4GA0A

Structure of the n-terminal domain of nup358
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
143
structure length
143
Chain Sequence
RSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWLERAAKLFPGSPAIYKLKEQLLDCEGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords E3 SUMO-protein ligase RanBP2
total genus 57
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga0A00
1WAO1 5FZSA 3U4TA 3ZHEB 2VGYA 1PC2A 4NRHB 1KT1A 4HOTA 4G1TA 4UQXA 4GYWA 3ASGA 2LNIA 3KD7A 4J0UA 2OOEA 2V5FA 3CKCA 3Q49B 3S7JA 1TJCA 4CGVA 3MA5A 3LY8A 4GA1A 3PE4A 4GA2A 5BNWA 2J9QA 4G25A 4I9CA 2HO1A 4H7XA 3GW4A 4I17A 3EDTB 4IN3B 1E96B 5LCWC 4HOQA 4BT8A 3CV0A 4XI0A 2XEVA 4KBQA 4WNGA 1ELWA 4U0UA 3TG5A 4HORA 4O6FA 2PL2A 1HH8A 1W3BA 2Y4UA 3Q4AB 4U04A 5ARFA 3RJVA 3MKRA 4I9EA 1WM5A 4UQYA 3AS4A 2Q7FA 3FFLA 4AM9A 4KXKB 3Q5MA 4LEUA 4G26A 1Y8MA 5CCMA 4GYYA 4I1AA 5D0QD 3QKYA 3R9AB 2IF4A 3HYMB 4G23A 2UY1A 3QWWA 4G2VA 4U0ZA 1XNFA 4XI9A 5M72A 5FTPA 3AS8A 3KAEA 3PDNA 4Y6WA 4HOSA 5BT1A 3QWPA 4N5CA 5FZQA 3ZHEA 4EQFA 3ESKA 5FJYA 1YA0A 4JL0A 5KJMA 4U0SA 2UY1B 4Y6CA 2FEZA 5CCLA 3K9IA 3LYAA 4I2WA 3E4BA 4YVOA 4WUYA 3TGOA 4WNEA 4J8EA 2VYIA 3O48A 5LCWJ 4UQZA 5C1DA 2C2LA 2I6HA 4G24A 4J8FA 4UI9J 1NA3A 5G04C 3UQ3A 3OXFA 5A6CA 5BW8C 2LSVA 5JJTA 4NQ0A 3FWVA 3SF4A 5G05C 4AIFA 3LKUA 1IHGA 3ZPJA 4GCOA 4U07A 2PQRA 3ASDA 2C0LA 4GZ3A 3ZFWA 2XGMA 2HR2A 3GZ2A 3RKVA 3Q15A 2KC7A 1P5QA 2FBNA 2BUGA 3ASHA 3UUXA 4GA0A 3LPZA 3QDNA 4KYOB 3GZ1A 4GZ6A 4ABNA 1NZNA 2VGXA 4JA9A 4RG9A 3RO2A 3CK8A 4BT9A 3BEEA 2XPIA 3N71A 5D0OD 1NA0A 2L6JA 3CKBA 3MV3B 3QOUA 4RG6A 3S7FA 2ONDA 2VQ2A 3MEKA 3U3WA 2NC9A 3JYSA 5ARGA 2FO7A 5AYWD 3SZ7A 3CVLA 3ZN3A 3VTYA 2JLBA 4B94A 5HI7A 4CDRA 4HOUA 3WXXA 1KT0A 2KCKA 2C0MA 3Q47B 4BWRA 4GCNA 5DIZA 2MHKA 4I2ZA 1HZ4A 3CVPA 3OXGA 4UI9C 5EX3A 5KJLA 2QFCA 2P58C 3ASFA 5EX0A 4GPKA 4GZ5A 4XIFA 3GYZA 3LY7A 5DBKA 5G05J 3URZA 4N2SA 3TAXA 4AY5A 3VTXA 1ZU2A 2KCLA 4N39A 3RIBA 2XCBA 1ELRA 2UWJG 3NF1A 3S7DA 4N3BA 5KJNA 3QWVA 4WNDA 3LCAA 3RU0A 3CVNA 4GYOA 1HXIA 2E2EA 2IFUA 2LSUA 3MV2B 3OXLA 5G04J 3TG4A 3ULQA 1IYGA 3AS5A 2KATA 2WQHA 4ME2A 1OUVA 2VGXB 4JA7A 4UI9K 1A17A 2AVPA 5EKQD 3RO3A 5FT9A 3FP3A 4WNFA 3CK7A 4F3VA 2VSNA 1ZBPA 3LY9A 2XGOA 4N3CA 4YVQC 3S7BA 3CVQA 1FCHA 4APOA 3UPVA 1KLXA 2FI7A 2R5SA 2WPVA 2Y4TA 5FZRA 4AY6A 1QQEA 2YHCA 2YQ8A 3KS2A 5KJKA 2PZIA 4BTBA 4J8DA 4W9RA 1QZ2A 2KCVA 1B89A 5JJ6A 2HYZA 5JJ7A 3CK9A 3IEGA 4A1SA 2XCCA 4H7YA 2DBAA 4JHRA 4YNDA 4BTAA 2FF4A 2GW1A 4N3AA 5A7DB 3ZGQA 4CGWA 4N2QA 3PE3A 5HQ8A 2XGSA 5CHEE 2VSYA 2PQNA 3CEQA
chains in the Genus database with same CATH superfamily
3U4TA 3G2UA 5CRVA 5ANLA 4G25A 3GW4A 2LO6A 5LCWC 4BT8A 2VSXE 5EYPF 1HH8A 4L9PA 1TN6A 3D9NA 2R05A 3FULA 2IEJA 2RD0A 5BT1A 3RK6A 1YA0A 2OCCE 4TV3A 4YVOA 1O1RA 1MX4A 3RRUA 1S70B 2I6HA 5CMWA 2BEDA 1OCRE 5BXOA 3I4GA 4ANWA 2IU1A 4QFVA 4YDEA 2WXFA 4YDWA 5ANRA 4NIKA 3LPZA 3CHPA 4CEMA 2GRQB 5EILA 3MV3B 3LXUX 5HI7A 3ZRHA 2OEVA 3WXXA 3ULEG 4GCNA 1X5BA 2L9BA 3FUIA 4GMLA 3B13A 2EILE 4XIFA 5AJLA 3LJNA 1OCOE 5BUZA 4KZCA 4HI8A 2XRYA 1SZ9A 2CG2A 3L08A 3D9PA 3FUDA 3Q9UC 1DCQA 3L6AA 2IY0C 2DYRE 1OWPA 2A4ZA 3HXDA 2CFZA 3Q78A 3B7SA 5G55A 3CSTA 4H7YA 3FTWA 4WWPA 2H6GA 5HQ8A 2ILRA 3SNXA 3IHVA 1BI8B 3I5PA 4UQXA 5FQ7A 3PS6A 2HM8A 1KZOA 1MHQA 4E6HA 4KBQA 4O6FA 3ULYA 2XPYA 4APFA 2DYSE 4DLQA 4NURA 4GTPA 4U0ZA 3AU4A 2I9CA 2EIJE 1TR4A 3ZHEA 3ESKA 3Q7AA 1HS6A 2FO1E 2MRIA 3S2AA 2J49A 4TUMA 4CRWA 4ILHB 3FUHA 4DX6D 3FEYA 3CVXA 4HRMB 4BX8A 5FWQA 3BEEA 1TN7A 4AOFA 4LSZE 4K0RA 3PZ1A 2QFCA 4ZFHA 2KBXA 1NP7A 4B93B 5CEDB 3ABME 2E2EA 5CEAA 4U8VD 3ULQA 1H2UA 3Q7FA 3RO3A 1AWCB 4BERA 5BV0A 1SA5A 3UM2A 1SW6A 2Y0BG 1HX8A 3ZW3A 3JQ0A 4YNDA 4DX7D 4ANUA 4CGWA 2QYJA 2V4HC 4I43A 3IXEA 2VSYA 3T5VA 2L6BA 3TL5A 3NQPA 4DI3A 4I6EA 2P2CP 4CGVA 5BNWA 4JPSA 4ACLA 2XEVA 3LEWA 3TG5A 2PL2A 2F8YA 4U96D 1OY3D 1WM5A 3EIJA 4UQYA 3HVEB 3TWWA 2KZTA 3EIQC 3FFLA 4G26A 1Y8MA 3D9LA 2OV8A 1WG0A 4WWNA 4XI9A 1OWLA 3HIZA 3AS8A 5FZQA 1MX2A 2J8SD 2H6HA 2WQ7A 3L13A 2ZIRA 3ZUVB 4YDYA 5A6CA 3X2QE 3APDA 2ETBA 4HQDA 3ZYKA 3UIOC 4RG6A 2VQ2A 1TNYA 3JYSA 3T8KA 4C48B 1DNPA 2JLBA 4RLYA 2C0MA 4Q69A 3J5QB 1H6OA 3UT4A 3VTXA 2HE0A 3ZYQA 3EHNA 4HFGA 5H7PA 1OUVA 4BSXA 4JEUA 3AJIA 1FPPA 5AN8A 2WQ6A 3KEAA 4ANVA 4UWKA 4W9RA 2IJGX 3IEGA 4HRNA 3ZGQA 3PUKA 4N2QA 3NOCD 3VLEA 2E0IA 1V54E 1OCCE 3SQVA 4V3IA 3E30A 2LNIA 5B3SE 2P9LG 4BX9A 2HO1A 3PZDA 4J7WA 4IN3B 3DXKG 4XEIG 1E8YA 1N94A 2FULA 3CIAA 1EDUA 3HXEA 4CCAA 4OAVB 1XNFA 5FTPA 3ZVVA 3DPDA 4N5QA 3FTXA 1TNOA 5FJYA 5JHAA 4IYPA 4R7LA 2LXLA 2OVBA 2I1JA 1UJJA 4GTTA 4UQZA 2KZTB 2WXLA 4CDNA 4A63B 4EBAG 1K8KG 3FH5A 3RKVA 3RSEG 3QDNA 3ABKE 4GZ6A 3VLFA 4BT9A 4NACA 4A3TA 2BTDA 3D9OA 1UN8A 3U3WA 4A3VA 2XRZA 1JWGA 3QK0A 5DIZA 4I2ZA 3CVPA 3GZSA 2UWJG 5KJNA 2AJAA 4GAAA 3LDZA 3CVNA 1HO8A 3AS5A 5EN5D 2WQHA 2XZTG 2YHEA 2X6KA 1H6PA 2WPVA 2YQ8A 2P9KG 4EZJA 3Q9NC 3KS2A 2AXVA 4F7AA 3C98A 4A1SA 2GW1A 3CHMA 4GZCA 4GYWA 3ASGA 3Q49B 4EZLA 3UM0A 4JC8A 4HOQA 1MQSA 1H2TC 2RG8A 4DI4A 3L17A 1QBQA 3MKQA 1E8XA 4AJWA 4DPRA 1SZAA 1JCRA 4Y6WA 3PDNA 3KEZA 5KJMA 4U0SA 4A1GA 2FEZA 3SFZA 3UIPC 3IHYA 5G04C 5T4YA 2KXPC 4GTRA 3UKUG 3ASDA 3DWLG 4U95D 5ENOD 2KC7A 2QC9A 3TWQA 2NC9A 1DCEA 4B94A 2KM4A 4L2YA 5AQ9A 3TJPA 3FUNA 5HKPA 4N2SA 3D9KA 2F8XK 5HS0A 1Z5SC 3QWVA 3HG0D 1BI7B 5LOZA 4BETA 3DSUA 1JWFA 3SI5A 4F3VA 3LY9A 4YVQC 3NZUA 3B7UX 1WDYA 3TXNA 1AP7A 2AXZA 4FJYA 3UT7A 5JJ6A 2F37A 1HF8A 2IO2C 5CRUA 2WXRA 1E90A 3V79K 3PNTB 4HOTA 3MA5A 5KNGA 3ESLA 3D3MA 4K03A 4CDMA 2EIME 3PZ2A 2WMOA 1HG5A 3MKRA 4I9EA 5C2YA 2NYJA 3Q5MA 4B8AA 4AV7A 4JHKA 3BG0B 3QWWA 4IRUA 2WXPA 4KMOA 3TWUA 4BY6A 3FUMA 1BU9A 1S0PA 4GCOA 3MX3A 3BQOA 2FBNA 2XPZA 5FQ4A 2L6JA 2PM6A 5BPPA 3AAAC 3FU6A 3NOGD 2X6IA 4DX2A 1U3CA 3ZEFA 1DVPA 5EX0A 4GPKA 4G11A 5DBKA 1ZU2A 1ELRA 5ENSD 3JXIA 5B1AE 4GZDA 4GYOA 1Y6IA 4FU3A 2XZDG 3FP3A 3EUVA 1OWMA 3CVQA 1IXVA 3L16A 4Q96A 1MX6A 3R7RA 1HU3A 4J8DA 3HXBA 3FEXA 4MKTA 5CBNA 3AG2E 3ZU7B 2XGSA 5G2NA 3CHQA 4ANXA 4GU5A 3CKCA 1FT1A 4G8LA 2XEHA 5ENPD 1JCSA 4I9CA 4FC8A 3EHRA 3ZIMA 3E33A 1ELWA 2P9PG 1TNBA 1OCZE 4LEUA 4TUUA 4GYYA 3R9AB 3HYMB 5AQAA 3KSQA 3U9WA 3QWPA 4EQFA 3NZSA 4XKCA 2X3MA 3O4ZA 5J08A 3DSSA 4G24A 2YNQA 4CT0A 2LSVA 3ONLA 3PREA 4MRUA 4E85A 4EBAA 3ZFWA 4FP7A 2XGMA 3QJZA 4RQIA 5KNHD 3RO2A 2GROB 5CMYA 3PVLA 2ONDA 3FH7A 3P1UA 2I1KA 3UMVA 1S63A 3LS8A 1O5MA 1NI1A 1NFIE 4WNDA 2WXNA 3UXGA 3ZKJA 3IV0A 5LP0A 4N3CA 3QB2A 2Y69E 5FZRA 3V30A 1X81A 2IOLA 3FUFA 1H0AA 1H6KA 1WAO1 2H6IA 4G1TA 3ASOE 4J0UA 5B1BE 3LVRE 3CLJA 2VGEA 4U8HA 4HORA 3SO8A 5AENA 1UW4B 1DC2A 3FUEA 1Q2ZA 4KXKB 3DBSA 1H2VC 4N5CA 2ETAA 4OVUA 2X6HA 5T3RA 1KPSB 1Z3XA 1N54A 5JHBA 1V55E 3Q75A 2DWZA 2HR2A 3ZXPA 1IKND 2BUGA 3DRAA 3QAQA 3EJNA 3GZ1A 4U63A 5EIDA 4RSYA 1NA0A 3ONKA 4B8CB 3QOUA 1YMPA 3VTYA 3DSXA 2X6FA 2KCKA 4BWRA 4OAUC 5ITZF 2P58C 4GZ5A 4U8YD 3FTYA 3ASNE 4LUNU 3S7DA 2KATA 2AVPA 1MYOA 4WNFA 1NL4A 4D10C 2R17C 4B0ZA 4UWGA 2LUHA 1K1AA 3PUJA 2GRMA 5LX8A 2GRRB 3TWSA 1RW2A 5KWDA 1S64A 2JEKA 3CK9A 5T8IA 2FF4A 3APCA 4FJZA 4B89A 4XX5A 4I6JA 3KD7A 1U2VG 3PE4A 4AXHA 3E37A 4L2LA 4O1OA 3TWXA 1VDYA 5FQ6A 4WNGA 3CVVA 2WXMA 3V31A 3UT8A 4F6RD 3DSVA 2P9IG 5M72A 3E34A 4EHMA 4PS8A 3BUAA 2WXHA 2EQXA 2X38A 3OXFA 3FDHA 1IHGA 2PQRA 2CHXA 1P5QA 2XENA 3UUXA 3U64A 4ABNA 2IQCA 1HFAA 4JVSA 2GRNB 1E8WA 4LCTA 2OVFA 3B7RL 3CVLA 4OVVA 4PS7A 3IBEA 2EINE 3HXCA 5KJLA 2WXOA 4L1BA 5FINA 2XCBA 3LCAA 4ILIA 5G04J 3OXLA 2BF0X 1N11A 5EYLA 1UOHA 4DK5A 2IOSA 3MYVA 3CVYA 2R5SA 4DLOA 1QQEA 3RRNB 3UX4A 2WMNA 5KJKA 1E7VA 4J6IA 3P2BA 4BTAA 3C5RA 3Q79A 2YINA 1RZ4A 3C3QA 3I3NA 3CEQA 3DXMG 1UG3A 2VTBA 3G2VA 2LAHA 1ELKA 1E96B 3EHQA 4KVOA 1LD8A 3CHRA 4KT6B 4EZKA 2P9NG 5CCMA 4I1AA 1QYMA 4HOSA 3APFA 3QC1A 3W9GA 3LYAA 4LNUD 3TGOA 4GTMA 3HXFA 3TWRA 2EIKE 2WVIA 3FWVA 3FUJA 3UM1A 2CFUA 4F1SA 2BKGA 4GMRA 5A23A 3L22A 3FU5A 2VGXA 3AG1E 2LAIA 3B7BA 1K1BA 5AQ7A 1WY6A 4I1OB 5ENRD 4GTVA 4URKA 4PUCA 5JA4D 3OXGA 1L5JA 4A55A 3EU5A 2MYOA 3FUKA 1EF1C 2BKKB 2OEWA 3RU0A 3UM3A 1MJ0A 4WAFA 4AVXA 4M3OA 4ATZD 2V5QC 1N4PA 1LD7A 3CVUA 3ML8A 5LFAA 2Y4TA 4U7EB 3QARA 2PZIA 4BTBA 2VSOE 3DEOA 3CQCB 4N3AA 5J90A 2VTBB 1PC2A 1GW6A 4GA1A 3HRAA 5D2MC 1TYQG 3CV0A 2ZGGA 3G2WA 3R7QA 4TXRA 2AW6A 5ARFA 3RJVA 3OAWA 4P29A 2XHEA 2DIWA 2IF4A 3L9TA 3KAEA 1O1SA 4DX5D 4GTOA 4O60A 2UY1B 5CCLA 3K9IA 4I2WA 3JUIA 4ATGA 4WNEA 3WG7E 2DVWA 4J8FA 3UQ3A 4NQ0A 3LJ3A 3SFXA 3GZ2A 3ASHA 4BEPA 3MGBA 2P9UG 4Q94A 3FTZA 2J08A 3SD5A 4JA9A 4RG9A 3CK8A 3N71A 1INZA 4UWHA 3BG1B 1TEZA 1TJFA 5ARGA 4J8YA 4ACKA 3ZNGA 5KBAA 1Z6TA 3JUEA 1OWOA 3LY7A 4XKBA 3EHMA 1H19A 4FULA 4N39A 2KCLA 3KSLA 3C3RA 2CG3A 2RFMA 2J07A 1FT2A 1ZBPA 4AY6A 4PH4B 4HB5A 4OYSA 5AQBA 3FHEA 3DSTA 2XQ0A 5CERB 4JHRA 1TNZA 3FY4A 2LXMA 5FZSA 3ZHEB 2B6CA 4FA6A 4H7XA 1W3BA 2Y4UA 4HBDA 2A5EA 5D66A 2GRPB 2M63A 1UJKA 3AS4A 2VJ8A 3TWTA 5IY5E 4EECA 3CHOA 3CQGB 3SFYA 4F53A 4Y6CA 3E4BA 3D9MA 5KCMA 3O48A 3J5PA 3VLDA 5BW8C 4AIFA 2WXQA 2X6JA 3FTSA 2L0TB 3CR3A 3T8MA 3FH8A 2CHWA 2R02A 4LERA 2XPIA 1IQUA 5E76A 3B95A 5AYWD 4UWLA 4K5CA 3AG4E 4QQIA 3T5XA 3PEVB 1HZ4A 1N4RA 1TN8A 4G8KA 1A5EA 4AY5A 3RIBA 4C9BB 3I4RB 4GMJA 3CK7A 3S7BA 1KLXA 3CSFA 2YHCA 1N95A 3CHSA 2F0YA 2Y3AA 4JEHA 3UINC 1N4QA 5JJ7A 2DBAA 3C72A 5A7DB 4MLPA 5CHEE 5AARA 2PQNA 2NSZA 2V5FA 1TJCA 1HE8A 2PM7A 4I6GA 4XI0A 5ENTD 1EYHA 4U04A 3EU9A 3CVWA 3B7TA 4C0EA 4TXPA 2I2OA 3NAWA 2V0PA 1OXJA 3HHMA 4JL0A 3ZXSA 3SBSA 2IONA 3MZLB 3IKOB 1UN9A 1FVFA 3E32A 2PNNA 4J8EA 3HVEA 2IO3C 1NA3A 4PDXA 3ZYMA 5ENNA 3RRMB 3LKUA 1KZPA 5ENQD 5HRYA 1U3DA 3PRZA 5BV1A 4HNAD 4GA0A 4O1PA 4KYOB 4L7TA 4FADA 4GTQA 2ZU6B 3DPYA 3ISMC 2QYUA 3MCXA 4JHJA 1KT0A 3HDXA 3ASFA 5G05J 3FTVA 3PH0C 4HRLA 3V2OA 3TG4A 4GTSA 4UI9K 3L82A 2VSNA 4FHJA 3D9HA 3UPVA 2A5UA 2MOWA 3R9MA 4WWOA 1IQRA 3AG3E 1OWNA 3G2TA 2KCVA 3JQ1A 3D9JA 3F6QA 4X8QA 3AU5A 3G2SA 3SGHA 2L0IA 2WM9A 1N4SA 3S7JA 4HLLA 4GA2A 3TWVA 4LNGA 4I17A 3EDTB 4BESA 4ILGA 3ML9A 2WXJA 3D9IA 1N0RA 4I1MA 5AAOA 4JB8P 4K5BA 4JW1A 3U66A 3FTUA 1YCSB 2GGFA 4Z68A 4K5AB 3CGHA 4BFRA 4IULA 2DCPA 1JCQA 2QZAA 2V4LA 5JJTA 1O1TA 1BD8A 3SF4A 5G05C 5FIOA 2C0LA 5CECB 3LVQE 4FLHA 4XZ4A 4UUCA 1JUQA 4HI9A 4FLBA 1FVHA 3CKBA 3MEKA 3PEUB 2WXIA 4L23A 2FO7A 3ABLE 4LRZA 4HOUA 4MBGA 4KVMA 4JZYA 2R59A 4TXQA 1TNUA 4CZ2D 1JPLA 3SHFA 4MS6A 4N3BA 2XS8A 4TRQA 1BLXB 1HXIA 1MZCA 4JD2G 3MV2B 3ENEA 2XEEA 4UWFA 5FT9A 2ZGDA 3Q73A 2XGOA 2FI7A 4KZ0A 4LNBA 1K3ZD 3SBTB 5BXUA 3MKQB 4BSZB 4DX1A 2HYZA 2RFAA 4AEZC 1ZB1A 4JXTA 3RAUA 1PAQA 2VGYA 3BU8A 4NRHB 3SY2A 2QY7A 3LY8A 2J9QA 2Y1LE 4HS2A 2CHZA 2P9SG 4RVBA 5EIBE 2J4DA 3FU3A 2H6FA 4DRXE 1LF8A 4AM9A 5E75A 4C0MA 4G2VA 1XGWA 2UY1A 5AJDA 3DSWA 2DZNA 3NBNB 3OTNA 1N52A 5LCWJ 1D9SA 1EPUA 4U07A 4GZ3A 1Z3YA 1N9AA 3UKRG 4EPZA 1YYHA 3S7FA 3SZ7A 3ZN3A 4CDRA 1N0QA 5EX3A 2MHKA 4UI9C 3UTMA 3URZA 3TAXA 1OT8A 3NF1A 3JXJA 2DZOA 4GB9A 4CT4A 3NB2A 2LSUA 2RKKA 1IYGA 4ME2A 4JA7A 1PY1A 2ETCA 4J8SA 2XS1A 4AP2A 1E7UA 1FCHA 3PNLB 2ZXWE 2WXKA 1B89A 3MJWA 2WXGA 3T9KA 3PE3A 3PZ3A 1KT1A 4LG6A 2OOEA 4F1PA 4CYMD 1BPOA 1SQMA 2WB2A 2GRLA 2B0OE 4U0UA 3Q4AB 5AIJA 3UI2A 4FHKA 2AXUA 2Q7FA 2R2LA 1D8DA 5D0QD 3PZ4A 3QKYA 1IHBA 4HLEA 4G23A 3TXMA 1LTXA 4DUIA 4WUYA 5EDSA 2VYIA 5C1DA 2C2LA 4UI9J 3ZPJA 4XE0A 3Q15A 1SA4A 4ZHBA 1NZNA 5D0OD 1HG2A 2AWIA 2JABA 3DEPA 3W9FA 3Q47B 3FU0A 2R03A 3GYZA 1SVXA 3ZYLA 1D8EA 2NXPA 5JMND 2IFUA 4HVBA 4DJAA 2VGXB 4YDOA 3C3OA 1A17A 5EKQD 2ZISA 1QNFA 2J09A 4HXIA 4APOA 3QNKA 1G3NB 2V8SE 4PS3A 3L54A 1QZ2A 5CBOA 3V2XA 3JCKC 4GPMA 2XCCA 5FQ8A 2J4BA 1E8ZA 4M7CA
chains in the Genus database with same CATH topology
4FJZA 3U4TA 3CHMA 4B89A 2NSZA 4GZCA 4XX5A 3G2UA 4GYWA 3ASGA 3KD7A 4I6JA 2V5FA 3Q49B 1TJCA 5ANLA 3PE4A 4AXHA 4G25A 4EZLA 3GW4A 1HE8A 2LO6A 2PM7A 4I6GA 4JC8A 4L2LA 4HOQA 1VDYA 2VSXE 4BT8A 5LCWC 1MQSA 4XI0A 5FQ6A 4WNGA 1H2TC 2RG8A 3CVVA 1EYHA 1HH8A 3L17A 4DI4A 4U04A 2WXMA 3UT8A 3CVWA 3B7TA 3MKQA 4C0EA 1E8XA 3D9NA 4AJWA 2I2OA 4DPRA 1SZAA 2V0PA 5M72A 3FULA 4Y6WA 3PDNA 2RD0A 3KEZA 5BT1A 3HHMA 3RK6A 1YA0A 4JL0A 5KJMA 4U0SA 4TV3A 4A1GA 3ZXSA 3SBSA 2FEZA 3SFZA 2IONA 3MZLB 4YVOA 3IKOB 4PS8A 1UN9A 1FVFA 2WXHA 4J8EA 3RRUA 3IHYA 2EQXA 2I6HA 3HVEA 5G04C 5T4YA 1NA3A 2X38A 4PDXA 3OXFA 3ZYMA 5CMWA 3FDHA 5ENNA 3RRMB 3LKUA 1IHGA 3I4GA 2PQRA 3ASDA 4ANWA 2IU1A 4QFVA 1U3DA 2CHXA 1P5QA 2KC7A 2WXFA 3PRZA 5ANRA 5BV1A 3UUXA 4GA0A 3LPZA 3U64A 3CHPA 4KYOB 4CEMA 4ABNA 2IQCA 1HFAA 4JVSA 1E8WA 4L7TA 4FADA 3MV3B 3LXUX 2ZU6B 4LCTA 2OVFA 2NC9A 3B7RL 3CVLA 4B94A 2KM4A 3MCXA 4L2YA 5HI7A 3ZRHA 4JHJA 3WXXA 1KT0A 3TJPA 4OVVA 3HDXA 3FUNA 3IBEA 4GCNA 4PS7A 1X5BA 2L9BA 3FUIA 4GMLA 5KJLA 3B13A 3ASFA 2WXOA 4L1BA 4XIFA 5G05J 3FTVA 3PH0C 4N2SA 5AJLA 3D9KA 2XCBA 5BUZA 4KZCA 3QWVA 3LCAA 4ILIA 5G04J 2XRYA 1SZ9A 3TG4A 3OXLA 2CG2A 5LOZA 3L08A 2BF0X 3D9PA 4UI9K 1JWFA 3FUDA 3SI5A 4F3VA 2VSNA 3LY9A 4FHJA 4YVQC 4DK5A 3NZUA 3B7UX 3L6AA 2IOSA 2A5UA 3MYVA 3UPVA 3TXNA 2R5SA 1OWPA 3CVYA 4DLOA 2A4ZA 2AXZA 1QQEA 2MOWA 3RRNB 4FJYA 2WMNA 3UX4A 5KJKA 4WWOA 1IQRA 1OWNA 3G2TA 2KCVA 1E7VA 4J6IA 3UT7A 2CFZA 3P2BA 5JJ6A 3B7SA 5G55A 1HF8A 3JQ1A 3CSTA 4H7YA 3D9JA 4BTAA 3FTWA 4WWPA 2WXRA 2YINA 1E90A 5HQ8A 2ILRA 3I3NA 3PNTB 3CEQA 3SNXA 3AU5A 3IHVA 3I5PA 3G2SA 3SGHA 4HOTA 4UQXA 1UG3A 2L0IA 2WM9A 2VTBA 3S7JA 3MA5A 4GA2A 3ESLA 3G2VA 3PS6A 5FQ7A 2HM8A 2LAHA 1ELKA 3D3MA 3EDTB 1E96B 4I17A 4K03A 4CDMA 4E6HA 1MHQA 4KBQA 2WMOA 4KVOA 4ILGA 4O6FA 3ML9A 1HG5A 2WXJA 3D9IA 3CHRA 3MKRA 4I9EA 2XPYA 4I1MA 4APFA 4KT6B 4JW1A 4EZKA 4DLQA 3U66A 4NURA 5C2YA 3FTUA 3Q5MA 4B8AA 4AV7A 5CCMA 4I1AA 2GGFA 4JHKA 3BG0B 4U0ZA 3AU4A 3QWWA 4IRUA 2WXPA 4KMOA 2I9CA 4HOSA 4BY6A 3ZHEA 3CGHA 4BFRA 3APFA 3ESKA 3QC1A 1HS6A 4IULA 3LYAA 2DCPA 2MRIA 3TGOA 3FUMA 3S2AA 2J49A 2V4LA 1S0PA 5JJTA 2WVIA 3FWVA 3SF4A 5G05C 3FUJA 4CRWA 2CFUA 4GCOA 3MX3A 4ILHB 4F1SA 2C0LA 3FUHA 3LVQE 4FLHA 3FEYA 4XZ4A 2FBNA 3CVXA 5A23A 3L22A 3FU5A 1JUQA 2VGXA 4BX8A 2XPZA 4FLBA 5FQ4A 5FWQA 3BEEA 2LAIA 1FVHA 2L6JA 3CKBA 4AOFA 1WY6A 2PM6A 3MEKA 3PEUB 4I1OB 2WXIA 5BPPA 4K0RA 3FU6A 4L23A 2FO7A 4URKA 4LRZA 4HOUA 4PUCA 2X6IA 4KVMA 1U3CA 3ZEFA 3OXGA 4JZYA 1DVPA 2QFCA 2R59A 1L5JA 5EX0A 4A55A 4G11A 4GPKA 5DBKA 1JPLA 3SHFA 4MS6A 1ZU2A 3FUKA 1NP7A 1ELRA 1EF1C 4N3BA 3RU0A 4TRQA 4GZDA 1HXIA 2E2EA 4GYOA 3MV2B 3ULQA 1H2UA 4WAFA 1Y6IA 4AVXA 3ENEA 4FU3A 4M3OA 3RO3A 4UWFA 5FT9A 3FP3A 5BV0A 1OWMA 2XGOA 3CVUA 3CVQA 3ML8A 3L16A 2FI7A 4KZ0A 2Y4TA 4Q96A 5LFAA 3SBTB 3R7RA 3QARA 2PZIA 1HU3A 4J8DA 4BTBA 2VSOE 3MKQB 3FEXA 1HX8A 2HYZA 3ZW3A 4MKTA 3CQCB 3JQ0A 4YNDA 4AEZC 4N3AA 5J90A 4ANUA 4CGWA 4I43A 2XGSA 4JXTA 2VSYA 5G2NA 3T5VA 1PAQA 3TL5A 3CHQA 2VGYA 3NQPA 4ANXA 2VTBB 4GU5A 1PC2A 4NRHB 4DI3A 1GW6A 4I6EA 3CKCA 4CGVA 2QY7A 3LY8A 4GA1A 5BNWA 4JPSA 2J9QA 4I9CA 4FC8A 3ZIMA 3CV0A 4HS2A 2XEVA 3G2WA 3R7QA 2CHZA 1ELWA 3LEWA 3TG5A 4ACLA 2PL2A 4RVBA 2AW6A 5ARFA 2J4DA 3RJVA 3FU3A 1WM5A 3EIJA 3OAWA 4UQYA 3HVEB 2KZTA 3EIQC 1LF8A 3FFLA 4P29A 5E75A 4AM9A 4LEUA 4TUUA 4G26A 4C0MA 1Y8MA 3D9LA 4GYYA 2XHEA 2DIWA 2OV8A 3R9AB 2IF4A 3HYMB 1XGWA 2UY1A 4G2VA 1OWLA 4WWNA 4XI9A 5AJDA 3U9WA 3HIZA 3AS8A 3KAEA 3QWPA 5FZQA 4EQFA 2WQ7A 2UY1B 3NZSA 3OTNA 4XKCA 5CCLA 3K9IA 4I2WA 2X3MA 3JUIA 4ATGA 3L13A 3O4ZA 4WNEA 5J08A 1N52A 5LCWJ 4G24A 4J8FA 3UQ3A 5A6CA 2YNQA 4CT0A 2LSVA 4NQ0A 3ONLA 3LJ3A 3PREA 3APDA 4MRUA 4E85A 4EBAA 1EPUA 4U07A 4GZ3A 4FP7A 3ZFWA 2XGMA 3GZ2A 1Z3YA 3QJZA 3ASHA 3MGBA 4Q94A 3FTZA 4EPZA 2J08A 3SD5A 3RO2A 4JA9A 4RG9A 3ZYKA 3CK8A 3N71A 5CMYA 1INZA 4RG6A 3PVLA 2ONDA 2VQ2A 3BG1B 4UWHA 3S7FA 1TEZA 3FH7A 1TJFA 3JYSA 3P1UA 5ARGA 3SZ7A 3ZN3A 1DNPA 2JLBA 4CDRA 4ACKA 2I1KA 2C0MA 4Q69A 5EX3A 2MHKA 4UI9C 3UMVA 1Z6TA 1OWOA 3LY7A 4XKBA 3URZA 3EHMA 3LS8A 3TAXA 3UT4A 1H19A 3VTXA 4FULA 4N39A 2KCLA 3NF1A 3ZYQA 4WNDA 4GB9A 2WXNA 4CT4A 2LSUA 1IYGA 2CG3A 3EHNA 4HFGA 4ME2A 1OUVA 4JA7A 2J07A 4JEUA 4BSXA 3IV0A 1PY1A 4J8SA 4AP2A 5LP0A 1ZBPA 1E7UA 4N3CA 3QB2A 1FCHA 5FZRA 3PNLB 2WQ6A 4AY6A 4ANVA 2WXKA 4UWKA 4PH4B 4OYSA 4W9RA 2IOLA 3FUFA 1B89A 3FHEA 1H0AA 2IJGX 2XQ0A 3IEGA 2WXGA 3MJWA 4JHRA 3ZGQA 3FY4A 3PUKA 4N2QA 3PE3A 1H6KA 3VLEA 2E0IA 1WAO1 5FZSA 4V3IA 3ZHEB 1KT1A 4G1TA 2LNIA 4J0UA 2OOEA 4BX9A 4FA6A 1BPOA 2HO1A 4H7XA 1SQMA 3PZDA 4IN3B 2WB2A 3LVRE 2GRLA 3CLJA 4U8HA 4HORA 4U0UA 1E8YA 1W3BA 2Y4UA 3Q4AB 5AENA 5AIJA 2M63A 4FHKA 1UW4B 1UJKA 2AXUA 3AS4A 2Q7FA 3FUEA 2FULA 3CIAA 4KXKB 2VJ8A 1EDUA 5D0QD 3DBSA 3QKYA 1H2VC 4EECA 4G23A 3TXMA 3CHOA 4CCAA 4HLEA 1XNFA 5FTPA 3CQGB 3ZVVA 3DPDA 3FTXA 4N5CA 4OVUA 5FJYA 2X6HA 5T3RA 4IYPA 4R7LA 4F53A 5JHAA 1Z3XA 4Y6CA 2OVBA 3E4BA 2I1JA 1UJJA 4WUYA 5EDSA 1N54A 3D9MA 5KCMA 2VYIA 3O48A 4UQZA 5C1DA 2C2LA 2KZTB 2WXLA 4UI9J 4CDNA 3VLDA 5BW8C 4AIFA 5JHBA 4EBAG 2WXQA 3ZPJA 2X6JA 4XE0A 3FH5A 2HR2A 3RKVA 3Q15A 3FTSA 2L0TB 3CR3A 2BUGA 3QAQA 3EJNA 3T8MA 3QDNA 3FH8A 3GZ1A 4GZ6A 3VLFA 1NZNA 2CHWA 4U63A 4BT9A 4RSYA 4NACA 4LERA 4A3TA 2BTDA 1IQUA 2XPIA 5D0OD 1HG2A 1NA0A 3ONKA 4B8CB 3QOUA 2AWIA 5E76A 3D9OA 1UN8A 3U3WA 5AYWD 4UWLA 4A3VA 3VTYA 2XRZA 3T5XA 1JWGA 2X6FA 2KCKA 3PEVB 3QK0A 3Q47B 4BWRA 5DIZA 4I2ZA 1HZ4A 3CVPA 2P58C 3FU0A 3GZSA 4GZ5A 3FTYA 3GYZA 4AY5A 3RIBA 4C9BB 4LUNU 3ZYLA 2UWJG 3I4RB 3S7DA 2NXPA 5KJNA 4GAAA 3LDZA 3CVNA 1HO8A 2IFUA 4GMJA 4HVBA 4DJAA 3AS5A 2KATA 2WQHA 2VGXB 1A17A 2AVPA 5EKQD 2YHEA 2X6KA 4WNFA 3CK7A 1QNFA 4D10C 2R17C 3S7BA 2J09A 4HXIA 4APOA 1KLXA 2WPVA 3QNKA 3CSFA 2YHCA 2YQ8A 3CHSA 4UWGA 4B0ZA 4EZJA 2V8SE 2GRMA 3KS2A 3PUJA 2AXVA 4PS3A 5LX8A 3L54A 4F7AA 3C98A 1QZ2A 2Y3AA 4JEHA 2JEKA 3JCKC 5JJ7A 3CK9A 4A1SA 2XCCA 2DBAA 5T8IA 2FF4A 2GW1A 2J4BA 1E8ZA 5FQ8A 5A7DB 3APCA 4MLPA 5CHEE 2PQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAO 1;  5FZS A;  3U4T A;  3ZHE B;  2VGY A;  1PC2 A;  4NRH B;  1KT1 A;  4HOT A;  4G1T A;  4UQX A;  4GYW A;  3ASG A;  2LNI A;  3KD7 A;  4J0U A;  2OOE A;  2V5F A;  3CKC A;  3Q49 B;  3S7J A;  1TJC A;  4CGV A;  3MA5 A;  3LY8 A;  4GA1 A;  3PE4 A;  4GA2 A;  5BNW A;  2J9Q A;  4G25 A;  4I9C A;  2HO1 A;  4H7X A;  3GW4 A;  4I17 A;  3EDT B;  4IN3 B;  1E96 B;  5LCW C;  4HOQ A;  4BT8 A;  3CV0 A;  4XI0 A;  2XEV A;  4KBQ A;  4WNG A;  1ELW A;  4U0U A;  3TG5 A;  4HOR A;  4O6F A;  2PL2 A;  1HH8 A;  1W3B A;  2Y4U A;  3Q4A B;  4U04 A;  5ARF A;  3RJV A;  3MKR A;  4I9E A;  1WM5 A;  4UQY A;  3AS4 A;  2Q7F A;  3FFL A;  4AM9 A;  4KXK B;  3Q5M A;  4LEU A;  4G26 A;  1Y8M A;  5CCM A;  4GYY A;  4I1A A;  5D0Q D;  3QKY A;  3R9A B;  2IF4 A;  3HYM B;  4G23 A;  2UY1 A;  3QWW A;  4G2V A;  4U0Z A;  1XNF A;  4XI9 A;  5M72 A;  5FTP A;  3AS8 A;  3KAE A;  3PDN A;  4Y6W A;  4HOS A;  5BT1 A;  3QWP A;  4N5C A;  5FZQ A;  3ZHE A;  4EQF A;  3ESK A;  5FJY A;  1YA0 A;  4JL0 A;  5KJM A;  4U0S A;  2UY1 B;  4Y6C A;  2FEZ A;  5CCL A;  3K9I A;  3LYA A;  4I2W A;  3E4B A;  4YVO A;  4WUY A;  3TGO A;  4WNE A;  4J8E A;  2VYI A;  3O48 A;  5LCW J;  4UQZ A;  5C1D A;  2C2L A;  2I6H A;  4G24 A;  4J8F A;  4UI9 J;  1NA3 A;  5G04 C;  3UQ3 A;  3OXF A;  5A6C A;  5BW8 C;  2LSV A;  5JJT A;  4NQ0 A;  3FWV A;  3SF4 A;  5G05 C;  4AIF A;  3LKU A;  1IHG A;  3ZPJ A;  4GCO A;  4U07 A;  2PQR A;  3ASD A;  2C0L A;  4GZ3 A;  3ZFW A;  2XGM A;  2HR2 A;  3GZ2 A;  3RKV A;  3Q15 A;  2KC7 A;  1P5Q A;  2FBN A;  2BUG A;  3ASH A;  3UUX A;  4GA0 A;  3LPZ A;  3QDN A;  4KYO B;  3GZ1 A;  4GZ6 A;  4ABN A;  1NZN A;  2VGX A;  4JA9 A;  4RG9 A;  3RO2 A;  3CK8 A;  4BT9 A;  3BEE A;  2XPI A;  3N71 A;  5D0O D;  1NA0 A;  2L6J A;  3CKB A;  3MV3 B;  3QOU A;  4RG6 A;  3S7F A;  2OND A;  2VQ2 A;  3MEK A;  3U3W A;  2NC9 A;  3JYS A;  5ARG A;  2FO7 A;  5AYW D;  3SZ7 A;  3CVL A;  3ZN3 A;  3VTY A;  2JLB A;  4B94 A;  5HI7 A;  4CDR A;  4HOU A;  3WXX A;  1KT0 A;  2KCK A;  2C0M A;  3Q47 B;  4BWR A;  4GCN A;  5DIZ A;  2MHK A;  4I2Z A;  1HZ4 A;  3CVP A;  3OXG A;  4UI9 C;  5EX3 A;  5KJL A;  2QFC A;  2P58 C;  3ASF A;  5EX0 A;  4GPK A;  4GZ5 A;  4XIF A;  3GYZ A;  3LY7 A;  5DBK A;  5G05 J;  3URZ A;  4N2S A;  3TAX A;  4AY5 A;  3VTX A;  1ZU2 A;  2KCL A;  4N39 A;  3RIB A;  2XCB A;  1ELR A;  2UWJ G;  3NF1 A;  3S7D A;  4N3B A;  5KJN A;  3QWV A;  4WND A;  3LCA A;  3RU0 A;  3CVN A;  4GYO A;  1HXI A;  2E2E A;  2IFU A;  2LSU A;  3MV2 B;  3OXL A;  5G04 J;  3TG4 A;  3ULQ A;  1IYG A;  3AS5 A;  2KAT A;  2WQH A;  4ME2 A;  1OUV A;  2VGX B;  4JA7 A;  4UI9 K;  1A17 A;  2AVP A;  5EKQ D;  3RO3 A;  5FT9 A;  3FP3 A;  4WNF A;  3CK7 A;  4F3V A;  2VSN A;  1ZBP A;  3LY9 A;  2XGO A;  4N3C A;  4YVQ C;  3S7B A;  3CVQ A;  1FCH A;  4APO A;  3UPV A;  1KLX A;  2FI7 A;  2R5S A;  2WPV A;  2Y4T A;  5FZR A;  4AY6 A;  1QQE A;  2YHC A;  2YQ8 A;  3KS2 A;  5KJK A;  2PZI A;  4BTB A;  4J8D A;  4W9R A;  1QZ2 A;  2KCV A;  1B89 A;  5JJ6 A;  2HYZ A;  5JJ7 A;  3CK9 A;  3IEG A;  4A1S A;  2XCC A;  4H7Y A;  2DBA A;  4JHR A;  4YND A;  4BTA A;  2FF4 A;  2GW1 A;  4N3A A;  5A7D B;  3ZGQ A;  4CGW A;  4N2Q A;  3PE3 A;  5HQ8 A;  2XGS A;  5CHE E;  2VSY A;  2PQN A;  3CEQ A; 
#chains in the Genus database with same CATH topology
 3U4T A;  3G2U A;  5CRV A;  5ANL A;  4G25 A;  3GW4 A;  2LO6 A;  5LCW C;  4BT8 A;  2VSX E;  5EYP F;  1HH8 A;  4L9P A;  1TN6 A;  3D9N A;  2R05 A;  3FUL A;  2IEJ A;  2RD0 A;  5BT1 A;  3RK6 A;  1YA0 A;  2OCC E;  4TV3 A;  4YVO A;  1O1R A;  1MX4 A;  3RRU A;  1S70 B;  2I6H A;  5CMW A;  2BED A;  1OCR E;  5BXO A;  3I4G A;  4ANW A;  2IU1 A;  4QFV A;  4YDE A;  2WXF A;  4YDW A;  5ANR A;  4NIK A;  3LPZ A;  3CHP A;  4CEM A;  2GRQ B;  5EIL A;  3MV3 B;  3LXU X;  5HI7 A;  3ZRH A;  2OEV A;  3WXX A;  3ULE G;  4GCN A;  1X5B A;  2L9B A;  3FUI A;  4GML A;  3B13 A;  2EIL E;  4XIF A;  5AJL A;  3LJN A;  1OCO E;  5BUZ A;  4KZC A;  4HI8 A;  2XRY A;  1SZ9 A;  2CG2 A;  3L08 A;  3D9P A;  3FUD A;  3Q9U C;  1DCQ A;  3L6A A;  2IY0 C;  2DYR E;  1OWP A;  2A4Z A;  3HXD A;  2CFZ A;  3Q78 A;  3B7S A;  5G55 A;  3CST A;  4H7Y A;  3FTW A;  4WWP A;  2H6G A;  5HQ8 A;  2ILR A;  3SNX A;  3IHV A;  1BI8 B;  3I5P A;  4UQX A;  5FQ7 A;  3PS6 A;  2HM8 A;  1KZO A;  1MHQ A;  4E6H A;  4KBQ A;  4O6F A;  3ULY A;  2XPY A;  4APF A;  2DYS E;  4DLQ A;  4NUR A;  4GTP A;  4U0Z A;  3AU4 A;  2I9C A;  2EIJ E;  1TR4 A;  3ZHE A;  3ESK A;  3Q7A A;  1HS6 A;  2FO1 E;  2MRI A;  3S2A A;  2J49 A;  4TUM A;  4CRW A;  4ILH B;  3FUH A;  4DX6 D;  3FEY A;  3CVX A;  4HRM B;  4BX8 A;  5FWQ A;  3BEE A;  1TN7 A;  4AOF A;  4LSZ E;  4K0R A;  3PZ1 A;  2QFC A;  4ZFH A;  2KBX A;  1NP7 A;  4B93 B;  5CED B;  3ABM E;  2E2E A;  5CEA A;  4U8V D;  3ULQ A;  1H2U A;  3Q7F A;  3RO3 A;  1AWC B;  4BER A;  5BV0 A;  1SA5 A;  3UM2 A;  1SW6 A;  2Y0B G;  1HX8 A;  3ZW3 A;  3JQ0 A;  4YND A;  4DX7 D;  4ANU A;  4CGW A;  2QYJ A;  2V4H C;  4I43 A;  3IXE A;  2VSY A;  3T5V A;  2L6B A;  3TL5 A;  3NQP A;  4DI3 A;  4I6E A;  2P2C P;  4CGV A;  5BNW A;  4JPS A;  4ACL A;  2XEV A;  3LEW A;  3TG5 A;  2PL2 A;  2F8Y A;  4U96 D;  1OY3 D;  1WM5 A;  3EIJ A;  4UQY A;  3HVE B;  3TWW A;  2KZT A;  3EIQ C;  3FFL A;  4G26 A;  1Y8M A;  3D9L A;  2OV8 A;  1WG0 A;  4WWN A;  4XI9 A;  1OWL A;  3HIZ A;  3AS8 A;  5FZQ A;  1MX2 A;  2J8S D;  2H6H A;  2WQ7 A;  3L13 A;  2ZIR A;  3ZUV B;  4YDY A;  5A6C A;  3X2Q E;  3APD A;  2ETB A;  4HQD A;  3ZYK A;  3UIO C;  4RG6 A;  2VQ2 A;  1TNY A;  3JYS A;  3T8K A;  4C48 B;  1DNP A;  2JLB A;  4RLY A;  2C0M A;  4Q69 A;  3J5Q B;  1H6O A;  3UT4 A;  3VTX A;  2HE0 A;  3ZYQ A;  3EHN A;  4HFG A;  5H7P A;  1OUV A;  4BSX A;  4JEU A;  3AJI A;  1FPP A;  5AN8 A;  2WQ6 A;  3KEA A;  4ANV A;  4UWK A;  4W9R A;  2IJG X;  3IEG A;  4HRN A;  3ZGQ A;  3PUK A;  4N2Q A;  3NOC D;  3VLE A;  2E0I A;  1V54 E;  1OCC E;  3SQV A;  4V3I A;  3E30 A;  2LNI A;  5B3S E;  2P9L G;  4BX9 A;  2HO1 A;  3PZD A;  4J7W A;  4IN3 B;  3DXK G;  4XEI G;  1E8Y A;  1N94 A;  2FUL A;  3CIA A;  1EDU A;  3HXE A;  4CCA A;  4OAV B;  1XNF A;  5FTP A;  3ZVV A;  3DPD A;  4N5Q A;  3FTX A;  1TNO A;  5FJY A;  5JHA A;  4IYP A;  4R7L A;  2LXL A;  2OVB A;  2I1J A;  1UJJ A;  4GTT A;  4UQZ A;  2KZT B;  2WXL A;  4CDN A;  4A63 B;  4EBA G;  1K8K G;  3FH5 A;  3RKV A;  3RSE G;  3QDN A;  3ABK E;  4GZ6 A;  3VLF A;  4BT9 A;  4NAC A;  4A3T A;  2BTD A;  3D9O A;  1UN8 A;  3U3W A;  4A3V A;  2XRZ A;  1JWG A;  3QK0 A;  5DIZ A;  4I2Z A;  3CVP A;  3GZS A;  2UWJ G;  5KJN A;  2AJA A;  4GAA A;  3LDZ A;  3CVN A;  1HO8 A;  3AS5 A;  5EN5 D;  2WQH A;  2XZT G;  2YHE A;  2X6K A;  1H6P A;  2WPV A;  2YQ8 A;  2P9K G;  4EZJ A;  3Q9N C;  3KS2 A;  2AXV A;  4F7A A;  3C98 A;  4A1S A;  2GW1 A;  3CHM A;  4GZC A;  4GYW A;  3ASG A;  3Q49 B;  4EZL A;  3UM0 A;  4JC8 A;  4HOQ A;  1MQS A;  1H2T C;  2RG8 A;  4DI4 A;  3L17 A;  1QBQ A;  3MKQ A;  1E8X A;  4AJW A;  4DPR A;  1SZA A;  1JCR A;  4Y6W A;  3PDN A;  3KEZ A;  5KJM A;  4U0S A;  4A1G A;  2FEZ A;  3SFZ A;  3UIP C;  3IHY A;  5G04 C;  5T4Y A;  2KXP C;  4GTR A;  3UKU G;  3ASD A;  3DWL G;  4U95 D;  5ENO D;  2KC7 A;  2QC9 A;  3TWQ A;  2NC9 A;  1DCE A;  4B94 A;  2KM4 A;  4L2Y A;  5AQ9 A;  3TJP A;  3FUN A;  5HKP A;  4N2S A;  3D9K A;  2F8X K;  5HS0 A;  1Z5S C;  3QWV A;  3HG0 D;  1BI7 B;  5LOZ A;  4BET A;  3DSU A;  1JWF A;  3SI5 A;  4F3V A;  3LY9 A;  4YVQ C;  3NZU A;  3B7U X;  1WDY A;  3TXN A;  1AP7 A;  2AXZ A;  4FJY A;  3UT7 A;  5JJ6 A;  2F37 A;  1HF8 A;  2IO2 C;  5CRU A;  2WXR A;  1E90 A;  3V79 K;  3PNT B;  4HOT A;  3MA5 A;  5KNG A;  3ESL A;  3D3M A;  4K03 A;  4CDM A;  2EIM E;  3PZ2 A;  2WMO A;  1HG5 A;  3MKR A;  4I9E A;  5C2Y A;  2NYJ A;  3Q5M A;  4B8A A;  4AV7 A;  4JHK A;  3BG0 B;  3QWW A;  4IRU A;  2WXP A;  4KMO A;  3TWU A;  4BY6 A;  3FUM A;  1BU9 A;  1S0P A;  4GCO A;  3MX3 A;  3BQO A;  2FBN A;  2XPZ A;  5FQ4 A;  2L6J A;  2PM6 A;  5BPP A;  3AAA C;  3FU6 A;  3NOG D;  2X6I A;  4DX2 A;  1U3C A;  3ZEF A;  1DVP A;  5EX0 A;  4GPK A;  4G11 A;  5DBK A;  1ZU2 A;  1ELR A;  5ENS D;  3JXI A;  5B1A E;  4GZD A;  4GYO A;  1Y6I A;  4FU3 A;  2XZD G;  3FP3 A;  3EUV A;  1OWM A;  3CVQ A;  1IXV A;  3L16 A;  4Q96 A;  1MX6 A;  3R7R A;  1HU3 A;  4J8D A;  3HXB A;  3FEX A;  4MKT A;  5CBN A;  3AG2 E;  3ZU7 B;  2XGS A;  5G2N A;  3CHQ A;  4ANX A;  4GU5 A;  3CKC A;  1FT1 A;  4G8L A;  2XEH A;  5ENP D;  1JCS A;  4I9C A;  4FC8 A;  3EHR A;  3ZIM A;  3E33 A;  1ELW A;  2P9P G;  1TNB A;  1OCZ E;  4LEU A;  4TUU A;  4GYY A;  3R9A B;  3HYM B;  5AQA A;  3KSQ A;  3U9W A;  3QWP A;  4EQF A;  3NZS A;  4XKC A;  2X3M A;  3O4Z A;  5J08 A;  3DSS A;  4G24 A;  2YNQ A;  4CT0 A;  2LSV A;  3ONL A;  3PRE A;  4MRU A;  4E85 A;  4EBA A;  3ZFW A;  4FP7 A;  2XGM A;  3QJZ A;  4RQI A;  5KNH D;  3RO2 A;  2GRO B;  5CMY A;  3PVL A;  2OND A;  3FH7 A;  3P1U A;  2I1K A;  3UMV A;  1S63 A;  3LS8 A;  1O5M A;  1NI1 A;  1NFI E;  4WND A;  2WXN A;  3UXG A;  3ZKJ A;  3IV0 A;  5LP0 A;  4N3C A;  3QB2 A;  2Y69 E;  5FZR A;  3V30 A;  1X81 A;  2IOL A;  3FUF A;  1H0A A;  1H6K A;  1WAO 1;  2H6I A;  4G1T A;  3ASO E;  4J0U A;  5B1B E;  3LVR E;  3CLJ A;  2VGE A;  4U8H A;  4HOR A;  3SO8 A;  5AEN A;  1UW4 B;  1DC2 A;  3FUE A;  1Q2Z A;  4KXK B;  3DBS A;  1H2V C;  4N5C A;  2ETA A;  4OVU A;  2X6H A;  5T3R A;  1KPS B;  1Z3X A;  1N54 A;  5JHB A;  1V55 E;  3Q75 A;  2DWZ A;  2HR2 A;  3ZXP A;  1IKN D;  2BUG A;  3DRA A;  3QAQ A;  3EJN A;  3GZ1 A;  4U63 A;  5EID A;  4RSY A;  1NA0 A;  3ONK A;  4B8C B;  3QOU A;  1YMP A;  3VTY A;  3DSX A;  2X6F A;  2KCK A;  4BWR A;  4OAU C;  5ITZ F;  2P58 C;  4GZ5 A;  4U8Y D;  3FTY A;  3ASN E;  4LUN U;  3S7D A;  2KAT A;  2AVP A;  1MYO A;  4WNF A;  1NL4 A;  4D10 C;  2R17 C;  4B0Z A;  4UWG A;  2LUH A;  1K1A A;  3PUJ A;  2GRM A;  5LX8 A;  2GRR B;  3TWS A;  1RW2 A;  5KWD A;  1S64 A;  2JEK A;  3CK9 A;  5T8I A;  2FF4 A;  3APC A;  4FJZ A;  4B89 A;  4XX5 A;  4I6J A;  3KD7 A;  1U2V G;  3PE4 A;  4AXH A;  3E37 A;  4L2L A;  4O1O A;  3TWX A;  1VDY A;  5FQ6 A;  4WNG A;  3CVV A;  2WXM A;  3V31 A;  3UT8 A;  4F6R D;  3DSV A;  2P9I G;  5M72 A;  3E34 A;  4EHM A;  4PS8 A;  3BUA A;  2WXH A;  2EQX A;  2X38 A;  3OXF A;  3FDH A;  1IHG A;  2PQR A;  2CHX A;  1P5Q A;  2XEN A;  3UUX A;  3U64 A;  4ABN A;  2IQC A;  1HFA A;  4JVS A;  2GRN B;  1E8W A;  4LCT A;  2OVF A;  3B7R L;  3CVL A;  4OVV A;  4PS7 A;  3IBE A;  2EIN E;  3HXC A;  5KJL A;  2WXO A;  4L1B A;  5FIN A;  2XCB A;  3LCA A;  4ILI A;  5G04 J;  3OXL A;  2BF0 X;  1N11 A;  5EYL A;  1UOH A;  4DK5 A;  2IOS A;  3MYV A;  3CVY A;  2R5S A;  4DLO A;  1QQE A;  3RRN B;  3UX4 A;  2WMN A;  5KJK A;  1E7V A;  4J6I A;  3P2B A;  4BTA A;  3C5R A;  3Q79 A;  2YIN A;  1RZ4 A;  3C3Q A;  3I3N A;  3CEQ A;  3DXM G;  1UG3 A;  2VTB A;  3G2V A;  2LAH A;  1ELK A;  1E96 B;  3EHQ A;  4KVO A;  1LD8 A;  3CHR A;  4KT6 B;  4EZK A;  2P9N G;  5CCM A;  4I1A A;  1QYM A;  4HOS A;  3APF A;  3QC1 A;  3W9G A;  3LYA A;  4LNU D;  3TGO A;  4GTM A;  3HXF A;  3TWR A;  2EIK E;  2WVI A;  3FWV A;  3FUJ A;  3UM1 A;  2CFU A;  4F1S A;  2BKG A;  4GMR A;  5A23 A;  3L22 A;  3FU5 A;  2VGX A;  3AG1 E;  2LAI A;  3B7B A;  1K1B A;  5AQ7 A;  1WY6 A;  4I1O B;  5ENR D;  4GTV A;  4URK A;  4PUC A;  5JA4 D;  3OXG A;  1L5J A;  4A55 A;  3EU5 A;  2MYO A;  3FUK A;  1EF1 C;  2BKK B;  2OEW A;  3RU0 A;  3UM3 A;  1MJ0 A;  4WAF A;  4AVX A;  4M3O A;  4ATZ D;  2V5Q C;  1N4P A;  1LD7 A;  3CVU A;  3ML8 A;  5LFA A;  2Y4T A;  4U7E B;  3QAR A;  2PZI A;  4BTB A;  2VSO E;  3DEO A;  3CQC B;  4N3A A;  5J90 A;  2VTB B;  1PC2 A;  1GW6 A;  4GA1 A;  3HRA A;  5D2M C;  1TYQ G;  3CV0 A;  2ZGG A;  3G2W A;  3R7Q A;  4TXR A;  2AW6 A;  5ARF A;  3RJV A;  3OAW A;  4P29 A;  2XHE A;  2DIW A;  2IF4 A;  3L9T A;  3KAE A;  1O1S A;  4DX5 D;  4GTO A;  4O60 A;  2UY1 B;  5CCL A;  3K9I A;  4I2W A;  3JUI A;  4ATG A;  4WNE A;  3WG7 E;  2DVW A;  4J8F A;  3UQ3 A;  4NQ0 A;  3LJ3 A;  3SFX A;  3GZ2 A;  3ASH A;  4BEP A;  3MGB A;  2P9U G;  4Q94 A;  3FTZ A;  2J08 A;  3SD5 A;  4JA9 A;  4RG9 A;  3CK8 A;  3N71 A;  1INZ A;  4UWH A;  3BG1 B;  1TEZ A;  1TJF A;  5ARG A;  4J8Y A;  4ACK A;  3ZNG A;  5KBA A;  1Z6T A;  3JUE A;  1OWO A;  3LY7 A;  4XKB A;  3EHM A;  1H19 A;  4FUL A;  4N39 A;  2KCL A;  3KSL A;  3C3R A;  2CG3 A;  2RFM A;  2J07 A;  1FT2 A;  1ZBP A;  4AY6 A;  4PH4 B;  4HB5 A;  4OYS A;  5AQB A;  3FHE A;  3DST A;  2XQ0 A;  5CER B;  4JHR A;  1TNZ A;  3FY4 A;  2LXM A;  5FZS A;  3ZHE B;  2B6C A;  4FA6 A;  4H7X A;  1W3B A;  2Y4U A;  4HBD A;  2A5E A;  5D66 A;  2GRP B;  2M63 A;  1UJK A;  3AS4 A;  2VJ8 A;  3TWT A;  5IY5 E;  4EEC A;  3CHO A;  3CQG B;  3SFY A;  4F53 A;  4Y6C A;  3E4B A;  3D9M A;  5KCM A;  3O48 A;  3J5P A;  3VLD A;  5BW8 C;  4AIF A;  2WXQ A;  2X6J A;  3FTS A;  2L0T B;  3CR3 A;  3T8M A;  3FH8 A;  2CHW A;  2R02 A;  4LER A;  2XPI A;  1IQU A;  5E76 A;  3B95 A;  5AYW D;  4UWL A;  4K5C A;  3AG4 E;  4QQI A;  3T5X A;  3PEV B;  1HZ4 A;  1N4R A;  1TN8 A;  4G8K A;  1A5E A;  4AY5 A;  3RIB A;  4C9B B;  3I4R B;  4GMJ A;  3CK7 A;  3S7B A;  1KLX A;  3CSF A;  2YHC A;  1N95 A;  3CHS A;  2F0Y A;  2Y3A A;  4JEH A;  3UIN C;  1N4Q A;  5JJ7 A;  2DBA A;  3C72 A;  5A7D B;  4MLP A;  5CHE E;  5AAR A;  2PQN A;  2NSZ A;  2V5F A;  1TJC A;  1HE8 A;  2PM7 A;  4I6G A;  4XI0 A;  5ENT D;  1EYH A;  4U04 A;  3EU9 A;  3CVW A;  3B7T A;  4C0E A;  4TXP A;  2I2O A;  3NAW A;  2V0P A;  1OXJ A;  3HHM A;  4JL0 A;  3ZXS A;  3SBS A;  2ION A;  3MZL B;  3IKO B;  1UN9 A;  1FVF A;  3E32 A;  2PNN A;  4J8E A;  3HVE A;  2IO3 C;  1NA3 A;  4PDX A;  3ZYM A;  5ENN A;  3RRM B;  3LKU A;  1KZP A;  5ENQ D;  5HRY A;  1U3D A;  3PRZ A;  5BV1 A;  4HNA D;  4GA0 A;  4O1P A;  4KYO B;  4L7T A;  4FAD A;  4GTQ A;  2ZU6 B;  3DPY A;  3ISM C;  2QYU A;  3MCX A;  4JHJ A;  1KT0 A;  3HDX A;  3ASF A;  5G05 J;  3FTV A;  3PH0 C;  4HRL A;  3V2O A;  3TG4 A;  4GTS A;  4UI9 K;  3L82 A;  2VSN A;  4FHJ A;  3D9H A;  3UPV A;  2A5U A;  2MOW A;  3R9M A;  4WWO A;  1IQR A;  3AG3 E;  1OWN A;  3G2T A;  2KCV A;  3JQ1 A;  3D9J A;  3F6Q A;  4X8Q A;  3AU5 A;  3G2S A;  3SGH A;  2L0I A;  2WM9 A;  1N4S A;  3S7J A;  4HLL A;  4GA2 A;  3TWV A;  4LNG A;  4I17 A;  3EDT B;  4BES A;  4ILG A;  3ML9 A;  2WXJ A;  3D9I A;  1N0R A;  4I1M A;  5AAO A;  4JB8 P;  4K5B A;  4JW1 A;  3U66 A;  3FTU A;  1YCS B;  2GGF A;  4Z68 A;  4K5A B;  3CGH A;  4BFR A;  4IUL A;  2DCP A;  1JCQ A;  2QZA A;  2V4L A;  5JJT A;  1O1T A;  1BD8 A;  3SF4 A;  5G05 C;  5FIO A;  2C0L A;  5CEC B;  3LVQ E;  4FLH A;  4XZ4 A;  4UUC A;  1JUQ A;  4HI9 A;  4FLB A;  1FVH A;  3CKB A;  3MEK A;  3PEU B;  2WXI A;  4L23 A;  2FO7 A;  3ABL E;  4LRZ A;  4HOU A;  4MBG A;  4KVM A;  4JZY A;  2R59 A;  4TXQ A;  1TNU A;  4CZ2 D;  1JPL A;  3SHF A;  4MS6 A;  4N3B A;  2XS8 A;  4TRQ A;  1BLX B;  1HXI A;  1MZC A;  4JD2 G;  3MV2 B;  3ENE A;  2XEE A;  4UWF A;  5FT9 A;  2ZGD A;  3Q73 A;  2XGO A;  2FI7 A;  4KZ0 A;  4LNB A;  1K3Z D;  3SBT B;  5BXU A;  3MKQ B;  4BSZ B;  4DX1 A;  2HYZ A;  2RFA A;  4AEZ C;  1ZB1 A;  4JXT A;  3RAU A;  1PAQ A;  2VGY A;  3BU8 A;  4NRH B;  3SY2 A;  2QY7 A;  3LY8 A;  2J9Q A;  2Y1L E;  4HS2 A;  2CHZ A;  2P9S G;  4RVB A;  5EIB E;  2J4D A;  3FU3 A;  2H6F A;  4DRX E;  1LF8 A;  4AM9 A;  5E75 A;  4C0M A;  4G2V A;  1XGW A;  2UY1 A;  5AJD A;  3DSW A;  2DZN A;  3NBN B;  3OTN A;  1N52 A;  5LCW J;  1D9S A;  1EPU A;  4U07 A;  4GZ3 A;  1Z3Y A;  1N9A A;  3UKR G;  4EPZ A;  1YYH A;  3S7F A;  3SZ7 A;  3ZN3 A;  4CDR A;  1N0Q A;  5EX3 A;  2MHK A;  4UI9 C;  3UTM A;  3URZ A;  3TAX A;  1OT8 A;  3NF1 A;  3JXJ A;  2DZO A;  4GB9 A;  4CT4 A;  3NB2 A;  2LSU A;  2RKK A;  1IYG A;  4ME2 A;  4JA7 A;  1PY1 A;  2ETC A;  4J8S A;  2XS1 A;  4AP2 A;  1E7U A;  1FCH A;  3PNL B;  2ZXW E;  2WXK A;  1B89 A;  3MJW A;  2WXG A;  3T9K A;  3PE3 A;  3PZ3 A;  1KT1 A;  4LG6 A;  2OOE A;  4F1P A;  4CYM D;  1BPO A;  1SQM A;  2WB2 A;  2GRL A;  2B0O E;  4U0U A;  3Q4A B;  5AIJ A;  3UI2 A;  4FHK A;  2AXU A;  2Q7F A;  2R2L A;  1D8D A;  5D0Q D;  3PZ4 A;  3QKY A;  1IHB A;  4HLE A;  4G23 A;  3TXM A;  1LTX A;  4DUI A;  4WUY A;  5EDS A;  2VYI A;  5C1D A;  2C2L A;  4UI9 J;  3ZPJ A;  4XE0 A;  3Q15 A;  1SA4 A;  4ZHB A;  1NZN A;  5D0O D;  1HG2 A;  2AWI A;  2JAB A;  3DEP A;  3W9F A;  3Q47 B;  3FU0 A;  2R03 A;  3GYZ A;  1SVX A;  3ZYL A;  1D8E A;  2NXP A;  5JMN D;  2IFU A;  4HVB A;  4DJA A;  2VGX B;  4YDO A;  3C3O A;  1A17 A;  5EKQ D;  2ZIS A;  1QNF A;  2J09 A;  4HXI A;  4APO A;  3QNK A;  1G3N B;  2V8S E;  4PS3 A;  3L54 A;  1QZ2 A;  5CBO A;  3V2X A;  3JCK C;  4GPM A;  2XCC A;  5FQ8 A;  2J4B A;  1E8Z A;  4M7C A; 
#chains in the Genus database with same CATH homology
 4FJZ A;  3U4T A;  3CHM A;  4B89 A;  2NSZ A;  4GZC A;  4XX5 A;  3G2U A;  4GYW A;  3ASG A;  3KD7 A;  4I6J A;  2V5F A;  3Q49 B;  1TJC A;  5ANL A;  3PE4 A;  4AXH A;  4G25 A;  4EZL A;  3GW4 A;  1HE8 A;  2LO6 A;  2PM7 A;  4I6G A;  4JC8 A;  4L2L A;  4HOQ A;  1VDY A;  2VSX E;  4BT8 A;  5LCW C;  1MQS A;  4XI0 A;  5FQ6 A;  4WNG A;  1H2T C;  2RG8 A;  3CVV A;  1EYH A;  1HH8 A;  3L17 A;  4DI4 A;  4U04 A;  2WXM A;  3UT8 A;  3CVW A;  3B7T A;  3MKQ A;  4C0E A;  1E8X A;  3D9N A;  4AJW A;  2I2O A;  4DPR A;  1SZA A;  2V0P A;  5M72 A;  3FUL A;  4Y6W A;  3PDN A;  2RD0 A;  3KEZ A;  5BT1 A;  3HHM A;  3RK6 A;  1YA0 A;  4JL0 A;  5KJM A;  4U0S A;  4TV3 A;  4A1G A;  3ZXS A;  3SBS A;  2FEZ A;  3SFZ A;  2ION A;  3MZL B;  4YVO A;  3IKO B;  4PS8 A;  1UN9 A;  1FVF A;  2WXH A;  4J8E A;  3RRU A;  3IHY A;  2EQX A;  2I6H A;  3HVE A;  5G04 C;  5T4Y A;  1NA3 A;  2X38 A;  4PDX A;  3OXF A;  3ZYM A;  5CMW A;  3FDH A;  5ENN A;  3RRM B;  3LKU A;  1IHG A;  3I4G A;  2PQR A;  3ASD A;  4ANW A;  2IU1 A;  4QFV A;  1U3D A;  2CHX A;  1P5Q A;  2KC7 A;  2WXF A;  3PRZ A;  5ANR A;  5BV1 A;  3UUX A;  4GA0 A;  3LPZ A;  3U64 A;  3CHP A;  4KYO B;  4CEM A;  4ABN A;  2IQC A;  1HFA A;  4JVS A;  1E8W A;  4L7T A;  4FAD A;  3MV3 B;  3LXU X;  2ZU6 B;  4LCT A;  2OVF A;  2NC9 A;  3B7R L;  3CVL A;  4B94 A;  2KM4 A;  3MCX A;  4L2Y A;  5HI7 A;  3ZRH A;  4JHJ A;  3WXX A;  1KT0 A;  3TJP A;  4OVV A;  3HDX A;  3FUN A;  3IBE A;  4GCN A;  4PS7 A;  1X5B A;  2L9B A;  3FUI A;  4GML A;  5KJL A;  3B13 A;  3ASF A;  2WXO A;  4L1B A;  4XIF A;  5G05 J;  3FTV A;  3PH0 C;  4N2S A;  5AJL A;  3D9K A;  2XCB A;  5BUZ A;  4KZC A;  3QWV A;  3LCA A;  4ILI A;  5G04 J;  2XRY A;  1SZ9 A;  3TG4 A;  3OXL A;  2CG2 A;  5LOZ A;  3L08 A;  2BF0 X;  3D9P A;  4UI9 K;  1JWF A;  3FUD A;  3SI5 A;  4F3V A;  2VSN A;  3LY9 A;  4FHJ A;  4YVQ C;  4DK5 A;  3NZU A;  3B7U X;  3L6A A;  2IOS A;  2A5U A;  3MYV A;  3UPV A;  3TXN A;  2R5S A;  1OWP A;  3CVY A;  4DLO A;  2A4Z A;  2AXZ A;  1QQE A;  2MOW A;  3RRN B;  4FJY A;  2WMN A;  3UX4 A;  5KJK A;  4WWO A;  1IQR A;  1OWN A;  3G2T A;  2KCV A;  1E7V A;  4J6I A;  3UT7 A;  2CFZ A;  3P2B A;  5JJ6 A;  3B7S A;  5G55 A;  1HF8 A;  3JQ1 A;  3CST A;  4H7Y A;  3D9J A;  4BTA A;  3FTW A;  4WWP A;  2WXR A;  2YIN A;  1E90 A;  5HQ8 A;  2ILR A;  3I3N A;  3PNT B;  3CEQ A;  3SNX A;  3AU5 A;  3IHV A;  3I5P A;  3G2S A;  3SGH A;  4HOT A;  4UQX A;  1UG3 A;  2L0I A;  2WM9 A;  2VTB A;  3S7J A;  3MA5 A;  4GA2 A;  3ESL A;  3G2V A;  3PS6 A;  5FQ7 A;  2HM8 A;  2LAH A;  1ELK A;  3D3M A;  3EDT B;  1E96 B;  4I17 A;  4K03 A;  4CDM A;  4E6H A;  1MHQ A;  4KBQ A;  2WMO A;  4KVO A;  4ILG A;  4O6F A;  3ML9 A;  1HG5 A;  2WXJ A;  3D9I A;  3CHR A;  3MKR A;  4I9E A;  2XPY A;  4I1M A;  4APF A;  4KT6 B;  4JW1 A;  4EZK A;  4DLQ A;  3U66 A;  4NUR A;  5C2Y A;  3FTU A;  3Q5M A;  4B8A A;  4AV7 A;  5CCM A;  4I1A A;  2GGF A;  4JHK A;  3BG0 B;  4U0Z A;  3AU4 A;  3QWW A;  4IRU A;  2WXP A;  4KMO A;  2I9C A;  4HOS A;  4BY6 A;  3ZHE A;  3CGH A;  4BFR A;  3APF A;  3ESK A;  3QC1 A;  1HS6 A;  4IUL A;  3LYA A;  2DCP A;  2MRI A;  3TGO A;  3FUM A;  3S2A A;  2J49 A;  2V4L A;  1S0P A;  5JJT A;  2WVI A;  3FWV A;  3SF4 A;  5G05 C;  3FUJ A;  4CRW A;  2CFU A;  4GCO A;  3MX3 A;  4ILH B;  4F1S A;  2C0L A;  3FUH A;  3LVQ E;  4FLH A;  3FEY A;  4XZ4 A;  2FBN A;  3CVX A;  5A23 A;  3L22 A;  3FU5 A;  1JUQ A;  2VGX A;  4BX8 A;  2XPZ A;  4FLB A;  5FQ4 A;  5FWQ A;  3BEE A;  2LAI A;  1FVH A;  2L6J A;  3CKB A;  4AOF A;  1WY6 A;  2PM6 A;  3MEK A;  3PEU B;  4I1O B;  2WXI A;  5BPP A;  4K0R A;  3FU6 A;  4L23 A;  2FO7 A;  4URK A;  4LRZ A;  4HOU A;  4PUC A;  2X6I A;  4KVM A;  1U3C A;  3ZEF A;  3OXG A;  4JZY A;  1DVP A;  2QFC A;  2R59 A;  1L5J A;  5EX0 A;  4A55 A;  4G11 A;  4GPK A;  5DBK A;  1JPL A;  3SHF A;  4MS6 A;  1ZU2 A;  3FUK A;  1NP7 A;  1ELR A;  1EF1 C;  4N3B A;  3RU0 A;  4TRQ A;  4GZD A;  1HXI A;  2E2E A;  4GYO A;  3MV2 B;  3ULQ A;  1H2U A;  4WAF A;  1Y6I A;  4AVX A;  3ENE A;  4FU3 A;  4M3O A;  3RO3 A;  4UWF A;  5FT9 A;  3FP3 A;  5BV0 A;  1OWM A;  2XGO A;  3CVU A;  3CVQ A;  3ML8 A;  3L16 A;  2FI7 A;  4KZ0 A;  2Y4T A;  4Q96 A;  5LFA A;  3SBT B;  3R7R A;  3QAR A;  2PZI A;  1HU3 A;  4J8D A;  4BTB A;  2VSO E;  3MKQ B;  3FEX A;  1HX8 A;  2HYZ A;  3ZW3 A;  4MKT A;  3CQC B;  3JQ0 A;  4YND A;  4AEZ C;  4N3A A;  5J90 A;  4ANU A;  4CGW A;  4I43 A;  2XGS A;  4JXT A;  2VSY A;  5G2N A;  3T5V A;  1PAQ A;  3TL5 A;  3CHQ A;  2VGY A;  3NQP A;  4ANX A;  2VTB B;  4GU5 A;  1PC2 A;  4NRH B;  4DI3 A;  1GW6 A;  4I6E A;  3CKC A;  4CGV A;  2QY7 A;  3LY8 A;  4GA1 A;  5BNW A;  4JPS A;  2J9Q A;  4I9C A;  4FC8 A;  3ZIM A;  3CV0 A;  4HS2 A;  2XEV A;  3G2W A;  3R7Q A;  2CHZ A;  1ELW A;  3LEW A;  3TG5 A;  4ACL A;  2PL2 A;  4RVB A;  2AW6 A;  5ARF A;  2J4D A;  3RJV A;  3FU3 A;  1WM5 A;  3EIJ A;  3OAW A;  4UQY A;  3HVE B;  2KZT A;  3EIQ C;  1LF8 A;  3FFL A;  4P29 A;  5E75 A;  4AM9 A;  4LEU A;  4TUU A;  4G26 A;  4C0M A;  1Y8M A;  3D9L A;  4GYY A;  2XHE A;  2DIW A;  2OV8 A;  3R9A B;  2IF4 A;  3HYM B;  1XGW A;  2UY1 A;  4G2V A;  1OWL A;  4WWN A;  4XI9 A;  5AJD A;  3U9W A;  3HIZ A;  3AS8 A;  3KAE A;  3QWP A;  5FZQ A;  4EQF A;  2WQ7 A;  2UY1 B;  3NZS A;  3OTN A;  4XKC A;  5CCL A;  3K9I A;  4I2W A;  2X3M A;  3JUI A;  4ATG A;  3L13 A;  3O4Z A;  4WNE A;  5J08 A;  1N52 A;  5LCW J;  4G24 A;  4J8F A;  3UQ3 A;  5A6C A;  2YNQ A;  4CT0 A;  2LSV A;  4NQ0 A;  3ONL A;  3LJ3 A;  3PRE A;  3APD A;  4MRU A;  4E85 A;  4EBA A;  1EPU A;  4U07 A;  4GZ3 A;  4FP7 A;  3ZFW A;  2XGM A;  3GZ2 A;  1Z3Y A;  3QJZ A;  3ASH A;  3MGB A;  4Q94 A;  3FTZ A;  4EPZ A;  2J08 A;  3SD5 A;  3RO2 A;  4JA9 A;  4RG9 A;  3ZYK A;  3CK8 A;  3N71 A;  5CMY A;  1INZ A;  4RG6 A;  3PVL A;  2OND A;  2VQ2 A;  3BG1 B;  4UWH A;  3S7F A;  1TEZ A;  3FH7 A;  1TJF A;  3JYS A;  3P1U A;  5ARG A;  3SZ7 A;  3ZN3 A;  1DNP A;  2JLB A;  4CDR A;  4ACK A;  2I1K A;  2C0M A;  4Q69 A;  5EX3 A;  2MHK A;  4UI9 C;  3UMV A;  1Z6T A;  1OWO A;  3LY7 A;  4XKB A;  3URZ A;  3EHM A;  3LS8 A;  3TAX A;  3UT4 A;  1H19 A;  3VTX A;  4FUL A;  4N39 A;  2KCL A;  3NF1 A;  3ZYQ A;  4WND A;  4GB9 A;  2WXN A;  4CT4 A;  2LSU A;  1IYG A;  2CG3 A;  3EHN A;  4HFG A;  4ME2 A;  1OUV A;  4JA7 A;  2J07 A;  4JEU A;  4BSX A;  3IV0 A;  1PY1 A;  4J8S A;  4AP2 A;  5LP0 A;  1ZBP A;  1E7U A;  4N3C A;  3QB2 A;  1FCH A;  5FZR A;  3PNL B;  2WQ6 A;  4AY6 A;  4ANV A;  2WXK A;  4UWK A;  4PH4 B;  4OYS A;  4W9R A;  2IOL A;  3FUF A;  1B89 A;  3FHE A;  1H0A A;  2IJG X;  2XQ0 A;  3IEG A;  2WXG A;  3MJW A;  4JHR A;  3ZGQ A;  3FY4 A;  3PUK A;  4N2Q A;  3PE3 A;  1H6K A;  3VLE A;  2E0I A;  1WAO 1;  5FZS A;  4V3I A;  3ZHE B;  1KT1 A;  4G1T A;  2LNI A;  4J0U A;  2OOE A;  4BX9 A;  4FA6 A;  1BPO A;  2HO1 A;  4H7X A;  1SQM A;  3PZD A;  4IN3 B;  2WB2 A;  3LVR E;  2GRL A;  3CLJ A;  4U8H A;  4HOR A;  4U0U A;  1E8Y A;  1W3B A;  2Y4U A;  3Q4A B;  5AEN A;  5AIJ A;  2M63 A;  4FHK A;  1UW4 B;  1UJK A;  2AXU A;  3AS4 A;  2Q7F A;  3FUE A;  2FUL A;  3CIA A;  4KXK B;  2VJ8 A;  1EDU A;  5D0Q D;  3DBS A;  3QKY A;  1H2V C;  4EEC A;  4G23 A;  3TXM A;  3CHO A;  4CCA A;  4HLE A;  1XNF A;  5FTP A;  3CQG B;  3ZVV A;  3DPD A;  3FTX A;  4N5C A;  4OVU A;  5FJY A;  2X6H A;  5T3R A;  4IYP A;  4R7L A;  4F53 A;  5JHA A;  1Z3X A;  4Y6C A;  2OVB A;  3E4B A;  2I1J A;  1UJJ A;  4WUY A;  5EDS A;  1N54 A;  3D9M A;  5KCM A;  2VYI A;  3O48 A;  4UQZ A;  5C1D A;  2C2L A;  2KZT B;  2WXL A;  4UI9 J;  4CDN A;  3VLD A;  5BW8 C;  4AIF A;  5JHB A;  4EBA G;  2WXQ A;  3ZPJ A;  2X6J A;  4XE0 A;  3FH5 A;  2HR2 A;  3RKV A;  3Q15 A;  3FTS A;  2L0T B;  3CR3 A;  2BUG A;  3QAQ A;  3EJN A;  3T8M A;  3QDN A;  3FH8 A;  3GZ1 A;  4GZ6 A;  3VLF A;  1NZN A;  2CHW A;  4U63 A;  4BT9 A;  4RSY A;  4NAC A;  4LER A;  4A3T A;  2BTD A;  1IQU A;  2XPI A;  5D0O D;  1HG2 A;  1NA0 A;  3ONK A;  4B8C B;  3QOU A;  2AWI A;  5E76 A;  3D9O A;  1UN8 A;  3U3W A;  5AYW D;  4UWL A;  4A3V A;  3VTY A;  2XRZ A;  3T5X A;  1JWG A;  2X6F A;  2KCK A;  3PEV B;  3QK0 A;  3Q47 B;  4BWR A;  5DIZ A;  4I2Z A;  1HZ4 A;  3CVP A;  2P58 C;  3FU0 A;  3GZS A;  4GZ5 A;  3FTY A;  3GYZ A;  4AY5 A;  3RIB A;  4C9B B;  4LUN U;  3ZYL A;  2UWJ G;  3I4R B;  3S7D A;  2NXP A;  5KJN A;  4GAA A;  3LDZ A;  3CVN A;  1HO8 A;  2IFU A;  4GMJ A;  4HVB A;  4DJA A;  3AS5 A;  2KAT A;  2WQH A;  2VGX B;  1A17 A;  2AVP A;  5EKQ D;  2YHE A;  2X6K A;  4WNF A;  3CK7 A;  1QNF A;  4D10 C;  2R17 C;  3S7B A;  2J09 A;  4HXI A;  4APO A;  1KLX A;  2WPV A;  3QNK A;  3CSF A;  2YHC A;  2YQ8 A;  3CHS A;  4UWG A;  4B0Z A;  4EZJ A;  2V8S E;  2GRM A;  3KS2 A;  3PUJ A;  2AXV A;  4PS3 A;  5LX8 A;  3L54 A;  4F7A A;  3C98 A;  1QZ2 A;  2Y3A A;  4JEH A;  2JEK A;  3JCK C;  5JJ7 A;  3CK9 A;  4A1S A;  2XCC A;  2DBA A;  5T8I A;  2FF4 A;  2GW1 A;  2J4B A;  1E8Z A;  5FQ8 A;  5A7D B;  3APC A;  4MLP A;  5CHE E;  2PQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...