3T5XA

Pcid2:dss1 structure
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
195
structure length
195
Chain Sequence
STAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLLPVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEKLKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGYISHQHQKLVVSKQNPFPPLSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords PCI domain-containing protein 2
total genus 66
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01399 PCI PCI domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t5xA02
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3t5xA01
1LEAA 3D0SA 2EA2A 1SFEA 1IRGA 2FMYA 4HOBA 3ZMVA 2DLLA 3BJOA 3PFIA 3GF2A 1U2WA 1TLHB 2DW4A 3KZYA 4D0PA 2WV0A 3BDDA 2HS5A 2QZ8A 1IW7F 2IRFG 4RB0A 3NEUA 2W57A 3F72A 5K5RA 3F22A 2J5PA 3V8LA 1P4AA 4OIQF 2H6CA 2RKHA 3WE2A 4U0VA 1QGPA 1J9IA 5JVTA 2Z5UA 3JCKC 2QQAA 2ZMEA 2O6GE 2XUBA 3N4MA 4Q48A 5DCFA 4KICA 2DPDA 1KQ9A 3SXYA 1XMAA 5JR3A 4PDKA 3I53A 1ZRFA 3TO9A 4Z2YA 5K5QA 1W7PB 3LA2A 3R0AA 3R61A 1ZGAA 2BYVE 3ZMDA 4A6DA 3LAPA 4KUMA 1RI7A 5AIQA 1TW2A 3FXRA 4ASNA 4BHCA 3TO6A 3K1PA 2LDUA 3GO5A 2IA1A 2KKOA 4D10C 3WTUC 1XD7A 5L3BA 4EJOA 3R0JA 4M72A 2YU3A 3M8EA 3BJAA 3HYIA 1ZRCA 2MH9A 3KP7A 3WODF 3Q9VA 1XGOA 3V4GA 1W7PD 4UVCA 5LHHA 5H20A 1JGSA 2HZTA 3O6BB 3N97A 1P6RA 2LF8A 5DCMB 3GEZA 1XMKA 3P9IA 3FZVA 4KN7X 5LEJA 1ODDA 3PQJA 1QPMA 3SQNA 4AIHA 1DDNA 3E5UA 3E6CC 3C3WA 1R23A 4HDVA 1QZYA 2MLKA 2GQQA 2OAZA 1XDUA 1J7KA 1IRFA 2RC4A 2VBYA 1G6NA 1S29A 3M1EA 5JFRA 3DKWA 2VOOA 4YFKF 1BN5A 5LGTA 2A3SA 4FX0A 4MEYF 1FP2A 4WXCA 5IT3A 3H92A 3U9GA 3LA7A 3KETA 2QENA 5D5UB 3WGGA 3GZ6A 4L9NA 1FYLA 3GFIA 5DUIA 5LBQA 2G7UA 3SFZA 4UNOA 2D2WA 1QNTA 1WQ2A 3QPTA 2DFIA 1OYIA 2FU4A 3TDZC 3QPHA 2ETHA 1D8KA 3WTWC 3REOA 3CO6C 2XRNA 3FHZA 2Z3YA 4P55A 4YIIA 4OINF 1O7LA 4EJTA 1YG2A 5D5WB 4G7OF 2O3FA 1L0OC 1FY7A 1GXQA 4LB6B 3VODA 2L4MA 2ELHA 4KFCA 1LB2A 2EB7A 4P9FA 4L5IA 3KE2A 2HKOA 3NQOA 2GIVA 1R22A 3GWZA 1BI0A 1F1ZA 3EYIA 1FT9A 3C1DA 2DT5A 4ZYGA 2YX4A 4IVNA 5HLGA 3RI4A 5E8GA 3TO7A 1C0WA 1R5HA 5HOOA 4HAMA 2A5YB 4ESJA 4M9SA 3IWFA 4FHTA 3K9TA 2E1NA 2W85A 3CHMA 3L9FA 4GYGA 5HLHA 2MD5A 4EJVA 4Q5SF 1FZPB 4N0BA 2ZFWA 3I0TA 2ZBKA 3F21A 1J5YA 4BHPA 5BS6A 1ZRDA 4FX4A 5LGUA 1TTYA 1O3SA 2PMHA 2CGPA 4ENMA 5FFZA 4A2UA 3IKTA 4A0YA 2VODA 1SD4A 2HFHA 5K5OA 2EFWA 2Y48A 4G7HF 4UXNA 2L01A 3B02A 3BZ6A 4LG0B 1TQMA 3E5QA 1Z05A 5BPIA 2EV6A 3COAC 2OU2A 3IHUA 3DQVC 2EFNA 1RUOA 3LQRA 4RS8A 3WTZA 2YSRA 1FNNA 1EV7A 4ETSA 1IAWA 2UXNA 3SZPA 2OA4A 5E17F 1KU9A 4HA8A 2RQPA 2FF4A 3RYRA 2NAZA 2HQNA 1U5TC 1XSVA 1HKSA 1G3WA 3FM5A 4EM0B 2R7DA 2W24A 1U5TB 1A04A 2FE3A 3L7WA 3JAMK 1K7AA 5DD4A 4N9IA 4NB5A 1MGTA 1FX7A 4N9HA 4AIKA 2IP2A 2XAHA 2MLGA 5IT9K 2P6SA 4RGRA 3GLXA 4QWQA 4HF2A 3F6VA 2LKPA 3H3UA 1ON1A 3WTVC 4AIJA 1IUYA 3EQLF 4R8HA 3ZN0A 4KNYA 3MZHA 1K78B 2HWVA 3WTYC 1ZLJA 2OQGA 2CW0F 4HLYA 3GVAA 2PI0A 4MTEA 1TQIA 2QM3A 1AOYA 1RNLA 3OOPA 1MD0A 1KA8A 3ERED 5HDNA 3ROUA 3KP5A 3CO7C 1WRJA 4LLNA 3GX4X 1FP1D 2PMUA 3KP6A 4MGRA 2V1UA 2ZNYA 4Q47A 2PEXA 5D4SA 2MBFA 4WWCA 5E1ZB 5E8IA 1KYZA 2XAJA 2P5LC 2ISYA 5F64A 2QQBA 2FQ3A 1IXCA 2ESNA 1OKRA 4FT8A 1G3YA 3O3KA 5HS7A 1LVAA 1P2FA 4LMYA 1SD5A 3VFZA 3QRFF 3KP3A 3KCCA 3EETA 4G6DA 4OMZA 1Z9CA 4WK8F 4YG2F 3EDPA 2F5FA 2H6BA 2HDCA 3VOEA 1KGSA 2FRHA 4EJUA 1TBXA 2KRFA 2M8EA 5BOXA 5FO5A 4TV7A 1UB9A 1UHWA 1G3SA 5J8FA 1EH6A 5LRRA 4RB3C 1STZA 2ZXJA 2D45A 2DO7A 1SFUA 2RV8A 3BOQA 1ZYRF 3BPXA 2UXXA 1J59A 1S3JA 3HHGA 5K1YA 3WTSC 2BGCA 3HTUA 4AD9A 2FNPA 5DUKA 1BIAA 2A61A 4LCTA 1GXPA 3WGIA 4NHJA 1H9TA 2XAQA 2P8TA 4M74A 4M6YA 4KA4A 1SD7A 1JXSA 4NQWA 5BPDA 3J81K 3I54A 1UHMA 4OIPF 4EM2A 4P5OA 1EH8A 3C7JA 3R6SA 4AVPA 3BP8A 3CJNA 1HW5A 3KP2A 4UVBA 5LGNA 4ESFA 4MQ9F 2VOPA 4K2EA 4CXFA 5FD6A 1YW9A 2FA5A 1JHFA 4E70A 2EWNA 3TOBA 4ZYEA 3QOPA 2PFBA 1USSA 4G94A 5L3CA 1HSJA 1OR7A 2KIFA 1D5VA 5HLIA 3SZTA 2VN2A 2IVMA 4CO8A 5F6FA 3K0LA 1O7FA 4RB1A 1SMYF 4KMFA 1VTNC 4OIOF 4LGWA 4KDPA 2HGCA 2D1VA 3GFJA 1YO5C 1Z6RA 3JAMZ 4XLPF 4MQVA 2ACJA 2GAUA 1REPC 2A07F 2EV5A 3E5XA 4L9VA 4HQEA 2VONA 3E6DA 4ESBA 4KT5C 1SAXA 2CYYA 4UVAA 2G9WA 1RUNA 2CSOA 3ABTA 1E2XA 3GZ5A 1K78A 5CVUA 3G3ZA 4EV0A 2NRAC 1BC8C 3M9AA 3K2ZA 4I0AA 2K02A 4XLNF 2K4BA 1W4MA 2DI3A 2OZ6A 2QBYA 1X3UA 2VE8A 4G9YA 3S2WA 1XSXA 2XV4S 3F8FA 2STWA 4ON0A 1FYKA 5AIPA 2VC0A 4M6XA 3HRTA 1FBQA 3MZYA 4KIFA 1LDJA 1BI3A 1DUXC 1WWXA 1FSEA 1B4AA 3U2RA 2DU9A 5LHIA 2V1XA 2JRTA 3IL2A 1FYMA 1LEBA 3GFMA 4LK0F 2EV0A 2YPRA 3JTGA 4IJAA 3HRSA 3Q9SA 4G8XA 4IF4A 1XSDA 2A69F 1B59A 1E17A 1AWCA 4XSZF 1ONVA 1BJAA 2FOKA 1J2XA 2BE5F 4L9JA 2XASA 3FWEA 2ZO4A 4OMYA 4OOIA 4BYYA 1HBXG 5HVQC 2M45A 4DNCA 3DPLC 4KIGA 3ZQ7A 3CUQB 4I0BA 2AS5F 1K79A 5CLSA 3QAHA 4L0YB 4U0YA 1QQIA 2VT2A 5E1WA 4DQ2A 3CUQA 4EGZA 1I1GA 1Z1DA 1YLFA 2CO5A 3ECOA 4U0WA 4BXUA 1TNSA 2V9VA 3ML6A 3C18A 3RPUA 3JTHA 5D8LB 1ULYA 2PG4A 1YW8A 3RYPA 1R00A 2UWMA 3W6KB 1IN5A 2R3SA 3T1BA 2A68F 2XIGA 3WGHA 4M9ZA 3LFKA 4GGGA 4M9XA 2W84A 2XROA 1XGSA 1V4RA 3QP5A 3D5LA 3HOTA 3F8BA 2RDPA 2FBIA 1XDSA 3GXOA 2LNBA 4I09A 2O61A 1UFMA 4H0EA 3TQNA 3EYYA 4EJWA 5L3EA 3WTXC 1O3TA 1J75A 1DPUA 5D4RA 3RTRA 3CUQC 2FBHA 4GO1A 1KYWA 2CFXA 2W25A 5CVJA 2HQRA 4ZYDA 4YFNF 2Z99A 3F8NA 5D8KB 4P9UA 1Y0UA 1YTYA 2KJCA 1T0FA 1XCBA 2HTSA 3M8FA 4IHSA 2QVOA 4Y13A 5A2QZ 2VT3A 2XAGA 2ESHA 2HOEA 1WKMA 5IT9Z 4UHTA 4KYWA 1W7PA 5KK1A 3MEXA 1FWZA 3MQ0A 4UV9A 1U3EM 3VEPA 1TNTA 3BWGA 2V1DA 2X0LA 3MCZA 2AXLA 1BOAA 1FPQA 2E7XA 2F5CA 5TRDA 4HX4A 1ZN2A 2IA0A 2G7HA 4BQAA 3E97A 1LJ9A 3ZPLA 1R36A 1NHAA 1I27A 2YX7A 2ZJ2A 4ENKA 1D3YA 2A6HF 4GYIA 2PQ8A 1OYYA 3P7NA 1IF1A 1BBYA 2WC2A 4B8XA 5E18F 4G6QA 3VB2A 1TW3A 2CWEA 4MTDA 3CTAA 5KVRA 3DF8A 4UUVA 4HBLA 4MHGA 3WU0A 2FSWA 3L2CA 5CJ9A 2XGXA 2F5DA 3FX3A 5BQTA 3IKVA 1FSHA 2BV6A 2RNJA 4BHBA 2UZKA 3ZMUA 1YS7A 1YIOA 3NRVA 5FLXK 3E6MA 4R79A 3I59B 3J7AO 3BJ6A 3WTTC 3TXNA 3RKXA 1MDMA 2X4HA 2Z33A 4I7HA 4S05A 3T5XA 2GA2A 1S8NA 4RGSA 1LQ1A 4CGZA 2Q2EA 4KIBA 5FLXZ 1BI2A 2M87A 3OV8A 5FB2A 4L18B 3I71A 4EM1A 3LA3A 1RIOH 1K6OA 2HKXA 4CHUA 2EFOA 1F5TA 1G4DA 4CICA 2R7FA 2WTEA 2ZNZA 2B0LA 3E6BA 5J6XA 4HX7A 2XKPA 1BC7C 3IC7A 3QU3A 1I5ZA 2DQLA 2BBYA 4L0ZB 2KIUA 2MRIA 4KMUX 1WI9A 2P5VA 2EA4A 3K1MA 3ZP5A 1MZBA 3W6JB 4RAYA 4I02A 1S7AA 3KLNA 4IRGA 4IRIA 5ED4A 3LQQA 4BNCA 1ZLKA 1KQ8A 4R1HA 2MC3A 1O3QA 2LF7A 4A5MA 2M1BA 2NS0A 1GVJA 5HS8A 1CGPA 4EQQA 3KLOA 1ZREA 1ZG3A 1HXDA 3WG9A 4LFUA 2HEOA 1KQ0A 2ZMEB 2HYFA 3TXMA 3DEUA 3EUHA 4EMSA 3KFWX 2NNNA 1CF7B 5D5VB 1BI1A 3V7CA 4HF1A 4LD5A 3FMQA 3ZMSA 2QWWA 2HYGD 3F8MA 1H9GA 4JQFA 5ICFA 1F9NA 1LDKB 1I6XA 2JPCA 3H3ZA 3FXUA 2LSOA 2OD5A 6PAXA 3BY6A 5J8CA 3F6OA 3CDHA 2STTA 3HUGA 3FMRA 2FEZA 4OIRF 3FXQA 1IN7A 5JHUA 4HZFA 3FMSA 1D8JA 4A12A 3G73A 5D6FA 1FLIA 3I59A 4U7BA 3TGNA 4IXAA 3ZMTA 2Q0OA 4XRFA 3JSPA 1V3FA 2QUFA 1MDMB 3GFLA 4LG0A 1IXRC 1B9NA 2P7VB 4Y15A 2GA1A 5ILSA 2P5KA 4RGXA 1YFHA 2KJBA 2ADUA 4LJZF 2Q8KA 3WU1B 1OMIA 3KEOA 5L3DA 2FNAA 4F7ZA 1ZGJA 1HSTA 1HKQA 2O8XA 3ISPA 2OBPA 4ENJA 3SHFA 1XN7A 2GZWA 4HV5A 2V79A 1B1BA 3I4PA 2XAFA 1PUEE 2PN6A 5FFXA 3T0YA 2V6CA 3WE3A 2JTVA 3B73A 3DV8A 3HRMA 1OYWA 3HTSB 4I01A 3DPTA 3F23A 2D1HA 1PP7U 2P7CB 3RIRA 1G3TA 4A6EA 5CVVA 3U1DA 3K1NA 5A2QK 1IXSB 2JSCA 5LLQA 3ELKA 1JHHA 2IJLA 2KIMA 5ICEA 4EVIA 1ZG5A 2Y75A 1ZH5A 1R58A 2DAOA 3QP6A 3HOSA 4O5VA 1RZ4A 2QYOA 2P4WA 2F5EA 1XGMA 2JZYA 4HX8A 5DD8A 5TJJA 2L54A 1FBUA 2VE9A 3LWFA 2O03A 2Z9OA 2FMLA 4PGGA 2ZCWA 4GXOA 3ZN1A 1O3RA 4G7ZF 1W5TA 3DXJF 1R7JA 3KP4A 2QLZA 5ICCA 1P4XA 2IT0A 3IRRA 5ERIA 1ZAOA 3ABUA 4AWXB 5LHGA 4B09A 4LK1F 4QLCU 5LRSA 1LNWA 1U78A 1YW7A 3HHHA 4YFXF 1XB4A 4WCGA 3FF5A 1S6LA 4WX9A 3R4KA 2DTRA 4PZJA 4M71A 2JPBA 5ILUA 1HKTA 2QBYB 1SMTA 3QU6A 2MA3A 1TQPA 4EGYA 1U6GA 2HTJA 5D6EA 5H6QA 1GHCA 4O6JA 3ECHA 4P96A 3M7GA 4RGUA 1XCVA 2VBWA 1QBJA 4HDUA 1YS6A 2DQRA 2GXGA 2XVCA 3GUDA 1P4WA 1QO0D 4JK1X 2CQKA 5DV5A 3CUOA 2NYXA 1ZG1A 3GW2A 2A6EF 2CG4A 4XBFA 2H27A 3ULQB 4JBAA 1MKMA 3V7SA 3RKWA 2RN7A 4WXHA 5DYMA 2OZUA 2FBKA 2L3DA 1KU3A 2JT1A 4ZYHA 4M73A 2GWRA 2WWYA 5F1RA 4LLLA 1R5GA 1HW1A 2VBXA 3HRUA 4I98B 5ICGA 1WSUA 4RAZA 5L3GA 5AONA 2K86A 2XKOA 4BAYA 3MFKA 4L5JA 2OQRA 1KU2A 4HF0A 4BH9A 2L4AA 2H09A 5E1XA 1Z91A 3I5UA 2XHKA 2IPQX 1H0MA 1ZARA 3LSTA 5JI6A 2YR2A 1IN6A 1P92A 3MWMA 1W5SA 4O3MA 5DCMA 1JE8A 3GYHX 1LDDA 4A5NA 5H6RA 4KN4X 1F4KA 5CVIA 4ZZDA 5HDKA 1ZHFA 2VXZA 3K69A 2EFPA 1FC3A 1FBSA 2DK5A 4U88A 2O0YA 1UCRA 2RVCA 3HSFA 3RJPA 2E7WA 3I58A 4A0XA 4CZZA 4IHTA 3DFGA 2P6TA 1J0RA 3HSRA 1PP8F 2ZKZA 1T2KA 1I1SA 4Y17A 5LEKA 4PCQA 2K27A 4HYEA 1HQCA 1YQAA 4HV6A 4ZZLA 3P9KA 3J81Z 4IPAA 3ZMZA 4Q4ZF 3R60A 4RB2C 1BIBA 2GXBA 2DBBA 4L9TA 3CLOA 3P9CA 4XSXF 1Z7UA 2QQ9A 1CF7A 3T8RA 1ON2A 1BM9A 5DEQA 2E1CA 2HR3A 3KEQA 3V8JA 1EH7A 3BROA 3MAJA 4I2OA 1Z6TA 2PBIA 4HQMA 1DPRA 3FM3A 4OU0A 4LB5A 5BMZA 1O57A 1IN4A 2Y0MA 1XGNA 3IRQA 4WF2A 2C6YA 5HS9A 1L3LA 1FOKA 3KZZA 1USTA 3BPVA 3TDUC 4UV8A 5E20A 3IWZA 1T6SA 2ISZA 2VBZA 2MH2A 5DDGA 2PJPA 1SD6A 4ENNA 1SFXA 1PDNC 3RKYA 4A0ZA 1OPCA 3L09A 2PLYA 5ILVA 1R1UA 1S7OA 1QZZA 2L02A 1KU7A 1MJAA 4GCVA 4MEXF 3DP7A 4ZH4F 4MNUA 2TDXA 5L3FA 3J80K 3V8KA 1YYVA 2H94A 4CYDA 2IA2A 2VC1A 2RGVA 2COMA 4U7DA 3TOAA 4LLGF 2EJRA 1MJBA 1IN8A 3RPQA 1IZ1A 4WXDA 4HW0A 1MJ9A 2EK5A 1T98A 3O2PE 1R1TA 4S04A 5FD5A 2BEOA 5CYVA 3AAFA 4PGHA 4CDGA 1U8RA 5HDGA 2DPUA 1R1VA 3Q5FA 3JSOA 3E3VA 3TKYA 2M30A 2K7LA 2IW5A 3LAJA 2M5WA 5EEHA 3JW4A 1B9MA 3I64A 3HIFA 3T8TA 2K4JA 2DK8A 2J5OA 5CVRA 4IRHA 3F8CA 1U5TA 5FGMA 5D5XB 3RDIA 3HSEA 1T38A 2NNYA 3L00A 4YIFA 1T39A 3F3XA 1DP7P 4HLXA 5EEGA 1B6AA 2F2EA 2EFQA 1Q1HA 3V7RA 2FXAA 1HW2A 3PQKA 3J80Z
chains in the Genus database with same CATH superfamily
5JHAA 1R9TJ 1H6KA 1LEAA 5IOZA 3T9KA 1KT0A 3D0SA 2EA2A 1RPWA 3CIAA 2P0WA 1I39A 1SFEA 2W48A 3CCYA 1IRGA 2FMYA 1GUUA 4HOBA 3ZMVA 2XGOA 2DLLA 5ITZF 1GVDA 3BJOA 4DBRA 3PFIA 3PUKA 1E8XA 1OCCE 1T33A 4I2WA 5ARFA 3OAWA 2F8XK 3GF2A 3QWLA 4X8QA 1U2WA 1TLHB 2I9CA 3RRUA 2PL2A 5B1AE 3GLLA 2DW4A 4TUUA 3KZYA 1HG5A 4D0PA 2WV0A 3LSMA 4GYWA 3BDDA 2HS5A 4ANUA 2JA7J 1I50J 5DM6F 2QZ8A 1IW7F 4HLEA 4KT6B 2IRFG 1O5MA 4RB0A 4GZCA 1Z3YA 4XOTA 3PO3J 3NEUA 2HYZA 2W57A 3H0DA 1D0ZA 3F72A 5K5RA 2DA6A 3F22A 2J5PA 3V8LA 4A1GA 1P4AA 4OIQF 2XEHA 4O60A 2H6CA 2RKHA 2WXPA 2KFDA 3ZYLA 1BR4A 3WE2A 4DUIA 4U0VA 1QGPA 1J9IA 5JVTA 2Z5UA 2IO3C 5EDSA 3ZR8X 3JRCA 4RAGA 4JXTA 3SBTB 1TL8A 3MZLB 4B8AA 3JCKC 3LMMA 3ZVVA 2OVBA 5G05C 2MSYA 4DI4A 4E7HA 2QQAA 2ZMEA 4A63B 2IGOA 2O6GE 1A35A 3FH5A 1Y6IA 3S1RJ 2XUBA 3E34A 1VQ7I 3VLFA 3VYUB 3OYCA 4GTOA 5ANLA 3N4MA 1UHSA 4Q48A 5DCFA 2J4BA 3D9IA 3E32A 4KICA 2DPDA 4AY6A 3CJTB 3CD6I 2R7RA 4B93B 4HLLA 1IKND 1OCOH 4BE0A 1KQ9A 3L1PA 3SXYA 5EG0B 1XMAA 5FQ4A 3OL3A 1G3NB 5JR3A 1OWPA 4PDKA 1WG0A 3I53A 3SFXA 2R7WA 3TO9A 1ZRFA 2DCEA 5J3LA 3D9NA 5D0OD 1DU0A 3A2KA 3EJNA 4Z2YA 5K5QA 1TNUA 1W7PB 2CFUA 4F7AA 1YRNB 3LA2A 3R0AA 3KSLA 3R61A 1ZGAA 3OYGA 3CVWA 2M0CA 2BYVE 3ZMDA 3HG9A 5ENSD 3HOUJ 3K70D 4V2FA 2COBA 4XLHA 3Q7AA 3UIPC 4A6DA 3LAPA 1ETVA 3AG1H 4KUMA 3OY9A 1RI7A 3PNYA 5AIQA 5FRMA 1TW2A 2CHZA 4FLHA 4JZYA 3WHCA 1LFPA 3FXRA 4FASD 3D9KA 2IGNA 4ASNA 4BHCA 3TO6A 3K1PA 2LDUA 1IUFA 3HRAA 4AP2A 1FVHA 2VKHA 4BS9A 3BCAA 5B5EC 3GO5A 3I3LA 4HEA2 3B13A 3DRAA 3D9JA 2M3AA 3G2WA 3S14J 1E90A 2E36A 2IA1A 3S2AA 2HDWA 1WJAA 3FHNA 2KKOA 1NK2P 3JXJA 3MA5A 4D10C 4DK5A 4E7JA 3WTUC 3RAUA 1XD7A 3HPGA 3OR1C 3J7YJ 1ZGWA 5L3BA 4EJOA 2MFZA 4URKA 4DBQA 2GGFA 3R0JA 2I2OA 3QAQA 4M72A 3AS8A 3G6EI 4PS3A 2YU3A 2WXKA 2W7NA 1A17A 2L7MP 2VSOE 1E3HA 2CUEA 3M8EA 4HRIA 3HXCA 3RRNB 4HOQA 5HNFA 3BJAA 3HYIA 2BW3B 3ML9A 1ZRCA 2MH9A 3SDGA 2HVSA 4B48A 2CFOA 2MC4A 1F43A 3C98A 3KP7A 3Q7FA 2KL4A 3WODF 2DCPA 4G26A 2H8WA 2ZU6B 1RKTA 3Q9VA 2K85A 1XGOA 4JX5A 4HXIA 1DVPA 2BKKB 3S7BA 2X51A 3UI2A 3V4GA 4IKFA 2MABA 4X6AJ 1OLTA 4RMNA 1W7PD 4AC0A 2DA5A 1RR8C 2DYRE 5CCLA 3TL4X 4UVCA 3KPHA 3S8PA 4GAAA 5LHHA 4JPSA 1P5QA 5HS0A 5H20A 1JGSA 5EZGA 2BKGA 3UKUG 4CUGA 2HZTA 3O6BB 3H9JA 5M3FJ 3N97A 4XK4A 2IFUA 5C2YA 2WAQN 3DEWA 1P6RA 2LF8A 4BJ6C 5DCMB 3GEZA 1XMKA 5HNHA 2XZDG 2WXGA 3AG3E 3HM5A 3APDA 1UJ8A 3SY2A 3CR3A 4UUSB 4E6HA 3P9IA 3FZVA 1ZR2A 4ZDOA 3L2UA 4CCMA 5C3EJ 3NZUA 4QFVA 3IV0A 4KN7X 5LEJA 3JXIA 3PIPF 4EATA 1G2HA 1ODDA 3PQJA 2L7ZA 1X81A 1QPMA 2AXTC 3SQNA 4GFBA 1BR2A 3OYNA 2H1KA 4WWOA 4F6RD 4AIHA 1DDNA 2F37A 3E5UA 1N4RA 4AXHA 2Z16A 3KZIC 4ABZA 3NWSA 3FUHA 3E30A 3E6CC 3CCMI 5DBKA 3C3WA 2JSPA 1R23A 4HDVA 4BDZA 4WWPA 1UN8A 2H6IA 1QZYA 5CBOA 2MLKA 1FEXA 2BXYA 4I1MA 4DRXE 1BD8A 3V30A 2GQQA 2DA1A 2OAZA 3AL0C 1JKQC 4N2SA 2X48A 1XDUA 4AM3A 3IHVA 1JCRA 3SI5A 1J7KA 4NACA 3MVPA 1IRFA 2RC4A 4PK4A 3UPVA 1SW6A 3TG4A 3ULYA 2WQHA 5AQBA 2VBYA 1TN7A 1G6NA 1S29A 5EGOB 3M1EA 2AVPA 4HORA 5JFRA 3DKWA 1TWAJ 3FTZA 2VOOA 4YFKF 1S63A 2XDVA 4CSWA 3LFUA 3OS2A 1BN5A 2ICWG 2IXSA 5LGTA 2JRMA 5AAOA 2A3SA 1I3QJ 2ZJQF 3WU2C 4FX0A 3DWLE 2O7OA 4G2VA 2KCLA 3UMVA 4MEYF 1FP2A 3GBGA 2LKXA 2XPIA 4WXCA 4YVOA 4F55A 2J08A 2KISA 2YINA 5IT3A 3H92A 3U9GA 3LA7A 3KETA 2QENA 5D5UB 3IKOB 1SA5A 3HBLA 1YRNA 3PNLB 2R7UA 4GZ6A 2A5EA 3OYAA 3WGGA 4GRIA 3GZ6A 4FQGA 2I8DA 4L9NA 1HDDC 3AU4A 1W36C 1DCEA 2R59A 1FYLA 4KVOA 3B7BA 4G6TB 3CQGB 4HRMB 4N5QA 4V3IA 3GFIA 2WQ6A 4IOCF 5ARGA 1DNPA 3DEOA 5DUIA 5LBQA 2WXQA 2G7UA 3ZQLA 3OSFA 3SFZA 4II3A 5M5YJ 4UNOA 4AEZC 5GPCA 1ZELA 2D2WA 1EYHA 3S32A 1WZ2A 1VI0A 2KBXA 1H0AA 5FJYA 1QNTA 1WQ2A 3QPTA 2DFIA 3H9QA 4EEFG 1OYIA 1WJFA 2XS1A 2FU4A 3D5SC 5JJ6A 1U0JA 3UKRG 3TDZC 2V7FA 3QPHA 4A3IJ 2E1MC 4K5AB 5JJ7A 3BG3A 4MLOA 2ETHA 1S0PA 1D8KA 1H19A 4U8YD 3Q3SA 3WTWC 3REOA 3CO6C 2XRNA 1W1WE 1NI1A 2Z3YA 2H1LA 4P55A 4YIIA 3FHZA 1JJ6C 1QZ2A 4OINF 2P9IG 4NURA 2KATA 4ACLA 1O7LA 3ESKA 4RBOA 4EJTA 1YG2A 5D5WB 4G7OF 5FIOA 2O3FA 1GW6A 3FUFA 4LNBA 4BFRA 1L0OC 4AU7A 4JHKA 1FY7A 1RRJA 4RG6A 4D1QA 1GXQA 4LB6B 4ILIA 3VODA 4MLPA 3SFYA 2L4MA 2ELHA 3B7UX 3ZRGA 1VQOI 3PUFA 4KFCA 3QC1A 4GZ5A 4ZFHA 5BNWA 4PSXA 4TXQA 5KNHD 1Z0XA 1Y8QB 3AFHA 3IH2A 5E3NA 1LB2A 2EB7A 2BZTA 1VQ9I 4P9FA 2VQ2A 3ZQFA 4L5IA 1P7IA 3CKCA 1E96B 3UTMA 3BTLA 1X58A 2IEJA 5ENPD 4BT9A 1ETYA 3KE2A 3PSIA 2HKOA 3NQOA 3WHBA 1V54E 2GIVA 1OISA 1R22A 2TRTA 2ETBA 2GRRB 3GWZA 4IRUA 1BI0A 3VSKA 1F1ZA 3BCBA 3FEXA 1X4OA 4U04A 2UV1A 4D7MA 4OAZA 1U3CA 3EYIA 5EYPF 2ZSIB 2E2IJ 1FT9A 2CV0A 3C1DA 2MHKA 5A7DB 3K70C 2DT5A 4A3TA 4ZYGA 4RLQA 2YX4A 4IVNA 5HLGA 3RI4A 1IYGA 3FK7A 5E8GA 5J4VA 1KT1A 2Y4TA 2A5WA 2ZXIA 1R5HA 3TO7A 5HOOA 1C0WA 5FRNA 2YHCA 4HAMA 2V26A 2A5YB 1N75A 2CUZA 2NXNB 4ESJA 1TZLA 4M9SA 2JK3A 4FETA 2RQQA 3W2WA 1PUFB 3B6CA 3IWFA 4FHTA 2YS9A 3K9TA 1E8ZA 2EQXA 2P58C 2OTJI 2E1NA 4JD2G 2DMNA 2W85A 4MRUA 4DYCA 3L9FA 1SAUA 3CHMA 4GYGA 3EDTB 4N4NB 5HLHA 2MD5A 3GTLJ 2QYJA 3IXEA 3SFIA 1J09A 3JRIA 3CC4I 3DTKA 4EJVA 4XRMA 4Q5SF 1FZPB 3AG4E 2WA0A 4N0BA 5D2MC 1TN6A 3LVQE 1EDUA 3UXGA 1Q2ZA 2XGDA 2ZFWA 3I0TA 2ZBKA 4QPOA 3F21A 1J5YA 1TNBA 4BHPA 4BQQA 5BS6A 1ZRDA 4ITVA 4FX4A 3MEKA 1T95A 5LGUA 4C3IJ 1HA8A 4YNDA 4G8LA 2NC9A 2CQNA 2AQEA 1TTYA 1O3SA 2PMHA 2E1OA 3HOVJ 4QQIA 3B7TA 2CGPA 1TT5B 1JTYA 4NDLA 4ENMA 2ZGDA 5BUZA 5FFZA 3VWBA 4XORA 3MMYB 2LUHA 4A2UA 5HQ8A 2QSGX 3IKTA 3CVUA 2FI7A 5J4YA 1AKHA 2JVHA 4A0YA 2VODA 1SD4A 2HFHA 3PE4A 5K5OA 2X6WA 3KS2A 2EFWA 2R05A 5EIBE 2Y48A 3MD2A 4XL9A 1UZCA 4G7HF 4UXNA 4BL0B 1VQLI 2L01A 2DN0A 1X2MA 3B02A 3BZ6A 3V42A 1V5EA 4LG0B 1BPOA 2CHWA 1TQMA 3GTPJ 4YDYA 3V31A 3FTSA 3E5QA 5JA4D 1Z05A 5BV0A 2LSVA 2LXLA 5FKLA 4F93B 3L54A 5BPIA 2EV6A 3COAC 1N77A 2GW1A 2OU2A 3X2QE 3DPDA 3IHUA 1QVUA 5FKOA 1VQ5I 2IS1A 4OAUC 5FROA 1HF8A 3DQVC 2R5ZB 4AY5A 3H9GA 2HOSA 2EFNA 1RUOA 4IHWA 4C0MA 3LQRA 4RS8A 5JHBA 1U9NA 1L5JA 2K5CA 2HR2A 3QQAA 3WTZA 2YSRA 1SZ9A 1FNNA 1EV7A 5CEDB 4ETSA 1IAWA 2WXNA 2UXNA 3SZPA 5IYDJ 2OA4A 5E17F 3MKQB 1KU9A 2BEDA 4HA8A 2RQPA 2FF4A 3RYRA 2NAZA 2HQNA 3B7RL 2UUZA 1MHQA 4QTRA 3C3OA 3RZDJ 2QSHX 3FXLA 4OAVB 3H36A 3KIOA 1U5TC 4M3BA 1XSVA 2F48A 1EF1C 1MNEA 4IQJA 3FDYA 3TW7A 5CMYA 1HKSA 3FTWA 1G3WA 3CVXA 3FM5A 2KCVA 1OCOE 1P9QC 2ILRA 4MO7A 4A3JJ 3LKUA 4W9RA 3JQ0A 4GPKA 4EM0B 5AARA 2KLOA 1Z77A 3L16A 3PREA 2XPVA 1OY3D 5KJKA 1ETWA 1GT0C 2R7DA 3CCVI 3CC2I 1IC8A 2V0PA 2W24A 5M5XJ 1U5TB 1A04A 4UWHA 2FE3A 3L7WA 1H8AC 2WXOA 3JAMK 2KC7A 1OCCH 4EQFA 4NC8A 5TGTA 2J49A 1UN9A 2K3FA 1JT6A 1K7AA 5DD4A 4N9IA 4UY8I 4NB5A 3CF5F 1MGTA 4E7IA 2FJ1A 3HXFA 5FQ7A 4BTBA 4J8FA 4AYBN 2KMUA 1Y8RB 1FX7A 3BG5A 4LERA 4CZ2D 3LY8A 2EBIA 4N9HA 4AIKA 3K4KA 2IP2A 2ZFUA 2DYSH 2XAHA 2F5VA 3U4TA 3NZSA 2MLGA 1TWGJ 2W82A 4A3EJ 5IT9K 4U95D 5GADJ 2P6SA 4RGRA 3GLXA 4QWQA 5GP9A 3SDBA 2Y0BG 3V79K 4HF2A 4CYCB 3F6VA 1I6HJ 2OJED 4BJTA 4PJNA 1RW2A 3FUEA 2LKPA 3H3UA 1ON1A 2ZMEC 3J7AY 5JJTA 3SF4A 3QOUA 4Q69A 3WTVC 4AIJA 4M3FA 1HCRA 2IS4A 1IUYA 3E33A 4U07A 2ONDA 3GCMA 3EQLF 2LSUA 4R8HA 2OV7A 3ZN0A 3FK6A 4BSZB 4N3BA 2XB0X 4II2A 4EHMA 4AUXA 4KNYA 3MZHA 5CBNA 4CDMA 2HXIA 1K78B 2HWVA 1X4PA 1ZLJA 4S0HB 3WTYC 3I4MJ 3BUAA 2HVRA 2QCOA 2OQGA 3ESWB 1GV5A 3OWTA 4FADA 2C0LA 5HODA 1MYOA 2CW0F 3LSPA 4HLYA 1ACIA 3GVAA 2PI0A 2R7VA 3Q73A 4BX9A 4MTEA 4C9BB 3WG7H 2DA4A 3ZIMA 1TQIA 3S2DJ 5KJMA 3J5QB 2QM3A 3E1SA 1AOYA 3DBHB 4U96D 2AO9A 3DBLB 1RNLA 3OOPA 3PFYA 2NVXJ 2Y4UA 1MD0A 1ZTRA 3OIQA 1H2TC 3ULQA 3TGOA 1KA8A 5F27A 3U64A 3K2AA 1RESA 3DSWA 1RC9A 3ERED 5HRYA 2M63A 5EX3A 5HDNA 3VPRA 2VJIA 1N11A 4EBAG 3PZ3A 2DOEA 3KP5A 3ROUA 1R4MB 4BY1J 2NS8A 2R7XA 2WVIA 2IAIA 5CQEA 2WMOA 3CO7C 1WRJA 5F04A 3QPSA 3RPUD 4RM2A 3R7RA 4LLNA 3GTJJ 3HG0D 2NOJB 5K7FA 4BKXA 4ACKA 4E7LA 4CGVA 2DIWA 3GX4X 5M3MJ 2ZISA 1FOYA 5AYWD 1FP1D 2PMUA 3FXKA 2CW8A 2E2HJ 4A69C 2NVTJ 4HNTA 3EHMA 3KP6A 4LSZE 1MMAA 5JLWA 3X2QH 2TCTA 4MGRA 4PFPA 3ZGKA 4H7XA 3A03A 3PNTA 2V1UA 2XEVA 3ZYQA 3CCSI 2ZNYA 2AWIA 4BY7J 2RREA 4Q47A 2EINE 5A23A 1N94A 4I6GA 2DA2A 2PEXA 3G1LA 2R7QA 5D4SA 1QRYA 3MV3B 1YE9A 3W9FA 4HI9A 4HQDA 2MBFA 4WWCA 2DZOA 3PEUB 2F4IA 1N25A 2F4OB 5E1ZB 5E8IA 3TWSA 1KYZA 3CJQB 3K4NA 5FT9A 1BR1A 2XAJA 5IPAA 4ANXA 2P5LC 3L22A 2VPRA 5KNGA 2E60A 2ZIRA 4DIQA 2I1KA 4N3CA 2ISYA 5F64A 4J7WA 3OYEA 2ME6A 2QQBA 2FQ3A 4CGWA 1IXCA 2DA3A 3KYCB 2KT0A 3NF1A 2ZJPF 3BT9A 2ESNA 4RDUA 4JB8P 3PSFA 5KHDA 4I9CA 4ZYAA 3L17A 5CERB 1OKRA 5F0HA 3KSQA 4FT8A 1G3YA 3O3KA 4CYCA 2BHZA 5HS7A 1HX8A 1LVAA 1P2FA 1ZKGA 4LMYA 3CVQA 3ULEG 1SD5A 4X0GA 3IEGA 3VFZA 1K83J 3QRFF 1X1PA 3QWWA 4QSHA 3KP3A 1VQ8I 3KCCA 2KZTB 3EETA 4G6DA 4U0UA 4HVBA 5FINA 1MIJA 4OMZA 1Z9CA 2LRDA 4WK8F 1TJFA 2EILE 2XC7A 4YG2F 2X1EA 2H6HA 2XF7A 3S3OA 4BGDA 3EDPA 2F5FA 3FU3A 2H6BA 3CMEI 3RZOJ 2HDCA 3DSTA 3BTCA 3VOEA 3BTIA 2XHEA 5GAEJ 1KGSA 3PIOF 1N95A 2FRHA 4EJUA 3F6QA 1TBXA 2WV1A 4CCJA 2V4HC 1MQSA 2KRFA 3HOWJ 2M8EA 1JWGA 2OOEA 3AS5A 3AG2E 5BOXA 3ASNE 4GU5A 3R9MA 4ABNA 4UUTA 4J01A 5FO5A 4TV7A 5G05J 1UB9A 1UHWA 1YYHA 3Q15A 1G3SA 5J8FA 3RIBA 1EH6A 5J40A 4FE4A 5LRRA 5J1YA 4RB3C 4FCYA 3CC7I 2Y1LE 1STZA 4XLEA 2ZXJA 4B8CB 4G25A 2MYSA 3OYIA 2D45A 1JPLA 3DCFA 3U66A 2DO7A 1SFUA 2RV8A 2X85A 1OQYA 3S3MA 3BOQA 2Q7FA 1ZYRF 3LPZA 2WAQA 3BPXA 3UUXA 3BR5A 2UXXA 1J59A 4EPZA 3DBRB 2FX0A 1S3JA 1XTAA 2HE0A 2XZTG 3S7FA 5J1RA 3HHGA 5K1YA 4DX7D 3DU6A 4CCOA 3S3NA 3E0JB 5F08A 2QYUA 3WTSC 3PDNA 4L9PA 2BGCA 1ZK8A 3HTUA 3TEDA 4AD9A 2FNPA 5DUKA 5E3LA 1BIAA 2NSZA 2A61A 4LCTA 2KRHA 4YDWA 1GXPA 2V6EA 3OYDA 3WGIA 4XI9A 4NHJA 1H9TA 4XLAA 2XAQA 2P8TA 4M74A 4M6YA 2K3PA 3PUJA 4KA4A 4U63A 2VTBA 1OCZH 5C4JJ 2KZVA 3MKLA 2WB1N 4JHJA 2X6OA 4XN0A 1SD7A 3C2HA 5D0QD 1JXSA 1JCSA 3JQ1A 4NQWA 2XGEA 4BXFA 5BPDA 3SNXA 3BR0A 3J81K 1NFIE 4RVBA 4ZDPA 3I54A 1UHMA 4OIPF 1MMNA 3FULA 4P29A 3NQPA 4EM2A 1A6QA 4P5OA 2B0OE 4B89A 5BXOA 1TWFJ 1EH8A 3LXUX 5BXUA 2P9PG 3C7JA 4O1OA 1MBKA 3R6SA 3Q78A 4I1OB 4AVPA 3BP8A 1QNFA 1NTCA 5IP9J 3CJNA 4M6VA 1HW5A 3KP2A 4UVBA 5LGNA 5FLMJ 2VJ8A 1SVLA 4UUCA 3UM1A 4ESFA 4MQ9F 2R4GA 2VOPA 2NVYJ 4K2EA 2HYJA 3L82A 1PUFA 3L08A 1T56A 4CXFA 2CH0A 5FD6A 5KNLA 2X6JA 3SEQA 1YW9A 3ASDA 3FTVA 4BX8A 5A6CA 2FA5A 1JHFA 2Y3AA 1GDTA 1KPSB 3WG7E 2JQ7A 1ELKA 3ZUVB 4BQOA 4O1PA 4E70A 3S17J 2EWNA 3FKJA 2E35A 4DX2A 3TOBA 4ZYEA 4LUNU 3KYLA 1JGGA 3NOGD 2FOWA 4RAFA 1XGWA 3QOPA 2PFBA 1JUSA 1USSA 3DKYA 2J8SD 3P2BA 2DXIA 4CCKA 2AXVA 4JEUA 4G94A 2V4LA 4Z6YA 3A1YA 3TP0A 1OWMA 3HXLA 5L3CA 1HSJA 1OR7A 2KIFA 2XPUA 1D5VA 1WHUA 2GRNB 5IYBJ 1TNOA 1UG0A 4YDEA 2CQXA 5HLIA 1NH3A 2XPWA 3MCXA 1WJBA 3SZTA 2VN2A 3C72A 4XNFA 1EF4A 3GZ1A 2IVMA 4CO8A 3CVNA 5F6FA 5GTHC 4HOUA 2GLOA 3K0LA 3S1MJ 1O7FA 1K8KG 2OCCH 1SFOJ 4RB1A 1SMYF 3HB9A 4CT0A 2VL8A 4D9JA 1IQUA 4NUBA 2ZB9A 2DOAA 4KMFA 2VLAA 1IJWC 3ZQHA 4ZJZA 3ASHA 2VSXE 3CHQA 3OYBA 4UUSA 1U9OA 2XS8A 1VTNC 4F1PA 1D8EA 5T8IA 5LX8A 3W9GA 4OIOF 4LGWA 1WJDA 4KDPA 2HGCA 4A3KJ 2P2CP 2MOWA 1X2NA 2D1VA 2JMWA 3GFJA 4CT4A 1YO5C 3P5JA 1OWLA 2KP6A 4B3AA 3GZSA 3UT8A 2X3MA 3PEVB 3OYHA 1Z6RA 3JAMZ 4XLPF 4MQVA 3W2VA 2GAUA 2ACJA 3CF2A 3DEEA 2AJAA 3K10A 4XLFA 1REPC 3LNQA 5EYLA 5DS9A 3CCRI 1FCHA 4NC7A 5CMWA 4XI0A 4XLCA 1YHQI 4C2UA 3U21A 4DPRA 3BG6A 3TP3A 3RK6A 4IZZA 1WVRA 2BVMA 2L9VA 1EJ9A 2A07F 4NRHB 2I6HA 2VSNA 2EV5A 1X5BA 2PM7A 3E5XA 4KZ0A 4L9VA 4HQEA 2VONA 2L6JA 2PX9A 3FUJA 3E6DA 1VF9A 3BR6A 4ESBA 4KT5C 3PVLA 1SAXA 2CYYA 4UVAA 2G9WA 4JYKA 1W0TA 1RUNA 2E0IA 2W4SA 2CSOA 4A3MJ 4D7NA 4YRVA 4ATZD 2EZLA 3HJEA 4E4HA 1TN8A 2WXLA 4BE1A 2G0EA 3ABTA 1E2XA 4CH7A 3CDIA 4Y33A 4FP7A 1TEZA 3QYFA 4TUMA 3GZ5A 2AXUA 3TWVA 1K78A 5CVUA 2VYIA 4BDYA 1W5CC 1D0XA 2L6BA 2DYSE 4HNAD 3CHPA 3G3ZA 5E3OA 3D9PA 4FJZA 1XC5A 4EV0A 2NRAC 4XMYA 1BC8C 3BG0B 4WUYA 3M9AA 2I1JA 3K2ZA 4I0AA 2VJJA 3SD5A 3UX4A 1MX2A 2K02A 4XLNF 3OYLA 2K4BA 3U3WA 2VXDA 5F0FA 5EKQD 1W4MA 3M4OJ 2DI3A 1VFCA 4I9EA 2VJ5A 4KXKB 1Y1VJ 4XE0A 2OZ6A 2HZDA 1YJWI 1SA4A 2QBYA 3RO3A 1X3UA 1B8IB 3CVPA 2VE8A 4GZ3A 4XRSG 3OS1A 4G9YA 2BXZA 1N4SA 3S2WA 4ANJA 1XSXA 2L9SA 1MX4A 1UJKA 3DTEA 2BF0X 4KYOB 2EH3A 2LBFB 3CCLI 2ZXWH 3AS4A 2XV4S 4C9YA 2F6CA 3TJPA 1F36A 3F8FA 2STWA 4ON0A 9ANTA 3OXFA 1FYKA 5AIPA 3RCOA 2VC0A 3OMYA 3VLDA 5EJCA 4M6XA 3ESLA 1S9HA 1JUPA 1SC7A 5FWQA 3NAUA 3CMYA 3HRTA 1OR7C 5FQ6A 1FBQA 2E2JJ 2GRPB 4CEMA 4BUPA 3VYTB 4DYQA 2IOSA 4L2YA 3C5RA 3MZYA 1S5LC 4KIFA 2LXMA 4KZCA 4GCNA 1LDJA 1B89A 3BG7A 3Q47B 5FKMA 1FVFA 1UAAA 4FHKA 5KJLA 1BI3A 1DUXC 1WWXA 3OSGA 3LJNA 3OXGA 2RNGA 1OT8A 4HPQA 1NP7A 1FSEA 3FHEA 3B95A 3HXDA 1B4AA 3U2RA 2DU9A 5LHIA 3JYSA 2V1XA 4M3OA 2JRTA 3IL2A 1FYMA 1LEBA 3GFMA 3CHOA 4LK0F 2HPIA 2EV0A 1LFBA 2YPRA 3U1KA 3UIOC 3JTGA 3CK8A 4IJAA 3ASFA 3HGGA 2F0YA 2XEEA 3EIQC 3HRSA 3Q9SA 3PZDA 2VPLA 1OCTC 3EUKL 4G8XA 3G1OA 2DYRH 3OIOA 4IF4A 1XSDA 2A69F 1POGA 2CFZA 1B59A 1H6PA 4UB6C 1ITYA 1E17A 1AWCA 4XSZF 2ZGGA 3A0HC 4BBSJ 2XPZA 3LVRE 3APCA 4I43A 1ONVA 1BJAA 2FOKA 3QYBA 3HOZJ 1ELRA 1VDYA 1WAO1 2YQ8A 1HC8A 3BG1B 4TXRA 2OVFA 1S70B 2IQCA 3SGHA 1J2XA 2OUMA 2BE5F 3QYEA 3JRFA 2GROB 2IU1A 2EILH 3AG3H 4L9JA 1CQTA 2VQCA 2A4ZA 3FWEA 2XASA 2ZO4A 2LO6A 2LY9A 4A3LJ 4OMYA 4XZ4A 4OOIA 4BYYA 3KEAA 1Z3XA 1HBXG 1QU3A 4CCNA 2IO2C 1MMGA 1A31A 3KX2A 5HVQC 4JA9A 3CZ6A 1E7VA 2M45A 4DNCA 1QVTA 3DPLC 2VUMJ 2DFEA 2GRMA 3HYMB 4EZLA 2GOMA 1W3BA 1JTXA 4A55A 3LSRA 3GTQJ 4BACA 1FTTA 4KIGA 3ZQ7A 3FH7A 4A3CJ 2XGCA 3CUQB 4I0BA 2AS5F 4HOSA 1K79A 5CLSA 4K0RA 3HKZA 3QAHA 4L0YB 1H2UA 4U0YA 2R02A 4L23A 4UWGA 1QQIA 1N4PA 2VT2A 5E1WA 3L2QA 1TNZA 4TV3A 2CG3A 2LG4A 4DQ2A 2V1NA 3BC8A 3CUQA 4EGZA 1NZNA 1K6YA 1MSEC 1I1GA 2KIQA 2LBFA 4JP0A 2P9SG 4HG2A 1Z1DA 4N4OB 2M9HA 1YLFA 3MJWA 2CO5A 1S7EA 1B72A 5KAIC 2ID3A 3ECOA 4U0WA 4BXUA 1TNSA 2V9VA 1V5FA 3I9V2 4B47A 3ML6A 3H3VK 2CG2A 2FO1E 5FLVA 4EZJA 3C18A 3RPUA 1YX3A 3JTHA 2L0KA 1ULYA 3HEFA 2PG4A 5D8LB 1YW8A 3RYPA 4DGWB 1UJJA 1R00A 2UWMA 3W6KB 2ELKA 2DVWA 4PSWA 3OIPA 2A6TA 1N52A 1IN5A 5CHEE 2R3SA 3TL5A 3ZYMA 2Y0SA 3T1BA 2A68F 4TRQA 2B6CA 3HVEB 2XIGA 3WGHA 3ONKA 4UI9C 4M9ZA 3LFKA 5JVGF 4GGGA 4M9XA 4N3AA 2W84A 2Y31A 2XROA 4IO9F 1DCQA 1XGSA 1V4RA 2HOAA 4BE2A 3HPHA 4L1BA 4AOFA 3QP5A 2XGSA 3D5LA 2P9NG 2CQQA 3Q49B 4U0ZA 1YCSB 1TYQG 4I99C 2IEKA 3HOTA 4KMOA 3HC7A 3I55I 2KPMA 3C3RA 3F8BA 4GTPA 2RDPA 2Y69E 2WADA 2FBIA 5GAGJ 3LL7A 1IG7A 4LG6A 4B0ZA 1HLVA 1XDSA 2WXMA 2KDZA 4FJYA 3GXOA 2LNBA 4I09A 3W6VA 2O61A 4RSYA 3RSEG 5KBAA 1UFMA 4H0EA 3TQNA 3CLJA 5B1BH 3EYYA 1ETOA 3H5AA 4EJWA 4CRWA 5L3EA 3Q9NC 3WTXC 4DW6A 4DZJA 4B1RA 3UM2A 2VKEA 4M3GA 4UWLA 3V2OA 1O3TA 3TWTA 3QJZA 1J75A 5B1BE 4JX6A 5CRVA 1DPUA 2L7KA 2W1OA 3DPYA 1HFAA 1NG6A 1EA3A 5D4RA 5D66A 1LFUP 3RTRA 3K4CA 3CUQC 3HIZA 2I5UA 2FBHA 4GO1A 4NQ0A 4ILGA 4WNGA 1KYWA 2CFXA 5EGOA 2W25A 5CVJA 4YDOA 3ZYKA 2HQRA 1WH5A 4YFNF 4ZYDA 5AIJA 2Z99A 3F8NA 1E3OC 4APOA 5D8KB 1MBEA 4U87A 5KAFC 3EU5A 2MG4A 4P9UA 1Y0UA 1YTYA 3LSIA 2KJCA 4HOTA 1INZA 1T0FA 1XCBA 2HTSA 3M8FA 4JVSA 4IHSA 2QVOA 3KD7A 2Z2SB 2OPTA 4Y13A 1RKWA 5A2QZ 1HS6A 3CHSA 4WAFA 4BERA 3PH0C 4EBAA 2VT3A 2XAGA 4D5CA 3K6GA 1IO2A 4BSXA 2HXOA 1IDYA 3ZHEB 2BOLA 2BY3A 2DZNA 2LK2A 3G2BA 2ESHA 2OEVA 5K7ZA 2HOEA 3EU9A 1WKMA 2K9LA 5IT9Z 2NYJA 4UHTA 3Q75A 4XIDA 4KYWA 4ZHBA 1W7PA 3VDXA 4XONA 2DMUA 3ZXPA 5KK1A 3MEXA 2NXPA 4WNEA 1FWZA 3MQ0A 2IS6A 4UV9A 1H6OA 3SYTA 1TWHJ 5ENRD 1U3EM 4IEJA 3URZA 2ZXHA 3VEPA 1HU3A 3ABMH 1PYVA 1TNTA 3BWGA 2V1DA 4ME2A 2AQFA 2X0LA 3MCZA 1UW4B 4KISA 4PS7A 2AXLA 2FD5A 3ZOBA 3TWUA 4NIKA 2M4KA 2X6XA 2V9KA 4XICA 2JUGA 1BOAA 1A36A 2NVQJ 5CKTA 2IS2A 1FPQA 2E7XA 1JKRC 2F5CA 1BA5A 3AJIA 3OXLA 2QKLB 4A1SA 5J08A 5TRDA 4HX4A 1ZN2A 4QPQA 2IA0A 1EPUA 2G7HA 4AM9A 3G4SI 3UM0A 4Y3OA 4BQAA 3E97A 1LJ9A 3MKZA 2V8SE 3ZPLA 1HOMA 5ENNA 2PMZA 2F8YA 1R36A 1Q1VA 1NHAA 3Q0WA 1I27A 2YX7A 2Y0SN 3JCUC 4Y6CA 2WAFA 2ZJ2A 4ENKA 1HZ4A 3ABME 1D3YA 2A6HF 4GYIA 1X19A 2PQ8A 4XR6A 5EYRA 4AIDA 3CKBA 1OYYA 1O1TA 3UNGC 5CCMA 2YNQA 3P7NA 2VQHA 3ERMA 1IF1A 1BBYA 4KT6A 2J4DA 2ZXWE 2WC2A 4XQFA 3OR2C 4B8XA 5E18F 3Q0UA 2I10A 1DP3A 4G6QA 3VB2A 4KITB 1TW3A 2X6YA 4QIWN 3MZ8A 2CWEA 3JRDA 2R7SA 4MTDA 4K03A 2LREA 3CTAA 1MSFC 3ML8A 5KVRA 3DF8A 2VGYA 4ANVA 5J47A 4UUVA 4HBLA 4MHGA 3WU0A 1Y1WJ 5J1UA 2FSWA 3L2CA 2DMTA 2DA7A 1ZQ3P 2DOFA 1JUMA 2V5FA 5CJ9A 2YHEA 3FTXA 2VKVA 4YEJA 1HE8A 3FEYA 2XGXA 2F5DA 1ORKA 3FX3A 5BQTA 2RFAA 3IKVA 1FSHA 3QNKA 5IYCJ 3OOUA 2BV6A 2RNJA 4BHBA 4BQNA 3I56I 1SVXA 1P7JA 3GZ2A 5ENQD 2UZKA 2LLKA 2Q2EB 3ZMUA 1YS7A 1YIOA 1HW2A 3NRVA 3MYVA 3VTYA 1IV6A 3E6MA 1FJLA 5FLXK 2HO1A 4PS8A 2LYCA 4CDNA 4R79A 4IN3B 4IX7A 1Y39A 2V9PA 4GMLA 4BT8A 3I59B 1DGWY 4F3QA 3NOCD 3G71I 3HDDA 4LG3A 3J7AO 2H6GA 3CCUI 3BJ6A 3KAEA 3WTTC 3RQIA 3ZN3A 3DU5A 3TXNA 3ZHEA 4CCAA 3RKXA 1MDMA 2X4HA 2EPFA 2Z33A 1MBJA 4I7HA 2XB5A 3QPLA 4S05A 2JLBA 5DM7F 2JVGA 3T5XA 1N0RA 2GA2A 2L0TB 3MX3A 2JA2A 1FMVA 1S8NA 3ASGA 1MZCA 4RGSA 4RA2A 3M8JA 1LQ1A 4CGZA 2UWJG 4XIFA 3EHQA 4J8SA 4K5CA 2Q2EA 4BBRJ 2HDDA 5G55A 3E4BA 1MMSA 3L2WA 4KIBA 5FQ8A 2CMPA 2EIJH 5FLXZ 3HDXA 1KZOA 1BI2A 5DIZA 1B72B 2M87A 2KXPC 3CK7A 2P9LG 3OV8A 5FB2A 4UQZA 4L18B 3S1QJ 1Z5SC 4PJMA 1VQ6I 3I71A 5EIDA 5LD2C 1UG2A 4IOAF 4EM1A 3LA3A 1RIOH 4U8HA 1K6OA 3HOXJ 2HKXA 4OWRB 5E76A 4CHUA 2KZGA 1FLIA 2EFOA 2LVSA 3CGHA 4PDXA 1F5TA 1QBQA 4F3VA 2LR8A 1G4DA 1MBGA 4CICA 1D1CA 3BR1A 3T8MA 5IOYA 3GTGJ 4RM3A 2CS3A 3MGBA 3S7DA 2R7FA 2EQRA 2WTEA 2ZNZA 1Y0NA 2B0LA 3E6BA 5J6XA 3ABKH 2GM4A 1FT1A 4HX7A 2XKPA 3I4NJ 4A3FJ 1BC7C 3BG9A 3IC7A 1MNMC 3QU3A 1FIAA 5F1JA 4HS2A 3FBNB 3K4MA 3VYSB 3CP8A 4FULA 1I5ZA 3LJ3A 2DQLA 2BBYA 3AG2H 4XKCA 3OYJA 1VNDA 4L0ZB 4R7LA 3RKVA 2KIUA 2QGUA 4IQ4A 1ENHA 2MRIA 4RG9A 4KMUX 1IQRA 3MKYB 4LNGA 1XX5A 4GTVA 1JT0A 3GMEA 1HO8A 2VGXB 3AU5A 1WI9A 5FZSA 2P5VA 2EA4A 3K1MA 4F52A 1IDZA 3QK0A 3ZP5A 1VQMI 1SVOA 3CDLA 1MZBA 4BJ5C 5FJ8J 3W6JB 1EKEA 4RAYA 4H7YA 4DX1A 4I02A 3BTJA 3J7ZI 2E19A 1A5JA 3LCAA 1S7AA 3KLNA 2M34A 2EZHA 4IRGA 2XSJC 2DFHA 2IY0C 4IRIA 4HSRA 1UOHA 5ED4A 2L9BA 3KEYA 1K1AA 3FWVA 3LQQA 4BNCA 4GMRA 1ZLKA 1KQ8A 4MIMA 4R1HA 2MC3A 3EUAA 2HOTA 4OYSA 3I4GA 2YUSA 1O3QA 2ECCA 4CZCA 3ZGQA 2QSFX 1IRZA 4RQIA 1X1CA 2LF7A 2LFBA 1OJLA 4A5MA 1OWNA 5ANRA 2M1BA 3T8KA 1TT0A 5CPRB 2NS0A 3FUKA 1GVJA 4ZDLA 1ETQA 3A01A 2DTZA 5HS8A 1CGPA 4BEHB 2PJRB 1E0EA 4EQQA 4DLOA 3KLOA 4HFGA 1ZREA 1ZG3A 1H89C 2R2LA 2GRLA 1HXDA 3WG9A 2XSDC 1FPPA 5AQ7A 4I6EA 1MX6A 5IY5E 4LFUA 1U3DA 3GZNB 2HEOA 3T5VA 1KQ0A 2CW7A 3GTMJ 4BEHA 2PJRA 2ZMEB 3S16J 2HYFA 1XNFA 2MD0A 2Y9YA 3TXMA 3DEUA 3EUHA 4EMSA 4HRLA 3KFWX 4IYPA 2NNNA 4G12A 4E7SA 1RR7A 1N9AA 1YMPA 1CF7B 1MNDA 4XKBA 4AV7A 5D5VB 1BI1A 3V7CA 4HF1A 3IAM2 3ZNGA 5B3SE 2WXIA 4LD5A 3FMQA 4E7KA 3ZMSA 3DBSA 3E37A 2QWWA 2HYGD 3F8MA 1Y8MA 1O1SA 5CRUA 1DU6A 5CQGA 2JJ7A 3FP3A 1H9GA 4JQFA 2GOXB 5ICFA 5JHFA 1F9NA 1LDKB 3A01B 2R7TA 4B44A 1PC2A 1I6XA 2JPCA 2B7EA 3H3ZA 2JA5J 3FXUA 2QF7A 2LSOA 3FUNA 2OD5A 3NB2A 6PAXA 3QKYA 4V2GA 1LD8A 1B8IA 3BY6A 4DZPA 5J8CA 3F6OA 3CDHA 2STTA 2JABA 2LAIA 2X6IA 3HUGA 5EF6A 3MKRA 3Q79A 1G8XA 1R49A 3FMRA 2FEZA 4OIRF 3TWQA 3FXQA 2LP0A 4GPMA 1FTZA 1IN7A 5JHUA 2LNIA 3G2UA 3KYDB 1V54H 2PZIA 1LF8A 1V55H 3LY7A 2VB6A 2WQ7A 1LKXA 4HZFA 5BV1A 4GTTA 1Z67A 3MKWB 3D9OA 1OCRE 1GLNA 1Z7LA 4JX4A 1GV2A 1JI8A 5B3SH 1N0QA 3FMSA 4LEUA 1D8JA 4F1SA 2WM9A 4A12A 1E3PA 2ECBA 2KHMA 3S93A 3G73A 5D6FA 1OFCX 4AYBA 3CCEI 3H5NA 3I59A 3L2RA 3ZQCA 1S72I 4U7BA 2GBYA 4FHJA 1BU9A 1UELB 1WM5A 3TGNA 4IXAA 1ZB1A 3ZMTA 2Q0OA 1XPXA 1KONA 4XRFA 2OCEA 4Y4RA 1MBHA 1V3FA 5DTDA 2WY7Q 2QUFA 3JSPA 1MDMB 4A93J 1WJEA 2MYOA 1DQUA 5LP0A 3JREA 2WMNA 3HGYA 1AU7A 2IOLA 4MS6A 2K9SA 3JR9A 3ISMC 3GFLA 4LG0A 4DYRA 5C4XJ 2R93J 2RKKA 5FKNA 1IXRC 1JKOC 2OC6A 3R9AB 1W36D 2ID6A 3FXJA 1B9NA 3BQZA 3VSLA 2P7VB 2IGKA 4Y15A 4FU3A 4LNUD 2GA1A 3IH3A 5ILSA 1T0FC 5BPPA 2L5QA 2P5KA 2D5VA 3BU8A 4RGXA 1YFHA 2KJBA 2ADUA 3SZGA 3D1NI 4LJZF 1QHGA 4JL0A 5G2NA 4X1EA 2R5ZA 2M7AA 1X3WB 2CUFA 2Q8KA 4H4KC 3SEZA 3WU1B 2GRQB 1OMIA 3BR3A 2DJNA 3KEOA 5L3DA 1K61A 4E85A 1X1BA 4GA0A 2YU9J 2L9NA 3O48A 2XGMA 4EZKA 5AQ9A 4JW1A 2QFCA 3MN2A 3IP4B 2BY0A 2PMZN 4XN3A 2FNAA 4F7ZA 4W1UA 2P9UG 3PNVA 1TR4A 4FC8A 5IP7J 1N4QA 2QZAA 1TP4A 2VQGA 2DMQA 4GB9A 4IHYA 2QC9A 3PJRA 4BY6A 1ZGJA 5HI7A 3RKQA 1HSTA 1HKQA 1YJ9I 4ZTJA 1YX5A 2OEWA 3QDNA 2QEXI 3CVYA 1NK3P 1D9SA 3UM3A 1OUVA 2O8XA 3ISPA 1S64A 2OBPA 4ENJA 3IHYA 3SHFA 1XN7A 5M5WJ 1U8BA 2RD0A 1E7UA 2GZWA 3SBSA 4HV5A 2V79A 1B1BA 3G1MA 2N8GA 3I4PA 2XAFA 1SFKA 2ZSHB 3IBEA 4J8YA 4I76A 3D9HA 1AWCB 1JUQA 2Y69H 4D5FA 3PE3A 3ZQQA 3IAS2 1PUEE 2PN6A 5FFXA 3T0YA 3CVVA 4RLYA 1R71A 2HQ5A 2V6CA 3NBNB 3WE3A 2JTVA 3PNTB 4K5BA 2JN6A 3B73A 4XRSA 5LOZA 3DV8A 3ABKE 2JEKA 3HRMA 4LITA 1HF0A 3DSUA 3MV2B 4I6JA 2OCCE 1OYWA 5AN8A 2LMDA 2WY8Q 1BOBA 2LKSA 4I01A 3HTSB 3GTKJ 2ELJA 2R5SA 3BZKA 3DPTA 3F23A 2D1HA 4IHXA 1PP7U 4XKWA 2CJJA 2P7CB 3OTNA 3EUHC 3LSKA 5KJNA 4BWRA 1NG7A 3C2BA 1OWOA 3RIRA 2VGEA 1G3TA 4A6EA 4LIVA 5LFAA 3ASNH 5CVVA 3HL2A 3D9MA 2VJ4A 1FT2A 2WBMA 2AHQA 4HB5A 3U1DA 3DSXA 3H1CA 3E7LA 4BU2A 3K1NA 1VZ0A 3LSHA 3M3YJ 1JWFA 2X1CA 2JA6J 1QA6A 5A2QK 2AXZA 2QY7A 1IXSB 2E2EA 1APLC 2JSCA 5LLQA 2X9DA 3ELKA 5E79C 1JHHA 2IJLA 2KIMA 2Y30A 4W97A 4MKTA 1W0UA 4BEPA 2B63J 5ICEA 4EVIA 1A5EA 4L5EA 1MMDA 1ZG5A 1ZU2A 2QA4I 2Y75A 5H2FC 2EIKH 4J0UA 1ZH5A 3FXMA 1R58A 2DAOA 3CMMA 4A3BJ 3QP6A 3HOSA 4YIRX 4O5VA 3JRAA 1RZ4A 2QYOA 2P4WA 2F5EA 1XGMA 2JZYA 3KEZA 3G2SA 4GA1A 2K9NA 4HX8A 5DD8A 5TJJA 4BXXJ 1ETXA 2XRLA 2XRZA 2L54A 1QPIA 2WPVA 4OVUA 3RU0A 3OYKA 3ABLE 3VLEA 1MH3A 2IJGX 1FBUA 2JWTA 2WAEA 1R5ID 5K7HA 2VE9A 4IL6C 3APFA 2WXFA 3CEQA 3LWFA 4LOCA 2BVLA 2O03A 5EILA 1WGXA 2Z9OA 3D9LA 2DFFA 4J00A 2E1MB 4XM3A 1O1RA 3ASOE 2FMLA 5B1AH 4PGGA 1NL4A 3FUIA 5G04J 3CMAI 3HOYJ 4DX6D 2ZCWA 1H2VC 4GXOA 1JJ8C 3ZN1A 3EHNA 4FLBA 3MKQA 4UB8C 4NNJA 5JMND 1VQ4I 3RO2A 3SQVA 3U9WA 3DLLF 3PUBA 4DLQA 3UT7A 4KJZA 1O3RA 4G7ZF 1HH8A 1W5TA 3DXJF 1R7JA 3KP4A 1D8DA 2QLZA 5ICCA 4A3DJ 4GMJA 1P4XA 3OYFA 5FKKA 2IT0A 1SZAA 2EINH 3ZFWA 2WXHA 1Z21A 2FUG2 1SEUA 1KLXA 3IRRA 5ERIA 3ABLH 3BR2A 3CESA 1ZAOA 3ABUA 1SQMA 4AWXB 2Q1ZB 2R7OA 5LHGA 4L2LA 5AQAA 4B09A 5FTPA 3B6AA 4LK1F 5T4YA 4QLCU 2XCCA 5LRSA 3ONLA 2MGQA 1LNWA 3CHRA 4DX5D 2WXJA 3EPZA 1YW7A 3HHHA 4YFXF 1XB4A 4WCGA 1U78A 1H88C 2HPMA 2ETCA 4PH4B 3UT4A 2VI6A 3FF5A 2K9QA 1S6LA 4YELA 4WX9A 2A05A 4ZTFA 4A3GJ 1SANA 3R4KA 3FTUA 2DTRA 1YOVB 4PZJA 4M71A 2J09A 4BESA 2K9MA 2O8KA 5BT1A 2Y9ZA 2JPBA 5ILUA 1HKTA 2QBYB 1N54A 1SMTA 3QU6A 3GYZA 3LS8A 5HKPA 2MA3A 3O8HA 3B7SA 2L9RA 3FU0A 4ANWA 2R5YB 4CA0A 2EIJE 1TQPA 4EGYA 2C2LA 3LYAA 4C3HJ 3NARA 1U6GA 1LPQA 3TG5A 3EUVA 2HTJA 5EG0A 5D6EA 5H6QA 2VASA 1GHCA 3TWRA 2OTLI 2DMPA 4AVZA 4CYMD 4O6JA 1T08B 3ECHA 3BEEA 3M1CA 5E75A 2QQ8A 2EIME 3ZEFA 2C0MA 4P96A 3M7GA 4RGUA 4I1AA 1XCVA 4ILHB 4XX5A 4G8KA 3N71A 4FISA 4Y52J 2BY1A 1JKPC 2DJIA 1K3ZD 2B9SA 3QODA 2FULA 3IUOA 3AAAC 2VBWA 4MFEA 2JA8J 1QBJA 5AJDA 4LIUA 4HDUA 4UQYA 2R5YA 1BL0A 4C2TA 2ETAA 3Q9UC 5BW8C 4M3EA 4Z68A 4GTQA 3UINC 1ERDA 1YS6A 2DQRA 2GXGA 2XVCA 1K4TA 1DGRM 2HNHA 2KM4A 3GUDA 3AG4H 4J6IA 1ETKA 1P4WA 1G59A 1QO0D 3CLQA 4A3VA 1ZR4A 4JK1X 2CQKA 2XF5A 5DV5A 3LEWA 2LOOA 2NYXA 3CUOA 3K7AJ 1ZG1A 4N39A 3GW2A 2A6EF 2R17C 1WDYA 5EX0A 4U0SA 2CG4A 4XBFA 2H27A 3CK9A 3ULQB 4JBAA 5TISC 1PY1A 4GA2A 1MKMA 1BI7B 2P81A 1TWCJ 1LE8A 4APFA 5KWDA 3V7SA 3OYMA 4O6FA 3RKWA 2RN7A 3LDZA 4WXHA 2L2OA 4GTSA 5DYMA 2CV2A 2OZUA 3ZQIA 4FTHA 2E71A 3S15J 2FBKA 3AKZA 1UMQA 2L3DA 1AHDP 3I5PA 4JHRA 4JC8A 1KU3A 3HXBA 3K4BA 3D5RC 5AJLA 1BW6A 3PZ1A 2JT1A 4ZYHA 2L7FP 3LSGA 1NA3A 1WJ5A 3I4RB 2QKMB 4M73A 2WB1A 2GWRA 2WWYA 3I3NA 3ZW3A 4NBQA 3ZU7B 5F1RA 4E7ZA 1FIPA 4PJ0C 4LLLA 1R5GA 1HW1A 3RQ4A 1M1EB 2IONA 2X38A 4GTRA 4IULA 2VBXA 1WPKA 3HRUA 4FE7A 4I98B 4U8VD 5ICGA 3RJVA 4LRZA 1XG1A 3ASOH 4RAZA 1WSUA 2E34A 3QB2A 4GYYA 5L3GA 5AONA 3ZCOA 4MBGA 2CU7A 3JRHA 2K86A 1OCRH 2XKOA 4BAYA 3MFKA 4HI8A 4L5JA 2OQRA 4YVQC 3M07A 4HSTA 2XRYA 3PM1A 3BQOA 1KU2A 4HF0A 3BLYA 4BH9A 3JRBA 3TAXA 1WH7A 2L4AA 3TWXA 3A4CA 2X6KA 2H09A 5E1XA 3DXMG 1Z91A 3I5UA 3L13A 2VIXA 5B66C 2XHKA 4DOZA 2IPQX 1H0MA 1ZARA 2RG8A 3G2VA 2M0MA 2WB2A 3ENEA 3QOEA 3D3MA 3LSTA 2DWZA 5JI6A 4V19K 4UI9K 2YR2A 1IN6A 1P92A 2EZIA 2CUJA 3UQ3A 3FIWA 2EIKE 2HQAA 2V4JC 5EZHA 3L2VA 2AW6A 3MWMA 1PVEA 2KRCA 3N05A 4PJLA 2BY2A 1W5SA 2J07A 2PM6A 3Q4AB 4PUCA 1QZEA 4O3MA 3VYRB 2H8RA 2UY1A 1E8WA 5DCMA 1JE8A 2HM8A 1U2VG 4BTAA 1WI3A 5ENTD 3FXOA 3QARA 3DKXA 3GYHX 4B94A 2VQLA 1X1DA 3DSSA 1LDDA 4PJJA 4A5NA 5H6RA 4KN4X 4C2MJ 2CQ7A 2DODA 1YJNI 1F4KA 2UY1B 3DSVA 5CVIA 4HBDA 2CHXA 1LTXA 3TWWA 4ZZDA 5HDKA 1ZHFA 2KDOA 2X1DA 2DDBA 2LC2A 1YITI 2VXZA 3HKZN 3K69A 4Q96A 2IF4A 2CRGA 2LD5A 4J8EA 1IHGA 2GXAA 4HRNA 2EFPA 1TNYA 1FC3A 3AG1E 5J90A 1FBSA 2EZKA 3A0BC 4AIFA 2DK5A 1AA7A 4U88A 2O0YA 5HLTA 1UCRA 1TJCA 2RVCA 3LSJA 1MH4A 3CP2A 4M3DA 3HSFA 3RJPA 3S7JA 4C30A 3FFLA 2E7WA 3I58A 3CQZJ 4A0XA 1ZBPA 3ZXSA 4CZZA 2PQRA 1LVKA 3SJMA 4IHTA 3DFGA 3WXXA 2P6TA 1AP7A 1J0RA 2KCKA 3HSRA 3OS0A 3PZ2A 1I3AA 2PNNA 1PP8F 4EECA 2ZKZA 1LE8B 3AL0B 1T2KA 4XKVA 5KCMA 1I1SA 5C1DA 2H6FA 2FO7A 3FUDA 3C2GA 4Y17A 1FOXA 2GIZA 5LEKA 4PCQA 5EDNA 1QQEA 2RAEA 4MFDA 4GDFA 4J8DA 2K27A 4HYEA 4DI3A 1HQCA 1YQAA 1XS9A 4HV6A 1KZPA 3JRGA 4GTMA 2F4MB 3P9KA 3ZMZA 4IPAA 4ZZLA 3J81Z 5EEAA 1PAQA 3FY4A 4B3XA 4F53A 4JEHA 1K4SA 3BZCA 4Q4ZF 1QHHD 2NVUB 4CDRA 3R60A 4RB2C 1BIBA 3UR3C 2R03A 1IRXA 3FH8A 2GXBA 2DBBA 1ELWA 4WNFA 3PL8A 4P1WA 3CJRB 4L9TA 3V2XA 3CLOA 3P9CA 4XSXF 1R4NB 2XAUA 1Z7UA 2MW8A 2QQ9A 3H5RA 3VTXA 4B43A 4I6ZA 4GCOA 1E8YA 1RETA 1CF7A 3T8RA 3RSNA 2M7BA 1ON2A 3K4LA 1BM9A 2EIMH 3ZQGA 1HG2A 4F91B 2V5QC 3CV0A 5EN5D 5DEQA 2E1CA 1OXJA 3S1NJ 1V5GA 2HR3A 2KZTA 3KEQA 4C48B 3Q5MA 3V8JA 3FU5A 2CV1A 1R6RA 1EH7A 3BROA 3MAJA 4I2OA 3FU6A 1Z6TA 3TBIA 2PBIA 5IP6A 3ZRHA 3IV5A 1FMWA 3F9KA 4HQMA 5FZRA 3LOCA 1DPRA 1QYMA 3FM3A 3DTIA 3IH4A 2W00A 2Y2ZA 4OU0A 4LB5A 2L0IA 3HUGB 2NOGA 1VQKI 1X3ZB 5F0CA 5BMZA 3DWLG 4JA7A 4XOPA 1O57A 1NA0A 4L7TA 2BHYA 1IN4A 2Y0MA 1XGNA 3IRQA 4WF2A 5GTIC 2C6YA 2XPYA 5HS9A 1X1AA 4AVXA 1D1AA 1L3LA 3L9TA 1PJRA 3SZ7A 2E5NA 1FOKA 2VKDA 3KZZA 1USTA 1O4XA 3BPVA 3DPUA 2LY1A 3TDUC 4U7EB 4UV8A 1MBFA 5E20A 3IWZA 2OV8A 1T6SA 4F92B 4B4CA 2WXRA 3SO8A 3P1UA 1FOWA 4ATGA 2HU9A 2ISZA 4G1TA 5CECB 4PFOA 4E6KG 2VBZA 3J5PA 2Z1DA 2MH2A 4M7CA 2FBNA 2K40A 4HNVA 3ONQA 3CSTA 5M72A 5DDGA 2ZC2A 2P9KG 1WFXA 3FISA 2PJPA 1SD6A 4ENNA 1SFXA 4ZC3A 4Y6WA 1PDNC 2M2EA 4IHVA 1IV8A 3RKYA 2M4GA 4J19A 3NWTA 4A0ZA 4GZDA 1OPCA 3FTYA 3L09A 2E5ZA 2ZJRF 2PLYA 2R92J 3NAWA 2DT7B 3W3CA 3HXEA 2X6HA 5ILVA 4FA6A 1R1UA 4JOMA 5C44J 1S7OA 1QZZA 2DDAA 2NS7A 4RLFA 1OCPA 3UKGA 1BI8B 3ZPJA 2L02A 1KU7A 1MJAA 4GCVA 3OL4A 4MEXF 1Y56A 3DP7A 2BW3A 4ZH4F 4MNUA 2TDXA 5L3FA 3J80K 2A5UA 1BLXB 4CCLA 5FZQA 3K4JA 3V8KA 3A02A 4PUSA 2O9LA 1YYVA 2H94A 1AKHB 3EIJA 2R7ZJ 4UQXA 4BETA 3HZJA 2PQNA 4CYDA 4WNDA 4Q94A 1IHBA 1WJCA 3R7QA 2IA2A 2XF6A 3HHMA 2VC1A 3C3QA 2RGVA 1D5YA 5LCWC 2COMA 1BW5A 5LCWJ 4U7DA 3TMOA 5GAHJ 3TOAA 4UWKA 3H0GJ 3JUEA 2DT6A 2IGMA 1BJZA 4LLGF 1IGNA 2EJRA 5JLXA 3W2AA 4DJAA 1MJBA 3RRMB 2LAHA 4C3JJ 1IN8A 3RPQA 1WY6A 3PS6A 5G04C 3G2TA 2J9QA 1IZ1A 5GPAA 3O8GA 4WXDA 5BNGA 4TXPA 3TW6A 1D0YA 4HW0A 5T3RA 4Y7NJ 1MJ9A 2VGXA 2EK5A 3K9IA 3PQKA 5E3MA 4UI9J 2R0QC 4UWFA 5CEAA 1T98A 3O2PE 1D1BA 1R1TA 3GTOJ 3DLAA 1LD7A 4S04A 3O4ZA 5FD5A 4NC6A 1A6IA 4NQWB 3CCQI 2O5RA 2BEOA 2FQ4A 5CYVA 3AAFA 3JUIA 4GYOA 4PGHA 3QWVA 2DBAA 1T8IA 4N2QA 3CVLA 3LY9A 4OVVA 4CDGA 1U8RA 4KBQA 5HDGA 1MJ0A 1LUJB 2DPUA 3CCJI 1TC3C 1MW7A 1R1VA 1K1BA 1XMXA 3JSOA 3Q5FA 3F0CA 3CSFA 3E3VA 4N5CA 2BTDA 3TKYA 1JCQA 2M30A 2K7LA 3L6AA 3PRZA 4G24A 1YI2I 2LH9A 3QWPA 1UG3A 2IW5A 5IY5H 3LAJA 4AJWA 1SVMA 2M5WA 3JW4A 5EEHA 1OCZE 2BUGA 2VSYA 3EHRA 1YIJI 1B9MA 3I64A 5ENOD 3HIFA 1N78A 4C0EA 4WWNA 3DEPA 3T8TA 3FBIB 4G23A 2K4JA 2DK8A 2XCBA 2J5OA 1HDPA 1DC2A 1V55E 5CVRA 4IRHA 2ME0A 3PZ4A 3Q0VA 4KVMA 2IBDA 2VTBB 3F8CA 3CQCB 4HNUA 2JUCA 1U5TA 2X6FA 5FGMA 4I2ZA 1WCMJ 5D5XB 2LY2A 5H7PA 2M8GX 3RDIA 4OAYA 3HSEA 3BQYA 1T38A 2XENA 4I17A 2NNYA 1VQNI 2RFMA 3L00A 4YIFA 3HVEA 1HXIA 3S2HJ 1T39A 3FUMA 3F3XA 1DP7P 2KQRA 4HLXA 2OF7A 5EEGA 3PO2J 1B6AA 2F2EA 3GW4A 1KZHA 4G11A 2EFQA 4XEIG 2LTPA 3FKIJ 1Q1HA 3V7RA 2HI3A 2FXAA 1VQPI 1YA0A 3DXKG 3FDHA 5AENA 1IXVA 2HVQA 2XQ0A 3H35A 3J80Z 3ZKJA
chains in the Genus database with same CATH topology
5JHAA 1H6KA 1LEAA 1KT0A 3D0SA 2EA2A 3CIAA 1SFEA 1IRGA 2FMYA 4HOBA 3ZMVA 2XGOA 2DLLA 3BJOA 3PFIA 3PUKA 1E8XA 4I2WA 5ARFA 3OAWA 3GF2A 1U2WA 1TLHB 2I9CA 3RRUA 2PL2A 2DW4A 4TUUA 3KZYA 1HG5A 4D0PA 2WV0A 4GYWA 3BDDA 2HS5A 4ANUA 2QZ8A 1IW7F 4KT6B 2IRFG 4RB0A 4GZCA 1Z3YA 2HYZA 3NEUA 2W57A 3F72A 5K5RA 3F22A 4A1GA 2J5PA 3V8LA 1P4AA 4OIQF 2H6CA 2RKHA 2WXPA 3ZYLA 3WE2A 4U0VA 1QGPA 1J9IA 5JVTA 2Z5UA 5EDSA 3SBTB 4JXTA 4B8AA 3MZLB 4DI4A 3JCKC 3ZVVA 2OVBA 5G05C 2QQAA 2ZMEA 2O6GE 3FH5A 1Y6IA 2XUBA 3VLFA 5ANLA 3N4MA 4Q48A 5DCFA 2J4BA 3D9IA 4KICA 2DPDA 4AY6A 1KQ9A 3SXYA 1XMAA 5FQ4A 5JR3A 1OWPA 4PDKA 3I53A 1ZRFA 3TO9A 3D9NA 5D0OD 3EJNA 4Z2YA 5K5QA 1W7PB 2CFUA 4F7AA 3LA2A 3R0AA 3R61A 1ZGAA 3CVWA 2BYVE 3ZMDA 4A6DA 3LAPA 4KUMA 1RI7A 5AIQA 1TW2A 2CHZA 4FLHA 4JZYA 3FXRA 3D9KA 4ASNA 4BHCA 3TO6A 3K1PA 2LDUA 4AP2A 1FVHA 3GO5A 3B13A 3G2WA 3D9JA 1E90A 2IA1A 3MA5A 2KKOA 4D10C 4DK5A 3WTUC 1XD7A 5L3BA 4EJOA 4URKA 3QAQA 2GGFA 3R0JA 2I2OA 4M72A 3AS8A 4PS3A 2YU3A 2WXKA 1A17A 2VSOE 3M8EA 3RRNB 4HOQA 3BJAA 3HYIA 3ML9A 1ZRCA 2MH9A 3C98A 3KP7A 3WODF 2DCPA 4G26A 2ZU6B 3Q9VA 1XGOA 4HXIA 1DVPA 3S7BA 3V4GA 1W7PD 5CCLA 4GAAA 4UVCA 5LHHA 4JPSA 1P5QA 5H20A 1JGSA 2HZTA 3O6BB 3N97A 2IFUA 5C2YA 1P6RA 2LF8A 5DCMB 3GEZA 1XMKA 2WXGA 3APDA 3CR3A 4E6HA 3P9IA 3FZVA 3NZUA 4QFVA 3IV0A 4KN7X 5LEJA 1ODDA 3PQJA 1QPMA 3SQNA 4WWOA 4AIHA 1DDNA 3E5UA 4AXHA 3FUHA 3E6CC 5DBKA 3C3WA 1R23A 4HDVA 4WWPA 1UN8A 1QZYA 2MLKA 4I1MA 2GQQA 2OAZA 4N2SA 1XDUA 3IHVA 3SI5A 1J7KA 4NACA 3UPVA 1IRFA 2RC4A 3TG4A 2WQHA 2VBYA 1G6NA 1S29A 4HORA 3M1EA 2AVPA 5JFRA 3DKWA 3FTZA 2VOOA 4YFKF 1BN5A 5LGTA 2A3SA 4FX0A 4G2VA 2KCLA 3UMVA 4MEYF 1FP2A 2XPIA 4WXCA 4YVOA 2J08A 2YINA 5IT3A 3H92A 3U9GA 3LA7A 3KETA 2QENA 5D5UB 3IKOB 4GZ6A 3PNLB 3WGGA 3GZ6A 3AU4A 4L9NA 2R59A 1FYLA 4KVOA 3CQGB 4V3IA 3GFIA 2WQ6A 5ARGA 1DNPA 5DUIA 5LBQA 2WXQA 2G7UA 3SFZA 4AEZC 4UNOA 2D2WA 1EYHA 5FJYA 1H0AA 1QNTA 1WQ2A 3QPTA 2DFIA 1OYIA 2FU4A 5JJ6A 3TDZC 3QPHA 5JJ7A 2ETHA 1S0PA 1D8KA 1H19A 3WTWC 3REOA 3CO6C 2XRNA 3FHZA 2Z3YA 4P55A 4YIIA 1QZ2A 4OINF 4NURA 2KATA 4ACLA 1O7LA 3ESKA 4EJTA 1YG2A 5D5WB 4G7OF 2O3FA 1GW6A 3FUFA 4BFRA 1L0OC 4JHKA 1FY7A 4RG6A 4ILIA 1GXQA 4LB6B 4MLPA 3VODA 2L4MA 2ELHA 3B7UX 4KFCA 3QC1A 5BNWA 4GZ5A 1LB2A 2VQ2A 2EB7A 4P9FA 4L5IA 3CKCA 1E96B 4BT9A 3KE2A 3FEYA 2HKOA 3NQOA 2GIVA 1R22A 4IRUA 3GWZA 1BI0A 1F1ZA 3FEXA 4U04A 1U3CA 3EYIA 1FT9A 3C1DA 2MHKA 5A7DB 2DT5A 4A3TA 4ZYGA 2YX4A 4IVNA 5HLGA 3RI4A 1IYGA 5E8GA 1KT1A 2Y4TA 3TO7A 1C0WA 1R5HA 5HOOA 2YHCA 4HAMA 2A5YB 4ESJA 4M9SA 3IWFA 4FHTA 3K9TA 1E8ZA 2EQXA 2P58C 4MRUA 2E1NA 2W85A 3CHMA 3L9FA 4GYGA 3EDTB 5HLHA 2MD5A 4EJVA 4Q5SF 1FZPB 4N0BA 3LVQE 1EDUA 2ZFWA 3I0TA 2ZBKA 3F21A 1J5YA 4BHPA 5BS6A 1ZRDA 4FX4A 3MEKA 5LGUA 2NC9A 1TTYA 1O3SA 2PMHA 3B7TA 2CGPA 5BUZA 4ENMA 5FFZA 4A2UA 5HQ8A 3IKTA 3CVUA 2FI7A 4A0YA 2VODA 1SD4A 2HFHA 3PE4A 5K5OA 3KS2A 2EFWA 2Y48A 4G7HF 4UXNA 2L01A 1BPOA 3B02A 3BZ6A 4LG0B 2CHWA 3PZDA 1TQMA 3FTSA 3E5QA 1Z05A 5BV0A 2LSVA 3L54A 5BPIA 2EV6A 3COAC 2GW1A 2OU2A 3DPDA 3IHUA 1HF8A 3DQVC 4AY5A 2EFNA 1RUOA 4C0MA 3LQRA 4RS8A 5JHBA 1L5JA 2HR2A 3WTZA 2YSRA 1SZ9A 1FNNA 1EV7A 4ETSA 1IAWA 2WXNA 2UXNA 3SZPA 2OA4A 5E17F 3MKQB 1KU9A 4HA8A 2RQPA 2FF4A 3RYRA 2NAZA 2HQNA 3B7RL 1MHQA 1U5TC 1EF1C 1XSVA 5CMYA 1HKSA 3FTWA 1G3WA 3CVXA 3FM5A 2KCVA 2ILRA 3LKUA 4W9RA 3JQ0A 4GPKA 4EM0B 3L16A 3PREA 5KJKA 2R7DA 2V0PA 2W24A 1U5TB 1A04A 4UWHA 2FE3A 3L7WA 2WXOA 3JAMK 2KC7A 4EQFA 2J49A 1UN9A 1K7AA 5DD