4GA0A

Structure of the n-terminal domain of nup358
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
143
structure length
143
Chain Sequence
b'RSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWLERAAKLFPGSPAIYKLKEQLLDCEGED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase RanBP2
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 57
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga0A00
4I2ZA 2XCBA 2VSNA 3TG5A 2UY1B 5A7DB 2I6HA 4GA0A 2DBAA 2LSVA 3R9AB 2L6JA 3QWWA 5ARFA 4HORA 5D0OD 5JJ6A 2UWJG 4UQZA 2YHCA 3S7DA 5LCWC 4N2QA 3AS8A 3WXXA 4I9CA 4LEUA 5CCLA 4HOUA 2WPVA 1E96B 3GZ1A 4RG9A 4A1SA 1HH8A 2KCLA 3GW4A 4WUYA 2KATA 3U3WA 4ABNA 4I2WA 4UI9K 3ASFA 5JJTA 4AM9A 4UQYA 4GPKA 4U07A 4BT9A 3URZA 2VGXB 3Q4AB 4I1AA 4GA1A 1ZU2A 3ASDA 1ELWA 5LCWJ 5G05C 5FZSA 4JA7A 3LY7A 4BTBA 5JJ7A 5AYWD 3MEKA 2V5FA 4XIFA 5HQ8A 3ZFWA 5KJMA 1WAO1 2Y4TA 3ASGA 2ONDA 4I17A 4H7XA 4WNFA 3ESKA 3IEGA 3SF4A 3S7FA 3RKVA 3QKYA 4U0SA 2IF4A 2FO7A 1WM5A 4U0ZA 3FFLA 3VTXA 3BEEA 3KS2A 3CVPA 5FT9A 2XGMA 4Y6CA 5HI7A 3CEQA 2Y4UA 5KJNA 4GYYA 4BWRA 5DBKA 3GYZA 4IN3B 2PQNA 3RO3A 4U0UA 4J8DA 4GZ5A 5G05J 4HOQA 4WNGA 4G1TA 3CKBA 2QFCA 2XCCA 2HR2A 3UUXA 4AY6A 1NZNA 3QWVA 4UI9C 4N2SA 3K9IA 4BTAA 1KT1A 3MV3B 1ELRA 3FP3A 3Q47B 2LNIA 1Y8MA 3S7BA 2FF4A 2FBNA 5BW8C 2OOEA 3OXGA 1KLXA 3LY8A 2C0MA 4KXKB 2KCVA 3O48A 4F3VA 2FEZA 5A6CA 4XI0A 2E2EA 3UQ3A 5EX0A 3Q5MA 5CCMA 4GZ3A 4UI9J 4N39A 4CDRA 3CKCA 5ARGA 3CK9A 3MV2B 4YNDA 3U4TA 1P5QA 2YQ8A 4AY5A 4G23A 4JA9A 1IYGA 4GZ6A 2XGSA 1QQEA 4UQXA 2FI7A 3RU0A 4HOSA 1NA0A 5EKQD 3AS5A 3QOUA 3CVLA 3LKUA 2PZIA 3Q49B 2XEVA 4N3CA 2VGXA 3FWVA 5FJYA 4Y6WA 4GCOA 4WNEA 4I9EA 3GZ2A 3PE3A 3CVQA 1W3BA 4ME2A 4J8EA 5KJKA 5KJLA 3ZHEB 1PC2A 2Q7FA 2AVPA 4CGWA 3CVNA 1XNFA 3N71A 1NA3A 3E4BA 4GYWA 4JHRA 3TG4A 3RJVA 5CHEE 1IHGA 5BNWA 2VGYA 4U04A 1TJCA 4G26A 3KAEA 4JL0A 3UPVA 3ULQA 2C2LA 2JLBA 2WQHA 4G2VA 4YVQC 2UY1A 4GCNA 1B89A 2GW1A 5M72A 4CGVA 2IFUA 4GYOA 4N5CA 5DIZA 3CV0A 4H7YA 1KT0A 3MA5A 3ASHA 1A17A 5FTPA 4N3BA 1QZ2A 2R5SA 3SZ7A 3EDTB 2XPIA 3RO2A 2PQRA 4YVOA 3JYSA 3OXLA 2XGOA 3LY9A 4J0UA 3LCAA 1HXIA 4NRHB 3OXFA 4G24A 2KCKA 3QDNA 4RG6A 2C0LA 5C1DA 1OUVA 3Q15A 4AIFA 4KYOB 3CK7A 5G04C 3NF1A 3RIBA 4EQFA 5D0QD 1YA0A 3HYMB 2NC9A 3PE4A 2VSYA 3ZPJA 5EX3A 5BT1A 4XI9A 3MKRA 4N3AA 3ZGQA 4W9RA 3AS4A 2VYIA 1ZBPA 1FCHA 2LSUA 3S7JA 3TAXA 4NQ0A 4GA2A 3ZN3A 3VTYA 4G25A 2KC7A 4APOA 2MHKA 2BUGA 4KBQA 4J8FA 1HZ4A 5G04J 2VQ2A 3CK8A 3QWPA 2HO1A 3TGOA 2J9QA 2PL2A 3LPZA 2HYZA 3KD7A 4HOTA 4O6FA 3PDNA 5FZRA 4B94A 5FZQA 4BT8A 3LYAA 4WNDA 3ZHEA 2P58C
chains in the Genus database with same CATH superfamily
3E30A 4G11A 5A7DB 3ZNGA 3UM2A 3EU5A 1OXJA 2LSVA 2I2OA 3R9AB 2L6JA 4KZCA 3CVUA 3V2OA 2AWIA 4CT0A 4GZDA 2AJAA 4UQZA 1WY6A 1UJKA 4EHMA 2Y0BG 1K1BA 5CCLA 1E8XA 1Q2ZA 3EHNA 4YDWA 3DSTA 3T5VA 3PVLA 4K5AB 1TNBA 1LTXA 4I1MA 3F6QA 4WUYA 2KATA 5CERB 4ABNA 1L5JA 1V54E 3SFYA 3ASFA 3PNLB 5EYPF 2B6CA 4U07A 2VGXB 4I6JA 1ZU2A 1E8YA 1ELWA 2QC9A 2XZTG 3NOGD 4JA7A 1EDUA 4DRXE 1S64A 3NB2A 1DVPA 2X6HA 3MEKA 2V5FA 3UKRG 4C9BB 2LO6A 4LNUD 3ZFWA 1TNOA 3CHQA 4GTMA 4GMLA 4MS6A 5ENQD 4I17A 4HRMB 1D8EA 3SF4A 2WXMA 2GRMA 3RKVA 4U0SA 2IF4A 4AP2A 3FFLA 4BFRA 2AXZA 4HRNA 2XGMA 4Z68A 3P2BA 3LJ3A 3QC1A 4U0UA 3KEAA 4HOQA 5BXUA 1H2VC 2ZISA 4G1TA 3G2SA 3MX3A 3DPYA 3L82A 1N95A 2PNNA 4XKBA 3TWXA 1OWNA 1SA5A 2R59A 3FUJA 2HR2A 3ML9A 5AENA 3L54A 3R7RA 2DZNA 3QWVA 1KT1A 2DWZA 1JWFA 3JXJA 1ELRA 3FP3A 3FU0A 3MZLB 1Y8MA 5CECB 1KLXA 3J5PA 4LNGA 3U9WA 2XS1A 4ACKA 3NAWA 3PEVB 3O48A 2X6IA 3QNKA 4U8YD 2GRRB 4PS3A 5BV1A 2RFAA 5A6CA 1JCRA 2E2EA 2OEVA 5EX0A 5EDSA 3DSUA 4ATZD 3CVXA 4N39A 3CKCA 4NIKA 3RK6A 3CK9A 3PREA 1RZ4A 4I6EA 4ILHB 3ZRHA 4PS7A 2P9PG 2XEEA 3HXCA 1P5QA 1FVFA 4KT6B 3VLDA 1UJJA 4JA9A 4UUCA 5AQ9A 4APFA 3TWQA 3KSLA 3SI5A 3L13A 5KWDA 3OTNA 4J8SA 3FDHA 3CHMA 4BSZB 5FINA 5KNHD 3CVLA 3PH0C 4HLEA 1BLXB 4GTOA 2WXOA 3CR3A 1UOHA 1WG0A 3HIZA 3IHYA 3APFA 1K1AA 2ETBA 2BEDA 1W3BA 1LD8A 2CG3A 2XHEA 4J8EA 5KJLA 3CHSA 2IO2C 5JHAA 3CVYA 5T8IA 3UINC 3ISMC 3EIJA 1SZAA 4F1SA 3LJNA 3ZXSA 3N71A 2KZTA 3HDXA 5CRVA 1DCQA 4XKCA 1MZCA 2IJGX 3E4BA 4GYWA 3TG4A 1IHGA 3PUKA 5CRUA 4K0RA 1TJCA 3UTMA 2YHEA 3D9MA 2F0YA 1FT1A 3B7SA 3E32A 1NP7A 3C98A 2JLBA 1MX4A 3R7QA 4U63A 2UY1A 3V31A 3Q78A 4FC8A 3W9GA 5HKPA 3MA5A 2GROB 4TV3A 2GRQB 3B7UX 4FHKA 5ITZF 2R5SA 3EDTB 2XPIA 4FP7A 4YVOA 3JYSA 2XGOA 4A1GA 3Q79A 5IY5E 5ENTD 2KCKA 3QDNA 4GZCA 2WXHA 4CEMA 5D66A 1OUVA 5T4YA 3W9FA 1Z3YA 3FTSA 3NF1A 3RIBA 5D0QD 4DK5A 3ONLA 1SA4A 5FQ7A 2NC9A 3PE4A 3FUDA 2VSYA 3ZPJA 5BT1A 1QNFA 3UI2A 4XI9A 3ZGQA 3AS4A 2OEWA 4JVSA 4BERA 1ZBPA 2Y69E 3C72A 1FCHA 2NSZA 5AAOA 4JZYA 3S7JA 3TAXA 3ULEG 4C0MA 4GA2A 3VTYA 2KC7A 2BUGA 4HBDA 3SFXA 2V4HC 2QYUA 3ZW3A 2VJ8A 2VQ2A 5C2YA 3B7RL 3D9IA 5ANRA 1N4RA 4AJWA 1BPOA 1OWPA 2P9SG 3KD7A 3SBTB 2WXIA 1O1SA 4O6FA 1XGWA 3B7BA 4I6GA 4WNDA 3ZHEA 3HVEB 2J4DA 2QYJA 2AW6A 2UY1B 1N4SA 3ENEA 4PUCA 2DBAA 4CDNA 3R9MA 5ARFA 4WAFA 4HNAD 5JJ6A 2UWJG 2X6FA 2YHCA 3PZ4A 1KZOA 3U64A 5LCWC 3AS8A 3WXXA 4ANWA 4U95D 4UWLA 2HE0A 5G55A 2J08A 2FULA 3GZSA 4FHJA 1IKND 4LG6A 4TXQA 1LD7A 1TN6A 1HH8A 2KCLA 1UW4B 4GTPA 4HQDA 3UT4A 4I2WA 4NACA 3RRUA 4UQYA 2IEJA 5FWQA 2WXNA 3KEZA 3RRMB 2EIJE 4UWKA 2J09A 4BEPA 3TWSA 4BTBA 1MYOA 5G2NA 3MKQA 3TWTA 3UM1A 5HQ8A 3NOCD 3CGHA 4KMOA 1OCZE 2ONDA 3ESKA 3MYVA 3FTWA 5FQ8A 4EPZA 1O5MA 2FO7A 1WM5A 1DNPA 4U0ZA 4UWFA 1Y6IA 4DX5D 2Y4UA 4HLLA 4GYYA 2PQNA 2BKGA 3RO3A 4YDOA 4L7TA 3PUJA 5G05J 1N94A 3I4RB 4MLPA 2KM4A 2A4ZA 4U8HA 1JCQA 1E7VA 2QFCA 4AEZC 4BX9A 3D9PA 4AY6A 4IYPA 1H6OA 4BTAA 3MV3B 5LOZA 4EBAA 3IKOB 4J7WA 1MJ0A 4D10C 2I1KA 4XEIG 4L23A 3S7BA 5BW8C 2FBNA 4ANXA 1PY1A 2P9IG 5B1BE 3BG0B 3UX4A 4Q69A 2FEZA 2VGEA 1HX8A 3L22A 3UQ3A 5BUZA 3TXNA 3Q5MA 4RQIA 3AU4A 4G8KA 1N11A 3DSXA 3FUIA 2WXQA 4UI9J 2DIWA 3UMVA 3HRAA 4DLQA 1MX2A 5ARGA 3RAUA 1N4QA 5AQ7A 1HG2A 2VTBA 2R17C 2YQ8A 2R05A 4G23A 1IYGA 2XGSA 4UQXA 4XE0A 5CEAA 2PZIA 3Q49B 2XEVA 1NL4A 1PAQA 3CHOA 3ZUVB 4WNEA 3UM3A 4I9EA 1BI7B 3SY2A 3FTVA 5BPPA 1HE8A 3PZ1A 1ELKA 1YYHA 5KJKA 3DEPA 2KBXA 3UT7A 2Q7FA 4CCAA 4WWNA 2AVPA 2WXJA 3V2XA 4GTVA 4CGWA 1YCSB 1XNFA 1U2VG 1FPPA 2GRPB 4CYMD 3DRAA 3FUFA 5CHEE 2XPYA 4DI3A 3TWVA 4M3OA 4G26A 3DSSA 2JABA 2WM9A 5A23A 5FQ6A 2J4BA 2WXKA 1N0QA 3ESLA 1K8KG 3DBSA 3ONKA 2IQCA 4G2VA 2GW1A 5M72A 2CFZA 4N5CA 4CGVA 3ASHA 2ZIRA 4HFGA 1OWOA 5FTPA 3JUIA 3FY4A 2L6BA 2VTBB 3JQ1A 3LDZA 2V5QC 2BF0X 2PQRA 2YINA 3QB2A 4J0UA 1HXIA 2XENA 3L16A 3O4ZA 3SHFA 5E76A 1Z6TA 3UM0A 2C0LA 2ZXWE 5C1DA 3AAAC 3Q15A 2ZGGA 1H6PA 4KYOB 3CK7A 3TWUA 2XS8A 1JWGA 1EF1C 5AQAA 1OCOE 1YMPA 4LUNU 5EX3A 4Q94A 1E7UA 5AIJA 4WWPA 2IOSA 4N3AA 1JCSA 3FEXA 1H19A 3FULA 2VSOE 4ANUA 4UWGA 2VYIA 5KNGA 4GU5A 1IQRA 5ENRD 4URKA 2LSUA 4NQ0A 3ZN3A 3ZYMA 4U8VD 3SBSA 1MHQA 5G04J 3FH8A 2EIKE 3CK8A 3QWPA 3Q7FA 3TGOA 3LPZA 3CHRA 4AOFA 2F37A 5E75A 3FTUA 4MRUA 4CRWA 2IONA 5ENSD 4HOTA 4K03A 4YDEA 4B94A 2P9LG 2H6IA 3HG0D 4BETA 4I2ZA 2XCBA 3TG5A 4BSXA 4TXRA 2ZGDA 4TUUA 2CHXA 4GA0A 2L0TB 3Q9UC 4UWHA 1K3ZD 4ZFHA 3IBEA 5D0OD 1X81A 3D9LA 2PM7A 3ZKJA 3S7DA 5J08A 4I9CA 4LEUA 2LAHA 4HOUA 4TUMA 1SQMA 2EIME 3BU8A 2I9CA 4RG9A 2XZDG 3GW4A 2DYRE 2RKKA 4ATGA 1NI1A 3DSWA 3FTYA 5JJTA 3ZIMA 4F6RD 3PZ3A 4BT9A 4FADA 2F8YA 3CQCB 4GA1A 5HS0A 2H6GA 1DC2A 3MGBA 2WQ7A 4GPMA 5FZSA 3LY7A 5JJ7A 1UN9A 2DZOA 4XIFA 4X8QA 1TNZA 1WAO1 2Y4TA 4R7LA 2V0PA 3ASGA 3I3NA 4JEUA 5KCMA 2BTDA 3S7FA 2WXGA 1FT2A 3BEEA 2KZTB 3PNTB 5FT9A 2P2CP 1TNYA 5KJNA 2J07A 3B7TA 3HXFA 3D9KA 4BWRA 2I1JA 1EPUA 1QYMA 4J8DA 3VLFA 2LXMA 4GZ5A 4O1OA 1OCCE 2LXLA 3C3OA 4WNGA 4OAVB 2GRNB 3EU9A 3IXEA 5EIBE 1N54A 2XCCA 4PDXA 3WG7E 4DLOA 3UUXA 4OVVA 4LERA 2NYJA 4HXIA 2XRYA 1TN8A 4JC8A 2MYOA 3QAQA 2XEHA 1IXVA 2Y3AA 4DX6D 3Q47B 4B0ZA 1V55E 2BKKB 2MOWA 2FF4A 2OOEA 3OXGA 3APCA 2XPZA 2KCVA 2WMOA 2ETCA 2A5EA 1UG3A 1TNUA 5CCMA 3EIQC 3AG2E 1BU9A 1OY3D 4GTSA 1Z3XA 3ZVVA 3V30A 3D9NA 3D9HA 3ZYLA 4DX2A 3ASOE 4GTQA 2CG2A 3MV2B 3JCKC 3DPDA 2RG8A 5AJLA 3Q73A 5HRYA 2CFUA 4GZ6A 1QBQA 2H6HA 3UIOC 1QQEA 4K5BA 3MCXA 2EILE 3AG3E 3UT8A 4ANVA 1H0AA 4DI4A 5EKQD 1RW2A 5EIDA 3LKUA 4HB5A 4AXHA 4N3CA 2VGXA 4B8CB 3FWVA 5LFAA 4GCOA 3FUKA 3JUEA 3GZ2A 2IOLA 4QFVA 3KSQA 3PE3A 3HXBA 4ME2A 3UXGA 4BX8A 4ILGA 2J49A 3ZHEB 1PC2A 4JXTA 3TXMA 3G2WA 3ZYQA 4BY6A 3CVNA 4EZLA 5BV0A 4A63B 2X6KA 4KVMA 3BQOA 5CMWA 2X38A 4JHRA 1O1RA 5BNWA 1IQUA 2ZU6B 2IY0C 5AARA 1OWLA 3QJZA 3J5QB 2X3MA 4JL0A 3UPVA 2FO1E 2PM6A 3ULQA 4L2LA 2M63A 1WDYA 5BXOA 1H6KA 4YVQC 3B13A 5AQBA 4CDMA 4GCNA 3DWLG 4GYOA 5EN5D 1KZPA 3CVWA 2L9BA 1A17A 1D8DA 3T8KA 3FUHA 2H6FA 3Q7AA 3PZ2A 1H2TC 4C48B 3RO2A 3EUVA 1S70B 3OXLA 3E34A 4NRHB 3MKQB 3FEYA 1O1TA 3OXFA 1A5EA 5FIOA 4RG6A 3CQGB 4A3TA 4TXPA 4C0EA 2XQ0A 1N0RA 3SD5A 1SW6A 4HI8A 2RD0A 2IO3C 1YA0A 4A55A 5JHBA 3UKUG 4F53A 1BD8A 4GTTA 4EZJA 3MKRA 4W9RA 3I4GA 3D3MA 3HXEA 4L1BA 4F1PA 1HFAA 3C3RA 4LRZA 4O60A 4APOA 3PZDA 2MHKA 1E8WA 3ASNE 4LCTA 5JMND 4J8FA 4GTRA 3SNXA 4JB8P 4BESA 1EYHA 2OVBA 2HYZA 5CEDB 3AG1E 3FUEA 4NURA 3ABLE 4O1PA 3IHVA 5FZRA 1HF8A 2HM8A 4OAUC 5FZQA 1JPLA 4BT8A 4PH4B 4DX1A 3T9KA 4KZ0A 2P58C 3DXMG 3QK0A 2VSXE 3V79K 3ZU7B 2VSNA 4FA6A 2I6HA 3DEOA 2WXRA 1NFIE 4U96D 2XRZA 3FUNA 2DCPA 1D9SA 3QWWA 4HORA 4RLYA 2P9KG 4B8AA 3U66A 4N2QA 4HVBA 2OV8A 3L6AA 4KVOA 3TJPA 3EJNA 3C5RA 1AP7A 2WPVA 1OT8A 2DYSE 5EILA 1E96B 1TR4A 3GZ1A 3D9JA 1N4PA 5ENOD 4A1SA 2WXFA 1UN8A 3CHPA 4XZ4A 3ML8A 3U3WA 4M7CA 4UI9K 4AM9A 4MBGA 4F7AA 4GPKA 4GB9A 4DUIA 3URZA 2EQXA 3Q4AB 4I1AA 3ASDA 4L9PA 2LAIA 5LCWJ 5G05C 1G3NB 1MQSA 1OWMA 2B0OE 5AYWD 4U7EB 3D9OA 3FU5A 2Y1LE 5AN8A 5KJMA 2E0IA 3Q9NC 3B95A 4H7XA 4WNFA 3IEGA 2OCCE 5CBNA 3TWRA 2P9UG 3ABME 3QKYA 3FU3A 2RFMA 3VTXA 4DX7D 3KS2A 3BUAA 3CVPA 4IULA 3C3QA 4Y6CA 5HI7A 3CEQA 3ABKE 3P1UA 3FTZA 5DBKA 3GYZA 4IN3B 3LS8A 5B1AE 1LF8A 4P29A 4JHKA 2OVFA 4J6IA 1U3CA 3E33A 4I1OB 3JXIA 3CKBA 4B89A 5D2MC 3NZUA 3NQPA 2R03A 3FH7A 3FHEA 2V8SE 4RVBA 3EHMA 1NZNA 1KPSB 3CLJA 3NZSA 4UI9C 4N2SA 3K9IA 4JEHA 2V4LA 5ANLA 2ETAA 3L17A 4QQIA 4OYSA 3ZXPA 2WVIA 2LNIA 4I43A 3G2TA 4LSZE 5CBOA 3LY8A 5J90A 2C0MA 1U3DA 4KXKB 3NBNB 5AJDA 3HVEA 4F3VA 4PS8A 4OVUA 4YDYA 4XI0A 3T5XA 4L2YA 3RRNB 4ILIA 4TRQA 3OAWA 2MRIA 4GZ3A 2R02A 1FVHA 4DPRA 2GGFA 1OCRE 4CDRA 1S63A 4MKTA 3FH5A 4HI9A 4YNDA 3U4TA 4K5CA 4EECA 1JUQA 2A5UA 1HU3A 4AY5A 1S0PA 5CMYA 3TWWA 3Q75A 3PRZA 2YNQA 2FI7A 3RU0A 5H7PA 1N52A 4HOSA 1NA0A 2CHZA 3AS5A 3QOUA 4FLBA 3EHQA 5T3RA 1AWCB 1X5BA 5FJYA 4Y6WA 5LX8A 4LNBA 1VDYA 2AXVA 3CIAA 3CVQA 1ZB1A 3ZYKA 3UIPC 3G2VA 1HO8A 3L9TA 1SZ9A 1H2UA 3FTXA 3HHMA 3HXDA 4JPSA 2WB2A 2WXLA 4ACLA 2F8XK 1TYQG 2CHWA 3FU6A 3AJIA 3CVVA 3CSFA 3SFZA 1NA3A 4FULA 2WQ6A 2QY7A 3AU5A 3LVQE 1IHBA 2AXUA 1E90A 3S2AA 3DXKG 3RJVA 2VGYA 2P9NG 1HG5A 4U04A 1E8ZA 3SGHA 5ENNA 1BI8B 4FU3A 3KAEA 2C2LA 4AV7A 2DVWA 3EHRA 5LP0A 4GMRA 2WQHA 2NXPA 4E6HA 3QARA 3RSEG 4JD2G 4ZHBA 3JQ0A 5B3SE 1B89A 4FLHA 3I5PA 2IU1A 2IFUA 4V3IA 4JW1A 3AG4E 4EZKA 3CV0A 4H7YA 1KT0A 5DIZA 4AVXA 4GAAA 3LVRE 3ZEFA 4N3BA 2WMNA 4XX5A 3PEUB 1QZ2A 3SZ7A 5KBAA 4A3VA 3BG1B 3FUMA 3VLEA 3ULYA 2JEKA 3LY9A 3LCAA 2L0IA 5ENPD 4Q96A 1GW6A 4G24A 1INZA 4CT4A 2ILRA 4N5QA 1DCEA 4AIFA 3T8MA 5G04C 3SO8A 3APDA 4EQFA 3E37A 4RSYA 2EINE 4G8LA 4FJZA 3LXUX 3CSTA 3DSVA 3HYMB 4JHJA 2X6JA 1MX6A 5EYLA 5FQ4A 1Z5SC 4IRUA 4J8YA 3G2UA 5JA4D 4FJYA 3TL5A 4GMJA 2WXPA 4CZ2D 4B93B 3L08A 2LUHA 4G25A 4KBQA 1SVXA 2GRLA 4DJAA 4HRLA 3SQVA 1HZ4A 3LEWA 2HO1A 2R2LA 3IV0A 2J9QA 2PL2A 3PS6A 4EBAG 4HS2A 1TEZA 4WWOA 1TN7A 4E85A 3MJWA 3PDNA 1HS6A 3X2QE 1TJFA 2QZAA 2J8SD 3LYAA 1N9AA 2KXPC
chains in the Genus database with same CATH topology
2J4DA 4I2ZA 2XCBA 2VSXE 2VSNA 4G11A 3TG5A 4BSXA 4FA6A 2AW6A 2UY1B 5A7DB 4TUUA 2I6HA 2CHXA 3ENEA 4GA0A 4PUCA 2L0TB 2DBAA 2LSVA 2WXRA 2I2OA 3R9AB 4CDNA 2L6JA 4KZCA 4UWHA 2XRZA 3CVUA 2AWIA 3FUNA 3IBEA 4CT0A 2DCPA 3QWWA 5ARFA 4WAFA 4HORA 5D0OD 4GZDA 5JJ6A 3D9LA 2UWJG 4UQZA 1WY6A 2X6FA 2YHCA 4B8AA 3U66A 2PM7A 1UJKA 3U64A 3S7DA 5LCWC 4N2QA 3AS8A 4HVBA 3WXXA 5J08A 2OV8A 4I9CA 4LEUA 4ANWA 3L6AA 4KVOA 3TJPA 1E8XA 2LAHA 5CCLA 3EJNA 4UWLA 4HOUA 1SQMA 3EHNA 5G55A 2J08A 2WPVA 2FULA 1E96B 2I9CA 3GZ1A 3GZSA 3D9JA 3T5VA 4RG9A 4FHJA 3PVLA 4A1SA 2WXFA 1UN8A 3CHPA 1HH8A 4XZ4A 2KCLA 3GW4A 4I1MA 3ML8A 1UW4B 4ATGA 4WUYA 2KATA 3U3WA 3UT4A 4ABNA 4I2WA 1L5JA 4UI9K 3ASFA 3FTYA 3PNLB 3ZIMA 5JJTA 4NACA 4AM9A 3RRUA 4UQYA 4F7AA 4GPKA 4GB9A 4U07A 4BT9A 3URZA 2EQXA 5FWQA 2VGXB 2WXNA 3KEZA 4FADA 3Q4AB 3CQCB 3RRMB 4I1AA 4GA1A 4I6JA 1ZU2A 1E8YA 3ASDA 4UWKA 1ELWA 3MGBA 2J09A 2LAIA 5LCWJ 5G05C 2WQ7A 5FZSA 4JA7A 1MQSA 1EDUA 3LY7A 1OWMA 4BTBA 5JJ7A 5AYWD 1UN9A 5G2NA 3D9OA 3MKQA 1DVPA 2X6HA 3FU5A 3MEKA 2V5FA 4XIFA 5HQ8A 4C9BB 2LO6A 3ZFWA 3CHQA 5KJMA 3CGHA 1WAO1 2Y4TA 4R7LA 4GMLA 4KMOA 2V0PA 3ASGA 3I3NA 4JEUA 2ONDA 4MS6A 2E0IA 4I17A 4H7XA 4WNFA 5KCMA 3ESKA 3IEGA 3SF4A 2BTDA 3S7FA 2WXMA 2GRMA 3MYVA 3FTWA 2WXGA 3RKVA 5FQ8A 3QKYA 4U0SA 4EPZA 2IF4A 3FU3A 2FO7A 1WM5A 4AP2A 1DNPA 4U0ZA 4UWFA 1Y6IA 3FFLA 3VTXA 3BEEA 4BFRA 2KZTB 3PNTB 2AXZA 3KS2A 3CVPA 4IULA 5FT9A 2XGMA 4Y6CA 5HI7A 3CEQA 2Y4UA 5KJNA 2J07A 3B7TA 3P1UA 3FTZA 4GYYA 3D9KA 4BWRA 2I1JA 5DBKA 3P2BA 3GYZA 4IN3B 1EPUA 3LS8A 3LJ3A 2PQNA 3QC1A 3RO3A 4U0UA 3VLFA 4J8DA 4L7TA 3PUJA 1LF8A 4GZ5A 4HOQA 4JHKA 2OVFA 4P29A 4J6IA 1H2VC 5G05J 1U3CA 3I4RB 4I1OB 4WNGA 4MLPA 4G1TA 3G2SA 2KM4A 2A4ZA 3MX3A 3CKBA 4U8HA 4B89A 3NZUA 3NQPA 4XKBA 1E7VA 1N54A 2QFCA 4AEZC 3FH7A 4BX9A 3FHEA 2XCCA 2V8SE 1OWNA 2R59A 3D9PA 3FUJA 4PDXA 3EHMA 2HR2A 3ML9A 4RVBA 3UUXA 4DLOA 5AENA 4AY6A 1NZNA 4IYPA 4OVVA 3L54A 3R7RA 4LERA 3QWVA 3CLJA 3NZSA 4UI9C 4N2SA 3K9IA 4JEHA 4HXIA 2XRYA 2V4LA 5ANLA 4BTAA 4JC8A 1KT1A 3MV3B 5LOZA 4EBAA 1JWFA 3IKOB 3QAQA 1ELRA 2Y3AA 3L17A 4OYSA 3FP3A 3FU0A 2WVIA 3MZLB 3Q47B 4D10C 2I1KA 4B0ZA 4L23A 2LNIA 1Y8MA 2MOWA 4I43A 3G2TA 3S7BA 2FF4A 2FBNA 5BW8C 1PY1A 2OOEA 4ANXA 3OXGA 1KLXA 3LY8A 3APCA 5J90A 2C0MA 1U3DA 4KXKB 3U9WA 3BG0B 4ACKA 5AJDA 3UX4A 4Q69A 2XPZA 2KCVA 3PEVB 3HVEA 3O48A 4F3VA 2X6IA 4PS8A 3QNKA 2FEZA 2WMOA 4OVUA 4PS3A 5BV1A 1HX8A 3L22A 5A6CA 4XI0A 2E2EA 3UQ3A 3T5XA 5BUZA 4L2YA 3RRNB 5EX0A 3TXNA 5EDSA 4ILIA 3Q5MA 4TRQA 1UG3A 3OAWA 5CCMA 2MRIA 3EIQC 3AU4A 4GZ3A 1FVHA 4DPRA 3FUIA 2WXQA 4UI9J 2DIWA 2GGFA 3CVXA 4N39A 1Z3XA 3UMVA 4CDRA 3ZVVA 3CKCA 4DLQA 4MKTA 3D9NA 3FH5A 5ARGA 3RK6A 3ZYLA 3CK9A 3PREA 4I6EA 2CG2A 3MV2B 4ILHB 1HG2A 3ZRHA 3JCKC 4PS7A 4YNDA 2VTBA 3DPDA 3U4TA 1P5QA 2R17C 2RG8A 1FVFA 2YQ8A 4EECA 1JUQA 5AJLA 2A5UA 1HU3A 4AY5A 1S0PA 4KT6B 3VLDA 5CMYA 1UJJA 2CFUA 4G23A 4JA9A 1IYGA 4GZ6A 2XGSA 4APFA 1QQEA 3PRZA 4UQXA 3SI5A 3MCXA 2YNQA 3L13A 2FI7A 3OTNA 3RU0A 3UT8A 4J8SA 4ANVA 1N52A 4XE0A 4HOSA 3FDHA 3CHMA 1H0AA 4DI4A 1NA0A 5EKQD 2CHZA 3AS5A 3QOUA 4FLBA 3CVLA 3PH0C 3LKUA 5T3RA 4AXHA 2PZIA 3Q49B 2XEVA 4N3CA 2VGXA 4HLEA 4B8CB 1X5BA 3FWVA 5LFAA 5FJYA 1PAQA 2WXOA 3CHOA 3CR3A 3FUKA 3HIZA 3IHYA 4GCOA 4I9EA 4WNEA 3APFA 5LX8A 3GZ2A 2IOLA 1VDYA 4QFVA 3FTVA 2AXVA 3CIAA 5BPPA 3PE3A 3CVQA 1HE8A 1W3BA 3G2VA 1HO8A 3ZYKA 4ME2A 1ELKA 1SZ9A 2CG3A 2XHEA 4J8EA 4BX8A 5KJKA 1H2UA 3FTXA 3HHMA 4ILGA 4JPSA 5KJLA 2J49A 3CHSA 3ZHEB 2WB2A 3UT7A 2WXLA 5JHAA 4ACLA 1PC2A 2Q7FA 3CVYA 4JXTA 5T8IA 4CCAA 3TXMA 3G2WA 3EIJA 1SZAA 4WWNA 3ZYQA 4F1SA 2AVPA 2WXJA 4BY6A 2CHWA 3FU6A 4CGWA 3CVNA 3CVVA 3CSFA 3ZXSA 3SFZA 4EZLA 1XNFA 3N71A 5BV0A 1NA3A 2KZTA 4FULA 3HDXA 2QY7A 3AU5A 2WQ6A 4XKCA 2X6KA 3LVQE 2IJGX 3E4BA 4KVMA 4GYWA 5CMWA 2X38A 2AXUA 1E90A 4JHRA 3S2AA 3TG4A 3FUFA 3RJVA 5CHEE 1IHGA 5BNWA 2VGYA 1IQUA 2ZU6B 3PUKA 1HG5A 2XPYA 1OWLA 4U04A 4DI3A 1E8ZA 4K0RA 1TJCA 2YHEA 4M3OA 3QJZA 5ENNA 3D9MA 3SGHA 4G26A 2X3MA 4FU3A 3KAEA 4JL0A 2WM9A 3UPVA 2PM6A 5A23A 3B7SA 2C2LA 2J4BA 2WXKA 5FQ6A 1NP7A 3ULQA 4AV7A 3ESLA 4L2LA 3C98A 2JLBA 5LP0A 2M63A 2WQHA 2NXPA 3DBSA 4E6HA 3QARA 1H6KA 3R7QA 3ZW3A 3ONKA 2IQCA 4G2VA 4U63A 4YVQC 3B13A 4CDMA 2UY1A 4GCNA 3JQ0A 1B89A 4FLHA 2GW1A 3I5PA 4FC8A 2IU1A 5M72A 2CFZA 2IFUA 4GYOA 4N5CA 4V3IA 4CGVA 4JW1A 4EZKA 3CVWA 3CV0A 2L9BA 1KT0A 4H7YA 5DIZA 4AVXA 3MA5A 3ASHA 4GAAA 4HFGA 1OWOA 3LVRE 4TV3A 1A17A 5FTPA 3JUIA 3FY4A 3ZEFA 4N3BA 2VTBB 2WMNA 3FUHA 4XX5A 3B7UX 3PEUB 3JQ1A 4FHKA 1QZ2A 2R5SA 3LDZA 3SZ7A 4A3VA 3BG1B 1H2TC 3EDTB 2BF0X 3FUMA 3VLEA 2XPIA 4FP7A 3RO2A 2PQRA 2YINA 4YVOA 3JYSA 3OXLA 2JEKA 2XGOA 4A1GA 3LY9A 3QB2A 4J0UA 3LCAA 2L0IA 1HXIA 3L16A 4NRHB 3MKQB 3O4ZA 3FEYA 3OXFA 4Q96A 3SHFA 5E76A 1Z6TA 1GW6A 4G24A 2KCKA 3QDNA 4GZCA 2WXHA 4RG6A 2ILRA 4CEMA 4CT4A 1INZA 3CQGB 2C0LA 4A3TA 5C1DA 1OUVA 5T4YA 3Q15A 4AIFA 4KYOB 3T8MA 3CK7A 4C0EA 2XQ0A 1Z3YA 5G04C 3FTSA 1JWGA 1EF1C 3NF1A 3SD5A 3RIBA 3APDA 4EQFA 2RD0A 4RSYA 5D0QD 4DK5A 3ONLA 4FJZA 3LXUX 3CSTA 1YA0A 3HYMB 5FQ7A 4A55A 4JHJA 2NC9A 2X6JA 3PE4A 3FUDA 4LUNU 5JHBA 2VSYA 3ZPJA 5EX3A 4Q94A 1E7UA 5AIJA 5BT1A 4WWPA 4F53A 5FQ4A 1QNFA 2IOSA 4IRUA 4EZJA 3G2UA 4XI9A 3MKRA 4N3AA 3ZGQA 4FJYA 3FEXA 1H19A 4W9RA 3FULA 3AS4A 3I4GA 3D3MA 2VSOE 4ANUA 4UWGA 2VYIA 4Y6WA 4JVSA 4L1BA 1ZBPA 1FCHA 2NSZA 4GU5A 3TL5A 1IQRA 1HFAA 4GMJA 2WXPA 4JZYA 4URKA 2LSUA 3S7JA 3TAXA 4C0MA 4NQ0A 4GA2A 4LRZA 3ZN3A 3VTYA 3L08A 2KC7A 3PZDA 4G25A 4APOA 2MHKA 2BUGA 1E8WA 4LCTA 3ZYMA 4KBQA 2GRLA 4DJAA 3SBSA 4J8FA 1HZ4A 1MHQA 5G04J 3FH8A 3SNXA 2VJ8A 2VQ2A 3CK8A 3LEWA 3QWPA 5C2YA 2HO1A 3IV0A 3B7RL 3D9IA 3TGOA 5ANRA 2J9QA 2PL2A 3LPZA 3PS6A 3CHRA 1EYHA 4AJWA 4AOFA 4EBAG 2OVBA 1BPOA 5E75A 1OWPA 2HYZA 3FTUA 3FUEA 4HS2A 3KD7A 4MRUA 4WWOA 3SBTB 4CRWA 4NURA 2IONA 1TEZA 2WXIA 4HOTA 4K03A 3IHVA 4O6FA 4E85A 3MJWA 3PDNA 5FZRA 4B94A 1HF8A 2HM8A 1HS6A 5FZQA 1TJFA 1XGWA 1JPLA 4BT8A 4PH4B 3LYAA 4I6GA 4KZ0A 4WNDA 3ZHEA 2P58C 3HVEB 3QK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2Z A;  2XCB A;  2VSN A;  3TG5 A;  2UY1 B;  5A7D B;  2I6H A;  4GA0 A;  2DBA A;  2LSV A;  3R9A B;  2L6J A;  3QWW A;  5ARF A;  4HOR A;  5D0O D;  5JJ6 A;  2UWJ G;  4UQZ A;  2YHC A;  3S7D A;  5LCW C;  4N2Q A;  3AS8 A;  3WXX A;  4I9C A;  4LEU A;  5CCL A;  4HOU A;  2WPV A;  1E96 B;  3GZ1 A;  4RG9 A;  4A1S A;  1HH8 A;  2KCL A;  3GW4 A;  4WUY A;  2KAT A;  3U3W A;  4ABN A;  4I2W A;  4UI9 K;  3ASF A;  5JJT A;  4AM9 A;  4UQY A;  4GPK A;  4U07 A;  4BT9 A;  3URZ A;  2VGX B;  3Q4A B;  4I1A A;  4GA1 A;  1ZU2 A;  3ASD A;  1ELW A;  5LCW J;  5G05 C;  5FZS A;  4JA7 A;  3LY7 A;  4BTB A;  5JJ7 A;  5AYW D;  3MEK A;  2V5F A;  4XIF A;  5HQ8 A;  3ZFW A;  5KJM A;  1WAO 1;  2Y4T A;  3ASG A;  2OND A;  4I17 A;  4H7X A;  4WNF A;  3ESK A;  3IEG A;  3SF4 A;  3S7F A;  3RKV A;  3QKY A;  4U0S A;  2IF4 A;  2FO7 A;  1WM5 A;  4U0Z A;  3FFL A;  3VTX A;  3BEE A;  3KS2 A;  3CVP A;  5FT9 A;  2XGM A;  4Y6C A;  5HI7 A;  3CEQ A;  2Y4U A;  5KJN A;  4GYY A;  4BWR A;  5DBK A;  3GYZ A;  4IN3 B;  2PQN A;  3RO3 A;  4U0U A;  4J8D A;  4GZ5 A;  5G05 J;  4HOQ A;  4WNG A;  4G1T A;  3CKB A;  2QFC A;  2XCC A;  2HR2 A;  3UUX A;  4AY6 A;  1NZN A;  3QWV A;  4UI9 C;  4N2S A;  3K9I A;  4BTA A;  1KT1 A;  3MV3 B;  1ELR A;  3FP3 A;  3Q47 B;  2LNI A;  1Y8M A;  3S7B A;  2FF4 A;  2FBN A;  5BW8 C;  2OOE A;  3OXG A;  1KLX A;  3LY8 A;  2C0M A;  4KXK B;  2KCV A;  3O48 A;  4F3V A;  2FEZ A;  5A6C A;  4XI0 A;  2E2E A;  3UQ3 A;  5EX0 A;  3Q5M A;  5CCM A;  4GZ3 A;  4UI9 J;  4N39 A;  4CDR A;  3CKC A;  5ARG A;  3CK9 A;  3MV2 B;  4YND A;  3U4T A;  1P5Q A;  2YQ8 A;  4AY5 A;  4G23 A;  4JA9 A;  1IYG A;  4GZ6 A;  2XGS A;  1QQE A;  4UQX A;  2FI7 A;  3RU0 A;  4HOS A;  1NA0 A;  5EKQ D;  3AS5 A;  3QOU A;  3CVL A;  3LKU A;  2PZI A;  3Q49 B;  2XEV A;  4N3C A;  2VGX A;  3FWV A;  5FJY A;  4Y6W A;  4GCO A;  4WNE A;  4I9E A;  3GZ2 A;  3PE3 A;  3CVQ A;  1W3B A;  4ME2 A;  4J8E A;  5KJK A;  5KJL A;  3ZHE B;  1PC2 A;  2Q7F A;  2AVP A;  4CGW A;  3CVN A;  1XNF A;  3N71 A;  1NA3 A;  3E4B A;  4GYW A;  4JHR A;  3TG4 A;  3RJV A;  5CHE E;  1IHG A;  5BNW A;  2VGY A;  4U04 A;  1TJC A;  4G26 A;  3KAE A;  4JL0 A;  3UPV A;  3ULQ A;  2C2L A;  2JLB A;  2WQH A;  4G2V A;  4YVQ C;  2UY1 A;  4GCN A;  1B89 A;  2GW1 A;  5M72 A;  4CGV A;  2IFU A;  4GYO A;  4N5C A;  5DIZ A;  3CV0 A;  4H7Y A;  1KT0 A;  3MA5 A;  3ASH A;  1A17 A;  5FTP A;  4N3B A;  1QZ2 A;  2R5S A;  3SZ7 A;  3EDT B;  2XPI A;  3RO2 A;  2PQR A;  4YVO A;  3JYS A;  3OXL A;  2XGO A;  3LY9 A;  4J0U A;  3LCA A;  1HXI A;  4NRH B;  3OXF A;  4G24 A;  2KCK A;  3QDN A;  4RG6 A;  2C0L A;  5C1D A;  1OUV A;  3Q15 A;  4AIF A;  4KYO B;  3CK7 A;  5G04 C;  3NF1 A;  3RIB A;  4EQF A;  5D0Q D;  1YA0 A;  3HYM B;  2NC9 A;  3PE4 A;  2VSY A;  3ZPJ A;  5EX3 A;  5BT1 A;  4XI9 A;  3MKR A;  4N3A A;  3ZGQ A;  4W9R A;  3AS4 A;  2VYI A;  1ZBP A;  1FCH A;  2LSU A;  3S7J A;  3TAX A;  4NQ0 A;  4GA2 A;  3ZN3 A;  3VTY A;  4G25 A;  2KC7 A;  4APO A;  2MHK A;  2BUG A;  4KBQ A;  4J8F A;  1HZ4 A;  5G04 J;  2VQ2 A;  3CK8 A;  3QWP A;  2HO1 A;  3TGO A;  2J9Q A;  2PL2 A;  3LPZ A;  2HYZ A;  3KD7 A;  4HOT A;  4O6F A;  3PDN A;  5FZR A;  4B94 A;  5FZQ A;  4BT8 A;  3LYA A;  4WND A;  3ZHE A;  2P58 C; 
#chains in the Genus database with same CATH topology
 3E30 A;  4G11 A;  5A7D B;  3ZNG A;  3UM2 A;  3EU5 A;  1OXJ A;  2LSV A;  2I2O A;  3R9A B;  2L6J A;  4KZC A;  3CVU A;  3V2O A;  2AWI A;  4CT0 A;  4GZD A;  2AJA A;  4UQZ A;  1WY6 A;  1UJK A;  4EHM A;  2Y0B G;  1K1B A;  5CCL A;  1E8X A;  1Q2Z A;  3EHN A;  4YDW A;  3DST A;  3T5V A;  3PVL A;  4K5A B;  1TNB A;  1LTX A;  4I1M A;  3F6Q A;  4WUY A;  2KAT A;  5CER B;  4ABN A;  1L5J A;  1V54 E;  3SFY A;  3ASF A;  3PNL B;  5EYP F;  2B6C A;  4U07 A;  2VGX B;  4I6J A;  1ZU2 A;  1E8Y A;  1ELW A;  2QC9 A;  2XZT G;  3NOG D;  4JA7 A;  1EDU A;  4DRX E;  1S64 A;  3NB2 A;  1DVP A;  2X6H A;  3MEK A;  2V5F A;  3UKR G;  4C9B B;  2LO6 A;  4LNU D;  3ZFW A;  1TNO A;  3CHQ A;  4GTM A;  4GML A;  4MS6 A;  5ENQ D;  4I17 A;  4HRM B;  1D8E A;  3SF4 A;  2WXM A;  2GRM A;  3RKV A;  4U0S A;  2IF4 A;  4AP2 A;  3FFL A;  4BFR A;  2AXZ A;  4HRN A;  2XGM A;  4Z68 A;  3P2B A;  3LJ3 A;  3QC1 A;  4U0U A;  3KEA A;  4HOQ A;  5BXU A;  1H2V C;  2ZIS A;  4G1T A;  3G2S A;  3MX3 A;  3DPY A;  3L82 A;  1N95 A;  2PNN A;  4XKB A;  3TWX A;  1OWN A;  1SA5 A;  2R59 A;  3FUJ A;  2HR2 A;  3ML9 A;  5AEN A;  3L54 A;  3R7R A;  2DZN A;  3QWV A;  1KT1 A;  2DWZ A;  1JWF A;  3JXJ A;  1ELR A;  3FP3 A;  3FU0 A;  3MZL B;  1Y8M A;  5CEC B;  1KLX A;  3J5P A;  4LNG A;  3U9W A;  2XS1 A;  4ACK A;  3NAW A;  3PEV B;  3O48 A;  2X6I A;  3QNK A;  4U8Y D;  2GRR B;  4PS3 A;  5BV1 A;  2RFA A;  5A6C A;  1JCR A;  2E2E A;  2OEV A;  5EX0 A;  5EDS A;  3DSU A;  4ATZ D;  3CVX A;  4N39 A;  3CKC A;  4NIK A;  3RK6 A;  3CK9 A;  3PRE A;  1RZ4 A;  4I6E A;  4ILH B;  3ZRH A;  4PS7 A;  2P9P G;  2XEE A;  3HXC A;  1P5Q A;  1FVF A;  4KT6 B;  3VLD A;  1UJJ A;  4JA9 A;  4UUC A;  5AQ9 A;  4APF A;  3TWQ A;  3KSL A;  3SI5 A;  3L13 A;  5KWD A;  3OTN A;  4J8S A;  3FDH A;  3CHM A;  4BSZ B;  5FIN A;  5KNH D;  3CVL A;  3PH0 C;  4HLE A;  1BLX B;  4GTO A;  2WXO A;  3CR3 A;  1UOH A;  1WG0 A;  3HIZ A;  3IHY A;  3APF A;  1K1A A;  2ETB A;  2BED A;  1W3B A;  1LD8 A;  2CG3 A;  2XHE A;  4J8E A;  5KJL A;  3CHS A;  2IO2 C;  5JHA A;  3CVY A;  5T8I A;  3UIN C;  3ISM C;  3EIJ A;  1SZA A;  4F1S A;  3LJN A;  3ZXS A;  3N71 A;  2KZT A;  3HDX A;  5CRV A;  1DCQ A;  4XKC A;  1MZC A;  2IJG X;  3E4B A;  4GYW A;  3TG4 A;  1IHG A;  3PUK A;  5CRU A;  4K0R A;  1TJC A;  3UTM A;  2YHE A;  3D9M A;  2F0Y A;  1FT1 A;  3B7S A;  3E32 A;  1NP7 A;  3C98 A;  2JLB A;  1MX4 A;  3R7Q A;  4U63 A;  2UY1 A;  3V31 A;  3Q78 A;  4FC8 A;  3W9G A;  5HKP A;  3MA5 A;  2GRO B;  4TV3 A;  2GRQ B;  3B7U X;  4FHK A;  5ITZ F;  2R5S A;  3EDT B;  2XPI A;  4FP7 A;  4YVO A;  3JYS A;  2XGO A;  4A1G A;  3Q79 A;  5IY5 E;  5ENT D;  2KCK A;  3QDN A;  4GZC A;  2WXH A;  4CEM A;  5D66 A;  1OUV A;  5T4Y A;  3W9F A;  1Z3Y A;  3FTS A;  3NF1 A;  3RIB A;  5D0Q D;  4DK5 A;  3ONL A;  1SA4 A;  5FQ7 A;  2NC9 A;  3PE4 A;  3FUD A;  2VSY A;  3ZPJ A;  5BT1 A;  1QNF A;  3UI2 A;  4XI9 A;  3ZGQ A;  3AS4 A;  2OEW A;  4JVS A;  4BER A;  1ZBP A;  2Y69 E;  3C72 A;  1FCH A;  2NSZ A;  5AAO A;  4JZY A;  3S7J A;  3TAX A;  3ULE G;  4C0M A;  4GA2 A;  3VTY A;  2KC7 A;  2BUG A;  4HBD A;  3SFX A;  2V4H C;  2QYU A;  3ZW3 A;  2VJ8 A;  2VQ2 A;  5C2Y A;  3B7R L;  3D9I A;  5ANR A;  1N4R A;  4AJW A;  1BPO A;  1OWP A;  2P9S G;  3KD7 A;  3SBT B;  2WXI A;  1O1S A;  4O6F A;  1XGW A;  3B7B A;  4I6G A;  4WND A;  3ZHE A;  3HVE B;  2J4D A;  2QYJ A;  2AW6 A;  2UY1 B;  1N4S A;  3ENE A;  4PUC A;  2DBA A;  4CDN A;  3R9M A;  5ARF A;  4WAF A;  4HNA D;  5JJ6 A;  2UWJ G;  2X6F A;  2YHC A;  3PZ4 A;  1KZO A;  3U64 A;  5LCW C;  3AS8 A;  3WXX A;  4ANW A;  4U95 D;  4UWL A;  2HE0 A;  5G55 A;  2J08 A;  2FUL A;  3GZS A;  4FHJ A;  1IKN D;  4LG6 A;  4TXQ A;  1LD7 A;  1TN6 A;  1HH8 A;  2KCL A;  1UW4 B;  4GTP A;  4HQD A;  3UT4 A;  4I2W A;  4NAC A;  3RRU A;  4UQY A;  2IEJ A;  5FWQ A;  2WXN A;  3KEZ A;  3RRM B;  2EIJ E;  4UWK A;  2J09 A;  4BEP A;  3TWS A;  4BTB A;  1MYO A;  5G2N A;  3MKQ A;  3TWT A;  3UM1 A;  5HQ8 A;  3NOC D;  3CGH A;  4KMO A;  1OCZ E;  2OND A;  3ESK A;  3MYV A;  3FTW A;  5FQ8 A;  4EPZ A;  1O5M A;  2FO7 A;  1WM5 A;  1DNP A;  4U0Z A;  4UWF A;  1Y6I A;  4DX5 D;  2Y4U A;  4HLL A;  4GYY A;  2PQN A;  2BKG A;  3RO3 A;  4YDO A;  4L7T A;  3PUJ A;  5G05 J;  1N94 A;  3I4R B;  4MLP A;  2KM4 A;  2A4Z A;  4U8H A;  1JCQ A;  1E7V A;  2QFC A;  4AEZ C;  4BX9 A;  3D9P A;  4AY6 A;  4IYP A;  1H6O A;  4BTA A;  3MV3 B;  5LOZ A;  4EBA A;  3IKO B;  4J7W A;  1MJ0 A;  4D10 C;  2I1K A;  4XEI G;  4L23 A;  3S7B A;  5BW8 C;  2FBN A;  4ANX A;  1PY1 A;  2P9I G;  5B1B E;  3BG0 B;  3UX4 A;  4Q69 A;  2FEZ A;  2VGE A;  1HX8 A;  3L22 A;  3UQ3 A;  5BUZ A;  3TXN A;  3Q5M A;  4RQI A;  3AU4 A;  4G8K A;  1N11 A;  3DSX A;  3FUI A;  2WXQ A;  4UI9 J;  2DIW A;  3UMV A;  3HRA A;  4DLQ A;  1MX2 A;  5ARG A;  3RAU A;  1N4Q A;  5AQ7 A;  1HG2 A;  2VTB A;  2R17 C;  2YQ8 A;  2R05 A;  4G23 A;  1IYG A;  2XGS A;  4UQX A;  4XE0 A;  5CEA A;  2PZI A;  3Q49 B;  2XEV A;  1NL4 A;  1PAQ A;  3CHO A;  3ZUV B;  4WNE A;  3UM3 A;  4I9E A;  1BI7 B;  3SY2 A;  3FTV A;  5BPP A;  1HE8 A;  3PZ1 A;  1ELK A;  1YYH A;  5KJK A;  3DEP A;  2KBX A;  3UT7 A;  2Q7F A;  4CCA A;  4WWN A;  2AVP A;  2WXJ A;  3V2X A;  4GTV A;  4CGW A;  1YCS B;  1XNF A;  1U2V G;  1FPP A;  2GRP B;  4CYM D;  3DRA A;  3FUF A;  5CHE E;  2XPY A;  4DI3 A;  3TWV A;  4M3O A;  4G26 A;  3DSS A;  2JAB A;  2WM9 A;  5A23 A;  5FQ6 A;  2J4B A;  2WXK A;  1N0Q A;  3ESL A;  1K8K G;  3DBS A;  3ONK A;  2IQC A;  4G2V A;  2GW1 A;  5M72 A;  2CFZ A;  4N5C A;  4CGV A;  3ASH A;  2ZIR A;  4HFG A;  1OWO A;  5FTP A;  3JUI A;  3FY4 A;  2L6B A;  2VTB B;  3JQ1 A;  3LDZ A;  2V5Q C;  2BF0 X;  2PQR A;  2YIN A;  3QB2 A;  4J0U A;  1HXI A;  2XEN A;  3L16 A;  3O4Z A;  3SHF A;  5E76 A;  1Z6T A;  3UM0 A;  2C0L A;  2ZXW E;  5C1D A;  3AAA C;  3Q15 A;  2ZGG A;  1H6P A;  4KYO B;  3CK7 A;  3TWU A;  2XS8 A;  1JWG A;  1EF1 C;  5AQA A;  1OCO E;  1YMP A;  4LUN U;  5EX3 A;  4Q94 A;  1E7U A;  5AIJ A;  4WWP A;  2IOS A;  4N3A A;  1JCS A;  3FEX A;  1H19 A;  3FUL A;  2VSO E;  4ANU A;  4UWG A;  2VYI A;  5KNG A;  4GU5 A;  1IQR A;  5ENR D;  4URK A;  2LSU A;  4NQ0 A;  3ZN3 A;  3ZYM A;  4U8V D;  3SBS A;  1MHQ A;  5G04 J;  3FH8 A;  2EIK E;  3CK8 A;  3QWP A;  3Q7F A;  3TGO A;  3LPZ A;  3CHR A;  4AOF A;  2F37 A;  5E75 A;  3FTU A;  4MRU A;  4CRW A;  2ION A;  5ENS D;  4HOT A;  4K03 A;  4YDE A;  4B94 A;  2P9L G;  2H6I A;  3HG0 D;  4BET A;  4I2Z A;  2XCB A;  3TG5 A;  4BSX A;  4TXR A;  2ZGD A;  4TUU A;  2CHX A;  4GA0 A;  2L0T B;  3Q9U C;  4UWH A;  1K3Z D;  4ZFH A;  3IBE A;  5D0O D;  1X81 A;  3D9L A;  2PM7 A;  3ZKJ A;  3S7D A;  5J08 A;  4I9C A;  4LEU A;  2LAH A;  4HOU A;  4TUM A;  1SQM A;  2EIM E;  3BU8 A;  2I9C A;  4RG9 A;  2XZD G;  3GW4 A;  2DYR E;  2RKK A;  4ATG A;  1NI1 A;  3DSW A;  3FTY A;  5JJT A;  3ZIM A;  4F6R D;  3PZ3 A;  4BT9 A;  4FAD A;  2F8Y A;  3CQC B;  4GA1 A;  5HS0 A;  2H6G A;  1DC2 A;  3MGB A;  2WQ7 A;  4GPM A;  5FZS A;  3LY7 A;  5JJ7 A;  1UN9 A;  2DZO A;  4XIF A;  4X8Q A;  1TNZ A;  1WAO 1;  2Y4T A;  4R7L A;  2V0P A;  3ASG A;  3I3N A;  4JEU A;  5KCM A;  2BTD A;  3S7F A;  2WXG A;  1FT2 A;  3BEE A;  2KZT B;  3PNT B;  5FT9 A;  2P2C P;  1TNY A;  5KJN A;  2J07 A;  3B7T A;  3HXF A;  3D9K A;  4BWR A;  2I1J A;  1EPU A;  1QYM A;  4J8D A;  3VLF A;  2LXM A;  4GZ5 A;  4O1O A;  1OCC E;  2LXL A;  3C3O A;  4WNG A;  4OAV B;  2GRN B;  3EU9 A;  3IXE A;  5EIB E;  1N54 A;  2XCC A;  4PDX A;  3WG7 E;  4DLO A;  3UUX A;  4OVV A;  4LER A;  2NYJ A;  4HXI A;  2XRY A;  1TN8 A;  4JC8 A;  2MYO A;  3QAQ A;  2XEH A;  1IXV A;  2Y3A A;  4DX6 D;  3Q47 B;  4B0Z A;  1V55 E;  2BKK B;  2MOW A;  2FF4 A;  2OOE A;  3OXG A;  3APC A;  2XPZ A;  2KCV A;  2WMO A;  2ETC A;  2A5E A;  1UG3 A;  1TNU A;  5CCM A;  3EIQ C;  3AG2 E;  1BU9 A;  1OY3 D;  4GTS A;  1Z3X A;  3ZVV A;  3V30 A;  3D9N A;  3D9H A;  3ZYL A;  4DX2 A;  3ASO E;  4GTQ A;  2CG2 A;  3MV2 B;  3JCK C;  3DPD A;  2RG8 A;  5AJL A;  3Q73 A;  5HRY A;  2CFU A;  4GZ6 A;  1QBQ A;  2H6H A;  3UIO C;  1QQE A;  4K5B A;  3MCX A;  2EIL E;  3AG3 E;  3UT8 A;  4ANV A;  1H0A A;  4DI4 A;  5EKQ D;  1RW2 A;  5EID A;  3LKU A;  4HB5 A;  4AXH A;  4N3C A;  2VGX A;  4B8C B;  3FWV A;  5LFA A;  4GCO A;  3FUK A;  3JUE A;  3GZ2 A;  2IOL A;  4QFV A;  3KSQ A;  3PE3 A;  3HXB A;  4ME2 A;  3UXG A;  4BX8 A;  4ILG A;  2J49 A;  3ZHE B;  1PC2 A;  4JXT A;  3TXM A;  3G2W A;  3ZYQ A;  4BY6 A;  3CVN A;  4EZL A;  5BV0 A;  4A63 B;  2X6K A;  4KVM A;  3BQO A;  5CMW A;  2X38 A;  4JHR A;  1O1R A;  5BNW A;  1IQU A;  2ZU6 B;  2IY0 C;  5AAR A;  1OWL A;  3QJZ A;  3J5Q B;  2X3M A;  4JL0 A;  3UPV A;  2FO1 E;  2PM6 A;  3ULQ A;  4L2L A;  2M63 A;  1WDY A;  5BXO A;  1H6K A;  4YVQ C;  3B13 A;  5AQB A;  4CDM A;  4GCN A;  3DWL G;  4GYO A;  5EN5 D;  1KZP A;  3CVW A;  2L9B A;  1A17 A;  1D8D A;  3T8K A;  3FUH A;  2H6F A;  3Q7A A;  3PZ2 A;  1H2T C;  4C48 B;  3RO2 A;  3EUV A;  1S70 B;  3OXL A;  3E34 A;  4NRH B;  3MKQ B;  3FEY A;  1O1T A;  3OXF A;  1A5E A;  5FIO A;  4RG6 A;  3CQG B;  4A3T A;  4TXP A;  4C0E A;  2XQ0 A;  1N0R A;  3SD5 A;  1SW6 A;  4HI8 A;  2RD0 A;  2IO3 C;  1YA0 A;  4A55 A;  5JHB A;  3UKU G;  4F53 A;  1BD8 A;  4GTT A;  4EZJ A;  3MKR A;  4W9R A;  3I4G A;  3D3M A;  3HXE A;  4L1B A;  4F1P A;  1HFA A;  3C3R A;  4LRZ A;  4O60 A;  4APO A;  3PZD A;  2MHK A;  1E8W A;  3ASN E;  4LCT A;  5JMN D;  4J8F A;  4GTR A;  3SNX A;  4JB8 P;  4BES A;  1EYH A;  2OVB A;  2HYZ A;  5CED B;  3AG1 E;  3FUE A;  4NUR A;  3ABL E;  4O1P A;  3IHV A;  5FZR A;  1HF8 A;  2HM8 A;  4OAU C;  5FZQ A;  1JPL A;  4BT8 A;  4PH4 B;  4DX1 A;  3T9K A;  4KZ0 A;  2P58 C;  3DXM G;  3QK0 A;  2VSX E;  3V79 K;  3ZU7 B;  2VSN A;  4FA6 A;  2I6H A;  3DEO A;  2WXR A;  1NFI E;  4U96 D;  2XRZ A;  3FUN A;  2DCP A;  1D9S A;  3QWW A;  4HOR A;  4RLY A;  2P9K G;  4B8A A;  3U66 A;  4N2Q A;  4HVB A;  2OV8 A;  3L6A A;  4KVO A;  3TJP A;  3EJN A;  3C5R A;  1AP7 A;  2WPV A;  1OT8 A;  2DYS E;  5EIL A;  1E96 B;  1TR4 A;  3GZ1 A;  3D9J A;  1N4P A;  5ENO D;  4A1S A;  2WXF A;  1UN8 A;  3CHP A;  4XZ4 A;  3ML8 A;  3U3W A;  4M7C A;  4UI9 K;  4AM9 A;  4MBG A;  4F7A A;  4GPK A;  4GB9 A;  4DUI A;  3URZ A;  2EQX A;  3Q4A B;  4I1A A;  3ASD A;  4L9P A;  2LAI A;  5LCW J;  5G05 C;  1G3N B;  1MQS A;  1OWM A;  2B0O E;  5AYW D;  4U7E B;  3D9O A;  3FU5 A;  2Y1L E;  5AN8 A;  5KJM A;  2E0I A;  3Q9N C;  3B95 A;  4H7X A;  4WNF A;  3IEG A;  2OCC E;  5CBN A;  3TWR A;  2P9U G;  3ABM E;  3QKY A;  3FU3 A;  2RFM A;  3VTX A;  4DX7 D;  3KS2 A;  3BUA A;  3CVP A;  4IUL A;  3C3Q A;  4Y6C A;  5HI7 A;  3CEQ A;  3ABK E;  3P1U A;  3FTZ A;  5DBK A;  3GYZ A;  4IN3 B;  3LS8 A;  5B1A E;  1LF8 A;  4P29 A;  4JHK A;  2OVF A;  4J6I A;  1U3C A;  3E33 A;  4I1O B;  3JXI A;  3CKB A;  4B89 A;  5D2M C;  3NZU A;  3NQP A;  2R03 A;  3FH7 A;  3FHE A;  2V8S E;  4RVB A;  3EHM A;  1NZN A;  1KPS B;  3CLJ A;  3NZS A;  4UI9 C;  4N2S A;  3K9I A;  4JEH A;  2V4L A;  5ANL A;  2ETA A;  3L17 A;  4QQI A;  4OYS A;  3ZXP A;  2WVI A;  2LNI A;  4I43 A;  3G2T A;  4LSZ E;  5CBO A;  3LY8 A;  5J90 A;  2C0M A;  1U3D A;  4KXK B;  3NBN B;  5AJD A;  3HVE A;  4F3V A;  4PS8 A;  4OVU A;  4YDY A;  4XI0 A;  3T5X A;  4L2Y A;  3RRN B;  4ILI A;  4TRQ A;  3OAW A;  2MRI A;  4GZ3 A;  2R02 A;  1FVH A;  4DPR A;  2GGF A;  1OCR E;  4CDR A;  1S63 A;  4MKT A;  3FH5 A;  4HI9 A;  4YND A;  3U4T A;  4K5C A;  4EEC A;  1JUQ A;  2A5U A;  1HU3 A;  4AY5 A;  1S0P A;  5CMY A;  3TWW A;  3Q75 A;  3PRZ A;  2YNQ A;  2FI7 A;  3RU0 A;  5H7P A;  1N52 A;  4HOS A;  1NA0 A;  2CHZ A;  3AS5 A;  3QOU A;  4FLB A;  3EHQ A;  5T3R A;  1AWC B;  1X5B A;  5FJY A;  4Y6W A;  5LX8 A;  4LNB A;  1VDY A;  2AXV A;  3CIA A;  3CVQ A;  1ZB1 A;  3ZYK A;  3UIP C;  3G2V A;  1HO8 A;  3L9T A;  1SZ9 A;  1H2U A;  3FTX A;  3HHM A;  3HXD A;  4JPS A;  2WB2 A;  2WXL A;  4ACL A;  2F8X K;  1TYQ G;  2CHW A;  3FU6 A;  3AJI A;  3CVV A;  3CSF A;  3SFZ A;  1NA3 A;  4FUL A;  2WQ6 A;  2QY7 A;  3AU5 A;  3LVQ E;  1IHB A;  2AXU A;  1E90 A;  3S2A A;  3DXK G;  3RJV A;  2VGY A;  2P9N G;  1HG5 A;  4U04 A;  1E8Z A;  3SGH A;  5ENN A;  1BI8 B;  4FU3 A;  3KAE A;  2C2L A;  4AV7 A;  2DVW A;  3EHR A;  5LP0 A;  4GMR A;  2WQH A;  2NXP A;  4E6H A;  3QAR A;  3RSE G;  4JD2 G;  4ZHB A;  3JQ0 A;  5B3S E;  1B89 A;  4FLH A;  3I5P A;  2IU1 A;  2IFU A;  4V3I A;  4JW1 A;  3AG4 E;  4EZK A;  3CV0 A;  4H7Y A;  1KT0 A;  5DIZ A;  4AVX A;  4GAA A;  3LVR E;  3ZEF A;  4N3B A;  2WMN A;  4XX5 A;  3PEU B;  1QZ2 A;  3SZ7 A;  5KBA A;  4A3V A;  3BG1 B;  3FUM A;  3VLE A;  3ULY A;  2JEK A;  3LY9 A;  3LCA A;  2L0I A;  5ENP D;  4Q96 A;  1GW6 A;  4G24 A;  1INZ A;  4CT4 A;  2ILR A;  4N5Q A;  1DCE A;  4AIF A;  3T8M A;  5G04 C;  3SO8 A;  3APD A;  4EQF A;  3E37 A;  4RSY A;  2EIN E;  4G8L A;  4FJZ A;  3LXU X;  3CST A;  3DSV A;  3HYM B;  4JHJ A;  2X6J A;  1MX6 A;  5EYL A;  5FQ4 A;  1Z5S C;  4IRU A;  4J8Y A;  3G2U A;  5JA4 D;  4FJY A;  3TL5 A;  4GMJ A;  2WXP A;  4CZ2 D;  4B93 B;  3L08 A;  2LUH A;  4G25 A;  4KBQ A;  1SVX A;  2GRL A;  4DJA A;  4HRL A;  3SQV A;  1HZ4 A;  3LEW A;  2HO1 A;  2R2L A;  3IV0 A;  2J9Q A;  2PL2 A;  3PS6 A;  4EBA G;  4HS2 A;  1TEZ A;  4WWO A;  1TN7 A;  4E85 A;  3MJW A;  3PDN A;  1HS6 A;  3X2Q E;  1TJF A;  2QZA A;  2J8S D;  3LYA A;  1N9A A;  2KXP C; 
#chains in the Genus database with same CATH homology
 2J4D A;  4I2Z A;  2XCB A;  2VSX E;  2VSN A;  4G11 A;  3TG5 A;  4BSX A;  4FA6 A;  2AW6 A;  2UY1 B;  5A7D B;  4TUU A;  2I6H A;  2CHX A;  3ENE A;  4GA0 A;  4PUC A;  2L0T B;  2DBA A;  2LSV A;  2WXR A;  2I2O A;  3R9A B;  4CDN A;  2L6J A;  4KZC A;  4UWH A;  2XRZ A;  3CVU A;  2AWI A;  3FUN A;  3IBE A;  4CT0 A;  2DCP A;  3QWW A;  5ARF A;  4WAF A;  4HOR A;  5D0O D;  4GZD A;  5JJ6 A;  3D9L A;  2UWJ G;  4UQZ A;  1WY6 A;  2X6F A;  2YHC A;  4B8A A;  3U66 A;  2PM7 A;  1UJK A;  3U64 A;  3S7D A;  5LCW C;  4N2Q A;  3AS8 A;  4HVB A;  3WXX A;  5J08 A;  2OV8 A;  4I9C A;  4LEU A;  4ANW A;  3L6A A;  4KVO A;  3TJP A;  1E8X A;  2LAH A;  5CCL A;  3EJN A;  4UWL A;  4HOU A;  1SQM A;  3EHN A;  5G55 A;  2J08 A;  2WPV A;  2FUL A;  1E96 B;  2I9C A;  3GZ1 A;  3GZS A;  3D9J A;  3T5V A;  4RG9 A;  4FHJ A;  3PVL A;  4A1S A;  2WXF A;  1UN8 A;  3CHP A;  1HH8 A;  4XZ4 A;  2KCL A;  3GW4 A;  4I1M A;  3ML8 A;  1UW4 B;  4ATG A;  4WUY A;  2KAT A;  3U3W A;  3UT4 A;  4ABN A;  4I2W A;  1L5J A;  4UI9 K;  3ASF A;  3FTY A;  3PNL B;  3ZIM A;  5JJT A;  4NAC A;  4AM9 A;  3RRU A;  4UQY A;  4F7A A;  4GPK A;  4GB9 A;  4U07 A;  4BT9 A;  3URZ A;  2EQX A;  5FWQ A;  2VGX B;  2WXN A;  3KEZ A;  4FAD A;  3Q4A B;  3CQC B;  3RRM B;  4I1A A;  4GA1 A;  4I6J A;  1ZU2 A;  1E8Y A;  3ASD A;  4UWK A;  1ELW A;  3MGB A;  2J09 A;  2LAI A;  5LCW J;  5G05 C;  2WQ7 A;  5FZS A;  4JA7 A;  1MQS A;  1EDU A;  3LY7 A;  1OWM A;  4BTB A;  5JJ7 A;  5AYW D;  1UN9 A;  5G2N A;  3D9O A;  3MKQ A;  1DVP A;  2X6H A;  3FU5 A;  3MEK A;  2V5F A;  4XIF A;  5HQ8 A;  4C9B B;  2LO6 A;  3ZFW A;  3CHQ A;  5KJM A;  3CGH A;  1WAO 1;  2Y4T A;  4R7L A;  4GML A;  4KMO A;  2V0P A;  3ASG A;  3I3N A;  4JEU A;  2OND A;  4MS6 A;  2E0I A;  4I17 A;  4H7X A;  4WNF A;  5KCM A;  3ESK A;  3IEG A;  3SF4 A;  2BTD A;  3S7F A;  2WXM A;  2GRM A;  3MYV A;  3FTW A;  2WXG A;  3RKV A;  5FQ8 A;  3QKY A;  4U0S A;  4EPZ A;  2IF4 A;  3FU3 A;  2FO7 A;  1WM5 A;  4AP2 A;  1DNP A;  4U0Z A;  4UWF A;  1Y6I A;  3FFL A;  3VTX A;  3BEE A;  4BFR A;  2KZT B;  3PNT B;  2AXZ A;  3KS2 A;  3CVP A;  4IUL A;  5FT9 A;  2XGM A;  4Y6C A;  5HI7 A;  3CEQ A;  2Y4U A;  5KJN A;  2J07 A;  3B7T A;  3P1U A;  3FTZ A;  4GYY A;  3D9K A;  4BWR A;  2I1J A;  5DBK A;  3P2B A;  3GYZ A;  4IN3 B;  1EPU A;  3LS8 A;  3LJ3 A;  2PQN A;  3QC1 A;  3RO3 A;  4U0U A;  3VLF A;  4J8D A;  4L7T A;  3PUJ A;  1LF8 A;  4GZ5 A;  4HOQ A;  4JHK A;  2OVF A;  4P29 A;  4J6I A;  1H2V C;  5G05 J;  1U3C A;  3I4R B;  4I1O B;  4WNG A;  4MLP A;  4G1T A;  3G2S A;  2KM4 A;  2A4Z A;  3MX3 A;  3CKB A;  4U8H A;  4B89 A;  3NZU A;  3NQP A;  4XKB A;  1E7V A;  1N54 A;  2QFC A;  4AEZ C;  3FH7 A;  4BX9 A;  3FHE A;  2XCC A;  2V8S E;  1OWN A;  2R59 A;  3D9P A;  3FUJ A;  4PDX A;  3EHM A;  2HR2 A;  3ML9 A;  4RVB A;  3UUX A;  4DLO A;  5AEN A;  4AY6 A;  1NZN A;  4IYP A;  4OVV A;  3L54 A;  3R7R A;  4LER A;  3QWV A;  3CLJ A;  3NZS A;  4UI9 C;  4N2S A;  3K9I A;  4JEH A;  4HXI A;  2XRY A;  2V4L A;  5ANL A;  4BTA A;  4JC8 A;  1KT1 A;  3MV3 B;  5LOZ A;  4EBA A;  1JWF A;  3IKO B;  3QAQ A;  1ELR A;  2Y3A A;  3L17 A;  4OYS A;  3FP3 A;  3FU0 A;  2WVI A;  3MZL B;  3Q47 B;  4D10 C;  2I1K A;  4B0Z A;  4L23 A;  2LNI A;  1Y8M A;  2MOW A;  4I43 A;  3G2T A;  3S7B A;  2FF4 A;  2FBN A;  5BW8 C;  1PY1 A;  2OOE A;  4ANX A;  3OXG A;  1KLX A;  3LY8 A;  3APC A;  5J90 A;  2C0M A;  1U3D A;  4KXK B;  3U9W A;  3BG0 B;  4ACK A;  5AJD A;  3UX4 A;  4Q69 A;  2XPZ A;  2KCV A;  3PEV B;  3HVE A;  3O48 A;  4F3V A;  2X6I A;  4PS8 A;  3QNK A;  2FEZ A;  2WMO A;  4OVU A;  4PS3 A;  5BV1 A;  1HX8 A;  3L22 A;  5A6C A;  4XI0 A;  2E2E A;  3UQ3 A;  3T5X A;  5BUZ A;  4L2Y A;  3RRN B;  5EX0 A;  3TXN A;  5EDS A;  4ILI A;  3Q5M A;  4TRQ A;  1UG3 A;  3OAW A;  5CCM A;  2MRI A;  3EIQ C;  3AU4 A;  4GZ3 A;  1FVH A;  4DPR A;  3FUI A;  2WXQ A;  4UI9 J;  2DIW A;  2GGF A;  3CVX A;  4N39 A;  1Z3X A;  3UMV A;  4CDR A;  3ZVV A;  3CKC A;  4DLQ A;  4MKT A;  3D9N A;  3FH5 A;  5ARG A;  3RK6 A;  3ZYL A;  3CK9 A;  3PRE A;  4I6E A;  2CG2 A;  3MV2 B;  4ILH B;  1HG2 A;  3ZRH A;  3JCK C;  4PS7 A;  4YND A;  2VTB A;  3DPD A;  3U4T A;  1P5Q A;  2R17 C;  2RG8 A;  1FVF A;  2YQ8 A;  4EEC A;  1JUQ A;  5AJL A;  2A5U A;  1HU3 A;  4AY5 A;  1S0P A;  4KT6 B;  3VLD A;  5CMY A;  1UJJ A;  2CFU A;  4G23 A;  4JA9 A;  1IYG A;  4GZ6 A;  2XGS A;  4APF A;  1QQE A;  3PRZ A;  4UQX A;  3SI5 A;  3MCX A;  2YNQ A;  3L13 A;  2FI7 A;  3OTN A;  3RU0 A;  3UT8 A;  4J8S A;  4ANV A;  1N52 A;  4XE0 A;  4HOS A;  3FDH A;  3CHM A;  1H0A A;  4DI4 A;  1NA0 A;  5EKQ D;  2CHZ A;  3AS5 A;  3QOU A;  4FLB A;  3CVL A;  3PH0 C;  3LKU A;  5T3R A;  4AXH A;  2PZI A;  3Q49 B;  2XEV A;  4N3C A;  2VGX A;  4HLE A;  4B8C B;  1X5B A;  3FWV A;  5LFA A;  5FJY A;  1PAQ A;  2WXO A;  3CHO A;  3CR3 A;  3FUK A;  3HIZ A;  3IHY A;  4GCO A;  4I9E A;  4WNE A;  3APF A;  5LX8 A;  3GZ2 A;  2IOL A;  1VDY A;  4QFV A;  3FTV A;  2AXV A;  3CIA A;  5BPP A;  3PE3 A;  3CVQ A;  1HE8 A;  1W3B A;  3G2V A;  1HO8 A;  3ZYK A;  4ME2 A;  1ELK A;  1SZ9 A;  2CG3 A;  2XHE A;  4J8E A;  4BX8 A;  5KJK A;  1H2U A;  3FTX A;  3HHM A;  4ILG A;  4JPS A;  5KJL A;  2J49 A;  3CHS A;  3ZHE B;  2WB2 A;  3UT7 A;  2WXL A;  5JHA A;  4ACL A;  1PC2 A;  2Q7F A;  3CVY A;  4JXT A;  5T8I A;  4CCA A;  3TXM A;  3G2W A;  3EIJ A;  1SZA A;  4WWN A;  3ZYQ A;  4F1S A;  2AVP A;  2WXJ A;  4BY6 A;  2CHW A;  3FU6 A;  4CGW A;  3CVN A;  3CVV A;  3CSF A;  3ZXS A;  3SFZ A;  4EZL A;  1XNF A;  3N71 A;  5BV0 A;  1NA3 A;  2KZT A;  4FUL A;  3HDX A;  2QY7 A;  3AU5 A;  2WQ6 A;  4XKC A;  2X6K A;  3LVQ E;  2IJG X;  3E4B A;  4KVM A;  4GYW A;  5CMW A;  2X38 A;  2AXU A;  1E90 A;  4JHR A;  3S2A A;  3TG4 A;  3FUF A;  3RJV A;  5CHE E;  1IHG A;  5BNW A;  2VGY A;  1IQU A;  2ZU6 B;  3PUK A;  1HG5 A;  2XPY A;  1OWL A;  4U04 A;  4DI3 A;  1E8Z A;  4K0R A;  1TJC A;  2YHE A;  4M3O A;  3QJZ A;  5ENN A;  3D9M A;  3SGH A;  4G26 A;  2X3M A;  4FU3 A;  3KAE A;  4JL0 A;  2WM9 A;  3UPV A;  2PM6 A;  5A23 A;  3B7S A;  2C2L A;  2J4B A;  2WXK A;  5FQ6 A;  1NP7 A;  3ULQ A;  4AV7 A;  3ESL A;  4L2L A;  3C98 A;  2JLB A;  5LP0 A;  2M63 A;  2WQH A;  2NXP A;  3DBS A;  4E6H A;  3QAR A;  1H6K A;  3R7Q A;  3ZW3 A;  3ONK A;  2IQC A;  4G2V A;  4U63 A;  4YVQ C;  3B13 A;  4CDM A;  2UY1 A;  4GCN A;  3JQ0 A;  1B89 A;  4FLH A;  2GW1 A;  3I5P A;  4FC8 A;  2IU1 A;  5M72 A;  2CFZ A;  2IFU A;  4GYO A;  4N5C A;  4V3I A;  4CGV A;  4JW1 A;  4EZK A;  3CVW A;  3CV0 A;  2L9B A;  1KT0 A;  4H7Y A;  5DIZ A;  4AVX A;  3MA5 A;  3ASH A;  4GAA A;  4HFG A;  1OWO A;  3LVR E;  4TV3 A;  1A17 A;  5FTP A;  3JUI A;  3FY4 A;  3ZEF A;  4N3B A;  2VTB B;  2WMN A;  3FUH A;  4XX5 A;  3B7U X;  3PEU B;  3JQ1 A;  4FHK A;  1QZ2 A;  2R5S A;  3LDZ A;  3SZ7 A;  4A3V A;  3BG1 B;  1H2T C;  3EDT B;  2BF0 X;  3FUM A;  3VLE A;  2XPI A;  4FP7 A;  3RO2 A;  2PQR A;  2YIN A;  4YVO A;  3JYS A;  3OXL A;  2JEK A;  2XGO A;  4A1G A;  3LY9 A;  3QB2 A;  4J0U A;  3LCA A;  2L0I A;  1HXI A;  3L16 A;  4NRH B;  3MKQ B;  3O4Z A;  3FEY A;  3OXF A;  4Q96 A;  3SHF A;  5E76 A;  1Z6T A;  1GW6 A;  4G24 A;  2KCK A;  3QDN A;  4GZC A;  2WXH A;  4RG6 A;  2ILR A;  4CEM A;  4CT4 A;  1INZ A;  3CQG B;  2C0L A;  4A3T A;  5C1D A;  1OUV A;  5T4Y A;  3Q15 A;  4AIF A;  4KYO B;  3T8M A;  3CK7 A;  4C0E A;  2XQ0 A;  1Z3Y A;  5G04 C;  3FTS A;  1JWG A;  1EF1 C;  3NF1 A;  3SD5 A;  3RIB A;  3APD A;  4EQF A;  2RD0 A;  4RSY A;  5D0Q D;  4DK5 A;  3ONL A;  4FJZ A;  3LXU X;  3CST A;  1YA0 A;  3HYM B;  5FQ7 A;  4A55 A;  4JHJ A;  2NC9 A;  2X6J A;  3PE4 A;  3FUD A;  4LUN U;  5JHB A;  2VSY A;  3ZPJ A;  5EX3 A;  4Q94 A;  1E7U A;  5AIJ A;  5BT1 A;  4WWP A;  4F53 A;  5FQ4 A;  1QNF A;  2IOS A;  4IRU A;  4EZJ A;  3G2U A;  4XI9 A;  3MKR A;  4N3A A;  3ZGQ A;  4FJY A;  3FEX A;  1H19 A;  4W9R A;  3FUL A;  3AS4 A;  3I4G A;  3D3M A;  2VSO E;  4ANU A;  4UWG A;  2VYI A;  4Y6W A;  4JVS A;  4L1B A;  1ZBP A;  1FCH A;  2NSZ A;  4GU5 A;  3TL5 A;  1IQR A;  1HFA A;  4GMJ A;  2WXP A;  4JZY A;  4URK A;  2LSU A;  3S7J A;  3TAX A;  4C0M A;  4NQ0 A;  4GA2 A;  4LRZ A;  3ZN3 A;  3VTY A;  3L08 A;  2KC7 A;  3PZD A;  4G25 A;  4APO A;  2MHK A;  2BUG A;  1E8W A;  4LCT A;  3ZYM A;  4KBQ A;  2GRL A;  4DJA A;  3SBS A;  4J8F A;  1HZ4 A;  1MHQ A;  5G04 J;  3FH8 A;  3SNX A;  2VJ8 A;  2VQ2 A;  3CK8 A;  3LEW A;  3QWP A;  5C2Y A;  2HO1 A;  3IV0 A;  3B7R L;  3D9I A;  3TGO A;  5ANR A;  2J9Q A;  2PL2 A;  3LPZ A;  3PS6 A;  3CHR A;  1EYH A;  4AJW A;  4AOF A;  4EBA G;  2OVB A;  1BPO A;  5E75 A;  1OWP A;  2HYZ A;  3FTU A;  3FUE A;  4HS2 A;  3KD7 A;  4MRU A;  4WWO A;  3SBT B;  4CRW A;  4NUR A;  2ION A;  1TEZ A;  2WXI A;  4HOT A;  4K03 A;  3IHV A;  4O6F A;  4E85 A;  3MJW A;  3PDN A;  5FZR A;  4B94 A;  1HF8 A;  2HM8 A;  1HS6 A;  5FZQ A;  1TJF A;  1XGW A;  1JPL A;  4BT8 A;  4PH4 B;  3LYA A;  4I6G A;  4KZ0 A;  4WND A;  3ZHE A;  2P58 C;  3HVE B;  3QK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...