1V55E

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1v55E00
2DYRE 1OCRE 2Y69E 1V54E 2DYSE 3AG3E 3AG1E 5B1BE 5IY5E 2EIJE 3AG4E 3ASOE 3ABME 3ABLE 1OCCE 2EIKE 3WG7E 2EILE 1OCOE 2EINE 2EIME 3AG2E 2ZXWE 3ASNE 5B3SE 3X2QE 1OCZE 2OCCE 5B1AE 3ABKE 1V55E
chains in the Genus database with same CATH superfamily
1BLXB 1L5JA 4GTRA 3PEUB 5C1DA 2DVWA 3CVXA 2OV8A 1MX6A 4B89A 3ASDA 1KZOA 4OYSA 1S0PA 4UI9C 2F37A 3CHSA 3X2QE 3LVRE 3D3MA 3OXFA 5FT9A 3PUKA 4CZ2D 4WWOA 3RRNB 1RW2A 1G3NB 2WXOA 5EIBE 1Z6TA 3PS6A 4N5QA 4HLLA 4AP2A 5ENQD 1DVPA 1N94A 3ZXPA 2WXMA 4HI8A 4CDRA 3G2WA 2MHKA 2KCKA 5AJLA 1KLXA 4B0ZA 4I1OB 3BG1B 3E34A 4QQIA 3G2TA 4IYPA 2V5QC 1FT1A 3DWLG 5FQ7A 5J08A 2ZXWE 4BT8A 2F8YA 3AAAC 3ZYQA 3PUJA 2PM7A 3TWWA 3BU8A 2VJ8A 3ASFA 1EYHA 3ML8A 5LP0A 1WG0A 3PVLA 4OAUC 3T8KA 4CT4A 3E33A 4AJWA 1JCQA 2C0MA 3Q49B 1HO8A 5CBOA 3E4BA 2YINA 3V30A 5CCLA 2GW1A 2GRQB 4AXHA 4I9CA 4UQXA 4B94A 2QYJA 1E8XA 4I6JA 4U07A 3SF4A 3LY7A 2ILRA 4WNDA 3PZ3A 5EIDA 3ESLA 1SQMA 3JCKC 3NOCD 3DBSA 3VLEA 3GZSA 4L1BA 4RG9A 4GMJA 1UN9A 2VGXB 3AS8A 3FUIA 1N9AA 4KZCA 2WPVA 4O1OA 3Q15A 5CHEE 1SZ9A 3HVEA 4U0UA 2R03A 2WXJA 3D9LA 4BTBA 2IOSA 3ZRHA 4CDMA 4KZ0A 2MRIA 1H6PA 3DPYA 4HXIA 3V31A 3R7QA 2LXLA 3D9IA 4JHJA 3B7TA 1SA4A 5BPPA 2XS8A 3PNTB 4GPMA 4BWRA 1AWCB 4BTAA 2WXIA 3G2UA 3Q9UC 4CGWA 2BF0X 3MX3A 2UY1B 4ZHBA 2Y4TA 5AQBA 1Y6IA 1NI1A 2I9CA 5AYWD 4U04A 3GZ1A 5ITZF 4HNAD 3UXGA 4XKBA 5AIJA 3SO8A 1Z3YA 3I5PA 4DLQA 3Q9NC 4HQDA 5BT1A 3D9PA 2P2CP 4RSYA 4BX8A 1BI8B 4I17A 2BKGA 3UINC 4ABNA 5CCMA 3P2BA 3CHQA 4A1GA 4GZ3A 2WXHA 4W9RA 1MHQA 3CIAA 5KNHD 1LTXA 3ML9A 2J49A 1AP7A 3CGHA 4Q69A 5CEDB 3CK7A 4G25A 3JQ0A 1E7UA 4BEPA 3FEXA 2AXUA 1E96B 3MGBA 3MA5A 3ZPJA 4OVVA 4Z68A 2CHWA 1YA0A 5E76A 2EIME 2KATA 4H7XA 4DJAA 2X3MA 4G23A 3RIBA 4DUIA 1BPOA 4I2WA 3Q75A 4TXQA 1P5QA 3K9IA 3FUEA 3I3NA 4GTSA 3AG3E 4HOTA 4ATZD 3CSFA 1N95A 5HKPA 4GZ6A 2KXPC 3DSWA 3S7JA 4F7AA 4IULA 5JHBA 1IQUA 3FEYA 4DRXE 2XRZA 4N2SA 3FWVA 4ACLA 1NL4A 4XEIG 2L0IA 4I2ZA 3WXXA 4A1SA 3L13A 1D8EA 2EIJE 3ZIMA 2WXQA 3N71A 4AY5A 2A5UA 1LD7A 4LUNU 3DXKG 1BU9A 5FQ6A 4BERA 3FUFA 4JPSA 4TXRA 2B0OE 4U8YD 1FT2A 5BUZA 3SFYA 2P9LG 4TV3A 5B1BE 1TEZA 4YDYA 4YDWA 2FO1E 4A63B 2R02A 3CVYA 1KT0A 4C0MA 2JLBA 3ZUVB 5AN8A 3CVPA 1IYGA 3CHOA 3IXEA 3EHRA 3FTYA 5JJ7A 5FQ4A 1PC2A 2KBXA 3UPVA 3FH5A 2J9QA 3QJZA 4Q96A 5H7PA 2VQ2A 3FUNA 3FUHA 3DSTA 3VTXA 2VSYA 5A23A 3FY4A 3EIQC 2I6HA 1NA3A 3MKQB 1VDYA 2UWJG 2XZTG 3G2VA 3KS2A 3TG5A 1OWNA 2X6KA 5KJLA 3NF1A 5FINA 3LJ3A 2NYJA 5FZSA 5KWDA 2QZAA 3TXMA 4JA7A 3TWUA 1TNZA 3U9WA 5ENTD 1JUQA 3DEOA 4DX6D 4AVXA 5AQ9A 2LXMA 3ISMC 4JVSA 3QOUA 2ZGGA 3D9HA 4HBDA 4C9BB 3L6AA 4JEUA 1JWFA 1EF1C 5T8IA 1UG3A 1Q2ZA 3MJWA 3QK0A 3B7SA 4RVBA 2VTBB 1N4QA 4YDEA 3RU0A 4XZ4A 1DNPA 3UM3A 1UW4B 1N0RA 1K1AA 2L9BA 1TR4A 5A6CA 2XCCA 1W3BA 4AV7A 3Q47B 5KNGA 4APOA 2NXPA 2MOWA 4UUCA 3IBEA 3B95A 1S70B 1ELRA 3CVWA 2ONDA 4NRHB 4G11A 4L7TA 3UMVA 4J7WA 3QDNA 3ABLE 3AG2E 4ILIA 3CVLA 2X38A 3V79K 4F3VA 3FHEA 3VLDA 4GMRA 2RFAA 2GRLA 3HYMB 3LKUA 5G05J 2IOLA 4LCTA 4PS3A 2WXKA 3TJPA 2RD0A 4JEHA 4KVMA 4XE0A 2PZIA 2IO2C 4UWFA 1E7VA 5ENRD 3SFZA 5JHAA 2CFUA 3ZXSA 2WXLA 2XCBA 5FTPA 5G2NA 4U0SA 3ZGQA 3JUEA 5JA4D 4MS6A 4A55A 4DI4A 3LY8A 3JXIA 3FUDA 4L2LA 3RJVA 3Q79A 3B13A 3CV0A 3VLFA 3UUXA 3BG0B 3ZFWA 4LERA 4B93B 3TXNA 1FVFA 4MKTA 5FZRA 1O1RA 2OVFA 3L9TA 5ENPD 1ZBPA 1JPLA 1OWPA 2IONA 4GTVA 3I4GA 1S63A 2RFMA 4I6GA 5KJMA 4HRNA 1N4PA 2DBAA 2CHXA 2LO6A 4TRQA 1Z5SC 4LNUD 3APDA 2M63A 1TNUA 2JEKA 4LRZA 5KCMA 1H19A 1H2UA 2XHEA 4JHRA 4GTQA 3TAXA 3EIJA 4F53A 3L22A 2WQ6A 3RKVA 4J8YA 3Q4AB 5CMYA 2P9KG 3FTWA 2DIWA 2C2LA 3BEEA 3TGOA 4F1SA 1Z3XA 3HXCA 4WWNA 3UKUG 4GAAA 3PE4A 2J4BA 4G2VA 4R7LA 3UTMA 4ATGA 2V4LA 4WNFA 5CERB 3UQ3A 2NSZA 3JUIA 4I1MA 3PH0C 5EDSA 4HS2A 2L6BA 4J6IA 2AXVA 2H6GA 5EYPF 4M7CA 3NBNB 2GRRB 3FTVA 3HXBA 2VSNA 2B6CA 3D9JA 3L17A 2UY1A 2PQRA 3UI2A 1OCOE 2VGEA 1K8KG 5EKQD 4J8SA 2YHEA 3DPDA 4AEZC 1KT1A 4HI9A 1O1SA 2IY0C 3TWVA 4O6FA 1IHGA 4JA9A 4JHKA 3Q7AA 2BTDA 2KZTB 4PUCA 5BNWA 2EILE 4F6RD 3PZDA 1O5MA 3HDXA 1WM5A 3KSLA 2P9NG 3QWVA 1MQSA 4N3AA 5JJ6A 1NZNA 3ZVVA 4L9PA 2WXGA 2XEHA 2J07A 3FTSA 4I43A 4AY6A 4G8LA 2R2LA 1X5BA 4K5AB 5G04C 1H6KA 2P9PG 5LCWJ 4CCAA 1MX2A 3I4RB 4DI3A 2QYUA 2R17C 2LSUA 3ZKJA 4DX7D 3DSUA 3ASHA 2J09A 2KCVA 5D2MC 2FEZA 3QNKA 5ENSD 3FTUA 1OCZE 4U0ZA 1EPUA 1HXIA 5AQ7A 3NAWA 1GW6A 4GMLA 4EBAG 1E8WA 4ZFHA 2FULA 3E30A 2EIKE 3C3RA 4XKCA 1LF8A 2ETCA 5KJNA 1HS6A 5ANLA 4UI9J 3L16A 1DCEA 2WQHA 1TN8A 3EHQA 3DXMG 1N52A 4OAVB 2HO1A 3T5VA 1NFIE 2WXRA 2EINE 1WY6A 3FULA 2X6JA 1MYOA 3MKRA 3CKCA 1N4SA 2XEEA 1PY1A 2ETBA 2C0LA 3UM2A 2YNQA 3S2AA 1H2VC 4FHJA 3ULQA 5EN5D 4JC8A 3SY2A 4UWKA 1JCSA 3ZYKA 3ABME 4DX5D 3RRUA 4A3VA 2YHCA 5CMWA 2CG3A 3U66A 1OT8A 4UQYA 2KM4A 1QQEA 4ANVA 2VSOE 3J5QB 2XPIA 4BX9A 2AVPA 1N0QA 1D8DA 3MKQA 4JD2G 2PL2A 4FHKA 5ARGA 2P9SG 4IRUA 5HS0A 1TN7A 4K5CA 4BFRA 4LNGA 3ZEFA 1SA5A 2BUGA 5DIZA 1SZAA 3C3QA 5CEAA 2XZDG 3O48A 3PEVB 5KJKA 4WWPA 2XPZA 3SI5A 1U3DA 3DSSA 1IQRA 4G26A 2R5SA 5HQ8A 3ZYLA 4BT9A 3GW4A 3KEZA 2IQCA 5B3SE 3SHFA 4U8VD 3FU0A 4GZ5A 3PRZA 3D9OA 1HFAA 2GRNB 3APCA 4B8CB 2RG8A 3LS8A 3ASGA 3ASOE 3SD5A 4GU5A 3CKBA 3NOGD 3R9AB 4ME2A 4K0RA 4E85A 5D0QD 4GA0A 4GA1A 5D66A 2P9UG 3U64A 3LVQE 1DC2A 4EZLA 3QKYA 4C0EA 3L08A 2VTBA 1OWOA 2P58C 4N39A 1PAQA 1HZ4A 1BI7B 3LJNA 2NC9A 3FUMA 2WXNA 3QC1A 3B7RL 3PZ1A 3L54A 1UN8A 2Y0BG 2J4DA 4V3IA 1WAO1 3AU4A 2IJGX 4Y6CA 2FF4A 3CQGB 3TWQA 5KBAA 4MBGA 4G8KA 4WNEA 4XIFA 2HM8A 4KVOA 5EX0A 2AJAA 4ACKA 3HRAA 5EX3A 3RAUA 3LPZA 2FO7A 4O60A 5LX8A 1HH8A 4I9EA 1SVXA 3SGHA 2AWIA 3NB2A 4MLPA 4GYWA 3CQCB 3SNXA 2Y1LE 2XGSA 2ZU6B 1N54A 3FU5A 2HYZA 4LG6A 3QWWA 4JW1A 2GROB 4NACA 4I6EA 3ONLA 5B1AE 4FJZA 4FC8A 4YDOA 4GTPA 4EECA 2WVIA 4DX2A 2WB2A 3SBSA 4K5BA 5BV1A 4RG6A 3MV2B 3DEPA 3PREA 1Y8MA 3CHRA 3MYVA 5J90A 1IHBA 2H6IA 4C48B 3JQ1A 4ILHB 3R9MA 4JB8P 1NA0A 1HX8A 3IKOB 2I1KA 2I2OA 4DLOA 4TUUA 3UX4A 3RSEG 1MX4A 1S64A 3C98A 4CRWA 2DZNA 2JABA 1X81A 3PDNA 3W9GA 5IY5E 4HOSA 5AARA 1U2VG 3PZ2A 1OCCE 4FU3A 5HI7A 4TXPA 1K1BA 5CRUA 1E90A 1FCHA 4J8FA 3TG4A 2WMNA 4URKA 3CVNA 3IV0A 3V2OA 4YVOA 4FJYA 4E6HA 4YNDA 5AJDA 3AG4E 3ZHEB 2VYIA 3HXDA 1TJCA 1HE8A 4FULA 2V4HC 3EJNA 2CFZA 1XGWA 4HORA 5BXUA 4M3OA 5BXOA 3AS5A 1LD8A 3B7BA 2DWZA 4U96D 4F1PA 5EILA 4EBAA 4GYOA 2AXZA 2IU1A 4LEUA 5LFAA 4BY6A 2PQNA 1OWLA 2BEDA 1OWMA 1FVHA 1MJ0A 2X6IA 4P29A 3EUVA 3QAQA 3MCXA 1SW6A 2OEWA 1N4RA 5HRYA 1NP7A 3UM1A 3DSVA 1QYMA 3ZW3A 1HU3A 4GTMA 5BV0A 3CK9A 4RQIA 2VGXA 3ULYA 2Y69E 4D10C 2RKKA 3NZUA 3ONKA 2L0TB 1O1TA 3QWPA 4GCOA 4J8DA 4RLYA 3D9MA 3DSXA 3D9KA 1WDYA 4J0UA 2XEVA 4N5CA 4PH4B 4BESA 3CEQA 2V8SE 3G2SA 2QY7A 5FZQA 3CHMA 4FLBA 3DRAA 3S7BA 2KCLA 1IKND 2OOEA 1UJJA 3L82A 4L23A 1OY3D 3IHVA 4UI9K 3E32A 3CVVA 2BKKB 1V55E 4EQFA 1KZPA 3FU3A 2XPYA 4GZCA 2H6FA 3SFXA 2J8SD 2DZOA 1OXJA 3GZ2A 3LEWA 3MZLB 2CG2A 4ILGA 5M72A 3ZYMA 5FQ8A 1A17A 3EU5A 3JXJA 3Q7FA 3ULEG 5LOZA 3PE3A 4GB9A 1QNFA 3RO3A 3CVQA 4WUYA 1V54E 3MV3B 5FWQA 3CR3A 5CECB 2V0PA 3IEGA 1ZB1A 4G1TA 2XENA 2WQ7A 3CSTA 2DCPA 5JJTA 4CEMA 1TNBA 3HG0D 4KBQA 3WG7E 4Q94A 3CK8A 3Q78A 3HHMA 4FADA 4A3TA 5DBKA 2XQ0A 4GCNA 3FP3A 3RK6A 3C5RA 5AAOA 1K3ZD 5CRVA 4MRUA 1E8ZA 2GGFA 4HLEA 1TN6A 3HXEA 4ANWA 4ANUA 4J8EA 1YMPA 2OVBA 5CBNA 3SBTB 4GYYA 4KYOB 4AIFA 2VGYA 1FPPA 1QBQA 1H0AA 3NQPA 4NIKA 2ZISA 3RRMB 3FTZA 3CHPA 3IHYA 2P9IG 1OUVA 1DCQA 3LDZA 3R7RA 3UIOC 1HG2A 2LAIA 3FFLA 4UWHA 3FU6A 3UT7A 3CVUA 3UM0A 2GRMA 3UT8A 5A7DB 1JWGA 4Y6WA 3ZN3A 1TJFA 1QZ2A 3B7UX 3UIPC 4IN3B 3RO2A 3AU5A 1HF8A 3LYAA 5C2YA 3EU9A 1A5EA 2FBNA 4G24A 3FUJA 3TWTA 5G55A 4LNBA 4PS8A 3D9NA 3HVEB 2XS1A 2Q7FA 2OEVA 3T5XA 4TUMA 2F8XK 1D9SA 4KXKB 5JMND 3EDTB 4FLHA 2A5EA 4GPKA 3QARA 3U4TA 2IFUA 3KEAA 3F6QA 4WAFA 2WMOA 3ESKA 4UWLA 4FA6A 2OCCE 3J5PA 5T3RA 3P1UA 4U63A 3FH7A 3APFA 4EZKA 1UOHA 3MEKA 2WM9A 4OVUA 2Y3AA 3SZ7A 2XRYA 2Y4UA 1YYHA 3BQOA 3FH8A 4KMOA 3JYSA 2I1JA 4AOFA 3AJIA 2H6HA 2L6JA 2ZIRA 4HRLA 4DX1A 3LXUX 5BW8C 1RZ4A 3OXGA 1IXVA 1TNOA 4BSZB 3NZSA 2R05A 3Q5MA 4DPRA 3C72A 4XX5A 2AW6A 5EYLA 1ELKA 3ZU7B 2QFCA 3BUAA 5G04J 5G05C 2X6FA 5ARFA 3FDHA 1TYQG 4EHMA 5ANRA 1UJKA 4KT6B 4CGVA 3V2XA 1ELWA 1U3CA 2IO3C 2YQ8A 4L2YA 2DYRE 3ZNGA 4PS7A 4PDXA 4CYMD 3EHNA 4N3CA 4YVQC 3ENEA 2E0IA 4QFVA 4CT0A 2EQXA 1YCSB 2IF4A 3FUKA 3T8MA 4AM9A 2KC7A 2XGOA 3FTXA 3E37A 2F0YA 2V5FA 4U7EB 4BETA 2FI7A 3LCAA 4B8AA 2PNNA 4HRMB 5ENNA 3HIZA 2XGMA 5AENA 4HOQA 1MZCA 3ZHEA 4NQ0A 4XI0A 1JCRA 3ASNE 4UWGA 3C3OA 5D0OD 1ZU2A 3QB2A 5FIOA 3PZ4A 2LAHA 1N11A 3OXLA 4LSZE 3OAWA 4GTOA 4UQZA 5FJYA 4DK5A 3AS4A 4JL0A 2R59A 3TWXA 4ANXA 3VTYA 2HR2A 3EHMA 4HB5A 2VSXE 4NURA 2QC9A 4WNGA 2E2EA 2CHZA 4HOUA 5AQAA 2GRPB 2LNIA 2LUHA 3KAEA 3KD7A 3UKRG 4GA2A 3O4ZA 4HFGA 3ABKE 1OCRE 4I1AA 2MYOA 4U8HA 1EDUA 1HG5A 3S7FA 2X6HA 5T4YA 3AG1E 3S7DA 1KPSB 4APFA 3W9FA 4FP7A 3TL5A 3UT4A 1TNYA 2ETAA 1XNFA 4N3BA 4JZYA 2PM6A 3PNLB 3URZA 4GTTA 2DYSE 2A4ZA 4X8QA 4N2QA 2HE0A 2IEJA 2ZGDA 1B89A 4EZJA 3T9KA 3LY9A 4CDNA 3U3WA 3KSQA 3CLJA 5ENOD 3GYZA 1H6OA 4K03A 4JXTA 3TWSA 3SQVA 4BSXA 3TWRA 3HXFA 2LSVA 4H7YA 4O1PA 5E75A 5LCWC 1H2TC 4U95D 1INZA 4EPZA 4XI9A 2WXPA 2WXFA 1BD8A 3OTNA 2KZTA 4HVBA 3Q73A 4GZDA 2J08A 1E8YA
chains in the Genus database with same CATH topology
2DYRE 1OCRE 2Y69E 1V54E 2DYSE 3AG3E 3AG1E 5B1BE 5IY5E 2EIJE 3AG4E 3ASOE 3ABME 3ABLE 1OCCE 2EIKE 3WG7E 2EILE 1OCOE 2EINE 2EIME 3AG2E 2ZXWE 3ASNE 5B3SE 3X2QE 1OCZE 2OCCE 5B1AE 3ABKE 1V55E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR E;  1OCR E;  2Y69 E;  1V54 E;  2DYS E;  3AG3 E;  3AG1 E;  5B1B E;  5IY5 E;  2EIJ E;  3AG4 E;  3ASO E;  3ABM E;  3ABL E;  1OCC E;  2EIK E;  3WG7 E;  2EIL E;  1OCO E;  2EIN E;  2EIM E;  3AG2 E;  2ZXW E;  3ASN E;  5B3S E;  3X2Q E;  1OCZ E;  2OCC E;  5B1A E;  3ABK E;  1V55 E; 
#chains in the Genus database with same CATH topology
 1BLX B;  1L5J A;  4GTR A;  3PEU B;  5C1D A;  2DVW A;  3CVX A;  2OV8 A;  1MX6 A;  4B89 A;  3ASD A;  1KZO A;  4OYS A;  1S0P A;  4UI9 C;  2F37 A;  3CHS A;  3X2Q E;  3LVR E;  3D3M A;  3OXF A;  5FT9 A;  3PUK A;  4CZ2 D;  4WWO A;  3RRN B;  1RW2 A;  1G3N B;  2WXO A;  5EIB E;  1Z6T A;  3PS6 A;  4N5Q A;  4HLL A;  4AP2 A;  5ENQ D;  1DVP A;  1N94 A;  3ZXP A;  2WXM A;  4HI8 A;  4CDR A;  3G2W A;  2MHK A;  2KCK A;  5AJL A;  1KLX A;  4B0Z A;  4I1O B;  3BG1 B;  3E34 A;  4QQI A;  3G2T A;  4IYP A;  2V5Q C;  1FT1 A;  3DWL G;  5FQ7 A;  5J08 A;  2ZXW E;  4BT8 A;  2F8Y A;  3AAA C;  3ZYQ A;  3PUJ A;  2PM7 A;  3TWW A;  3BU8 A;  2VJ8 A;  3ASF A;  1EYH A;  3ML8 A;  5LP0 A;  1WG0 A;  3PVL A;  4OAU C;  3T8K A;  4CT4 A;  3E33 A;  4AJW A;  1JCQ A;  2C0M A;  3Q49 B;  1HO8 A;  5CBO A;  3E4B A;  2YIN A;  3V30 A;  5CCL A;  2GW1 A;  2GRQ B;  4AXH A;  4I9C A;  4UQX A;  4B94 A;  2QYJ A;  1E8X A;  4I6J A;  4U07 A;  3SF4 A;  3LY7 A;  2ILR A;  4WND A;  3PZ3 A;  5EID A;  3ESL A;  1SQM A;  3JCK C;  3NOC D;  3DBS A;  3VLE A;  3GZS A;  4L1B A;  4RG9 A;  4GMJ A;  1UN9 A;  2VGX B;  3AS8 A;  3FUI A;  1N9A A;  4KZC A;  2WPV A;  4O1O A;  3Q15 A;  5CHE E;  1SZ9 A;  3HVE A;  4U0U A;  2R03 A;  2WXJ A;  3D9L A;  4BTB A;  2IOS A;  3ZRH A;  4CDM A;  4KZ0 A;  2MRI A;  1H6P A;  3DPY A;  4HXI A;  3V31 A;  3R7Q A;  2LXL A;  3D9I A;  4JHJ A;  3B7T A;  1SA4 A;  5BPP A;  2XS8 A;  3PNT B;  4GPM A;  4BWR A;  1AWC B;  4BTA A;  2WXI A;  3G2U A;  3Q9U C;  4CGW A;  2BF0 X;  3MX3 A;  2UY1 B;  4ZHB A;  2Y4T A;  5AQB A;  1Y6I A;  1NI1 A;  2I9C A;  5AYW D;  4U04 A;  3GZ1 A;  5ITZ F;  4HNA D;  3UXG A;  4XKB A;  5AIJ A;  3SO8 A;  1Z3Y A;  3I5P A;  4DLQ A;  3Q9N C;  4HQD A;  5BT1 A;  3D9P A;  2P2C P;  4RSY A;  4BX8 A;  1BI8 B;  4I17 A;  2BKG A;  3UIN C;  4ABN A;  5CCM A;  3P2B A;  3CHQ A;  4A1G A;  4GZ3 A;  2WXH A;  4W9R A;  1MHQ A;  3CIA A;  5KNH D;  1LTX A;  3ML9 A;  2J49 A;  1AP7 A;  3CGH A;  4Q69 A;  5CED B;  3CK7 A;  4G25 A;  3JQ0 A;  1E7U A;  4BEP A;  3FEX A;  2AXU A;  1E96 B;  3MGB A;  3MA5 A;  3ZPJ A;  4OVV A;  4Z68 A;  2CHW A;  1YA0 A;  5E76 A;  2EIM E;  2KAT A;  4H7X A;  4DJA A;  2X3M A;  4G23 A;  3RIB A;  4DUI A;  1BPO A;  4I2W A;  3Q75 A;  4TXQ A;  1P5Q A;  3K9I A;  3FUE A;  3I3N A;  4GTS A;  3AG3 E;  4HOT A;  4ATZ D;  3CSF A;  1N95 A;  5HKP A;  4GZ6 A;  2KXP C;  3DSW A;  3S7J A;  4F7A A;  4IUL A;  5JHB A;  1IQU A;  3FEY A;  4DRX E;  2XRZ A;  4N2S A;  3FWV A;  4ACL A;  1NL4 A;  4XEI G;  2L0I A;  4I2Z A;  3WXX A;  4A1S A;  3L13 A;  1D8E A;  2EIJ E;  3ZIM A;  2WXQ A;  3N71 A;  4AY5 A;  2A5U A;  1LD7 A;  4LUN U;  3DXK G;  1BU9 A;  5FQ6 A;  4BER A;  3FUF A;  4JPS A;  4TXR A;  2B0O E;  4U8Y D;  1FT2 A;  5BUZ A;  3SFY A;  2P9L G;  4TV3 A;  5B1B E;  1TEZ A;  4YDY A;  4YDW A;  2FO1 E;  4A63 B;  2R02 A;  3CVY A;  1KT0 A;  4C0M A;  2JLB A;  3ZUV B;  5AN8 A;  3CVP A;  1IYG A;  3CHO A;  3IXE A;  3EHR A;  3FTY A;  5JJ7 A;  5FQ4 A;  1PC2 A;  2KBX A;  3UPV A;  3FH5 A;  2J9Q A;  3QJZ A;  4Q96 A;  5H7P A;  2VQ2 A;  3FUN A;  3FUH A;  3DST A;  3VTX A;  2VSY A;  5A23 A;  3FY4 A;  3EIQ C;  2I6H A;  1NA3 A;  3MKQ B;  1VDY A;  2UWJ G;  2XZT G;  3G2V A;  3KS2 A;  3TG5 A;  1OWN A;  2X6K A;  5KJL A;  3NF1 A;  5FIN A;  3LJ3 A;  2NYJ A;  5FZS A;  5KWD A;  2QZA A;  3TXM A;  4JA7 A;  3TWU A;  1TNZ A;  3U9W A;  5ENT D;  1JUQ A;  3DEO A;  4DX6 D;  4AVX A;  5AQ9 A;  2LXM A;  3ISM C;  4JVS A;  3QOU A;  2ZGG A;  3D9H A;  4HBD A;  4C9B B;  3L6A A;  4JEU A;  1JWF A;  1EF1 C;  5T8I A;  1UG3 A;  1Q2Z A;  3MJW A;  3QK0 A;  3B7S A;  4RVB A;  2VTB B;  1N4Q A;  4YDE A;  3RU0 A;  4XZ4 A;  1DNP A;  3UM3 A;  1UW4 B;  1N0R A;  1K1A A;  2L9B A;  1TR4 A;  5A6C A;  2XCC A;  1W3B A;  4AV7 A;  3Q47 B;  5KNG A;  4APO A;  2NXP A;  2MOW A;  4UUC A;  3IBE A;  3B95 A;  1S70 B;  1ELR A;  3CVW A;  2OND A;  4NRH B;  4G11 A;  4L7T A;  3UMV A;  4J7W A;  3QDN A;  3ABL E;  3AG2 E;  4ILI A;  3CVL A;  2X38 A;  3V79 K;  4F3V A;  3FHE A;  3VLD A;  4GMR A;  2RFA A;  2GRL A;  3HYM B;  3LKU A;  5G05 J;  2IOL A;  4LCT A;  4PS3 A;  2WXK A;  3TJP A;  2RD0 A;  4JEH A;  4KVM A;  4XE0 A;  2PZI A;  2IO2 C;  4UWF A;  1E7V A;  5ENR D;  3SFZ A;  5JHA A;  2CFU A;  3ZXS A;  2WXL A;  2XCB A;  5FTP A;  5G2N A;  4U0S A;  3ZGQ A;  3JUE A;  5JA4 D;  4MS6 A;  4A55 A;  4DI4 A;  3LY8 A;  3JXI A;  3FUD A;  4L2L A;  3RJV A;  3Q79 A;  3B13 A;  3CV0 A;  3VLF A;  3UUX A;  3BG0 B;  3ZFW A;  4LER A;  4B93 B;  3TXN A;  1FVF A;  4MKT A;  5FZR A;  1O1R A;  2OVF A;  3L9T A;  5ENP D;  1ZBP A;  1JPL A;  1OWP A;  2ION A;  4GTV A;  3I4G A;  1S63 A;  2RFM A;  4I6G A;  5KJM A;  4HRN A;  1N4P A;  2DBA A;  2CHX A;  2LO6 A;  4TRQ A;  1Z5S C;  4LNU D;  3APD A;  2M63 A;  1TNU A;  2JEK A;  4LRZ A;  5KCM A;  1H19 A;  1H2U A;  2XHE A;  4JHR A;  4GTQ A;  3TAX A;  3EIJ A;  4F53 A;  3L22 A;  2WQ6 A;  3RKV A;  4J8Y A;  3Q4A B;  5CMY A;  2P9K G;  3FTW A;  2DIW A;  2C2L A;  3BEE A;  3TGO A;  4F1S A;  1Z3X A;  3HXC A;  4WWN A;  3UKU G;  4GAA A;  3PE4 A;  2J4B A;  4G2V A;  4R7L A;  3UTM A;  4ATG A;  2V4L A;  4WNF A;  5CER B;  3UQ3 A;  2NSZ A;  3JUI A;  4I1M A;  3PH0 C;  5EDS A;  4HS2 A;  2L6B A;  4J6I A;  2AXV A;  2H6G A;  5EYP F;  4M7C A;  3NBN B;  2GRR B;  3FTV A;  3HXB A;  2VSN A;  2B6C A;  3D9J A;  3L17 A;  2UY1 A;  2PQR A;  3UI2 A;  1OCO E;  2VGE A;  1K8K G;  5EKQ D;  4J8S A;  2YHE A;  3DPD A;  4AEZ C;  1KT1 A;  4HI9 A;  1O1S A;  2IY0 C;  3TWV A;  4O6F A;  1IHG A;  4JA9 A;  4JHK A;  3Q7A A;  2BTD A;  2KZT B;  4PUC A;  5BNW A;  2EIL E;  4F6R D;  3PZD A;  1O5M A;  3HDX A;  1WM5 A;  3KSL A;  2P9N G;  3QWV A;  1MQS A;  4N3A A;  5JJ6 A;  1NZN A;  3ZVV A;  4L9P A;  2WXG A;  2XEH A;  2J07 A;  3FTS A;  4I43 A;  4AY6 A;  4G8L A;  2R2L A;  1X5B A;  4K5A B;  5G04 C;  1H6K A;  2P9P G;  5LCW J;  4CCA A;  1MX2 A;  3I4R B;  4DI3 A;  2QYU A;  2R17 C;  2LSU A;  3ZKJ A;  4DX7 D;  3DSU A;  3ASH A;  2J09 A;  2KCV A;  5D2M C;  2FEZ A;  3QNK A;  5ENS D;  3FTU A;  1OCZ E;  4U0Z A;  1EPU A;  1HXI A;  5AQ7 A;  3NAW A;  1GW6 A;  4GML A;  4EBA G;  1E8W A;  4ZFH A;  2FUL A;  3E30 A;  2EIK E;  3C3R A;  4XKC A;  1LF8 A;  2ETC A;  5KJN A;  1HS6 A;  5ANL A;  4UI9 J;  3L16 A;  1DCE A;  2WQH A;  1TN8 A;  3EHQ A;  3DXM G;  1N52 A;  4OAV B;  2HO1 A;  3T5V A;  1NFI E;  2WXR A;  2EIN E;  1WY6 A;  3FUL A;  2X6J A;  1MYO A;  3MKR A;  3CKC A;  1N4S A;  2XEE A;  1PY1 A;  2ETB A;  2C0L A;  3UM2 A;  2YNQ A;  3S2A A;  1H2V C;  4FHJ A;  3ULQ A;  5EN5 D;  4JC8 A;  3SY2 A;  4UWK A;  1JCS A;  3ZYK A;  3ABM E;  4DX5 D;  3RRU A;  4A3V A;  2YHC A;  5CMW A;  2CG3 A;  3U66 A;  1OT8 A;  4UQY A;  2KM4 A;  1QQE A;  4ANV A;  2VSO E;  3J5Q B;  2XPI A;  4BX9 A;  2AVP A;  1N0Q A;  1D8D A;  3MKQ A;  4JD2 G;  2PL2 A;  4FHK A;  5ARG A;  2P9S G;  4IRU A;  5HS0 A;  1TN7 A;  4K5C A;  4BFR A;  4LNG A;  3ZEF A;  1SA5 A;  2BUG A;  5DIZ A;  1SZA A;  3C3Q A;  5CEA A;  2XZD G;  3O48 A;  3PEV B;  5KJK A;  4WWP A;  2XPZ A;  3SI5 A;  1U3D A;  3DSS A;  1IQR A;  4G26 A;  2R5S A;  5HQ8 A;  3ZYL A;  4BT9 A;  3GW4 A;  3KEZ A;  2IQC A;  5B3S E;  3SHF A;  4U8V D;  3FU0 A;  4GZ5 A;  3PRZ A;  3D9O A;  1HFA A;  2GRN B;  3APC A;  4B8C B;  2RG8 A;  3LS8 A;  3ASG A;  3ASO E;  3SD5 A;  4GU5 A;  3CKB A;  3NOG D;  3R9A B;  4ME2 A;  4K0R A;  4E85 A;  5D0Q D;  4GA0 A;  4GA1 A;  5D66 A;  2P9U G;  3U64 A;  3LVQ E;  1DC2 A;  4EZL A;  3QKY A;  4C0E A;  3L08 A;  2VTB A;  1OWO A;  2P58 C;  4N39 A;  1PAQ A;  1HZ4 A;  1BI7 B;  3LJN A;  2NC9 A;  3FUM A;  2WXN A;  3QC1 A;  3B7R L;  3PZ1 A;  3L54 A;  1UN8 A;  2Y0B G;  2J4D A;  4V3I A;  1WAO 1;  3AU4 A;  2IJG X;  4Y6C A;  2FF4 A;  3CQG B;  3TWQ A;  5KBA A;  4MBG A;  4G8K A;  4WNE A;  4XIF A;  2HM8 A;  4KVO A;  5EX0 A;  2AJA A;  4ACK A;  3HRA A;  5EX3 A;  3RAU A;  3LPZ A;  2FO7 A;  4O60 A;  5LX8 A;  1HH8 A;  4I9E A;  1SVX A;  3SGH A;  2AWI A;  3NB2 A;  4MLP A;  4GYW A;  3CQC B;  3SNX A;  2Y1L E;  2XGS A;  2ZU6 B;  1N54 A;  3FU5 A;  2HYZ A;  4LG6 A;  3QWW A;  4JW1 A;  2GRO B;  4NAC A;  4I6E A;  3ONL A;  5B1A E;  4FJZ A;  4FC8 A;  4YDO A;  4GTP A;  4EEC A;  2WVI A;  4DX2 A;  2WB2 A;  3SBS A;  4K5B A;  5BV1 A;  4RG6 A;  3MV2 B;  3DEP A;  3PRE A;  1Y8M A;  3CHR A;  3MYV A;  5J90 A;  1IHB A;  2H6I A;  4C48 B;  3JQ1 A;  4ILH B;  3R9M A;  4JB8 P;  1NA0 A;  1HX8 A;  3IKO B;  2I1K A;  2I2O A;  4DLO A;  4TUU A;  3UX4 A;  3RSE G;  1MX4 A;  1S64 A;  3C98 A;  4CRW A;  2DZN A;  2JAB A;  1X81 A;  3PDN A;  3W9G A;  5IY5 E;  4HOS A;  5AAR A;  1U2V G;  3PZ2 A;  1OCC E;  4FU3 A;  5HI7 A;  4TXP A;  1K1B A;  5CRU A;  1E90 A;  1FCH A;  4J8F A;  3TG4 A;  2WMN A;  4URK A;  3CVN A;  3IV0 A;  3V2O A;  4YVO A;  4FJY A;  4E6H A;  4YND A;  5AJD A;  3AG4 E;  3ZHE B;  2VYI A;  3HXD A;  1TJC A;  1HE8 A;  4FUL A;  2V4H C;  3EJN A;  2CFZ A;  1XGW A;  4HOR A;  5BXU A;  4M3O A;  5BXO A;  3AS5 A;  1LD8 A;  3B7B A;  2DWZ A;  4U96 D;  4F1P A;  5EIL A;  4EBA A;  4GYO A;  2AXZ A;  2IU1 A;  4LEU A;  5LFA A;  4BY6 A;  2PQN A;  1OWL A;  2BED A;  1OWM A;  1FVH A;  1MJ0 A;  2X6I A;  4P29 A;  3EUV A;  3QAQ A;  3MCX A;  1SW6 A;  2OEW A;  1N4R A;  5HRY A;  1NP7 A;  3UM1 A;  3DSV A;  1QYM A;  3ZW3 A;  1HU3 A;  4GTM A;  5BV0 A;  3CK9 A;  4RQI A;  2VGX A;  3ULY A;  2Y69 E;  4D10 C;  2RKK A;  3NZU A;  3ONK A;  2L0T B;  1O1T A;  3QWP A;  4GCO A;  4J8D A;  4RLY A;  3D9M A;  3DSX A;  3D9K A;  1WDY A;  4J0U A;  2XEV A;  4N5C A;  4PH4 B;  4BES A;  3CEQ A;  2V8S E;  3G2S A;  2QY7 A;  5FZQ A;  3CHM A;  4FLB A;  3DRA A;  3S7B A;  2KCL A;  1IKN D;  2OOE A;  1UJJ A;  3L82 A;  4L23 A;  1OY3 D;  3IHV A;  4UI9 K;  3E32 A;  3CVV A;  2BKK B;  1V55 E;  4EQF A;  1KZP A;  3FU3 A;  2XPY A;  4GZC A;  2H6F A;  3SFX A;  2J8S D;  2DZO A;  1OXJ A;  3GZ2 A;  3LEW A;  3MZL B;  2CG2 A;  4ILG A;  5M72 A;  3ZYM A;  5FQ8 A;  1A17 A;  3EU5 A;  3JXJ A;  3Q7F A;  3ULE G;  5LOZ A;  3PE3 A;  4GB9 A;  1QNF A;  3RO3 A;  3CVQ A;  4WUY A;  1V54 E;  3MV3 B;  5FWQ A;  3CR3 A;  5CEC B;  2V0P A;  3IEG A;  1ZB1 A;  4G1T A;  2XEN A;  2WQ7 A;  3CST A;  2DCP A;  5JJT A;  4CEM A;  1TNB A;  3HG0 D;  4KBQ A;  3WG7 E;  4Q94 A;  3CK8 A;  3Q78 A;  3HHM A;  4FAD A;  4A3T A;  5DBK A;  2XQ0 A;  4GCN A;  3FP3 A;  3RK6 A;  3C5R A;  5AAO A;  1K3Z D;  5CRV A;  4MRU A;  1E8Z A;  2GGF A;  4HLE A;  1TN6 A;  3HXE A;  4ANW A;  4ANU A;  4J8E A;  1YMP A;  2OVB A;  5CBN A;  3SBT B;  4GYY A;  4KYO B;  4AIF A;  2VGY A;  1FPP A;  1QBQ A;  1H0A A;  3NQP A;  4NIK A;  2ZIS A;  3RRM B;  3FTZ A;  3CHP A;  3IHY A;  2P9I G;  1OUV A;  1DCQ A;  3LDZ A;  3R7R A;  3UIO C;  1HG2 A;  2LAI A;  3FFL A;  4UWH A;  3FU6 A;  3UT7 A;  3CVU A;  3UM0 A;  2GRM A;  3UT8 A;  5A7D B;  1JWG A;  4Y6W A;  3ZN3 A;  1TJF A;  1QZ2 A;  3B7U X;  3UIP C;  4IN3 B;  3RO2 A;  3AU5 A;  1HF8 A;  3LYA A;  5C2Y A;  3EU9 A;  1A5E A;  2FBN A;  4G24 A;  3FUJ A;  3TWT A;  5G55 A;  4LNB A;  4PS8 A;  3D9N A;  3HVE B;  2XS1 A;  2Q7F A;  2OEV A;  3T5X A;  4TUM A;  2F8X K;  1D9S A;  4KXK B;  5JMN D;  3EDT B;  4FLH A;  2A5E A;  4GPK A;  3QAR A;  3U4T A;  2IFU A;  3KEA A;  3F6Q A;  4WAF A;  2WMO A;  3ESK A;  4UWL A;  4FA6 A;  2OCC E;  3J5P A;  5T3R A;  3P1U A;  4U63 A;  3FH7 A;  3APF A;  4EZK A;  1UOH A;  3MEK A;  2WM9 A;  4OVU A;  2Y3A A;  3SZ7 A;  2XRY A;  2Y4U A;  1YYH A;  3BQO A;  3FH8 A;  4KMO A;  3JYS A;  2I1J A;  4AOF A;  3AJI A;  2H6H A;  2L6J A;  2ZIR A;  4HRL A;  4DX1 A;  3LXU X;  5BW8 C;  1RZ4 A;  3OXG A;  1IXV A;  1TNO A;  4BSZ B;  3NZS A;  2R05 A;  3Q5M A;  4DPR A;  3C72 A;  4XX5 A;  2AW6 A;  5EYL A;  1ELK A;  3ZU7 B;  2QFC A;  3BUA A;  5G04 J;  5G05 C;  2X6F A;  5ARF A;  3FDH A;  1TYQ G;  4EHM A;  5ANR A;  1UJK A;  4KT6 B;  4CGV A;  3V2X A;  1ELW A;  1U3C A;  2IO3 C;  2YQ8 A;  4L2Y A;  2DYR E;  3ZNG A;  4PS7 A;  4PDX A;  4CYM D;  3EHN A;  4N3C A;  4YVQ C;  3ENE A;  2E0I A;  4QFV A;  4CT0 A;  2EQX A;  1YCS B;  2IF4 A;  3FUK A;  3T8M A;  4AM9 A;  2KC7 A;  2XGO A;  3FTX A;  3E37 A;  2F0Y A;  2V5F A;  4U7E B;  4BET A;  2FI7 A;  3LCA A;  4B8A A;  2PNN A;  4HRM B;  5ENN A;  3HIZ A;  2XGM A;  5AEN A;  4HOQ A;  1MZC A;  3ZHE A;  4NQ0 A;  4XI0 A;  1JCR A;  3ASN E;  4UWG A;  3C3O A;  5D0O D;  1ZU2 A;  3QB2 A;  5FIO A;  3PZ4 A;  2LAH A;  1N11 A;  3OXL A;  4LSZ E;  3OAW A;  4GTO A;  4UQZ A;  5FJY A;  4DK5 A;  3AS4 A;  4JL0 A;  2R59 A;  3TWX A;  4ANX A;  3VTY A;  2HR2 A;  3EHM A;  4HB5 A;  2VSX E;  4NUR A;  2QC9 A;  4WNG A;  2E2E A;  2CHZ A;  4HOU A;  5AQA A;  2GRP B;  2LNI A;  2LUH A;  3KAE A;  3KD7 A;  3UKR G;  4GA2 A;  3O4Z A;  4HFG A;  3ABK E;  1OCR E;  4I1A A;  2MYO A;  4U8H A;  1EDU A;  1HG5 A;  3S7F A;  2X6H A;  5T4Y A;  3AG1 E;  3S7D A;  1KPS B;  4APF A;  3W9F A;  4FP7 A;  3TL5 A;  3UT4 A;  1TNY A;  2ETA A;  1XNF A;  4N3B A;  4JZY A;  2PM6 A;  3PNL B;  3URZ A;  4GTT A;  2DYS E;  2A4Z A;  4X8Q A;  4N2Q A;  2HE0 A;  2IEJ A;  2ZGD A;  1B89 A;  4EZJ A;  3T9K A;  3LY9 A;  4CDN A;  3U3W A;  3KSQ A;  3CLJ A;  5ENO D;  3GYZ A;  1H6O A;  4K03 A;  4JXT A;  3TWS A;  3SQV A;  4BSX A;  3TWR A;  3HXF A;  2LSV A;  4H7Y A;  4O1P A;  5E75 A;  5LCW C;  1H2T C;  4U95 D;  1INZ A;  4EPZ A;  4XI9 A;  2WXP A;  2WXF A;  1BD8 A;  3OTN A;  2KZT A;  4HVB A;  3Q73 A;  4GZD A;  2J08 A;  1E8Y A; 
#chains in the Genus database with same CATH homology
 2DYR E;  1OCR E;  2Y69 E;  1V54 E;  2DYS E;  3AG3 E;  3AG1 E;  5B1B E;  5IY5 E;  2EIJ E;  3AG4 E;  3ASO E;  3ABM E;  3ABL E;  1OCC E;  2EIK E;  3WG7 E;  2EIL E;  1OCO E;  2EIN E;  2EIM E;  3AG2 E;  2ZXW E;  3ASN E;  5B3S E;  3X2Q E;  1OCZ E;  2OCC E;  5B1A E;  3ABK E;  1V55 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...