4EBAG

Crystal structure of the rna14-rna15 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
81
Chain Sequence
b'PWLPVGVDVNINMTTPAMCISSELGKLQKDQQMALLKVIQHFCKDETFVALLEEAPQLSYAIAELLLSNGVCSVDQLTQLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords mRNA 3'-end-processing protein RNA14
publication title Crystal structure of the Rna14-Rna15 complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Structural protein/rna binding protein
total genus 18
structure length 81
sequence length 83
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF14304 CSTF_C Transcription termination and cleavage factor C-terminal
G PF14327 CSTF2_hinge Hinge domain of cleavage stimulation factor subunit 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.630 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ebaG00
2L9BA 4EBAG
chains in the Genus database with same CATH superfamily
1WAO1 4UI9J 3DSSA 4CRWA 3CVVA 3FH8A 3AS8A 3SBSA 2Y4UA 1MX4A 4I1OB 2IEJA 3FU3A 3EU5A 3D9JA 3C5RA 4UWHA 4P29A 2HO1A 3DBSA 1JWFA 2CHZA 3ZYMA 1N54A 4JZYA 3AAAC 1HX8A 1UJKA 2KATA 5EYPF 1WM5A 3EHRA 3D3MA 4GTTA 5CRUA 3FTZA 1WDYA 3QWPA 2IO2C 2EQXA 4CCAA 2DZNA 2LSVA 3ONKA 5BV0A 1A17A 3DSWA 4DUIA 2WXLA 1H6PA 3FWVA 1H2VC 3LY9A 2ONDA 1UJJA 2PNNA 3HVEA 4ACLA 2FULA 4C0MA 4GTQA 4U8YD 4OAVB 2WQ7A 4O60A 1QYMA 1MX2A 2XEHA 1WG0A 3DPDA 3PH0C 3URZA 3ISMC 2AWIA 1NA0A 4KMOA 2FBNA 2WXIA 4MBGA 4FULA 3NBNB 3MCXA 3QB2A 3FTYA 4RG9A 3MX3A 4DX5D 1DCEA 5EKQD 4GB9A 2V0PA 1A5EA 3RIBA 2WMOA 2XGOA 3OAWA 4A55A 4GTVA 3HXDA 5CHEE 3UT4A 5BPPA 4MKTA 3CKCA 3LKUA 3APDA 4RSYA 5CRVA 4N5QA 4ATZD 2ETCA 3SD5A 2XGSA 2ILRA 4PS8A 4KBQA 3ZXPA 1IXVA 4GU5A 4LNGA 4KYOB 1NP7A 2CFUA 1KT0A 4FHKA 2NC9A 3Q15A 2I1JA 4B94A 3AS5A 4A3VA 2XCBA 3RRNB 5DBKA 4FLHA 5DIZA 4JEHA 4DX2A 1HS6A 4XIFA 4U8VD 4ZHBA 1SZAA 1HXIA 1TNUA 3LPZA 4XKBA 4ATGA 2IFUA 3CVPA 2DVWA 3HIZA 1BPOA 2IJGX 1ZBPA 3NF1A 3EU9A 1OY3D 2KCKA 2EIJE 4GTSA 1DNPA 1E8XA 2YHEA 3TWVA 4OAUC 2UWJG 3S7BA 5B3SE 2GROB 1EDUA 3PREA 2R59A 1LTXA 4GPMA 3RJVA 4ABNA 4H7XA 3JYSA 4CDMA 3BU8A 4V3IA 1HH8A 3E37A 5EX0A 2P9NG 4ACKA 4WUYA 3CHQA 2WXHA 1FT2A 1JCRA 2X3MA 4JXTA 2I1KA 2DIWA 2GRNB 3FUIA 1OWPA 4TRQA 3JXIA 2XPIA 2RD0A 3TWSA 3CVYA 4GZDA 3B7BA 4EZJA 4DPRA 2WXPA 3ASOE 3S2AA 2XZTG 1KZPA 3V79K 1O1TA 4GPKA 4NQ0A 1TNOA 4UWKA 2YINA 4NURA 3B7SA 2B6CA 3ZW3A 4LERA 3CIAA 2JLBA 3HXBA 5ENPD 3QC1A 5CMWA 5G55A 3B95A 3UIOC 2P9IG 3JCKC 2J08A 4K5BA 2WM9A 3PS6A 3Q49B 4WNDA 4KZCA 4OVUA 4E6HA 3MGBA 4PS7A 3QJZA 1U3DA 2QYUA 4X8QA 4G2VA 4Q96A 1N4PA 2CHWA 2BUGA 3EUVA 3DSUA 2VSXE 3KEAA 4C48B 3BUAA 3RSEG 3ZXSA 4I1AA 4CDNA 1EPUA 4I2WA 2LO6A 4I43A 4MLPA 5EYLA 4Y6CA 3EHQA 2X6IA 3QWWA 3I3NA 4L1BA 1TN8A 3PEVB 1E96B 1HO8A 1SA4A 2RFMA 3CK7A 4WNFA 4JL0A 5LOZA 4BT8A 4J8YA 1SVXA 2DCPA 4XKCA 3ESKA 4BSZB 3APFA 3UM0A 1HFAA 2LNIA 3L54A 1YYHA 2E0IA 1PC2A 1UG3A 1ELKA 3L16A 1S63A 2EINE 4ILHB 4AY6A 4GYYA 2JABA 4HLLA 1E7UA 3E32A 3D9LA 4A3TA 2V8SE 2YHCA 3AU4A 3CSTA 3CK9A 4BERA 3J5PA 1INZA 5ENTD 1ELRA 3PE3A 1NZNA 3PNTB 4Q69A 5LX8A 2L0IA 2WMNA 3FUMA 1V54E 4DJAA 2X38A 5J90A 3IBEA 4U04A 3UI2A 4GTOA 2R5SA 2F8YA 3NZUA 2L6JA 4G24A 5FT9A 2YQ8A 2XRZA 3U3WA 2XPZA 2LAHA 2PM6A 4JB8P 4BY6A 3O48A 4JPSA 3FUHA 4BT9A 3NB2A 3LJ3A 5H7PA 1W3BA 3Q7FA 2MOWA 3IV0A 4YVOA 3GW4A 3NAWA 2MYOA 3PNLB 3UM3A 4LUNU 2BTDA 4ZFHA 4GA1A 3C3QA 4HORA 4K03A 3SQVA 2UY1A 2KBXA 5T4YA 3C72A 4MS6A 1JCSA 3PZDA 4NIKA 5G05C 5T8IA 5FJYA 5A7DB 3F6QA 3TAXA 4ANVA 3DPYA 2P2CP 1DCQA 1OT8A 4FP7A 3ENEA 1AP7A 4LSZE 3B13A 3D9NA 3R9MA 5HQ8A 3P1UA 4L7TA 4U0SA 5KJNA 1TN6A 2BEDA 3ZU7B 4HOSA 2OOEA 4LNBA 3TWQA 2Y69E 4GZCA 3RU0A 3VTXA 4CEMA 4LRZA 4ANXA 3CVUA 4J8SA 3SY2A 5CBNA 3T9KA 3EDTB 4OYSA 3ASNE 2XGMA 4M7CA 4YDEA 3UM2A 4GTMA 3ZKJA 1RZ4A 1N94A 2HM8A 1LF8A 4U07A 4EHMA 3TGOA 2NYJA 3LS8A 3ZN3A 5D66A 1TEZA 1N9AA 3UINC 3I4RB 3TWRA 2Y3AA 5C2YA 3APCA 2QY7A 1OCZE 4B93B 3ULYA 4HS2A 1XNFA 5AAOA 4O6FA 4JHJA 2WB2A 3CQCB 3TG4A 2WXGA 3B7UX 3HXCA 4U8HA 4N5CA 3G2TA 2KZTA 3GZ1A 4XX5A 2WVIA 1DVPA 4IN3B 4KT6B 2MHKA 2RKKA 2VSYA 2QFCA 2DYRE 1OCRE 1FT1A 1ELWA 3BG1B 4BETA 2OV8A 3Q4AB 2FO7A 1NL4A 3OXLA 4Q94A 3MKQB 4RLYA 3D9KA 5LP0A 3UPVA 1AWCB 5ENQD 2NSZA 4UQZA 2ZGDA 3L08A 3L13A 4D10C 3ZEFA 1N4RA 5JJ7A 4HFGA 3UUXA 3S7FA 3G2SA 4I9EA 3NZSA 1OCCE 2GRPB 3E33A 3K9IA 3RK6A 5D0OD 4BX9A 4EZLA 5AQAA 5D2MC 5A6CA 1BD8A 1O1RA 2XPYA 5E75A 3QOUA 3S7DA 5EN5D 3HHMA 3CSFA 5D0QD 3PEUB 3VTYA 2BKKB 4GTRA 3GZSA 2IO3C 1H6KA 2VQ2A 3TXNA 1TJFA 1GW6A 1IYGA 4A63B 2LAIA 5CMYA 1H19A 1N11A 4XEIG 3E34A 2VGXB 1IHGA 2H6HA 2P9SG 3ULEG 3JXJA 4WWPA 4ILIA 4AVXA 4F53A 4XI0A 3DXMG 2C0MA 2WXJA 3Q7AA 4APOA 5JJ6A 2EIME 3UT8A 1E8YA 4JHRA 2CFZA 4WWOA 2H6IA 2VTBB 3ZYLA 4BFRA 4HVBA 1H6OA 3NQPA 4FC8A 3CR3A 4APFA 3FP3A 3DSTA 4E85A 5JJTA 1VDYA 5B1BE 1OWOA 4DLQA 1Z5SC 4F1SA 3Q79A 4G23A 5LFAA 4AJWA 4R7LA 4XZ4A 5BNWA 2EILE 4G25A 1IQRA 3LDZA 4C9BB 3ZPJA 3UKRG 1BI7B 3AS4A 4LEUA 4B8AA 3KD7A 2BF0X 1MX6A 3SBTB 2VTBA 1X5BA 2L0TB 2VSOE 4C0EA 3C3OA 3FTWA 4LCTA 5JHBA 2BKGA 2V5QC 3AJIA 1TYQG 4CGWA 4PDXA 2XHEA 4U0ZA 2ETAA 3AU5A 3CHSA 2A4ZA 1Z3XA 4PUCA 2J09A 3FUNA 4RVBA 5A23A 3MV2B 1D8DA 2I9CA 2IQCA 1SW6A 3G2WA 4W9RA 4J8DA 1UN8A 3UMVA 3PZ4A 2R03A 3VLEA 4F7AA 5G05J 1B89A 1QQEA 3CEQA 2C2LA 4I2ZA 4TXRA 3N71A 4QFVA 3TWXA 3W9FA 2WPVA 4L2YA 3D9HA 2IOSA 2XQ0A 1UN9A 1N52A 4BTBA 5LCWC 3PE4A 3NOCD 5EIDA 4EBAA 3FUKA 4DK5A 4DX7D 2Y0BG 5G2NA 3R9AB 5KJKA 2X6HA 4CDRA 3ZNGA 5AARA 3WG7E 2KM4A 2H6GA 3QKYA 1QZ2A 4JEUA 5BW8C 4FJYA 3ZRHA 1LD8A 3E4BA 4HRLA 3OXFA 3HRAA 2WXKA 4WWNA 3UKUG 2LUHA 3RRMB 5ITZF 4HXIA 4FLBA 4GMLA 3Q47B 1U2VG 2IF4A 1E8WA 3KAEA 4HOQA 5HS0A 4DI3A 4NRHB 1E8ZA 4AEZC 5T3RA 4F1PA 1NFIE 5ENOD 2P58C 3SI5A 4JD2G 4NACA 1OUVA 4N2SA 2ZIRA 4AM9A 1BI8B 2QC9A 3SHFA 5ENNA 5KNHD 1YMPA 1XGWA 5B1AE 2KCVA 4N3CA 3HDXA 1BLXB 1MQSA 5G04C 3ZYKA 3SF4A 2YNQA 4EECA 4J8FA 2KCLA 3NOGD 3L17A 4J7WA 3L6AA 3DXKG 2DYSE 2OEWA 4HQDA 4BX8A 2AVPA 4RQIA 1K3ZD 4GA0A 1ZB1A 3PUKA 5ARFA 2C0LA 4A1GA 3PDNA 1HF8A 4YVQC 2J9QA 4HI9A 1E7VA 3RO2A 2RG8A 3BQOA 4M3OA 1QNFA 4YDWA 5HKPA 1MJ0A 3QARA 2XEEA 3U4TA 4L2LA 5CBOA 3FTVA 1N4SA 1DC2A 4G8LA 1HG2A 4YDOA 2VSNA 2PZIA 4ILGA 2GRRB 1TR4A 3QNKA 5C1DA 5AQ7A 4RG6A 5KJMA 3EHNA 3U9WA 2HE0A 4GMRA 1SQMA 1N95A 2V4HC 5CERB 5FZSA 2KC7A 2PQNA 2WXMA 3ZHEB 3Q78A 3UM1A 4JC8A 3PZ3A 3HXFA 4G1TA 4ANWA 4N3BA 2LXLA 4KVMA 3FTXA 4JA7A 3HXEA 2QZAA 5FWQA 2DBAA 2V5FA 3FTUA 5EILA 1Z3YA 3G2VA 3FEXA 3ZGQA 3T8KA 3FU0A 3LVRE 3U66A 1UW4B 4OVVA 3HYMB 3ASHA 4HB5A 3LEWA 4N3AA 3U64A 1O5MA 4U95D 2X6KA 2GGFA 2QYJA 2PQRA 2WQHA 3FH7A 3UXGA 2R17C 1MHQA 2H6FA 4U96D 3ASGA 4G8KA 3E30A 3ZUVB 1FPPA 3ZIMA 1S0PA 2DWZA 3CVQA 3DSVA 2CG3A 1Y6IA 4HOTA 3RKVA 5KWDA 2X6FA 2WXQA 4HBDA 2L6BA 4HNAD 5JHAA 1OWMA 1MZCA 4L23A 3SGHA 4FADA 3V2XA 3RAUA 2ZGGA 4CT4A 3CVLA 1X81A 1P5QA 1N4QA 3T5VA 2IOLA 2WXRA 4GZ3A 5BUZA 1E90A 5AJLA 2ZU6B 3V31A 2P9KG 1LD7A 2FF4A 2F8XK 1D8EA 3C98A 1Q2ZA 4IULA 2I6HA 5FQ6A 2VJ8A 3CKBA 3CHOA 5AENA 2WQ6A 3MYVA 3KS2A 3T8MA 5FTPA 2OEVA 3ONLA 3TG5A 5ANRA 3HVEB 5BXUA 3IEGA 3L82A 4UI9K 4BEPA 4HRNA 3UTMA 2PL2A 3KEZA 5HI7A 4KZ0A 3O4ZA 4ANUA 5AQBA 5JMND 4EZKA 5BT1A 5CCMA 2AXUA 2I2OA 5LCWJ 1OCOE 1UOHA 1OWNA 2JEKA 2NXPA 1H2UA 3TWWA 3IXEA 4O1PA 4CYMD 1HU3A 3ML8A 2XCCA 4TXPA 4Y6WA 4UQXA 3D9IA 4G11A 3MKQA 4PH4B 2J4BA 3W9GA 3ZVVA 3FDHA 4K0RA 4JW1A 3AG2E 4H7YA 4DX6D 4UWGA 3B7RL 3SO8A 2R05A 4GCOA 1YA0A 3ABME 4GTPA 2Q7FA 5KJLA 3VLDA 2J07A 1KLXA 2CG2A 4K5CA 3MJWA 4EQFA 2GRLA 1TNBA 3X2QE 3EIJA 3AG1E 2AXZA 2ZISA 5KCMA 5JA4D 4JVSA 3EJNA 5G04J 2L9BA 3TL5A 5IY5E 3SFYA 2CHXA 1KZOA 1MYOA 3JQ0A 1QBQA 3D9MA 2GRQB 4WNGA 2IU1A 4MRUA 1HZ4A 4B8CB 5M72A 2IONA 4QQIA 4GZ6A 2F0YA 2R02A 2A5UA 4AY5A 4BSXA 2VGXA 3PUJA 2LSUA 2M63A 3IKOB 3CVWA 3HG0D 3D9OA 3I4GA 4J6IA 3CVNA 3DWLG 2EIKE 3SNXA 3PRZA 1JCQA 1K8KG 3PZ1A 2HR2A 4EPZA 4FU3A 3CHPA 1FVHA 3TWUA 4N39A 4TUUA 2MRIA 3RO3A 4AIFA 5ENRD 4UWFA 5EDSA 4EBAG 1H2TC 3KSLA 1HG5A 4BWRA 4GYOA 4LG6A 4CT0A 5CCLA 2F37A 4AP2A 4UI9C 4GYWA 2P9PG 3EIQC 3J5QB 5FQ7A 2RFAA 2WXOA 2VGYA 4I6EA 4TXQA 1FCHA 2AJAA 2E2EA 5E76A 3QK0A 4O1OA 1FVFA 3AG4E 4I17A 3ABKE 4B0ZA 3FUFA 4TUMA 1G3NB 3L22A 1TJCA 4FJZA 3Q75A 1JPLA 4WNEA 3DEOA 2J8SD 1S70B 4GMJA 3JUIA 3SZ7A 1IKND 3UIPC 3WXXA 4CZ2D 2WXFA 2DZOA 3FUDA 2Y1LE 4XI9A 3CV0A 2XENA 3UX4A 4LNUD 2FI7A 1Y8MA 3T5XA 2AXVA 3G2UA 3ZFWA 2V4LA 4AOFA 4TV3A 3FULA 2VYIA 3BEEA 2J49A 5ENSD 4DRXE 3ESLA 5HRYA 3AG3E 2ZXWE 4U7EB 3UQ3A 3TXMA 4DX1A 1S64A 2OVFA 3FFLA 4F3VA 3QWVA 2XS1A 1K1AA 3MEKA 4FA6A 3FU6A 4U0UA 2FO1E 5BXOA 5CEDB 3LXUX 5KNGA 1PY1A 4DI4A 4GA2A 3UT7A 2ETBA 5AYWD 3I5PA 2J4DA 2XRYA 1EYHA 5EX3A 5EIBE 3LYAA 1IQUA 1JUQA 3BG0B 2LXMA 2KXPC 3CHMA 4UUCA 5CEAA 5AJDA 4HOUA 5KBAA 3ABLE 3OTNA 3P2BA 3FY4A 4KVOA 4HLEA 1NA3A 3V30A 3MZLB 1NI1A 4YDYA 1OXJA 2IY0C 3GZ2A 4JHKA 3Q73A 4B89A 1N0RA 4A1SA 3IHYA 4HI8A 5FINA 3CQGB 3ASFA 3FH5A 3D9PA 1KT1A 3PVLA 3SFXA 3R7RA 2XS8A 3DRAA 2HYZA 2FEZA 3Q9NC 3VLFA 2OCCE 4N2QA 1TN7A 1SZ9A 1U3CA 3EHMA 1PAQA 4IYPA 1WY6A 3LY8A 4Z68A 5FZQA 1ZU2A 2UY1B 3OXGA 5FZRA 4PS3A 2A5EA 3IHVA 2XZDG 3V2OA 2PM7A 3LCAA 4J8EA 2WXNA 3ML9A 3KSQA 3LY7A 1TNYA 4FHJA 5FIOA 3ZYQA 2B0OE 2GRMA 3MV3B 4YNDA 3JQ1A 1RW2A 3MA5A 5J08A 3CVXA 3TWTA 5CECB 4GZ5A 3C3RA 1SA5A 3CLJA 3JUEA 3DEPA 1N0QA 4K5AB 1IHBA 2OVBA 4UQYA 1EF1C 1OWLA 2R2LA 3FUJA 1YCSB 4BESA 1HE8A 2X6JA 1O1SA 1H0AA 3GYZA 3Q5MA 4IRUA 4GAAA 5ANLA 1V55E 5ARGA 4AV7A 3CHRA 4F6RD 3RRUA 1L5JA 4U63A 4CGVA 4I1MA 4I6JA 4XE0A 4KXKB 4BTAA 4GCNA 2P9UG 5FQ8A 3ZHEA 3CK8A 3R7QA 2VGEA 3PZ2A 4JA9A 1Z6TA 1BU9A 1KPSB 1D9SA 1K1BA 3S7JA 3FHEA 4L9PA 5AN8A 5AQ9A 3SFZA 4UWLA 3CGHA 2KZTB 3ASDA 4DLOA 3QDNA 2P9LG 3MKRA 3LVQE 3FUEA 3QAQA 1TNZA 4URKA 2Y4TA 1JWGA 4I9CA 4WAFA 5AIJA 3DSXA 5FQ4A 4ME2A 2GW1A 5BV1A 4HRMB 2XEVA 2AW6A 4G26A 3LJNA 3B7TA 4AXHA 3L9TA 3FU5A 4J0UA 3Q9UC 3FTSA 3FEYA 3ULQA 3TJPA 4I6GA
chains in the Genus database with same CATH topology
1WAO1 4BY6A 4WNGA 3O48A 4JPSA 3FUHA 2IU1A 4MRUA 2KM4A 4UI9J 1HZ4A 4BT9A 4CRWA 4B8CB 3QKYA 1QZ2A 5M72A 3LJ3A 4JEUA 3CVVA 3FH8A 3AS8A 5BW8C 2IONA 3SBSA 4FJYA 1W3BA 3ZRHA 3E4BA 4GZ6A 2Y4UA 4I1OB 3FU3A 3D9JA 2MOWA 3IV0A 4YVOA 4UWHA 3OXFA 4P29A 2WXKA 2A5UA 3GW4A 2HO1A 4WWNA 3DBSA 3PNLB 1JWFA 3RRMB 2CHZA 4AY5A 4BSXA 2VGXA 3ZYMA 3PUJA 1N54A 4JZYA 2LSUA 4LUNU 4HXIA 2BTDA 4FLBA 4GA1A 4GMLA 2M63A 1HX8A 1UJKA 3IKOB 2KATA 3Q47B 2IF4A 3KAEA 1E8WA 1WM5A 4HOQA 4HORA 4DI3A 4NRHB 4K03A 3CVWA 1E8ZA 2UY1A 3D3MA 4AEZC 5T3RA 5T4YA 3D9OA 4MS6A 3FTZA 3PZDA 5G05C 2P58C 3I4GA 3QWPA 4J6IA 3SI5A 5T8IA 3CVNA 5FJYA 2EQXA 4NACA 4CCAA 5A7DB 3TAXA 4ANVA 1OUVA 2LSVA 4N2SA 3ONKA 4AM9A 3SNXA 5BV0A 3SHFA 5ENNA 1A17A 3PRZA 4FP7A 2HR2A 4EPZA 3ENEA 4FU3A 2WXLA 3FWVA 1XGWA 1H2VC 3B13A 3D9NA 3CHPA 2KCVA 1FVHA 5HQ8A 4N3CA 4N39A 3LY9A 4TUUA 3P1UA 3HDXA 2MRIA 2ONDA 4L7TA 4U0SA 3RO3A 4AIFA 5KJNA 1MQSA 1UJJA 5G04C 3HVEA 4ACLA 4UWFA 2FULA 4HOSA 3ZYKA 2OOEA 5EDSA 4EBAG 1H2TC 1HG5A 4C0MA 4BWRA 4GZCA 4GYOA 3SF4A 2YNQA 4EECA 4J8FA 2KCLA 4CT0A 3L17A 3RU0A 3VTXA 5CCLA 4AP2A 4CEMA 3L6AA 4LRZA 4UI9C 4GYWA 4ANXA 3CVUA 4J8SA 2WQ7A 3EDTB 3EIQC 4OYSA 5FQ7A 2XGMA 2WXOA 2VGYA 3DPDA 4I6EA 1FCHA 2E2EA 5E76A 4BX8A 3PH0C 3QK0A 3URZA 2AWIA 2AVPA 1FVFA 1LF8A 2HM8A 1NA0A 4I17A 4KMOA 4B0ZA 2FBNA 2WXIA 4U07A 4GA0A 3FUFA 3PUKA 3L22A 3TGOA 4FULA 3LS8A 1TJCA 3MCXA 3ZN3A 3QB2A 4FJZA 5ARFA 2C0LA 1TEZA 3FTYA 4RG9A 3MX3A 4A1GA 1JPLA 4WNEA 3I4RB 5EKQD 2Y3AA 5C2YA 3APCA 4GB9A 4GMJA 3PDNA 2QY7A 3JUIA 1HF8A 4YVQC 2V0PA 3SZ7A 2J9QA 3RIBA 1E7VA 3RO2A 2RG8A 4M3OA 1QNFA 3WXXA 4HS2A 2WXFA 1XNFA 2WMOA 4O6FA 4JHJA 2WB2A 3FUDA 2XGOA 3QARA 3OAWA 4XI9A 3CQCB 3CV0A 3U4TA 3UX4A 4L2LA 4A55A 3TG4A 2FI7A 2WXGA 1Y8MA 3T5XA 2AXVA 3G2UA 3ZFWA 3B7UX 4U8HA 5CHEE 4N5CA 3FTVA 2V4LA 3UT4A 4AOFA 5BPPA 4TV3A 3G2TA 2KZTA 3FULA 4MKTA 3CKCA 3GZ1A 3LKUA 2VYIA 4XX5A 1HG2A 3APDA 4RSYA 3BEEA 2J49A 2VSNA 2PZIA 2WVIA 4ILGA 3QNKA 1DVPA 4IN3B 4KT6B 5C1DA 2MHKA 3ESLA 4RG6A 2VSYA 5KJMA 2QFCA 3EHNA 3SD5A 2XGSA 1ELWA 3BG1B 3U9WA 3UQ3A 4I6GA 3TXMA 1SQMA 2ILRA 2OV8A 4PS8A 4KBQA 2OVFA 4GU5A 5FZSA 3FFLA 3Q4AB 4KYOB 1NP7A 2FO7A 4F3VA 2CFUA 1KT0A 3QWVA 2KC7A 2PQNA 2WXMA 4FHKA 3ZHEB 2NC9A 4JC8A 3MEKA 2I1JA 3Q15A 4FA6A 4B94A 3FU6A 3AS5A 4A3VA 4U0UA 3OXLA 2XCBA 4G1TA 3LXUX 4ANWA 4Q94A 1PY1A 3MKQB 3RRNB 4DI4A 3D9KA 4N3BA 4GA2A 4KVMA 5DBKA 3UT7A 3FTXA 5LP0A 4FLHA 3UPVA 5DIZA 4JEHA 1HS6A 4JA7A 5AYWD 3I5PA 2J4DA 4XIFA 2XRYA 1EYHA 5EX3A 2NSZA 5FWQA 4UQZA 2DBAA 3LYAA 2V5FA 1SZAA 3FTUA 1HXIA 3LPZA 4XKBA 1IQUA 1Z3YA 3G2VA 3L08A 1JUQA 3BG0B 3FEXA 3FU0A 3L13A 3LVRE 3ZGQA 2IFUA 1UW4B 4ATGA 3U66A 4D10C 4OVVA 3CVPA 3HYMB 3ASHA 3ZEFA 3LEWA 4N3AA 5JJ7A 3CHMA 3HIZA 4HFGA 3UUXA 1BPOA 2IJGX 1ZBPA 3U64A 3S7FA 3G2SA 2X6KA 3NF1A 2GGFA 4I9EA 5AJDA 3NZSA 4HOUA 2KCKA 2PQRA 3OTNA 2WQHA 3P2BA 1DNPA 1E8XA 2YHEA 3FY4A 4KVOA 4HLEA 1NA3A 3FH7A 2UWJG 3K9IA 3MZLB 2R17C 3S7BA 3RK6A 1MHQA 1EDUA 5D0OD 3PREA 4BX9A 4EZLA 2R59A 3GZ2A 3RJVA 4JHKA 4ABNA 5A6CA 3ASGA 2XPYA 4H7XA 3JYSA 5E75A 4B89A 4CDMA 4V3IA 3QOUA 1HH8A 3S7DA 5EX0A 3ZIMA 1S0PA 3CVQA 3HHMA 3IHYA 4A1SA 3CSFA 4ACKA 5D0QD 3PEUB 2CG3A 1Y6IA 3CQGB 4WUYA 3ASFA 3VTYA 3FH5A 4HOTA 3RKVA 3CHQA 2WXHA 3D9PA 3GZSA 1H6KA 1KT1A 2X6FA 2X3MA 2VQ2A 3TXNA 1TJFA 4JXTA 2I1KA 1GW6A 2DIWA 2WXQA 3PVLA 1IYGA 3R7RA 5JHAA 3FUIA 2HYZA 2FEZA 1OWMA 2LAIA 1OWPA 4L23A 4TRQA 3SGHA 2XPIA 5CMYA 2RD0A 4FADA 3VLFA 1H19A 3CVYA 4GZDA 4EZJA 4DPRA 2VGXB 2WXPA 4N2QA 1IHGA 1SZ9A 4CT4A 1U3CA 3CVLA 3EHMA 1PAQA 3S2AA 4IYPA 1WY6A 3LY8A 4WWPA 1P5QA 4ILIA 4AVXA 5FZQA 1ZU2A 4F53A 3T5VA 2IOLA 2WXRA 4GZ3A 4XI0A 5BUZA 4GPKA 1E90A 2UY1B 3OXGA 2C0MA 4NQ0A 5FZRA 2WXJA 4UWKA 4PS3A 5AJLA 4APOA 5JJ6A 2YINA 3IHVA 4NURA 3B7SA 2PM7A 2ZU6B 3LCAA 4J8EA 3UT8A 2WXNA 3ML9A 3ZW3A 1E8YA 3CIAA 4LERA 2JLBA 3LY7A 4FHJA 2FF4A 3QC1A 5CMWA 4JHRA 2CFZA 4WWOA 2GRMA 3MV3B 4YNDA 5G55A 3JQ1A 3ZYQA 4CDRA 3C98A 3MA5A 4IULA 5J08A 3ZYLA 2VTBB 2I6HA 3JCKC 5FQ6A 3CVXA 4BFRA 2VJ8A 3CKBA 2J08A 3CHOA 4HVBA 2WM9A 3NQPA 5AENA 3PS6A 4GZ5A 3Q49B 4FC8A 4WNDA 2WQ6A 4KZCA 4OVUA 4E6HA 3MGBA 3CLJA 3CR3A 3MYVA 4PS7A 4APFA 3FP3A 3KS2A 3QJZA 1U3DA 4E85A 4G2VA 3T8MA 4Q96A 5FTPA 1VDYA 2OVBA 4UQYA 1EF1C 5JJTA 3ONLA 3TG5A 5ANRA 1OWLA 3HVEB 2CHWA 1OWOA 4DLQA 2BUGA 4F1SA 3IEGA 3FUJA 2VSXE 1HE8A 4UI9K 2X6JA 4G23A 1H0AA 5LFAA 3GYZA 3Q5MA 4AJWA 4IRUA 3ZXSA 4GAAA 4I1AA 2PL2A 4R7LA 4XZ4A 3KEZA 5ANLA 5HI7A 5BNWA 4KZ0A 4CDNA 1EPUA 3O4ZA 4G25A 4I2WA 5ARGA 4AV7A 2LO6A 4ANUA 1IQRA 3LDZA 4C9BB 3ZPJA 3CHRA 4I43A 4MLPA 3AS4A 4Y6CA 3RRUA 4LEUA 4EZKA 5BT1A 4B8AA 1L5JA 3KD7A 2AXUA 2I2OA 5CCMA 4U63A 5LCWJ 2BF0X 2X6IA 4CGVA 3QWWA 3I3NA 1OWNA 2JEKA 3SBTB 4L1BA 2VTBA 3PEVB 4I1MA 1X5BA 2L0TB 2VSOE 1E96B 4I6JA 1HO8A 4XE0A 4C0EA 4KXKB 2NXPA 3CK7A 4GCNA 4WNFA 4BTAA 1H2UA 3FTWA 5FQ8A 4LCTA 5JHBA 4JL0A 5LOZA 4BT8A 3ZHEA 3CK8A 1HU3A 3R7QA 2DCPA 3ML8A 4XKCA 2XCCA 4Y6WA 4CGWA 3ESKA 3D9IA 1Z6TA 4G11A 4JA9A 2XHEA 4PDXA 4UQXA 3APFA 4U0ZA 3AU5A 3CHSA 3S7JA 3MKQA 3FHEA 4PH4B 2A4ZA 2J4BA 1HFAA 2LNIA 1Z3XA 3L54A 2E0IA 3ZVVA 1PC2A 1UG3A 1ELKA 4PUCA 2J09A 3FDHA 3L16A 3FUNA 3SFZA 4K0RA 4ILHB 4AY6A 4JW1A 4RVBA 4UWLA 4GYYA 3CGHA 5A23A 2KZTB 3MV2B 1E7UA 3ASDA 4DLOA 2I9CA 2IQCA 4H7YA 3D9LA 4A3TA 2V8SE 4UWGA 3B7RL 3QDNA 2YHCA 3AU4A 3G2WA 3CSTA 3MKRA 4W9RA 3LVQE 3FUEA 4GCOA 3CK9A 1YA0A 4J8DA 1UN8A 2Q7FA 3QAQA 3UMVA 5KJLA 1INZA 3VLEA 4F7AA 1ELRA 5G05J 3VLDA 1B89A 1QQEA 3CEQA 4URKA 2Y4TA 3PE3A 2J07A 2C2LA 1JWGA 1NZNA 1KLXA 3PNTB 4I9CA 4I2ZA 4WAFA 2CG2A 4Q69A 5AIJA 5LX8A 3MJWA 5FQ4A 2L0IA 4ME2A 2WMNA 2GW1A 4EQFA 5BV1A 3N71A 2GRLA 2XEVA 2AW6A 4G26A 4QFVA 3B7TA 4AXHA 3FUMA 4DJAA 3EIJA 2WPVA 2AXZA 2X38A 4L2YA 5J90A 3FU5A 3IBEA 2IOSA 2XQ0A 4J0UA 4U04A 5KCMA 1UN9A 2R5SA 3FTSA 2L6JA 3NZUA 4G24A 4JVSA 1N52A 4BTBA 5FT9A 5LCWC 3EJNA 3FEYA 3PE4A 2YQ8A 3ULQA 4EBAA 3FUKA 5G04J 2L9BA 4DK5A 2XRZA 3U3WA 2XPZA 5G2NA 2LAHA 2PM6A 3TJPA 3TL5A 3R9AB 5KJKA 2CHXA 2X6HA 3JQ0A 3D9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9B A;  4EBA G; 
#chains in the Genus database with same CATH topology
 1WAO 1;  4UI9 J;  3DSS A;  4CRW A;  3CVV A;  3FH8 A;  3AS8 A;  3SBS A;  2Y4U A;  1MX4 A;  4I1O B;  2IEJ A;  3FU3 A;  3EU5 A;  3D9J A;  3C5R A;  4UWH A;  4P29 A;  2HO1 A;  3DBS A;  1JWF A;  2CHZ A;  3ZYM A;  1N54 A;  4JZY A;  3AAA C;  1HX8 A;  1UJK A;  2KAT A;  5EYP F;  1WM5 A;  3EHR A;  3D3M A;  4GTT A;  5CRU A;  3FTZ A;  1WDY A;  3QWP A;  2IO2 C;  2EQX A;  4CCA A;  2DZN A;  2LSV A;  3ONK A;  5BV0 A;  1A17 A;  3DSW A;  4DUI A;  2WXL A;  1H6P A;  3FWV A;  1H2V C;  3LY9 A;  2OND A;  1UJJ A;  2PNN A;  3HVE A;  4ACL A;  2FUL A;  4C0M A;  4GTQ A;  4U8Y D;  4OAV B;  2WQ7 A;  4O60 A;  1QYM A;  1MX2 A;  2XEH A;  1WG0 A;  3DPD A;  3PH0 C;  3URZ A;  3ISM C;  2AWI A;  1NA0 A;  4KMO A;  2FBN A;  2WXI A;  4MBG A;  4FUL A;  3NBN B;  3MCX A;  3QB2 A;  3FTY A;  4RG9 A;  3MX3 A;  4DX5 D;  1DCE A;  5EKQ D;  4GB9 A;  2V0P A;  1A5E A;  3RIB A;  2WMO A;  2XGO A;  3OAW A;  4A55 A;  4GTV A;  3HXD A;  5CHE E;  3UT4 A;  5BPP A;  4MKT A;  3CKC A;  3LKU A;  3APD A;  4RSY A;  5CRV A;  4N5Q A;  4ATZ D;  2ETC A;  3SD5 A;  2XGS A;  2ILR A;  4PS8 A;  4KBQ A;  3ZXP A;  1IXV A;  4GU5 A;  4LNG A;  4KYO B;  1NP7 A;  2CFU A;  1KT0 A;  4FHK A;  2NC9 A;  3Q15 A;  2I1J A;  4B94 A;  3AS5 A;  4A3V A;  2XCB A;  3RRN B;  5DBK A;  4FLH A;  5DIZ A;  4JEH A;  4DX2 A;  1HS6 A;  4XIF A;  4U8V D;  4ZHB A;  1SZA A;  1HXI A;  1TNU A;  3LPZ A;  4XKB A;  4ATG A;  2IFU A;  3CVP A;  2DVW A;  3HIZ A;  1BPO A;  2IJG X;  1ZBP A;  3NF1 A;  3EU9 A;  1OY3 D;  2KCK A;  2EIJ E;  4GTS A;  1DNP A;  1E8X A;  2YHE A;  3TWV A;  4OAU C;  2UWJ G;  3S7B A;  5B3S E;  2GRO B;  1EDU A;  3PRE A;  2R59 A;  1LTX A;  4GPM A;  3RJV A;  4ABN A;  4H7X A;  3JYS A;  4CDM A;  3BU8 A;  4V3I A;  1HH8 A;  3E37 A;  5EX0 A;  2P9N G;  4ACK A;  4WUY A;  3CHQ A;  2WXH A;  1FT2 A;  1JCR A;  2X3M A;  4JXT A;  2I1K A;  2DIW A;  2GRN B;  3FUI A;  1OWP A;  4TRQ A;  3JXI A;  2XPI A;  2RD0 A;  3TWS A;  3CVY A;  4GZD A;  3B7B A;  4EZJ A;  4DPR A;  2WXP A;  3ASO E;  3S2A A;  2XZT G;  1KZP A;  3V79 K;  1O1T A;  4GPK A;  4NQ0 A;  1TNO A;  4UWK A;  2YIN A;  4NUR A;  3B7S A;  2B6C A;  3ZW3 A;  4LER A;  3CIA A;  2JLB A;  3HXB A;  5ENP D;  3QC1 A;  5CMW A;  5G55 A;  3B95 A;  3UIO C;  2P9I G;  3JCK C;  2J08 A;  4K5B A;  2WM9 A;  3PS6 A;  3Q49 B;  4WND A;  4KZC A;  4OVU A;  4E6H A;  3MGB A;  4PS7 A;  3QJZ A;  1U3D A;  2QYU A;  4X8Q A;  4G2V A;  4Q96 A;  1N4P A;  2CHW A;  2BUG A;  3EUV A;  3DSU A;  2VSX E;  3KEA A;  4C48 B;  3BUA A;  3RSE G;  3ZXS A;  4I1A A;  4CDN A;  1EPU A;  4I2W A;  2LO6 A;  4I43 A;  4MLP A;  5EYL A;  4Y6C A;  3EHQ A;  2X6I A;  3QWW A;  3I3N A;  4L1B A;  1TN8 A;  3PEV B;  1E96 B;  1HO8 A;  1SA4 A;  2RFM A;  3CK7 A;  4WNF A;  4JL0 A;  5LOZ A;  4BT8 A;  4J8Y A;  1SVX A;  2DCP A;  4XKC A;  3ESK A;  4BSZ B;  3APF A;  3UM0 A;  1HFA A;  2LNI A;  3L54 A;  1YYH A;  2E0I A;  1PC2 A;  1UG3 A;  1ELK A;  3L16 A;  1S63 A;  2EIN E;  4ILH B;  4AY6 A;  4GYY A;  2JAB A;  4HLL A;  1E7U A;  3E32 A;  3D9L A;  4A3T A;  2V8S E;  2YHC A;  3AU4 A;  3CST A;  3CK9 A;  4BER A;  3J5P A;  1INZ A;  5ENT D;  1ELR A;  3PE3 A;  1NZN A;  3PNT B;  4Q69 A;  5LX8 A;  2L0I A;  2WMN A;  3FUM A;  1V54 E;  4DJA A;  2X38 A;  5J90 A;  3IBE A;  4U04 A;  3UI2 A;  4GTO A;  2R5S A;  2F8Y A;  3NZU A;  2L6J A;  4G24 A;  5FT9 A;  2YQ8 A;  2XRZ A;  3U3W A;  2XPZ A;  2LAH A;  2PM6 A;  4JB8 P;  4BY6 A;  3O48 A;  4JPS A;  3FUH A;  4BT9 A;  3NB2 A;  3LJ3 A;  5H7P A;  1W3B A;  3Q7F A;  2MOW A;  3IV0 A;  4YVO A;  3GW4 A;  3NAW A;  2MYO A;  3PNL B;  3UM3 A;  4LUN U;  2BTD A;  4ZFH A;  4GA1 A;  3C3Q A;  4HOR A;  4K03 A;  3SQV A;  2UY1 A;  2KBX A;  5T4Y A;  3C72 A;  4MS6 A;  1JCS A;  3PZD A;  4NIK A;  5G05 C;  5T8I A;  5FJY A;  5A7D B;  3F6Q A;  3TAX A;  4ANV A;  3DPY A;  2P2C P;  1DCQ A;  1OT8 A;  4FP7 A;  3ENE A;  1AP7 A;  4LSZ E;  3B13 A;  3D9N A;  3R9M A;  5HQ8 A;  3P1U A;  4L7T A;  4U0S A;  5KJN A;  1TN6 A;  2BED A;  3ZU7 B;  4HOS A;  2OOE A;  4LNB A;  3TWQ A;  2Y69 E;  4GZC A;  3RU0 A;  3VTX A;  4CEM A;  4LRZ A;  4ANX A;  3CVU A;  4J8S A;  3SY2 A;  5CBN A;  3T9K A;  3EDT B;  4OYS A;  3ASN E;  2XGM A;  4M7C A;  4YDE A;  3UM2 A;  4GTM A;  3ZKJ A;  1RZ4 A;  1N94 A;  2HM8 A;  1LF8 A;  4U07 A;  4EHM A;  3TGO A;  2NYJ A;  3LS8 A;  3ZN3 A;  5D66 A;  1TEZ A;  1N9A A;  3UIN C;  3I4R B;  3TWR A;  2Y3A A;  5C2Y A;  3APC A;  2QY7 A;  1OCZ E;  4B93 B;  3ULY A;  4HS2 A;  1XNF A;  5AAO A;  4O6F A;  4JHJ A;  2WB2 A;  3CQC B;  3TG4 A;  2WXG A;  3B7U X;  3HXC A;  4U8H A;  4N5C A;  3G2T A;  2KZT A;  3GZ1 A;  4XX5 A;  2WVI A;  1DVP A;  4IN3 B;  4KT6 B;  2MHK A;  2RKK A;  2VSY A;  2QFC A;  2DYR E;  1OCR E;  1FT1 A;  1ELW A;  3BG1 B;  4BET A;  2OV8 A;  3Q4A B;  2FO7 A;  1NL4 A;  3OXL A;  4Q94 A;  3MKQ B;  4RLY A;  3D9K A;  5LP0 A;  3UPV A;  1AWC B;  5ENQ D;  2NSZ A;  4UQZ A;  2ZGD A;  3L08 A;  3L13 A;  4D10 C;  3ZEF A;  1N4R A;  5JJ7 A;  4HFG A;  3UUX A;  3S7F A;  3G2S A;  4I9E A;  3NZS A;  1OCC E;  2GRP B;  3E33 A;  3K9I A;  3RK6 A;  5D0O D;  4BX9 A;  4EZL A;  5AQA A;  5D2M C;  5A6C A;  1BD8 A;  1O1R A;  2XPY A;  5E75 A;  3QOU A;  3S7D A;  5EN5 D;  3HHM A;  3CSF A;  5D0Q D;  3PEU B;  3VTY A;  2BKK B;  4GTR A;  3GZS A;  2IO3 C;  1H6K A;  2VQ2 A;  3TXN A;  1TJF A;  1GW6 A;  1IYG A;  4A63 B;  2LAI A;  5CMY A;  1H19 A;  1N11 A;  4XEI G;  3E34 A;  2VGX B;  1IHG A;  2H6H A;  2P9S G;  3ULE G;  3JXJ A;  4WWP A;  4ILI A;  4AVX A;  4F53 A;  4XI0 A;  3DXM G;  2C0M A;  2WXJ A;  3Q7A A;  4APO A;  5JJ6 A;  2EIM E;  3UT8 A;  1E8Y A;  4JHR A;  2CFZ A;  4WWO A;  2H6I A;  2VTB B;  3ZYL A;  4BFR A;  4HVB A;  1H6O A;  3NQP A;  4FC8 A;  3CR3 A;  4APF A;  3FP3 A;  3DST A;  4E85 A;  5JJT A;  1VDY A;  5B1B E;  1OWO A;  4DLQ A;  1Z5S C;  4F1S A;  3Q79 A;  4G23 A;  5LFA A;  4AJW A;  4R7L A;  4XZ4 A;  5BNW A;  2EIL E;  4G25 A;  1IQR A;  3LDZ A;  4C9B B;  3ZPJ A;  3UKR G;  1BI7 B;  3AS4 A;  4LEU A;  4B8A A;  3KD7 A;  2BF0 X;  1MX6 A;  3SBT B;  2VTB A;  1X5B A;  2L0T B;  2VSO E;  4C0E A;  3C3O A;  3FTW A;  4LCT A;  5JHB A;  2BKG A;  2V5Q C;  3AJI A;  1TYQ G;  4CGW A;  4PDX A;  2XHE A;  4U0Z A;  2ETA A;  3AU5 A;  3CHS A;  2A4Z A;  1Z3X A;  4PUC A;  2J09 A;  3FUN A;  4RVB A;  5A23 A;  3MV2 B;  1D8D A;  2I9C A;  2IQC A;  1SW6 A;  3G2W A;  4W9R A;  4J8D A;  1UN8 A;  3UMV A;  3PZ4 A;  2R03 A;  3VLE A;  4F7A A;  5G05 J;  1B89 A;  1QQE A;  3CEQ A;  2C2L A;  4I2Z A;  4TXR A;  3N71 A;  4QFV A;  3TWX A;  3W9F A;  2WPV A;  4L2Y A;  3D9H A;  2IOS A;  2XQ0 A;  1UN9 A;  1N52 A;  4BTB A;  5LCW C;  3PE4 A;  3NOC D;  5EID A;  4EBA A;  3FUK A;  4DK5 A;  4DX7 D;  2Y0B G;  5G2N A;  3R9A B;  5KJK A;  2X6H A;  4CDR A;  3ZNG A;  5AAR A;  3WG7 E;  2KM4 A;  2H6G A;  3QKY A;  1QZ2 A;  4JEU A;  5BW8 C;  4FJY A;  3ZRH A;  1LD8 A;  3E4B A;  4HRL A;  3OXF A;  3HRA A;  2WXK A;  4WWN A;  3UKU G;  2LUH A;  3RRM B;  5ITZ F;  4HXI A;  4FLB A;  4GML A;  3Q47 B;  1U2V G;  2IF4 A;  1E8W A;  3KAE A;  4HOQ A;  5HS0 A;  4DI3 A;  4NRH B;  1E8Z A;  4AEZ C;  5T3R A;  4F1P A;  1NFI E;  5ENO D;  2P58 C;  3SI5 A;  4JD2 G;  4NAC A;  1OUV A;  4N2S A;  2ZIR A;  4AM9 A;  1BI8 B;  2QC9 A;  3SHF A;  5ENN A;  5KNH D;  1YMP A;  1XGW A;  5B1A E;  2KCV A;  4N3C A;  3HDX A;  1BLX B;  1MQS A;  5G04 C;  3ZYK A;  3SF4 A;  2YNQ A;  4EEC A;  4J8F A;  2KCL A;  3NOG D;  3L17 A;  4J7W A;  3L6A A;  3DXK G;  2DYS E;  2OEW A;  4HQD A;  4BX8 A;  2AVP A;  4RQI A;  1K3Z D;  4GA0 A;  1ZB1 A;  3PUK A;  5ARF A;  2C0L A;  4A1G A;  3PDN A;  1HF8 A;  4YVQ C;  2J9Q A;  4HI9 A;  1E7V A;  3RO2 A;  2RG8 A;  3BQO A;  4M3O A;  1QNF A;  4YDW A;  5HKP A;  1MJ0 A;  3QAR A;  2XEE A;  3U4T A;  4L2L A;  5CBO A;  3FTV A;  1N4S A;  1DC2 A;  4G8L A;  1HG2 A;  4YDO A;  2VSN A;  2PZI A;  4ILG A;  2GRR B;  1TR4 A;  3QNK A;  5C1D A;  5AQ7 A;  4RG6 A;  5KJM A;  3EHN A;  3U9W A;  2HE0 A;  4GMR A;  1SQM A;  1N95 A;  2V4H C;  5CER B;  5FZS A;  2KC7 A;  2PQN A;  2WXM A;  3ZHE B;  3Q78 A;  3UM1 A;  4JC8 A;  3PZ3 A;  3HXF A;  4G1T A;  4ANW A;  4N3B A;  2LXL A;  4KVM A;  3FTX A;  4JA7 A;  3HXE A;  2QZA A;  5FWQ A;  2DBA A;  2V5F A;  3FTU A;  5EIL A;  1Z3Y A;  3G2V A;  3FEX A;  3ZGQ A;  3T8K A;  3FU0 A;  3LVR E;  3U66 A;  1UW4 B;  4OVV A;  3HYM B;  3ASH A;  4HB5 A;  3LEW A;  4N3A A;  3U64 A;  1O5M A;  4U95 D;  2X6K A;  2GGF A;  2QYJ A;  2PQR A;  2WQH A;  3FH7 A;  3UXG A;  2R17 C;  1MHQ A;  2H6F A;  4U96 D;  3ASG A;  4G8K A;  3E30 A;  3ZUV B;  1FPP A;  3ZIM A;  1S0P A;  2DWZ A;  3CVQ A;  3DSV A;  2CG3 A;  1Y6I A;  4HOT A;  3RKV A;  5KWD A;  2X6F A;  2WXQ A;  4HBD A;  2L6B A;  4HNA D;  5JHA A;  1OWM A;  1MZC A;  4L23 A;  3SGH A;  4FAD A;  3V2X A;  3RAU A;  2ZGG A;  4CT4 A;  3CVL A;  1X81 A;  1P5Q A;  1N4Q A;  3T5V A;  2IOL A;  2WXR A;  4GZ3 A;  5BUZ A;  1E90 A;  5AJL A;  2ZU6 B;  3V31 A;  2P9K G;  1LD7 A;  2FF4 A;  2F8X K;  1D8E A;  3C98 A;  1Q2Z A;  4IUL A;  2I6H A;  5FQ6 A;  2VJ8 A;  3CKB A;  3CHO A;  5AEN A;  2WQ6 A;  3MYV A;  3KS2 A;  3T8M A;  5FTP A;  2OEV A;  3ONL A;  3TG5 A;  5ANR A;  3HVE B;  5BXU A;  3IEG A;  3L82 A;  4UI9 K;  4BEP A;  4HRN A;  3UTM A;  2PL2 A;  3KEZ A;  5HI7 A;  4KZ0 A;  3O4Z A;  4ANU A;  5AQB A;  5JMN D;  4EZK A;  5BT1 A;  5CCM A;  2AXU A;  2I2O A;  5LCW J;  1OCO E;  1UOH A;  1OWN A;  2JEK A;  2NXP A;  1H2U A;  3TWW A;  3IXE A;  4O1P A;  4CYM D;  1HU3 A;  3ML8 A;  2XCC A;  4TXP A;  4Y6W A;  4UQX A;  3D9I A;  4G11 A;  3MKQ A;  4PH4 B;  2J4B A;  3W9G A;  3ZVV A;  3FDH A;  4K0R A;  4JW1 A;  3AG2 E;  4H7Y A;  4DX6 D;  4UWG A;  3B7R L;  3SO8 A;  2R05 A;  4GCO A;  1YA0 A;  3ABM E;  4GTP A;  2Q7F A;  5KJL A;  3VLD A;  2J07 A;  1KLX A;  2CG2 A;  4K5C A;  3MJW A;  4EQF A;  2GRL A;  1TNB A;  3X2Q E;  3EIJ A;  3AG1 E;  2AXZ A;  2ZIS A;  5KCM A;  5JA4 D;  4JVS A;  3EJN A;  5G04 J;  2L9B A;  3TL5 A;  5IY5 E;  3SFY A;  2CHX A;  1KZO A;  1MYO A;  3JQ0 A;  1QBQ A;  3D9M A;  2GRQ B;  4WNG A;  2IU1 A;  4MRU A;  1HZ4 A;  4B8C B;  5M72 A;  2ION A;  4QQI A;  4GZ6 A;  2F0Y A;  2R02 A;  2A5U A;  4AY5 A;  4BSX A;  2VGX A;  3PUJ A;  2LSU A;  2M63 A;  3IKO B;  3CVW A;  3HG0 D;  3D9O A;  3I4G A;  4J6I A;  3CVN A;  3DWL G;  2EIK E;  3SNX A;  3PRZ A;  1JCQ A;  1K8K G;  3PZ1 A;  2HR2 A;  4EPZ A;  4FU3 A;  3CHP A;  1FVH A;  3TWU A;  4N39 A;  4TUU A;  2MRI A;  3RO3 A;  4AIF A;  5ENR D;  4UWF A;  5EDS A;  4EBA G;  1H2T C;  3KSL A;  1HG5 A;  4BWR A;  4GYO A;  4LG6 A;  4CT0 A;  5CCL A;  2F37 A;  4AP2 A;  4UI9 C;  4GYW A;  2P9P G;  3EIQ C;  3J5Q B;  5FQ7 A;  2RFA A;  2WXO A;  2VGY A;  4I6E A;  4TXQ A;  1FCH A;  2AJA A;  2E2E A;  5E76 A;  3QK0 A;  4O1O A;  1FVF A;  3AG4 E;  4I17 A;  3ABK E;  4B0Z A;  3FUF A;  4TUM A;  1G3N B;  3L22 A;  1TJC A;  4FJZ A;  3Q75 A;  1JPL A;  4WNE A;  3DEO A;  2J8S D;  1S70 B;  4GMJ A;  3JUI A;  3SZ7 A;  1IKN D;  3UIP C;  3WXX A;  4CZ2 D;  2WXF A;  2DZO A;  3FUD A;  2Y1L E;  4XI9 A;  3CV0 A;  2XEN A;  3UX4 A;  4LNU D;  2FI7 A;  1Y8M A;  3T5X A;  2AXV A;  3G2U A;  3ZFW A;  2V4L A;  4AOF A;  4TV3 A;  3FUL A;  2VYI A;  3BEE A;  2J49 A;  5ENS D;  4DRX E;  3ESL A;  5HRY A;  3AG3 E;  2ZXW E;  4U7E B;  3UQ3 A;  3TXM A;  4DX1 A;  1S64 A;  2OVF A;  3FFL A;  4F3V A;  3QWV A;  2XS1 A;  1K1A A;  3MEK A;  4FA6 A;  3FU6 A;  4U0U A;  2FO1 E;  5BXO A;  5CED B;  3LXU X;  5KNG A;  1PY1 A;  4DI4 A;  4GA2 A;  3UT7 A;  2ETB A;  5AYW D;  3I5P A;  2J4D A;  2XRY A;  1EYH A;  5EX3 A;  5EIB E;  3LYA A;  1IQU A;  1JUQ A;  3BG0 B;  2LXM A;  2KXP C;  3CHM A;  4UUC A;  5CEA A;  5AJD A;  4HOU A;  5KBA A;  3ABL E;  3OTN A;  3P2B A;  3FY4 A;  4KVO A;  4HLE A;  1NA3 A;  3V30 A;  3MZL B;  1NI1 A;  4YDY A;  1OXJ A;  2IY0 C;  3GZ2 A;  4JHK A;  3Q73 A;  4B89 A;  1N0R A;  4A1S A;  3IHY A;  4HI8 A;  5FIN A;  3CQG B;  3ASF A;  3FH5 A;  3D9P A;  1KT1 A;  3PVL A;  3SFX A;  3R7R A;  2XS8 A;  3DRA A;  2HYZ A;  2FEZ A;  3Q9N C;  3VLF A;  2OCC E;  4N2Q A;  1TN7 A;  1SZ9 A;  1U3C A;  3EHM A;  1PAQ A;  4IYP A;  1WY6 A;  3LY8 A;  4Z68 A;  5FZQ A;  1ZU2 A;  2UY1 B;  3OXG A;  5FZR A;  4PS3 A;  2A5E A;  3IHV A;  2XZD G;  3V2O A;  2PM7 A;  3LCA A;  4J8E A;  2WXN A;  3ML9 A;  3KSQ A;  3LY7 A;  1TNY A;  4FHJ A;  5FIO A;  3ZYQ A;  2B0O E;  2GRM A;  3MV3 B;  4YND A;  3JQ1 A;  1RW2 A;  3MA5 A;  5J08 A;  3CVX A;  3TWT A;  5CEC B;  4GZ5 A;  3C3R A;  1SA5 A;  3CLJ A;  3JUE A;  3DEP A;  1N0Q A;  4K5A B;  1IHB A;  2OVB A;  4UQY A;  1EF1 C;  1OWL A;  2R2L A;  3FUJ A;  1YCS B;  4BES A;  1HE8 A;  2X6J A;  1O1S A;  1H0A A;  3GYZ A;  3Q5M A;  4IRU A;  4GAA A;  5ANL A;  1V55 E;  5ARG A;  4AV7 A;  3CHR A;  4F6R D;  3RRU A;  1L5J A;  4U63 A;  4CGV A;  4I1M A;  4I6J A;  4XE0 A;  4KXK B;  4BTA A;  4GCN A;  2P9U G;  5FQ8 A;  3ZHE A;  3CK8 A;  3R7Q A;  2VGE A;  3PZ2 A;  4JA9 A;  1Z6T A;  1BU9 A;  1KPS B;  1D9S A;  1K1B A;  3S7J A;  3FHE A;  4L9P A;  5AN8 A;  5AQ9 A;  3SFZ A;  4UWL A;  3CGH A;  2KZT B;  3ASD A;  4DLO A;  3QDN A;  2P9L G;  3MKR A;  3LVQ E;  3FUE A;  3QAQ A;  1TNZ A;  4URK A;  2Y4T A;  1JWG A;  4I9C A;  4WAF A;  5AIJ A;  3DSX A;  5FQ4 A;  4ME2 A;  2GW1 A;  5BV1 A;  4HRM B;  2XEV A;  2AW6 A;  4G26 A;  3LJN A;  3B7T A;  4AXH A;  3L9T A;  3FU5 A;  4J0U A;  3Q9U C;  3FTS A;  3FEY A;  3ULQ A;  3TJP A;  4I6G A; 
#chains in the Genus database with same CATH homology
 1WAO 1;  4BY6 A;  4WNG A;  3O48 A;  4JPS A;  3FUH A;  2IU1 A;  4MRU A;  2KM4 A;  4UI9 J;  1HZ4 A;  4BT9 A;  4CRW A;  4B8C B;  3QKY A;  1QZ2 A;  5M72 A;  3LJ3 A;  4JEU A;  3CVV A;  3FH8 A;  3AS8 A;  5BW8 C;  2ION A;  3SBS A;  4FJY A;  1W3B A;  3ZRH A;  3E4B A;  4GZ6 A;  2Y4U A;  4I1O B;  3FU3 A;  3D9J A;  2MOW A;  3IV0 A;  4YVO A;  4UWH A;  3OXF A;  4P29 A;  2WXK A;  2A5U A;  3GW4 A;  2HO1 A;  4WWN A;  3DBS A;  3PNL B;  1JWF A;  3RRM B;  2CHZ A;  4AY5 A;  4BSX A;  2VGX A;  3ZYM A;  3PUJ A;  1N54 A;  4JZY A;  2LSU A;  4LUN U;  4HXI A;  2BTD A;  4FLB A;  4GA1 A;  4GML A;  2M63 A;  1HX8 A;  1UJK A;  3IKO B;  2KAT A;  3Q47 B;  2IF4 A;  3KAE A;  1E8W A;  1WM5 A;  4HOQ A;  4HOR A;  4DI3 A;  4NRH B;  4K03 A;  3CVW A;  1E8Z A;  2UY1 A;  3D3M A;  4AEZ C;  5T3R A;  5T4Y A;  3D9O A;  4MS6 A;  3FTZ A;  3PZD A;  5G05 C;  2P58 C;  3I4G A;  3QWP A;  4J6I A;  3SI5 A;  5T8I A;  3CVN A;  5FJY A;  2EQX A;  4NAC A;  4CCA A;  5A7D B;  3TAX A;  4ANV A;  1OUV A;  2LSV A;  4N2S A;  3ONK A;  4AM9 A;  3SNX A;  5BV0 A;  3SHF A;  5ENN A;  1A17 A;  3PRZ A;  4FP7 A;  2HR2 A;  4EPZ A;  3ENE A;  4FU3 A;  2WXL A;  3FWV A;  1XGW A;  1H2V C;  3B13 A;  3D9N A;  3CHP A;  2KCV A;  1FVH A;  5HQ8 A;  4N3C A;  4N39 A;  3LY9 A;  4TUU A;  3P1U A;  3HDX A;  2MRI A;  2OND A;  4L7T A;  4U0S A;  3RO3 A;  4AIF A;  5KJN A;  1MQS A;  1UJJ A;  5G04 C;  3HVE A;  4ACL A;  4UWF A;  2FUL A;  4HOS A;  3ZYK A;  2OOE A;  5EDS A;  4EBA G;  1H2T C;  1HG5 A;  4C0M A;  4BWR A;  4GZC A;  4GYO A;  3SF4 A;  2YNQ A;  4EEC A;  4J8F A;  2KCL A;  4CT0 A;  3L17 A;  3RU0 A;  3VTX A;  5CCL A;  4AP2 A;  4CEM A;  3L6A A;  4LRZ A;  4UI9 C;  4GYW A;  4ANX A;  3CVU A;  4J8S A;  2WQ7 A;  3EDT B;  3EIQ C;  4OYS A;  5FQ7 A;  2XGM A;  2WXO A;  2VGY A;  3DPD A;  4I6E A;  1FCH A;  2E2E A;  5E76 A;  4BX8 A;  3PH0 C;  3QK0 A;  3URZ A;  2AWI A;  2AVP A;  1FVF A;  1LF8 A;  2HM8 A;  1NA0 A;  4I17 A;  4KMO A;  4B0Z A;  2FBN A;  2WXI A;  4U07 A;  4GA0 A;  3FUF A;  3PUK A;  3L22 A;  3TGO A;  4FUL A;  3LS8 A;  1TJC A;  3MCX A;  3ZN3 A;  3QB2 A;  4FJZ A;  5ARF A;  2C0L A;  1TEZ A;  3FTY A;  4RG9 A;  3MX3 A;  4A1G A;  1JPL A;  4WNE A;  3I4R B;  5EKQ D;  2Y3A A;  5C2Y A;  3APC A;  4GB9 A;  4GMJ A;  3PDN A;  2QY7 A;  3JUI A;  1HF8 A;  4YVQ C;  2V0P A;  3SZ7 A;  2J9Q A;  3RIB A;  1E7V A;  3RO2 A;  2RG8 A;  4M3O A;  1QNF A;  3WXX A;  4HS2 A;  2WXF A;  1XNF A;  2WMO A;  4O6F A;  4JHJ A;  2WB2 A;  3FUD A;  2XGO A;  3QAR A;  3OAW A;  4XI9 A;  3CQC B;  3CV0 A;  3U4T A;  3UX4 A;  4L2L A;  4A55 A;  3TG4 A;  2FI7 A;  2WXG A;  1Y8M A;  3T5X A;  2AXV A;  3G2U A;  3ZFW A;  3B7U X;  4U8H A;  5CHE E;  4N5C A;  3FTV A;  2V4L A;  3UT4 A;  4AOF A;  5BPP A;  4TV3 A;  3G2T A;  2KZT A;  3FUL A;  4MKT A;  3CKC A;  3GZ1 A;  3LKU A;  2VYI A;  4XX5 A;  1HG2 A;  3APD A;  4RSY A;  3BEE A;  2J49 A;  2VSN A;  2PZI A;  2WVI A;  4ILG A;  3QNK A;  1DVP A;  4IN3 B;  4KT6 B;  5C1D A;  2MHK A;  3ESL A;  4RG6 A;  2VSY A;  5KJM A;  2QFC A;  3EHN A;  3SD5 A;  2XGS A;  1ELW A;  3BG1 B;  3U9W A;  3UQ3 A;  4I6G A;  3TXM A;  1SQM A;  2ILR A;  2OV8 A;  4PS8 A;  4KBQ A;  2OVF A;  4GU5 A;  5FZS A;  3FFL A;  3Q4A B;  4KYO B;  1NP7 A;  2FO7 A;  4F3V A;  2CFU A;  1KT0 A;  3QWV A;  2KC7 A;  2PQN A;  2WXM A;  4FHK A;  3ZHE B;  2NC9 A;  4JC8 A;  3MEK A;  2I1J A;  3Q15 A;  4FA6 A;  4B94 A;  3FU6 A;  3AS5 A;  4A3V A;  4U0U A;  3OXL A;  2XCB A;  4G1T A;  3LXU X;  4ANW A;  4Q94 A;  1PY1 A;  3MKQ B;  3RRN B;  4DI4 A;  3D9K A;  4N3B A;  4GA2 A;  4KVM A;  5DBK A;  3UT7 A;  3FTX A;  5LP0 A;  4FLH A;  3UPV A;  5DIZ A;  4JEH A;  1HS6 A;  4JA7 A;  5AYW D;  3I5P A;  2J4D A;  4XIF A;  2XRY A;  1EYH A;  5EX3 A;  2NSZ A;  5FWQ A;  4UQZ A;  2DBA A;  3LYA A;  2V5F A;  1SZA A;  3FTU A;  1HXI A;  3LPZ A;  4XKB A;  1IQU A;  1Z3Y A;  3G2V A;  3L08 A;  1JUQ A;  3BG0 B;  3FEX A;  3FU0 A;  3L13 A;  3LVR E;  3ZGQ A;  2IFU A;  1UW4 B;  4ATG A;  3U66 A;  4D10 C;  4OVV A;  3CVP A;  3HYM B;  3ASH A;  3ZEF A;  3LEW A;  4N3A A;  5JJ7 A;  3CHM A;  3HIZ A;  4HFG A;  3UUX A;  1BPO A;  2IJG X;  1ZBP A;  3U64 A;  3S7F A;  3G2S A;  2X6K A;  3NF1 A;  2GGF A;  4I9E A;  5AJD A;  3NZS A;  4HOU A;  2KCK A;  2PQR A;  3OTN A;  2WQH A;  3P2B A;  1DNP A;  1E8X A;  2YHE A;  3FY4 A;  4KVO A;  4HLE A;  1NA3 A;  3FH7 A;  2UWJ G;  3K9I A;  3MZL B;  2R17 C;  3S7B A;  3RK6 A;  1MHQ A;  1EDU A;  5D0O D;  3PRE A;  4BX9 A;  4EZL A;  2R59 A;  3GZ2 A;  3RJV A;  4JHK A;  4ABN A;  5A6C A;  3ASG A;  2XPY A;  4H7X A;  3JYS A;  5E75 A;  4B89 A;  4CDM A;  4V3I A;  3QOU A;  1HH8 A;  3S7D A;  5EX0 A;  3ZIM A;  1S0P A;  3CVQ A;  3HHM A;  3IHY A;  4A1S A;  3CSF A;  4ACK A;  5D0Q D;  3PEU B;  2CG3 A;  1Y6I A;  3CQG B;  4WUY A;  3ASF A;  3VTY A;  3FH5 A;  4HOT A;  3RKV A;  3CHQ A;  2WXH A;  3D9P A;  3GZS A;  1H6K A;  1KT1 A;  2X6F A;  2X3M A;  2VQ2 A;  3TXN A;  1TJF A;  4JXT A;  2I1K A;  1GW6 A;  2DIW A;  2WXQ A;  3PVL A;  1IYG A;  3R7R A;  5JHA A;  3FUI A;  2HYZ A;  2FEZ A;  1OWM A;  2LAI A;  1OWP A;  4L23 A;  4TRQ A;  3SGH A;  2XPI A;  5CMY A;  2RD0 A;  4FAD A;  3VLF A;  1H19 A;  3CVY A;  4GZD A;  4EZJ A;  4DPR A;  2VGX B;  2WXP A;  4N2Q A;  1IHG A;  1SZ9 A;  4CT4 A;  1U3C A;  3CVL A;  3EHM A;  1PAQ A;  3S2A A;  4IYP A;  1WY6 A;  3LY8 A;  4WWP A;  1P5Q A;  4ILI A;  4AVX A;  5FZQ A;  1ZU2 A;  4F53 A;  3T5V A;  2IOL A;  2WXR A;  4GZ3 A;  4XI0 A;  5BUZ A;  4GPK A;  1E90 A;  2UY1 B;  3OXG A;  2C0M A;  4NQ0 A;  5FZR A;  2WXJ A;  4UWK A;  4PS3 A;  5AJL A;  4APO A;  5JJ6 A;  2YIN A;  3IHV A;  4NUR A;  3B7S A;  2PM7 A;  2ZU6 B;  3LCA A;  4J8E A;  3UT8 A;  2WXN A;  3ML9 A;  3ZW3 A;  1E8Y A;  3CIA A;  4LER A;  2JLB A;  3LY7 A;  4FHJ A;  2FF4 A;  3QC1 A;  5CMW A;  4JHR A;  2CFZ A;  4WWO A;  2GRM A;  3MV3 B;  4YND A;  5G55 A;  3JQ1 A;  3ZYQ A;  4CDR A;  3C98 A;  3MA5 A;  4IUL A;  5J08 A;  3ZYL A;  2VTB B;  2I6H A;  3JCK C;  5FQ6 A;  3CVX A;  4BFR A;  2VJ8 A;  3CKB A;  2J08 A;  3CHO A;  4HVB A;  2WM9 A;  3NQP A;  5AEN A;  3PS6 A;  4GZ5 A;  3Q49 B;  4FC8 A;  4WND A;  2WQ6 A;  4KZC A;  4OVU A;  4E6H A;  3MGB A;  3CLJ A;  3CR3 A;  3MYV A;  4PS7 A;  4APF A;  3FP3 A;  3KS2 A;  3QJZ A;  1U3D A;  4E85 A;  4G2V A;  3T8M A;  4Q96 A;  5FTP A;  1VDY A;  2OVB A;  4UQY A;  1EF1 C;  5JJT A;  3ONL A;  3TG5 A;  5ANR A;  1OWL A;  3HVE B;  2CHW A;  1OWO A;  4DLQ A;  2BUG A;  4F1S A;  3IEG A;  3FUJ A;  2VSX E;  1HE8 A;  4UI9 K;  2X6J A;  4G23 A;  1H0A A;  5LFA A;  3GYZ A;  3Q5M A;  4AJW A;  4IRU A;  3ZXS A;  4GAA A;  4I1A A;  2PL2 A;  4R7L A;  4XZ4 A;  3KEZ A;  5ANL A;  5HI7 A;  5BNW A;  4KZ0 A;  4CDN A;  1EPU A;  3O4Z A;  4G25 A;  4I2W A;  5ARG A;  4AV7 A;  2LO6 A;  4ANU A;  1IQR A;  3LDZ A;  4C9B B;  3ZPJ A;  3CHR A;  4I43 A;  4MLP A;  3AS4 A;  4Y6C A;  3RRU A;  4LEU A;  4EZK A;  5BT1 A;  4B8A A;  1L5J A;  3KD7 A;  2AXU A;  2I2O A;  5CCM A;  4U63 A;  5LCW J;  2BF0 X;  2X6I A;  4CGV A;  3QWW A;  3I3N A;  1OWN A;  2JEK A;  3SBT B;  4L1B A;  2VTB A;  3PEV B;  4I1M A;  1X5B A;  2L0T B;  2VSO E;  1E96 B;  4I6J A;  1HO8 A;  4XE0 A;  4C0E A;  4KXK B;  2NXP A;  3CK7 A;  4GCN A;  4WNF A;  4BTA A;  1H2U A;  3FTW A;  5FQ8 A;  4LCT A;  5JHB A;  4JL0 A;  5LOZ A;  4BT8 A;  3ZHE A;  3CK8 A;  1HU3 A;  3R7Q A;  2DCP A;  3ML8 A;  4XKC A;  2XCC A;  4Y6W A;  4CGW A;  3ESK A;  3D9I A;  1Z6T A;  4G11 A;  4JA9 A;  2XHE A;  4PDX A;  4UQX A;  3APF A;  4U0Z A;  3AU5 A;  3CHS A;  3S7J A;  3MKQ A;  3FHE A;  4PH4 B;  2A4Z A;  2J4B A;  1HFA A;  2LNI A;  1Z3X A;  3L54 A;  2E0I A;  3ZVV A;  1PC2 A;  1UG3 A;  1ELK A;  4PUC A;  2J09 A;  3FDH A;  3L16 A;  3FUN A;  3SFZ A;  4K0R A;  4ILH B;  4AY6 A;  4JW1 A;  4RVB A;  4UWL A;  4GYY A;  3CGH A;  5A23 A;  2KZT B;  3MV2 B;  1E7U A;  3ASD A;  4DLO A;  2I9C A;  2IQC A;  4H7Y A;  3D9L A;  4A3T A;  2V8S E;  4UWG A;  3B7R L;  3QDN A;  2YHC A;  3AU4 A;  3G2W A;  3CST A;  3MKR A;  4W9R A;  3LVQ E;  3FUE A;  4GCO A;  3CK9 A;  1YA0 A;  4J8D A;  1UN8 A;  2Q7F A;  3QAQ A;  3UMV A;  5KJL A;  1INZ A;  3VLE A;  4F7A A;  1ELR A;  5G05 J;  3VLD A;  1B89 A;  1QQE A;  3CEQ A;  4URK A;  2Y4T A;  3PE3 A;  2J07 A;  2C2L A;  1JWG A;  1NZN A;  1KLX A;  3PNT B;  4I9C A;  4I2Z A;  4WAF A;  2CG2 A;  4Q69 A;  5AIJ A;  5LX8 A;  3MJW A;  5FQ4 A;  2L0I A;  4ME2 A;  2WMN A;  2GW1 A;  4EQF A;  5BV1 A;  3N71 A;  2GRL A;  2XEV A;  2AW6 A;  4G26 A;  4QFV A;  3B7T A;  4AXH A;  3FUM A;  4DJA A;  3EIJ A;  2WPV A;  2AXZ A;  2X38 A;  4L2Y A;  5J90 A;  3FU5 A;  3IBE A;  2IOS A;  2XQ0 A;  4J0U A;  4U04 A;  5KCM A;  1UN9 A;  2R5S A;  3FTS A;  2L6J A;  3NZU A;  4G24 A;  4JVS A;  1N52 A;  4BTB A;  5FT9 A;  5LCW C;  3EJN A;  3FEY A;  3PE4 A;  2YQ8 A;  3ULQ A;  4EBA A;  3FUK A;  5G04 J;  2L9B A;  4DK5 A;  2XRZ A;  3U3W A;  2XPZ A;  5G2N A;  2LAH A;  2PM6 A;  3TJP A;  3TL5 A;  3R9A B;  5KJK A;  2CHX A;  2X6H A;  3JQ0 A;  3D9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...