1V55E

Bovine heart cytochrome c oxidase at the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1v55E00
1OCCE 3AG4E 2Y69E 3ASNE 3ABME 1V55E 1OCRE 3ABLE 2EIME 2DYSE 5B1BE 1OCOE 3ABKE 1OCZE 5B1AE 2DYRE 2EILE 3WG7E 2EIKE 2ZXWE 3AG1E 2OCCE 2EIJE 1V54E 3AG3E 3ASOE 2EINE 5B3SE 3X2QE 3AG2E 5IY5E
chains in the Genus database with same CATH superfamily
3CIAA 4J8SA 3DPDA 3PZ2A 3UIPC 3AS8A 3APDA 4J6IA 2IFUA 4U07A 4C9BB 1OXJA 2XS8A 4JPSA 2WXHA 3NF1A 4U8YD 2IQCA 3AAAC 2WXMA 4IULA 1NFIE 3TWXA 3UM0A 1K1AA 3HXFA 2ZU6B 1MZCA 3PE4A 4GMJA 2KCVA 3OTNA 5CCLA 3BG1B 4U7EB 5B3SE 4BFRA 4CDRA 3CR3A 1N9AA 4FHJA 4DK5A 2E0IA 1SQMA 2YHCA 3OXLA 1VDYA 1OCOE 3HHMA 2YHEA 3CHOA 5CMYA 2R2LA 1PAQA 3ZGQA 2CFUA 2UY1A 3PH0C 3TWVA 1HG5A 2WXGA 1U3CA 3PEUB 4HI9A 1BPOA 4L2YA 4GTOA 3FULA 1SVXA 5CRUA 4AM9A 4RG6A 3FUJA 4MRUA 4GTPA 2R03A 2L0IA 3SFYA 2EIKE 3S7BA 4P29A 2C2LA 3W9FA 5ITZF 1W3BA 1UOHA 1HU3A 3VLFA 3SBTB 4XE0A 4CRWA 4UWKA 4BTAA 5FINA 2F0YA 4I1AA 2HO1A 2RFAA 4CDMA 3CVYA 2OOEA 2Y1LE 1GW6A 4WNEA 4C48B 3QC1A 3Q7AA 2XEHA 1NI1A 3MKQA 4ILIA 3ULEG 2IONA 2KATA 3G2UA 2P9NG 3PZ3A 2FULA 3Q7FA 1E8ZA 1HE8A 3ASDA 1TNOA 2AWIA 1E90A 4DX5D 4AY6A 4Y6WA 3FTZA 3FEXA 3FUMA 2DZNA 2LSUA 5FZRA 1MX2A 3CHMA 2XCCA 3Q75A 3UM2A 4F3VA 3RU0A 1TEZA 2DCPA 2VGXA 5EN5D 4ANVA 5KJLA 5HKPA 4WAFA 4JA7A 4JHJA 4APOA 2JABA 3E32A 4WWPA 1OUVA 2ZISA 5ENOD 3Q9UC 3Q5MA 3LPZA 1DVPA 4ACKA 2XPIA 1SZAA 2ZIRA 3U4TA 4HOTA 4N3CA 2GRPB 3FH8A 2XZDG 3ZHEB 3O48A 1K8KG 5IY5E 2ETBA 4OVUA 1HS6A 1D9SA 1ELRA 2NXPA 4BTBA 3Q78A 1EDUA 3D9LA 2VSNA 3EIJA 4HFGA 4I9CA 3FH5A 2XPYA 1WDYA 4FA6A 4IYPA 2KC7A 1E7UA 1V55E 1AWCB 3CHSA 2IO2C 1A5EA 3L54A 5ENPD 5AQ7A 2VSOE 4HOSA 3ESKA 3AG1E 2H6FA 2IOLA 2Y0BG 3UX4A 3KS2A 3EDTB 3UINC 5T8IA 3LDZA 3CQCB 2XGOA 4JD2G 4LNUD 3CKCA 3NOGD 3LCAA 4QQIA 4OVVA 3UXGA 4J0UA 4DJAA 2FBNA 4N5CA 4CDNA 1S0PA 1KPSB 4ATZD 1YA0A 4BWRA 2AW6A 3HXCA 2Y4TA 4RQIA 3IV0A 5CMWA 2ZXWE 4UI9J 2VGEA 3GYZA 2ETCA 2QYJA 3Q47B 4GTSA 3TG4A 2IEJA 4GZ6A 3QKYA 4JC8A 1OWOA 1E8XA 1LTXA 2X3MA 3T9KA 5ANRA 4I1MA 5T4YA 1A17A 2GRNB 4DI4A 2J49A 3JYSA 4FJZA 2PM7A 4L7TA 3TWSA 3ZW3A 5B1AE 5HQ8A 4HRLA 3I4GA 4G8LA 3IEGA 2P9PG 3DEOA 4B89A 5BW8C 5A6CA 1Y8MA 1N4SA 1B89A 2H6GA 4PH4B 5FT9A 1BI8B 3PUKA 2AXZA 1N94A 4BX9A 1ZU2A 3KSQA 3DSUA 3DSWA 2Y4UA 1BI7B 4BETA 4W9RA 1ELWA 5FTPA 3EHRA 3MYVA 3EHQA 1X5BA 5AQ9A 3ZYKA 4TUUA 3FH7A 3RRMB 4PS3A 3W9GA 4XI0A 5HI7A 3UQ3A 4G2VA 3HG0D 4B0ZA 2J08A 1WAO1 3LY7A 4UQXA 3SGHA 3TWRA 3IBEA 4MKTA 1IYGA 4EPZA 3DXMG 3ABME 3FUKA 3ZYQA 2X6HA 3CVWA 3U66A 4AP2A 4F7AA 5AJDA 3ASHA 3UKRG 4O60A 2YNQA 3HVEB 3SFZA 3V2OA 1E96B 3L82A 5LX8A 5AYWD 2HM8A 3LS8A 3SQVA 3RAUA 5CBOA 3QNKA 3B7BA 4E6HA 3IXEA 4ILGA 2CFZA 2MYOA 3C3OA 3CK8A 3ZPJA 4XI9A 1UW4B 5CRVA 5KBAA 4DPRA 1H6PA 3DPYA 4G26A 3FTVA 1H2VC 1QBQA 1JWFA 2P9KG 2LAIA 2XHEA 5C2YA 3ULYA 3TWQA 3TWWA 3HRAA 3D9JA 2WXOA 2X6IA 3LVQE 4O1PA 2VTBB 4DX6D 1TNZA 5KCMA 1EPUA 2MOWA 5G55A 2XGSA 2EILE 1IHGA 4UI9C 2QFCA 1H19A 3EJNA 3LY9A 4BX8A 3OXFA 4KVOA 4IN3B 3P1UA 3EIQC 2PL2A 3APCA 4EBAG 4I2WA 5BNWA 4AIFA 3T5VA 1JCQA 4KYOB 3MCXA 4A3VA 2BUGA 5FQ8A 1UN8A 3FU0A 4MBGA 2L6BA 4G25A 1TJCA 4AXHA 3L13A 4J7WA 2BTDA 5AJLA 2LXLA 3L08A 5FQ6A 5EDSA 2I1JA 1TR4A 2IU1A 2KZTB 5EYLA 4WNGA 3DSSA 1UJJA 3FTWA 3B7TA 2YINA 3L17A 4YVOA 3MZLB 3SFXA 3X2QE 3TJPA 1MHQA 1TN7A 3E37A 4N3BA 2P9UG 2VSYA 4NRHB 5ARFA 2GROB 2B6CA 2PNNA 5D0OD 1EF1C 1NA3A 3PNLB 3TG5A 5ANLA 5BUZA 3DWLG 1N95A 3NZUA 5G2NA 2RD0A 3QARA 4HLEA 4J8EA 3PZ4A 2KXPC 2I1KA 2UY1B 4AVXA 2IJGX 4BY6A 2E2EA 3BUAA 4J8FA 5CHEE 4EZJA 3DEPA 4L2LA 5EIDA 4OAVB 3ZYLA 3RJVA 1H6KA 1INZA 2EINE 4F1PA 3CVVA 4HQDA 3B13A 5FQ7A 4UI9K 3KEZA 1O1RA 5ENQD 5CBNA 3JQ1A 1HG2A 4FC8A 2OCCE 3FU5A 4A63B 3B95A 4GYYA 4N39A 2I2OA 1HX8A 4ANWA 3MKQB 1OY3D 1IHBA 4GTTA 4Z68A 3MKRA 4BSZB 3ISMC 1Z3XA 3UUXA 5JJ7A 4M7CA 3QWVA 3ASOE 5D0QD 5LCWC 4HORA 2OVFA 1PC2A 1UG3A 4BSXA 3TGOA 3ULQA 5KWDA 2P58C 4GTMA 1L5JA 2DYRE 4DX1A 1PY1A 3GW4A 1TYQG 4GZDA 4LUNU 3C3RA 4BERA 2CHXA 3NZSA 3B7RL 3JUIA 1MX4A 2H6IA 2IO3C 4HVBA 5ENSD 3G2SA 4HOQA 4NQ0A 3SZ7A 3ZKJA 3FEYA 1NA0A 3E34A 5LFAA 4ZFHA 4B8CB 4E85A 4KMOA 3PDNA 2UWJG 3PNTB 5A7DB 3PZ1A 1FCHA 3CHRA 4U8HA 1N4PA 4XKBA 2BKGA 2HYZA 4HRNA 2WVIA 3C5RA 5CERB 1FVFA 2RFMA 3D3MA 1HF8A 4U63A 4LNGA 2MRIA 2LAHA 2VYIA 2WQ6A 3D9KA 2PM6A 5BV1A 3G2VA 4F1SA 2CG2A 4L9PA 4U96D 1WG0A 4GA2A 5EIBE 3LKUA 1JCRA 3CVNA 4GTVA 4KXKB 4D10C 4G23A 4U8VD 3CVXA 3E30A 3ENEA 4U95D 3RK6A 4K5BA 4LNBA 3UKUG 4TXPA 4CCAA 2ETAA 1Z3YA 3TAXA 4OYSA 4FU3A 3DRAA 4O6FA 3TWUA 3PUJA 2FO1E 3DSTA 5FQ4A 3QOUA 4AV7A 1N4QA 5KJKA 2DWZA 1ELKA 3QWWA 5ENRD 3RIBA 4A1GA 4URKA 2AXUA 3TXMA 1IQRA 2FF4A 4V3IA 3B7UX 1H0AA 3MEKA 1U3DA 3ZRHA 3LJNA 1S63A 3F6QA 5HS0A 1BU9A 4Q94A 2QZAA 4BESA 5G04J 5DBKA 2F8YA 3QDNA 4GZCA 4HB5A 5EX3A 2A5UA 1TNYA 5G05J 4TUMA 3FUNA 3CK9A 4UWHA 3C72A 2NC9A 2DBAA 3S7DA 1KLXA 1EYHA 4YNDA 2L9BA 1RZ4A 1YCSB 3JUEA 3BEEA 4GPKA 4GCNA 4GZ3A 2OEWA 1H6OA 3DSXA 4I6JA 3K9IA 3FU3A 3HXBA 2V8SE 2J07A 4FP7A 4GAAA 3AG3E 3SNXA 1OT8A 2P9IG 3CEQA 3D9NA 4LEUA 3TL5A 2J8SD 3SO8A 4A3TA 4DRXE 4F53A 2A4ZA 1ZBPA 5H7PA 2OEVA 4NIKA 2B0OE 3UT8A 2WXKA 3AU5A 5KJNA 3GZ1A 3JXJA 4CT4A 3PVLA 1UN9A 3J5QB 2WXFA 2OV8A 3V31A 1N4RA 3PZDA 1KZPA 1X81A 2Y69E 1OCRE 3AS5A 3HXDA 4A1SA 1BLXB 2XZTG 4KVMA 3SBSA 2NSZA 3TXNA 1TN8A 4Y6CA 5D66A 2V4LA 4CGWA 3MGBA 1E7VA 3HXEA 1K3ZD 4YDOA 2R02A 4EQFA 2IY0C 3FTYA 3ZXPA 2QYUA 3FUFA 2AVPA 2WB2A 4GA1A 4JZYA 3J5PA 2QC9A 3FWVA 2WXIA 5FIOA 1DNPA 4WUYA 4NACA 4DLOA 1DCQA 3I5PA 3EUVA 3RKVA 4ANXA 3CHQA 1HZ4A 2V5QC 1SA5A 2EQXA 4A55A 4JA9A 4UWLA 3FY4A 3AU4A 4LCTA 2I6HA 3DSVA 3CVUA 4RSYA 1OCZE 2WXQA 3CLJA 2VQ2A 1XGWA 4GTRA 4JVSA 3SF4A 1Z6TA 3ML9A 3Q4AB 1JUQA 4I6GA 3V2XA 5CEDB 1JPLA 4C0MA 4ME2A 1QQEA 1D8DA 3CSTA 4BT8A 4HBDA 3ONLA 4ABNA 3URZA 5LCWJ 1H2TC 4UWFA 3BQOA 1DCEA 4GMLA 4GYOA 3T5XA 3MX3A 4K0RA 3S7FA 1TNBA 4K5AB 4K03A 3V30A 2XCBA 1N11A 3G2TA 4XKCA 3E33A 4FJYA 4ACLA 3IHYA 2R17C 3Q49B 4IRUA 4TV3A 3JQ0A 4DX2A 5A23A 5G04C 2GGFA 3ASNE 2P9LG 4U0ZA 1N52A 5EYPF 3EU5A 1TNUA 4EHMA 4K5CA 5BXOA 5CEAA 4GU5A 2XRZA 2XENA 1Q2ZA 4Q96A 1E8YA 2P9SG 5G05C 2PQRA 3ZEFA 1Y6IA 3ZIMA 4B8AA 3VLDA 3N71A 3PREA 2GRRB 4L23A 3SY2A 1QYMA 2RG8A 3FTUA 5EKQD 3FTSA 5ENTD 2GRQB 2C0MA 3NAWA 4XZ4A 3R7RA 2KZTA 4KZ0A 2VJ8A 3EU9A 5D2MC 2WXPA 3L22A 5JJTA 5LOZA 4AEZC 2AXVA 4ZHBA 1TN6A 3FUHA 3UTMA 4LG6A 3OAWA 4DX7D 1FT1A 4RLYA 1OCCE 4LSZE 4KZCA 3UT4A 2CG3A 4GMRA 4U04A 1O1SA 4ATGA 3SD5A 1N54A 5CCMA 2WMOA 2OVBA 2V0PA 2IF4A 3APFA 4I1OB 5J08A 3ABLE 1IQUA 5BT1A 1MQSA 4GCOA 5JHAA 4NURA 3VTXA 3ZNGA 2ILRA 3S7JA 2X38A 1IXVA 4LERA 4JW1A 1MJ0A 3LYAA 3IKOB 2A5EA 4B93B 3C3QA 1HFAA 2KCLA 4I6EA 4JB8P 3ZUVB 3PS6A 5C1DA 2X6KA 5AQBA 3G2WA 4FULA 1KT0A 3JXIA 4GZ5A 3PE3A 3D9PA 3L16A 3LY8A 4YDYA 2VGYA 4RG9A 4ILHB 4Q69A 3R9AB 3JCKC 1AP7A 3SHFA 3MJWA 3RRNB 2FI7A 2H6HA 2HE0A 5E75A 4CT0A 3KSLA 3MV3B 3VLEA 3C98A 4G8KA 3O4ZA 4UQZA 5AN8A 1KZOA 3LVRE 3EHNA 3ONKA 4ANUA 2BEDA 4FLHA 3GZSA 4AOFA 1BD8A 2AJAA 2WQHA 4N3AA 1S70B 3CVQA 4M3OA 3WG7E 3R9MA 1E8WA 4QFVA 2J4BA 3WXXA 4JEHA 4CZ2D 4HLLA 2ONDA 5KNGA 2WXJA 4FADA 2V5FA 3ZFWA 3T8MA 2VGXB 3RO2A 1D8EA 1N0RA 4YDWA 5JA4D 4UUCA 3CGHA 1KT1A 1YMPA 3UM1A 3ZVVA 2LNIA 2ZGDA 3FP3A 1JWGA 2EIJE 4PDXA 3I4RB 5BV0A 4CGVA 3CKBA 3QAQA 2LUHA 4GYWA 4YDEA 3Q73A 3UPVA 2GRMA 3V79K 2VSXE 3EHMA 3ZHEA 3ESLA 5AENA 3KAEA 2IOSA 3QK0A 3OXGA 3LEWA 5CECB 2WM9A 3AG4E 5EX0A 4XIFA 1QZ2A 5JHBA 3PEVB 3E4BA 3FTXA 3QWPA 2L0TB 1HXIA 4FHKA 4JEUA 1WY6A 1G3NB 3BG0B 2DIWA 2XEEA 4RVBA 2WMNA 5DIZA 4TRQA 3UMVA 4L1BA 5KJMA 1LF8A 1MX6A 4N2SA 4JXTA 3ABKE 5AAOA 3HYMB 3HDXA 4EBAA 1OWMA 4WNFA 1V54E 2J9QA 2JEKA 2R59A 4X8QA 3ML8A 4TXRA 1SZ9A 2KBXA 2F37A 4U0SA 5KNHD 3B7SA 4O1OA 4BT9A 4KT6B 3FUEA 4CEMA 3AS4A 2P2CP 3GZ2A 3ASFA 4PS7A 4B94A 3AJIA 3I3NA 2R5SA 5FWQA 2XPZA 3ZN3A 2DVWA 3P2BA 2CHZA 2WXLA 3UM3A 4F6RD 4DUIA 3ZXSA 3UT7A 1YYHA 4AY5A 2XRYA 3ZU7B 4DLQA 3SI5A 3Q15A 1FT2A 3KD7A 2EIME 2WXRA 4KBQA 2PQNA 3FFLA 2C0LA 1N0QA 3KEAA 2YQ8A 4EZLA 2LO6A 4UWGA 1H2UA 4HNAD 3T8KA 4GTQA 2XGMA 3MA5A 2FEZA 2GRLA 1JCSA 2HR2A 2DZOA 5T3RA 3NBNB 4GA0A 1K1BA 3LXUX 3CQGB 3NOCD 1NL4A 2F8XK 3R7QA 3ASGA 4H7YA 1XNFA 5HRYA 3FU6A 4LRZA 4I43A 5ARGA 4EECA 1FVHA 2V4HC 4GB9A 3D9MA 4MLPA 3RO3A 1LD8A 1FPPA 4G1TA 1P5QA 3QB2A 5FZSA 5AIJA 5J90A 4HS2A 4UQYA 4APFA 3CK7A 4PS8A 3U3WA 4G24A 3QJZA 4I2ZA 1OWLA 3UI2A 3D9OA 2QY7A 1HO8A 3ZYMA 2R05A 4N2QA 2BF0X 4YVQC 2X6JA 5AQAA 4EZKA 5LP0A 1S64A 2CHWA 2MHKA 3UIOC 5ENNA 3S2AA 3AG2E 3L9TA 1MYOA 3HVEA 3LJ3A 1TJFA 3U9WA 5BPPA 3CSFA 2KM4A 4I17A 3DBSA 5JMND 4WWOA 2WPVA 4XX5A 4H7XA 2JLBA 5JJ6A 4AJWA 2M63A 3TWTA 5BXUA 1U2VG 3Q9NC 1OWPA 2XEVA 2DYSE 4CYMD 4HXIA 3RSEG 3MV2B 4JL0A 1OWNA 3CHPA 4JHRA 5EILA 2Y3AA 1IKND 3U64A 3D9IA 3NQPA 4J8DA 4J8YA 3VTYA 4TXQA 3FUIA 3PRZA 3NB2A 5FZQA 4JHKA 4HRMB 4BEPA 1Z5SC 3Q79A 5FJYA 5E76A 5B1BE 2LSVA 2WXNA 3FUDA 4DI3A 3IHVA 2X6FA 1QNFA 3D9HA 2NYJA 1SW6A 2L6JA 4PUCA 4WWNA 2LXMA 2ZGGA 4I9EA 4N5QA 2VTBA 1HH8A 3DXKG 4HI8A 5AARA 1NP7A 4C0EA 3CV0A 4U0UA 1ZB1A 2KCKA 1O5MA 2XS1A 3RRUA 4GPMA 2Q7FA 4MS6A 4FLBA 2GW1A 4G11A 1WM5A 4R7LA 4XEIG 3HIZA 3CVLA 2FO7A 2BKKB 1SA4A 3BU8A 2XQ0A 2RKKA 3CVPA 2J4DA 3L6AA 1UJKA 1DC2A 3FHEA 2PZIA 2WQ7A 1RW2A 4WNDA 4HOUA 2J09A 2I9CA 1O1TA 4OAUC 1NZNA 3FDHA 1LD7A 5M72A
chains in the Genus database with same CATH topology
1OCCE 3AG4E 2Y69E 3ASNE 3ABME 1V55E 1OCRE 3ABLE 2EIME 2DYSE 5B1BE 1OCOE 3ABKE 1OCZE 5B1AE 2DYRE 2EILE 3WG7E 2EIKE 2ZXWE 3AG1E 2OCCE 2EIJE 1V54E 3AG3E 3ASOE 2EINE 5B3SE 3X2QE 3AG2E 5IY5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC E;  3AG4 E;  2Y69 E;  3ASN E;  3ABM E;  1V55 E;  1OCR E;  3ABL E;  2EIM E;  2DYS E;  5B1B E;  1OCO E;  3ABK E;  1OCZ E;  5B1A E;  2DYR E;  2EIL E;  3WG7 E;  2EIK E;  2ZXW E;  3AG1 E;  2OCC E;  2EIJ E;  1V54 E;  3AG3 E;  3ASO E;  2EIN E;  5B3S E;  3X2Q E;  3AG2 E;  5IY5 E; 
#chains in the Genus database with same CATH topology
 3CIA A;  4J8S A;  3DPD A;  3PZ2 A;  3UIP C;  3AS8 A;  3APD A;  4J6I A;  2IFU A;  4U07 A;  4C9B B;  1OXJ A;  2XS8 A;  4JPS A;  2WXH A;  3NF1 A;  4U8Y D;  2IQC A;  3AAA C;  2WXM A;  4IUL A;  1NFI E;  3TWX A;  3UM0 A;  1K1A A;  3HXF A;  2ZU6 B;  1MZC A;  3PE4 A;  4GMJ A;  2KCV A;  3OTN A;  5CCL A;  3BG1 B;  4U7E B;  5B3S E;  4BFR A;  4CDR A;  3CR3 A;  1N9A A;  4FHJ A;  4DK5 A;  2E0I A;  1SQM A;  2YHC A;  3OXL A;  1VDY A;  1OCO E;  3HHM A;  2YHE A;  3CHO A;  5CMY A;  2R2L A;  1PAQ A;  3ZGQ A;  2CFU A;  2UY1 A;  3PH0 C;  3TWV A;  1HG5 A;  2WXG A;  1U3C A;  3PEU B;  4HI9 A;  1BPO A;  4L2Y A;  4GTO A;  3FUL A;  1SVX A;  5CRU A;  4AM9 A;  4RG6 A;  3FUJ A;  4MRU A;  4GTP A;  2R03 A;  2L0I A;  3SFY A;  2EIK E;  3S7B A;  4P29 A;  2C2L A;  3W9F A;  5ITZ F;  1W3B A;  1UOH A;  1HU3 A;  3VLF A;  3SBT B;  4XE0 A;  4CRW A;  4UWK A;  4BTA A;  5FIN A;  2F0Y A;  4I1A A;  2HO1 A;  2RFA A;  4CDM A;  3CVY A;  2OOE A;  2Y1L E;  1GW6 A;  4WNE A;  4C48 B;  3QC1 A;  3Q7A A;  2XEH A;  1NI1 A;  3MKQ A;  4ILI A;  3ULE G;  2ION A;  2KAT A;  3G2U A;  2P9N G;  3PZ3 A;  2FUL A;  3Q7F A;  1E8Z A;  1HE8 A;  3ASD A;  1TNO A;  2AWI A;  1E90 A;  4DX5 D;  4AY6 A;  4Y6W A;  3FTZ A;  3FEX A;  3FUM A;  2DZN A;  2LSU A;  5FZR A;  1MX2 A;  3CHM A;  2XCC A;  3Q75 A;  3UM2 A;  4F3V A;  3RU0 A;  1TEZ A;  2DCP A;  2VGX A;  5EN5 D;  4ANV A;  5KJL A;  5HKP A;  4WAF A;  4JA7 A;  4JHJ A;  4APO A;  2JAB A;  3E32 A;  4WWP A;  1OUV A;  2ZIS A;  5ENO D;  3Q9U C;  3Q5M A;  3LPZ A;  1DVP A;  4ACK A;  2XPI A;  1SZA A;  2ZIR A;  3U4T A;  4HOT A;  4N3C A;  2GRP B;  3FH8 A;  2XZD G;  3ZHE B;  3O48 A;  1K8K G;  5IY5 E;  2ETB A;  4OVU A;  1HS6 A;  1D9S A;  1ELR A;  2NXP A;  4BTB A;  3Q78 A;  1EDU A;  3D9L A;  2VSN A;  3EIJ A;  4HFG A;  4I9C A;  3FH5 A;  2XPY A;  1WDY A;  4FA6 A;  4IYP A;  2KC7 A;  1E7U A;  1V55 E;  1AWC B;  3CHS A;  2IO2 C;  1A5E A;  3L54 A;  5ENP D;  5AQ7 A;  2VSO E;  4HOS A;  3ESK A;  3AG1 E;  2H6F A;  2IOL A;  2Y0B G;  3UX4 A;  3KS2 A;  3EDT B;  3UIN C;  5T8I A;  3LDZ A;  3CQC B;  2XGO A;  4JD2 G;  4LNU D;  3CKC A;  3NOG D;  3LCA A;  4QQI A;  4OVV A;  3UXG A;  4J0U A;  4DJA A;  2FBN A;  4N5C A;  4CDN A;  1S0P A;  1KPS B;  4ATZ D;  1YA0 A;  4BWR A;  2AW6 A;  3HXC A;  2Y4T A;  4RQI A;  3IV0 A;  5CMW A;  2ZXW E;  4UI9 J;  2VGE A;  3GYZ A;  2ETC A;  2QYJ A;  3Q47 B;  4GTS A;  3TG4 A;  2IEJ A;  4GZ6 A;  3QKY A;  4JC8 A;  1OWO A;  1E8X A;  1LTX A;  2X3M A;  3T9K A;  5ANR A;  4I1M A;  5T4Y A;  1A17 A;  2GRN B;  4DI4 A;  2J49 A;  3JYS A;  4FJZ A;  2PM7 A;  4L7T A;  3TWS A;  3ZW3 A;  5B1A E;  5HQ8 A;  4HRL A;  3I4G A;  4G8L A;  3IEG A;  2P9P G;  3DEO A;  4B89 A;  5BW8 C;  5A6C A;  1Y8M A;  1N4S A;  1B89 A;  2H6G A;  4PH4 B;  5FT9 A;  1BI8 B;  3PUK A;  2AXZ A;  1N94 A;  4BX9 A;  1ZU2 A;  3KSQ A;  3DSU A;  3DSW A;  2Y4U A;  1BI7 B;  4BET A;  4W9R A;  1ELW A;  5FTP A;  3EHR A;  3MYV A;  3EHQ A;  1X5B A;  5AQ9 A;  3ZYK A;  4TUU A;  3FH7 A;  3RRM B;  4PS3 A;  3W9G A;  4XI0 A;  5HI7 A;  3UQ3 A;  4G2V A;  3HG0 D;  4B0Z A;  2J08 A;  1WAO 1;  3LY7 A;  4UQX A;  3SGH A;  3TWR A;  3IBE A;  4MKT A;  1IYG A;  4EPZ A;  3DXM G;  3ABM E;  3FUK A;  3ZYQ A;  2X6H A;  3CVW A;  3U66 A;  4AP2 A;  4F7A A;  5AJD A;  3ASH A;  3UKR G;  4O60 A;  2YNQ A;  3HVE B;  3SFZ A;  3V2O A;  1E96 B;  3L82 A;  5LX8 A;  5AYW D;  2HM8 A;  3LS8 A;  3SQV A;  3RAU A;  5CBO A;  3QNK A;  3B7B A;  4E6H A;  3IXE A;  4ILG A;  2CFZ A;  2MYO A;  3C3O A;  3CK8 A;  3ZPJ A;  4XI9 A;  1UW4 B;  5CRV A;  5KBA A;  4DPR A;  1H6P A;  3DPY A;  4G26 A;  3FTV A;  1H2V C;  1QBQ A;  1JWF A;  2P9K G;  2LAI A;  2XHE A;  5C2Y A;  3ULY A;  3TWQ A;  3TWW A;  3HRA A;  3D9J A;  2WXO A;  2X6I A;  3LVQ E;  4O1P A;  2VTB B;  4DX6 D;  1TNZ A;  5KCM A;  1EPU A;  2MOW A;  5G55 A;  2XGS A;  2EIL E;  1IHG A;  4UI9 C;  2QFC A;  1H19 A;  3EJN A;  3LY9 A;  4BX8 A;  3OXF A;  4KVO A;  4IN3 B;  3P1U A;  3EIQ C;  2PL2 A;  3APC A;  4EBA G;  4I2W A;  5BNW A;  4AIF A;  3T5V A;  1JCQ A;  4KYO B;  3MCX A;  4A3V A;  2BUG A;  5FQ8 A;  1UN8 A;  3FU0 A;  4MBG A;  2L6B A;  4G25 A;  1TJC A;  4AXH A;  3L13 A;  4J7W A;  2BTD A;  5AJL A;  2LXL A;  3L08 A;  5FQ6 A;  5EDS A;  2I1J A;  1TR4 A;  2IU1 A;  2KZT B;  5EYL A;  4WNG A;  3DSS A;  1UJJ A;  3FTW A;  3B7T A;  2YIN A;  3L17 A;  4YVO A;  3MZL B;  3SFX A;  3X2Q E;  3TJP A;  1MHQ A;  1TN7 A;  3E37 A;  4N3B A;  2P9U G;  2VSY A;  4NRH B;  5ARF A;  2GRO B;  2B6C A;  2PNN A;  5D0O D;  1EF1 C;  1NA3 A;  3PNL B;  3TG5 A;  5ANL A;  5BUZ A;  3DWL G;  1N95 A;  3NZU A;  5G2N A;  2RD0 A;  3QAR A;  4HLE A;  4J8E A;  3PZ4 A;  2KXP C;  2I1K A;  2UY1 B;  4AVX A;  2IJG X;  4BY6 A;  2E2E A;  3BUA A;  4J8F A;  5CHE E;  4EZJ A;  3DEP A;  4L2L A;  5EID A;  4OAV B;  3ZYL A;  3RJV A;  1H6K A;  1INZ A;  2EIN E;  4F1P A;  3CVV A;  4HQD A;  3B13 A;  5FQ7 A;  4UI9 K;  3KEZ A;  1O1R A;  5ENQ D;  5CBN A;  3JQ1 A;  1HG2 A;  4FC8 A;  2OCC E;  3FU5 A;  4A63 B;  3B95 A;  4GYY A;  4N39 A;  2I2O A;  1HX8 A;  4ANW A;  3MKQ B;  1OY3 D;  1IHB A;  4GTT A;  4Z68 A;  3MKR A;  4BSZ B;  3ISM C;  1Z3X A;  3UUX A;  5JJ7 A;  4M7C A;  3QWV A;  3ASO E;  5D0Q D;  5LCW C;  4HOR A;  2OVF A;  1PC2 A;  1UG3 A;  4BSX A;  3TGO A;  3ULQ A;  5KWD A;  2P58 C;  4GTM A;  1L5J A;  2DYR E;  4DX1 A;  1PY1 A;  3GW4 A;  1TYQ G;  4GZD A;  4LUN U;  3C3R A;  4BER A;  2CHX A;  3NZS A;  3B7R L;  3JUI A;  1MX4 A;  2H6I A;  2IO3 C;  4HVB A;  5ENS D;  3G2S A;  4HOQ A;  4NQ0 A;  3SZ7 A;  3ZKJ A;  3FEY A;  1NA0 A;  3E34 A;  5LFA A;  4ZFH A;  4B8C B;  4E85 A;  4KMO A;  3PDN A;  2UWJ G;  3PNT B;  5A7D B;  3PZ1 A;  1FCH A;  3CHR A;  4U8H A;  1N4P A;  4XKB A;  2BKG A;  2HYZ A;  4HRN A;  2WVI A;  3C5R A;  5CER B;  1FVF A;  2RFM A;  3D3M A;  1HF8 A;  4U63 A;  4LNG A;  2MRI A;  2LAH A;  2VYI A;  2WQ6 A;  3D9K A;  2PM6 A;  5BV1 A;  3G2V A;  4F1S A;  2CG2 A;  4L9P A;  4U96 D;  1WG0 A;  4GA2 A;  5EIB E;  3LKU A;  1JCR A;  3CVN A;  4GTV A;  4KXK B;  4D10 C;  4G23 A;  4U8V D;  3CVX A;  3E30 A;  3ENE A;  4U95 D;  3RK6 A;  4K5B A;  4LNB A;  3UKU G;  4TXP A;  4CCA A;  2ETA A;  1Z3Y A;  3TAX A;  4OYS A;  4FU3 A;  3DRA A;  4O6F A;  3TWU A;  3PUJ A;  2FO1 E;  3DST A;  5FQ4 A;  3QOU A;  4AV7 A;  1N4Q A;  5KJK A;  2DWZ A;  1ELK A;  3QWW A;  5ENR D;  3RIB A;  4A1G A;  4URK A;  2AXU A;  3TXM A;  1IQR A;  2FF4 A;  4V3I A;  3B7U X;  1H0A A;  3MEK A;  1U3D A;  3ZRH A;  3LJN A;  1S63 A;  3F6Q A;  5HS0 A;  1BU9 A;  4Q94 A;  2QZA A;  4BES A;  5G04 J;  5DBK A;  2F8Y A;  3QDN A;  4GZC A;  4HB5 A;  5EX3 A;  2A5U A;  1TNY A;  5G05 J;  4TUM A;  3FUN A;  3CK9 A;  4UWH A;  3C72 A;  2NC9 A;  2DBA A;  3S7D A;  1KLX A;  1EYH A;  4YND A;  2L9B A;  1RZ4 A;  1YCS B;  3JUE A;  3BEE A;  4GPK A;  4GCN A;  4GZ3 A;  2OEW A;  1H6O A;  3DSX A;  4I6J A;  3K9I A;  3FU3 A;  3HXB A;  2V8S E;  2J07 A;  4FP7 A;  4GAA A;  3AG3 E;  3SNX A;  1OT8 A;  2P9I G;  3CEQ A;  3D9N A;  4LEU A;  3TL5 A;  2J8S D;  3SO8 A;  4A3T A;  4DRX E;  4F53 A;  2A4Z A;  1ZBP A;  5H7P A;  2OEV A;  4NIK A;  2B0O E;  3UT8 A;  2WXK A;  3AU5 A;  5KJN A;  3GZ1 A;  3JXJ A;  4CT4 A;  3PVL A;  1UN9 A;  3J5Q B;  2WXF A;  2OV8 A;  3V31 A;  1N4R A;  3PZD A;  1KZP A;  1X81 A;  2Y69 E;  1OCR E;  3AS5 A;  3HXD A;  4A1S A;  1BLX B;  2XZT G;  4KVM A;  3SBS A;  2NSZ A;  3TXN A;  1TN8 A;  4Y6C A;  5D66 A;  2V4L A;  4CGW A;  3MGB A;  1E7V A;  3HXE A;  1K3Z D;  4YDO A;  2R02 A;  4EQF A;  2IY0 C;  3FTY A;  3ZXP A;  2QYU A;  3FUF A;  2AVP A;  2WB2 A;  4GA1 A;  4JZY A;  3J5P A;  2QC9 A;  3FWV A;  2WXI A;  5FIO A;  1DNP A;  4WUY A;  4NAC A;  4DLO A;  1DCQ A;  3I5P A;  3EUV A;  3RKV A;  4ANX A;  3CHQ A;  1HZ4 A;  2V5Q C;  1SA5 A;  2EQX A;  4A55 A;  4JA9 A;  4UWL A;  3FY4 A;  3AU4 A;  4LCT A;  2I6H A;  3DSV A;  3CVU A;  4RSY A;  1OCZ E;  2WXQ A;  3CLJ A;  2VQ2 A;  1XGW A;  4GTR A;  4JVS A;  3SF4 A;  1Z6T A;  3ML9 A;  3Q4A B;  1JUQ A;  4I6G A;  3V2X A;  5CED B;  1JPL A;  4C0M A;  4ME2 A;  1QQE A;  1D8D A;  3CST A;  4BT8 A;  4HBD A;  3ONL A;  4ABN A;  3URZ A;  5LCW J;  1H2T C;  4UWF A;  3BQO A;  1DCE A;  4GML A;  4GYO A;  3T5X A;  3MX3 A;  4K0R A;  3S7F A;  1TNB A;  4K5A B;  4K03 A;  3V30 A;  2XCB A;  1N11 A;  3G2T A;  4XKC A;  3E33 A;  4FJY A;  4ACL A;  3IHY A;  2R17 C;  3Q49 B;  4IRU A;  4TV3 A;  3JQ0 A;  4DX2 A;  5A23 A;  5G04 C;  2GGF A;  3ASN E;  2P9L G;  4U0Z A;  1N52 A;  5EYP F;  3EU5 A;  1TNU A;  4EHM A;  4K5C A;  5BXO A;  5CEA A;  4GU5 A;  2XRZ A;  2XEN A;  1Q2Z A;  4Q96 A;  1E8Y A;  2P9S G;  5G05 C;  2PQR A;  3ZEF A;  1Y6I A;  3ZIM A;  4B8A A;  3VLD A;  3N71 A;  3PRE A;  2GRR B;  4L23 A;  3SY2 A;  1QYM A;  2RG8 A;  3FTU A;  5EKQ D;  3FTS A;  5ENT D;  2GRQ B;  2C0M A;  3NAW A;  4XZ4 A;  3R7R A;  2KZT A;  4KZ0 A;  2VJ8 A;  3EU9 A;  5D2M C;  2WXP A;  3L22 A;  5JJT A;  5LOZ A;  4AEZ C;  2AXV A;  4ZHB A;  1TN6 A;  3FUH A;  3UTM A;  4LG6 A;  3OAW A;  4DX7 D;  1FT1 A;  4RLY A;  1OCC E;  4LSZ E;  4KZC A;  3UT4 A;  2CG3 A;  4GMR A;  4U04 A;  1O1S A;  4ATG A;  3SD5 A;  1N54 A;  5CCM A;  2WMO A;  2OVB A;  2V0P A;  2IF4 A;  3APF A;  4I1O B;  5J08 A;  3ABL E;  1IQU A;  5BT1 A;  1MQS A;  4GCO A;  5JHA A;  4NUR A;  3VTX A;  3ZNG A;  2ILR A;  3S7J A;  2X38 A;  1IXV A;  4LER A;  4JW1 A;  1MJ0 A;  3LYA A;  3IKO B;  2A5E A;  4B93 B;  3C3Q A;  1HFA A;  2KCL A;  4I6E A;  4JB8 P;  3ZUV B;  3PS6 A;  5C1D A;  2X6K A;  5AQB A;  3G2W A;  4FUL A;  1KT0 A;  3JXI A;  4GZ5 A;  3PE3 A;  3D9P A;  3L16 A;  3LY8 A;  4YDY A;  2VGY A;  4RG9 A;  4ILH B;  4Q69 A;  3R9A B;  3JCK C;  1AP7 A;  3SHF A;  3MJW A;  3RRN B;  2FI7 A;  2H6H A;  2HE0 A;  5E75 A;  4CT0 A;  3KSL A;  3MV3 B;  3VLE A;  3C98 A;  4G8K A;  3O4Z A;  4UQZ A;  5AN8 A;  1KZO A;  3LVR E;  3EHN A;  3ONK A;  4ANU A;  2BED A;  4FLH A;  3GZS A;  4AOF A;  1BD8 A;  2AJA A;  2WQH A;  4N3A A;  1S70 B;  3CVQ A;  4M3O A;  3WG7 E;  3R9M A;  1E8W A;  4QFV A;  2J4B A;  3WXX A;  4JEH A;  4CZ2 D;  4HLL A;  2OND A;  5KNG A;  2WXJ A;  4FAD A;  2V5F A;  3ZFW A;  3T8M A;  2VGX B;  3RO2 A;  1D8E A;  1N0R A;  4YDW A;  5JA4 D;  4UUC A;  3CGH A;  1KT1 A;  1YMP A;  3UM1 A;  3ZVV A;  2LNI A;  2ZGD A;  3FP3 A;  1JWG A;  2EIJ E;  4PDX A;  3I4R B;  5BV0 A;  4CGV A;  3CKB A;  3QAQ A;  2LUH A;  4GYW A;  4YDE A;  3Q73 A;  3UPV A;  2GRM A;  3V79 K;  2VSX E;  3EHM A;  3ZHE A;  3ESL A;  5AEN A;  3KAE A;  2IOS A;  3QK0 A;  3OXG A;  3LEW A;  5CEC B;  2WM9 A;  3AG4 E;  5EX0 A;  4XIF A;  1QZ2 A;  5JHB A;  3PEV B;  3E4B A;  3FTX A;  3QWP A;  2L0T B;  1HXI A;  4FHK A;  4JEU A;  1WY6 A;  1G3N B;  3BG0 B;  2DIW A;  2XEE A;  4RVB A;  2WMN A;  5DIZ A;  4TRQ A;  3UMV A;  4L1B A;  5KJM A;  1LF8 A;  1MX6 A;  4N2S A;  4JXT A;  3ABK E;  5AAO A;  3HYM B;  3HDX A;  4EBA A;  1OWM A;  4WNF A;  1V54 E;  2J9Q A;  2JEK A;  2R59 A;  4X8Q A;  3ML8 A;  4TXR A;  1SZ9 A;  2KBX A;  2F37 A;  4U0S A;  5KNH D;  3B7S A;  4O1O A;  4BT9 A;  4KT6 B;  3FUE A;  4CEM A;  3AS4 A;  2P2C P;  3GZ2 A;  3ASF A;  4PS7 A;  4B94 A;  3AJI A;  3I3N A;  2R5S A;  5FWQ A;  2XPZ A;  3ZN3 A;  2DVW A;  3P2B A;  2CHZ A;  2WXL A;  3UM3 A;  4F6R D;  4DUI A;  3ZXS A;  3UT7 A;  1YYH A;  4AY5 A;  2XRY A;  3ZU7 B;  4DLQ A;  3SI5 A;  3Q15 A;  1FT2 A;  3KD7 A;  2EIM E;  2WXR A;  4KBQ A;  2PQN A;  3FFL A;  2C0L A;  1N0Q A;  3KEA A;  2YQ8 A;  4EZL A;  2LO6 A;  4UWG A;  1H2U A;  4HNA D;  3T8K A;  4GTQ A;  2XGM A;  3MA5 A;  2FEZ A;  2GRL A;  1JCS A;  2HR2 A;  2DZO A;  5T3R A;  3NBN B;  4GA0 A;  1K1B A;  3LXU X;  3CQG B;  3NOC D;  1NL4 A;  2F8X K;  3R7Q A;  3ASG A;  4H7Y A;  1XNF A;  5HRY A;  3FU6 A;  4LRZ A;  4I43 A;  5ARG A;  4EEC A;  1FVH A;  2V4H C;  4GB9 A;  3D9M A;  4MLP A;  3RO3 A;  1LD8 A;  1FPP A;  4G1T A;  1P5Q A;  3QB2 A;  5FZS A;  5AIJ A;  5J90 A;  4HS2 A;  4UQY A;  4APF A;  3CK7 A;  4PS8 A;  3U3W A;  4G24 A;  3QJZ A;  4I2Z A;  1OWL A;  3UI2 A;  3D9O A;  2QY7 A;  1HO8 A;  3ZYM A;  2R05 A;  4N2Q A;  2BF0 X;  4YVQ C;  2X6J A;  5AQA A;  4EZK A;  5LP0 A;  1S64 A;  2CHW A;  2MHK A;  3UIO C;  5ENN A;  3S2A A;  3AG2 E;  3L9T A;  1MYO A;  3HVE A;  3LJ3 A;  1TJF A;  3U9W A;  5BPP A;  3CSF A;  2KM4 A;  4I17 A;  3DBS A;  5JMN D;  4WWO A;  2WPV A;  4XX5 A;  4H7X A;  2JLB A;  5JJ6 A;  4AJW A;  2M63 A;  3TWT A;  5BXU A;  1U2V G;  3Q9N C;  1OWP A;  2XEV A;  2DYS E;  4CYM D;  4HXI A;  3RSE G;  3MV2 B;  4JL0 A;  1OWN A;  3CHP A;  4JHR A;  5EIL A;  2Y3A A;  1IKN D;  3U64 A;  3D9I A;  3NQP A;  4J8D A;  4J8Y A;  3VTY A;  4TXQ A;  3FUI A;  3PRZ A;  3NB2 A;  5FZQ A;  4JHK A;  4HRM B;  4BEP A;  1Z5S C;  3Q79 A;  5FJY A;  5E76 A;  5B1B E;  2LSV A;  2WXN A;  3FUD A;  4DI3 A;  3IHV A;  2X6F A;  1QNF A;  3D9H A;  2NYJ A;  1SW6 A;  2L6J A;  4PUC A;  4WWN A;  2LXM A;  2ZGG A;  4I9E A;  4N5Q A;  2VTB A;  1HH8 A;  3DXK G;  4HI8 A;  5AAR A;  1NP7 A;  4C0E A;  3CV0 A;  4U0U A;  1ZB1 A;  2KCK A;  1O5M A;  2XS1 A;  3RRU A;  4GPM A;  2Q7F A;  4MS6 A;  4FLB A;  2GW1 A;  4G11 A;  1WM5 A;  4R7L A;  4XEI G;  3HIZ A;  3CVL A;  2FO7 A;  2BKK B;  1SA4 A;  3BU8 A;  2XQ0 A;  2RKK A;  3CVP A;  2J4D A;  3L6A A;  1UJK A;  1DC2 A;  3FHE A;  2PZI A;  2WQ7 A;  1RW2 A;  4WND A;  4HOU A;  2J09 A;  2I9C A;  1O1T A;  4OAU C;  1NZN A;  3FDH A;  1LD7 A;  5M72 A; 
#chains in the Genus database with same CATH homology
 1OCC E;  3AG4 E;  2Y69 E;  3ASN E;  3ABM E;  1V55 E;  1OCR E;  3ABL E;  2EIM E;  2DYS E;  5B1B E;  1OCO E;  3ABK E;  1OCZ E;  5B1A E;  2DYR E;  2EIL E;  3WG7 E;  2EIK E;  2ZXW E;  3AG1 E;  2OCC E;  2EIJ E;  1V54 E;  3AG3 E;  3ASO E;  2EIN E;  5B3S E;  3X2Q E;  3AG2 E;  5IY5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...