 2WAQA 3RKYA 1JJ6C 1SA4A 2ZU6B 2V9VA 4M71A 4B09A 1Z77A 5CVVA 3PNVA 4IEJA 1FSHA 2YQ8A 2EBIA 3HKZA 1ZRFA 3E6BA 2B0OE 3FF5A 3FUHA 1LD8A 1FNNA 2UXNA 2IQCA 3GEZA 2ETAA 4CCLA 3LXUX 3M8EA 4C30A 2LYCA 1HQCA 2IGOA 5ERIA 2X85A 3BEEA 3OXFA 4F3QA 4YDOA 3OXGA 4CYCA 2OOEA 1LPQA 3W9GA 3WU1B 3ZU7B 4QSHA 2HGCA 2DCEA 3OSGA 3DP7A 4EPZA 4L2YA 3QAHA 1ORKA 1E90A 4GTPA 1FTTA 1JCQA 3MWMA 1BLXB 3HXDA 2GXGA 3M07A 4G6QA 4N9HA 4HLYA 3VWBA 2BF0X 3CHSA 2R7RA 3KSLA 3TO9A 3ULYA 1QGPA 1HSTA 2X1EA 2CGPA 2L6JA 3LY9A 2FSWA 4AIHA 2XZTG 2WXMA 5HRYA 5LX8A 4HBLA 2RGVA 4F6RD 5CMWA 3H5AA 4YELA 5J4VA 1TNSA 1UN9A 2JABA 1KZOA 2UXXA 5FINA 1PUEE 1RKTA 4MFEA 4P96A 2J08A 2R5YA 3KEQA 2KIQA 5DM6F 3OYHA 2XAJA 4B1RA 1NG6A 5GP9A 3B7BA 3P1UA 1MGTA 2M30A 2LNBA 5DTDA 2DMTA 4K5BA 3MKLA 1X5BA 2FQ4A 2NNYA 1TWCJ 2JUGA 2QQAA 2E2HJ 2P9PG 2QM3A 4A6EA 3CLOA 4UQXA 5T3RA 1Z7UA 3L6AA 3R7QA 2JA7J 2VL8A 3E6DA 3SDGA 2RQQA 3M8JA 4AP2A 4M3EA 5KNHD 1LJ9A 3MKWB 3D9MA 3EHNA 4ILHB 1UW4B 1LD7A 4BT8A 2WQ6A 3ONQA 4XLEA 4ANXA 1YG2A 3JREA 2PX9A 2EIMH 2JUCA 2NVYJ 1ON2A 1Z3YA 3FUIA 3LA2A 2HQRA 3L00A 2P9SG 5ENRD 1DUXC 3HUGB 4DX1A 1DNPA 2F2EA 4ZH4F 2VT3A 2DA7A 1N11A 4HNAD 3URZA 2EH3A 2MFZA 4EM2A 4AM3A 3UMVA 2BKGA 3LJ3A 1YOVB 2IGMA 2QSHX 3ZPLA 4ZDLA 1IKND 3E0JB 3PE3A 1BW6A 4N2QA 1JE8A 2LAHA 2IONA 1QHHD 1LEAA 3KPHA 2OCCH 3SYTA 5D4SA 4BU2A 5ED4A 3VTXA 1S6LA 4E70A 2R0QC 1JJ8C 6PAXA 4I98B 2IA2A 4EZJA 4KITB 4BAYA 3K6GA 3U1KA 5TGTA 1TT0A 2EZKA 2CH0A 3RDIA 1G3YA 3LKUA 3RKVA 1HBXG 2BHZA 4L9TA 3K0LA 4DNCA 2EA2A 1UELB 2F5VA 2XDVA 4GRIA 3QNKA 4RB2C 4O1PA 3TWVA 3CJQB 2M9HA 3QP6A 3CP2A 4F55A 4RMNA 3D9OA 1P2FA 1XB4A 2CHZA 1J59A 1S70B 2ZMEB 1KYWA 2V6EA 2GRNB 2EFPA 2EWNA 2OCEA 1SVLA 3AG3H 3LA3A 2MH9A 3M1CA 1E0EA 3ZQCA 1JUPA 2QSGX 2GOXB 2M45A 3A2KA 5HOOA 3H35A 2M7BA 1YCSB 4JEUA 2ZXWE 5FT9A 3OYNA 3DBSA 2PFBA 4ZTFA 5JLXA 1BD8A 3MN2A 3ABKE 1JUSA 4UQYA 1K1AA 4XBFA 4G2VA 4Q96A 4U96D 3OYFA 1S63A 3ULQB 3FDHA 2YU3A 1IUFA 3I4MJ 4GYGA 2X38A 4PCQA 3RO3A 4AIFA 4HRNA 3ZN3A 4EJOA 3I4RB 2LNIA 3TGOA 3FUNA 3ISPA 1H9GA 3WTXC 3PNYA 3KD7A 2EIJH 3H1CA 3CIAA 1OCRE 4A55A 1N54A 2XVCA 5EZHA 2YNQA 2FMYA 5HS9A 3DU5A 3H3ZA 3LSMA 2FMLA 1Z67A 2DTRA 2O9LA 4GYOA 3ZKJA 2XAHA 3U1DA 3N97A 5BPDA 3C5RA 3MCXA 2DDBA 3M3YJ 1R4NB 4XRFA 4MNUA 4BY7J 5H7PA 5HVQC 3U66A 3K9TA 5E79C 3OAWA 2XSJC 4PJLA 5LFAA 3T5XA 1XSVA 2VLAA 1SVMA 3MZYA 3KYDB 1O1RA 1X4PA 4LJZF 3JRAA 1TNUA 2VSYA 3H5NA 3Q9NC 4GMRA 2PQRA 1TNBA 3PZ1A 1B9NA 4YG2F 1U78A 4KT6A 3EJNA 4DPRA 4UUCA 3U2RA 5IYDJ 2XHEA 2DT5A 2MRIA 1KPSB 1IN6A 3SFZA 4CDGA 3BJOA 4IOAF 3AG2E 3ESLA 2HI3A 4MQVA 3AKZA 4PH4B 1HDDC 1GV5A 4UVBA 5BNWA 2E36A 2W85A 3F8BA 3LFUA 2GOMA 4E7HA 2XGOA 4BHPA 1OLTA 2LC2A 5C4JJ 4A63B 2GRPB 1IN5A 2QWWA 4LITA 3CCSI 3L2WA 2IFUA 3FMQA 5FLMJ 5JMND 2M8EA 5IT9K 3K4BA 2E0IA 2M87A 2QEXI 3FXOA 2B6CA 1OCZH 3H36A 5KJNA 3CCYA 4RM3A 5H6QA 2ZXHA 1SA5A 3LVQE 3B6CA 5M3FJ 1I39A 4DQ2A 4BUPA 1MMDA 4Y13A 3CQGB 4N39A 3VSLA 5IY5H 2VN2A 4ENMA 3O48A 3W2VA 2R5ZB 2D5VA 3TWXA 3TL4X 3GX4X 2XZDG 3QOPA 3KEOA 2X4HA 4HORA 4BEHA 5DYMA 4CCOA 3JRIA 1ZGWA 3ZIMA 2O0YA 5CRUA 1X1CA 2K3PA 2V1UA 4EJWA 3V7CA 5GAGJ 4ENNA 4RM2A 1EA3A 2FBIA 3ML8A 4NBQA 1B89A 2BZTA 3GLLA 1BA5A 3V4GA 3LFKA 4JHJA 3RK6A 2HXIA 2KRHA 4CDNA 2VQCA 3P9IA 3KCCA 4Q69A 4GZCA 5ARFA 3H9JA 1W0UA 3VDXA 1L0OC 2RD0A 5D5XB 4CYCB 3U21A 3GF2A 1HU3A 1VQNI 1JUMA 2L3DA 2F37A 2F8YA 1VQ7I 3HB9A 3BC8A 2CQ7A 1TJFA 2FJ1A 2W24A 1ETQA 2RKKA 3CDLA 2HDCA 1S29A 4FISA 4G6DA 1I1SA 2X6XA 4GTMA 1Z5SC 3EPZA 3GTKJ 2X6WA 4CYMD 3OOUA 5F08A 1D0YA 2OVFA 3S2DJ 2PMUA 3UINC 2CG2A 2XKPA 5CMYA 2QF7A 1GW6A 2QQBA 1ZELA 1HG5A 1HE8A 4JW1A 1ELRA 2XPIA 1J5YA 1UMQA 3IH2A 1DP7P 3NZUA 3ONKA 3Q4AB 2R5YB 3PSIA 4PK4A 2JRMA 5FLXZ 1K61A 3S2HJ 1TEZA 2L9VA 4GAAA 2X6YA 1OCTC 3QWVA 5BPPA 2NVQJ 3BY6A 1LDKB 4MGRA 3OY9A 1JTYA 4MEYF 2KXPC 3ISMC 3DLLF 3MYVA 2X9DA 4U87A 5EILA 3EYYA 1XDUA 1ELWA 1TN7A 5K1YA 4E85A 3V8KA 5KVRA 2BUGA 3EU5A 3IKTA 1U5TA 2WXIA 4JA9A 1ZR4A 4LGWA 4Y6CA 1Z21A 4I09A 2V8SE 3FXUA 1H2UA 2HR3A 1VFCA 3QYEA 4II3A 4Y3OA 3GFMA 1G59A 3IH3A 1VQ4I 4Y52J 4UWLA 1T6SA 3RPQA 3I56I 2R2LA 4IQJA 2BGCA 2O5RA 4DZJA 4MO7A 2AJAA 1XPXA 2KDOA 2XRNA 1BIAA 5GTIC 4U07A 4J7WA 1D0XA 3S2WA 1T39A 2Z9OA 2CQKA 4ZDPA 3MEKA 2EILE 2VE9A 4KA4A 3SF4A 4OIOF 2MOWA 4PJJA 4WF2A 2DDAA 4FLHA 2HE0A 2BKKB 3EIQC 3U9GA 2R4GA 3AU4A 4O6JA 4U7EB 3TKYA 2BEOA 2ZB9A 5CECB 1PP8F 4WWNA 3I71A 1BN5A 4CO8A 4YIIA 3TW7A 4ASNA 4Y17A 3CHRA 4YDYA 4HX4A 3Q5FA 4F53A 4WXHA 3MKZA 3IV0A 3ZFWA 4AYBN 1U9NA 3IWFA 3CVXA 1J09A 4MTDA 2ZGDA 3I3LA 5G05J 3ZMTA 2A69F 4ANVA 3RO2A 1Z91A 1WJBA 3K4NA 3W6JB 5GAEJ 3MZHA 3JSOA 4W1UA 4WWPA 2GIVA 1I1GA 2IVMA 1WJFA 2PLYA 2L7KA 2DZOA 2ISZA 4KN7X 1FP1D 1FLIA 2QQ9A 4URKA 5FKOA 1K4TA 3KP3A 2L6BA 3QKYA 2LY9A 2RN7A 1JHHA 5A6CA 2FRHA 3AG4H 3EUAA 2M2EA 1TYQG 5HLHA 4L18B 2LF8A 1VI0A 2IF4A 4LMYA 4HNVA 1Z05A 2P6TA 3HIFA 4B43A 1SAUA 1T08B 3V31A 2FA5A 3UR3C 2H6FA 2ZIRA 2BVMA 2OF7A 3FKJA 1JKRC 4YEJA 5IOZA 3WHBA 4NRHB 1MMGA 1X4OA 3WTWC 1OJLA 2E5NA 2BY2A 4UY8I 3LEWA 1DP3A 3PUJA 3PUKA 2Z99A 4XMYA 4J8SA 1R4MB 4U0ZA 3DFGA 4PJMA 3E30A 3BCAA 5HLTA 3RJVA 2C2LA 4RB1A 1BI2A 2Y0SA 1VTNC 2VT2A 4H7XA 5F6FA 2WB1N 3S93A 3FDYA 4KICA 3TP3A 3L2QA 1ULYA 3HIZA 2ELHA 3LOCA 3O8HA 4BQAA 1KU2A 1ETOA 4JX6A 2W57A 1VQ9I 1FTZA 5LHHA 3WGIA 3KYLA 3JYSA 4KT6B 3ZMVA 3OS2A 4P1WA 2EINH 2XAUA 2F5FA 3E1SA 1OWNA 1D8DA 2XCBA 4FADA 4WUYA 1SD7A 1A36A 1IRGA 4WNEA 5CVRA 4MTEA 2FOKA 1K83J 1FMWA 3AL0C 3RTRA 3ZEFA 3F8MA 2VJIA 4A5NA 1QBQA 4IX7A 2WXGA 4Z68A 1PYVA 2RV8A 1XS9A 2V9KA 2ESHA 2FOWA 4L5IA 3K4KA 1ETXA 2A05A 2CW8A 5E1XA 2ZJPF 3LCAA 3RYPA 3DSSA 3CD6I 4ZYDA 3ECHA 1TBXA 4HX7A 1MNDA 4GFBA 2KP6A 4XKCA 4FJYA 3AG1E 4WAFA 4FETA 2VJ4A 4PS7A 4AEZC 4GZ3A 1T98A 1AA7A 4F7ZA 4WWOA 4GTTA 1Y8QB 4DIQA 1MBJA 5EDNA 2EB7A 4BEHB 3VODA 1P7JA 3HYMB 2GZWA 3QARA 1SFXA 1T2KA 5G2NA 2Y4TA 4PGHA 1FPPA 2X0LA 2XPVA 2PJRA 4G6TB 1MQSA 3PEUB 4HPQA 3PO3J 3OYMA 3BZKA 3RZOJ 4YVQC 1ZG3A 3NRVA 4HG2A 4IHVA 4ITVA 1FT2A 2WXQA 3DPTA 3HG0D 5K7FA 1UFMA 2WY7Q 3ELKA 2IS4A 1G3TA 1ZK8A 2HKOA 2M8GX 2W48A 4CZ2D 4GCNA 1XCVA 5LLQA 4HF1A 1OR7A 3GW2A 4RGXA 3WGHA 2DTZA 3V30A 1T0FA 2R7QA 2XAQA 1TC3C 3UPVA 3ZVVA 4JK1X 5BMZA 5TISC 3PJRA 3C72A 5M5YJ 1OKRA 5B3SE 3CUQA 2R03A 2ZNZA 4GTOA 2A5UA 2OJED 3E5UA 3FXQA 3PFIA 3I4PA 3G6EI 1V3FA 3RI4A 1OQYA 1R5ID 1MBGA 2IOLA 5CPRB 4AWXB 4HQDA 3ZQFA 4ZYEA 2E1NA 2LOOA 4V2GA 5CQEA 1HW2A 2PQ8A 2Q2EA 3K2AA 3LSHA 4I6EA 1VNDA 2OD5A 3S7BA 2LSUA 5HQ8A 3TWQA 3K4MA 3Q0VA 1I3AA 5LP0A 4XLPF 1R49A 1GXPA 4IRGA 5FLXK 1I6XA 3QWWA 2IT0A 1HKTA 4A3EJ 4LCTA 2QA4I 3ABUA 3R0AA 1FYLA 2R05A 4TUUA 5ENOD 1KLXA 5ICGA 2M7AA 3PREA 1ZAOA 4N4NB 4OYSA 1KZHA 3GTPJ 2R7SA 2LAIA 2ZC2A 4Z2YA 3D9PA 1IGNA 4X1EA 3TOBA 2P9NG 2I9CA 3PL8A 4FULA 4OAVB 1U5TB 2R7FA 3TDZC 3OYEA 1H89C 4I6JA 1S7AA 4BXXJ 2P5LC 2WV1A 2NRAC 3RSNA 1LFUP 2F5CA 2UUZA 3UUXA 3J7ZI 3EU9A 5G55A 3ZMUA 1JWFA 4BACA 2X6FA 4CSWA 4WWCA 4JVSA 1V54H 2G9WA 1V4RA 2KRFA 3GTQJ 1HX8A 5JHUA 2JJ7A 2XGMA 4ZYHA 4XRMA 4C3IJ 2A6HF 2FBKA 4KIBA 2DIWA 1RPWA 1Z0XA 3HXBA 1SMYF 3DF8A 1BIBA 5L3DA 1X81A 1STZA 2DK8A 1YYHA 4J8EA 4XR6A 2GRRB 4U7BA 1TNOA 5E18F 2VOOA 2WMOA 3G2BA 3SZ7A 1LEBA 3WE2A 4XLAA 1A6QA 3MFKA 9ANTA 1Y8RB 4CUGA 4ILGA 1MH4A 2H6CA 4IVNA 1W5TA 3B02A 4Y33A 4F92B 1EF1C 2CG4A 2AW6A 2LMDA 2DVWA 4K5CA 4EM1A 5L3CA 3MAJA 4M3FA 3CF2A 2XB5A 2VQHA 1AWCA 1P4AA 3ZOBA 4O1OA 2CQXA 2O8XA 2WAFA 2L02A 4PJ0C 4CCMA 4B3AA 2XGDA 1DVPA 4GTQA 3FMSA 4H7YA 4P5OA 2BHYA 4FJZA 2AQEA 1JT0A 2P81A 2WTEA 4PS3A 3Q9UC 3AU5A 3DQVC 1SEUA 4LG3A 3TO7A 1WGXA 4S05A 2NSZA 4M3OA 1KT0A 2LRDA 1B8IA 2E5ZA 4L0ZB 1N52A 1Z3XA 4GMLA 4DI3A 3G1OA 5E3OA 1JKQC 4HSRA 3IKOB 5GAHJ 3PEVB 2VGEA 2YUSA 1P5QA 1N94A 2CUJA 3OYAA 4BY1J 3ABME 3Q5MA 2Q0OA 1VF9A 2HVQA 1W3BA 4XN3A 4LRZA 5LEJA 3TWUA 3Q47B 1ZREA 2KFDA 2ZJQF 2J8SD 2K9SA 4E7SA 3KZYA 4ZJZA 3PE4A 4HBDA 3TXNA 4B0ZA 1K6YA 3CCQI 4HX8A 4IO9F 2VC0A 4HSTA 3SEQA 4DW6A 1EYHA 3DSXA 2WXHA 3ABLE 1FIPA 3ZQHA 3DRAA 2OVBA 2DA5A 4LOCA 4E7ZA 4K0RA 3CEQA 1AKHA 1YITI 2FUG2 2MSYA 1TTYA 1FWZA 4UXNA 2IBDA 4WK8F 1IUYA 2JSPA 5EX3A 4ZZLA 5JHFA 1FT1A 3JQ1A 4EM0B 3OV8A 4DJAA 1IN4A 1MW7A 5E1WA 5D5VB 3H92A 3R60A 1RI7A 1VZ0A 3OMYA 4J00A 1K78A 1G3NB 3F8NA 4XK4A 4GA2A 3P5JA 3D0SA 4YDEA 4CGVA 3DSUA 2VTBB 1TQMA 2PM6A 2XRYA 4IN3B 5E3MA 4RAYA 2UWJG 2JWTA 1BJZA 3CHOA 4XKBA 2D2WA 5DS9A 3NB2A 1ON1A 1LNWA 3QK0A 2RFAA 3SXYA 4IKFA 1QZEA 5LD2C 5M3MJ 1Y6IA 2NAZA 3EUHA 2DAOA 4JBAA 3WTTC 4OIPF 1YYVA 2CWEA 1ZU2A 2R7ZJ 2HZTA 3ULEG 1QZZA 4BDZA 2EZHA 2LH9A 4BJ6C 4DBQA 3CCUI 2EIKE 2Q1ZB 2XQ0A 5EEHA 1IYGA 3R7RA 4G7ZF 1F5TA 1ETKA 1HW5A 2HYFA 4ENKA 4EVIA 1RESA 3I4NJ 2QBYA 3GZ2A 2IAIA 5F0FA 3LA7A 2V9PA 5E20A 3PIOF 3DEOA 2HQNA 4B3XA 3BJAA 5K7HA 5ILVA 4N2SA 1VDYA 1XCBA 3SQNA 2DI3A 3I64A 3K10A 3EHQA 3MQ0A 3RIBA 2W25A 2E7XA 2EV6A 1IRFA 1EDUA 3F6QA 2FULA 4ILIA 3I55I 3I3NA 3M9AA 1NG7A 1WI9A 2F5DA 5J1RA 3DBLB 4KXKB 3QYFA 4IPAA 1U3CA 5FQ4A 1BC7C 4ABNA 4MLOA 1WY6A 2HYZA 4UWGA 1Z7LA 2I8DA 2GXAA 3Q78A 4I43A 4AUXA 3GTOJ 3FK6A 1KYZA 1Z6RA 2K9LA 3JCUC 2GROB 3VYRB 1I6HJ 2XPWA 2KCLA 3RPUA 2XPUA 4CCAA 1FVHA 1WQ2A 2CU7A 2ILRA 3AS5A 1OCRH 2PJRB 1VQ8I 4I2ZA 3HSFA 3IRQA 3J80Z 3A03A 3V7RA 2K9NA 4U0WA 4XL9A 2K02A 4A0YA 1W36C 2D45A 1A5EA 4IJAA 5EF6A 2L0KA 3FU3A 4E4HA 1R00A 3G1LA 2DYRH 3LSRA 4BTAA 4HF2A 4RGSA 4IHYA 2MBFA 4V2FA 4ZDOA 3L82A 3R4KA 1V55E 4XIDA 4BS9A 1O3QA 1R1VA 1O1SA 3MKQB 4FTHA 2YPRA 2K3FA 2RG8A 3IAM2 4LLLA 3S1NJ 3WG7H 2GRMA 3FUFA 3GTGJ 1HG2A 4NQWA 5DV5A 2RFMA 2R7XA 4G25A 1M1EB 1BL0A 2PNNA 3UIPC 1TQPA 2M4KA 3HG9A 1YJ9I 1IQRA 3ZMDA 1W4MA 3HJEA 2DYSH 3HDXA 2I10A 3E97A 5D2MC 2ZBKA 3DPLC 3B13A 1WH5A 1LVKA 2WAQN 4M3GA 1A31A 1XC5A 3W6VA 5ENNA 4BY6A 3AS8A 5LOZA 4MIMA 1F36A 1T56A 4QQIA 5AIJA 3IHYA 4D1QA 2VC1A 1YJWI 1H2VC 2NC9A 3HKZN 3GW4A 1EV7A 3AAAC 1A35A 4ATZD 5LGNA 1E8XA 2CHWA 4UB6C 2XENA 3DLAA 3Q75A 2V79A 1SZAA 3ZHEB 1BOBA 4HAMA 4E7IA 4UI9K 5ILSA 2NXPA 1E8YA 3PNTB 4TXPA 4JD2G 3RU0A 4Y7NJ 4MS6A 4GXOA 2ZJ2A 2LVSA 3JRFA 3SGHA 2KIMA 1SW6A 1ZLKA 4RGUA 3BZCA 3PZDA 3DPUA 4I99C 2WAEA 2F0YA 3FXKA 2VJJA 4FE7A 4B4CA 1UCRA 1JWGA 5J3LA 1R1UA 1BC8C 3J81Z 4M73A 3I5UA 3IBEA 2WXLA 4ACKA 4M3DA 4JL0A 5DBKA 2KZVA 2NS7A 1GV2A 4CDRA 2R7UA 3U64A 1WVRA 4DLQA 2LUHA 3HBLA 2L4AA 2VBZA 3TG5A 4KYOB 2HPIA 2TCTA 2NS0A 3KEZA 3E32A 1SVXA 1LVAA 1V5FA 2PBIA 2MC3A 1U8RA 4CCJA 2ONDA 3ASNH 3C3WA 1BI7B 3ZPJA 3JUEA 3HOXJ 2IEKA 4I01A 1BI0A 3ZN0A 1K4SA 3FM5A 3VOEA 2H6HA 3MD2A 3Q0WA 3MEXA 4J19A 5BQTA 1N9AA 3FZVA 2WXFA 3RAUA 1UG3A 2AXZA 3PRZA 1OWOA 4KMUX 2XPZA 3Q73A 1AWCB 3OS0A 1H0AA 4FU3A 1ENHA 5B1BH 1WG0A 4KUMA 3CSTA 5AQ7A 3ERMA 4MKTA 2A4ZA 2P9IG 3V2XA 2EZIA 1JUQA 3PM1A 4BHBA 1IXCA 2JMWA 2DJNA 4V3IA 2HFHA 3E5QA 4CT0A 1Q1HA 3ZW3A 2JPCA 1PUFA 3QQAA 3E5XA 3NWTA 3HHMA 3EYIA 5J6XA 1B8IB 4ETSA 2DA6A 5AN8A 5KK1A 2Y2ZA 2VQLA 3FTXA 4XLFA 1PVEA 4DYCA 3WG9A 1ZG1A 2XAFA 2JRTA 3KFWX 1QBJA 4CRWA 3ZXPA 5LCWC 1OCCE 4BYYA 1LTXA 5D6EA 1O4XA 3UQ3A 3DTKA 4BHCA 2YINA 3NAUA 3KLOA 4BE0A 3L1PA 2FQ3A 3HGYA 4Y6WA 5HLIA 2JZYA 2JK3A 2L9RA 1P4XA 2GA1A 3BT9A 1ZB1A 2X6JA 3UM2A 2BW3B 1J2XA 4F91B 3EHRA 3ERED 2V7FA 2MHKA 3H3UA 3JTGA 2PZIA 1JKPC 4I76A 1AKHB 3OIOA 1RC9A 3K9IA 2IS6A 2EILH 3C18A 5LRRA 4P9FA 2V5QC 2NOGA 2WADA 5JJ6A 4UV8A 4A3MJ 4L9PA 5CJ9A 3A01B 2IS2A 2PG4A 1JGGA 4L23A 1MJ9A 4HOQA 3ZQIA 3A02A 3ASOE 1ZGAA 2DOFA 3V7SA 1ETWA 2WWYA 2LLKA 2Y69E 2QGUA 2J4BA 2QLZA 2LDUA 4KVOA 1KQ8A 3N05A 1BR2A 3GTMJ 4IQ4A 5JFRA 3QWLA 5KHDA 4HZFA 5E75A 4UVAA 2VBWA 4C3HJ 5BNGA 2DK5A 4A3IJ 2ECBA 3QU6A 5J47A 1TL8A 5F27A 4U88A 5CKTA 4AVPA 3UM1A 3HOUJ 5CVJA 4GCOA 2QBYB 5AIPA 1IAWA 3LS8A 1V5EA 2DMNA 4G26A 1WJDA 2E2JJ 2RNGA 3NARA 3SBSA 3TWRA 2OA4A 3F21A 5CEAA 2JVHA 3MV2B 1BU9A 4NC6A 2IY0C 4KIFA 2IA0A 2CV1A 2L01A 3D9IA 4C48B 1X3WB 2L5QA 3UKGA 1K3ZD 2H8RA 3HXEA 4LD5A 1MJAA 2A61A 4JA7A 3T8MA 3RJPA 1IN7A 3ZXSA 1HKSA 1OFCX 2E1MB 1K1BA 3P2BA 4S04A 1TNZA 3E34A 3VPRA 5KJLA 2F4OB 2VIXA 5FZRA 3FFLA 2RKHA 2IA1A 3VLFA 2CRGA 2J5PA 1T33A 2DFEA 5F64A 2BV6A 3J80K 1AP7A 2D1HA 1EPUA 5FIOA 2HKXA 4QPOA 3TL5A 3CGHA 2B0LA 4XKWA 1E3OC 2DBBA 1U3EM 1REPC 2VGXA 4J6IA 3RKXA 2H6IA 4QWQA 4DYQA 3RSEG 2K4JA 2RNJA 3CMMA 1X19A 2K85A 3E6MA 4QFVA 1R58A 4UB8C 2M5WA 1HZ4A 3ZYMA 5JHBA 5FB2A 1Y8MA 3CC7I 4G24A 1I50J 2XSDC 3LQQA 2CFXA 3BG7A 3BJ6A 4RSYA 3SBTB 2GXBA 4B8XA 1TW2A 4A3DJ 3K70C 1SAXA 2X6IA 3UKUG 5DD4A 3SZPA 4NQWB 2P9LG 3PZ3A 1KA8A 1IG7A 1NI1A 2IGNA 4TV7A 3CDHA 3KP5A 1D3YA 2A68F 1IZ1A 4BGDA 1S5LC 5LHGA 1DCEA 3A0HC 3SNXA 2X1DA 3HTUA 4M6XA 4XN0A 1IW7F 4ANWA 2H8WA 3DXKG 2E1OA 3Q3SA 4OIQF 5KNLA 1H8AC 4YFXF 1KU7A 1YW9A 2L9SA 2VJ5A 3ZRGA 5D4RA 2NYJA 1WI3A 3FEXA 1TNYA 1G3WA 3TP0A 2WC2A 3C3OA 2EJRA 4D5FA 1ZRDA 2V6CA 3DWLG 3BCBA 5BOXA 4WNFA 4RG9A 5DD8A 5C1DA 5LRSA 5ANLA 1O3RA 1ZKGA 3OIPA 2WQHA 2Z5UA 4DYRA 2JPBA 2IPQX 1YIOA 3WTSC 3O3KA 2AVPA 5K5QA 3T0YA 1PC2A 1PAQA 2HNHA 3GUDA 4CYDA 5ICFA 3OYJA 3S3NA 1MZCA 2UV1A 2BVLA 1FYKA 3KIOA 4KIGA 3CCLI 2J49A 5IOYA 2WVIA 4GA0A 3FBIB 4MFDA 2LSVA 3KEAA 3V2OA 3BOQA 2ME6A 1SD4A 1MDMA 3CO7C 2N8GA 5JJTA 4EJVA 4FCYA 4YFNF 3ABTA 3CO6C 3TJPA 3J81K 3QYBA 4L5EA 3EDPA 3I53A 3AAFA 4D0PA 2EIME 3EHMA 2WXJA 1BM9A 1R36A 2K27A 2DA1A 4GTSA 1GHCA 1F4KA 3MKRA 4B8CB 3W2AA 2UY1A 4CZZA 3WTVC 5BXUA 5FRMA 1MX2A 3TXMA 1TWFJ 3PQJA 5J40A 1D5VA 5BUZA 4NQ0A 3EETA 2V5FA 3SFYA 3BR1A 2DN0A 2XCCA 3NAWA 2KISA 4GZ5A 2XF7A 4IOCF 1B1BA 3OYBA 4CGZA 1TNTA 1NZNA 2ZO4A 5G04C 1CF7A 4N5CA 4GDFA 1FOWA 2X3MA 2R92J 3RKWA 2A5YB 5DDGA 1MX4A 1XMXA 2W84A 2NXNB 1RUNA 4HFGA 2V0PA 2GM4A 2V1NA 4APFA 3MZ8A 5EKQD 3G4SI 3LSGA 1ZRCA 3CC4I 3G2SA 2IOSA 3I0TA 4L9NA 4XEIG 3JRDA 3KAEA 4M3BA 1NK2P 4IHXA 3CZ6A 4LK1F 1FYMA 2GGFA 3HVEA 1JT6A 3NOGD 4UI9C 2ICWG 4PS8A 3TDUC 5A7DB 3UM0A 3ZUVB 4N3AA 4A3GJ 2K5CA 1EH6A 1QU3A 3FH5A 3ZNGA 3OYLA 2IO3C 4G8LA 3F9KA 3FXRA 3LPZA 4ANUA 5IPAA 2R5SA 5AARA 2CUFA 3CMYA 2OZ6A 3WU0A 2O6GE 2I1JA 1YHQI 4GZDA 1O3SA 4JXTA 1ODDA 1VQOI 3OXLA 4JX5A 1N25A 2Y9YA 3J7YJ 3L54A 3PH0C 1YTYA 1D8JA 5D8KB 4MHGA 3RQIA 2HVRA 2LK2A 1PJRA 2P6SA 4NUBA 5JI6A 4CCKA 4DRXE 2Q8KA 1LF8A 3BPXA 3F72A 3R0JA 5EN5D 2WQ7A 4XICA 2VPLA 1FPQA 1UJKA 2ELKA 2RVCA 4L0YB 3L17A 2XB0X 3O6BB 1BOAA 4J0UA 2DA3A 5C4XJ 4IRHA 1WPKA 1YX5A 2B7EA 2EIJE 3B7UX 2DFFA 1LDDA 4IL6C 4BNCA 3OYGA 1KU9A 3DEWA 2C0MA 3VLDA 2NS8A 5IYBJ 5BS6A 2STWA 3GXOA 1Y0NA 1OWMA 1YRNA 5TJJA 4Q47A 2H09A 4G11A 4HEA2 2CQNA 1U6GA 2CW7A 2EFWA 2Y0BG 3ROUA 4KNYA 1E96B 4M7CA 5ITZF 2DFHA 2AS5F 4EQFA 1S3JA 5ENQD 3CHPA 5KAFC 4OMZA 4GMJA 4B89A 3BR2A 1N4SA 2H94A 1SFEA 1FX7A 3FTVA 2A6EF 1X3UA 4FX0A 1R9TJ 4CXFA 4M9XA 1R1TA 4ACLA 2QYOA 1GUUA 5LGUA 3G2TA 5D66A 4CHUA 5B5EC 3NWSA 3FUMA 5HKPA 3DTIA 3EQLF 3WE3A 3G73A 1GVDA 4LG0A 1W36D 2E2EA 2KZGA 4OIRF 1G2HA 4A1GA 4UUSA 3N4MA 1HLVA 4B8AA 4CGWA 2VBYA 3ZQ7A 4RG6A 2ZFWA 4BKXA 5CYVA 2R59A 4ANJA 1P6RA 2F6CA 2FU4A 1ZHFA 4FT8A 3LSPA 1IC8A 1DPRA 5B66C 1HS6A 5IT3A 2DT7B 2MGQA 2QENA 4LG6A 5KJMA 2J5OA 1XSXA 3S17J 3HSRA 3ASHA 4AV7A 1SD6A 2HQAA 2GRLA 1E2XA 4U0SA 4F1SA 1WM5A 1OCZE 1QVTA 3ECOA 4I0BA 1SANA 3WODF 4RS8A 3QOEA 4EATA 3HOYJ 4G7OF 1MBEA 4AJWA 2LY1A 4EHMA 4HB5A 1B9MA 2LF7A 2KBXA 3SJMA 3NZSA 5IY5E 3CLQA 2Y0SN 3L13A 4BERA 1F9NA 3ABLH 2JA2A 2KKOA 3FX3A 3ZCOA 4KYWA 2OEWA 1IHBA 3IP4B 3JUIA 1P9QC 2KIUA 5LEKA 2GWRA 1POGA 5CVUA 1MJBA 1UJJA 3CVQA 2DPDA 4NC7A 4YIFA 5EGOA 1E3HA 2VONA 2K4BA 3PZ2A 4N3BA 5FQ7A 2P7VB 4XQFA 4AVXA 3FP3A 3SDBA 2VOPA 1YFHA 1HSJA 3ZGKA 3CLJA 2JA6J 3C98A 2TDXA 3MZLB 2VGXB 3LQRA 3WU2C 2V1XA 1ZBPA 3DEEA 3C2BA 1V5GA 3DCFA 4M6VA 3G71I 2CUZA 2L4MA 2MD0A 2HDWA 2FF4A 3KEYA 3L9TA 3P9CA 1HO8A 1OPCA 1PY1A 3UKRG 2PJPA 4R1HA 5M72A 1FBSA 2KT0A 4S0HB 3FTYA 2J07A 1U2VG 2DXIA 3V8LA 4GYYA 2K7LA 4AOFA 5C3EJ 3N71A 3LSTA 2CV0A 2L9NA 1U3DA 2DMQA 1X1AA 3FTUA 5FD6A 4NACA 2XEHA 3Q0UA 5D6FA 4U0UA 4WNDA 5AQ9A 2NYXA 4I9EA 4XI0A 3SFXA 5CERB 2K86A 3DEPA 5KWDA 1LE8A 3GYZA 2EPFA 3OWTA 2DPUA 1P92A 4KMFA 4B47A 1G6NA 2KPMA 2MG4A 2BTDA 4EBAG 2QC9A 4DX5D 1FOYA 3EUVA 3CKBA 3JW4A 3S8PA 1OWPA 2QVOA 3Q15A 4A69C 3WHCA 1FCHA 2IRFG 5A23A 1QHGA 4OAUC 5EG0A 4C2TA 4EV0A 3C7JA 3MVPA 4OINF 4GZ6A 4K5AB 3FXMA 1VQKI 2P7CB 4GYWA 4O60A 4EEFG 2X1CA 3C3QA 4I2OA 2CYYA 1Q1VA 1OCOH 5AIQA 2A5EA 4KFCA 4BE2A 4YDWA 3HRAA 2HTJA 3FISA 5A2QZ 3U4TA 1MDMB 3DBRB 4JHRA 3FU5A 5J1YA 1E7UA 2L0TB 2ZCWA 3H5RA 2Y3AA 3AJIA 4GTRA 4IZZA 3SHFA 4BESA 4RB3C 1DCQA 1FOXA 3WTUC 4KN4X 4U04A 4BFRA 3F22A 4P29A 3CHQA 3EDTB 1MKMA 2HU9A 2LTPA 1BI3A 1ELKA 2KC7A 2VSNA 2ZSIB 4QTRA 2VODA 4JB8P 2V4HC 3ZYQA 2UY1B 4XM3A 3B7SA 4MRUA 1TWHJ 3FIWA 3HRSA 3F23A 1S72I 1MSEC 4B44A 1KQ9A 4LB6B 1TN6A 3CESA 2FEZA 1PDNC 1BW5A 2F48A 1D0ZA 2Y0MA 3AFHA 3H0DA 1RETA 1T8IA 1QNTA 1QVUA 1XGSA 3KX2A 2QKLB 4E7JA 2HO1A 3T8KA 1O5MA 3SEZA 4MEXF 1CF7B 1MMNA 4O5VA 4B48A 1NFIE 1U5TC 2ESNA 2VXDA 2DODA 5D5UB 3G2WA 1T38A 3IV5A 5GPAA 5KBAA 2YU9J 4RVBA 4XI9A 2AO9A 1GDTA 2FI7A 3ZR8X 5LGTA 4A3KJ 1MMSA 1LDJA 2DA2A 4I02A 2VGYA 2WMNA 3LSIA 4E6HA 1DGRM 3HVEB 2CSOA 4HV5A 1MX6A 3SD5A 3PUBA 2DWZA 4FQGA 4L9VA 4IHTA 1BI8B 1N4QA 3NOCD 2PMZA 5DM7F 5GPCA 2JA5J 4BSXA 4GPKA 4R79A 3R61A 4IYPA 2WB2A 1JCSA 4AIJA 1FVFA 3PSFA 3M8FA 2XF5A 3I58A 2Y31A 1EH8A 3CVUA 5HNHA 3FHEA 4ZHBA 1UG2A 2WY8Q 4JEHA 1YQAA 1DU0A 4D7NA 4A2UA 4JHKA 3JXIA 4LERA 3L7WA 4HQEA 5AQAA 1FBUA 2VE8A 4RA2A 5LCWJ 3HRMA 2COMA 1S7EA 3AG4E 1R22A 4FE4A 2G7UA 4RQIA 2LKSA 1Z1DA 4U8VD 3JRHA 2P9KG 3CR3A 1QA6A 2X6KA 3E37A 5HI7A 4HV6A 3L9FA 4C2UA 2R7VA 4CDMA 4FLBA 3TG4A 2P0WA 1XGNA 4GPMA 3BTIA 5HDGA 3HGGA 1YIJI 4O6FA 3QDNA 2DFIA 2M4GA 2Y48A 4YFKF 4ZYGA 3F8FA 3Q9VA 4FHTA 1NA0A 1ZG5A 2R7WA 3LL7A 1YRNB 3PO2J 5F1RA 3CCRI 5E8GA 2Y4UA 4HRMB 5DCMA 3M7GA 4AIDA 3IAS2 5L3BA 3IHVA 3S3OA 5KJKA 2DT6A 3FUJA 1YLFA 1IQUA 2GBYA 4G8XA 1A17A 3I4GA 2V26A 4ZTJA 3B73A 4D7MA 1NP7A 3BLYA 2VB6A 4EGZA 3QRFF 3BTJA 4A0XA 2KCVA 3PDNA 3Q9SA 4DX6D 4FA6A 1Q2ZA 2XEVA 2Y75A 3FKIJ 5LHIA 1FY7A 2EZLA 2UWMA 2GIZA 1I3QJ 4L9JA 5IYCJ 3X2QE 5F04A 2EINE 2XGCA 5J1UA 3FHZA 1ZLJA 3KE2A 1TN8A 4LNGA 4RDUA 3LY8A 4UUSB 4AY5A 4KT5C 3HPHA 5AQBA 1TWGJ 2ZSHB 2FXAA 2IU1A 4AM9A 3BQYA 3DBHB 4EQQA 1D8EA 5AJDA 1IV6A 1QQIA 1GXQA 1XGMA 2M34A 5CQGA 3CK8A 3GZNB 4J8FA 4KISA 5D0OD 3QODA 1TT5B 4K03A 2NVXJ 3BPVA 4CCNA 3K70D 1W7PD 2R7OA 3BQOA 4N3CA 3JCKC 4TRQA 2W4SA 1SMTA 2Z2SB 3ULQA 4I1OB 1IDYA 3TMOA 2JSCA 1GLNA 3BR3A 1MYOA 5JJ7A 2ZXWH 1FC3A 3K4LA 2BXYA 2XASA 1D1CA 2AXTC 2IW5A 3FXJA 3VYUB 4F52A 3ABKH 5EGOB 1R5GA 1J0RA 3S32A 1PP7U 1VQMI 1N75A 4IXAA 4DOZA 3IXEA 2H1KA 3PQKA 4I6GA 2XF6A 1SFUA 2HPMA 3JQ0A 1MBKA 2E71A 3CVVA 3RKQA 4L7TA 4PSWA 3KYCB 5FZSA 1WJCA 3F8CA 4ENJA 2AXLA 1OUVA 4DI4A 2I5UA 1H88C 2IP2A 2MH2A 2KJCA 5AONA 3LDZA 2WXNA 2OZUA 5JLWA 4M6YA 2PI0A 1MMAA 1ZYRF 4PZJA 4A3VA 3V79K 1UN8A 4A0ZA 2LSOA 2J9QA 3WXXA 2TRTA 2ZKZA 3CVNA 1N4RA 1B6AA 1O3TA 4JQFA 3HOTA 1YS7A 2BOLA 1LE8B 3FH7A 1BJAA 2ISYA 1ZQ3P 1MSFC 1XNFA 4MLPA 3OTNA 3JRGA 1XGOA 3DU6A 1A04A 4XRSG 1X1DA 3C2GA 2G0EA 4UUVA 1EF4A 1OT8A 3H9GA 5FFXA 2XS1A 3CUQB 3CSFA 3AG2H 5EG0B 5J8CA 3MJWA 1IJWC 2EV5A 1HA8A 3L22A 1OY3D 1F1ZA 2XKOA 2WA0A 3LAJA 3UTMA 3TO6A 4NIKA 3RZDJ 4A3TA 2Y9ZA 1WWXA 2BBYA 2ID3A 3T9KA 3BTCA 2Q2EB 2HYGD 5A2QK 1LFBA 1AHDP 4LEUA 4HW0A 2IXSA 1W7PA 2DQRA 1K6OA 3UT8A 4AIKA 4ZC3A 1HW1A 4IHWA 4M9SA 5L3FA 4GYIA 3S16J 3BG0B 4BJTA 1MBHA 2YHCA 2GAUA 1E7VA 1XX5A 1V54E 3K69A 1QPIA 3DPDA 2OTLI 5ARGA 1WSUA 2BYVE 1ZR2A 1DDNA 4LIVA 2YS9A 5CLSA 5C44J 4N4OB 5D5WB 1JTXA 3BTLA 1K8KG 2AHQA 5FO5A 4TV3A 2XRZA 3FU6A 4PSXA 1Z6TA
chains in the Genus database with same CATH topology
4Q5SF 3CKCA 1R7JA 1JGSA 1R5HA 3KLNA 1H6KA 5CCMA 2A3SA 5G04J 2M63A 3FTSA 4FHJA 2GA2A 2Z33A 3KP2A 4GGGA 1K7AA 3QC1A 2RDPA 3ZN1A 4PDXA 2IJLA 4HOUA 4FC8A 2FBNA 1JHFA 4HOBA 2WPVA 4I7HA 2DQLA 4GO1A 1KU3A 2RC4A 4LLGF 4UI9J 3GVAA 2CFZA 5DCFA 5K5OA 2C0LA 2CFUA 2OQRA 1NA3A 2P5KA 2GQQA 1ZGJA 5HDNA 2VSOE 4WCGA 3QPHA 1TW3A 2YX7A 4LFUA 2P4WA 4EBAA 3FUDA 2DCPA 3O4ZA 2OV8A 3FWVA 4ESJA 5DUKA 1H9TA 3RYRA 3FH8A 5ANRA 3I54A 3HSEA 3L08A 4C9BB 2HOEA 3G2VA 3RRUA 3RIRA 4HQMA 2CO5A 3IEGA 1SQMA 2DLLA 4PUCA 3QU3A 3REOA 5DCMB 2CG3A 2L9BA 2HS5A 3COAC 4IULA 2E1CA 1HF8A 4GB9A 1S0PA 3S7FA 3HTSB 1HH8A 2PM7A 1KT1A 3NQPA 2P8TA 1RUOA 4HLXA 2CW0F 1YW8A 3P7NA 1H19A 3I59A 1K78B 2XPYA 2OQGA 2I2OA 2DU9A 3HHHA 4YVOA 3BROA 3FM3A 2YR2A 1L3LA 2YSRA 2HWVA 3SZTA 1E8WA 2HM8A 2FBHA 4Q48A 3CVYA 3IKVA 2MLGA 1W5SA 4O3MA 3LYAA 3FWEA 1EH7A 1XSDA 5C2YA 4W9RA 2O03A 3D9NA 3LWFA 4HXIA 3BG1B 1KQ0A 4RB0A 2WM9A 5HDKA 1J75A 2R3SA 3HHGA 2R17C 3HRTA 4ME2A 4L2LA 2ADUA 1ONVA 4OOIA 3E4BA 1UHMA 2AXVA 3TOAA 5EX0A 2J4DA 3T8TA 1QQEA 4LB5A 1QNFA 4P9UA 1OYWA 3ZMZA 4F3VA 1OYIA 4A5MA 5HS7A 4I9CA 3FU0A 1QZ2A 3ZGQA 4IF4A 2PMHA 4WXCA 3CHMA 3R9AB 4APOA 3E3VA 1Z9CA 3DXJF 3PVLA 5J90A 3MCZA 1IXSB 2ACJA 4NURA 3SI5A 1HXIA 4XIFA 2JTVA 3ENEA 3IC7A 1J7KA 1ZARA 1W7PB 4BX8A 5FFZA 3FTZA 3CK9A 3FEYA 3I5PA 3ML9A 4BXUA 4GA1A 2VYIA 4ESBA 3HRUA 5ICCA 1XN7A 3D9KA 1KGSA 2WXOA 4XLNF 1MZBA 4H0EA 4NB5A 5J8FA 4UWKA 2QUFA 2BE5F 4IRUA 3NF1A 1MHQA 3IL2A 5KCMA 3MX3A 2I6HA 4ESFA 4I1AA 1LQ1A 2YHEA 1G3SA 4HDVA 4C0MA 2I1KA 4G7HF 3LAPA 3GO5A 2HTSA 2PL2A 2A07F 3UT4A 3WTZA 2V4LA 1JXSA 3HOSA 4CT4A 3C1DA 3G3ZA 2M1BA 5E1ZB 5TRDA 1O7FA 2HEOA 2V1DA 3T1BA 4G1TA 4JC8A 4XSXF 2RQPA 2DO7A 2WXKA 3L2CA 2DBAA 4XX5A 5H6RA 3CVWA 3JAMZ 2XV4S 4FP7A 1CGPA 1USTA 3OOPA 4OVVA 3B7TA 4L5JA 3ZMSA 3QB2A 2L54A 5BT1A 2ZXJA 3BP8A 4EJUA 4AD9A 5ILUA 1IHGA 2G7HA 3ONLA 5BV1A 5BW8C 4M74A 4CICA 2IJGX 2MA3A 1B59A 3WTYC 5LBQA 5FQ8A 4HYEA 5AYWD 2XIGA 1YO5C 2D1VA 4U8HA 4U0YA 1I5ZA 3FMRA 3FUEA 4EECA 1QZYA 4PDKA 1TJCA 2KCKA 3G2UA 3QAQA 2H27A 3QWPA 1JPLA 4U63A 5FGMA 2DW4A 4XZ4A 3I59B 1USSA 4A1SA 3LVRE 3GFJA 1RIOH 5DUIA 3S7DA 5FD5A 5D0QD 3D5LA 1RZ4A 1TQIA 4LK0F 1OMIA 1I27A 4WX9A 1G4DA 3APCA 5JR3A 3T5VA 4KDPA 1GVJA 3VB2A 4MQ9F 3TAXA 3V8JA 5EEGA 3GLXA 4OMYA 4I17A 2Z3YA 2GW1A 1ZH5A 3NEUA 4UHTA 2LO6A 5E76A 5AENA 2XGXA 3VFZA 4HVBA 2VSXE 3VLEA 2UZKA 1BPOA 4AXHA 4GU5A 5EDSA 3AS4A 3CJNA 4K2EA 5HS8A 1P4WA 2H6BA 4FX4A 2KM4A 3ASGA 2PN6A 1YW7A 2VXZA 4IHSA 2VTBA 4RGRA 2FNPA 2VQ2A 3M1EA 4HS2A 1O57A 1E17A 2VBXA 2R7DA 4BTBA 4HF0A 4BH9A 3GFIA 4ATGA 4OVUA 5DIZA 4I1MA 1BI1A 1U2WA 3DV8A 4Q94A 4BX9A 1FSEA 1S7OA 1L5JA 1H0MA 1XGWA 3BWGA 3J7AO 2O61A 1Y0UA 3GZ1A 1BBYA 2XUBA 3MV3B 4EMSA 1WKMA 3S7JA 3K2ZA 3QJZA 1E8ZA 4I0AA 3RRMB 1O7LA 1IF1A 2FO7A 4BT9A 3KP4A 5JVTA 4NHJA 4UWHA 3K1NA 4WXDA 2KZTA 4G23A 1FOKA 3PS6A 2NNNA 3ML6A 1OYYA 4LLNA 2L0IA 5CVIA 3JTHA 4IRIA 1S8NA 2E7WA 2XROA 2EV0A 2ETHA 3ESKA 1FP2A 3IHUA 2VJ8A 2X6HA 3MKQA 3ZRHA 2KATA 2P5VA 3CK7A 5E75A 1XDSA 2EK5A 4A12A 4R8HA 1HFAA 2P58C 3KZZA 2EQXA 1INZA 5T4YA 2C6YA 1WAO1 3UT7A 5BV0A 2WV0A 2LKPA 5L3GA 3CQCB 3W6KB 4UWFA 4EZLA 3IRRA 3FTWA 5CHEE 2MD5A 1ZN2A 2XGSA 3EIJA 5HLGA 1UB9A 3QPTA 4HA8A 1YS6A 3KP6A 2JEKA 4KVMA 3ZP5A 2O3FA 4U7DA 4HOSA 2EFNA 3JSPA 2JLBA 3ZHEA 4M72A 2FE3A 2JT1A 3GZ5A 3B7RL 4UV9A 2PQNA 2EFQA 3JAMK 4M9ZA 3E6CC 4Q4ZF 5ICEA 3D3MA 3T8RA 4A6DA 5CCLA 4FHKA 4BWRA 4GCVA 3P9KA 3CVLA 3RRNB 5T8IA 4ZZDA 4P55A 4G9YA 4KMOA 4N9IA 1TLHB 2ZNYA