4GA0A

Structure of the n-terminal domain of nup358
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
143
structure length
143
Chain Sequence
RSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWLERAAKLFPGSPAIYKLKEQLLDCEGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase RanBP2
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 57
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga0A00
4G26A 4JHRA 3LPZA 2YQ8A 4GYWA 2PQRA 1B89A 2LSVA 3U4TA 2FF4A 1KT0A 2Q7FA 3ASGA 3RO2A 4F3VA 4J8DA 2PL2A 3S7JA 4UI9C 1W3BA 4KBQA 3O48A 4WNGA 2E2EA 1ZU2A 1WM5A 3Q4AB 1NA0A 4G2VA 5AYWD 3UPVA 4YNDA 3ZPJA 1A17A 2KATA 2P58C 4I9CA 2VGXA 5LCWJ 2KCLA 2Y4TA 3ZHEA 4N39A 4J0UA 3TGOA 3VTXA 1NA3A 2LSUA 3AS4A 2L6JA 3MKRA 4GA2A 4WNFA 4J8EA 4CGVA 3OXLA 3U3WA 3TG5A 3LY8A 1QQEA 4XI9A 3MA5A 1FCHA 4WUYA 4BT8A 5KJLA 1TJCA 5HI7A 4BWRA 4UQYA 3ZFWA 3CVNA 3MV2B 5JJ7A 5CCLA 4YVQC 1YA0A 1P5QA 1ELRA 1ELWA 1KT1A 4GZ3A 4Y6WA 3CK9A 4JA7A 1HXIA 4GPKA 4HORA 3ASHA 4I1AA 5ARGA 2PQNA 5D0OD 4U0ZA 2HR2A 4ME2A 4KYOB 3Q47B 1E96B 3GZ2A 4I9EA 5DIZA 3N71A 3AS8A 3R9AB 4W9RA 3QWVA 5ARFA 4A1SA 1KLXA 3ESKA 4WNDA 2UWJG 5DBKA 2XEVA 4XIFA 3GW4A 4B94A 2FI7A 5FTPA 4N5CA 3LCAA 3FWVA 4RG9A 3CKCA 3LKUA 2HO1A 3QDNA 4GCOA 4AIFA 4CDRA 2VGYA 2HYZA 2ONDA 3CEQA 3GZ1A 5LCWC 3KAEA 3CVPA 2QFCA 3RJVA 4AM9A 4UI9J 2R5SA 4UQXA 3E4BA 5M72A 2I6HA 4GZ6A 5EKQD 4GYYA 5BT1A 4G1TA 4HOTA 3TG4A 2JLBA 2GW1A 5CHEE 3UQ3A 5EX3A 3FP3A 2XGOA 3ASFA 3Q15A 4G23A 4O6FA 3ULQA 5BW8C 3LY7A 4N2SA 4YVOA 5JJTA 5FJYA 5C1DA 3S7BA 4U0UA 2PZIA 5G04J 5FZQA 4BTBA 3BEEA 3S7FA 4BTAA 3JYSA 4HOSA 4JL0A 4HOQA 2FEZA 4HOUA 5A6CA 3KD7A 5EX0A 3HYMB 4GYOA 4U0SA 1PC2A 2UY1B 1QZ2A 1IYGA 2V5FA 1NZNA 3RKVA 4AY6A 2C0LA 2MHKA 4I17A 3SF4A 4RG6A 3CV0A 4G24A 4XI0A 2VYIA 4I2ZA 3OXGA 3QKYA 2Y4UA 3LY9A 1Y8MA 3WXXA 5D0QD 3Q5MA 4G25A 5HQ8A 4GA1A 2DBAA 2XGSA 2BUGA 5CCMA 3CK8A 5G05J 4UI9K 5KJNA 4IN3B 5FZRA 2FBNA 5A7DB 3CK7A 3IEGA 1ZBPA 3UUXA 4KXKB 5KJMA 2VSYA 5FT9A 3NF1A 2XGMA 4JA9A 3S7DA 3FFLA 5BNWA 3AS5A 4WNEA 2VGXB 1HZ4A 4GA0A 2VQ2A 4LEUA 3CKBA 1XNFA 2LNIA 3OXFA 4N3BA 3K9IA 3ZHEB 5KJKA 2IFUA 3KS2A 3PDNA 4U07A 4Y6CA 4J8FA 4N3CA 2XCBA 5G04C 3URZA 2XPIA 4ABNA 4NQ0A 4AY5A 2KCKA 4GCNA 3CVQA 4EQFA 3Q49B 4H7XA 1IHGA 2WPVA 1WAO1 2C0MA 3RO3A 2VSNA 4UQZA 4H7YA 2FO7A 3ASDA 2IF4A 3PE4A 2YHCA 4N2QA 4NRHB 2OOEA 3QWWA 3VTYA 4I2WA 3QOUA 4APOA 3RU0A 3MEKA 3ZGQA 2AVPA 5FZSA 3EDTB 1HH8A 4BT9A 3SZ7A 3LYAA 1OUVA 3CVLA 2NC9A 2UY1A 4U04A 2XCCA 2KC7A 2C2LA 3PE3A 4N3AA 4CGWA 3MV3B 2J9QA 5JJ6A 3RIBA 4GZ5A 3ZN3A 2WQHA 5G05C 3QWPA 3TAXA 3GYZA 2KCVA
chains in the Genus database with same CATH superfamily
5AENA 1N4QA 3LPZA 5JHBA 4GYWA 2LSVA 4ACLA 3ZUVB 1KT0A 4GTPA 3TWQA 3KEZA 4GMRA 4F3VA 2VSXE 2PL2A 1Z3YA 1O1RA 4I6GA 3Q79A 4KBQA 1N0QA 2E2EA 3U66A 3FUEA 4CYMD 1WM5A 2GRLA 1TR4A 3BU8A 4HS2A 3DPYA 2JEKA 2KXPC 3ZPJA 3SFXA 2ETAA 2KATA 2P58C 3VLDA 2F0YA 2GRMA 5G2NA 1OT8A 1K1BA 3MGBA 3AG3E 1OY3D 4JZYA 4ANXA 5LCWJ 2J8SD 2XHEA 2Y4TA 1NI1A 3L13A 4O60A 4N39A 4URKA 1HG2A 2LSUA 3O4ZA 1KPSB 2AXZA 1N0RA 4WNFA 3CVUA 4AP2A 3U3WA 1L5JA 3TG5A 4CCAA 4BESA 2A5UA 5BV0A 4FHKA 1BLXB 4X8QA 4IRUA 3G2TA 1DVPA 4I6JA 4GTTA 3V31A 5BV1A 4DJAA 5KJLA 3ZKJA 2R17C 5JJ7A 1QBQA 3NQPA 3CHMA 4Y6WA 4GMJA 4CDNA 3CK9A 4EECA 4JA7A 3ENEA 2R2LA 3I5PA 4HORA 1N54A 4BETA 1E7UA 2X6FA 4ATGA 2P9NG 2ZGGA 2OEWA 2VTBB 3PNLB 1D8EA 1MYOA 2MRIA 3U9WA 3Q47B 4K0RA 1SW6A 4I9EA 5DIZA 4G8LA 3PEUB 3IBEA 3AJIA 3QWVA 1OWMA 4MS6A 3T5VA 2X6JA 4FC8A 1KLXA 5BXUA 3FUDA 4L7TA 2M63A 4BX8A 2IJGX 3Q75A 1IXVA 4ILGA 2OV8A 4O1OA 5IY5E 3PZ4A 4N5CA 4XKCA 1UJJA 3FH7A 5ENQD 3CKCA 3LKUA 3ZVVA 4GCOA 4CDRA 3UT7A 3PUJA 1IQRA 5B3SE 4A3VA 2XPZA 3X2QE 2QFCA 4EBAA 4J6IA 4UQXA 5FINA 3MJWA 1UJKA 3CGHA 3PH0C 5BT1A 4OYSA 4G1TA 1UN8A 3TG4A 2GW1A 3LJ3A 4GPMA 3FP3A 5KBAA 2XGOA 4XEIG 3G2WA 5CEDB 4G23A 3UKUG 5BW8C 3RSEG 2EILE 4JHJA 4U96D 3CQCB 1YYHA 3S7BA 2PZIA 4UWLA 5G04J 5FZQA 1TYQG 4HRLA 5H7PA 2BEDA 3S7FA 4BTAA 3JYSA 4F53A 4OVUA 4HOQA 2FEZA 4EPZA 3DXKG 2R05A 3LJNA 3EHRA 3TJPA 2GRRB 3C3QA 1FT2A 3MZLB 5ANLA 3FH8A 1QZ2A 2Y1LE 2WXNA 2Y0BG 1IYGA 4O1PA 1TJFA 4FLHA 5ENTD 2C0LA 2DZOA 3UT4A 2PM6A 2AW6A 2VYIA 2JABA 3FU5A 4HFGA 4XX5A 2X38A 4BSZB 3HVEB 3ZIMA 5EYPF 2VTBA 4DLOA 5D0QD 3ASOE 1BPOA 1H6OA 5HQ8A 4C48B 4C9BB 1OCCE 2XGSA 3D9IA 2WQ7A 5BUZA 3QK0A 4GTQA 5A7DB 4XKBA 1H6KA 1JCRA 3B7RL 3CK7A 1ZBPA 3FY4A 3FDHA 5FT9A 2ETBA 4MBGA 1S70B 5E75A 1EPUA 4HBDA 3DRAA 3FUHA 3UM3A 4D10C 3ZYQA 1HZ4A 3FTXA 2I2OA 3CKBA 3D3MA 3Q7AA 4PS3A 5B1BE 3DPDA 5EYLA 3KS2A 3PDNA 4U07A 4OVVA 2ZXWE 3APDA 3E33A 1EDUA 3URZA 4DPRA 3CVWA 3TWUA 3ML8A 4QFVA 2KBXA 3Q49B 3RRNB 2WPVA 2C0MA 2WXJA 1TN7A 4UQZA 1JPLA 4H7YA 2FO7A 3ASDA 3S2AA 2IF4A 2WXMA 3T8KA 2YHCA 4EZKA 3W9FA 4NRHB 2OOEA 4B93B 3DEOA 3VTYA 4U8HA 1IHBA 2CHWA 3QOUA 4APOA 3D9JA 3ZGQA 5FZSA 1OWPA 3EHMA 2WXIA 1HH8A 3UKRG 4N5QA 4ANWA 2QZAA 2KZTB 2LXLA 2KC7A 3FTVA 3G2VA 4DI3A 5CMWA 3CHPA 3RIBA 2NYJA 1E8YA 4ZHBA 3V79K 5E76A 2QYUA 3UI2A 2KCVA 3W9GA 3QAQA 4JHRA 3HVEA 3NAWA 2QYJA 2YQ8A 3U4TA 4J7WA 2Q7FA 3SGHA 1OCZE 2IEJA 1E7VA 2V0PA 4B89A 2NXPA 4FLBA 2ZISA 1OXJA 1ZU2A 3HG0D 1SZAA 3UPVA 3NB2A 1A17A 4K03A 3HXCA 4AXHA 2Y69E 4HI8A 4JEUA 4ANVA 3MKQB 4ILHB 3HXDA 4G11A 4GB9A 2IY0C 3TXNA 5A23A 5T3RA 3C3OA 4DUIA 1MX2A 1NA3A 3AS4A 2L6JA 3MKRA 4FHJA 2YNQA 2P9SG 3UIPC 3VLEA 1D9SA 1EF1C 2ZGDA 2PM7A 3SQVA 1HE8A 1ZB1A 3ISMC 1SZ9A 2GRPB 3UT8A 5AN8A 1FCHA 1H19A 3V30A 3UIOC 4HXIA 3CQGB 1JWFA 3AU4A 4F1PA 4AJWA 3SBSA 3IKOB 3MV2B 3KSQA 1P5QA 1ELRA 2OCCE 2RFMA 4LRZA 4F1SA 4GPKA 4I1OB 3I4RB 4JD2G 1DCQA 3SO8A 3ASHA 3E32A 2KZTA 5D0OD 4FU3A 3CHSA 4XZ4A 2GRQB 2HR2A 3ML9A 4EBAG 4KYOB 1E96B 3TWVA 3NOCD 1DCEA 4JHKA 4GAAA 4L2YA 3FEYA 3TWSA 5LOZA 2DIWA 4WNDA 2WXLA 4U7EB 3SFYA 3GW4A 3CVVA 4B94A 1FVHA 5AJDA 2WXKA 4TV3A 5HS0A 4EHMA 4WWOA 5ENRD 3FUNA 1UOHA 4PH4B 1IKND 2HYZA 2ONDA 5KNHD 3FTZA 4L2LA 3QJZA 4PUCA 5LCWC 3KAEA 2PNNA 4AM9A 3RJVA 1Z6TA 4BX9A 3E4BA 1JUQA 3ZYMA 2I6HA 4GZ6A 5EKQD 3KSLA 5EIBE 2JLBA 2EQXA 3LXUX 2IU1A 3L54A 5CHEE 3UQ3A 1U2VG 3MKQA 4GU5A 3DSWA 3Q15A 4O6FA 1TNUA 3ULQA 3ULYA 3LY7A 3IHVA 1FT1A 3JQ1A 2H6IA 4F6RD 4I6EA 1H2TC 5FIOA 3SD5A 4HRMB 4LG6A 2H6HA 2MYOA 3PZ2A 3PZ3A 3JXIA 2OVBA 3OAWA 2GGFA 4BY6A 4HOSA 2MOWA 4UWHA 2XPYA 1RW2A 1HU3A 2IO2C 3IHYA 5A6CA 2IO3C 1LD8A 2DZNA 1TN6A 4KVOA 1SA4A 1N95A 4OAVB 4U0SA 1PY1A 1N4SA 4DX7D 4K5BA 3CLJA 2KM4A 4TXPA 3WG7E 4J8SA 3PNTB 3V2XA 3ZYLA 5AARA 3EUVA 4XI0A 3OXGA 4KVMA 4FADA 5CRUA 2YINA 1UW4B 5FQ6A 4UUCA 1Z5SC 5CECB 1Y8MA 1KZOA 3ZYKA 3WXXA 2P9KG 2GROB 4HLLA 4WWNA 1JCQA 4G25A 2ILRA 3L6AA 5ENSD 5G05J 4LNBA 4EZJA 1SVXA 3LS8A 3QB2A 3IEGA 3UUXA 2IQCA 3HXBA 4GTMA 3HXEA 4RVBA 2XGMA 4FA6A 3S7DA 1WY6A 3FU6A 3ABME 2VGXB 4PS8A 5D66A 1XNFA 3Q9NC 2CG2A 3OXFA 3ZHEB 3RRMB 3J5QB 1O1SA 2IFUA 2P9LG 4Y6CA 2H6GA 4AEZC 4F7AA 2XZDG 1S64A 3QC1A 2XCBA 5G04C 3TWXA 1UG3A 4NQ0A 3PVLA 1U3CA 4HI9A 4EQFA 1N11A 1IHGA 1WAO1 3RO3A 3DSTA 2DYSE 4FULA 2XS1A 4V3IA 3PE4A 2F8XK 3MX3A 4GMLA 2J49A 4U95D 3ABKE 4LERA 4B0ZA 4I2WA 4G8KA 1TNYA 4A1GA 2WXQA 4CT4A 3FH5A 3RU0A 3MEKA 3ONLA 4EZLA 3SZ7A 1O1TA 4TXQA 3LYAA 4AVXA 2XCCA 3SFZA 4M3OA 1XGWA 4YDEA 2RD0A 3C5RA 4G26A 4AV7A 2FF4A 1EYHA 3RO2A 4WWPA 4J8DA 2XZTG 4RLYA 3S7JA 4UI9C 5EN5D 3P2BA 3HIZA 3O48A 4WNGA 2DYRE 3SHFA 1E8WA 1NA0A 3EIQC 3J5PA 3FUIA 4DX1A 4G2VA 4GZDA 5AYWD 1NL4A 4YNDA 4JW1A 3TXMA 3UX4A 1E8XA 3L16A 3TWWA 1RZ4A 3BG0B 2J08A 1NFIE 4E6HA 2VGXA 2HM8A 4LSZE 1WDYA 3ZXPA 2WMOA 2LO6A 3ABLE 2KCLA 4R7LA 2OVFA 3ZHEA 3NOGD 2ZU6B 2V4LA 3VTXA 3BUAA 2WMNA 4GA2A 4FJYA 3UM1A 3G2SA 4CGVA 3OXLA 2V8SE 5CBOA 3LY8A 1QQEA 4P29A 4B8CB 4A63B 4A3TA 2I1KA 4BT8A 3Q78A 3EHQA 2H6FA 2XRZA 3JCKC 1TJCA 3JUEA 4J8YA 2EIJE 4GTRA 4UQYA 3ZFWA 2R03A 1QNFA 3V2OA 4YVQC 1YA0A 2A4ZA 5AIJA 1KT1A 1O5MA 1V54E 4GTSA 5AQ9A 1E90A 5ANRA 4I1AA 3ZW3A 5ARGA 2BKGA 2CG3A 3B7UX 3NZUA 3I4GA 1YCSB 3JQ0A 3LEWA 3N71A 5ARFA 2R02A 4A1SA 1VDYA 3QARA 3R7RA 5G55A 3PUKA 3B95A 4HVBA 2AXUA 4L23A 5CEAA 3GZSA 2XEVA 3CHOA 4XIFA 4ATZD 2J4DA 1OWNA 3Q7FA 3HDXA 5CRVA 5J08A 3CVXA 3LCAA 3CHRA 5LX8A 3FWVA 4OAUC 2YHEA 4AIFA 4TUMA 3IV0A 3MCXA 2VGYA 1K1AA 2CFUA 3P1UA 2NSZA 3GZ1A 2P2CP 2LUHA 2XENA 2R5SA 2WXFA 3D9KA 3SNXA 2WXHA 3SI5A 2QC9A 5M72A 1JCSA 4GYYA 4UWGA 4HOTA 3SBTB 2P9PG 4JPSA 4GZCA 3LVQE 4YDOA 1AP7A 1NP7A 3T9KA 5AQBA 4N2SA 5JJTA 5C2YA 5C1DA 4U0UA 1LF8A 1U3DA 5HRYA 2AXVA 3DWLG 3LVRE 4PDXA 3ONKA 1DNPA 3D9PA 3UXGA 4JL0A 1Q2ZA 3B13A 1HS6A 1TNBA 2HE0A 5EX0A 3HYMB 3RK6A 2WXRA 2XEEA 4U63A 2UY1B 2BF0X 4ACKA 2V5FA 1NZNA 3RKVA 3EU9A 3DSXA 2F8YA 4LNGA 4RG6A 3IXEA 4G24A 3HRAA 3E34A 2CHZA 4I2ZA 3FU0A 5LFAA 3QKYA 2WXPA 2I1JA 3RAUA 4CZ2D 1GW6A 3TWRA 4GA1A 2DBAA 3TL5A 1BU9A 5FQ7A 5CCMA 2V5QC 3CK8A 2GRNB 3AU5A 3FUMA 4UI9K 5KJNA 4IN3B 2X6KA 3L22A 1MZCA 4JXTA 2XRYA 2Y3AA 3CR3A 1TEZA 4RSYA 4KXKB 4JEHA 2VSYA 3JXJA 4HB5A 5ENNA 3NF1A 1OWLA 4JA9A 1DC2A 1INZA 1MHQA 5BNWA 4WNEA 4LEUA 1MX4A 4M7CA 1MX6A 4XE0A 4MRUA 4Q94A 3K9IA 4CRWA 3FTSA 3AG4E 4J8FA 1PAQA 3ZEFA 4N3CA 5T4YA 2XPIA 4ABNA 2ZIRA 3MYVA 2I9CA 2EIME 3R7QA 4AY5A 4GCNA 3CVQA 1UN9A 1MQSA 1V55E 2EINE 2VSNA 1AWCB 4LUNU 4B8AA 3C98A 3DSUA 3L9TA 5EDSA 4CT0A 2FULA 3ESLA 3QWWA 5KWDA 2R59A 5FWQA 5JHAA 3NZSA 5CMYA 2AVPA 2XS8A 4U8YD 3EIJA 1BD8A 2UY1A 4U04A 3ASNE 4DX5D 5T8IA 5KNGA 2C2LA 2J9QA 3FUFA 4DRXE 3UM0A 5JJ6A 4AOFA 4GZ5A 1N9AA 2WQHA 4E85A 5G05C 3TAXA 4HRNA 3GYZA 2LAIA 4CEMA 2IOSA 3CIAA 3FTUA 4APFA 4TRQA 2VSOE 4JB8P 2PQRA 1B89A 3BG1B 3FU3A 4YDWA 5AAOA 3ASGA 4BSXA 4NACA 3RRUA 3ULEG 2VGEA 4MKTA 1W3BA 5EILA 1YMPA 4JC8A 1D8DA 3Q4AB 3HHMA 3APFA 5B1AE 4ILIA 2WXGA 1HFAA 1MJ0A 2RFAA 4I9CA 4L9PA 5JMND 3FULA 2CFZA 4K5AB 5CERB 4J0UA 2XEHA 3FEXA 4U8VD 3TGOA 2L0IA 4J8EA 2V4HC 5BPPA 1H0AA 1TN8A 2DWZA 3FHEA 1S0PA 1JWGA 3FUJA 2LAHA 5AQAA 4XI9A 5FQ8A 3D9NA 3JUIA 3MA5A 4WUYA 3F6QA 1HF8A 2XQ0A 5HI7A 3DSVA 4BWRA 3CVNA 1X5BA 5CCLA 1QYMA 3ZXSA 1IQUA 4NURA 5D2MC 1ELWA 4FP7A 4GZ3A 3LDZA 5CBNA 3R9MA 4C0EA 4ZFHA 1Y6IA 2X6HA 1HXIA 2B0OE 2B6CA 4HNAD 3CHQA 5ENOD 4DX2A 1BI8B 1H2VC 2PQNA 3AAAC 4U0ZA 3QNKA 4ME2A 4YDYA 1OWOA 2IOLA 3AG2E 2A5EA 1SQMA 2ETCA 3AG1E 3GZ2A 4JVSA 3EJNA 3AS8A 3R9AB 4KZCA 1TNZA 4W9RA 4PS7A 3U64A 2LXMA 2E0IA 5KCMA 1N4PA 3ESKA 1H2UA 4A55A 2UWJG 5DBKA 3OTNA 3BQOA 1HG5A 2FI7A 4DX6D 5FTPA 5ITZF 4RG9A 2HO1A 3QDNA 3FTYA 3FUKA 1LD7A 3Q73A 3UMVA 4Z68A 1H6PA 3CEQA 3B7BA 4GTOA 3L17A 3APCA 3CVPA 4UI9J 3PRZA 3VLFA 2QY7A 2J4BA 3FTWA 2OEVA 3B7SA 2WQ6A 5JA4D 3UTMA 5EX3A 1E8ZA 4L1BA 3EU5A 1LTXA 3ASFA 4LNUD 2FO1E 4YVOA 3L08A 2P9IG 5LP0A 5FJYA 3DEPA 2L0TB 2X6IA 2F37A 4GTVA 4LCTA 4WAFA 1HO8A 3HXFA 4BTBA 5AQ7A 3BEEA 3CSTA 1ELKA 2IONA 3ZNGA 4CDMA 3SY2A 1S63A 1X81A 4NIKA 4HOUA 1KZPA 3KD7A 1OCOE 4UWKA 4Q96A 2P9UG 3UM2A 3T5XA 4GYOA 1PC2A 4C0MA 3DXMG 2L9BA 1K3ZD 1OCRE 3D9LA 4AY6A 4KT6B 2AWIA 2MHKA 3D9HA 4I17A 4HLEA 3SF4A 3CV0A 1HX8A 4DK5A 4KMOA 3DSSA 1N94A 2WM9A 3PZ1A 3CSFA 2Y4UA 3LY9A 2J07A 2RG8A 3L82A 3Q5MA 1G3NB 4Q69A 3C72A 4IYPA 2BUGA 2BKKB 3NBNB 3D9OA 5FZRA 2FBNA 1FVFA 3PZDA 3Q9UC 4K5CA 3PS6A 5KJMA 1FPPA 4KZ0A 2WXOA 3D9MA 3PREA 3FFLA 1WG0A 1N4RA 4BEPA 3AS5A 2J09A 4GA0A 2VQ2A 4RQIA 3PEVB 1N52A 3ZU7B 2LNIA 2EIKE 2DCPA 4N3BA 5KJKA 3E30A 3G2UA 2BTDA 1K8KG 2L6BA 4MLPA 3ZRHA 3KEAA 1TNOA 3C3RA 2KCKA 4I1MA 3DBSA 3TWTA 4H7XA 1BI7B 4UWFA 5BXOA 4TXRA 2DVWA 5HKPA 2AJAA 1SA5A 4N2QA 3EHNA 2CHXA 3B7TA 5J90A 5ENPD 2VJ8A 4QQIA 3EDTB 2WB2A 2RKKA 4IULA 4BFRA 3CVYA 2X3MA 4BT9A 3E37A 1OUVA 3CVLA 2NC9A 4HQDA 4I43A 4ANUA 5FQ4A 3PE3A 1Z3XA 4N3AA 4CGWA 3MV3B 4FJZA 4TUUA 3I3NA 3ZN3A 1A5EA 4BERA 5AJLA 3UINC 4DI4A 3T8MA 2WVIA 3QWPA 5EIDA 4DLQA
chains in the Genus database with same CATH topology
4G26A 4JHRA 4AV7A 3CIAA 3FTUA 3HVEA 5AENA 4APFA 3LPZA 2VSOE 4TRQA 5JHBA 2YQ8A 4GYWA 2PQRA 1B89A 2LSVA 4ACLA 3U4TA 2FF4A 3BG1B 1KT0A 2Q7FA 3FU3A 3SGHA 1EYHA 3KEZA 3ASGA 3RO2A 4BSXA 4WWPA 4J8DA 2VSXE 4NACA 4F3VA 2PL2A 3RRUA 1Z3YA 4I6GA 3S7JA 4UI9C 4MKTA 3P2BA 1E7VA 3HIZA 1W3BA 4KBQA 3O48A 4WNGA 2E2EA 3U66A 2V0PA 4JC8A 4B89A 2NXPA 4FLBA 1ZU2A 3FUEA 1WM5A 2GRLA 3SHFA 3Q4AB 1E8WA 1NA0A 3EIQC 3FUIA 4HS2A 4G2VA 3HHMA 3APFA 4GZDA 1SZAA 2JEKA 5AYWD 3UPVA 4YNDA 4ILIA 4JW1A 3ZPJA 1A17A 2WXGA 4K03A 3TXMA 3UX4A 1E8XA 1HFAA 2KATA 2P58C 3L16A 3VLDA 3BG0B 2J08A 2GRMA 5G2NA 4I9CA 4AXHA 2VGXA 4E6HA 2HM8A 4JEUA 3MGBA 4ANVA 3MKQB 4ILHB 4G11A 4JZYA 4ANXA 5LCWJ 2WMOA 2LO6A 3FULA 2KCLA 4GB9A 4R7LA 2XHEA 2CFZA 2OVFA 3TXNA 5A23A 2Y4TA 3ZHEA 2ZU6B 3L13A 5T3RA 4N39A 4J0UA 2V4LA 3FEXA 3TGOA 4URKA 1HG2A 3VTXA 1NA3A 2LSUA 3AS4A 3O4ZA 2AXZA 2WMNA 2L6JA 3MKRA 4GA2A 2L0IA 4FHJA 4FJYA 4J8EA 4WNFA 2YNQA 3G2SA 3CVUA 4AP2A 5BPPA 4CGVA 3OXLA 3U3WA 2V8SE 1L5JA 1H0AA 3FHEA 3VLEA 1S0PA 1JWGA 3TG5A 4CCAA 3FUJA 2LAHA 1EF1C 3LY8A 1QQEA 2PM7A 2A5UA 4XI9A 5FQ8A 3D9NA 1HE8A 5BV0A 4FHKA 3JUIA 3MA5A 1SZ9A 3UT8A 4P29A 4IRUA 1FCHA 4B8CB 1H19A 4WUYA 4A3TA 3G2TA 1DVPA 4HXIA 3CQGB 4I6JA 2I1KA 4BT8A 5BV1A 4DJAA 2XRZA 3JCKC 5KJLA 1JWFA 1TJCA 3AU4A 1HF8A 2XQ0A 4AJWA 5HI7A 4BWRA 4UQYA 3SBSA 3CVNA 3ZFWA 2R17C 3IKOB 1X5BA 3MV2B 5JJ7A 5CCLA 1QNFA 4YVQC 1YA0A 3ZXSA 1P5QA 2A4ZA 5AIJA 1IQUA 4NURA 1ELRA 1ELWA 4FP7A 1KT1A 4GZ3A 3NQPA 3LDZA 3CHMA 4HVBA 4Y6WA 4GMJA 4CDNA 3CK9A 4C0EA 4EECA 4JA7A 1Y6IA 4LRZA 3ENEA 2X6HA 4F1SA 1HXIA 3I5PA 1E90A 4GPKA 4I1OB 4HORA 3I4RB 1N54A 5ANRA 3CHQA 1E7UA 2X6FA 1H2VC 4ATGA 3ASHA 4I1AA 3ZW3A 5ARGA 2PQNA 2KZTA 2CG3A 5D0OD 4FU3A 3CHSA 4U0ZA 2VTBB 4XZ4A 2HR2A 3B7UX 3ML9A 2MRIA 3PNLB 3QNKA 4ME2A 4EBAG 3U9WA 1OWOA 3NZUA 4KYOB 3Q47B 4K0RA 2IOLA 1E96B 3I4GA 1SQMA 3GZ2A 3JQ0A 4I9EA 5DIZA 3PEUB 4JVSA 3IBEA 4JHKA 3LEWA 3EJNA 3N71A 4GAAA 3AS8A 4L2YA 3R9AB 4KZCA 4W9RA 3QWVA 5ARFA 4PS7A 3U64A 1OWMA 1VDYA 3FEYA 3QARA 4MS6A 3R7RA 2E0IA 5G55A 4A1SA 2X6JA 3T5VA 5KCMA 4FC8A 3PUKA 1KLXA 2DIWA 3ESKA 5LOZA 1H2UA 3FUDA 4WNDA 4L7TA 2WXLA 4A55A 2AXUA 2M63A 2UWJG 4L23A 3GZSA 2XEVA 3CHOA 3OTNA 4XIFA 2IJGX 3GW4A 5DBKA 4BX8A 3CVVA 2J4DA 1OWNA 4B94A 1FVHA 1HG5A 2FI7A 2OV8A 3HDXA 4ILGA 5FTPA 4N5CA 5J08A 3CVXA 4XKCA 5AJDA 2WXKA 3CHRA 3LCAA 1UJJA 3FH7A 4TV3A 3FWVA 4RG9A 5LX8A 3CKCA 3LKUA 2YHEA 2HO1A 3QDNA 3FTYA 3ZVVA 4GCOA 3FUKA 4WWOA 4AIFA 4CDRA 3UT7A 3FUNA 3PUJA 3IV0A 4PH4B 1IQRA 3MCXA 3UMVA 2VGYA 4A3VA 2XPZA 2HYZA 2ONDA 2CFUA 3CEQA 3P1UA 3FTZA 2NSZA 3GZ1A 3QJZA 3L17A 4L2LA 4PUCA 5LCWC 3APCA 3KAEA 3CVPA 2QFCA 3RJVA 4AM9A 4EBAA 4UI9J 4J6IA 3PRZA 2R5SA 4UQXA 3VLFA 1Z6TA 2WXFA 3D9KA 4BX9A 3E4BA 2QY7A 2J4BA 1JUQA 3SNXA 2WXHA 3FTWA 3SI5A 5M72A 3MJWA 1UJKA 3B7SA 3ZYMA 2I6HA 4GZ6A 3CGHA 5EKQD 2WQ6A 3PH0C 4GYYA 5BT1A 4UWGA 4OYSA 4G1TA 4HOTA 1UN8A 3SBTB 3TG4A 2JLBA 2EQXA 2GW1A 3LXUX 2IU1A 4JPSA 3L54A 5CHEE 3LJ3A 3UQ3A 4GZCA 5EX3A 3MKQA 1E8ZA 3FP3A 4GU5A 4L1BA 2XGOA 3G2WA 3LVQE 1NP7A 3ASFA 3Q15A 4G23A 4O6FA 3ULQA 5BW8C 3LY7A 4N2SA 3IHVA 3JQ1A 4YVOA 3L08A 4JHJA 5JJTA 5C2YA 3CQCB 5LP0A 5FJYA 4I6EA 5C1DA 3S7BA 4U0UA 2PZIA 1H2TC 1LF8A 1U3DA 4UWLA 2L0TB 5G04J 5FZQA 2X6IA 2AXVA 3SD5A 4LCTA 4WAFA 4BTBA 1HO8A 3LVRE 4PDXA 3BEEA 2OVBA 3ONKA 3CSTA 3OAWA 1DNPA 3S7FA 1ELKA 2GGFA 3D9PA 4BTAA 3JYSA 4BY6A 2IONA 4F53A 4HOSA 4JL0A 2MOWA 4OVUA 4UWHA 2XPYA 4CDMA 4HOQA 1HU3A 2FEZA 4EPZA 3B13A 4HOUA 3IHYA 5A6CA 3KD7A 1HS6A 4UWKA 4Q96A 5EX0A 3TJPA 3HYMB 4KVOA 3RK6A 3T5XA 4GYOA 3MZLB 4U0SA 2WXRA 1PY1A 5ANLA 1PC2A 4U63A 3FH8A 2UY1B 3CLJA 4C0MA 1QZ2A 2WXNA 2KM4A 2L9BA 2BF0X 1IYGA 1TJFA 4ACKA 4FLHA 2V5FA 1NZNA 3RKVA 4J8SA 3D9LA 4AY6A 2C0LA 2AWIA 2MHKA 4KT6B 4I17A 4HLEA 3SF4A 4RG6A 3PNTB 3CV0A 1HX8A 3ZYLA 4G24A 3UT4A 4DK5A 2PM6A 2AW6A 2CHZA 4XI0A 2VYIA 4I2ZA 3OXGA 4KMOA 3FU0A 3FU5A 4HFGA 4KVMA 4XX5A 5LFAA 3QKYA 4FADA 2X38A 2YINA 1UW4B 2WM9A 5FQ6A 3HVEB 2WXPA 3ZIMA 2I1JA 3CSFA 2Y4UA 3LY9A 2VTBA 1GW6A 4DLOA 1Y8MA 3ZYKA 3WXXA 5D0QD 2J07A 2RG8A 4WWNA 3Q5MA 1BPOA 4Q69A 4G25A 5HQ8A 4GA1A 4IYPA 2DBAA 4C9BB 3TL5A 5FQ7A 2XGSA 2BUGA 3D9IA 2WQ7A 5BUZA 2ILRA 5CCMA 3CK8A 3L6AA 3QK0A 5G05J 3AU5A 3FUMA 3D9OA 4UI9K 4EZJA 4IN3B 5KJNA 2X6KA 3L22A 3LS8A 5FZRA 4JXTA 2FBNA 4XKBA 1H6KA 5A7DB 2XRYA 1FVFA 3B7RL 3PZDA 2Y3AA 3CK7A 3IEGA 3CR3A 1ZBPA 3QB2A 3FY4A 1TEZA 3UUXA 4RSYA 4KXKB 3FDHA 4JEHA 3PS6A 2IQCA 5KJMA 2VSYA 5FT9A 4KZ0A 2WXOA 5ENNA 3NF1A 4RVBA 2XGMA 3D9MA 5E75A 1OWLA 1EPUA 3PREA 4JA9A 4FA6A 3S7DA 3FFLA 1INZA 1WY6A 1MHQA 5BNWA 3FUHA 3FU6A 4D10C 3ZYQA 3AS5A 4WNEA 2VGXB 1HZ4A 2J09A 4PS8A 3FTXA 4GA0A 2VQ2A 4LEUA 2I2OA 3CKBA 3D3MA 3QAQA 3PEVB 1N52A 1XNFA 4PS3A 2LNIA 3DPDA 4XE0A 4MRUA 2CG2A 3OXFA 2DCPA 4N3BA 3K9IA 4Q94A 3ZHEB 5KJKA 4CRWA 3G2UA 3RRMB 2IFUA 3KS2A 3PDNA 2BTDA 3FTSA 4U07A 4OVVA 4Y6CA 4AEZC 4F7AA 4MLPA 3APDA 1PAQA 3QC1A 4J8FA 4N3CA 2XCBA 3ZEFA 3ZRHA 5T4YA 5G04C 1EDUA 3URZA 2XPIA 4DPRA 3CVWA 4ABNA 3MYVA 1UG3A 2I9CA 4NQ0A 3R7QA 3PVLA 1U3CA 4AY5A 2KCKA 4GCNA 4I1MA 3DBSA 3CVQA 3ML8A 1UN9A 4QFVA 4EQFA 3Q49B 3RRNB 4H7XA 1IHGA 1MQSA 2WPVA 4UWFA 1WAO1 2C0MA 2WXJA 3RO3A 2VSNA 4LUNU 4B8AA 4FULA 4UQZA 3C98A 1JPLA 4H7YA 2FO7A 3ASDA 3S2AA 4V3IA 2IF4A 2WXMA 3PE4A 2YHCA 3MX3A 4GMLA 2J49A 2FULA 3ESLA 4CT0A 4EZKA 5EDSA 3EHNA 4NRHB 4N2QA 2OOEA 3QWWA 3VTYA 4LERA 4B0ZA 4I2WA 4U8HA 2CHWA 2R59A 2CHXA 3B7TA 3QOUA 5FWQA 4A1GA 5JHAA 2WXQA 4CT4A 5J90A 3FH5A 3NZSA 3RU0A 2VJ8A 4APOA 5CMYA 3D9JA 3MEKA 3ZGQA 2AVPA 5FZSA 1OWPA 3ONLA 3EHMA 3EDTB 2WXIA 2WB2A 1HH8A 4IULA 4EZLA 4BFRA 3CVYA 2X3MA 4BT9A 3SZ7A 3LYAA 1OUVA 4ANWA 3CVLA 3EIJA 2NC9A 2UY1A 4U04A 2KZTB 4AVXA 2XCCA 4I43A 4ANUA 5T8IA 5FQ4A 2KC7A 2C2LA 3SFZA 3PE3A 1Z3XA 3FTVA 4N3AA 3G2VA 3MV3B 2J9QA 4M3OA 4FJZA 3FUFA 4CGWA 1XGWA 4DI3A 5CMWA 5JJ6A 3CHPA 3I3NA 4GZ5A 4TUUA 3RIBA 3ZN3A 4AOFA 1E8YA 2WQHA 5AJLA 2RD0A 5E76A 4DI4A 4E85A 3T8MA 2WVIA 5G05C 3QWPA 3TAXA 4DLQA 3GYZA 2LAIA 4CEMA 2KCVA 2IOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G26 A;  4JHR A;  3LPZ A;  2YQ8 A;  4GYW A;  2PQR A;  1B89 A;  2LSV A;  3U4T A;  2FF4 A;  1KT0 A;  2Q7F A;  3ASG A;  3RO2 A;  4F3V A;  4J8D A;  2PL2 A;  3S7J A;  4UI9 C;  1W3B A;  4KBQ A;  3O48 A;  4WNG A;  2E2E A;  1ZU2 A;  1WM5 A;  3Q4A B;  1NA0 A;  4G2V A;  5AYW D;  3UPV A;  4YND A;  3ZPJ A;  1A17 A;  2KAT A;  2P58 C;  4I9C A;  2VGX A;  5LCW J;  2KCL A;  2Y4T A;  3ZHE A;  4N39 A;  4J0U A;  3TGO A;  3VTX A;  1NA3 A;  2LSU A;  3AS4 A;  2L6J A;  3MKR A;  4GA2 A;  4WNF A;  4J8E A;  4CGV A;  3OXL A;  3U3W A;  3TG5 A;  3LY8 A;  1QQE A;  4XI9 A;  3MA5 A;  1FCH A;  4WUY A;  4BT8 A;  5KJL A;  1TJC A;  5HI7 A;  4BWR A;  4UQY A;  3ZFW A;  3CVN A;  3MV2 B;  5JJ7 A;  5CCL A;  4YVQ C;  1YA0 A;  1P5Q A;  1ELR A;  1ELW A;  1KT1 A;  4GZ3 A;  4Y6W A;  3CK9 A;  4JA7 A;  1HXI A;  4GPK A;  4HOR A;  3ASH A;  4I1A A;  5ARG A;  2PQN A;  5D0O D;  4U0Z A;  2HR2 A;  4ME2 A;  4KYO B;  3Q47 B;  1E96 B;  3GZ2 A;  4I9E A;  5DIZ A;  3N71 A;  3AS8 A;  3R9A B;  4W9R A;  3QWV A;  5ARF A;  4A1S A;  1KLX A;  3ESK A;  4WND A;  2UWJ G;  5DBK A;  2XEV A;  4XIF A;  3GW4 A;  4B94 A;  2FI7 A;  5FTP A;  4N5C A;  3LCA A;  3FWV A;  4RG9 A;  3CKC A;  3LKU A;  2HO1 A;  3QDN A;  4GCO A;  4AIF A;  4CDR A;  2VGY A;  2HYZ A;  2OND A;  3CEQ A;  3GZ1 A;  5LCW C;  3KAE A;  3CVP A;  2QFC A;  3RJV A;  4AM9 A;  4UI9 J;  2R5S A;  4UQX A;  3E4B A;  5M72 A;  2I6H A;  4GZ6 A;  5EKQ D;  4GYY A;  5BT1 A;  4G1T A;  4HOT A;  3TG4 A;  2JLB A;  2GW1 A;  5CHE E;  3UQ3 A;  5EX3 A;  3FP3 A;  2XGO A;  3ASF A;  3Q15 A;  4G23 A;  4O6F A;  3ULQ A;  5BW8 C;  3LY7 A;  4N2S A;  4YVO A;  5JJT A;  5FJY A;  5C1D A;  3S7B A;  4U0U A;  2PZI A;  5G04 J;  5FZQ A;  4BTB A;  3BEE A;  3S7F A;  4BTA A;  3JYS A;  4HOS A;  4JL0 A;  4HOQ A;  2FEZ A;  4HOU A;  5A6C A;  3KD7 A;  5EX0 A;  3HYM B;  4GYO A;  4U0S A;  1PC2 A;  2UY1 B;  1QZ2 A;  1IYG A;  2V5F A;  1NZN A;  3RKV A;  4AY6 A;  2C0L A;  2MHK A;  4I17 A;  3SF4 A;  4RG6 A;  3CV0 A;  4G24 A;  4XI0 A;  2VYI A;  4I2Z A;  3OXG A;  3QKY A;  2Y4U A;  3LY9 A;  1Y8M A;  3WXX A;  5D0Q D;  3Q5M A;  4G25 A;  5HQ8 A;  4GA1 A;  2DBA A;  2XGS A;  2BUG A;  5CCM A;  3CK8 A;  5G05 J;  4UI9 K;  5KJN A;  4IN3 B;  5FZR A;  2FBN A;  5A7D B;  3CK7 A;  3IEG A;  1ZBP A;  3UUX A;  4KXK B;  5KJM A;  2VSY A;  5FT9 A;  3NF1 A;  2XGM A;  4JA9 A;  3S7D A;  3FFL A;  5BNW A;  3AS5 A;  4WNE A;  2VGX B;  1HZ4 A;  4GA0 A;  2VQ2 A;  4LEU A;  3CKB A;  1XNF A;  2LNI A;  3OXF A;  4N3B A;  3K9I A;  3ZHE B;  5KJK A;  2IFU A;  3KS2 A;  3PDN A;  4U07 A;  4Y6C A;  4J8F A;  4N3C A;  2XCB A;  5G04 C;  3URZ A;  2XPI A;  4ABN A;  4NQ0 A;  4AY5 A;  2KCK A;  4GCN A;  3CVQ A;  4EQF A;  3Q49 B;  4H7X A;  1IHG A;  2WPV A;  1WAO 1;  2C0M A;  3RO3 A;  2VSN A;  4UQZ A;  4H7Y A;  2FO7 A;  3ASD A;  2IF4 A;  3PE4 A;  2YHC A;  4N2Q A;  4NRH B;  2OOE A;  3QWW A;  3VTY A;  4I2W A;  3QOU A;  4APO A;  3RU0 A;  3MEK A;  3ZGQ A;  2AVP A;  5FZS A;  3EDT B;  1HH8 A;  4BT9 A;  3SZ7 A;  3LYA A;  1OUV A;  3CVL A;  2NC9 A;  2UY1 A;  4U04 A;  2XCC A;  2KC7 A;  2C2L A;  3PE3 A;  4N3A A;  4CGW A;  3MV3 B;  2J9Q A;  5JJ6 A;  3RIB A;  4GZ5 A;  3ZN3 A;  2WQH A;  5G05 C;  3QWP A;  3TAX A;  3GYZ A;  2KCV A; 
#chains in the Genus database with same CATH topology
 5AEN A;  1N4Q A;  3LPZ A;  5JHB A;  4GYW A;  2LSV A;  4ACL A;  3ZUV B;  1KT0 A;  4GTP A;  3TWQ A;  3KEZ A;  4GMR A;  4F3V A;  2VSX E;  2PL2 A;  1Z3Y A;  1O1R A;  4I6G A;  3Q79 A;  4KBQ A;  1N0Q A;  2E2E A;  3U66 A;  3FUE A;  4CYM D;  1WM5 A;  2GRL A;  1TR4 A;  3BU8 A;  4HS2 A;  3DPY A;  2JEK A;  2KXP C;  3ZPJ A;  3SFX A;  2ETA A;  2KAT A;  2P58 C;  3VLD A;  2F0Y A;  2GRM A;  5G2N A;  1OT8 A;  1K1B A;  3MGB A;  3AG3 E;  1OY3 D;  4JZY A;  4ANX A;  5LCW J;  2J8S D;  2XHE A;  2Y4T A;  1NI1 A;  3L13 A;  4O60 A;  4N39 A;  4URK A;  1HG2 A;  2LSU A;  3O4Z A;  1KPS B;  2AXZ A;  1N0R A;  4WNF A;  3CVU A;  4AP2 A;  3U3W A;  1L5J A;  3TG5 A;  4CCA A;  4BES A;  2A5U A;  5BV0 A;  4FHK A;  1BLX B;  4X8Q A;  4IRU A;  3G2T A;  1DVP A;  4I6J A;  4GTT A;  3V31 A;  5BV1 A;  4DJA A;  5KJL A;  3ZKJ A;  2R17 C;  5JJ7 A;  1QBQ A;  3NQP A;  3CHM A;  4Y6W A;  4GMJ A;  4CDN A;  3CK9 A;  4EEC A;  4JA7 A;  3ENE A;  2R2L A;  3I5P A;  4HOR A;  1N54 A;  4BET A;  1E7U A;  2X6F A;  4ATG A;  2P9N G;  2ZGG A;  2OEW A;  2VTB B;  3PNL B;  1D8E A;  1MYO A;  2MRI A;  3U9W A;  3Q47 B;  4K0R A;  1SW6 A;  4I9E A;  5DIZ A;  4G8L A;  3PEU B;  3IBE A;  3AJI A;  3QWV A;  1OWM A;  4MS6 A;  3T5V A;  2X6J A;  4FC8 A;  1KLX A;  5BXU A;  3FUD A;  4L7T A;  2M63 A;  4BX8 A;  2IJG X;  3Q75 A;  1IXV A;  4ILG A;  2OV8 A;  4O1O A;  5IY5 E;  3PZ4 A;  4N5C A;  4XKC A;  1UJJ A;  3FH7 A;  5ENQ D;  3CKC A;  3LKU A;  3ZVV A;  4GCO A;  4CDR A;  3UT7 A;  3PUJ A;  1IQR A;  5B3S E;  4A3V A;  2XPZ A;  3X2Q E;  2QFC A;  4EBA A;  4J6I A;  4UQX A;  5FIN A;  3MJW A;  1UJK A;  3CGH A;  3PH0 C;  5BT1 A;  4OYS A;  4G1T A;  1UN8 A;  3TG4 A;  2GW1 A;  3LJ3 A;  4GPM A;  3FP3 A;  5KBA A;  2XGO A;  4XEI G;  3G2W A;  5CED B;  4G23 A;  3UKU G;  5BW8 C;  3RSE G;  2EIL E;  4JHJ A;  4U96 D;  3CQC B;  1YYH A;  3S7B A;  2PZI A;  4UWL A;  5G04 J;  5FZQ A;  1TYQ G;  4HRL A;  5H7P A;  2BED A;  3S7F A;  4BTA A;  3JYS A;  4F53 A;  4OVU A;  4HOQ A;  2FEZ A;  4EPZ A;  3DXK G;  2R05 A;  3LJN A;  3EHR A;  3TJP A;  2GRR B;  3C3Q A;  1FT2 A;  3MZL B;  5ANL A;  3FH8 A;  1QZ2 A;  2Y1L E;  2WXN A;  2Y0B G;  1IYG A;  4O1P A;  1TJF A;  4FLH A;  5ENT D;  2C0L A;  2DZO A;  3UT4 A;  2PM6 A;  2AW6 A;  2VYI A;  2JAB A;  3FU5 A;  4HFG A;  4XX5 A;  2X38 A;  4BSZ B;  3HVE B;  3ZIM A;  5EYP F;  2VTB A;  4DLO A;  5D0Q D;  3ASO E;  1BPO A;  1H6O A;  5HQ8 A;  4C48 B;  4C9B B;  1OCC E;  2XGS A;  3D9I A;  2WQ7 A;  5BUZ A;  3QK0 A;  4GTQ A;  5A7D B;  4XKB A;  1H6K A;  1JCR A;  3B7R L;  3CK7 A;  1ZBP A;  3FY4 A;  3FDH A;  5FT9 A;  2ETB A;  4MBG A;  1S70 B;  5E75 A;  1EPU A;  4HBD A;  3DRA A;  3FUH A;  3UM3 A;  4D10 C;  3ZYQ A;  1HZ4 A;  3FTX A;  2I2O A;  3CKB A;  3D3M A;  3Q7A A;  4PS3 A;  5B1B E;  3DPD A;  5EYL A;  3KS2 A;  3PDN A;  4U07 A;  4OVV A;  2ZXW E;  3APD A;  3E33 A;  1EDU A;  3URZ A;  4DPR A;  3CVW A;  3TWU A;  3ML8 A;  4QFV A;  2KBX A;  3Q49 B;  3RRN B;  2WPV A;  2C0M A;  2WXJ A;  1TN7 A;  4UQZ A;  1JPL A;  4H7Y A;  2FO7 A;  3ASD A;  3S2A A;  2IF4 A;  2WXM A;  3T8K A;  2YHC A;  4EZK A;  3W9F A;  4NRH B;  2OOE A;  4B93 B;  3DEO A;  3VTY A;  4U8H A;  1IHB A;  2CHW A;  3QOU A;  4APO A;  3D9J A;  3ZGQ A;  5FZS A;  1OWP A;  3EHM A;  2WXI A;  1HH8 A;  3UKR G;  4N5Q A;  4ANW A;  2QZA A;  2KZT B;  2LXL A;  2KC7 A;  3FTV A;  3G2V A;  4DI3 A;  5CMW A;  3CHP A;  3RIB A;  2NYJ A;  1E8Y A;  4ZHB A;  3V79 K;  5E76 A;  2QYU A;  3UI2 A;  2KCV A;  3W9G A;  3QAQ A;  4JHR A;  3HVE A;  3NAW A;  2QYJ A;  2YQ8 A;  3U4T A;  4J7W A;  2Q7F A;  3SGH A;  1OCZ E;  2IEJ A;  1E7V A;  2V0P A;  4B89 A;  2NXP A;  4FLB A;  2ZIS A;  1OXJ A;  1ZU2 A;  3HG0 D;  1SZA A;  3UPV A;  3NB2 A;  1A17 A;  4K03 A;  3HXC A;  4AXH A;  2Y69 E;  4HI8 A;  4JEU A;  4ANV A;  3MKQ B;  4ILH B;  3HXD A;  4G11 A;  4GB9 A;  2IY0 C;  3TXN A;  5A23 A;  5T3R A;  3C3O A;  4DUI A;  1MX2 A;  1NA3 A;  3AS4 A;  2L6J A;  3MKR A;  4FHJ A;  2YNQ A;  2P9S G;  3UIP C;  3VLE A;  1D9S A;  1EF1 C;  2ZGD A;  2PM7 A;  3SQV A;  1HE8 A;  1ZB1 A;  3ISM C;  1SZ9 A;  2GRP B;  3UT8 A;  5AN8 A;  1FCH A;  1H19 A;  3V30 A;  3UIO C;  4HXI A;  3CQG B;  1JWF A;  3AU4 A;  4F1P A;  4AJW A;  3SBS A;  3IKO B;  3MV2 B;  3KSQ A;  1P5Q A;  1ELR A;  2OCC E;  2RFM A;  4LRZ A;  4F1S A;  4GPK A;  4I1O B;  3I4R B;  4JD2 G;  1DCQ A;  3SO8 A;  3ASH A;  3E32 A;  2KZT A;  5D0O D;  4FU3 A;  3CHS A;  4XZ4 A;  2GRQ B;  2HR2 A;  3ML9 A;  4EBA G;  4KYO B;  1E96 B;  3TWV A;  3NOC D;  1DCE A;  4JHK A;  4GAA A;  4L2Y A;  3FEY A;  3TWS A;  5LOZ A;  2DIW A;  4WND A;  2WXL A;  4U7E B;  3SFY A;  3GW4 A;  3CVV A;  4B94 A;  1FVH A;  5AJD A;  2WXK A;  4TV3 A;  5HS0 A;  4EHM A;  4WWO A;  5ENR D;  3FUN A;  1UOH A;  4PH4 B;  1IKN D;  2HYZ A;  2OND A;  5KNH D;  3FTZ A;  4L2L A;  3QJZ A;  4PUC A;  5LCW C;  3KAE A;  2PNN A;  4AM9 A;  3RJV A;  1Z6T A;  4BX9 A;  3E4B A;  1JUQ A;  3ZYM A;  2I6H A;  4GZ6 A;  5EKQ D;  3KSL A;  5EIB E;  2JLB A;  2EQX A;  3LXU X;  2IU1 A;  3L54 A;  5CHE E;  3UQ3 A;  1U2V G;  3MKQ A;  4GU5 A;  3DSW A;  3Q15 A;  4O6F A;  1TNU A;  3ULQ A;  3ULY A;  3LY7 A;  3IHV A;  1FT1 A;  3JQ1 A;  2H6I A;  4F6R D;  4I6E A;  1H2T C;  5FIO A;  3SD5 A;  4HRM B;  4LG6 A;  2H6H A;  2MYO A;  3PZ2 A;  3PZ3 A;  3JXI A;  2OVB A;  3OAW A;  2GGF A;  4BY6 A;  4HOS A;  2MOW A;  4UWH A;  2XPY A;  1RW2 A;  1HU3 A;  2IO2 C;  3IHY A;  5A6C A;  2IO3 C;  1LD8 A;  2DZN A;  1TN6 A;  4KVO A;  1SA4 A;  1N95 A;  4OAV B;  4U0S A;  1PY1 A;  1N4S A;  4DX7 D;  4K5B A;  3CLJ A;  2KM4 A;  4TXP A;  3WG7 E;  4J8S A;  3PNT B;  3V2X A;  3ZYL A;  5AAR A;  3EUV A;  4XI0 A;  3OXG A;  4KVM A;  4FAD A;  5CRU A;  2YIN A;  1UW4 B;  5FQ6 A;  4UUC A;  1Z5S C;  5CEC B;  1Y8M A;  1KZO A;  3ZYK A;  3WXX A;  2P9K G;  2GRO B;  4HLL A;  4WWN A;  1JCQ A;  4G25 A;  2ILR A;  3L6A A;  5ENS D;  5G05 J;  4LNB A;  4EZJ A;  1SVX A;  3LS8 A;  3QB2 A;  3IEG A;  3UUX A;  2IQC A;  3HXB A;  4GTM A;  3HXE A;  4RVB A;  2XGM A;  4FA6 A;  3S7D A;  1WY6 A;  3FU6 A;  3ABM E;  2VGX B;  4PS8 A;  5D66 A;  1XNF A;  3Q9N C;  2CG2 A;  3OXF A;  3ZHE B;  3RRM B;  3J5Q B;  1O1S A;  2IFU A;  2P9L G;  4Y6C A;  2H6G A;  4AEZ C;  4F7A A;  2XZD G;  1S64 A;  3QC1 A;  2XCB A;  5G04 C;  3TWX A;  1UG3 A;  4NQ0 A;  3PVL A;  1U3C A;  4HI9 A;  4EQF A;  1N11 A;  1IHG A;  1WAO 1;  3RO3 A;  3DST A;  2DYS E;  4FUL A;  2XS1 A;  4V3I A;  3PE4 A;  2F8X K;  3MX3 A;  4GML A;  2J49 A;  4U95 D;  3ABK E;  4LER A;  4B0Z A;  4I2W A;  4G8K A;  1TNY A;  4A1G A;  2WXQ A;  4CT4 A;  3FH5 A;  3RU0 A;  3MEK A;  3ONL A;  4EZL A;  3SZ7 A;  1O1T A;  4TXQ A;  3LYA A;  4AVX A;  2XCC A;  3SFZ A;  4M3O A;  1XGW A;  4YDE A;  2RD0 A;  3C5R A;  4G26 A;  4AV7 A;  2FF4 A;  1EYH A;  3RO2 A;  4WWP A;  4J8D A;  2XZT G;  4RLY A;  3S7J A;  4UI9 C;  5EN5 D;  3P2B A;  3HIZ A;  3O48 A;  4WNG A;  2DYR E;  3SHF A;  1E8W A;  1NA0 A;  3EIQ C;  3J5P A;  3FUI A;  4DX1 A;  4G2V A;  4GZD A;  5AYW D;  1NL4 A;  4YND A;  4JW1 A;  3TXM A;  3UX4 A;  1E8X A;  3L16 A;  3TWW A;  1RZ4 A;  3BG0 B;  2J08 A;  1NFI E;  4E6H A;  2VGX A;  2HM8 A;  4LSZ E;  1WDY A;  3ZXP A;  2WMO A;  2LO6 A;  3ABL E;  2KCL A;  4R7L A;  2OVF A;  3ZHE A;  3NOG D;  2ZU6 B;  2V4L A;  3VTX A;  3BUA A;  2WMN A;  4GA2 A;  4FJY A;  3UM1 A;  3G2S A;  4CGV A;  3OXL A;  2V8S E;  5CBO A;  3LY8 A;  1QQE A;  4P29 A;  4B8C B;  4A63 B;  4A3T A;  2I1K A;  4BT8 A;  3Q78 A;  3EHQ A;  2H6F A;  2XRZ A;  3JCK C;  1TJC A;  3JUE A;  4J8Y A;  2EIJ E;  4GTR A;  4UQY A;  3ZFW A;  2R03 A;  1QNF A;  3V2O A;  4YVQ C;  1YA0 A;  2A4Z A;  5AIJ A;  1KT1 A;  1O5M A;  1V54 E;  4GTS A;  5AQ9 A;  1E90 A;  5ANR A;  4I1A A;  3ZW3 A;  5ARG A;  2BKG A;  2CG3 A;  3B7U X;  3NZU A;  3I4G A;  1YCS B;  3JQ0 A;  3LEW A;  3N71 A;  5ARF A;  2R02 A;  4A1S A;  1VDY A;  3QAR A;  3R7R A;  5G55 A;  3PUK A;  3B95 A;  4HVB A;  2AXU A;  4L23 A;  5CEA A;  3GZS A;  2XEV A;  3CHO A;  4XIF A;  4ATZ D;  2J4D A;  1OWN A;  3Q7F A;  3HDX A;  5CRV A;  5J08 A;  3CVX A;  3LCA A;  3CHR A;  5LX8 A;  3FWV A;  4OAU C;  2YHE A;  4AIF A;  4TUM A;  3IV0 A;  3MCX A;  2VGY A;  1K1A A;  2CFU A;  3P1U A;  2NSZ A;  3GZ1 A;  2P2C P;  2LUH A;  2XEN A;  2R5S A;  2WXF A;  3D9K A;  3SNX A;  2WXH A;  3SI5 A;  2QC9 A;  5M72 A;  1JCS A;  4GYY A;  4UWG A;  4HOT A;  3SBT B;  2P9P G;  4JPS A;  4GZC A;  3LVQ E;  4YDO A;  1AP7 A;  1NP7 A;  3T9K A;  5AQB A;  4N2S A;  5JJT A;  5C2Y A;  5C1D A;  4U0U A;  1LF8 A;  1U3D A;  5HRY A;  2AXV A;  3DWL G;  3LVR E;  4PDX A;  3ONK A;  1DNP A;  3D9P A;  3UXG A;  4JL0 A;  1Q2Z A;  3B13 A;  1HS6 A;  1TNB A;  2HE0 A;  5EX0 A;  3HYM B;  3RK6 A;  2WXR A;  2XEE A;  4U63 A;  2UY1 B;  2BF0 X;  4ACK A;  2V5F A;  1NZN A;  3RKV A;  3EU9 A;  3DSX A;  2F8Y A;  4LNG A;  4RG6 A;  3IXE A;  4G24 A;  3HRA A;  3E34 A;  2CHZ A;  4I2Z A;  3FU0 A;  5LFA A;  3QKY A;  2WXP A;  2I1J A;  3RAU A;  4CZ2 D;  1GW6 A;  3TWR A;  4GA1 A;  2DBA A;  3TL5 A;  1BU9 A;  5FQ7 A;  5CCM A;  2V5Q C;  3CK8 A;  2GRN B;  3AU5 A;  3FUM A;  4UI9 K;  5KJN A;  4IN3 B;  2X6K A;  3L22 A;  1MZC A;  4JXT A;  2XRY A;  2Y3A A;  3CR3 A;  1TEZ A;  4RSY A;  4KXK B;  4JEH A;  2VSY A;  3JXJ A;  4HB5 A;  5ENN A;  3NF1 A;  1OWL A;  4JA9 A;  1DC2 A;  1INZ A;  1MHQ A;  5BNW A;  4WNE A;  4LEU A;  1MX4 A;  4M7C A;  1MX6 A;  4XE0 A;  4MRU A;  4Q94 A;  3K9I A;  4CRW A;  3FTS A;  3AG4 E;  4J8F A;  1PAQ A;  3ZEF A;  4N3C A;  5T4Y A;  2XPI A;  4ABN A;  2ZIR A;  3MYV A;  2I9C A;  2EIM E;  3R7Q A;  4AY5 A;  4GCN A;  3CVQ A;  1UN9 A;  1MQS A;  1V55 E;  2EIN E;  2VSN A;  1AWC B;  4LUN U;  4B8A A;  3C98 A;  3DSU A;  3L9T A;  5EDS A;  4CT0 A;  2FUL A;  3ESL A;  3QWW A;  5KWD A;  2R59 A;  5FWQ A;  5JHA A;  3NZS A;  5CMY A;  2AVP A;  2XS8 A;  4U8Y D;  3EIJ A;  1BD8 A;  2UY1 A;  4U04 A;  3ASN E;  4DX5 D;  5T8I A;  5KNG A;  2C2L A;  2J9Q A;  3FUF A;  4DRX E;  3UM0 A;  5JJ6 A;  4AOF A;  4GZ5 A;  1N9A A;  2WQH A;  4E85 A;  5G05 C;  3TAX A;  4HRN A;  3GYZ A;  2LAI A;  4CEM A;  2IOS A;  3CIA A;  3FTU A;  4APF A;  4TRQ A;  2VSO E;  4JB8 P;  2PQR A;  1B89 A;  3BG1 B;  3FU3 A;  4YDW A;  5AAO A;  3ASG A;  4BSX A;  4NAC A;  3RRU A;  3ULE G;  2VGE A;  4MKT A;  1W3B A;  5EIL A;  1YMP A;  4JC8 A;  1D8D A;  3Q4A B;  3HHM A;  3APF A;  5B1A E;  4ILI A;  2WXG A;  1HFA A;  1MJ0 A;  2RFA A;  4I9C A;  4L9P A;  5JMN D;  3FUL A;  2CFZ A;  4K5A B;  5CER B;  4J0U A;  2XEH A;  3FEX A;  4U8V D;  3TGO A;  2L0I A;  4J8E A;  2V4H C;  5BPP A;  1H0A A;  1TN8 A;  2DWZ A;  3FHE A;  1S0P A;  1JWG A;  3FUJ A;  2LAH A;  5AQA A;  4XI9 A;  5FQ8 A;  3D9N A;  3JUI A;  3MA5 A;  4WUY A;  3F6Q A;  1HF8 A;  2XQ0 A;  5HI7 A;  3DSV A;  4BWR A;  3CVN A;  1X5B A;  5CCL A;  1QYM A;  3ZXS A;  1IQU A;  4NUR A;  5D2M C;  1ELW A;  4FP7 A;  4GZ3 A;  3LDZ A;  5CBN A;  3R9M A;  4C0E A;  4ZFH A;  1Y6I A;  2X6H A;  1HXI A;  2B0O E;  2B6C A;  4HNA D;  3CHQ A;  5ENO D;  4DX2 A;  1BI8 B;  1H2V C;  2PQN A;  3AAA C;  4U0Z A;  3QNK A;  4ME2 A;  4YDY A;  1OWO A;  2IOL A;  3AG2 E;  2A5E A;  1SQM A;  2ETC A;  3AG1 E;  3GZ2 A;  4JVS A;  3EJN A;  3AS8 A;  3R9A B;  4KZC A;  1TNZ A;  4W9R A;  4PS7 A;  3U64 A;  2LXM A;  2E0I A;  5KCM A;  1N4P A;  3ESK A;  1H2U A;  4A55 A;  2UWJ G;  5DBK A;  3OTN A;  3BQO A;  1HG5 A;  2FI7 A;  4DX6 D;  5FTP A;  5ITZ F;  4RG9 A;  2HO1 A;  3QDN A;  3FTY A;  3FUK A;  1LD7 A;  3Q73 A;  3UMV A;  4Z68 A;  1H6P A;  3CEQ A;  3B7B A;  4GTO A;  3L17 A;  3APC A;  3CVP A;  4UI9 J;  3PRZ A;  3VLF A;  2QY7 A;  2J4B A;  3FTW A;  2OEV A;  3B7S A;  2WQ6 A;  5JA4 D;  3UTM A;  5EX3 A;  1E8Z A;  4L1B A;  3EU5 A;  1LTX A;  3ASF A;  4LNU D;  2FO1 E;  4YVO A;  3L08 A;  2P9I G;  5LP0 A;  5FJY A;  3DEP A;  2L0T B;  2X6I A;  2F37 A;  4GTV A;  4LCT A;  4WAF A;  1HO8 A;  3HXF A;  4BTB A;  5AQ7 A;  3BEE A;  3CST A;  1ELK A;  2ION A;  3ZNG A;  4CDM A;  3SY2 A;  1S63 A;  1X81 A;  4NIK A;  4HOU A;  1KZP A;  3KD7 A;  1OCO E;  4UWK A;  4Q96 A;  2P9U G;  3UM2 A;  3T5X A;  4GYO A;  1PC2 A;  4C0M A;  3DXM G;  2L9B A;  1K3Z D;  1OCR E;  3D9L A;  4AY6 A;  4KT6 B;  2AWI A;  2MHK A;  3D9H A;  4I17 A;  4HLE A;  3SF4 A;  3CV0 A;  1HX8 A;  4DK5 A;  4KMO A;  3DSS A;  1N94 A;  2WM9 A;  3PZ1 A;  3CSF A;  2Y4U A;  3LY9 A;  2J07 A;  2RG8 A;  3L82 A;  3Q5M A;  1G3N B;  4Q69 A;  3C72 A;  4IYP A;  2BUG A;  2BKK B;  3NBN B;  3D9O A;  5FZR A;  2FBN A;  1FVF A;  3PZD A;  3Q9U C;  4K5C A;  3PS6 A;  5KJM A;  1FPP A;  4KZ0 A;  2WXO A;  3D9M A;  3PRE A;  3FFL A;  1WG0 A;  1N4R A;  4BEP A;  3AS5 A;  2J09 A;  4GA0 A;  2VQ2 A;  4RQI A;  3PEV B;  1N52 A;  3ZU7 B;  2LNI A;  2EIK E;  2DCP A;  4N3B A;  5KJK A;  3E30 A;  3G2U A;  2BTD A;  1K8K G;  2L6B A;  4MLP A;  3ZRH A;  3KEA A;  1TNO A;  3C3R A;  2KCK A;  4I1M A;  3DBS A;  3TWT A;  4H7X A;  1BI7 B;  4UWF A;  5BXO A;  4TXR A;  2DVW A;  5HKP A;  2AJA A;  1SA5 A;  4N2Q A;  3EHN A;  2CHX A;  3B7T A;  5J90 A;  5ENP D;  2VJ8 A;  4QQI A;  3EDT B;  2WB2 A;  2RKK A;  4IUL A;  4BFR A;  3CVY A;  2X3M A;  4BT9 A;  3E37 A;  1OUV A;  3CVL A;  2NC9 A;  4HQD A;  4I43 A;  4ANU A;  5FQ4 A;  3PE3 A;  1Z3X A;  4N3A A;  4CGW A;  3MV3 B;  4FJZ A;  4TUU A;  3I3N A;  3ZN3 A;  1A5E A;  4BER A;  5AJL A;  3UIN C;  4DI4 A;  3T8M A;  2WVI A;  3QWP A;  5EID A;  4DLQ A; 
#chains in the Genus database with same CATH homology
 4G26 A;  4JHR A;  4AV7 A;  3CIA A;  3FTU A;  3HVE A;  5AEN A;  4APF A;  3LPZ A;  2VSO E;  4TRQ A;  5JHB A;  2YQ8 A;  4GYW A;  2PQR A;  1B89 A;  2LSV A;  4ACL A;  3U4T A;  2FF4 A;  3BG1 B;  1KT0 A;  2Q7F A;  3FU3 A;  3SGH A;  1EYH A;  3KEZ A;  3ASG A;  3RO2 A;  4BSX A;  4WWP A;  4J8D A;  2VSX E;  4NAC A;  4F3V A;  2PL2 A;  3RRU A;  1Z3Y A;  4I6G A;  3S7J A;  4UI9 C;  4MKT A;  3P2B A;  1E7V A;  3HIZ A;  1W3B A;  4KBQ A;  3O48 A;  4WNG A;  2E2E A;  3U66 A;  2V0P A;  4JC8 A;  4B89 A;  2NXP A;  4FLB A;  1ZU2 A;  3FUE A;  1WM5 A;  2GRL A;  3SHF A;  3Q4A B;  1E8W A;  1NA0 A;  3EIQ C;  3FUI A;  4HS2 A;  4G2V A;  3HHM A;  3APF A;  4GZD A;  1SZA A;  2JEK A;  5AYW D;  3UPV A;  4YND A;  4ILI A;  4JW1 A;  3ZPJ A;  1A17 A;  2WXG A;  4K03 A;  3TXM A;  3UX4 A;  1E8X A;  1HFA A;  2KAT A;  2P58 C;  3L16 A;  3VLD A;  3BG0 B;  2J08 A;  2GRM A;  5G2N A;  4I9C A;  4AXH A;  2VGX A;  4E6H A;  2HM8 A;  4JEU A;  3MGB A;  4ANV A;  3MKQ B;  4ILH B;  4G11 A;  4JZY A;  4ANX A;  5LCW J;  2WMO A;  2LO6 A;  3FUL A;  2KCL A;  4GB9 A;  4R7L A;  2XHE A;  2CFZ A;  2OVF A;  3TXN A;  5A23 A;  2Y4T A;  3ZHE A;  2ZU6 B;  3L13 A;  5T3R A;  4N39 A;  4J0U A;  2V4L A;  3FEX A;  3TGO A;  4URK A;  1HG2 A;  3VTX A;  1NA3 A;  2LSU A;  3AS4 A;  3O4Z A;  2AXZ A;  2WMN A;  2L6J A;  3MKR A;  4GA2 A;  2L0I A;  4FHJ A;  4FJY A;  4J8E A;  4WNF A;  2YNQ A;  3G2S A;  3CVU A;  4AP2 A;  5BPP A;  4CGV A;  3OXL A;  3U3W A;  2V8S E;  1L5J A;  1H0A A;  3FHE A;  3VLE A;  1S0P A;  1JWG A;  3TG5 A;  4CCA A;  3FUJ A;  2LAH A;  1EF1 C;  3LY8 A;  1QQE A;  2PM7 A;  2A5U A;  4XI9 A;  5FQ8 A;  3D9N A;  1HE8 A;  5BV0 A;  4FHK A;  3JUI A;  3MA5 A;  1SZ9 A;  3UT8 A;  4P29 A;  4IRU A;  1FCH A;  4B8C B;  1H19 A;  4WUY A;  4A3T A;  3G2T A;  1DVP A;  4HXI A;  3CQG B;  4I6J A;  2I1K A;  4BT8 A;  5BV1 A;  4DJA A;  2XRZ A;  3JCK C;  5KJL A;  1JWF A;  1TJC A;  3AU4 A;  1HF8 A;  2XQ0 A;  4AJW A;  5HI7 A;  4BWR A;  4UQY A;  3SBS A;  3CVN A;  3ZFW A;  2R17 C;  3IKO B;  1X5B A;  3MV2 B;  5JJ7 A;  5CCL A;  1QNF A;  4YVQ C;  1YA0 A;  3ZXS A;  1P5Q A;  2A4Z A;  5AIJ A;  1IQU A;  4NUR A;  1ELR A;  1ELW A;  4FP7 A;  1KT1 A;  4GZ3 A;  3NQP A;  3LDZ A;  3CHM A;  4HVB A;  4Y6W A;  4GMJ A;  4CDN A;  3CK9 A;  4C0E A;  4EEC A;  4JA7 A;  1Y6I A;  4LRZ A;  3ENE A;  2X6H A;  4F1S A;  1HXI A;  3I5P A;  1E90 A;  4GPK A;  4I1O B;  4HOR A;  3I4R B;  1N54 A;  5ANR A;  3CHQ A;  1E7U A;  2X6F A;  1H2V C;  4ATG A;  3ASH A;  4I1A A;  3ZW3 A;  5ARG A;  2PQN A;  2KZT A;  2CG3 A;  5D0O D;  4FU3 A;  3CHS A;  4U0Z A;  2VTB B;  4XZ4 A;  2HR2 A;  3B7U X;  3ML9 A;  2MRI A;  3PNL B;  3QNK A;  4ME2 A;  4EBA G;  3U9W A;  1OWO A;  3NZU A;  4KYO B;  3Q47 B;  4K0R A;  2IOL A;  1E96 B;  3I4G A;  1SQM A;  3GZ2 A;  3JQ0 A;  4I9E A;  5DIZ A;  3PEU B;  4JVS A;  3IBE A;  4JHK A;  3LEW A;  3EJN A;  3N71 A;  4GAA A;  3AS8 A;  4L2Y A;  3R9A B;  4KZC A;  4W9R A;  3QWV A;  5ARF A;  4PS7 A;  3U64 A;  1OWM A;  1VDY A;  3FEY A;  3QAR A;  4MS6 A;  3R7R A;  2E0I A;  5G55 A;  4A1S A;  2X6J A;  3T5V A;  5KCM A;  4FC8 A;  3PUK A;  1KLX A;  2DIW A;  3ESK A;  5LOZ A;  1H2U A;  3FUD A;  4WND A;  4L7T A;  2WXL A;  4A55 A;  2AXU A;  2M63 A;  2UWJ G;  4L23 A;  3GZS A;  2XEV A;  3CHO A;  3OTN A;  4XIF A;  2IJG X;  3GW4 A;  5DBK A;  4BX8 A;  3CVV A;  2J4D A;  1OWN A;  4B94 A;  1FVH A;  1HG5 A;  2FI7 A;  2OV8 A;  3HDX A;  4ILG A;  5FTP A;  4N5C A;  5J08 A;  3CVX A;  4XKC A;  5AJD A;  2WXK A;  3CHR A;  3LCA A;  1UJJ A;  3FH7 A;  4TV3 A;  3FWV A;  4RG9 A;  5LX8 A;  3CKC A;  3LKU A;  2YHE A;  2HO1 A;  3QDN A;  3FTY A;  3ZVV A;  4GCO A;  3FUK A;  4WWO A;  4AIF A;  4CDR A;  3UT7 A;  3FUN A;  3PUJ A;  3IV0 A;  4PH4 B;  1IQR A;  3MCX A;  3UMV A;  2VGY A;  4A3V A;  2XPZ A;  2HYZ A;  2OND A;  2CFU A;  3CEQ A;  3P1U A;  3FTZ A;  2NSZ A;  3GZ1 A;  3QJZ A;  3L17 A;  4L2L A;  4PUC A;  5LCW C;  3APC A;  3KAE A;  3CVP A;  2QFC A;  3RJV A;  4AM9 A;  4EBA A;  4UI9 J;  4J6I A;  3PRZ A;  2R5S A;  4UQX A;  3VLF A;  1Z6T A;  2WXF A;  3D9K A;  4BX9 A;  3E4B A;  2QY7 A;  2J4B A;  1JUQ A;  3SNX A;  2WXH A;  3FTW A;  3SI5 A;  5M72 A;  3MJW A;  1UJK A;  3B7S A;  3ZYM A;  2I6H A;  4GZ6 A;  3CGH A;  5EKQ D;  2WQ6 A;  3PH0 C;  4GYY A;  5BT1 A;  4UWG A;  4OYS A;  4G1T A;  4HOT A;  1UN8 A;  3SBT B;  3TG4 A;  2JLB A;  2EQX A;  2GW1 A;  3LXU X;  2IU1 A;  4JPS A;  3L54 A;  5CHE E;  3LJ3 A;  3UQ3 A;  4GZC A;  5EX3 A;  3MKQ A;  1E8Z A;  3FP3 A;  4GU5 A;  4L1B A;  2XGO A;  3G2W A;  3LVQ E;  1NP7 A;  3ASF A;  3Q15 A;  4G23 A;  4O6F A;  3ULQ A;  5BW8 C;  3LY7 A;  4N2S A;  3IHV A;  3JQ1 A;  4YVO A;  3L08 A;  4JHJ A;  5JJT A;  5C2Y A;  3CQC B;  5LP0 A;  5FJY A;  4I6E A;  5C1D A;  3S7B A;  4U0U A;  2PZI A;  1H2T C;  1LF8 A;  1U3D A;  4UWL A;  2L0T B;  5G04 J;  5FZQ A;  2X6I A;  2AXV A;  3SD5 A;  4LCT A;  4WAF A;  4BTB A;  1HO8 A;  3LVR E;  4PDX A;  3BEE A;  2OVB A;  3ONK A;  3CST A;  3OAW A;  1DNP A;  3S7F A;  1ELK A;  2GGF A;  3D9P A;  4BTA A;  3JYS A;  4BY6 A;  2ION A;  4F53 A;  4HOS A;  4JL0 A;  2MOW A;  4OVU A;  4UWH A;  2XPY A;  4CDM A;  4HOQ A;  1HU3 A;  2FEZ A;  4EPZ A;  3B13 A;  4HOU A;  3IHY A;  5A6C A;  3KD7 A;  1HS6 A;  4UWK A;  4Q96 A;  5EX0 A;  3TJP A;  3HYM B;  4KVO A;  3RK6 A;  3T5X A;  4GYO A;  3MZL B;  4U0S A;  2WXR A;  1PY1 A;  5ANL A;  1PC2 A;  4U63 A;  3FH8 A;  2UY1 B;  3CLJ A;  4C0M A;  1QZ2 A;  2WXN A;  2KM4 A;  2L9B A;  2BF0 X;  1IYG A;  1TJF A;  4ACK A;  4FLH A;  2V5F A;  1NZN A;  3RKV A;  4J8S A;  3D9L A;  4AY6 A;  2C0L A;  2AWI A;  2MHK A;  4KT6 B;  4I17 A;  4HLE A;  3SF4 A;  4RG6 A;  3PNT B;  3CV0 A;  1HX8 A;  3ZYL A;  4G24 A;  3UT4 A;  4DK5 A;  2PM6 A;  2AW6 A;  2CHZ A;  4XI0 A;  2VYI A;  4I2Z A;  3OXG A;  4KMO A;  3FU0 A;  3FU5 A;  4HFG A;  4KVM A;  4XX5 A;  5LFA A;  3QKY A;  4FAD A;  2X38 A;  2YIN A;  1UW4 B;  2WM9 A;  5FQ6 A;  3HVE B;  2WXP A;  3ZIM A;  2I1J A;  3CSF A;  2Y4U A;  3LY9 A;  2VTB A;  1GW6 A;  4DLO A;  1Y8M A;  3ZYK A;  3WXX A;  5D0Q D;  2J07 A;  2RG8 A;  4WWN A;  3Q5M A;  1BPO A;  4Q69 A;  4G25 A;  5HQ8 A;  4GA1 A;  4IYP A;  2DBA A;  4C9B B;  3TL5 A;  5FQ7 A;  2XGS A;  2BUG A;  3D9I A;  2WQ7 A;  5BUZ A;  2ILR A;  5CCM A;  3CK8 A;  3L6A A;  3QK0 A;  5G05 J;  3AU5 A;  3FUM A;  3D9O A;  4UI9 K;  4EZJ A;  4IN3 B;  5KJN A;  2X6K A;  3L22 A;  3LS8 A;  5FZR A;  4JXT A;  2FBN A;  4XKB A;  1H6K A;  5A7D B;  2XRY A;  1FVF A;  3B7R L;  3PZD A;  2Y3A A;  3CK7 A;  3IEG A;  3CR3 A;  1ZBP A;  3QB2 A;  3FY4 A;  1TEZ A;  3UUX A;  4RSY A;  4KXK B;  3FDH A;  4JEH A;  3PS6 A;  2IQC A;  5KJM A;  2VSY A;  5FT9 A;  4KZ0 A;  2WXO A;  5ENN A;  3NF1 A;  4RVB A;  2XGM A;  3D9M A;  5E75 A;  1OWL A;  1EPU A;  3PRE A;  4JA9 A;  4FA6 A;  3S7D A;  3FFL A;  1INZ A;  1WY6 A;  1MHQ A;  5BNW A;  3FUH A;  3FU6 A;  4D10 C;  3ZYQ A;  3AS5 A;  4WNE A;  2VGX B;  1HZ4 A;  2J09 A;  4PS8 A;  3FTX A;  4GA0 A;  2VQ2 A;  4LEU A;  2I2O A;  3CKB A;  3D3M A;  3QAQ A;  3PEV B;  1N52 A;  1XNF A;  4PS3 A;  2LNI A;  3DPD A;  4XE0 A;  4MRU A;  2CG2 A;  3OXF A;  2DCP A;  4N3B A;  3K9I A;  4Q94 A;  3ZHE B;  5KJK A;  4CRW A;  3G2U A;  3RRM B;  2IFU A;  3KS2 A;  3PDN A;  2BTD A;  3FTS A;  4U07 A;  4OVV A;  4Y6C A;  4AEZ C;  4F7A A;  4MLP A;  3APD A;  1PAQ A;  3QC1 A;  4J8F A;  4N3C A;  2XCB A;  3ZEF A;  3ZRH A;  5T4Y A;  5G04 C;  1EDU A;  3URZ A;  2XPI A;  4DPR A;  3CVW A;  4ABN A;  3MYV A;  1UG3 A;  2I9C A;  4NQ0 A;  3R7Q A;  3PVL A;  1U3C A;  4AY5 A;  2KCK A;  4GCN A;  4I1M A;  3DBS A;  3CVQ A;  3ML8 A;  1UN9 A;  4QFV A;  4EQF A;  3Q49 B;  3RRN B;  4H7X A;  1IHG A;  1MQS A;  2WPV A;  4UWF A;  1WAO 1;  2C0M A;  2WXJ A;  3RO3 A;  2VSN A;  4LUN U;  4B8A A;  4FUL A;  4UQZ A;  3C98 A;  1JPL A;  4H7Y A;  2FO7 A;  3ASD A;  3S2A A;  4V3I A;  2IF4 A;  2WXM A;  3PE4 A;  2YHC A;  3MX3 A;  4GML A;  2J49 A;  2FUL A;  3ESL A;  4CT0 A;  4EZK A;  5EDS A;  3EHN A;  4NRH B;  4N2Q A;  2OOE A;  3QWW A;  3VTY A;  4LER A;  4B0Z A;  4I2W A;  4U8H A;  2CHW A;  2R59 A;  2CHX A;  3B7T A;  3QOU A;  5FWQ A;  4A1G A;  5JHA A;  2WXQ A;  4CT4 A;  5J90 A;  3FH5 A;  3NZS A;  3RU0 A;  2VJ8 A;  4APO A;  5CMY A;  3D9J A;  3MEK A;  3ZGQ A;  2AVP A;  5FZS A;  1OWP A;  3ONL A;  3EHM A;  3EDT B;  2WXI A;  2WB2 A;  1HH8 A;  4IUL A;  4EZL A;  4BFR A;  3CVY A;  2X3M A;  4BT9 A;  3SZ7 A;  3LYA A;  1OUV A;  4ANW A;  3CVL A;  3EIJ A;  2NC9 A;  2UY1 A;  4U04 A;  2KZT B;  4AVX A;  2XCC A;  4I43 A;  4ANU A;  5T8I A;  5FQ4 A;  2KC7 A;  2C2L A;  3SFZ A;  3PE3 A;  1Z3X A;  3FTV A;  4N3A A;  3G2V A;  3MV3 B;  2J9Q A;  4M3O A;  4FJZ A;  3FUF A;  4CGW A;  1XGW A;  4DI3 A;  5CMW A;  5JJ6 A;  3CHP A;  3I3N A;  4GZ5 A;  4TUU A;  3RIB A;  3ZN3 A;  4AOF A;  1E8Y A;  2WQH A;  5AJL A;  2RD0 A;  5E76 A;  4DI4 A;  4E85 A;  3T8M A;  2WVI A;  5G05 C;  3QWP A;  3TAX A;  4DLQ A;  3GYZ A;  2LAI A;  4CEM A;  2KCV A;  2IOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...