1V55E

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1v55E00
3ABKE 2Y69E 2EIKE 3WG7E 2EINE 3X2QE 3AG4E 5IY5E 2OCCE 5B3SE 1OCOE 3ABLE 2DYSE 1OCRE 2DYRE 2ZXWE 2EIME 5B1AE 1V54E 3ASOE 5B1BE 3AG3E 1OCZE 3ASNE 3ABME 1V55E 2EILE 3AG1E 2EIJE 3AG2E 1OCCE
chains in the Genus database with same CATH superfamily
1Z5SC 3L9TA 5C1DA 4HQDA 3SFYA 1DC2A 1HG5A 2DYRE 2WMNA 3CVUA 1OCZE 3L22A 2I1JA 2R5SA 3Q9NC 3ZXSA 4C0EA 1D9SA 2ZIRA 4DI3A 3IXEA 2KBXA 5ANRA 2WQHA 2XGOA 4PUCA 3PUJA 3UIOC 5EDSA 3HIZA 4N2SA 4RVBA 3FU6A 5AAOA 3KSLA 2C2LA 1E90A 1EDUA 2E2EA 1FPPA 3DSWA 2MRIA 1KT0A 3TGOA 2J4BA 2VQ2A 3GZ2A 4DX5D 4UWLA 1EYHA 2YHCA 4JHRA 4YDEA 5FZSA 4UQZA 4J8YA 3IHYA 3CVVA 3CR3A 2AXUA 3QNKA 3ZYMA 5BPPA 3ASHA 4APFA 4FC8A 3V30A 4HBDA 1BU9A 2OEVA 3CQGB 2IQCA 4MRUA 4RLYA 2PQNA 1LTXA 1HX8A 5JJTA 4HLLA 1VDYA 4FLBA 1P5QA 4WWPA 3SBSA 4BSZB 4GYWA 1MQSA 3D9MA 2RD0A 4FA6A 3SZ7A 2UY1A 2F8XK 3L6AA 4RG6A 2LAHA 3DRAA 3ABME 4HOQA 3JQ0A 3P2BA 4BFRA 4ME2A 2X6IA 2XGMA 5BUZA 1QYMA 3RRUA 2OVBA 3CKCA 3DEOA 4PS3A 5EYLA 4G25A 1N4RA 2CHXA 3W9GA 1MX4A 3C98A 3CEQA 3Q5MA 3TXNA 2EIJE 3EHNA 3FUHA 5AQBA 3C3OA 1NP7A 3QJZA 3D9KA 2X3MA 4ILIA 2H6FA 3AG4E 3U9WA 5CEAA 4N39A 5FINA 1YA0A 4LRZA 5CCLA 4LNBA 2KCKA 4NURA 3AS5A 3ZRHA 4NQ0A 2XPIA 3OTNA 2XS8A 4J6IA 2M63A 4LG6A 4FJYA 4NACA 2BEDA 5JJ6A 2KCVA 4MS6A 2PL2A 3G2SA 3LY7A 1SW6A 2XRYA 3L17A 4H7YA 4U0SA 2QYUA 3ZKJA 3VTXA 2J4DA 3TWQA 3ZW3A 1EPUA 5A6CA 2UWJG 4KVMA 3SD5A 3JYSA 5ARGA 3TWVA 3WXXA 3EUVA 1E8ZA 3CHOA 3PZ2A 3U4TA 1H0AA 3CSFA 4BWRA 3FTSA 4PDXA 1X81A 3SY2A 3ESLA 1UOHA 5A7DB 1WG0A 3NQPA 2LXMA 1BI7B 4UWFA 5BT1A 5KJKA 1QZ2A 4AP2A 4J7WA 1RW2A 3FUIA 2LSUA 2QC9A 2XQ0A 3MKRA 4TUMA 2PNNA 2R03A 1N95A 3D9OA 5HQ8A 3EHMA 1AWCB 3IV0A 1DVPA 4DLOA 1NA3A 3HVEA 5KWDA 5FWQA 3FTUA 3NF1A 1TJFA 5BV0A 2XZDG 3DXKG 2VJ8A 3ASDA 1H2TC 5ENPD 2WXHA 2I9CA 4HS2A 4CRWA 3S7DA 2IO3C 5T4YA 1OXJA 3FY4A 2OEWA 4WAFA 3LYAA 2DCPA 2XENA 3LJNA 4F7AA 3HRAA 5AJDA 4N5QA 3JXJA 4OVUA 1MX6A 5KNHD 1O1RA 4U96D 1IHGA 1SQMA 4K5BA 5JHAA 2WXLA 2IONA 5G05C 2J09A 2QZAA 3SFXA 4HOTA 3FU3A 3QWPA 1JUQA 2LUHA 2CHWA 3MKQA 2H6HA 1Z6TA 4J8EA 3NB2A 2WXFA 3L82A 4Y6WA 1FT2A 4RSYA 3PS6A 4GTVA 4GZ3A 4EPZA 2IU1A 3B7BA 3NOCD 3ZYKA 3S7FA 3V2OA 3R9AB 2J49A 1OWMA 2R59A 3D9NA 3Q15A 2XGSA 4AY6A 4GTSA 4JEHA 1MHQA 4J8SA 3QOUA 4XX5A 3UM0A 4FLHA 1SVXA 3ZUVB 5AIJA 5EYPF 2OCCE 2PZIA 5BW8C 3V2XA 4LNGA 3CVYA 2DVWA 3LJ3A 4M7CA 4EBAG 3BUAA 3GYZA 5EN5D 3SQVA 5HKPA 4EHMA 3Q9UC 3CVQA 2XZTG 4U0ZA 5BV1A 5FT9A 3MJWA 1SA5A 2V4LA 3UT4A 2WXMA 2WXNA 4ANUA 4CCAA 1DCEA 1FVHA 3HDXA 1UJKA 4G8KA 5LCWJ 3LXUX 3TXMA 4GZCA 2LSVA 3PH0C 3SGHA 3W9FA 2A5UA 2YQ8A 4TXPA 3ABKE 1H6KA 3CVLA 2Y0BG 4HORA 3UI2A 3CVXA 3IKOB 2B6CA 1LD7A 1TNUA 3AG1E 1MX2A 4HVBA 4YDWA 1E8WA 5AYWD 1HXIA 2MOWA 2IJGX 3C3RA 3ZIMA 4G24A 4CT4A 2I1KA 2AXZA 3DPYA 2X6JA 3RK6A 3E34A 3FU5A 3TJPA 5KJLA 4KZ0A 2V4HC 4IULA 1N94A 3TAXA 1U3CA 2P9UG 4GMLA 3UPVA 2C0MA 4JC8A 2HE0A 1UN8A 3AG2E 5AENA 3RU0A 1IYGA 5FZRA 4WWOA 4FHJA 2F8YA 5AJLA 4OVVA 4IN3B 4HB5A 3TWRA 3C5RA 1HH8A 5JHBA 1O5MA 1TJCA 4CDNA 4U0UA 4JA9A 3CHQA 4JXTA 5AQAA 1E8YA 4GZ6A 2QFCA 2DZOA 3ZHEA 4GB9A 4LEUA 3S7JA 2CFZA 2GRPB 3ASFA 4AXHA 3KSQA 5G04C 1IKND 5ITZF 5FQ6A 4MLPA 4N3AA 3FWVA 1U2VG 4WNEA 2XCCA 2R2LA 4FULA 4GAAA 5CMYA 1B89A 4B94A 4MKTA 2BKKB 1OCOE 4HI8A 3EU5A 5A23A 1L5JA 1XNFA 2P9SG 2X6KA 3SNXA 4A3VA 4FU3A 1NL4A 4B89A 1UN9A 4HI9A 2IFUA 3TG5A 4CZ2D 2GRQB 2V0PA 5E76A 4X8QA 3NZSA 4BERA 3B7UX 2P2CP 2WXPA 2Y69E 4GTTA 1A5EA 4AOFA 4GPMA 4HRLA 4HFGA 1SZAA 5BNWA 3DSXA 3L08A 4DJAA 3EJNA 1FT1A 3ESKA 3CVWA 3R9MA 3TG4A 2GRNB 2X6HA 3QWVA 4L23A 1TN7A 2LXLA 2PM7A 3OXLA 2LNIA 1TEZA 1UG3A 3RKVA 2ZGGA 2ETCA 3SO8A 3DPDA 1N4PA 3FEXA 3HXDA 3O48A 3CK7A 4OAVB 5LFAA 3HG0D 3T5XA 4GPKA 3FH8A 3ZNGA 3UINC 4FJZA 2XRZA 2EIKE 4FP7A 4FHKA 1TNBA 3ZEFA 3BG0B 2ZXWE 4GTQA 2EQXA 1Y8MA 3FFLA 1KZOA 4KYOB 3FTYA 4UWKA 3ENEA 3RJVA 4HRNA 1ELKA 1WY6A 4DRXE 2UY1B 4J8FA 4PS7A 4BETA 4Z68A 4WNFA 5CHEE 3TWUA 5EKQD 3Q7FA 3CK9A 4I9CA 3IHVA 2NXPA 1H6OA 3O4ZA 2BF0X 4CGWA 5AN8A 3LKUA 3APCA 2KC7A 4UWGA 4IRUA 1O1SA 2X38A 1HE8A 4BY6A 4I6EA 2V5QC 2VYIA 4ANXA 3GZSA 2R02A 2RG8A 1ELWA 5C2YA 1GW6A 2VTBA 4GTOA 3TWWA 2EIME 2WQ6A 4RG9A 3SHFA 2VSYA 2XHEA 1YCSB 3RIBA 4WUYA 3RO3A 1N0QA 2P9IG 2DBAA 3D3MA 2WXOA 3C72A 4ACKA 3U66A 2RFAA 2DYSE 3MYVA 4OAUC 4GTMA 3SFZA 3R7QA 2GROB 3V79K 1K3ZD 2FI7A 2NC9A 5KNGA 5CMWA 2WXRA 5CEDB 2P9PG 2MHKA 2F0YA 1UJJA 4N5CA 3DXMG 2VGEA 4N3BA 3TWXA 3RRNB 2BKGA 2HR2A 4CDMA 1PAQA 5D0QD 2FO7A 1MJ0A 3MV3B 2L9BA 4UQYA 1E7VA 4AJWA 3K9IA 4YDOA 2A5EA 3HVEB 2VSOE 3JUIA 3LDZA 1JCSA 3APFA 3E30A 3MA5A 5FJYA 4CT0A 1BD8A 3JCKC 3ISMC 4V3IA 3GW4A 3UKUG 3PZ1A 2X6FA 3CVNA 2Y1LE 3GZ1A 4G8LA 4G11A 4O1PA 5B3SE 3ZVVA 2FBNA 3P1UA 3PNTB 2JLBA 4K0RA 3AS8A 3U64A 5KJNA 3UKRG 3APDA 4EZLA 2XEEA 4KZCA 3LPZA 3VLFA 2KCLA 2AXVA 3VLDA 3PE4A 3OXGA 2H6IA 3EHQA 4CEMA 4GTPA 5D0OD 1V55E 4G26A 2ZGDA 4B8CB 3UM1A 2WXIA 1N4SA 3MGBA 2ETBA 1INZA 4LUNU 3G2WA 3ZXPA 3DSSA 3MKQB 1D8EA 3D9IA 4H7XA 1JCQA 4LSZE 2NSZA 3HXBA 4IYPA 5EIDA 2B0OE 4W9RA 3ULEG 4JEUA 2HO1A 2IOSA 3BEEA 2HM8A 1N9AA 4WNDA 2Y4TA 3QB2A 1S70B 3N71A 1DNPA 3CHMA 3S7BA 3J5QB 4GTRA 1MYOA 4AIFA 1ZU2A 5ENOD 2J8SD 4PS8A 3Q75A 5FIOA 2F37A 4GA0A 3UQ3A 4GZDA 3KAEA 4K03A 5T8IA 2BTDA 5IY5E 4DUIA 3KS2A 5G05J 1N4QA 1KZPA 4A63B 3I4GA 4J0UA 4GCNA 1HZ4A 4ANVA 5ENSD 2C0LA 5LOZA 3AU4A 1HF8A 5G2NA 4AY5A 3PEUB 1LD8A 4G2VA 4BTAA 3J5PA 3ZPJA 1E96B 1EF1C 3PZ4A 3FTWA 4YDYA 2GRMA 2KXPC 3UT7A 2VGYA 2Y3AA 4BSXA 4BX9A 5H7PA 3CHRA 4Q96A 4HLEA 3RO2A 1YYHA 2VSXE 1S0PA 2J08A 3IEGA 2OVFA 2FO1E 4XZ4A 1WDYA 1ZBPA 1WAO1 2I6HA 4L7TA 3VLEA 5HRYA 4JB8P 2YINA 4E6HA 2AW6A 3ZFWA 3Q49B 2WVIA 4UI9C 3UT8A 1NA0A 2EILE 3G2VA 3FTVA 2P9NG 4ATZD 2OOEA 2KZTA 4U04A 4U95D 3B7SA 2L6JA 4WWNA 4JPSA 3F6QA 3LS8A 2E0IA 3NZUA 5HI7A 4A1GA 3OAWA 3HXEA 2WXJA 2ETAA 5E75A 4U8YD 2AWIA 5J08A 3VTYA 5CCMA 5CECB 3T5VA 2CG2A 3QK0A 3ZHEB 3AJIA 3HYMB 3HXFA 3LY8A 1OUVA 4I1AA 4GZ5A 3X2QE 3CLJA 2R05A 1S63A 3RSEG 4FADA 1MZCA 3FUKA 3PVLA 4Q69A 3PZDA 2GRLA 1ELRA 1JPLA 3FU0A 4I6GA 4L2LA 1X5BA 3RAUA 4UQXA 4J8DA 2WMOA 4B0ZA 1KPSB 2BUGA 3FUEA 4YVQC 3ZYLA 4P29A 5HS0A 2XEVA 2J9QA 5AARA 3FDHA 5G55A 4BT9A 2IY0C 4XKBA 2VGXA 1IHBA 5B1AE 1A17A 3QKYA 3FULA 5B1BE 3FTZA 4C48B 3FTXA 3ZU7B 1NI1A 3D9LA 4CGVA 1HG2A 4N2QA 2I2OA 4XKCA 4AV7A 3CQCB 1DCQA 4XEIG 5D66A 5ARFA 1N11A 4I6JA 4HXIA 2KM4A 1ZB1A 3B7RL 3EU9A 2Y4UA 2KATA 3CIAA 2L6BA 4JHKA 5BXUA 4E85A 4QQIA 3QC1A 2L0IA 1SZ9A 2V8SE 3L16A 3C3QA 3FEYA 3FUFA 1HU3A 5EIBE 3Q73A 3I3NA 1BPOA 3ML9A 4TV3A 1OWOA 3NOGD 3DBSA 1TNOA 3Q7AA 3UUXA 4DX7D 4QFVA 4L1BA 1JCRA 1Z3XA 2CG3A 2YHEA 4EZJA 4MBGA 4BT8A 4AEZC 3MEKA 2AVPA 3AG3E 4PH4B 4N3CA 3UTMA 4RQIA 3KEZA 1OWPA 1IQRA 5FZQA 1S64A 3DEPA 4GA2A 3UMVA 1PC2A 4JZYA 3NBNB 4DK5A 2CHZA 3JUEA 3UX4A 3Q78A 3PDNA 4G1TA 4TXRA 4ABNA 4URKA 4BTBA 4NIKA 3LEWA 4F1SA 3QWWA 5AQ9A 1JWFA 4KT6B 4AVXA 1N54A 3KD7A 3E33A 5J90A 4K5CA 1O1TA 3D9JA 1QQEA 4XIFA 3V31A 2J07A 2R17C 4TUUA 3Q4AB 2QY7A 3NAWA 5DBKA 2PM6A 3ULYA 3CSTA 4ACLA 3L54A 2VTBB 5M72A 2Q7FA 3UXGA 4DLQA 1V54E 4JVSA 3RRMB 3ULQA 3JXIA 4C0MA 5BXOA 3PUKA 3URZA 4WNGA 3Q47B 4A55A 3AU5A 3ML8A 3ZYQA 1BI8B 1H2VC 4EBAA 3KEAA 4GYOA 3DSTA 5KJMA 4I2ZA 4F53A 4KBQA 4Y6CA 4F1PA 3ASGA 1Y6IA 1LF8A 3AAAC 4F6RD 4U8VD 3BQOA 4ILGA 4ZHBA 3WG7E 1HO8A 4YNDA 1TNZA 4JHJA 4B8AA 5JA4D 1JWGA 3U3WA 3TL5A 5FQ8A 2WM9A 2XPZA 2IOLA 3EIJA 2WXQA 3EIQC 4GMRA 3LVQE 3L13A 3MZLB 3MV2B 1SA4A 3ASOE 3AS4A 2GRRB 3FP3A 1HFAA 1H19A 1K8KG 5T3RA 1OT8A 3DWLG 1G3NB 2LO6A 3DSVA 3B7TA 4HOUA 4XI0A 4BEPA 5FTPA 3MCXA 1N52A 2P9KG 4GU5A 1TN8A 2P9LG 1E7UA 4JD2G 4CDRA 4HNAD 1TR4A 3CGHA 4I1OB 1K1AA 2LAIA 4I17A 3LVRE 3LCAA 2JABA 1FVFA 1YMPA 3SF4A 3EDTB 3ONLA 3SI5A 4EQFA 4I43A 2XS1A 5LP0A 5CERB 4I2WA 3MX3A 4I9EA 3T9KA 3ZN3A 4HOSA 2DIWA 3T8MA 2GGFA 3IBEA 1WM5A 2GW1A 2EINE 5EX0A 1H2UA 1H6PA 3TWSA 4O6FA 1N0RA 3BG1B 3I5PA 1TNYA 2HYZA 5CRUA 1OY3D 4Q94A 2OV8A 4EECA 5ENQD 4DX2A 5EX3A 2YNQA 4K5AB 3FUNA 2XCBA 4F3VA 5KBAA 2CFUA 2XEHA 3OXFA 2WQ7A 1D8DA 4A1SA 5LCWC 4U7EB 2XPYA 4APOA 1TN6A 5ANLA 3UM2A 3PEVB 4I1MA 5EILA 3R7RA 2WXGA 2MYOA 3CVPA 3I4RB 1KT1A 2P58C 3E37A 1OCCE 2WPVA 3HHMA 3PRZA 3HXCA 4U8HA 4BX8A 3LY9A 2WXKA 5ENRD 3T8KA 1PY1A 5FQ4A 1XGWA 2VSNA 3B95A 2H6GA 4AM9A 1U3DA 5AQ7A 4R7LA 2ONDA 3FUMA 3PREA 3UIPC 3FH5A 4UWHA 1AP7A 5ENTD 4KMOA 1OWLA 3CHSA 3G2UA 3D9HA 4JW1A 4D10C 2IO2C 4ZFHA 1Z3YA 2RKKA 4DPRA 2IF4A 1W3BA 1KLXA 3FUDA 2L0TB 4ILHB 3FUJA 4GMJA 2ZU6B 1NFIE 5FQ7A 1OCRE 3E32A 4LNUD 3D9PA 4XI9A 4OYSA 3CKBA 4O60A 4XE0A 1UW4B 3CV0A 2PQRA 1IQUA 1RZ4A 3QARA 2KZTB 5JMND 4U07A 2DWZA 4CYMD 1OWNA 4JA7A 1HS6A 3TWTA 5CBOA 2V5FA 4EZKA 4L2YA 1K1BA 1Q2ZA 4LERA 4BESA 3B13A 4ATGA 4LCTA 4M3OA 4G23A 2ILRA 4DI4A 4KVOA 4GA1A 4GCOA 3PNLB 2A4ZA 4DX6D 3G2TA 5CRVA 3FH7A 2FULA 1QNFA 4UI9K 3ASNE 1NZNA 4YVOA 3CHPA 4KXKB 2JEKA 4DX1A 5KCMA 4C9BB 4TXQA 4L9PA 5JJ7A 3QDNA 3BU8A 4TRQA 5D2MC 2DZNA 4UI9J 3SBTB 3PZ3A 3ABLE 4GYYA 3PE3A 3ZGQA 2ZISA 3FHEA 3S2AA 3ONKA 1QBQA 1TYQG 5ENNA 2RFMA 4JL0A 3EHRA 3E4BA 3QAQA 1BLXB 2WB2A 4ANWA 4O1OA 2AJAA 2VGXB 4B93B 4UUCA 3CK8A 4NRHB 5CBNA 1FCHA 1E8XA 3DSUA 2NYJA 5DIZA 2IEJA 3JQ1A 4A3TA 2FF4A 1IXVA 2FEZA 4HRMB 4U63A 3Q79A 5LX8A 2QYJA 5G04J 3UM3A
chains in the Genus database with same CATH topology
3ABKE 2Y69E 2EIKE 3WG7E 2EINE 3X2QE 3AG4E 5IY5E 2OCCE 5B3SE 1OCOE 3ABLE 2DYSE 1OCRE 2DYRE 2ZXWE 2EIME 5B1AE 1V54E 3ASOE 5B1BE 3AG3E 1OCZE 3ASNE 3ABME 1V55E 2EILE 3AG1E 2EIJE 3AG2E 1OCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABK E;  2Y69 E;  2EIK E;  3WG7 E;  2EIN E;  3X2Q E;  3AG4 E;  5IY5 E;  2OCC E;  5B3S E;  1OCO E;  3ABL E;  2DYS E;  1OCR E;  2DYR E;  2ZXW E;  2EIM E;  5B1A E;  1V54 E;  3ASO E;  5B1B E;  3AG3 E;  1OCZ E;  3ASN E;  3ABM E;  1V55 E;  2EIL E;  3AG1 E;  2EIJ E;  3AG2 E;  1OCC E; 
#chains in the Genus database with same CATH topology
 1Z5S C;  3L9T A;  5C1D A;  4HQD A;  3SFY A;  1DC2 A;  1HG5 A;  2DYR E;  2WMN A;  3CVU A;  1OCZ E;  3L22 A;  2I1J A;  2R5S A;  3Q9N C;  3ZXS A;  4C0E A;  1D9S A;  2ZIR A;  4DI3 A;  3IXE A;  2KBX A;  5ANR A;  2WQH A;  2XGO A;  4PUC A;  3PUJ A;  3UIO C;  5EDS A;  3HIZ A;  4N2S A;  4RVB A;  3FU6 A;  5AAO A;  3KSL A;  2C2L A;  1E90 A;  1EDU A;  2E2E A;  1FPP A;  3DSW A;  2MRI A;  1KT0 A;  3TGO A;  2J4B A;  2VQ2 A;  3GZ2 A;  4DX5 D;  4UWL A;  1EYH A;  2YHC A;  4JHR A;  4YDE A;  5FZS A;  4UQZ A;  4J8Y A;  3IHY A;  3CVV A;  3CR3 A;  2AXU A;  3QNK A;  3ZYM A;  5BPP A;  3ASH A;  4APF A;  4FC8 A;  3V30 A;  4HBD A;  1BU9 A;  2OEV A;  3CQG B;  2IQC A;  4MRU A;  4RLY A;  2PQN A;  1LTX A;  1HX8 A;  5JJT A;  4HLL A;  1VDY A;  4FLB A;  1P5Q A;  4WWP A;  3SBS A;  4BSZ B;  4GYW A;  1MQS A;  3D9M A;  2RD0 A;  4FA6 A;  3SZ7 A;  2UY1 A;  2F8X K;  3L6A A;  4RG6 A;  2LAH A;  3DRA A;  3ABM E;  4HOQ A;  3JQ0 A;  3P2B A;  4BFR A;  4ME2 A;  2X6I A;  2XGM A;  5BUZ A;  1QYM A;  3RRU A;  2OVB A;  3CKC A;  3DEO A;  4PS3 A;  5EYL A;  4G25 A;  1N4R A;  2CHX A;  3W9G A;  1MX4 A;  3C98 A;  3CEQ A;  3Q5M A;  3TXN A;  2EIJ E;  3EHN A;  3FUH A;  5AQB A;  3C3O A;  1NP7 A;  3QJZ A;  3D9K A;  2X3M A;  4ILI A;  2H6F A;  3AG4 E;  3U9W A;  5CEA A;  4N39 A;  5FIN A;  1YA0 A;  4LRZ A;  5CCL A;  4LNB A;  2KCK A;  4NUR A;  3AS5 A;  3ZRH A;  4NQ0 A;  2XPI A;  3OTN A;  2XS8 A;  4J6I A;  2M63 A;  4LG6 A;  4FJY A;  4NAC A;  2BED A;  5JJ6 A;  2KCV A;  4MS6 A;  2PL2 A;  3G2S A;  3LY7 A;  1SW6 A;  2XRY A;  3L17 A;  4H7Y A;  4U0S A;  2QYU A;  3ZKJ A;  3VTX A;  2J4D A;  3TWQ A;  3ZW3 A;  1EPU A;  5A6C A;  2UWJ G;  4KVM A;  3SD5 A;  3JYS A;  5ARG A;  3TWV A;  3WXX A;  3EUV A;  1E8Z A;  3CHO A;  3PZ2 A;  3U4T A;  1H0A A;  3CSF A;  4BWR A;  3FTS A;  4PDX A;  1X81 A;  3SY2 A;  3ESL A;  1UOH A;  5A7D B;  1WG0 A;  3NQP A;  2LXM A;  1BI7 B;  4UWF A;  5BT1 A;  5KJK A;  1QZ2 A;  4AP2 A;  4J7W A;  1RW2 A;  3FUI A;  2LSU A;  2QC9 A;  2XQ0 A;  3MKR A;  4TUM A;  2PNN A;  2R03 A;  1N95 A;  3D9O A;  5HQ8 A;  3EHM A;  1AWC B;  3IV0 A;  1DVP A;  4DLO A;  1NA3 A;  3HVE A;  5KWD A;  5FWQ A;  3FTU A;  3NF1 A;  1TJF A;  5BV0 A;  2XZD G;  3DXK G;  2VJ8 A;  3ASD A;  1H2T C;  5ENP D;  2WXH A;  2I9C A;  4HS2 A;  4CRW A;  3S7D A;  2IO3 C;  5T4Y A;  1OXJ A;  3FY4 A;  2OEW A;  4WAF A;  3LYA A;  2DCP A;  2XEN A;  3LJN A;  4F7A A;  3HRA A;  5AJD A;  4N5Q A;  3JXJ A;  4OVU A;  1MX6 A;  5KNH D;  1O1R A;  4U96 D;  1IHG A;  1SQM A;  4K5B A;  5JHA A;  2WXL A;  2ION A;  5G05 C;  2J09 A;  2QZA A;  3SFX A;  4HOT A;  3FU3 A;  3QWP A;  1JUQ A;  2LUH A;  2CHW A;  3MKQ A;  2H6H A;  1Z6T A;  4J8E A;  3NB2 A;  2WXF A;  3L82 A;  4Y6W A;  1FT2 A;  4RSY A;  3PS6 A;  4GTV A;  4GZ3 A;  4EPZ A;  2IU1 A;  3B7B A;  3NOC D;  3ZYK A;  3S7F A;  3V2O A;  3R9A B;  2J49 A;  1OWM A;  2R59 A;  3D9N A;  3Q15 A;  2XGS A;  4AY6 A;  4GTS A;  4JEH A;  1MHQ A;  4J8S A;  3QOU A;  4XX5 A;  3UM0 A;  4FLH A;  1SVX A;  3ZUV B;  5AIJ A;  5EYP F;  2OCC E;  2PZI A;  5BW8 C;  3V2X A;  4LNG A;  3CVY A;  2DVW A;  3LJ3 A;  4M7C A;  4EBA G;  3BUA A;  3GYZ A;  5EN5 D;  3SQV A;  5HKP A;  4EHM A;  3Q9U C;  3CVQ A;  2XZT G;  4U0Z A;  5BV1 A;  5FT9 A;  3MJW A;  1SA5 A;  2V4L A;  3UT4 A;  2WXM A;  2WXN A;  4ANU A;  4CCA A;  1DCE A;  1FVH A;  3HDX A;  1UJK A;  4G8K A;  5LCW J;  3LXU X;  3TXM A;  4GZC A;  2LSV A;  3PH0 C;  3SGH A;  3W9F A;  2A5U A;  2YQ8 A;  4TXP A;  3ABK E;  1H6K A;  3CVL A;  2Y0B G;  4HOR A;  3UI2 A;  3CVX A;  3IKO B;  2B6C A;  1LD7 A;  1TNU A;  3AG1 E;  1MX2 A;  4HVB A;  4YDW A;  1E8W A;  5AYW D;  1HXI A;  2MOW A;  2IJG X;  3C3R A;  3ZIM A;  4G24 A;  4CT4 A;  2I1K A;  2AXZ A;  3DPY A;  2X6J A;  3RK6 A;  3E34 A;  3FU5 A;  3TJP A;  5KJL A;  4KZ0 A;  2V4H C;  4IUL A;  1N94 A;  3TAX A;  1U3C A;  2P9U G;  4GML A;  3UPV A;  2C0M A;  4JC8 A;  2HE0 A;  1UN8 A;  3AG2 E;  5AEN A;  3RU0 A;  1IYG A;  5FZR A;  4WWO A;  4FHJ A;  2F8Y A;  5AJL A;  4OVV A;  4IN3 B;  4HB5 A;  3TWR A;  3C5R A;  1HH8 A;  5JHB A;  1O5M A;  1TJC A;  4CDN A;  4U0U A;  4JA9 A;  3CHQ A;  4JXT A;  5AQA A;  1E8Y A;  4GZ6 A;  2QFC A;  2DZO A;  3ZHE A;  4GB9 A;  4LEU A;  3S7J A;  2CFZ A;  2GRP B;  3ASF A;  4AXH A;  3KSQ A;  5G04 C;  1IKN D;  5ITZ F;  5FQ6 A;  4MLP A;  4N3A A;  3FWV A;  1U2V G;  4WNE A;  2XCC A;  2R2L A;  4FUL A;  4GAA A;  5CMY A;  1B89 A;  4B94 A;  4MKT A;  2BKK B;  1OCO E;  4HI8 A;  3EU5 A;  5A23 A;  1L5J A;  1XNF A;  2P9S G;  2X6K A;  3SNX A;  4A3V A;  4FU3 A;  1NL4 A;  4B89 A;  1UN9 A;  4HI9 A;  2IFU A;  3TG5 A;  4CZ2 D;  2GRQ B;  2V0P A;  5E76 A;  4X8Q A;  3NZS A;  4BER A;  3B7U X;  2P2C P;  2WXP A;  2Y69 E;  4GTT A;  1A5E A;  4AOF A;  4GPM A;  4HRL A;  4HFG A;  1SZA A;  5BNW A;  3DSX A;  3L08 A;  4DJA A;  3EJN A;  1FT1 A;  3ESK A;  3CVW A;  3R9M A;  3TG4 A;  2GRN B;  2X6H A;  3QWV A;  4L23 A;  1TN7 A;  2LXL A;  2PM7 A;  3OXL A;  2LNI A;  1TEZ A;  1UG3 A;  3RKV A;  2ZGG A;  2ETC A;  3SO8 A;  3DPD A;  1N4P A;  3FEX A;  3HXD A;  3O48 A;  3CK7 A;  4OAV B;  5LFA A;  3HG0 D;  3T5X A;  4GPK A;  3FH8 A;  3ZNG A;  3UIN C;  4FJZ A;  2XRZ A;  2EIK E;  4FP7 A;  4FHK A;  1TNB A;  3ZEF A;  3BG0 B;  2ZXW E;  4GTQ A;  2EQX A;  1Y8M A;  3FFL A;  1KZO A;  4KYO B;  3FTY A;  4UWK A;  3ENE A;  3RJV A;  4HRN A;  1ELK A;  1WY6 A;  4DRX E;  2UY1 B;  4J8F A;  4PS7 A;  4BET A;  4Z68 A;  4WNF A;  5CHE E;  3TWU A;  5EKQ D;  3Q7F A;  3CK9 A;  4I9C A;  3IHV A;  2NXP A;  1H6O A;  3O4Z A;  2BF0 X;  4CGW A;  5AN8 A;  3LKU A;  3APC A;  2KC7 A;  4UWG A;  4IRU A;  1O1S A;  2X38 A;  1HE8 A;  4BY6 A;  4I6E A;  2V5Q C;  2VYI A;  4ANX A;  3GZS A;  2R02 A;  2RG8 A;  1ELW A;  5C2Y A;  1GW6 A;  2VTB A;  4GTO A;  3TWW A;  2EIM E;  2WQ6 A;  4RG9 A;  3SHF A;  2VSY A;  2XHE A;  1YCS B;  3RIB A;  4WUY A;  3RO3 A;  1N0Q A;  2P9I G;  2DBA A;  3D3M A;  2WXO A;  3C72 A;  4ACK A;  3U66 A;  2RFA A;  2DYS E;  3MYV A;  4OAU C;  4GTM A;  3SFZ A;  3R7Q A;  2GRO B;  3V79 K;  1K3Z D;  2FI7 A;  2NC9 A;  5KNG A;  5CMW A;  2WXR A;  5CED B;  2P9P G;  2MHK A;  2F0Y A;  1UJJ A;  4N5C A;  3DXM G;  2VGE A;  4N3B A;  3TWX A;  3RRN B;  2BKG A;  2HR2 A;  4CDM A;  1PAQ A;  5D0Q D;  2FO7 A;  1MJ0 A;  3MV3 B;  2L9B A;  4UQY A;  1E7V A;  4AJW A;  3K9I A;  4YDO A;  2A5E A;  3HVE B;  2VSO E;  3JUI A;  3LDZ A;  1JCS A;  3APF A;  3E30 A;  3MA5 A;  5FJY A;  4CT0 A;  1BD8 A;  3JCK C;  3ISM C;  4V3I A;  3GW4 A;  3UKU G;  3PZ1 A;  2X6F A;  3CVN A;  2Y1L E;  3GZ1 A;  4G8L A;  4G11 A;  4O1P A;  5B3S E;  3ZVV A;  2FBN A;  3P1U A;  3PNT B;  2JLB A;  4K0R A;  3AS8 A;  3U64 A;  5KJN A;  3UKR G;  3APD A;  4EZL A;  2XEE A;  4KZC A;  3LPZ A;  3VLF A;  2KCL A;  2AXV A;  3VLD A;  3PE4 A;  3OXG A;  2H6I A;  3EHQ A;  4CEM A;  4GTP A;  5D0O D;  1V55 E;  4G26 A;  2ZGD A;  4B8C B;  3UM1 A;  2WXI A;  1N4S A;  3MGB A;  2ETB A;  1INZ A;  4LUN U;  3G2W A;  3ZXP A;  3DSS A;  3MKQ B;  1D8E A;  3D9I A;  4H7X A;  1JCQ A;  4LSZ E;  2NSZ A;  3HXB A;  4IYP A;  5EID A;  2B0O E;  4W9R A;  3ULE G;  4JEU A;  2HO1 A;  2IOS A;  3BEE A;  2HM8 A;  1N9A A;  4WND A;  2Y4T A;  3QB2 A;  1S70 B;  3N71 A;  1DNP A;  3CHM A;  3S7B A;  3J5Q B;  4GTR A;  1MYO A;  4AIF A;  1ZU2 A;  5ENO D;  2J8S D;  4PS8 A;  3Q75 A;  5FIO A;  2F37 A;  4GA0 A;  3UQ3 A;  4GZD A;  3KAE A;  4K03 A;  5T8I A;  2BTD A;  5IY5 E;  4DUI A;  3KS2 A;  5G05 J;  1N4Q A;  1KZP A;  4A63 B;  3I4G A;  4J0U A;  4GCN A;  1HZ4 A;  4ANV A;  5ENS D;  2C0L A;  5LOZ A;  3AU4 A;  1HF8 A;  5G2N A;  4AY5 A;  3PEU B;  1LD8 A;  4G2V A;  4BTA A;  3J5P A;  3ZPJ A;  1E96 B;  1EF1 C;  3PZ4 A;  3FTW A;  4YDY A;  2GRM A;  2KXP C;  3UT7 A;  2VGY A;  2Y3A A;  4BSX A;  4BX9 A;  5H7P A;  3CHR A;  4Q96 A;  4HLE A;  3RO2 A;  1YYH A;  2VSX E;  1S0P A;  2J08 A;  3IEG A;  2OVF A;  2FO1 E;  4XZ4 A;  1WDY A;  1ZBP A;  1WAO 1;  2I6H A;  4L7T A;  3VLE A;  5HRY A;  4JB8 P;  2YIN A;  4E6H A;  2AW6 A;  3ZFW A;  3Q49 B;  2WVI A;  4UI9 C;  3UT8 A;  1NA0 A;  2EIL E;  3G2V A;  3FTV A;  2P9N G;  4ATZ D;  2OOE A;  2KZT A;  4U04 A;  4U95 D;  3B7S A;  2L6J A;  4WWN A;  4JPS A;  3F6Q A;  3LS8 A;  2E0I A;  3NZU A;  5HI7 A;  4A1G A;  3OAW A;  3HXE A;  2WXJ A;  2ETA A;  5E75 A;  4U8Y D;  2AWI A;  5J08 A;  3VTY A;  5CCM A;  5CEC B;  3T5V A;  2CG2 A;  3QK0 A;  3ZHE B;  3AJI A;  3HYM B;  3HXF A;  3LY8 A;  1OUV A;  4I1A A;  4GZ5 A;  3X2Q E;  3CLJ A;  2R05 A;  1S63 A;  3RSE G;  4FAD A;  1MZC A;  3FUK A;  3PVL A;  4Q69 A;  3PZD A;  2GRL A;  1ELR A;  1JPL A;  3FU0 A;  4I6G A;  4L2L A;  1X5B A;  3RAU A;  4UQX A;  4J8D A;  2WMO A;  4B0Z A;  1KPS B;  2BUG A;  3FUE A;  4YVQ C;  3ZYL A;  4P29 A;  5HS0 A;  2XEV A;  2J9Q A;  5AAR A;  3FDH A;  5G55 A;  4BT9 A;  2IY0 C;  4XKB A;  2VGX A;  1IHB A;  5B1A E;  1A17 A;  3QKY A;  3FUL A;  5B1B E;  3FTZ A;  4C48 B;  3FTX A;  3ZU7 B;  1NI1 A;  3D9L A;  4CGV A;  1HG2 A;  4N2Q A;  2I2O A;  4XKC A;  4AV7 A;  3CQC B;  1DCQ A;  4XEI G;  5D66 A;  5ARF A;  1N11 A;  4I6J A;  4HXI A;  2KM4 A;  1ZB1 A;  3B7R L;  3EU9 A;  2Y4U A;  2KAT A;  3CIA A;  2L6B A;  4JHK A;  5BXU A;  4E85 A;  4QQI A;  3QC1 A;  2L0I A;  1SZ9 A;  2V8S E;  3L16 A;  3C3Q A;  3FEY A;  3FUF A;  1HU3 A;  5EIB E;  3Q73 A;  3I3N A;  1BPO A;  3ML9 A;  4TV3 A;  1OWO A;  3NOG D;  3DBS A;  1TNO A;  3Q7A A;  3UUX A;  4DX7 D;  4QFV A;  4L1B A;  1JCR A;  1Z3X A;  2CG3 A;  2YHE A;  4EZJ A;  4MBG A;  4BT8 A;  4AEZ C;  3MEK A;  2AVP A;  3AG3 E;  4PH4 B;  4N3C A;  3UTM A;  4RQI A;  3KEZ A;  1OWP A;  1IQR A;  5FZQ A;  1S64 A;  3DEP A;  4GA2 A;  3UMV A;  1PC2 A;  4JZY A;  3NBN B;  4DK5 A;  2CHZ A;  3JUE A;  3UX4 A;  3Q78 A;  3PDN A;  4G1T A;  4TXR A;  4ABN A;  4URK A;  4BTB A;  4NIK A;  3LEW A;  4F1S A;  3QWW A;  5AQ9 A;  1JWF A;  4KT6 B;  4AVX A;  1N54 A;  3KD7 A;  3E33 A;  5J90 A;  4K5C A;  1O1T A;  3D9J A;  1QQE A;  4XIF A;  3V31 A;  2J07 A;  2R17 C;  4TUU A;  3Q4A B;  2QY7 A;  3NAW A;  5DBK A;  2PM6 A;  3ULY A;  3CST A;  4ACL A;  3L54 A;  2VTB B;  5M72 A;  2Q7F A;  3UXG A;  4DLQ A;  1V54 E;  4JVS A;  3RRM B;  3ULQ A;  3JXI A;  4C0M A;  5BXO A;  3PUK A;  3URZ A;  4WNG A;  3Q47 B;  4A55 A;  3AU5 A;  3ML8 A;  3ZYQ A;  1BI8 B;  1H2V C;  4EBA A;  3KEA A;  4GYO A;  3DST A;  5KJM A;  4I2Z A;  4F53 A;  4KBQ A;  4Y6C A;  4F1P A;  3ASG A;  1Y6I A;  1LF8 A;  3AAA C;  4F6R D;  4U8V D;  3BQO A;  4ILG A;  4ZHB A;  3WG7 E;  1HO8 A;  4YND A;  1TNZ A;  4JHJ A;  4B8A A;  5JA4 D;  1JWG A;  3U3W A;  3TL5 A;  5FQ8 A;  2WM9 A;  2XPZ A;  2IOL A;  3EIJ A;  2WXQ A;  3EIQ C;  4GMR A;  3LVQ E;  3L13 A;  3MZL B;  3MV2 B;  1SA4 A;  3ASO E;  3AS4 A;  2GRR B;  3FP3 A;  1HFA A;  1H19 A;  1K8K G;  5T3R A;  1OT8 A;  3DWL G;  1G3N B;  2LO6 A;  3DSV A;  3B7T A;  4HOU A;  4XI0 A;  4BEP A;  5FTP A;  3MCX A;  1N52 A;  2P9K G;  4GU5 A;  1TN8 A;  2P9L G;  1E7U A;  4JD2 G;  4CDR A;  4HNA D;  1TR4 A;  3CGH A;  4I1O B;  1K1A A;  2LAI A;  4I17 A;  3LVR E;  3LCA A;  2JAB A;  1FVF A;  1YMP A;  3SF4 A;  3EDT B;  3ONL A;  3SI5 A;  4EQF A;  4I43 A;  2XS1 A;  5LP0 A;  5CER B;  4I2W A;  3MX3 A;  4I9E A;  3T9K A;  3ZN3 A;  4HOS A;  2DIW A;  3T8M A;  2GGF A;  3IBE A;  1WM5 A;  2GW1 A;  2EIN E;  5EX0 A;  1H2U A;  1H6P A;  3TWS A;  4O6F A;  1N0R A;  3BG1 B;  3I5P A;  1TNY A;  2HYZ A;  5CRU A;  1OY3 D;  4Q94 A;  2OV8 A;  4EEC A;  5ENQ D;  4DX2 A;  5EX3 A;  2YNQ A;  4K5A B;  3FUN A;  2XCB A;  4F3V A;  5KBA A;  2CFU A;  2XEH A;  3OXF A;  2WQ7 A;  1D8D A;  4A1S A;  5LCW C;  4U7E B;  2XPY A;  4APO A;  1TN6 A;  5ANL A;  3UM2 A;  3PEV B;  4I1M A;  5EIL A;  3R7R A;  2WXG A;  2MYO A;  3CVP A;  3I4R B;  1KT1 A;  2P58 C;  3E37 A;  1OCC E;  2WPV A;  3HHM A;  3PRZ A;  3HXC A;  4U8H A;  4BX8 A;  3LY9 A;  2WXK A;  5ENR D;  3T8K A;  1PY1 A;  5FQ4 A;  1XGW A;  2VSN A;  3B95 A;  2H6G A;  4AM9 A;  1U3D A;  5AQ7 A;  4R7L A;  2OND A;  3FUM A;  3PRE A;  3UIP C;  3FH5 A;  4UWH A;  1AP7 A;  5ENT D;  4KMO A;  1OWL A;  3CHS A;  3G2U A;  3D9H A;  4JW1 A;  4D10 C;  2IO2 C;  4ZFH A;  1Z3Y A;  2RKK A;  4DPR A;  2IF4 A;  1W3B A;  1KLX A;  3FUD A;  2L0T B;  4ILH B;  3FUJ A;  4GMJ A;  2ZU6 B;  1NFI E;  5FQ7 A;  1OCR E;  3E32 A;  4LNU D;  3D9P A;  4XI9 A;  4OYS A;  3CKB A;  4O60 A;  4XE0 A;  1UW4 B;  3CV0 A;  2PQR A;  1IQU A;  1RZ4 A;  3QAR A;  2KZT B;  5JMN D;  4U07 A;  2DWZ A;  4CYM D;  1OWN A;  4JA7 A;  1HS6 A;  3TWT A;  5CBO A;  2V5F A;  4EZK A;  4L2Y A;  1K1B A;  1Q2Z A;  4LER A;  4BES A;  3B13 A;  4ATG A;  4LCT A;  4M3O A;  4G23 A;  2ILR A;  4DI4 A;  4KVO A;  4GA1 A;  4GCO A;  3PNL B;  2A4Z A;  4DX6 D;  3G2T A;  5CRV A;  3FH7 A;  2FUL A;  1QNF A;  4UI9 K;  3ASN E;  1NZN A;  4YVO A;  3CHP A;  4KXK B;  2JEK A;  4DX1 A;  5KCM A;  4C9B B;  4TXQ A;  4L9P A;  5JJ7 A;  3QDN A;  3BU8 A;  4TRQ A;  5D2M C;  2DZN A;  4UI9 J;  3SBT B;  3PZ3 A;  3ABL E;  4GYY A;  3PE3 A;  3ZGQ A;  2ZIS A;  3FHE A;  3S2A A;  3ONK A;  1QBQ A;  1TYQ G;  5ENN A;  2RFM A;  4JL0 A;  3EHR A;  3E4B A;  3QAQ A;  1BLX B;  2WB2 A;  4ANW A;  4O1O A;  2AJA A;  2VGX B;  4B93 B;  4UUC A;  3CK8 A;  4NRH B;  5CBN A;  1FCH A;  1E8X A;  3DSU A;  2NYJ A;  5DIZ A;  2IEJ A;  3JQ1 A;  4A3T A;  2FF4 A;  1IXV A;  2FEZ A;  4HRM B;  4U63 A;  3Q79 A;  5LX8 A;  2QYJ A;  5G04 J;  3UM3 A; 
#chains in the Genus database with same CATH homology
 3ABK E;  2Y69 E;  2EIK E;  3WG7 E;  2EIN E;  3X2Q E;  3AG4 E;  5IY5 E;  2OCC E;  5B3S E;  1OCO E;  3ABL E;  2DYS E;  1OCR E;  2DYR E;  2ZXW E;  2EIM E;  5B1A E;  1V54 E;  3ASO E;  5B1B E;  3AG3 E;  1OCZ E;  3ASN E;  3ABM E;  1V55 E;  2EIL E;  3AG1 E;  2EIJ E;  3AG2 E;  1OCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...