4GA0A

Structure of the n-terminal domain of nup358
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
143
structure length
143
Chain Sequence
RSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWLERAAKLFPGSPAIYKLKEQLLDCEGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords E3 SUMO-protein ligase RanBP2
total genus 57
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga0A00
3LPZA 4J0UA 5EX3A 1KT1A 4GZ5A 5G05C 2BUGA 3QWVA 4J8FA 3SF4A 4YNDA 3RJVA 2V5FA 2DBAA 1NA0A 2VGXA 2VGYA 3LY9A 4GZ6A 5FZQA 5G05J 4UQXA 4GA2A 5KJLA 1Y8MA 2KCVA 3UQ3A 5JJTA 3ZPJA 5KJKA 3LYAA 5CHEE 4AIFA 3CVPA 3KAEA 3FP3A 2Y4UA 4RG9A 2PL2A 2PQNA 3TG4A 5FTPA 2E2EA 5ARFA 4N3AA 2PQRA 5G04J 4KBQA 4EQFA 3U3WA 3OXLA 2Q7FA 4YVOA 3S7JA 5BT1A 5G04C 4BT9A 4HORA 4WNEA 2FF4A 4KYOB 1QZ2A 5EKQD 2VQ2A 3CVNA 1KLXA 2KCKA 1ZU2A 1ZBPA 2KCLA 4U0ZA 2VYIA 3LCAA 3LKUA 2FEZA 3SZ7A 5FT9A 3KD7A 3QDNA 2XCCA 2UWJG 4WNDA 4AY5A 3GZ1A 4AM9A 1NZNA 3RO3A 4N2SA 2LNIA 3E4BA 3ZHEA 5KJNA 3AS4A 1ELRA 3ASHA 3NF1A 3QWPA 3RKVA 3TG5A 4B94A 3LY8A 5D0QD 1IYGA 5HI7A 2Y4TA 2I6HA 3ASGA 2P58C 3VTYA 4BTBA 4U07A 4U04A 4Y6WA 5DBKA 5ARGA 3K9IA 2AVPA 2HR2A 5A7DB 2XEVA 5BW8C 2YHCA 3MEKA 2UY1A 2IFUA 2C0MA 4JA7A 4HOUA 2NC9A 4GA0A 4U0UA 3RIBA 2C0LA 2WQHA 3Q4AB 3KS2A 4H7YA 2R5SA 4GYYA 4RG6A 4YVQC 3Q15A 5FZRA 3ASDA 4O6FA 4GYWA 4WNGA 3UUXA 4APOA 2VSNA 2IF4A 3ESKA 2GW1A 4BWRA 1TJCA 5CCMA 3CVLA 4J8DA 2KC7A 4WNFA 5KJMA 5FZSA 2XPIA 1QQEA 2HYZA 4JHRA 2ONDA 4UQYA 4W9RA 3CV0A 4BT8A 4N5CA 3OXFA 3QKYA 5CCLA 3HYMB 3N71A 4CGVA 4KXKB 1WAO1 2MHKA 3TAXA 3AS5A 3ZHEB 4UQZA 2J9QA 3AS8A 2XCBA 2LSVA 4N3CA 4F3VA 4XI0A 4GPKA 4G25A 4G26A 3RO2A 5DIZA 2HO1A 4I2ZA 1HXIA 3URZA 4HOTA 2YQ8A 3Q49B 4N39A 1OUVA 3TGOA 5FJYA 3CK7A 3MV3B 5BNWA 3VTXA 1P5QA 3FWVA 3MA5A 1B89A 3PDNA 3RU0A 2OOEA 3ZN3A 1XNFA 3CK9A 5JJ6A 3CKBA 4HOSA 2C2LA 4U0SA 4ABNA 4H7XA 4LEUA 5D0OD 5HQ8A 2VSYA 3CKCA 4N2QA 3GZ2A 4I17A 3MKRA 2LSUA 3BEEA 3JYSA 5AYWD 3ULQA 3CVQA 5A6CA 2XGSA 3QOUA 3UPVA 1KT0A 5LCWJ 2FO7A 4ME2A 4G24A 3ZGQA 2FI7A 3LY7A 1PC2A 4Y6CA 3WXXA 4CDRA 4GYOA 1W3BA 3Q47B 3S7BA 5M72A 4AY6A 4UI9J 4BTAA 3R9AB 4HOQA 1IHGA 1YA0A 4I1AA 4JL0A 2FBNA 4I9CA 3EDTB 4GZ3A 4IN3B 3U4TA 4CGWA 5JJ7A 4JA9A 3S7FA 4NQ0A 4G23A 2JLBA 2PZIA 1A17A 3GYZA 3MV2B 3OXGA 3Q5MA 4XIFA 4A1SA 3IEGA 3ASFA 3FFLA 4G2VA 1ELWA 3PE4A 4I9EA 4I2WA 1HH8A 4GA1A 5EX0A 3ZFWA 3GW4A 1FCHA 4J8EA 1WM5A 2KATA 4GCNA 4NRHB 4UI9C 3S7DA 4XI9A 2L6JA 1E96B 4UI9K 4GCOA 2XGMA 2XGOA 3CEQA 3CK8A 3PE3A 1HZ4A 2VGXB 2QFCA 2UY1B 4WUYA 2WPVA 5C1DA 1NA3A 5LCWC 4G1TA 4N3BA 3QWWA 3O48A
chains in the Genus database with same CATH superfamily
4J0UA 4GZ5A 4YDOA 3QWVA 2VGYA 1NA0A 5G05J 2ZXWE 3CLJA 2Y4UA 3PH0C 4RG9A 3R7QA 2F8XK 3FUIA 2E2EA 3J5PA 4C48B 4AOFA 4A63B 4LSZE 4OVVA 2BTDA 3Q78A 3CVWA 4KZ0A 3V31A 4ILHB 1GW6A 2BKKB 4DRXE 2C0LA 5AIJA 4O6FA 1N4PA 4WWOA 1TNZA 2XPIA 3DSTA 5ITZF 3B7RL 2ILRA 2WMOA 4BEPA 1MJ0A 1HXIA 4I2ZA 5FQ4A 3SFZA 4TUMA 2H6IA 1TNUA 4HS2A 1ZB1A 2OOEA 5KBAA 2DIWA 2IY0C 5A23A 5HS0A 2IO3C 4A3TA 2EIKE 1N4RA 3QOUA 1KT0A 3G2UA 4G24A 3LY7A 2WXKA 2IOLA 3EIQC 1E90A 2WXFA 4B89A 4G23A 3BQOA 3UX4A 1QYMA 2Y0BG 4UI9C 4CT4A 5JHBA 3CVVA 2XGMA 4HQDA 3APCA 2DZOA 3O48A 5EX3A 2X6HA 2WXQA 2BKGA 3AJIA 4PUCA 4KBQA 3U3WA 3MKQA 4YVOA 4I1OB 4NACA 3B7TA 5AARA 5J08A 4PS8A 4HRNA 2UWJG 4HRMB 3BU8A 3DSWA 1D9SA 1ELRA 3NF1A 3CHSA 3FU6A 5ARGA 5LOZA 2ZGGA 1DVPA 4F7AA 4JA7A 3TWUA 3C98A 2WQHA 4G8KA 3URZA 5T4YA 3ASDA 3E30A 4KZCA 2WM9A 4AY6A 1TN7A 2HYZA 1S64A 5HRYA 3LJ3A 4APFA 3QK0A 3ZRHA 3RO2A 2Y69E 4N39A 3ONLA 5BUZA 3RU0A 5CMWA 4TRQA 4FU3A 1HS6A 2B0OE 1FT2A 2IOSA 3CR3A 2WXJA 3CVYA 3ULQA 3B7SA 4ME2A 4MLPA 3UM2A 4FLHA 1H6PA 3ZUVB 3U4TA 1PAQA 2J07A 4F1PA 4OVUA 2E0IA 5ENNA 3V30A 1TJFA 1U3CA 1NI1A 5H7PA 2R2LA 2QC9A 1E7UA 3AU5A 3BUAA 3JCKC 4OAUC 4GA2A 1Y8MA 4UUCA 4DI3A 2KBXA 4HB5A 4RVBA 1BD8A 1N52A 3FTSA 2KCKA 2VYIA 3T5XA 4HI9A 3D9OA 5KJNA 4UWKA 3RKVA 3TG5A 2RKKA 4BTBA 2QY7A 5EYPF 1IQRA 3B7BA 3W9GA 3E34A 3CQGB 2KXPC 3CHRA 5ENRD 4UQYA 4KXKB 1OWNA 2GROB 2L0TB 1KZOA 4N3CA 3B95A 3RK6A 2VTBA 4G26A 3ESLA 2ZIRA 3D9MA 5FJYA 1HO8A 4BY6A 4ILIA 4E85A 5T8IA 2VSYA 2CFUA 4U8YD 1SVXA 2XZTG 3MKRA 4MBGA 5AQ7A 3Q73A 4B0ZA 1MZCA 4JEHA 2GRPB 5M72A 2I1KA 4Q94A 4JL0A 4IN3B 3NQPA 4GTSA 3EHRA 4XX5A 2JLBA 4NIKA 4WWNA 4I2WA 1JCSA 4I1MA 2XEEA 4LCTA 3UTMA 3CEQA 3CK8A 3PE3A 1HZ4A 3ZXPA 1BLXB 1NA3A 3TWWA 3P1UA 2BUGA 4LG6A 4J8FA 2DBAA 2X6IA 1RZ4A 2EILE 1S70B 2PM6A 4GPMA 3CHOA 4XKBA 2P9NG 1BU9A 5ARFA 5G04J 3AG1E 3HXBA 3OXLA 1MYOA 4ATZD 4X8QA 5ANLA 3LVQE 1ZU2A 4U0ZA 1DCQA 3PZ3A 4GTPA 4GZCA 2VTBB 1INZA 4I6JA 3AG3E 4JHJA 3AS4A 4OYSA 2GRQB 4U04A 2UY1A 3EUVA 4Q69A 4GYYA 1KPSB 5EDSA 3AG2E 1TJCA 5KJMA 3KSLA 3O4ZA 2ZU6B 2M63A 3AS8A 1UG3A 2GGFA 4CCAA 3ZYKA 3HG0D 4U8HA 2CG3A 1OUVA 3DBSA 5BXUA 1P5QA 3FWVA 3HVEB 3UINC 3KSQA 4FA6A 2OV8A 1OWPA 3ZU7B 3JQ1A 4ABNA 3GZSA 4PDXA 4RLYA 3EHMA 3CHPA 1LD7A 4Y6CA 4IRUA 3FUFA 1A5EA 1HFAA 3OTNA 3S7FA 4DI4A 2LUHA 1UJJA 3ULYA 3PE4A 3EU5A 5EX0A 5EIBE 4HLEA 1OXJA 1UN8A 4NRHB 1E96B 3S2AA 2QFCA 2NYJA 2V4LA 4K5AB 2NXPA 3FUMA 4AIFA 3JXIA 2R05A 3MCXA 4J6IA 5FQ8A 3TWRA 4JXTA 3E33A 4GMJA 1QZ2A 3U9WA 3LCAA 1AWCB 2YHEA 4WAFA 1NZNA 4N2SA 3NZSA 3IXEA 5JMND 3ZW3A 4A3VA 3FULA 2NC9A 5JJTA 4ANUA 5AQAA 3JXJA 3C72A 1JCRA 5FWQA 1PY1A 2J9QA 4IYPA 3FU0A 5EYLA 5DIZA 2YQ8A 1N94A 4HVBA 3WG7E 2V5QC 1Z3XA 2CHWA 2IONA 5JJ6A 1IKND 2C2LA 1WDYA 3L17A 3NAWA 1NFIE 3D9JA 3CVQA 4MS6A 4K5CA 1EF1C 5LCWJ 3HXDA 1W3BA 1N11A 1KZPA 2FO1E 3OAWA 1TNYA 4GTVA 1E8YA 4I1AA 4I9CA 5JJ7A 5D66A 4A1SA 2Y1LE 2KM4A 1QBQA 4CEMA 3S7DA 2L0IA 3MGBA 1YMPA 4FP7A 4JZYA 5AJLA 3LPZA 3HXFA 3SHFA 3SF4A 3NOGD 5CRVA 5KCMA 3AAAC 3C5RA 2PQRA 4B8CB 1HG2A 3DEPA 3CHQA 3SFXA 5AJDA 4JB8P 4CYMD 4EZKA 1BPOA 3QDNA 4F1SA 1LF8A 1SA4A 4U07A 5DBKA 3UKRG 3KS2A 3AU4A 4GYWA 4BWRA 3APFA 5FZSA 3N71A 3G2VA 2R02A 2F0YA 1HG5A 4F3VA 4WWPA 4JPSA 4HOTA 2GRLA 2XS8A 1XNFA 2MRIA 3SBTB 5HQ8A 5D0OD 4BSXA 1MX2A 2J4DA 2OVBA 2XGSA 1FVHA 2DYRE 2X38A 3SFYA 2WXRA 3X2QE 4O1OA 4DJAA 4HOQA 4KVMA 2DVWA 3MJWA 1N54A 4LNUD 1OCOE 2CG2A 4Q96A 4TXRA 5CBNA 3UIPC 4TUUA 3IV0A 4PH4B 2VGXA 3SGHA 2P2CP 3LS8A 3FP3A 3I4RB 4BERA 3FH7A 1IXVA 4I6GA 4PS7A 4RQIA 3UM0A 3QWPA 1IYGA 5HI7A 3VTYA 4DLQA 3D9HA 3CVUA 2HR2A 2XPZA 3FUJA 4LUNU 3ZN3A 4FLBA 3QKYA 4CGVA 3AS5A 3ZKJA 2IQCA 3PEVB 4RSYA 4GTTA 2F37A 3CK9A 2J8SD 3CKBA 4H7XA 2XQ0A 4N2QA 2R03A 2XPYA 3TL5A 3L13A 4B8AA 4EBAA 1PC2A 4CDRA 4ANXA 4JHKA 1MX4A 2LO6A 1FVFA 1X81A 2FBNA 4I6EA 4BSZB 2RFMA 2WXOA 4U63A 1ELWA 4GA1A 4J8SA 4GCNA 3EHNA 3L82A 4GCOA 4KMOA 1OWMA 3ML9A 3EHQA 3DRAA 4DX2A 3E32A 3PUJA 2YNQA 4GZ6A 4UQXA 5CERB 3CVXA 2NSZA 3FTZA 3DSSA 1IQUA 3PREA 1L5JA 3CHMA 3J5QB 4KYOB 1KLXA 3B13A 3UXGA 5CRUA 3R9MA 4WNDA 4AY5A 4K5BA 4DLOA 1Z5SC 3LY8A 2I6HA 3ASGA 2P58C 3FHEA 2IU1A 3UKUG 1HE8A 3ZYMA 4L1BA 2KZTB 4HOUA 3Q4AB 3FTVA 4CDMA 2IF4A 3ESKA 3CVLA 4JHRA 4GU5A 1SA5A 4J8YA 1E8WA 3FUDA 3ONKA 1Z3YA 2WXHA 2PM7A 4GAAA 3RRMB 3MV3B 4MRUA 1DC2A 3TWSA 4ANVA 3MKQB 1OCZE 5JHAA 3U64A 2ZGDA 4DX7D 3ZGQA 3WXXA 1OCCE 3ASNE 1E8XA 4JD2G 1YA0A 1OT8A 4ACKA 3D3MA 4LNGA 1A17A 3MV2B 2WXNA 3ASFA 5G2NA 3L08A 1OCRE 2RFAA 3SNXA 5D2MC 4N3BA 4UWLA 1N9AA 5CEAA 4UWFA 4EZLA 2AXZA 3U66A 3G2WA 1TYQG 4AP2A 2P9IG 3CVPA 3FH5A 2X6JA 2LAHA 1RW2A 2KZTA 1OWOA 3I3NA 5EKQD 2WQ6A 4LNBA 3ZNGA 3KD7A 3GZ1A 3ASHA 3VLEA 1OY3D 2Y4TA 4AJWA 3D9LA 2R59A 3EIJA 2XEVA 2XZDG 5BW8C 2ZISA 1FPPA 2WXIA 2J09A 4BTAA 2GRMA 4FC8A 4PS3A 4U96D 4BT8A 4ILGA 4HBDA 1H6OA 3TAXA 4AV7A 3T5VA 4L7TA 4U8VD 1UJKA 3VTXA 3I4GA 4HOSA 4K0RA 3PVLA 4I17A 3D9NA 4J7WA 3SI5A 2OVFA 4XE0A 5AQ9A 3PS6A 4URKA 3Q47B 1HF8A 5BV0A 3EDTB 3PZ1A 4DX1A 3FFLA 4I9EA 4YDWA 4FJYA 2VSOE 4J8EA 4HRLA 4R7LA 2BEDA 2XGOA 3DXKG 4WUYA 3MYVA 2WPVA 3L22A 3DPDA 2L6BA 2OCCE 2MYOA 2IO2C 2DYSE 5G05C 2WB2A 3D9KA 1G3NB 1NL4A 5KJLA 2QYJA 4CZ2D 3KAEA 5KNGA 4TXPA 3TG4A 2PQNA 3VLFA 4GTRA 3C3RA 1OWLA 5FINA 3HXCA 2KCLA 1SZ9A 3HDXA 3IHYA 3UIOC 4EBAG 2CHXA 2LNIA 4B94A 4O60A 2LAIA 3Q7FA 4JEUA 4JC8A 4H7YA 3CSTA 4WNGA 2WXPA 2EQXA 3OXFA 5C2YA 1WAO1 2MHKA 3FUKA 3FTXA 5EIDA 3ZVVA 4XI0A 2HO1A 1XGWA 2LXLA 3MA5A 3G2SA 4NURA 3IHVA 3FDHA 3GZ2A 1JWGA 3UPVA 4U95D 1SZAA 4BX8A 2F8YA 1JPLA 2V4HC 3S7BA 3R9AB 5FIOA 4GZ3A 5B3SE 2EIJE 1H2VC 3GW4A 1Q2ZA 3ISMC 5ENTD 1UOHA 5LCWC 3C3QA 5E76A 2J08A 2WVIA 4YNDA 3RJVA 2KCVA 3FH8A 1V54E 1AP7A 1VDYA 4HFGA 3TWVA 4BT9A 5BV1A 4BX9A 3SZ7A 4C9BB 3UM3A 4HXIA 1N4QA 1H0AA 4N5QA 3ZHEA 1X5BA 2VSXE 3L6AA 1TNBA 5B1AE 4YDEA 5A7DB 1N95A 3I5PA 3MEKA 5FQ6A 4TV3A 4G11A 4U0UA 4O1PA 2R5SA 3UUXA 3ABME 2VSNA 3NZUA 1Y6IA 2KC7A 2ONDA 4W9RA 5LX8A 2L9BA 4G25A 3PRZA 1N0QA 1TEZA 1SW6A 4F6RD 4BESA 4GMRA 2LSUA 3BEEA 3BG0B 5A6CA 5ENQD 2QYUA 2XRYA 3SY2A 4AVXA 2XS1A 2AW6A 4XKCA 1E8ZA 4DX6D 3ML8A 5BPPA 4JW1A 1O1RA 3Q5MA 1MX6A 4G2VA 3TXNA 2DCPA 1FCHA 1JUQA 3P2BA 2I2OA 2AWIA 2YINA 1K1AA 3EJNA 3DPYA 3NOCD 5AAOA 2A4ZA 2P9KG 2V5FA 3TWTA 2B6CA 2GRRB 3ABKE 2PL2A 1H6KA 4BETA 4EQFA 2VJ8A 1Z6TA 3JQ0A 3LEWA 4OAVB 3QAQA 2HE0A 3D9IA 4DK5A 3PEUB 4HORA 3L16A 1ZBPA 2FEZA 4EPZA 2R17C 3HHMA 2X6KA 4ZHBA 3FTYA 1S0PA 3JUIA 3TWQA 4EHMA 5KNHD 4HI8A 3V79K 3IBEA 5FZRA 4YVQC 2JEKA 3TJPA 1QQEA 5CCLA 3CV0A 2XHEA 4XEIG 3HYMB 4IULA 4UQZA 4XZ4A 1K8KG 2XCBA 2V0PA 3RSEG 3Q49B 2DZNA 3PDNA 5J90A 3APDA 3NBNB 1MQSA 3CKCA 4GZDA 3FTWA 3HIZA 3UT7A 4M3OA 1UW4B 3LXUX 4K03A 2P9SG 2WQ7A 1NP7A 4NQ0A 2PZIA 3GYZA 3IEGA 4AEZC 2KATA 4TXQA 4MKTA 4XI9A 3MX3A 2VGXB 3CIAA 3RRNB 3MZLB 1N0RA 3CGHA 5ENSD 3R7RA 3FEYA 4I43A 3LY9A 3NB2A 4A1GA 4JVSA 4N3AA 2BF0X 5BT1A 3T9KA 3CVNA 3LKUA 2XCCA 4M7CA 1TNOA 3L9TA 1WG0A 3DSUA 1D8EA 1EYHA 1H2TC 5ENOD 3LVRE 1DCEA 3DEOA 2WMNA 3HXEA 3K9IA 4QQIA 3DSXA 2IJGX 3ZFWA 5CECB 4F53A 2I9CA 4APOA 3D9PA 1UN9A 1D8DA 4N5CA 5T3RA 4UWHA 4GPKA 1TN6A 2AXVA 3TGOA 3HRAA 4GB9A 3FUEA 4L2YA 3JYSA 4GTOA 1U3DA 2WXMA 1K1BA 4GMLA 3UMVA 3ZYLA 4GTMA 2FI7A 4A55A 4LRZA 3ZEFA 3SD5A 4XIFA 1WM5A 1FT1A 4UI9K 1YYHA 4V3IA 1K3ZD 1BI7B 3DSVA 3ASOE 4KVOA 4EECA 1WY6A 4D10C 1TR4A 3AG4E 3UQ3A 3ENEA 2Q7FA 3QJZA 2ETAA 1YCSB 5FT9A 5IY5E 4AM9A 4C0EA 3RO3A 3SO8A 3ZIMA 2P9UG 3QB2A 2ETCA 1EDUA 3CQCB 5D0QD 5G55A 4L23A 1H19A 3Q9UC 2AVPA 1LD8A 2IFUA 1O1SA 3Q79A 3JUEA 1H2UA 4WNFA 4E6HA 1E7VA 1QNFA 5EILA 4ANWA 2X3MA 3TWXA 3FEXA 4EZJA 3CK7A 3FU5A 3W9FA 2PNNA 4U0SA 3FU3A 2A5EA 3QARA 4FULA 1LTXA 2QZAA 1HU3A 2FO7A 2J49A 1DNPA 4UI9J 1O1TA 4CGWA 2FULA 3KEAA 3FTUA 2J4BA 1HH8A 3KEZA 4GTQA 4FHKA 3PZDA 5JA4D 3RRUA 3QWWA 2A5UA 1KT1A 3QC1A 4DPRA 1JCQA 3V2XA 5FZQA 3LYAA 5CHEE 3ABLE 3ZYQA 3EU9A 4ATGA 2OEWA 1V55E 1ELKA 2EINE 4WNEA 3SQVA 3Q9NC 4ACLA 3ULEG 5CBOA 2CHZA 4P29A 4Y6WA 3PUKA 2C0MA 4BFRA 1HX8A 4GA0A 2I1JA 3RIBA 3Q15A 5AQBA 2GW1A 3RAUA 1U2VG 4CT0A 3ZHEB 5LFAA 5HKPA 3V2OA 1IHBA 1N4SA 4FADA 4B93B 4L9PA 3UT8A 1SQMA 3FUHA 4FJZA 3UM1A 4DX5D 3ZXSA 1MHQA 4LEUA 4G8LA 2H6GA 5AYWD 2RG8A 4QFVA 4KT6B 1BI8B 2Y3AA 4GYOA 3G2TA 2HM8A 1IHGA 2H6HA 2WXLA 2GRNB 5E75A 3OXGA 3PZ2A 2L6JA 2DWZA 5LP0A 2V8SE 3DXMG 3Q75A 4UWGA 2AXUA 4G1TA 3Q7AA 5CEDB 2WXGA 3LJNA 3PNTB 5KJKA 3CSFA 3ZPJA 1JWFA 5EN5D 3PNLB 5FTPA 2VGEA 3BG1B 3DWLG 3L54A 5ANRA 2P9PG 3T8MA 3S7JA 2XEHA 4L2LA 5G04C 3IKOB 2FF4A 3B7UX 2VQ2A 3FUNA 2AJAA 2OEVA 4AXHA 2MOWA 4Z68A 4C0MA 2XENA 3E4BA 2X6FA 4YDYA 4HNAD 3PZ4A 3VLDA 5AENA 2RD0A 2YHCA 2CFZA 3UT4A 4DUIA 4RG6A 5KWDA 4ZFHA 2IEJA 1TN8A 5CCMA 1O5MA 4J8DA 4CDNA 5AN8A 3FY4A 2LSVA 1EPUA 4LERA 5B1BE 4CRWA 3C3OA 5BNWA 1B89A 1S63A 2LXMA 2P9LG 4HLLA 2XRZA 3F6QA 3LDZA 3QNKA 4FHJA 5FQ7A 3TXMA 3HVEA 2ETBA 3E37A 3UI2A 3T8KA 4JA9A 5CMYA 5ENPD 2H6FA 4U7EB 2JABA 3SBSA 2EIME 5BXOA 2UY1B 5C1DA
chains in the Genus database with same CATH topology
4UWFA 3CGHA 4J0UA 2V4LA 3R7RA 4GZ5A 3QWVA 3FEYA 4EZLA 4I43A 2VGYA 1NA0A 2AXZA 2NXPA 3FUMA 3LY9A 3U66A 3G2WA 5G05J 4AP2A 4A1GA 4JVSA 4AIFA 3CLJA 3CVPA 2Y4UA 3MCXA 3PH0C 4RG9A 3R7QA 3FUIA 2E2EA 4N3AA 3FH5A 4J6IA 2X6JA 5FQ8A 2BF0X 4AOFA 2LAHA 5BT1A 2KZTA 1OWOA 4JXTA 4GMJA 3I3NA 1QZ2A 5EKQD 3U9WA 3CVNA 4OVVA 2WQ6A 2BTDA 3LCAA 3LKUA 2YHEA 4WAFA 3KD7A 2XCCA 3CVWA 3GZ1A 4KZ0A 1NZNA 4N2SA 3NZSA 1EYHA 1H2TC 3ASHA 4ILHB 3VLEA 1GW6A 3ZW3A 2Y4TA 3LVRE 2WMNA 4AJWA 4A3VA 3D9LA 2R59A 3EIJA 3K9IA 2XEVA 5BW8C 3FULA 2IJGX 2NC9A 5JJTA 2C0LA 3ZFWA 2WXIA 2J09A 4BTAA 4F53A 2GRMA 5AIJA 4O6FA 2I9CA 4APOA 4FC8A 4WWOA 4ANUA 4PS3A 3D9PA 2XPIA 1UN9A 4BT8A 4ILGA 4N5CA 5FWQA 5T3RA 3TAXA 1PY1A 4UWHA 3B7RL 2ILRA 2J9QA 2WMOA 4IYPA 4AV7A 4GPKA 3FU0A 3T5VA 5DIZA 4L7TA 4I2ZA 1HXIA 5FQ4A 3SFZA 2YQ8A 2AXVA 3TGOA 1UJKA 4HS2A 3VTXA 4HVBA 1Z3XA 2OOEA 3I4GA 4GB9A 2CHWA 2IONA 3FUEA 4L2YA 5JJ6A 4HOSA 2C2LA 4K0RA 3L17A 2DIWA 3PVLA 4I17A 5A23A 3D9JA 3JYSA 4A3TA 3CVQA 4MS6A 3QOUA 3D9NA 1EF1C 1KT0A 1U3DA 2WXMA 3G2UA 5LCWJ 4GMLA 4G24A 3SI5A 3UMVA 2FI7A 3LY7A 3ZYLA 2WXKA 4A55A 2OVFA 4LRZA 4XE0A 1W3BA 3PS6A 4URKA 3ZEFA 3Q47B 3SD5A 1HF8A 2IOLA 3OAWA 1E8YA 4I1AA 5BV0A 4I9CA 5JJ7A 3EDTB 3EIQC 1E90A 2WXFA 4B89A 4G23A 4XIFA 3UX4A 4A1SA 3FFLA 4I9EA 2KM4A 4CEMA 4FJYA 2VSOE 1WM5A 4J8EA 4UI9C 3S7DA 4R7LA 4CT4A 4UI9K 5JHBA 3CVVA 2L0IA 2XGMA 2XGOA 3MGBA 4V3IA 4WUYA 3MYVA 2WPVA 3L22A 3DPDA 4FP7A 4JZYA 3APCA 5AJLA 3O48A 3LPZA 5EX3A 4KVOA 4EECA 1WY6A 2X6HA 5G05C 2WB2A 2WXQA 4D10C 3SHFA 3SF4A 3D9KA 5KJLA 3UQ3A 5KCMA 4PUCA 3KAEA 3TG4A 2PQNA 3ENEA 2PQRA 4B8CB 4KBQA 3U3WA 1HG2A 2Q7FA 3MKQA 4YVOA 3VLFA 3CHQA 3QJZA 1OWLA 4I1OB 5AJDA 2KCLA 4NACA 1SZ9A 3B7TA 5J08A 5FT9A 4EZKA 1BPOA 3QDNA 4PS8A 2UWJG 3HDXA 4F1SA 4AM9A 3IHYA 4C0EA 3RO3A 4EBAG 2CHXA 1LF8A 2LNIA 1ELRA 3ZIMA 3NF1A 4B94A 3QB2A 3CHSA 1EDUA 3CQCB 5D0QD 5G55A 2LAIA 4L23A 4U07A 1H19A 3FU6A 5DBKA 5ARGA 2AVPA 5LOZA 1DVPA 2IFUA 4F7AA 4JA7A 3C98A 4JEUA 2WQHA 4JC8A 3KS2A 4H7YA 3URZA 3AU4A 5T4YA 3CSTA 3ASDA 4WNGA 4GYWA 2WXPA 1H2UA 4KZCA 4BWRA 2EQXA 2WM9A 4AY6A 3APFA 4WNFA 5FZSA 4E6HA 2HYZA 3OXFA 5C2YA 3N71A 3LJ3A 1QNFA 1E7VA 4APFA 3G2VA 1WAO1 2MHKA 3FUKA 3FTXA 3ZVVA 1HG5A 4F3VA 3QK0A 4JPSA 4XI0A 4WWPA 2X3MA 3ZRHA 3RO2A 4ANWA 2HO1A 4HOTA 3FEXA 2GRLA 4N39A 4EZJA 1XGWA 3CK7A 3ONLA 3MA5A 5BUZA 3G2SA 4NURA 3FU5A 3RU0A 5CMWA 4TRQA 1XNFA 4FU3A 1HS6A 2MRIA 4U0SA 3SBTB 2IOSA 3CR3A 3IHVA 5D0OD 5HQ8A 3FDHA 3FU3A 4BSXA 3GZ2A 2WXJA 3CVYA 1JWGA 2J4DA 3ULQA 3B7SA 3QARA 4FULA 2OVBA 2XGSA 3UPVA 1FVHA 1HU3A 2FO7A 2X38A 4ME2A 4MLPA 1SZAA 4BX8A 2J49A 2WXRA 1JPLA 4DJAA 1DNPA 4FLHA 3S7BA 4UI9J 3R9AB 4HOQA 4KVMA 3U4TA 4GZ3A 4CGWA 2FULA 3MJWA 1N54A 1PAQA 2J07A 3FTUA 2J4BA 4OVUA 1HH8A 1H2VC 2E0IA 3KEZA 5ENNA 3GW4A 1TJFA 2CG2A 4FHKA 4Q96A 1U3CA 3PZDA 4TUUA 3RRUA 5LCWC 1E7UA 3IV0A 3QWWA 2A5UA 1KT1A 5E76A 3QC1A 4DPRA 2J08A 2WVIA 3AU5A 4YNDA 4PH4B 3RJVA 2VGXA 3JCKC 5FZQA 3SGHA 4GA2A 1Y8MA 2KCVA 3LS8A 3FH8A 3LYAA 4DI3A 5CHEE 3FP3A 3ZYQA 4ATGA 4RVBA 1VDYA 3I4RB 4HFGA 3FH7A 1ELKA 4BT9A 5BV1A 4WNEA 1N52A 3FTSA 4I6GA 2KCKA 4PS7A 4BX9A 2VYIA 4ACLA 3SZ7A 4C9BB 3T5XA 4HXIA 1H0AA 3D9OA 3ZHEA 5KJNA 4UWKA 3RKVA 3QWPA 1X5BA 3TG5A 2CHZA 4P29A 5HI7A 2VSXE 1IYGA 4BTBA 2QY7A 3VTYA 3L6AA 4DLQA 1IQRA 4Y6WA 3CVUA 2HR2A 2XPZA 3FUJA 3I5PA 3MEKA 5FQ6A 5A7DB 3PUKA 2C0MA 1HX8A 4LUNU 4GA0A 2I1JA 4G11A 4U0UA 4TV3A 3RIBA 3ZN3A 4BFRA 2R5SA 3CQGB 3Q15A 4FLBA 3UUXA 2VSNA 3NZUA 2GW1A 3CHRA 1Y6IA 2KC7A 2ONDA 4UQYA 4W9RA 3QKYA 4CGVA 4CT0A 4KXKB 5LX8A 1OWNA 3ZHEB 3AS5A 2L0TB 4N3CA 3RK6A 5LFAA 2L9BA 2VTBA 4G25A 4G26A 2IQCA 4FADA 3ESLA 3PRZA 3D9MA 5FJYA 1SQMA 3FUHA 3UT8A 3PEVB 4FJZA 4RSYA 3ZXSA 1HO8A 4BY6A 3CK9A 1TEZA 4ILIA 1MHQA 3CKBA 4H7XA 4LEUA 5T8IA 4E85A 2VSYA 2XQ0A 2CFUA 4N2QA 2XPYA 2RG8A 2LSUA 3BEEA 3BG0B 3MKRA 5AYWD 4QFVA 5A6CA 4KT6B 2XRYA 3TL5A 4B0ZA 3L13A 4B8AA 4JEHA 4EBAA 4AVXA 2Y3AA 1PC2A 2AW6A 4CDRA 4ANXA 4GYOA 4JHKA 4XKCA 2LO6A 1FVFA 2I1KA 3G2TA 5M72A 4Q94A 2HM8A 1E8ZA 4JL0A 1IHGA 3ML8A 2FBNA 4IN3B 3NQPA 2WXLA 4I6EA 5BPPA 4JW1A 5E75A 4XX5A 2JLBA 3Q5MA 3OXGA 4WWNA 2WXOA 4U63A 4I2WA 4G2VA 1ELWA 4GA1A 4J8SA 3TXNA 4I1MA 1FCHA 2DCPA 1JUQA 4GCNA 3P2BA 2I2OA 4LCTA 2AWIA 2L6JA 2YINA 3EHNA 4GCOA 5LP0A 3CK8A 3CEQA 3PE3A 3EJNA 2V8SE 1HZ4A 4KMOA 1OWMA 4UWGA 2AXUA 1NA3A 4G1TA 3ML9A 3P1UA 2WXGA 2BUGA 2A4ZA 3PUJA 4J8FA 2YNQA 2V5FA 2DBAA 2X6IA 3PNTB 4GZ6A 5KJKA 4UQXA 3CSFA 3CVXA 2NSZA 3ZPJA 3FTZA 1JWFA 2PM6A 3PNLB 3CHOA 2PL2A 4XKBA 1H6KA 5FTPA 5ARFA 2VJ8A 3BG1B 1Z6TA 3JQ0A 3LEWA 5G04J 4EQFA 3L54A 5ANRA 3OXLA 3QAQA 3S7JA 4L2LA 3T8MA 1IQUA 3PREA 3D9IA 5G04C 4DK5A 1L5JA 3PEUB 3IKOB 3L16A 3CHMA 2FF4A 3B7UX 4KYOB 5ANLA 2VQ2A 4HORA 1KLXA 3LVQE 1ZU2A 3B13A 1ZBPA 4U0ZA 3FUNA 2FEZA 4GZCA 4AXHA 2MOWA 4WNDA 4AY5A 2VTBB 1INZA 4I6JA 4C0MA 4EPZA 2R17C 3E4BA 2X6FA 3HHMA 3AS4A 2X6KA 4JHJA 4OYSA 4DLOA 3LY8A 2I6HA 3ASGA 2P58C 3FHEA 2IU1A 3FTYA 3VLDA 1HE8A 1S0PA 3JUIA 4U04A 5AENA 2RD0A 2YHCA 4L1BA 3ZYMA 2UY1A 2KZTB 4HOUA 2CFZA 3UT4A 4Q69A 3Q4AB 3IBEA 4RG6A 4GYYA 5FZRA 4YVQC 3FTVA 5EDSA 4CDMA 2JEKA 2IF4A 3ESKA 1TJCA 5CCMA 3CVLA 4J8DA 5KJMA 4JHRA 1QQEA 3TJPA 4GU5A 5CCLA 3CV0A 4CDNA 2XHEA 3HYMB 3O4ZA 1E8WA 3FUDA 3FY4A 4IULA 4UQZA 2ZU6B 2M63A 3ONKA 3AS8A 2XCBA 1UG3A 1EPUA 2LSVA 2GGFA 4XZ4A 3ZYKA 1Z3YA 4LERA 2V0PA 4CCAA 2WXHA 4U8HA 2PM7A 4GAAA 4CRWA 2CG3A 3Q49B 3RRMB 1OUVA 3DBSA 3MV3B 4MRUA 5BNWA 1P5QA 3FWVA 3HVEB 1B89A 4ANVA 3PDNA 4FA6A 5J90A 3APDA 2OV8A 1OWPA 3MKQB 1MQSA 2XRZA 3JQ1A 4ABNA 3GZSA 3LDZA 4PDXA 3CKCA 3QNKA 4FHJA 4GZDA 5FQ7A 5JHAA 3U64A 3FTWA 3HIZA 3TXMA 3EHMA 3CHPA 3ZGQA 3UT7A 4Y6CA 4IRUA 3WXXA 4M3OA 3HVEA 3FUFA 1UW4B 1E8XA 3LXUX 4K03A 2WQ7A 1NP7A 1HFAA 1YA0A 3OTNA 4ACKA 4JA9A 5CMYA 3D3MA 3S7FA 4DI4A 4NQ0A 2PZIA 1A17A 3GYZA 3MV2B 1UJJA 2WXNA 3IEGA 3ASFA 3PE4A 5G2NA 5EX0A 3SBSA 4AEZC 4HLEA 3L08A 1UN8A 2KATA 4MKTA 4NRHB 4XI9A 1E96B 3S2AA 3MX3A 2VGXB 2QFCA 2UY1B 3CIAA 3SNXA 5C1DA 3RRNB 3MZLB 4N3BA 4UWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPZ A;  4J0U A;  5EX3 A;  1KT1 A;  4GZ5 A;  5G05 C;  2BUG A;  3QWV A;  4J8F A;  3SF4 A;  4YND A;  3RJV A;  2V5F A;  2DBA A;  1NA0 A;  2VGX A;  2VGY A;  3LY9 A;  4GZ6 A;  5FZQ A;  5G05 J;  4UQX A;  4GA2 A;  5KJL A;  1Y8M A;  2KCV A;  3UQ3 A;  5JJT A;  3ZPJ A;  5KJK A;  3LYA A;  5CHE E;  4AIF A;  3CVP A;  3KAE A;  3FP3 A;  2Y4U A;  4RG9 A;  2PL2 A;  2PQN A;  3TG4 A;  5FTP A;  2E2E A;  5ARF A;  4N3A A;  2PQR A;  5G04 J;  4KBQ A;  4EQF A;  3U3W A;  3OXL A;  2Q7F A;  4YVO A;  3S7J A;  5BT1 A;  5G04 C;  4BT9 A;  4HOR A;  4WNE A;  2FF4 A;  4KYO B;  1QZ2 A;  5EKQ D;  2VQ2 A;  3CVN A;  1KLX A;  2KCK A;  1ZU2 A;  1ZBP A;  2KCL A;  4U0Z A;  2VYI A;  3LCA A;  3LKU A;  2FEZ A;  3SZ7 A;  5FT9 A;  3KD7 A;  3QDN A;  2XCC A;  2UWJ G;  4WND A;  4AY5 A;  3GZ1 A;  4AM9 A;  1NZN A;  3RO3 A;  4N2S A;  2LNI A;  3E4B A;  3ZHE A;  5KJN A;  3AS4 A;  1ELR A;  3ASH A;  3NF1 A;  3QWP A;  3RKV A;  3TG5 A;  4B94 A;  3LY8 A;  5D0Q D;  1IYG A;  5HI7 A;  2Y4T A;  2I6H A;  3ASG A;  2P58 C;  3VTY A;  4BTB A;  4U07 A;  4U04 A;  4Y6W A;  5DBK A;  5ARG A;  3K9I A;  2AVP A;  2HR2 A;  5A7D B;  2XEV A;  5BW8 C;  2YHC A;  3MEK A;  2UY1 A;  2IFU A;  2C0M A;  4JA7 A;  4HOU A;  2NC9 A;  4GA0 A;  4U0U A;  3RIB A;  2C0L A;  2WQH A;  3Q4A B;  3KS2 A;  4H7Y A;  2R5S A;  4GYY A;  4RG6 A;  4YVQ C;  3Q15 A;  5FZR A;  3ASD A;  4O6F A;  4GYW A;  4WNG A;  3UUX A;  4APO A;  2VSN A;  2IF4 A;  3ESK A;  2GW1 A;  4BWR A;  1TJC A;  5CCM A;  3CVL A;  4J8D A;  2KC7 A;  4WNF A;  5KJM A;  5FZS A;  2XPI A;  1QQE A;  2HYZ A;  4JHR A;  2OND A;  4UQY A;  4W9R A;  3CV0 A;  4BT8 A;  4N5C A;  3OXF A;  3QKY A;  5CCL A;  3HYM B;  3N71 A;  4CGV A;  4KXK B;  1WAO 1;  2MHK A;  3TAX A;  3AS5 A;  3ZHE B;  4UQZ A;  2J9Q A;  3AS8 A;  2XCB A;  2LSV A;  4N3C A;  4F3V A;  4XI0 A;  4GPK A;  4G25 A;  4G26 A;  3RO2 A;  5DIZ A;  2HO1 A;  4I2Z A;  1HXI A;  3URZ A;  4HOT A;  2YQ8 A;  3Q49 B;  4N39 A;  1OUV A;  3TGO A;  5FJY A;  3CK7 A;  3MV3 B;  5BNW A;  3VTX A;  1P5Q A;  3FWV A;  3MA5 A;  1B89 A;  3PDN A;  3RU0 A;  2OOE A;  3ZN3 A;  1XNF A;  3CK9 A;  5JJ6 A;  3CKB A;  4HOS A;  2C2L A;  4U0S A;  4ABN A;  4H7X A;  4LEU A;  5D0O D;  5HQ8 A;  2VSY A;  3CKC A;  4N2Q A;  3GZ2 A;  4I17 A;  3MKR A;  2LSU A;  3BEE A;  3JYS A;  5AYW D;  3ULQ A;  3CVQ A;  5A6C A;  2XGS A;  3QOU A;  3UPV A;  1KT0 A;  5LCW J;  2FO7 A;  4ME2 A;  4G24 A;  3ZGQ A;  2FI7 A;  3LY7 A;  1PC2 A;  4Y6C A;  3WXX A;  4CDR A;  4GYO A;  1W3B A;  3Q47 B;  3S7B A;  5M72 A;  4AY6 A;  4UI9 J;  4BTA A;  3R9A B;  4HOQ A;  1IHG A;  1YA0 A;  4I1A A;  4JL0 A;  2FBN A;  4I9C A;  3EDT B;  4GZ3 A;  4IN3 B;  3U4T A;  4CGW A;  5JJ7 A;  4JA9 A;  3S7F A;  4NQ0 A;  4G23 A;  2JLB A;  2PZI A;  1A17 A;  3GYZ A;  3MV2 B;  3OXG A;  3Q5M A;  4XIF A;  4A1S A;  3IEG A;  3ASF A;  3FFL A;  4G2V A;  1ELW A;  3PE4 A;  4I9E A;  4I2W A;  1HH8 A;  4GA1 A;  5EX0 A;  3ZFW A;  3GW4 A;  1FCH A;  4J8E A;  1WM5 A;  2KAT A;  4GCN A;  4NRH B;  4UI9 C;  3S7D A;  4XI9 A;  2L6J A;  1E96 B;  4UI9 K;  4GCO A;  2XGM A;  2XGO A;  3CEQ A;  3CK8 A;  3PE3 A;  1HZ4 A;  2VGX B;  2QFC A;  2UY1 B;  4WUY A;  2WPV A;  5C1D A;  1NA3 A;  5LCW C;  4G1T A;  4N3B A;  3QWW A;  3O48 A; 
#chains in the Genus database with same CATH topology
 4J0U A;  4GZ5 A;  4YDO A;  3QWV A;  2VGY A;  1NA0 A;  5G05 J;  2ZXW E;  3CLJ A;  2Y4U A;  3PH0 C;  4RG9 A;  3R7Q A;  2F8X K;  3FUI A;  2E2E A;  3J5P A;  4C48 B;  4AOF A;  4A63 B;  4LSZ E;  4OVV A;  2BTD A;  3Q78 A;  3CVW A;  4KZ0 A;  3V31 A;  4ILH B;  1GW6 A;  2BKK B;  4DRX E;  2C0L A;  5AIJ A;  4O6F A;  1N4P A;  4WWO A;  1TNZ A;  2XPI A;  3DST A;  5ITZ F;  3B7R L;  2ILR A;  2WMO A;  4BEP A;  1MJ0 A;  1HXI A;  4I2Z A;  5FQ4 A;  3SFZ A;  4TUM A;  2H6I A;  1TNU A;  4HS2 A;  1ZB1 A;  2OOE A;  5KBA A;  2DIW A;  2IY0 C;  5A23 A;  5HS0 A;  2IO3 C;  4A3T A;  2EIK E;  1N4R A;  3QOU A;  1KT0 A;  3G2U A;  4G24 A;  3LY7 A;  2WXK A;  2IOL A;  3EIQ C;  1E90 A;  2WXF A;  4B89 A;  4G23 A;  3BQO A;  3UX4 A;  1QYM A;  2Y0B G;  4UI9 C;  4CT4 A;  5JHB A;  3CVV A;  2XGM A;  4HQD A;  3APC A;  2DZO A;  3O48 A;  5EX3 A;  2X6H A;  2WXQ A;  2BKG A;  3AJI A;  4PUC A;  4KBQ A;  3U3W A;  3MKQ A;  4YVO A;  4I1O B;  4NAC A;  3B7T A;  5AAR A;  5J08 A;  4PS8 A;  4HRN A;  2UWJ G;  4HRM B;  3BU8 A;  3DSW A;  1D9S A;  1ELR A;  3NF1 A;  3CHS A;  3FU6 A;  5ARG A;  5LOZ A;  2ZGG A;  1DVP A;  4F7A A;  4JA7 A;  3TWU A;  3C98 A;  2WQH A;  4G8K A;  3URZ A;  5T4Y A;  3ASD A;  3E30 A;  4KZC A;  2WM9 A;  4AY6 A;  1TN7 A;  2HYZ A;  1S64 A;  5HRY A;  3LJ3 A;  4APF A;  3QK0 A;  3ZRH A;  3RO2 A;  2Y69 E;  4N39 A;  3ONL A;  5BUZ A;  3RU0 A;  5CMW A;  4TRQ A;  4FU3 A;  1HS6 A;  2B0O E;  1FT2 A;  2IOS A;  3CR3 A;  2WXJ A;  3CVY A;  3ULQ A;  3B7S A;  4ME2 A;  4MLP A;  3UM2 A;  4FLH A;  1H6P A;  3ZUV B;  3U4T A;  1PAQ A;  2J07 A;  4F1P A;  4OVU A;  2E0I A;  5ENN A;  3V30 A;  1TJF A;  1U3C A;  1NI1 A;  5H7P A;  2R2L A;  2QC9 A;  1E7U A;  3AU5 A;  3BUA A;  3JCK C;  4OAU C;  4GA2 A;  1Y8M A;  4UUC A;  4DI3 A;  2KBX A;  4HB5 A;  4RVB A;  1BD8 A;  1N52 A;  3FTS A;  2KCK A;  2VYI A;  3T5X A;  4HI9 A;  3D9O A;  5KJN A;  4UWK A;  3RKV A;  3TG5 A;  2RKK A;  4BTB A;  2QY7 A;  5EYP F;  1IQR A;  3B7B A;  3W9G A;  3E34 A;  3CQG B;  2KXP C;  3CHR A;  5ENR D;  4UQY A;  4KXK B;  1OWN A;  2GRO B;  2L0T B;  1KZO A;  4N3C A;  3B95 A;  3RK6 A;  2VTB A;  4G26 A;  3ESL A;  2ZIR A;  3D9M A;  5FJY A;  1HO8 A;  4BY6 A;  4ILI A;  4E85 A;  5T8I A;  2VSY A;  2CFU A;  4U8Y D;  1SVX A;  2XZT G;  3MKR A;  4MBG A;  5AQ7 A;  3Q73 A;  4B0Z A;  1MZC A;  4JEH A;  2GRP B;  5M72 A;  2I1K A;  4Q94 A;  4JL0 A;  4IN3 B;  3NQP A;  4GTS A;  3EHR A;  4XX5 A;  2JLB A;  4NIK A;  4WWN A;  4I2W A;  1JCS A;  4I1M A;  2XEE A;  4LCT A;  3UTM A;  3CEQ A;  3CK8 A;  3PE3 A;  1HZ4 A;  3ZXP A;  1BLX B;  1NA3 A;  3TWW A;  3P1U A;  2BUG A;  4LG6 A;  4J8F A;  2DBA A;  2X6I A;  1RZ4 A;  2EIL E;  1S70 B;  2PM6 A;  4GPM A;  3CHO A;  4XKB A;  2P9N G;  1BU9 A;  5ARF A;  5G04 J;  3AG1 E;  3HXB A;  3OXL A;  1MYO A;  4ATZ D;  4X8Q A;  5ANL A;  3LVQ E;  1ZU2 A;  4U0Z A;  1DCQ A;  3PZ3 A;  4GTP A;  4GZC A;  2VTB B;  1INZ A;  4I6J A;  3AG3 E;  4JHJ A;  3AS4 A;  4OYS A;  2GRQ B;  4U04 A;  2UY1 A;  3EUV A;  4Q69 A;  4GYY A;  1KPS B;  5EDS A;  3AG2 E;  1TJC A;  5KJM A;  3KSL A;  3O4Z A;  2ZU6 B;  2M63 A;  3AS8 A;  1UG3 A;  2GGF A;  4CCA A;  3ZYK A;  3HG0 D;  4U8H A;  2CG3 A;  1OUV A;  3DBS A;  5BXU A;  1P5Q A;  3FWV A;  3HVE B;  3UIN C;  3KSQ A;  4FA6 A;  2OV8 A;  1OWP A;  3ZU7 B;  3JQ1 A;  4ABN A;  3GZS A;  4PDX A;  4RLY A;  3EHM A;  3CHP A;  1LD7 A;  4Y6C A;  4IRU A;  3FUF A;  1A5E A;  1HFA A;  3OTN A;  3S7F A;  4DI4 A;  2LUH A;  1UJJ A;  3ULY A;  3PE4 A;  3EU5 A;  5EX0 A;  5EIB E;  4HLE A;  1OXJ A;  1UN8 A;  4NRH B;  1E96 B;  3S2A A;  2QFC A;  2NYJ A;  2V4L A;  4K5A B;  2NXP A;  3FUM A;  4AIF A;  3JXI A;  2R05 A;  3MCX A;  4J6I A;  5FQ8 A;  3TWR A;  4JXT A;  3E33 A;  4GMJ A;  1QZ2 A;  3U9W A;  3LCA A;  1AWC B;  2YHE A;  4WAF A;  1NZN A;  4N2S A;  3NZS A;  3IXE A;  5JMN D;  3ZW3 A;  4A3V A;  3FUL A;  2NC9 A;  5JJT A;  4ANU A;  5AQA A;  3JXJ A;  3C72 A;  1JCR A;  5FWQ A;  1PY1 A;  2J9Q A;  4IYP A;  3FU0 A;  5EYL A;  5DIZ A;  2YQ8 A;  1N94 A;  4HVB A;  3WG7 E;  2V5Q C;  1Z3X A;  2CHW A;  2ION A;  5JJ6 A;  1IKN D;  2C2L A;  1WDY A;  3L17 A;  3NAW A;  1NFI E;  3D9J A;  3CVQ A;  4MS6 A;  4K5C A;  1EF1 C;  5LCW J;  3HXD A;  1W3B A;  1N11 A;  1KZP A;  2FO1 E;  3OAW A;  1TNY A;  4GTV A;  1E8Y A;  4I1A A;  4I9C A;  5JJ7 A;  5D66 A;  4A1S A;  2Y1L E;  2KM4 A;  1QBQ A;  4CEM A;  3S7D A;  2L0I A;  3MGB A;  1YMP A;  4FP7 A;  4JZY A;  5AJL A;  3LPZ A;  3HXF A;  3SHF A;  3SF4 A;  3NOG D;  5CRV A;  5KCM A;  3AAA C;  3C5R A;  2PQR A;  4B8C B;  1HG2 A;  3DEP A;  3CHQ A;  3SFX A;  5AJD A;  4JB8 P;  4CYM D;  4EZK A;  1BPO A;  3QDN A;  4F1S A;  1LF8 A;  1SA4 A;  4U07 A;  5DBK A;  3UKR G;  3KS2 A;  3AU4 A;  4GYW A;  4BWR A;  3APF A;  5FZS A;  3N71 A;  3G2V A;  2R02 A;  2F0Y A;  1HG5 A;  4F3V A;  4WWP A;  4JPS A;  4HOT A;  2GRL A;  2XS8 A;  1XNF A;  2MRI A;  3SBT B;  5HQ8 A;  5D0O D;  4BSX A;  1MX2 A;  2J4D A;  2OVB A;  2XGS A;  1FVH A;  2DYR E;  2X38 A;  3SFY A;  2WXR A;  3X2Q E;  4O1O A;  4DJA A;  4HOQ A;  4KVM A;  2DVW A;  3MJW A;  1N54 A;  4LNU D;  1OCO E;  2CG2 A;  4Q96 A;  4TXR A;  5CBN A;  3UIP C;  4TUU A;  3IV0 A;  4PH4 B;  2VGX A;  3SGH A;  2P2C P;  3LS8 A;  3FP3 A;  3I4R B;  4BER A;  3FH7 A;  1IXV A;  4I6G A;  4PS7 A;  4RQI A;  3UM0 A;  3QWP A;  1IYG A;  5HI7 A;  3VTY A;  4DLQ A;  3D9H A;  3CVU A;  2HR2 A;  2XPZ A;  3FUJ A;  4LUN U;  3ZN3 A;  4FLB A;  3QKY A;  4CGV A;  3AS5 A;  3ZKJ A;  2IQC A;  3PEV B;  4RSY A;  4GTT A;  2F37 A;  3CK9 A;  2J8S D;  3CKB A;  4H7X A;  2XQ0 A;  4N2Q A;  2R03 A;  2XPY A;  3TL5 A;  3L13 A;  4B8A A;  4EBA A;  1PC2 A;  4CDR A;  4ANX A;  4JHK A;  1MX4 A;  2LO6 A;  1FVF A;  1X81 A;  2FBN A;  4I6E A;  4BSZ B;  2RFM A;  2WXO A;  4U63 A;  1ELW A;  4GA1 A;  4J8S A;  4GCN A;  3EHN A;  3L82 A;  4GCO A;  4KMO A;  1OWM A;  3ML9 A;  3EHQ A;  3DRA A;  4DX2 A;  3E32 A;  3PUJ A;  2YNQ A;  4GZ6 A;  4UQX A;  5CER B;  3CVX A;  2NSZ A;  3FTZ A;  3DSS A;  1IQU A;  3PRE A;  1L5J A;  3CHM A;  3J5Q B;  4KYO B;  1KLX A;  3B13 A;  3UXG A;  5CRU A;  3R9M A;  4WND A;  4AY5 A;  4K5B A;  4DLO A;  1Z5S C;  3LY8 A;  2I6H A;  3ASG A;  2P58 C;  3FHE A;  2IU1 A;  3UKU G;  1HE8 A;  3ZYM A;  4L1B A;  2KZT B;  4HOU A;  3Q4A B;  3FTV A;  4CDM A;  2IF4 A;  3ESK A;  3CVL A;  4JHR A;  4GU5 A;  1SA5 A;  4J8Y A;  1E8W A;  3FUD A;  3ONK A;  1Z3Y A;  2WXH A;  2PM7 A;  4GAA A;  3RRM B;  3MV3 B;  4MRU A;  1DC2 A;  3TWS A;  4ANV A;  3MKQ B;  1OCZ E;  5JHA A;  3U64 A;  2ZGD A;  4DX7 D;  3ZGQ A;  3WXX A;  1OCC E;  3ASN E;  1E8X A;  4JD2 G;  1YA0 A;  1OT8 A;  4ACK A;  3D3M A;  4LNG A;  1A17 A;  3MV2 B;  2WXN A;  3ASF A;  5G2N A;  3L08 A;  1OCR E;  2RFA A;  3SNX A;  5D2M C;  4N3B A;  4UWL A;  1N9A A;  5CEA A;  4UWF A;  4EZL A;  2AXZ A;  3U66 A;  3G2W A;  1TYQ G;  4AP2 A;  2P9I G;  3CVP A;  3FH5 A;  2X6J A;  2LAH A;  1RW2 A;  2KZT A;  1OWO A;  3I3N A;  5EKQ D;  2WQ6 A;  4LNB A;  3ZNG A;  3KD7 A;  3GZ1 A;  3ASH A;  3VLE A;  1OY3 D;  2Y4T A;  4AJW A;  3D9L A;  2R59 A;  3EIJ A;  2XEV A;  2XZD G;  5BW8 C;  2ZIS A;  1FPP A;  2WXI A;  2J09 A;  4BTA A;  2GRM A;  4FC8 A;  4PS3 A;  4U96 D;  4BT8 A;  4ILG A;  4HBD A;  1H6O A;  3TAX A;  4AV7 A;  3T5V A;  4L7T A;  4U8V D;  1UJK A;  3VTX A;  3I4G A;  4HOS A;  4K0R A;  3PVL A;  4I17 A;  3D9N A;  4J7W A;  3SI5 A;  2OVF A;  4XE0 A;  5AQ9 A;  3PS6 A;  4URK A;  3Q47 B;  1HF8 A;  5BV0 A;  3EDT B;  3PZ1 A;  4DX1 A;  3FFL A;  4I9E A;  4YDW A;  4FJY A;  2VSO E;  4J8E A;  4HRL A;  4R7L A;  2BED A;  2XGO A;  3DXK G;  4WUY A;  3MYV A;  2WPV A;  3L22 A;  3DPD A;  2L6B A;  2OCC E;  2MYO A;  2IO2 C;  2DYS E;  5G05 C;  2WB2 A;  3D9K A;  1G3N B;  1NL4 A;  5KJL A;  2QYJ A;  4CZ2 D;  3KAE A;  5KNG A;  4TXP A;  3TG4 A;  2PQN A;  3VLF A;  4GTR A;  3C3R A;  1OWL A;  5FIN A;  3HXC A;  2KCL A;  1SZ9 A;  3HDX A;  3IHY A;  3UIO C;  4EBA G;  2CHX A;  2LNI A;  4B94 A;  4O60 A;  2LAI A;  3Q7F A;  4JEU A;  4JC8 A;  4H7Y A;  3CST A;  4WNG A;  2WXP A;  2EQX A;  3OXF A;  5C2Y A;  1WAO 1;  2MHK A;  3FUK A;  3FTX A;  5EID A;  3ZVV A;  4XI0 A;  2HO1 A;  1XGW A;  2LXL A;  3MA5 A;  3G2S A;  4NUR A;  3IHV A;  3FDH A;  3GZ2 A;  1JWG A;  3UPV A;  4U95 D;  1SZA A;  4BX8 A;  2F8Y A;  1JPL A;  2V4H C;  3S7B A;  3R9A B;  5FIO A;  4GZ3 A;  5B3S E;  2EIJ E;  1H2V C;  3GW4 A;  1Q2Z A;  3ISM C;  5ENT D;  1UOH A;  5LCW C;  3C3Q A;  5E76 A;  2J08 A;  2WVI A;  4YND A;  3RJV A;  2KCV A;  3FH8 A;  1V54 E;  1AP7 A;  1VDY A;  4HFG A;  3TWV A;  4BT9 A;  5BV1 A;  4BX9 A;  3SZ7 A;  4C9B B;  3UM3 A;  4HXI A;  1N4Q A;  1H0A A;  4N5Q A;  3ZHE A;  1X5B A;  2VSX E;  3L6A A;  1TNB A;  5B1A E;  4YDE A;  5A7D B;  1N95 A;  3I5P A;  3MEK A;  5FQ6 A;  4TV3 A;  4G11 A;  4U0U A;  4O1P A;  2R5S A;  3UUX A;  3ABM E;  2VSN A;  3NZU A;  1Y6I A;  2KC7 A;  2OND A;  4W9R A;  5LX8 A;  2L9B A;  4G25 A;  3PRZ A;  1N0Q A;  1TEZ A;  1SW6 A;  4F6R D;  4BES A;  4GMR A;  2LSU A;  3BEE A;  3BG0 B;  5A6C A;  5ENQ D;  2QYU A;  2XRY A;  3SY2 A;  4AVX A;  2XS1 A;  2AW6 A;  4XKC A;  1E8Z A;  4DX6 D;  3ML8 A;  5BPP A;  4JW1 A;  1O1R A;  3Q5M A;  1MX6 A;  4G2V A;  3TXN A;  2DCP A;  1FCH A;  1JUQ A;  3P2B A;  2I2O A;  2AWI A;  2YIN A;  1K1A A;  3EJN A;  3DPY A;  3NOC D;  5AAO A;  2A4Z A;  2P9K G;  2V5F A;  3TWT A;  2B6C A;  2GRR B;  3ABK E;  2PL2 A;  1H6K A;  4BET A;  4EQF A;  2VJ8 A;  1Z6T A;  3JQ0 A;  3LEW A;  4OAV B;  3QAQ A;  2HE0 A;  3D9I A;  4DK5 A;  3PEU B;  4HOR A;  3L16 A;  1ZBP A;  2FEZ A;  4EPZ A;  2R17 C;  3HHM A;  2X6K A;  4ZHB A;  3FTY A;  1S0P A;  3JUI A;  3TWQ A;  4EHM A;  5KNH D;  4HI8 A;  3V79 K;  3IBE A;  5FZR A;  4YVQ C;  2JEK A;  3TJP A;  1QQE A;  5CCL A;  3CV0 A;  2XHE A;  4XEI G;  3HYM B;  4IUL A;  4UQZ A;  4XZ4 A;  1K8K G;  2XCB A;  2V0P A;  3RSE G;  3Q49 B;  2DZN A;  3PDN A;  5J90 A;  3APD A;  3NBN B;  1MQS A;  3CKC A;  4GZD A;  3FTW A;  3HIZ A;  3UT7 A;  4M3O A;  1UW4 B;  3LXU X;  4K03 A;  2P9S G;  2WQ7 A;  1NP7 A;  4NQ0 A;  2PZI A;  3GYZ A;  3IEG A;  4AEZ C;  2KAT A;  4TXQ A;  4MKT A;  4XI9 A;  3MX3 A;  2VGX B;  3CIA A;  3RRN B;  3MZL B;  1N0R A;  3CGH A;  5ENS D;  3R7R A;  3FEY A;  4I43 A;  3LY9 A;  3NB2 A;  4A1G A;  4JVS A;  4N3A A;  2BF0 X;  5BT1 A;  3T9K A;  3CVN A;  3LKU A;  2XCC A;  4M7C A;  1TNO A;  3L9T A;  1WG0 A;  3DSU A;  1D8E A;  1EYH A;  1H2T C;  5ENO D;  3LVR E;  1DCE A;  3DEO A;  2WMN A;  3HXE A;  3K9I A;  4QQI A;  3DSX A;  2IJG X;  3ZFW A;  5CEC B;  4F53 A;  2I9C A;  4APO A;  3D9P A;  1UN9 A;  1D8D A;  4N5C A;  5T3R A;  4UWH A;  4GPK A;  1TN6 A;  2AXV A;  3TGO A;  3HRA A;  4GB9 A;  3FUE A;  4L2Y A;  3JYS A;  4GTO A;  1U3D A;  2WXM A;  1K1B A;  4GML A;  3UMV A;  3ZYL A;  4GTM A;  2FI7 A;  4A55 A;  4LRZ A;  3ZEF A;  3SD5 A;  4XIF A;  1WM5 A;  1FT1 A;  4UI9 K;  1YYH A;  4V3I A;  1K3Z D;  1BI7 B;  3DSV A;  3ASO E;  4KVO A;  4EEC A;  1WY6 A;  4D10 C;  1TR4 A;  3AG4 E;  3UQ3 A;  3ENE A;  2Q7F A;  3QJZ A;  2ETA A;  1YCS B;  5FT9 A;  5IY5 E;  4AM9 A;  4C0E A;  3RO3 A;  3SO8 A;  3ZIM A;  2P9U G;  3QB2 A;  2ETC A;  1EDU A;  3CQC B;  5D0Q D;  5G55 A;  4L23 A;  1H19 A;  3Q9U C;  2AVP A;  1LD8 A;  2IFU A;  1O1S A;  3Q79 A;  3JUE A;  1H2U A;  4WNF A;  4E6H A;  1E7V A;  1QNF A;  5EIL A;  4ANW A;  2X3M A;  3TWX A;  3FEX A;  4EZJ A;  3CK7 A;  3FU5 A;  3W9F A;  2PNN A;  4U0S A;  3FU3 A;  2A5E A;  3QAR A;  4FUL A;  1LTX A;  2QZA A;  1HU3 A;  2FO7 A;  2J49 A;  1DNP A;  4UI9 J;  1O1T A;  4CGW A;  2FUL A;  3KEA A;  3FTU A;  2J4B A;  1HH8 A;  3KEZ A;  4GTQ A;  4FHK A;  3PZD A;  5JA4 D;  3RRU A;  3QWW A;  2A5U A;  1KT1 A;  3QC1 A;  4DPR A;  1JCQ A;  3V2X A;  5FZQ A;  3LYA A;  5CHE E;  3ABL E;  3ZYQ A;  3EU9 A;  4ATG A;  2OEW A;  1V55 E;  1ELK A;  2EIN E;  4WNE A;  3SQV A;  3Q9N C;  4ACL A;  3ULE G;  5CBO A;  2CHZ A;  4P29 A;  4Y6W A;  3PUK A;  2C0M A;  4BFR A;  1HX8 A;  4GA0 A;  2I1J A;  3RIB A;  3Q15 A;  5AQB A;  2GW1 A;  3RAU A;  1U2V G;  4CT0 A;  3ZHE B;  5LFA A;  5HKP A;  3V2O A;  1IHB A;  1N4S A;  4FAD A;  4B93 B;  4L9P A;  3UT8 A;  1SQM A;  3FUH A;  4FJZ A;  3UM1 A;  4DX5 D;  3ZXS A;  1MHQ A;  4LEU A;  4G8L A;  2H6G A;  5AYW D;  2RG8 A;  4QFV A;  4KT6 B;  1BI8 B;  2Y3A A;  4GYO A;  3G2T A;  2HM8 A;  1IHG A;  2H6H A;  2WXL A;  2GRN B;  5E75 A;  3OXG A;  3PZ2 A;  2L6J A;  2DWZ A;  5LP0 A;  2V8S E;  3DXM G;  3Q75 A;  4UWG A;  2AXU A;  4G1T A;  3Q7A A;  5CED B;  2WXG A;  3LJN A;  3PNT B;  5KJK A;  3CSF A;  3ZPJ A;  1JWF A;  5EN5 D;  3PNL B;  5FTP A;  2VGE A;  3BG1 B;  3DWL G;  3L54 A;  5ANR A;  2P9P G;  3T8M A;  3S7J A;  2XEH A;  4L2L A;  5G04 C;  3IKO B;  2FF4 A;  3B7U X;  2VQ2 A;  3FUN A;  2AJA A;  2OEV A;  4AXH A;  2MOW A;  4Z68 A;  4C0M A;  2XEN A;  3E4B A;  2X6F A;  4YDY A;  4HNA D;  3PZ4 A;  3VLD A;  5AEN A;  2RD0 A;  2YHC A;  2CFZ A;  3UT4 A;  4DUI A;  4RG6 A;  5KWD A;  4ZFH A;  2IEJ A;  1TN8 A;  5CCM A;  1O5M A;  4J8D A;  4CDN A;  5AN8 A;  3FY4 A;  2LSV A;  1EPU A;  4LER A;  5B1B E;  4CRW A;  3C3O A;  5BNW A;  1B89 A;  1S63 A;  2LXM A;  2P9L G;  4HLL A;  2XRZ A;  3F6Q A;  3LDZ A;  3QNK A;  4FHJ A;  5FQ7 A;  3TXM A;  3HVE A;  2ETB A;  3E37 A;  3UI2 A;  3T8K A;  4JA9 A;  5CMY A;  5ENP D;  2H6F A;  4U7E B;  2JAB A;  3SBS A;  2EIM E;  5BXO A;  2UY1 B;  5C1D A; 
#chains in the Genus database with same CATH homology
 4UWF A;  3CGH A;  4J0U A;  2V4L A;  3R7R A;  4GZ5 A;  3QWV A;  3FEY A;  4EZL A;  4I43 A;  2VGY A;  1NA0 A;  2AXZ A;  2NXP A;  3FUM A;  3LY9 A;  3U66 A;  3G2W A;  5G05 J;  4AP2 A;  4A1G A;  4JVS A;  4AIF A;  3CLJ A;  3CVP A;  2Y4U A;  3MCX A;  3PH0 C;  4RG9 A;  3R7Q A;  3FUI A;  2E2E A;  4N3A A;  3FH5 A;  4J6I A;  2X6J A;  5FQ8 A;  2BF0 X;  4AOF A;  2LAH A;  5BT1 A;  2KZT A;  1OWO A;  4JXT A;  4GMJ A;  3I3N A;  1QZ2 A;  5EKQ D;  3U9W A;  3CVN A;  4OVV A;  2WQ6 A;  2BTD A;  3LCA A;  3LKU A;  2YHE A;  4WAF A;  3KD7 A;  2XCC A;  3CVW A;  3GZ1 A;  4KZ0 A;  1NZN A;  4N2S A;  3NZS A;  1EYH A;  1H2T C;  3ASH A;  4ILH B;  3VLE A;  1GW6 A;  3ZW3 A;  2Y4T A;  3LVR E;  2WMN A;  4AJW A;  4A3V A;  3D9L A;  2R59 A;  3EIJ A;  3K9I A;  2XEV A;  5BW8 C;  3FUL A;  2IJG X;  2NC9 A;  5JJT A;  2C0L A;  3ZFW A;  2WXI A;  2J09 A;  4BTA A;  4F53 A;  2GRM A;  5AIJ A;  4O6F A;  2I9C A;  4APO A;  4FC8 A;  4WWO A;  4ANU A;  4PS3 A;  3D9P A;  2XPI A;  1UN9 A;  4BT8 A;  4ILG A;  4N5C A;  5FWQ A;  5T3R A;  3TAX A;  1PY1 A;  4UWH A;  3B7R L;  2ILR A;  2J9Q A;  2WMO A;  4IYP A;  4AV7 A;  4GPK A;  3FU0 A;  3T5V A;  5DIZ A;  4L7T A;  4I2Z A;  1HXI A;  5FQ4 A;  3SFZ A;  2YQ8 A;  2AXV A;  3TGO A;  1UJK A;  4HS2 A;  3VTX A;  4HVB A;  1Z3X A;  2OOE A;  3I4G A;  4GB9 A;  2CHW A;  2ION A;  3FUE A;  4L2Y A;  5JJ6 A;  4HOS A;  2C2L A;  4K0R A;  3L17 A;  2DIW A;  3PVL A;  4I17 A;  5A23 A;  3D9J A;  3JYS A;  4A3T A;  3CVQ A;  4MS6 A;  3QOU A;  3D9N A;  1EF1 C;  1KT0 A;  1U3D A;  2WXM A;  3G2U A;  5LCW J;  4GML A;  4G24 A;  3SI5 A;  3UMV A;  2FI7 A;  3LY7 A;  3ZYL A;  2WXK A;  4A55 A;  2OVF A;  4LRZ A;  4XE0 A;  1W3B A;  3PS6 A;  4URK A;  3ZEF A;  3Q47 B;  3SD5 A;  1HF8 A;  2IOL A;  3OAW A;  1E8Y A;  4I1A A;  5BV0 A;  4I9C A;  5JJ7 A;  3EDT B;  3EIQ C;  1E90 A;  2WXF A;  4B89 A;  4G23 A;  4XIF A;  3UX4 A;  4A1S A;  3FFL A;  4I9E A;  2KM4 A;  4CEM A;  4FJY A;  2VSO E;  1WM5 A;  4J8E A;  4UI9 C;  3S7D A;  4R7L A;  4CT4 A;  4UI9 K;  5JHB A;  3CVV A;  2L0I A;  2XGM A;  2XGO A;  3MGB A;  4V3I A;  4WUY A;  3MYV A;  2WPV A;  3L22 A;  3DPD A;  4FP7 A;  4JZY A;  3APC A;  5AJL A;  3O48 A;  3LPZ A;  5EX3 A;  4KVO A;  4EEC A;  1WY6 A;  2X6H A;  5G05 C;  2WB2 A;  2WXQ A;  4D10 C;  3SHF A;  3SF4 A;  3D9K A;  5KJL A;  3UQ3 A;  5KCM A;  4PUC A;  3KAE A;  3TG4 A;  2PQN A;  3ENE A;  2PQR A;  4B8C B;  4KBQ A;  3U3W A;  1HG2 A;  2Q7F A;  3MKQ A;  4YVO A;  3VLF A;  3CHQ A;  3QJZ A;  1OWL A;  4I1O B;  5AJD A;  2KCL A;  4NAC A;  1SZ9 A;  3B7T A;  5J08 A;  5FT9 A;  4EZK A;  1BPO A;  3QDN A;  4PS8 A;  2UWJ G;  3HDX A;  4F1S A;  4AM9 A;  3IHY A;  4C0E A;  3RO3 A;  4EBA G;  2CHX A;  1LF8 A;  2LNI A;  1ELR A;  3ZIM A;  3NF1 A;  4B94 A;  3QB2 A;  3CHS A;  1EDU A;  3CQC B;  5D0Q D;  5G55 A;  2LAI A;  4L23 A;  4U07 A;  1H19 A;  3FU6 A;  5DBK A;  5ARG A;  2AVP A;  5LOZ A;  1DVP A;  2IFU A;  4F7A A;  4JA7 A;  3C98 A;  4JEU A;  2WQH A;  4JC8 A;  3KS2 A;  4H7Y A;  3URZ A;  3AU4 A;  5T4Y A;  3CST A;  3ASD A;  4WNG A;  4GYW A;  2WXP A;  1H2U A;  4KZC A;  4BWR A;  2EQX A;  2WM9 A;  4AY6 A;  3APF A;  4WNF A;  5FZS A;  4E6H A;  2HYZ A;  3OXF A;  5C2Y A;  3N71 A;  3LJ3 A;  1QNF A;  1E7V A;  4APF A;  3G2V A;  1WAO 1;  2MHK A;  3FUK A;  3FTX A;  3ZVV A;  1HG5 A;  4F3V A;  3QK0 A;  4JPS A;  4XI0 A;  4WWP A;  2X3M A;  3ZRH A;  3RO2 A;  4ANW A;  2HO1 A;  4HOT A;  3FEX A;  2GRL A;  4N39 A;  4EZJ A;  1XGW A;  3CK7 A;  3ONL A;  3MA5 A;  5BUZ A;  3G2S A;  4NUR A;  3FU5 A;  3RU0 A;  5CMW A;  4TRQ A;  1XNF A;  4FU3 A;  1HS6 A;  2MRI A;  4U0S A;  3SBT B;  2IOS A;  3CR3 A;  3IHV A;  5D0O D;  5HQ8 A;  3FDH A;  3FU3 A;  4BSX A;  3GZ2 A;  2WXJ A;  3CVY A;  1JWG A;  2J4D A;  3ULQ A;  3B7S A;  3QAR A;  4FUL A;  2OVB A;  2XGS A;  3UPV A;  1FVH A;  1HU3 A;  2FO7 A;  2X38 A;  4ME2 A;  4MLP A;  1SZA A;  4BX8 A;  2J49 A;  2WXR A;  1JPL A;  4DJA A;  1DNP A;  4FLH A;  3S7B A;  4UI9 J;  3R9A B;  4HOQ A;  4KVM A;  3U4T A;  4GZ3 A;  4CGW A;  2FUL A;  3MJW A;  1N54 A;  1PAQ A;  2J07 A;  3FTU A;  2J4B A;  4OVU A;  1HH8 A;  1H2V C;  2E0I A;  3KEZ A;  5ENN A;  3GW4 A;  1TJF A;  2CG2 A;  4FHK A;  4Q96 A;  1U3C A;  3PZD A;  4TUU A;  3RRU A;  5LCW C;  1E7U A;  3IV0 A;  3QWW A;  2A5U A;  1KT1 A;  5E76 A;  3QC1 A;  4DPR A;  2J08 A;  2WVI A;  3AU5 A;  4YND A;  4PH4 B;  3RJV A;  2VGX A;  3JCK C;  5FZQ A;  3SGH A;  4GA2 A;  1Y8M A;  2KCV A;  3LS8 A;  3FH8 A;  3LYA A;  4DI3 A;  5CHE E;  3FP3 A;  3ZYQ A;  4ATG A;  4RVB A;  1VDY A;  3I4R B;  4HFG A;  3FH7 A;  1ELK A;  4BT9 A;  5BV1 A;  4WNE A;  1N52 A;  3FTS A;  4I6G A;  2KCK A;  4PS7 A;  4BX9 A;  2VYI A;  4ACL A;  3SZ7 A;  4C9B B;  3T5X A;  4HXI A;  1H0A A;  3D9O A;  3ZHE A;  5KJN A;  4UWK A;  3RKV A;  3QWP A;  1X5B A;  3TG5 A;  2CHZ A;  4P29 A;  5HI7 A;  2VSX E;  1IYG A;  4BTB A;  2QY7 A;  3VTY A;  3L6A A;  4DLQ A;  1IQR A;  4Y6W A;  3CVU A;  2HR2 A;  2XPZ A;  3FUJ A;  3I5P A;  3MEK A;  5FQ6 A;  5A7D B;  3PUK A;  2C0M A;  1HX8 A;  4LUN U;  4GA0 A;  2I1J A;  4G11 A;  4U0U A;  4TV3 A;  3RIB A;  3ZN3 A;  4BFR A;  2R5S A;  3CQG B;  3Q15 A;  4FLB A;  3UUX A;  2VSN A;  3NZU A;  2GW1 A;  3CHR A;  1Y6I A;  2KC7 A;  2OND A;  4UQY A;  4W9R A;  3QKY A;  4CGV A;  4CT0 A;  4KXK B;  5LX8 A;  1OWN A;  3ZHE B;  3AS5 A;  2L0T B;  4N3C A;  3RK6 A;  5LFA A;  2L9B A;  2VTB A;  4G25 A;  4G26 A;  2IQC A;  4FAD A;  3ESL A;  3PRZ A;  3D9M A;  5FJY A;  1SQM A;  3FUH A;  3UT8 A;  3PEV B;  4FJZ A;  4RSY A;  3ZXS A;  1HO8 A;  4BY6 A;  3CK9 A;  1TEZ A;  4ILI A;  1MHQ A;  3CKB A;  4H7X A;  4LEU A;  5T8I A;  4E85 A;  2VSY A;  2XQ0 A;  2CFU A;  4N2Q A;  2XPY A;  2RG8 A;  2LSU A;  3BEE A;  3BG0 B;  3MKR A;  5AYW D;  4QFV A;  5A6C A;  4KT6 B;  2XRY A;  3TL5 A;  4B0Z A;  3L13 A;  4B8A A;  4JEH A;  4EBA A;  4AVX A;  2Y3A A;  1PC2 A;  2AW6 A;  4CDR A;  4ANX A;  4GYO A;  4JHK A;  4XKC A;  2LO6 A;  1FVF A;  2I1K A;  3G2T A;  5M72 A;  4Q94 A;  2HM8 A;  1E8Z A;  4JL0 A;  1IHG A;  3ML8 A;  2FBN A;  4IN3 B;  3NQP A;  2WXL A;  4I6E A;  5BPP A;  4JW1 A;  5E75 A;  4XX5 A;  2JLB A;  3Q5M A;  3OXG A;  4WWN A;  2WXO A;  4U63 A;  4I2W A;  4G2V A;  1ELW A;  4GA1 A;  4J8S A;  3TXN A;  4I1M A;  1FCH A;  2DCP A;  1JUQ A;  4GCN A;  3P2B A;  2I2O A;  4LCT A;  2AWI A;  2L6J A;  2YIN A;  3EHN A;  4GCO A;  5LP0 A;  3CK8 A;  3CEQ A;  3PE3 A;  3EJN A;  2V8S E;  1HZ4 A;  4KMO A;  1OWM A;  4UWG A;  2AXU A;  1NA3 A;  4G1T A;  3ML9 A;  3P1U A;  2WXG A;  2BUG A;  2A4Z A;  3PUJ A;  4J8F A;  2YNQ A;  2V5F A;  2DBA A;  2X6I A;  3PNT B;  4GZ6 A;  5KJK A;  4UQX A;  3CSF A;  3CVX A;  2NSZ A;  3ZPJ A;  3FTZ A;  1JWF A;  2PM6 A;  3PNL B;  3CHO A;  2PL2 A;  4XKB A;  1H6K A;  5FTP A;  5ARF A;  2VJ8 A;  3BG1 B;  1Z6T A;  3JQ0 A;  3LEW A;  5G04 J;  4EQF A;  3L54 A;  5ANR A;  3OXL A;  3QAQ A;  3S7J A;  4L2L A;  3T8M A;  1IQU A;  3PRE A;  3D9I A;  5G04 C;  4DK5 A;  1L5J A;  3PEU B;  3IKO B;  3L16 A;  3CHM A;  2FF4 A;  3B7U X;  4KYO B;  5ANL A;  2VQ2 A;  4HOR A;  1KLX A;  3LVQ E;  1ZU2 A;  3B13 A;  1ZBP A;  4U0Z A;  3FUN A;  2FEZ A;  4GZC A;  4AXH A;  2MOW A;  4WND A;  4AY5 A;  2VTB B;  1INZ A;  4I6J A;  4C0M A;  4EPZ A;  2R17 C;  3E4B A;  2X6F A;  3HHM A;  3AS4 A;  2X6K A;  4JHJ A;  4OYS A;  4DLO A;  3LY8 A;  2I6H A;  3ASG A;  2P58 C;  3FHE A;  2IU1 A;  3FTY A;  3VLD A;  1HE8 A;  1S0P A;  3JUI A;  4U04 A;  5AEN A;  2RD0 A;  2YHC A;  4L1B A;  3ZYM A;  2UY1 A;  2KZT B;  4HOU A;  2CFZ A;  3UT4 A;  4Q69 A;  3Q4A B;  3IBE A;  4RG6 A;  4GYY A;  5FZR A;  4YVQ C;  3FTV A;  5EDS A;  4CDM A;  2JEK A;  2IF4 A;  3ESK A;  1TJC A;  5CCM A;  3CVL A;  4J8D A;  5KJM A;  4JHR A;  1QQE A;  3TJP A;  4GU5 A;  5CCL A;  3CV0 A;  4CDN A;  2XHE A;  3HYM B;  3O4Z A;  1E8W A;  3FUD A;  3FY4 A;  4IUL A;  4UQZ A;  2ZU6 B;  2M63 A;  3ONK A;  3AS8 A;  2XCB A;  1UG3 A;  1EPU A;  2LSV A;  2GGF A;  4XZ4 A;  3ZYK A;  1Z3Y A;  4LER A;  2V0P A;  4CCA A;  2WXH A;  4U8H A;  2PM7 A;  4GAA A;  4CRW A;  2CG3 A;  3Q49 B;  3RRM B;  1OUV A;  3DBS A;  3MV3 B;  4MRU A;  5BNW A;  1P5Q A;  3FWV A;  3HVE B;  1B89 A;  4ANV A;  3PDN A;  4FA6 A;  5J90 A;  3APD A;  2OV8 A;  1OWP A;  3MKQ B;  1MQS A;  2XRZ A;  3JQ1 A;  4ABN A;  3GZS A;  3LDZ A;  4PDX A;  3CKC A;  3QNK A;  4FHJ A;  4GZD A;  5FQ7 A;  5JHA A;  3U64 A;  3FTW A;  3HIZ A;  3TXM A;  3EHM A;  3CHP A;  3ZGQ A;  3UT7 A;  4Y6C A;  4IRU A;  3WXX A;  4M3O A;  3HVE A;  3FUF A;  1UW4 B;  1E8X A;  3LXU X;  4K03 A;  2WQ7 A;  1NP7 A;  1HFA A;  1YA0 A;  3OTN A;  4ACK A;  4JA9 A;  5CMY A;  3D3M A;  3S7F A;  4DI4 A;  4NQ0 A;  2PZI A;  1A17 A;  3GYZ A;  3MV2 B;  1UJJ A;  2WXN A;  3IEG A;  3ASF A;  3PE4 A;  5G2N A;  5EX0 A;  3SBS A;  4AEZ C;  4HLE A;  3L08 A;  1UN8 A;  2KAT A;  4MKT A;  4NRH B;  4XI9 A;  1E96 B;  3S2A A;  3MX3 A;  2VGX B;  2QFC A;  2UY1 B;  3CIA A;  3SNX A;  5C1D A;  3RRN B;  3MZL B;  4N3B A;  4UWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...