4EBAG

Crystal structure of the rna14-rna15 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
81
Chain Sequence
PWLPVGVDVNINMTTPAMCISSELGKLQKDQQMALLKVIQHFCKDETFVALLEEAPQLSYAIAELLLSNGVCSVDQLTQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/rna binding protein
molecule keywords mRNA 3'-end-processing protein RNA14
publication title Crystal structure of the Rna14-Rna15 complex.
pubmed doi rcsb
source organism Kluyveromyces lactis
total genus 18
structure length 81
sequence length 83
chains with identical sequence H, I
ec nomenclature
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF14304 CSTF_C Transcription termination and cleavage factor C-terminal
G PF14327 CSTF2_hinge Hinge domain of cleavage stimulation factor subunit 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.630 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ebaG00
2L9BA 4EBAG
chains in the Genus database with same CATH superfamily
1K1BA 4L9PA 1DC2A 1E7UA 4FHKA 2R02A 3FTZA 5T8IA 3CHSA 2V8SE 2KZTB 2I6HA 5EX0A 3PZ2A 2BUGA 2XGOA 3ZEFA 4U7EB 1E90A 5AQBA 3T9KA 1WAO1 1BI8B 3B13A 4EECA 4EBAA 2F8XK 3NQPA 4LNUD 2F37A 1TYQG 1E8WA 3DEPA 4U8YD 1N9AA 5HI7A 2I1JA 3TL5A 4BWRA 4JW1A 2UY1B 5LFAA 3KEAA 3OXLA 3ZIMA 3MKRA 1S64A 3ASOE 1IHGA 1Z5SC 3NOCD 2PM7A 4DUIA 1LD7A 5LX8A 1ELKA 3CV0A 5EN5D 3Q7AA 3C3RA 2IJGX 3MKQA 3Q4AB 4N3AA 3I3NA 4MLPA 2XGMA 3FDHA 2WXHA 1H6PA 4G1TA 3CHMA 4J7WA 2V4LA 2LAHA 2B6CA 2A5UA 3QC1A 4XKCA 3Q78A 4RVBA 5CRUA 1OCOE 2DBAA 5FQ6A 4FLBA 2WXPA 3E33A 3DSWA 2UWJG 4EZKA 3QJZA 5ENPD 5T4YA 4KZCA 4JHRA 4I1OB 4LCTA 1B89A 3C5RA 2AXUA 4BX8A 4E85A 2OVBA 3MEKA 4UWGA 4BTAA 4HRLA 1Y8MA 4I6JA 4JVSA 3P2BA 5M72A 4BESA 2MHKA 4I43A 2LSUA 2XEEA 3LXUX 4C9BB 5JHAA 4JC8A 4YDYA 1EF1C 4IN3B 3TWXA 3AS5A 2BF0X 4HLLA 4ANVA 2H6IA 3RIBA 1OWPA 4FP7A 3CHPA 4H7YA 4N2SA 3NB2A 3CR3A 5D2MC 4MBGA 2IEJA 5KCMA 2DYSE 2Y4TA 3CK7A 1IQRA 2P9IG 4JEHA 2P9PG 3FP3A 1UN8A 3HXFA 1UW4B 2VSXE 4DX1A 4EZJA 2GROB 3UT4A 2WXRA 4EBAG 3IEGA 4FLHA 3L9TA 4G11A 3ESKA 3L6AA 2KM4A 3G2VA 3EJNA 1OWOA 4CGVA 4U8VD 5FWQA 2GRNB 3G2UA 2Q7FA 5CCMA 2Y3AA 4B94A 1KPSB 4CDRA 4UQXA 2WXMA 4AEZC 2KBXA 5EIDA 1WG0A 1P5QA 2VQ2A 4CDNA 2WQHA 2VGXA 2IOSA 2XCBA 5BW8C 3LVQE 3Q75A 1HO8A 3HIZA 5AQAA 2I1KA 3HYMB 1H6KA 3LDZA 4Y6WA 2V4HC 3HXBA 4J8EA 2HM8A 3OXGA 2J4BA 5BNWA 3UPVA 3FUKA 2L0TB 1OWLA 4Q94A 3UIOC 2XZDG 3D9NA 1EYHA 3HVEA 2XS8A 5LOZA 2FEZA 3X2QE 2PM6A 2EINE 3PRZA 3AU4A 3C72A 3BUAA 3GW4A 3KSQA 4DPRA 1ZB1A 1TN6A 2H6FA 3E37A 4UWFA 3ULYA 4TUMA 4DX7D 2J09A 4JA9A 2X6FA 3V30A 4JA7A 3ZYMA 5KNGA 2QC9A 2KCVA 5G05J 4GTTA 5AARA 1HG5A 3SY2A 3CK8A 1RW2A 3SFYA 4G26A 2FO1E 3KS2A 5EYPF 5JA4D 2IOLA 3UINC 2X3MA 2P9LG 4K03A 3RU0A 3CVYA 2VGEA 2Y4UA 3ZKJA 3G2TA 3SI5A 4IRUA 2ZU6B 1N4RA 2X6KA 4UI9K 2WM9A 3DEOA 1FCHA 3OTNA 3T8MA 3HHMA 4GZCA 1NFIE 4HRMB 3ISMC 2IU1A 3D9MA 2AVPA 2EILE 1YMPA 2FO7A 5KJKA 4GTQA 2GRQB 4OVUA 1A5EA 3PZ1A 1QBQA 4L2LA 2ETCA 4U96D 5C2YA 5LCWJ 3CVWA 4XKBA 4N3BA 1FVHA 2VTBA 4I2WA 4DI4A 5CMWA 3CHQA 3RRNB 2ONDA 4HLEA 3JCKC 2FBNA 3E32A 4IULA 2IONA 3TG5A 2CG2A 5G05C 2C0MA 4KVOA 5FJYA 4JPSA 2LXLA 2VSOE 4XX5A 3MV2B 5D0QD 2JEKA 4GB9A 4YVOA 4L1BA 1JCQA 2KCKA 3NBNB 3NZSA 3ZUVB 1V54E 1HG2A 2ZISA 2A5EA 3C3OA 2WXOA 4OAVB 2E2EA 4GMRA 2QFCA 5LP0A 4PS7A 3N71A 1UOHA 1MZCA 1DCQA 4WNFA 1H2TC 4CGWA 4XI9A 4CDMA 2WXKA 1WY6A 1GW6A 5BV1A 2PZIA 4DLQA 4G23A 4GMJA 2C0LA 4GPMA 3L17A 3QK0A 3BQOA 4F1PA 5G04J 3DPDA 5IY5E 3FTXA 3CQCB 3V31A 1ELRA 4GTRA 3QB2A 4GMLA 2PL2A 4LERA 4XEIG 3ULQA 3ESLA 4PS3A 2WMOA 1FT1A 4ME2A 3FUIA 3TG4A 2BKGA 4O6FA 1DNPA 3UI2A 5AN8A 3E30A 3CVXA 4LRZA 1U3CA 3UX4A 2CHWA 3FUEA 1YCSB 3APCA 5KJLA 4APOA 2OVFA 3UM0A 2DVWA 4DI3A 2ETBA 3QNKA 4WWOA 1TJCA 4N39A 1OXJA 3B7BA 4K5CA 4EZLA 3B7UX 2WMNA 4MS6A 3SD5A 5ENNA 2P9KG 4ANXA 3BEEA 4KVMA 4GTVA 5AQ7A 3I5PA 3W9FA 3LEWA 1MHQA 5FT9A 3U4TA 4TUUA 1SQMA 3GZ1A 3UQ3A 3UMVA 2J08A 3PZ4A 4GCNA 4KXKB 3DSVA 4QFVA 2JABA 5ANLA 4BSXA 2P9SG 1UJJA 1O1SA 2R59A 3E34A 3FUNA 3LY9A 3ASGA 2XPYA 3HG0D 4GYYA 4CT4A 1IHBA 3L08A 3TJPA 2WB2A 3L16A 1HFAA 1JPLA 2FULA 1RZ4A 3FTWA 4J8YA 4GZ6A 2Y69E 3B7SA 2DCPA 3FUMA 5E75A 4TV3A 1K1AA 3DBSA 1OWMA 1N95A 2LO6A 4JZYA 2FF4A 2LXMA 2YINA 3EU5A 3CVUA 2EIJE 3CHOA 4N5QA 3TGOA 5AENA 5ENSD 5JJ6A 2Y0BG 2RKKA 3PZDA 1KLXA 3AG3E 1SVXA 2P9NG 3L22A 3TWVA 1JWFA 1O1TA 2ZXWE 5ENQD 3EIQC 3G2WA 1MX6A 3I4GA 4MKTA 1BI7B 3CKBA 2I2OA 4HFGA 5ARGA 1OCCE 2L9BA 4EQFA 3SHFA 2QYUA 3LVRE 3ABLE 1NA3A 4AOFA 3ENEA 2XCCA 2J8SD 3EIJA 3DWLG 3IV0A 4F53A 4JXTA 3R9AB 3AS8A 2AW6A 2WPVA 2XENA 1H2VC 3L13A 3ZHEA 3AJIA 3PDNA 1Y6IA 3I4RB 3MA5A 5CHEE 1UN9A 4DX6D 4UUCA 3QWVA 4ACKA 3EHRA 1JWGA 4YNDA 4RQIA 3ZGQA 3CVNA 3TWQA 3QAQA 1K3ZD 4UI9J 3AS4A 2CG3A 5JJ7A 1HE8A 5BV0A 3OXFA 4WNEA 1TNBA 1XNFA 4UWKA 2MRIA 1OT8A 3TWWA 4DJAA 3MKQB 3UUXA 1SZAA 1WM5A 1HU3A 3TWRA 4O1PA 3R7QA 1N52A 4B89A 4D10C 5CEDB 3FU5A 3ONKA 2DZNA 1AP7A 2WVIA 1E96B 4M3OA 1S63A 5BT1A 3HDXA 2HR2A 4HOQA 3FTSA 3P1UA 2CHXA 4ILHB 3U3WA 2OV8A 3UM2A 1U3DA 2E0IA 3CVVA 5CECB 3NZUA 4LUNU 2MYOA 4WUYA 4U95D 5CMYA 1WDYA 4HI8A 4U07A 1UJKA 1HZ4A 4I1AA 3ABME 3W9GA 2B0OE 5G55A 1N0QA 1N4QA 3B95A 3PEVB 4RG9A 2XRYA 4LNGA 3CEQA 3TWSA 1V55E 1ZU2A 3D3MA 2VSYA 2WXNA 4OAUC 4QQIA 3D9PA 3MV3B 4JD2G 3CQGB 4ABNA 1G3NB 4JHKA 5ENRD 3BU8A 4AP2A 2P9UG 3V79K 2MOWA 4FADA 2CFUA 3J5QB 4HI9A 2LAIA 1Z3YA 2R05A 3JXJA 4IYPA 4I9CA 2ILRA 3SFXA 3U9WA 4G8KA 4HBDA 5KNHD 2ZGDA 2OEWA 3T5VA 4NACA 3S7DA 5ENOD 2OEVA 3Q49B 2VSNA 5EX3A 3AG1E 3JQ1A 5CBNA 1Z6TA 2WXQA 3SFZA 3CK9A 4NRHB 1N54A 4DLOA 1XGWA 3SBSA 1NI1A 3ZYQA 2GW1A 2A4ZA 1VDYA 2KCLA 3CHRA 4NIKA 2YQ8A 3UIPC 4YDOA 3PREA 5HQ8A 3GZSA 4BERA 5A6CA 3ABKE 4HOSA 2XRZA 2LSVA 3ASDA 3RAUA 2PQNA 2C2LA 3S7JA 3CGHA 2YHEA 2VGXB 4A3TA 1H6OA 2P2CP 5FQ8A 3UT7A 1N94A 2V5QC 4G2VA 3LKUA 1TN8A 1W3BA 3FWVA 4M7CA 3MCXA 3FUJA 1U2VG 4DX5D 4TXQA 2KXPC 4FU3A 1TR4A 3IBEA 1TNUA 3D9IA 1YYHA 3HRAA 3HVEB 1JCSA 4KZ0A 3S7FA 3MGBA 2XZTG 3RKVA 3V2OA 5AJDA 3IXEA 1KT0A 2HE0A 4BFRA 3C98A 2NYJA 3QKYA 1TEZA 3AU5A 3DPYA 5KWDA 4HXIA 4E6HA 3Q9NC 1O5MA 4H7XA 4CEMA 2EIKE 4KBQA 3LJ3A 2XS1A 2VYIA 3UKUG 4Z68A 1MJ0A 4G24A 3PUJA 2F0YA 3FTYA 2KC7A 3FTUA 4ATZD 3SNXA 4FA6A 2IF4A 3TWUA 2GRPB 1IQUA 3QOUA 3LPZA 3PVLA 2L6BA 4DX2A 3CSTA 1AWCB 2P58C 2M63A 3K9IA 4ATGA 4I6GA 2CFZA 4U04A 1N4SA 4HORA 5DBKA 5AQ9A 2Y1LE 1ZBPA 3O4ZA 3ZYLA 3UXGA 2PNNA 3TWTA 3ZFWA 1QQEA 2WXIA 2J4DA 3PEUB 3FFLA 3BG1B 4HB5A 3AAAC 4WAFA 3APDA 4U63A 2GRRB 3ASHA 4O1OA 4EPZA 3ML9A 2VTBB 1SA4A 3VLEA 3O48A 3CVLA 2GRMA 4WNDA 2WQ6A 4ANUA 1SW6A 3FU0A 3D9JA 2JLBA 4BY6A 4LG6A 3EHMA 3RO2A 4GA2A 4PS8A 4W9RA 5LCWC 4XIFA 2QZAA 3TAXA 2IO3C 4A1SA 4BETA 3Q79A 4HQDA 3ASNE 5FQ7A 3V2XA 4HS2A 1SZ9A 4CT0A 4G8LA 4TXPA 4J8SA 3Q73A 4CCAA 2KZTA 1JCRA 4FHJA 5EYLA 3SQVA 2RG8A 3CSFA 4K0RA 4R7LA 2RFAA 3IHVA 2WXGA 3B7TA 2F8YA 4GTMA 5CBOA 2ZGGA 3BG0B 2NSZA 3CKCA 4PH4B 3UTMA 3Q9UC 3ZN3A 3QARA 1S70B 3VTYA 3ZU7B 4HNAD 2EQXA 2RFMA 4DK5A 1HS6A 1DVPA 4K5BA 3ZYKA 3DXKG 1NA0A 4A63B 2YNQA 2V5FA 4WWPA 2UY1A 3Q5MA 5FZQA 3RRUA 2R2LA 4P29A 1PC2A 1DCEA 4UWLA 5G04C 5D0OD 3FHEA 3WXXA 3IKOB 3APFA 4ZHBA 3SF4A 4Q69A 1EPUA 5E76A 1TN7A 2XEHA 3MX3A 1X5BA 2XPZA 3LYAA 3FTVA 1QZ2A 4LEUA 2VJ8A 5C1DA 5BPPA 4ZFHA 4BSZB 3FH8A 3ZXPA 2XQ0A 1N0RA 4AXHA 4J8DA 2LNIA 4CZ2D 1FPPA 4Q96A 4GZDA 5DIZA 5EILA 5B3SE 1A17A 4JL0A 4F6RD 3SBTB 4A55A 3C3QA 1OUVA 1IXVA 4A3VA 3ZVVA 3FU3A 5ENTD 5EIBE 2IY0C 3FUDA 2WXFA 3UM3A 3ULEG 3Q15A 1QNFA 2R5SA 2EIME 3D9LA 3CIAA 3CVQA 3ZW3A 2X6HA 4HRNA 4YDWA 3G2SA 3PNTB 3RRMB 3URZA 2GGFA 3LJNA 4N3CA 4XI0A 3EHNA 3R9MA 2XEVA 1MQSA 1OCRE 4GZ3A 1QYMA 3L82A 2X6IA 3FH5A 4F7AA 4BT9A 5D66A 2XPIA 4L23A 2HO1A 2RD0A 1SA5A 5BUZA 2L0IA 3T5XA 2R03A 1FT2A 3T8KA 2LUHA 1N4PA 4I9EA 1ELWA 4UWHA 1MYOA 1PY1A 3FEYA 3FU6A 3KSLA 5AIJA 4GYWA 1PAQA 4ILGA 4RLYA 1TJFA 1BPOA 4ACLA 3FULA 4NQ0A 5KBAA 4G25A 2IQCA 2BEDA 4J8FA 3MYVA 3Q47B 1TNZA 3QWPA 4DRXE 5J90A 4CYMD 3EUVA 1S0PA 4GTOA 3D9OA 5ARFA 5HS0A 4PDXA 3GZ2A 1KZOA 4MRUA 1E8YA 5AYWD 4C0MA 3JUIA 4U0UA 5CRVA 4GCOA 2BKKB 3UKRG 5J08A 2CHZA 2J07A 3ZHEB 5KJMA 1Z3XA 1OY3D 3PE3A 4KT6B 3R7RA 3KEZA 2ETAA 2DIWA 3FH7A 3KAEA 5G2NA 4B93B 1BU9A 1H2UA 3DSSA 3DSXA 3JQ0A 2OOEA 4ILIA 5KJNA 1LTXA 1INZA 2DWZA 4V3IA 3TXNA 4GZ5A 3S2AA 4AVXA 1OCZE 4UI9C 5H7PA 4J6IA 3TXMA 1H19A 3D9HA 3CVPA 4BEPA 2X38A 3GYZA 4AIFA 4HVBA 2IO2C 1KT1A 3ZPJA 3PS6A 4AJWA 1E8ZA 2WXJA 5ITZF 3VLDA 4B0ZA 3MZLB 4AM9A 3U66A 3HXDA 1O1RA 2NXPA 3PZ3A 3S7BA 4URKA 2NC9A 3L54A 4B8CB 4F3VA 4JHJA 2YHCA 3Q7FA 4LSZE 4N2QA 4GU5A 5AAOA 4KYOB 3QDNA 3FUHA 2XGSA 4HOUA 1BD8A 5FZRA 3RK6A 2WXLA 4L2YA 1FVFA 3ML8A 1Q2ZA 1NP7A 1IYGA 3DSTA 1D8DA 2HYZA 4FJYA 3SO8A 3EDTB 2AXVA 3J5PA 4YDEA 3B7RL 1N11A 1HH8A 1NL4A 2PQRA 4UQZA 4YVQC 3HXEA 4OYSA 1TNYA 4J0UA 3PH0C 3ASFA 4K5AB 3CLJA 2DYRE 1H0AA 4L7TA 5AJLA 1NZNA 1BLXB 4RG6A 2J9QA 2I9CA 5HRYA 1TNOA 2IFUA 4AV7A 2AJAA 2H6HA 2L6JA 3WG7E 1D8EA 5JMND 5A7DB 3VTXA 4GA1A 4BT8A 1MX4A 1E8XA 4N5CA 2V0PA 2H6GA 2VGYA 1K8KG 3AG4E 4UQYA 4APFA 3IHYA 3ZRHA 2QYJA 4TXRA 4FJZA 2GRLA 3DRAA 5B1BE 3PUKA 1KZPA 4FC8A 4GTSA 1L5JA 4LNBA 4A1GA 5EDSA 3NOGD 3E4BA 2ZIRA 3LCAA 3U64A 2BTDA 4GTPA 5ANRA 4AY6A 4XZ4A 4I6EA 1D9SA 4EHMA 4OVVA 4O60A 1JUQA 4U0SA 1LD8A 4RSYA 4JEUA 4I1MA 4WWNA 3LS8A 2J49A 4U8HA 3KD7A 3ZNGA 3EU9A 4C48B 5EKQD 1MX2A 3MJWA 5BXUA 3PE4A 3UT8A 1OWNA 3FY4A 4JB8P 3RJVA 4F1SA 1YA0A 3ONLA 3LY7A 3SZ7A 5CEAA 5FQ4A 3LY8A 5FTPA 4HOTA 3FUFA 4I17A 4CRWA 4XE0A 4TRQA 3SGHA 1EDUA 3RO3A 1X81A 4PUCA 1UG3A 2WQ7A 4GA0A 4BX9A 4KMOA 3VLFA 5FIOA 5T3RA 3UM1A 2X6JA 5JHBA 4X8QA 3QWWA 3HXCA 3FEXA 4WNGA 4NURA 2OCCE 4GYOA 3F6QA 4B8AA 1IKND 3EHQA 3ZXSA 2AWIA 3OAWA 2QY7A 5CCLA 5JJTA 5FZSA 2KATA 4U0ZA 5B1AE 5CERB 4FULA 5BXOA 4BTBA 1E7VA 3AG2E 3D9KA 4ANWA 3DSUA 4Y6CA 4GPKA 2DZOA 2FI7A 3JUEA 2XHEA 5HKPA 2AXZA 4GAAA 4C0EA 3NF1A 5A23A 1HF8A 3NAWA 3RSEG 5FINA 3JXIA 1HXIA 4I2ZA 3DXMG 1HX8A 4AY5A 3PNLB 1LF8A 2R17C 3JYSA
chains in the Genus database with same CATH topology
1XGWA 3SBSA 4J8FA 4L1BA 2KCKA 3NZSA 3MYVA 3Q47B 3QWPA 1HG2A 3ZYQA 1E7UA 4FHKA 3FTZA 2GW1A 5J90A 2WXOA 2A4ZA 5T8IA 1VDYA 3CHSA 1S0PA 2KCLA 3CHRA 2V8SE 3D9OA 5ARFA 2E2EA 2YQ8A 4PDXA 2KZTB 2QFCA 3GZ2A 5LP0A 4PS7A 3PREA 4MRUA 3N71A 5HQ8A 2I6HA 3GZSA 1E8YA 5EX0A 5AYWD 2BUGA 4C0MA 2XGOA 3JUIA 4U0UA 3ZEFA 4WNFA 5A6CA 4HOSA 1H2TC 4GCOA 4CGWA 4XI9A 2XRZA 1E90A 5J08A 2LSVA 2CHZA 4CDMA 3ASDA 2J07A 2WXKA 3ZHEB 2PQNA 1WAO1 2C2LA 1WY6A 1GW6A 3B13A 4EECA 4EBAA 1Z3XA 3S7JA 5KJMA 5BV1A 3PE3A 2PZIA 3CGHA 4G23A 4GMJA 4DLQA 2C0LA 3NQPA 2YHEA 2VGXB 4A3TA 4KT6B 3L17A 3QK0A 1E8WA 5G04J 3DPDA 3R7RA 3FTXA 3CQCB 5FQ8A 3UT7A 1ELRA 3KEZA 5HI7A 4G2VA 2I1JA 3LKUA 2DIWA 3FH7A 3KAEA 3QB2A 5G2NA 4GMLA 3TL5A 4BWRA 4JW1A 2UY1B 1H2UA 2PL2A 4LERA 5LFAA 1W3BA 3OXLA 3ULQA 3ESLA 3FWVA 3ZIMA 3MCXA 3JQ0A 2OOEA 2WMOA 3MKRA 4PS3A 3FUJA 4ME2A 4ILIA 5KJNA 4FU3A 1INZA 3IBEA 3FUIA 3TG4A 4V3IA 3TXNA 3D9IA 1IHGA 3HVEB 4GZ5A 4KZ0A 4O6FA 3S7FA 3S2AA 1DNPA 4AVXA 3MGBA 3RKVA 2PM7A 4UI9C 4J6IA 3TXMA 1H19A 3CVPA 5AJDA 5LX8A 1ELKA 4LRZA 4G25A 2X38A 3GYZA 3CV0A 4AIFA 3CVXA 1KT0A 4HVBA 1U3CA 4BFRA 3UX4A 1KT1A 3C98A 3ZPJA 2CHWA 3PS6A 4AJWA 3FUEA 2IJGX 3MKQA 1E8ZA 3Q4AB 3QKYA 3I3NA 2WXJA 4N3AA 3AU5A 4MLPA 1TEZA 3APCA 3VLDA 2XGMA 4B0ZA 3FDHA 2WXHA 3MZLB 4HXIA 4AM9A 5KJLA 4APOA 2OVFA 4E6HA 3U66A 4G1TA 3CHMA 4DI3A 2V4LA 4H7XA 4CEMA 3QNKA 4WWOA 1TJCA 4KBQA 3LJ3A 4N39A 2VYIA 2LAHA 4EZLA 3B7UX 4G24A 2A5UA 2WMNA 3FTYA 3PUJA 4MS6A 2KC7A 3QC1A 3FTUA 2NXPA 4XKCA 4RVBA 3SNXA 3SD5A 4FA6A 3S7BA 4URKA 5ENNA 4ANXA 2NC9A 2IF4A 3BEEA 4KVMA 3L54A 2DBAA 1IQUA 3I5PA 3QOUA 5FQ6A 3LEWA 2WXPA 4FLBA 1MHQA 4B8CB 5FT9A 4F3VA 3LPZA 3U4TA 4JHJA 2UWJG 4EZKA 2YHCA 3PVLA 1SQMA 3GZ1A 4TUUA 3QJZA 4N2QA 3UQ3A 3UMVA 5T4YA 4KZCA 4GU5A 4JHRA 4I1OB 4LCTA 1B89A 2AXUA 2J08A 3CSTA 4GCNA 4KXKB 4BX8A 4E85A 2OVBA 3MEKA 3QDNA 4KYOB 4UWGA 3FUHA 4QFVA 2P58C 2M63A 5ANLA 3K9IA 2XGSA 4BSXA 4ATGA 4BTAA 1UJJA 2CFZA 4HOUA 4I6GA 4U04A 5FZRA 4HORA 2R59A 3FUNA 3LY9A 5DBKA 3RK6A 2WXLA 3ASGA 4L2YA 2XPYA 1FVFA 3ML8A 4GYYA 1Y8MA 4I6JA 4CT4A 4JVSA 3L08A 1ZBPA 3P2BA 3TJPA 3O4ZA 2WB2A 1NP7A 1HFAA 1JPLA 2FULA 3L16A 3ZYLA 5M72A 1IYGA 3FTWA 3ZFWA 1QQEA 2MHKA 4I43A 2LSUA 2WXIA 3LXUX 4C9BB 5JHAA 2HYZA 2J4DA 3PEUB 4FJYA 1EF1C 3EDTB 4JC8A 3FFLA 4GZ6A 4IN3B 3BG1B 2AXVA 3B7SA 2DCPA 3FUMA 5E75A 4TV3A 3DBSA 3AS5A 1OWMA 2BF0X 4WAFA 4ANVA 2LO6A 3APDA 3RIBA 4JZYA 3B7RL 1OWPA 1HH8A 2FF4A 4FP7A 2YINA 3CHPA 2PQRA 4UQZA 4U63A 3CVUA 3CHOA 4H7YA 4YVQC 4N2SA 3ASHA 3TGOA 4OYSA 5AENA 4J0UA 4EPZA 3CR3A 3PH0C 3ML9A 3ASFA 2VTBB 3VLEA 3CLJA 3O48A 3CVLA 5JJ6A 5KCMA 1H0AA 2GRMA 2Y4TA 3CK7A 4L7TA 4WNDA 1IQRA 3PZDA 5AJLA 2WQ6A 1KLXA 4ANUA 3FU0A 4JEHA 1NZNA 3D9JA 2JLBA 4BY6A 3L22A 1JWFA 4RG6A 3EHMA 2J9QA 3FP3A 3RO2A 4GA2A 2I9CA 4PS8A 4W9RA 1UN8A 5LCWC 3EIQC 3G2WA 3I4GA 4MKTA 2IFUA 4XIFA 1UW4B 3CKBA 3TAXA 4AV7A 2VSXE 2L6JA 2I2OA 4EZJA 4A1SA 3UT4A 5FQ7A 2WXRA 4HFGA 5ARGA 4HS2A 4EBAG 3IEGA 5A7DB 3VTXA 4GA1A 1SZ9A 4FLHA 4BT8A 4N5CA 1E8XA 4CT0A 2V0PA 4G11A 2L9BA 3ESKA 3L6AA 4EQFA 3SHFA 2KM4A 2VGYA 3G2VA 3LVRE 4J8SA 1NA3A 4AOFA 3ENEA 4UQYA 4APFA 2XCCA 3EJNA 1OWOA 4CCAA 4CGVA 2KZTA 3IHYA 3ZRHA 4FHJA 3EIJA 5FWQA 2RG8A 3G2UA 4FJZA 3CSFA 2Q7FA 4K0RA 4R7LA 5CCMA 3IV0A 4F53A 3IHVA 2WXGA 2Y3AA 4JXTA 3B7TA 3R9AB 4B94A 2GRLA 3AS8A 2AW6A 4CDRA 2WPVA 4UQXA 1H2VC 2WXMA 3L13A 3BG0B 2NSZA 3CKCA 3PUKA 4PH4B 4AEZC 4FC8A 3ZHEA 1L5JA 3ZN3A 4A1GA 5EDSA 3QARA 3VTYA 3E4BA 3LCAA 3U64A 3PDNA 1P5QA 1Y6IA 2EQXA 4DK5A 2VQ2A 4CDNA 3I4RB 2WQHA 3MA5A 2VGXA 5CHEE 2BTDA 2IOSA 5D0QD 1HS6A 1UN9A 1DVPA 2XCBA 5ANRA 5BW8C 3ZYKA 3LVQE 4XZ4A 4AY6A 1NA0A 3QWVA 4ACKA 1JWGA 4I6EA 4YNDA 1HO8A 2YNQA 4OVVA 2V5FA 3CVNA 3HIZA 3ZGQA 2I1KA 4WWPA 3HYMB 3QAQA 1H6KA 3LDZA 4UI9J 4Y6WA 2UY1A 4J8EA 2HM8A 3Q5MA 3AS4A 1JUQA 3OXGA 2J4BA 4U0SA 5FZQA 3RRUA 5BNWA 2CG3A 3UPVA 4RSYA 4JEUA 5JJ7A 3FUKA 1HE8A 4I1MA 4P29A 4WWNA 1PC2A 5BV0A 2L0TB 1OWLA 3OXFA 4Q94A 4WNEA 4UWLA 3LS8A 3D9NA 1EYHA 3HVEA 5G04C 5D0OD 5LOZA 2FEZA 2J49A 3FHEA 3IKOB 3KD7A 4U8HA 3WXXA 1XNFA 3APFA 4UWKA 2PM6A 5EKQD 3SF4A 4Q69A 2MRIA 3PRZA 1EPUA 3AU4A 5E76A 3MJWA 3PE4A 3GW4A 3MX3A 1X5BA 4DPRA 2XPZA 3UT8A 1OWNA 3FY4A 4UWFA 3LYAA 3FTVA 1QZ2A 3RJVA 4DJAA 4F1SA 1YA0A 4LEUA 3ONLA 3MKQB 3UUXA 1SZAA 1WM5A 2J09A 2VJ8A 5C1DA 3LY7A 4JA9A 2X6FA 1HU3A 4JA7A 5BPPA 3ZYMA 3R7QA 1N52A 3SZ7A 4B89A 5FQ4A 3LY8A 5FTPA 4D10C 3FH8A 2KCVA 5G05J 4HOTA 3FUFA 3FU5A 3ONKA 2XQ0A 1HG5A 4I17A 4AXHA 4J8DA 2LNIA 4CRWA 3CK8A 2WVIA 4XE0A 4Q96A 1E96B 4TRQA 4GZDA 5DIZA 1A17A 4M3OA 4JL0A 4G26A 5BT1A 3SGHA 1EDUA 3HDXA 3RO3A 2HR2A 3SBTB 4PUCA 4HOQA 4A55A 3FTSA 3KS2A 1OUVA 1UG3A 4A3VA 3ZVVA 2IOLA 2WQ7A 3P1UA 4GA0A 3FU3A 2X3MA 2CHXA 4ILHB 4K03A 4BX9A 4KMOA 3RU0A 3VLFA 2OV8A 3U3WA 3CVYA 5T3RA 3FUDA 2X6JA 2Y4UA 1U3DA 2E0IA 3CVVA 5JHBA 2WXFA 3NZUA 3G2TA 3SI5A 3Q15A 1QNFA 2R5SA 3QWWA 4IRUA 3D9LA 3FEXA 4LUNU 3CIAA 4NURA 4WNGA 3CVQA 2ZU6B 2X6KA 4UI9K 4WUYA 3ZW3A 2X6HA 4GYOA 5CMYA 2WM9A 4B8AA 4U07A 3G2SA 3PNTB 1UJKA 1FCHA 3OTNA 1HZ4A 4I1AA 3ZXSA 3RRMB 3URZA 3T8MA 2GGFA 2AWIA 3OAWA 5G55A 2QY7A 4N3CA 3PEVB 4RG9A 4XI0A 2XRYA 3EHNA 5CCLA 3CEQA 5JJTA 5FZSA 2KATA 4U0ZA 3HHMA 4FULA 2XEVA 1MQSA 1ZU2A 1E7VA 4GZCA 4BTBA 3D3MA 2VSYA 2WXNA 4GZ3A 2IU1A 3D9MA 2X6IA 3D9PA 3MV3B 3FH5A 2AVPA 3CQGB 4ABNA 4F7AA 4BT9A 3D9KA 2XPIA 4JHKA 2FO7A 4ANWA 4L23A 2HO1A 4AP2A 5KJKA 2RD0A 2MOWA 4Y6CA 4FADA 5BUZA 4GPKA 2CFUA 4OVUA 2FI7A 2L0IA 2LAIA 4L2LA 1Z3YA 2XHEA 4NRHB 3T5XA 5C2YA 5LCWJ 3CVWA 4XKBA 4IYPA 4N3BA 1FVHA 2VTBA 4I9CA 2ILRA 4I2WA 4DI4A 2AXZA 4GAAA 5CMWA 3CHQA 3RRNB 4C0EA 2ONDA 3NF1A 4HLEA 3JCKC 3U9WA 2FBNA 4I9EA 5A23A 1ELWA 1HF8A 4UWHA 4IULA 2IONA 3TG5A 1PY1A 2CG2A 3T5VA 4NACA 3FEYA 3FU6A 5G05C 2C0MA 4KVOA 5AIJA 5FJYA 4GYWA 3S7DA 1HXIA 3Q49B 4I2ZA 2VSNA 5EX3A 1PAQA 4ILGA 4JPSA 2VSOE 1HX8A 1BPOA 1TJFA 3JQ1A 4XX5A 3MV2B 4ACLA 4AY5A 3FULA 1Z6TA 1LF8A 2JEKA 2R17C 2WXQA 3JYSA 3PNLB 4GB9A 4NQ0A 4YVOA 3SFZA 2IQCA 3CK9A 1N54A 4DLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9B A;  4EBA G; 
#chains in the Genus database with same CATH topology
 1K1B A;  4L9P A;  1DC2 A;  1E7U A;  4FHK A;  2R02 A;  3FTZ A;  5T8I A;  3CHS A;  2V8S E;  2KZT B;  2I6H A;  5EX0 A;  3PZ2 A;  2BUG A;  2XGO A;  3ZEF A;  4U7E B;  1E90 A;  5AQB A;  3T9K A;  1WAO 1;  1BI8 B;  3B13 A;  4EEC A;  4EBA A;  2F8X K;  3NQP A;  4LNU D;  2F37 A;  1TYQ G;  1E8W A;  3DEP A;  4U8Y D;  1N9A A;  5HI7 A;  2I1J A;  3TL5 A;  4BWR A;  4JW1 A;  2UY1 B;  5LFA A;  3KEA A;  3OXL A;  3ZIM A;  3MKR A;  1S64 A;  3ASO E;  1IHG A;  1Z5S C;  3NOC D;  2PM7 A;  4DUI A;  1LD7 A;  5LX8 A;  1ELK A;  3CV0 A;  5EN5 D;  3Q7A A;  3C3R A;  2IJG X;  3MKQ A;  3Q4A B;  4N3A A;  3I3N A;  4MLP A;  2XGM A;  3FDH A;  2WXH A;  1H6P A;  4G1T A;  3CHM A;  4J7W A;  2V4L A;  2LAH A;  2B6C A;  2A5U A;  3QC1 A;  4XKC A;  3Q78 A;  4RVB A;  5CRU A;  1OCO E;  2DBA A;  5FQ6 A;  4FLB A;  2WXP A;  3E33 A;  3DSW A;  2UWJ G;  4EZK A;  3QJZ A;  5ENP D;  5T4Y A;  4KZC A;  4JHR A;  4I1O B;  4LCT A;  1B89 A;  3C5R A;  2AXU A;  4BX8 A;  4E85 A;  2OVB A;  3MEK A;  4UWG A;  4BTA A;  4HRL A;  1Y8M A;  4I6J A;  4JVS A;  3P2B A;  5M72 A;  4BES A;  2MHK A;  4I43 A;  2LSU A;  2XEE A;  3LXU X;  4C9B B;  5JHA A;  4JC8 A;  4YDY A;  1EF1 C;  4IN3 B;  3TWX A;  3AS5 A;  2BF0 X;  4HLL A;  4ANV A;  2H6I A;  3RIB A;  1OWP A;  4FP7 A;  3CHP A;  4H7Y A;  4N2S A;  3NB2 A;  3CR3 A;  5D2M C;  4MBG A;  2IEJ A;  5KCM A;  2DYS E;  2Y4T A;  3CK7 A;  1IQR A;  2P9I G;  4JEH A;  2P9P G;  3FP3 A;  1UN8 A;  3HXF A;  1UW4 B;  2VSX E;  4DX1 A;  4EZJ A;  2GRO B;  3UT4 A;  2WXR A;  4EBA G;  3IEG A;  4FLH A;  3L9T A;  4G11 A;  3ESK A;  3L6A A;  2KM4 A;  3G2V A;  3EJN A;  1OWO A;  4CGV A;  4U8V D;  5FWQ A;  2GRN B;  3G2U A;  2Q7F A;  5CCM A;  2Y3A A;  4B94 A;  1KPS B;  4CDR A;  4UQX A;  2WXM A;  4AEZ C;  2KBX A;  5EID A;  1WG0 A;  1P5Q A;  2VQ2 A;  4CDN A;  2WQH A;  2VGX A;  2IOS A;  2XCB A;  5BW8 C;  3LVQ E;  3Q75 A;  1HO8 A;  3HIZ A;  5AQA A;  2I1K A;  3HYM B;  1H6K A;  3LDZ A;  4Y6W A;  2V4H C;  3HXB A;  4J8E A;  2HM8 A;  3OXG A;  2J4B A;  5BNW A;  3UPV A;  3FUK A;  2L0T B;  1OWL A;  4Q94 A;  3UIO C;  2XZD G;  3D9N A;  1EYH A;  3HVE A;  2XS8 A;  5LOZ A;  2FEZ A;  3X2Q E;  2PM6 A;  2EIN E;  3PRZ A;  3AU4 A;  3C72 A;  3BUA A;  3GW4 A;  3KSQ A;  4DPR A;  1ZB1 A;  1TN6 A;  2H6F A;  3E37 A;  4UWF A;  3ULY A;  4TUM A;  4DX7 D;  2J09 A;  4JA9 A;  2X6F A;  3V30 A;  4JA7 A;  3ZYM A;  5KNG A;  2QC9 A;  2KCV A;  5G05 J;  4GTT A;  5AAR A;  1HG5 A;  3SY2 A;  3CK8 A;  1RW2 A;  3SFY A;  4G26 A;  2FO1 E;  3KS2 A;  5EYP F;  5JA4 D;  2IOL A;  3UIN C;  2X3M A;  2P9L G;  4K03 A;  3RU0 A;  3CVY A;  2VGE A;  2Y4U A;  3ZKJ A;  3G2T A;  3SI5 A;  4IRU A;  2ZU6 B;  1N4R A;  2X6K A;  4UI9 K;  2WM9 A;  3DEO A;  1FCH A;  3OTN A;  3T8M A;  3HHM A;  4GZC A;  1NFI E;  4HRM B;  3ISM C;  2IU1 A;  3D9M A;  2AVP A;  2EIL E;  1YMP A;  2FO7 A;  5KJK A;  4GTQ A;  2GRQ B;  4OVU A;  1A5E A;  3PZ1 A;  1QBQ A;  4L2L A;  2ETC A;  4U96 D;  5C2Y A;  5LCW J;  3CVW A;  4XKB A;  4N3B A;  1FVH A;  2VTB A;  4I2W A;  4DI4 A;  5CMW A;  3CHQ A;  3RRN B;  2OND A;  4HLE A;  3JCK C;  2FBN A;  3E32 A;  4IUL A;  2ION A;  3TG5 A;  2CG2 A;  5G05 C;  2C0M A;  4KVO A;  5FJY A;  4JPS A;  2LXL A;  2VSO E;  4XX5 A;  3MV2 B;  5D0Q D;  2JEK A;  4GB9 A;  4YVO A;  4L1B A;  1JCQ A;  2KCK A;  3NBN B;  3NZS A;  3ZUV B;  1V54 E;  1HG2 A;  2ZIS A;  2A5E A;  3C3O A;  2WXO A;  4OAV B;  2E2E A;  4GMR A;  2QFC A;  5LP0 A;  4PS7 A;  3N71 A;  1UOH A;  1MZC A;  1DCQ A;  4WNF A;  1H2T C;  4CGW A;  4XI9 A;  4CDM A;  2WXK A;  1WY6 A;  1GW6 A;  5BV1 A;  2PZI A;  4DLQ A;  4G23 A;  4GMJ A;  2C0L A;  4GPM A;  3L17 A;  3QK0 A;  3BQO A;  4F1P A;  5G04 J;  3DPD A;  5IY5 E;  3FTX A;  3CQC B;  3V31 A;  1ELR A;  4GTR A;  3QB2 A;  4GML A;  2PL2 A;  4LER A;  4XEI G;  3ULQ A;  3ESL A;  4PS3 A;  2WMO A;  1FT1 A;  4ME2 A;  3FUI A;  3TG4 A;  2BKG A;  4O6F A;  1DNP A;  3UI2 A;  5AN8 A;  3E30 A;  3CVX A;  4LRZ A;  1U3C A;  3UX4 A;  2CHW A;  3FUE A;  1YCS B;  3APC A;  5KJL A;  4APO A;  2OVF A;  3UM0 A;  2DVW A;  4DI3 A;  2ETB A;  3QNK A;  4WWO A;  1TJC A;  4N39 A;  1OXJ A;  3B7B A;  4K5C A;  4EZL A;  3B7U X;  2WMN A;  4MS6 A;  3SD5 A;  5ENN A;  2P9K G;  4ANX A;  3BEE A;  4KVM A;  4GTV A;  5AQ7 A;  3I5P A;  3W9F A;  3LEW A;  1MHQ A;  5FT9 A;  3U4T A;  4TUU A;  1SQM A;  3GZ1 A;  3UQ3 A;  3UMV A;  2J08 A;  3PZ4 A;  4GCN A;  4KXK B;  3DSV A;  4QFV A;  2JAB A;  5ANL A;  4BSX A;  2P9S G;  1UJJ A;  1O1S A;  2R59 A;  3E34 A;  3FUN A;  3LY9 A;  3ASG A;  2XPY A;  3HG0 D;  4GYY A;  4CT4 A;  1IHB A;  3L08 A;  3TJP A;  2WB2 A;  3L16 A;  1HFA A;  1JPL A;  2FUL A;  1RZ4 A;  3FTW A;  4J8Y A;  4GZ6 A;  2Y69 E;  3B7S A;  2DCP A;  3FUM A;  5E75 A;  4TV3 A;  1K1A A;  3DBS A;  1OWM A;  1N95 A;  2LO6 A;  4JZY A;  2FF4 A;  2LXM A;  2YIN A;  3EU5 A;  3CVU A;  2EIJ E;  3CHO A;  4N5Q A;  3TGO A;  5AEN A;  5ENS D;  5JJ6 A;  2Y0B G;  2RKK A;  3PZD A;  1KLX A;  3AG3 E;  1SVX A;  2P9N G;  3L22 A;  3TWV A;  1JWF A;  1O1T A;  2ZXW E;  5ENQ D;  3EIQ C;  3G2W A;  1MX6 A;  3I4G A;  4MKT A;  1BI7 B;  3CKB A;  2I2O A;  4HFG A;  5ARG A;  1OCC E;  2L9B A;  4EQF A;  3SHF A;  2QYU A;  3LVR E;  3ABL E;  1NA3 A;  4AOF A;  3ENE A;  2XCC A;  2J8S D;  3EIJ A;  3DWL G;  3IV0 A;  4F53 A;  4JXT A;  3R9A B;  3AS8 A;  2AW6 A;  2WPV A;  2XEN A;  1H2V C;  3L13 A;  3ZHE A;  3AJI A;  3PDN A;  1Y6I A;  3I4R B;  3MA5 A;  5CHE E;  1UN9 A;  4DX6 D;  4UUC A;  3QWV A;  4ACK A;  3EHR A;  1JWG A;  4YND A;  4RQI A;  3ZGQ A;  3CVN A;  3TWQ A;  3QAQ A;  1K3Z D;  4UI9 J;  3AS4 A;  2CG3 A;  5JJ7 A;  1HE8 A;  5BV0 A;  3OXF A;  4WNE A;  1TNB A;  1XNF A;  4UWK A;  2MRI A;  1OT8 A;  3TWW A;  4DJA A;  3MKQ B;  3UUX A;  1SZA A;  1WM5 A;  1HU3 A;  3TWR A;  4O1P A;  3R7Q A;  1N52 A;  4B89 A;  4D10 C;  5CED B;  3FU5 A;  3ONK A;  2DZN A;  1AP7 A;  2WVI A;  1E96 B;  4M3O A;  1S63 A;  5BT1 A;  3HDX A;  2HR2 A;  4HOQ A;  3FTS A;  3P1U A;  2CHX A;  4ILH B;  3U3W A;  2OV8 A;  3UM2 A;  1U3D A;  2E0I A;  3CVV A;  5CEC B;  3NZU A;  4LUN U;  2MYO A;  4WUY A;  4U95 D;  5CMY A;  1WDY A;  4HI8 A;  4U07 A;  1UJK A;  1HZ4 A;  4I1A A;  3ABM E;  3W9G A;  2B0O E;  5G55 A;  1N0Q A;  1N4Q A;  3B95 A;  3PEV B;  4RG9 A;  2XRY A;  4LNG A;  3CEQ A;  3TWS A;  1V55 E;  1ZU2 A;  3D3M A;  2VSY A;  2WXN A;  4OAU C;  4QQI A;  3D9P A;  3MV3 B;  4JD2 G;  3CQG B;  4ABN A;  1G3N B;  4JHK A;  5ENR D;  3BU8 A;  4AP2 A;  2P9U G;  3V79 K;  2MOW A;  4FAD A;  2CFU A;  3J5Q B;  4HI9 A;  2LAI A;  1Z3Y A;  2R05 A;  3JXJ A;  4IYP A;  4I9C A;  2ILR A;  3SFX A;  3U9W A;  4G8K A;  4HBD A;  5KNH D;  2ZGD A;  2OEW A;  3T5V A;  4NAC A;  3S7D A;  5ENO D;  2OEV A;  3Q49 B;  2VSN A;  5EX3 A;  3AG1 E;  3JQ1 A;  5CBN A;  1Z6T A;  2WXQ A;  3SFZ A;  3CK9 A;  4NRH B;  1N54 A;  4DLO A;  1XGW A;  3SBS A;  1NI1 A;  3ZYQ A;  2GW1 A;  2A4Z A;  1VDY A;  2KCL A;  3CHR A;  4NIK A;  2YQ8 A;  3UIP C;  4YDO A;  3PRE A;  5HQ8 A;  3GZS A;  4BER A;  5A6C A;  3ABK E;  4HOS A;  2XRZ A;  2LSV A;  3ASD A;  3RAU A;  2PQN A;  2C2L A;  3S7J A;  3CGH A;  2YHE A;  2VGX B;  4A3T A;  1H6O A;  2P2C P;  5FQ8 A;  3UT7 A;  1N94 A;  2V5Q C;  4G2V A;  3LKU A;  1TN8 A;  1W3B A;  3FWV A;  4M7C A;  3MCX A;  3FUJ A;  1U2V G;  4DX5 D;  4TXQ A;  2KXP C;  4FU3 A;  1TR4 A;  3IBE A;  1TNU A;  3D9I A;  1YYH A;  3HRA A;  3HVE B;  1JCS A;  4KZ0 A;  3S7F A;  3MGB A;  2XZT G;  3RKV A;  3V2O A;  5AJD A;  3IXE A;  1KT0 A;  2HE0 A;  4BFR A;  3C98 A;  2NYJ A;  3QKY A;  1TEZ A;  3AU5 A;  3DPY A;  5KWD A;  4HXI A;  4E6H A;  3Q9N C;  1O5M A;  4H7X A;  4CEM A;  2EIK E;  4KBQ A;  3LJ3 A;  2XS1 A;  2VYI A;  3UKU G;  4Z68 A;  1MJ0 A;  4G24 A;  3PUJ A;  2F0Y A;  3FTY A;  2KC7 A;  3FTU A;  4ATZ D;  3SNX A;  4FA6 A;  2IF4 A;  3TWU A;  2GRP B;  1IQU A;  3QOU A;  3LPZ A;  3PVL A;  2L6B A;  4DX2 A;  3CST A;  1AWC B;  2P58 C;  2M63 A;  3K9I A;  4ATG A;  4I6G A;  2CFZ A;  4U04 A;  1N4S A;  4HOR A;  5DBK A;  5AQ9 A;  2Y1L E;  1ZBP A;  3O4Z A;  3ZYL A;  3UXG A;  2PNN A;  3TWT A;  3ZFW A;  1QQE A;  2WXI A;  2J4D A;  3PEU B;  3FFL A;  3BG1 B;  4HB5 A;  3AAA C;  4WAF A;  3APD A;  4U63 A;  2GRR B;  3ASH A;  4O1O A;  4EPZ A;  3ML9 A;  2VTB B;  1SA4 A;  3VLE A;  3O48 A;  3CVL A;  2GRM A;  4WND A;  2WQ6 A;  4ANU A;  1SW6 A;  3FU0 A;  3D9J A;  2JLB A;  4BY6 A;  4LG6 A;  3EHM A;  3RO2 A;  4GA2 A;  4PS8 A;  4W9R A;  5LCW C;  4XIF A;  2QZA A;  3TAX A;  2IO3 C;  4A1S A;  4BET A;  3Q79 A;  4HQD A;  3ASN E;  5FQ7 A;  3V2X A;  4HS2 A;  1SZ9 A;  4CT0 A;  4G8L A;  4TXP A;  4J8S A;  3Q73 A;  4CCA A;  2KZT A;  1JCR A;  4FHJ A;  5EYL A;  3SQV A;  2RG8 A;  3CSF A;  4K0R A;  4R7L A;  2RFA A;  3IHV A;  2WXG A;  3B7T A;  2F8Y A;  4GTM A;  5CBO A;  2ZGG A;  3BG0 B;  2NSZ A;  3CKC A;  4PH4 B;  3UTM A;  3Q9U C;  3ZN3 A;  3QAR A;  1S70 B;  3VTY A;  3ZU7 B;  4HNA D;  2EQX A;  2RFM A;  4DK5 A;  1HS6 A;  1DVP A;  4K5B A;  3ZYK A;  3DXK G;  1NA0 A;  4A63 B;  2YNQ A;  2V5F A;  4WWP A;  2UY1 A;  3Q5M A;  5FZQ A;  3RRU A;  2R2L A;  4P29 A;  1PC2 A;  1DCE A;  4UWL A;  5G04 C;  5D0O D;  3FHE A;  3WXX A;  3IKO B;  3APF A;  4ZHB A;  3SF4 A;  4Q69 A;  1EPU A;  5E76 A;  1TN7 A;  2XEH A;  3MX3 A;  1X5B A;  2XPZ A;  3LYA A;  3FTV A;  1QZ2 A;  4LEU A;  2VJ8 A;  5C1D A;  5BPP A;  4ZFH A;  4BSZ B;  3FH8 A;  3ZXP A;  2XQ0 A;  1N0R A;  4AXH A;  4J8D A;  2LNI A;  4CZ2 D;  1FPP A;  4Q96 A;  4GZD A;  5DIZ A;  5EIL A;  5B3S E;  1A17 A;  4JL0 A;  4F6R D;  3SBT B;  4A55 A;  3C3Q A;  1OUV A;  1IXV A;  4A3V A;  3ZVV A;  3FU3 A;  5ENT D;  5EIB E;  2IY0 C;  3FUD A;  2WXF A;  3UM3 A;  3ULE G;  3Q15 A;  1QNF A;  2R5S A;  2EIM E;  3D9L A;  3CIA A;  3CVQ A;  3ZW3 A;  2X6H A;  4HRN A;  4YDW A;  3G2S A;  3PNT B;  3RRM B;  3URZ A;  2GGF A;  3LJN A;  4N3C A;  4XI0 A;  3EHN A;  3R9M A;  2XEV A;  1MQS A;  1OCR E;  4GZ3 A;  1QYM A;  3L82 A;  2X6I A;  3FH5 A;  4F7A A;  4BT9 A;  5D66 A;  2XPI A;  4L23 A;  2HO1 A;  2RD0 A;  1SA5 A;  5BUZ A;  2L0I A;  3T5X A;  2R03 A;  1FT2 A;  3T8K A;  2LUH A;  1N4P A;  4I9E A;  1ELW A;  4UWH A;  1MYO A;  1PY1 A;  3FEY A;  3FU6 A;  3KSL A;  5AIJ A;  4GYW A;  1PAQ A;  4ILG A;  4RLY A;  1TJF A;  1BPO A;  4ACL A;  3FUL A;  4NQ0 A;  5KBA A;  4G25 A;  2IQC A;  2BED A;  4J8F A;  3MYV A;  3Q47 B;  1TNZ A;  3QWP A;  4DRX E;  5J90 A;  4CYM D;  3EUV A;  1S0P A;  4GTO A;  3D9O A;  5ARF A;  5HS0 A;  4PDX A;  3GZ2 A;  1KZO A;  4MRU A;  1E8Y A;  5AYW D;  4C0M A;  3JUI A;  4U0U A;  5CRV A;  4GCO A;  2BKK B;  3UKR G;  5J08 A;  2CHZ A;  2J07 A;  3ZHE B;  5KJM A;  1Z3X A;  1OY3 D;  3PE3 A;  4KT6 B;  3R7R A;  3KEZ A;  2ETA A;  2DIW A;  3FH7 A;  3KAE A;  5G2N A;  4B93 B;  1BU9 A;  1H2U A;  3DSS A;  3DSX A;  3JQ0 A;  2OOE A;  4ILI A;  5KJN A;  1LTX A;  1INZ A;  2DWZ A;  4V3I A;  3TXN A;  4GZ5 A;  3S2A A;  4AVX A;  1OCZ E;  4UI9 C;  5H7P A;  4J6I A;  3TXM A;  1H19 A;  3D9H A;  3CVP A;  4BEP A;  2X38 A;  3GYZ A;  4AIF A;  4HVB A;  2IO2 C;  1KT1 A;  3ZPJ A;  3PS6 A;  4AJW A;  1E8Z A;  2WXJ A;  5ITZ F;  3VLD A;  4B0Z A;  3MZL B;  4AM9 A;  3U66 A;  3HXD A;  1O1R A;  2NXP A;  3PZ3 A;  3S7B A;  4URK A;  2NC9 A;  3L54 A;  4B8C B;  4F3V A;  4JHJ A;  2YHC A;  3Q7F A;  4LSZ E;  4N2Q A;  4GU5 A;  5AAO A;  4KYO B;  3QDN A;  3FUH A;  2XGS A;  4HOU A;  1BD8 A;  5FZR A;  3RK6 A;  2WXL A;  4L2Y A;  1FVF A;  3ML8 A;  1Q2Z A;  1NP7 A;  1IYG A;  3DST A;  1D8D A;  2HYZ A;  4FJY A;  3SO8 A;  3EDT B;  2AXV A;  3J5P A;  4YDE A;  3B7R L;  1N11 A;  1HH8 A;  1NL4 A;  2PQR A;  4UQZ A;  4YVQ C;  3HXE A;  4OYS A;  1TNY A;  4J0U A;  3PH0 C;  3ASF A;  4K5A B;  3CLJ A;  2DYR E;  1H0A A;  4L7T A;  5AJL A;  1NZN A;  1BLX B;  4RG6 A;  2J9Q A;  2I9C A;  5HRY A;  1TNO A;  2IFU A;  4AV7 A;  2AJA A;  2H6H A;  2L6J A;  3WG7 E;  1D8E A;  5JMN D;  5A7D B;  3VTX A;  4GA1 A;  4BT8 A;  1MX4 A;  1E8X A;  4N5C A;  2V0P A;  2H6G A;  2VGY A;  1K8K G;  3AG4 E;  4UQY A;  4APF A;  3IHY A;  3ZRH A;  2QYJ A;  4TXR A;  4FJZ A;  2GRL A;  3DRA A;  5B1B E;  3PUK A;  1KZP A;  4FC8 A;  4GTS A;  1L5J A;  4LNB A;  4A1G A;  5EDS A;  3NOG D;  3E4B A;  2ZIR A;  3LCA A;  3U64 A;  2BTD A;  4GTP A;  5ANR A;  4AY6 A;  4XZ4 A;  4I6E A;  1D9S A;  4EHM A;  4OVV A;  4O60 A;  1JUQ A;  4U0S A;  1LD8 A;  4RSY A;  4JEU A;  4I1M A;  4WWN A;  3LS8 A;  2J49 A;  4U8H A;  3KD7 A;  3ZNG A;  3EU9 A;  4C48 B;  5EKQ D;  1MX2 A;  3MJW A;  5BXU A;  3PE4 A;  3UT8 A;  1OWN A;  3FY4 A;  4JB8 P;  3RJV A;  4F1S A;  1YA0 A;  3ONL A;  3LY7 A;  3SZ7 A;  5CEA A;  5FQ4 A;  3LY8 A;  5FTP A;  4HOT A;  3FUF A;  4I17 A;  4CRW A;  4XE0 A;  4TRQ A;  3SGH A;  1EDU A;  3RO3 A;  1X81 A;  4PUC A;  1UG3 A;  2WQ7 A;  4GA0 A;  4BX9 A;  4KMO A;  3VLF A;  5FIO A;  5T3R A;  3UM1 A;  2X6J A;  5JHB A;  4X8Q A;  3QWW A;  3HXC A;  3FEX A;  4WNG A;  4NUR A;  2OCC E;  4GYO A;  3F6Q A;  4B8A A;  1IKN D;  3EHQ A;  3ZXS A;  2AWI A;  3OAW A;  2QY7 A;  5CCL A;  5JJT A;  5FZS A;  2KAT A;  4U0Z A;  5B1A E;  5CER B;  4FUL A;  5BXO A;  4BTB A;  1E7V A;  3AG2 E;  3D9K A;  4ANW A;  3DSU A;  4Y6C A;  4GPK A;  2DZO A;  2FI7 A;  3JUE A;  2XHE A;  5HKP A;  2AXZ A;  4GAA A;  4C0E A;  3NF1 A;  5A23 A;  1HF8 A;  3NAW A;  3RSE G;  5FIN A;  3JXI A;  1HXI A;  4I2Z A;  3DXM G;  1HX8 A;  4AY5 A;  3PNL B;  1LF8 A;  2R17 C;  3JYS A; 
#chains in the Genus database with same CATH homology
 1XGW A;  3SBS A;  4J8F A;  4L1B A;  2KCK A;  3NZS A;  3MYV A;  3Q47 B;  3QWP A;  1HG2 A;  3ZYQ A;  1E7U A;  4FHK A;  3FTZ A;  2GW1 A;  5J90 A;  2WXO A;  2A4Z A;  5T8I A;  1VDY A;  3CHS A;  1S0P A;  2KCL A;  3CHR A;  2V8S E;  3D9O A;  5ARF A;  2E2E A;  2YQ8 A;  4PDX A;  2KZT B;  2QFC A;  3GZ2 A;  5LP0 A;  4PS7 A;  3PRE A;  4MRU A;  3N71 A;  5HQ8 A;  2I6H A;  3GZS A;  1E8Y A;  5EX0 A;  5AYW D;  2BUG A;  4C0M A;  2XGO A;  3JUI A;  4U0U A;  3ZEF A;  4WNF A;  5A6C A;  4HOS A;  1H2T C;  4GCO A;  4CGW A;  4XI9 A;  2XRZ A;  1E90 A;  5J08 A;  2LSV A;  2CHZ A;  4CDM A;  3ASD A;  2J07 A;  2WXK A;  3ZHE B;  2PQN A;  1WAO 1;  2C2L A;  1WY6 A;  1GW6 A;  3B13 A;  4EEC A;  4EBA A;  1Z3X A;  3S7J A;  5KJM A;  5BV1 A;  3PE3 A;  2PZI A;  3CGH A;  4G23 A;  4GMJ A;  4DLQ A;  2C0L A;  3NQP A;  2YHE A;  2VGX B;  4A3T A;  4KT6 B;  3L17 A;  3QK0 A;  1E8W A;  5G04 J;  3DPD A;  3R7R A;  3FTX A;  3CQC B;  5FQ8 A;  3UT7 A;  1ELR A;  3KEZ A;  5HI7 A;  4G2V A;  2I1J A;  3LKU A;  2DIW A;  3FH7 A;  3KAE A;  3QB2 A;  5G2N A;  4GML A;  3TL5 A;  4BWR A;  4JW1 A;  2UY1 B;  1H2U A;  2PL2 A;  4LER A;  5LFA A;  1W3B A;  3OXL A;  3ULQ A;  3ESL A;  3FWV A;  3ZIM A;  3MCX A;  3JQ0 A;  2OOE A;  2WMO A;  3MKR A;  4PS3 A;  3FUJ A;  4ME2 A;  4ILI A;  5KJN A;  4FU3 A;  1INZ A;  3IBE A;  3FUI A;  3TG4 A;  4V3I A;  3TXN A;  3D9I A;  1IHG A;  3HVE B;  4GZ5 A;  4KZ0 A;  4O6F A;  3S7F A;  3S2A A;  1DNP A;  4AVX A;  3MGB A;  3RKV A;  2PM7 A;  4UI9 C;  4J6I A;  3TXM A;  1H19 A;  3CVP A;  5AJD A;  5LX8 A;  1ELK A;  4LRZ A;  4G25 A;  2X38 A;  3GYZ A;  3CV0 A;  4AIF A;  3CVX A;  1KT0 A;  4HVB A;  1U3C A;  4BFR A;  3UX4 A;  1KT1 A;  3C98 A;  3ZPJ A;  2CHW A;  3PS6 A;  4AJW A;  3FUE A;  2IJG X;  3MKQ A;  1E8Z A;  3Q4A B;  3QKY A;  3I3N A;  2WXJ A;  4N3A A;  3AU5 A;  4MLP A;  1TEZ A;  3APC A;  3VLD A;  2XGM A;  4B0Z A;  3FDH A;  2WXH A;  3MZL B;  4HXI A;  4AM9 A;  5KJL A;  4APO A;  2OVF A;  4E6H A;  3U66 A;  4G1T A;  3CHM A;  4DI3 A;  2V4L A;  4H7X A;  4CEM A;  3QNK A;  4WWO A;  1TJC A;  4KBQ A;  3LJ3 A;  4N39 A;  2VYI A;  2LAH A;  4EZL A;  3B7U X;  4G24 A;  2A5U A;  2WMN A;  3FTY A;  3PUJ A;  4MS6 A;  2KC7 A;  3QC1 A;  3FTU A;  2NXP A;  4XKC A;  4RVB A;  3SNX A;  3SD5 A;  4FA6 A;  3S7B A;  4URK A;  5ENN A;  4ANX A;  2NC9 A;  2IF4 A;  3BEE A;  4KVM A;  3L54 A;  2DBA A;  1IQU A;  3I5P A;  3QOU A;  5FQ6 A;  3LEW A;  2WXP A;  4FLB A;  1MHQ A;  4B8C B;  5FT9 A;  4F3V A;  3LPZ A;  3U4T A;  4JHJ A;  2UWJ G;  4EZK A;  2YHC A;  3PVL A;  1SQM A;  3GZ1 A;  4TUU A;  3QJZ A;  4N2Q A;  3UQ3 A;  3UMV A;  5T4Y A;  4KZC A;  4GU5 A;  4JHR A;  4I1O B;  4LCT A;  1B89 A;  2AXU A;  2J08 A;  3CST A;  4GCN A;  4KXK B;  4BX8 A;  4E85 A;  2OVB A;  3MEK A;  3QDN A;  4KYO B;  4UWG A;  3FUH A;  4QFV A;  2P58 C;  2M63 A;  5ANL A;  3K9I A;  2XGS A;  4BSX A;  4ATG A;  4BTA A;  1UJJ A;  2CFZ A;  4HOU A;  4I6G A;  4U04 A;  5FZR A;  4HOR A;  2R59 A;  3FUN A;  3LY9 A;  5DBK A;  3RK6 A;  2WXL A;  3ASG A;  4L2Y A;  2XPY A;  1FVF A;  3ML8 A;  4GYY A;  1Y8M A;  4I6J A;  4CT4 A;  4JVS A;  3L08 A;  1ZBP A;  3P2B A;  3TJP A;  3O4Z A;  2WB2 A;  1NP7 A;  1HFA A;  1JPL A;  2FUL A;  3L16 A;  3ZYL A;  5M72 A;  1IYG A;  3FTW A;  3ZFW A;  1QQE A;  2MHK A;  4I43 A;  2LSU A;  2WXI A;  3LXU X;  4C9B B;  5JHA A;  2HYZ A;  2J4D A;  3PEU B;  4FJY A;  1EF1 C;  3EDT B;  4JC8 A;  3FFL A;  4GZ6 A;  4IN3 B;  3BG1 B;  2AXV A;  3B7S A;  2DCP A;  3FUM A;  5E75 A;  4TV3 A;  3DBS A;  3AS5 A;  1OWM A;  2BF0 X;  4WAF A;  4ANV A;  2LO6 A;  3APD A;  3RIB A;  4JZY A;  3B7R L;  1OWP A;  1HH8 A;  2FF4 A;  4FP7 A;  2YIN A;  3CHP A;  2PQR A;  4UQZ A;  4U63 A;  3CVU A;  3CHO A;  4H7Y A;  4YVQ C;  4N2S A;  3ASH A;  3TGO A;  4OYS A;  5AEN A;  4J0U A;  4EPZ A;  3CR3 A;  3PH0 C;  3ML9 A;  3ASF A;  2VTB B;  3VLE A;  3CLJ A;  3O48 A;  3CVL A;  5JJ6 A;  5KCM A;  1H0A A;  2GRM A;  2Y4T A;  3CK7 A;  4L7T A;  4WND A;  1IQR A;  3PZD A;  5AJL A;  2WQ6 A;  1KLX A;  4ANU A;  3FU0 A;  4JEH A;  1NZN A;  3D9J A;  2JLB A;  4BY6 A;  3L22 A;  1JWF A;  4RG6 A;  3EHM A;  2J9Q A;  3FP3 A;  3RO2 A;  4GA2 A;  2I9C A;  4PS8 A;  4W9R A;  1UN8 A;  5LCW C;  3EIQ C;  3G2W A;  3I4G A;  4MKT A;  2IFU A;  4XIF A;  1UW4 B;  3CKB A;  3TAX A;  4AV7 A;  2VSX E;  2L6J A;  2I2O A;  4EZJ A;  4A1S A;  3UT4 A;  5FQ7 A;  2WXR A;  4HFG A;  5ARG A;  4HS2 A;  4EBA G;  3IEG A;  5A7D B;  3VTX A;  4GA1 A;  1SZ9 A;  4FLH A;  4BT8 A;  4N5C A;  1E8X A;  4CT0 A;  2V0P A;  4G11 A;  2L9B A;  3ESK A;  3L6A A;  4EQF A;  3SHF A;  2KM4 A;  2VGY A;  3G2V A;  3LVR E;  4J8S A;  1NA3 A;  4AOF A;  3ENE A;  4UQY A;  4APF A;  2XCC A;  3EJN A;  1OWO A;  4CCA A;  4CGV A;  2KZT A;  3IHY A;  3ZRH A;  4FHJ A;  3EIJ A;  5FWQ A;  2RG8 A;  3G2U A;  4FJZ A;  3CSF A;  2Q7F A;  4K0R A;  4R7L A;  5CCM A;  3IV0 A;  4F53 A;  3IHV A;  2WXG A;  2Y3A A;  4JXT A;  3B7T A;  3R9A B;  4B94 A;  2GRL A;  3AS8 A;  2AW6 A;  4CDR A;  2WPV A;  4UQX A;  1H2V C;  2WXM A;  3L13 A;  3BG0 B;  2NSZ A;  3CKC A;  3PUK A;  4PH4 B;  4AEZ C;  4FC8 A;  3ZHE A;  1L5J A;  3ZN3 A;  4A1G A;  5EDS A;  3QAR A;  3VTY A;  3E4B A;  3LCA A;  3U64 A;  3PDN A;  1P5Q A;  1Y6I A;  2EQX A;  4DK5 A;  2VQ2 A;  4CDN A;  3I4R B;  2WQH A;  3MA5 A;  2VGX A;  5CHE E;  2BTD A;  2IOS A;  5D0Q D;  1HS6 A;  1UN9 A;  1DVP A;  2XCB A;  5ANR A;  5BW8 C;  3ZYK A;  3LVQ E;  4XZ4 A;  4AY6 A;  1NA0 A;  3QWV A;  4ACK A;  1JWG A;  4I6E A;  4YND A;  1HO8 A;  2YNQ A;  4OVV A;  2V5F A;  3CVN A;  3HIZ A;  3ZGQ A;  2I1K A;  4WWP A;  3HYM B;  3QAQ A;  1H6K A;  3LDZ A;  4UI9 J;  4Y6W A;  2UY1 A;  4J8E A;  2HM8 A;  3Q5M A;  3AS4 A;  1JUQ A;  3OXG A;  2J4B A;  4U0S A;  5FZQ A;  3RRU A;  5BNW A;  2CG3 A;  3UPV A;  4RSY A;  4JEU A;  5JJ7 A;  3FUK A;  1HE8 A;  4I1M A;  4P29 A;  4WWN A;  1PC2 A;  5BV0 A;  2L0T B;  1OWL A;  3OXF A;  4Q94 A;  4WNE A;  4UWL A;  3LS8 A;  3D9N A;  1EYH A;  3HVE A;  5G04 C;  5D0O D;  5LOZ A;  2FEZ A;  2J49 A;  3FHE A;  3IKO B;  3KD7 A;  4U8H A;  3WXX A;  1XNF A;  3APF A;  4UWK A;  2PM6 A;  5EKQ D;  3SF4 A;  4Q69 A;  2MRI A;  3PRZ A;  1EPU A;  3AU4 A;  5E76 A;  3MJW A;  3PE4 A;  3GW4 A;  3MX3 A;  1X5B A;  4DPR A;  2XPZ A;  3UT8 A;  1OWN A;  3FY4 A;  4UWF A;  3LYA A;  3FTV A;  1QZ2 A;  3RJV A;  4DJA A;  4F1S A;  1YA0 A;  4LEU A;  3ONL A;  3MKQ B;  3UUX A;  1SZA A;  1WM5 A;  2J09 A;  2VJ8 A;  5C1D A;  3LY7 A;  4JA9 A;  2X6F A;  1HU3 A;  4JA7 A;  5BPP A;  3ZYM A;  3R7Q A;  1N52 A;  3SZ7 A;  4B89 A;  5FQ4 A;  3LY8 A;  5FTP A;  4D10 C;  3FH8 A;  2KCV A;  5G05 J;  4HOT A;  3FUF A;  3FU5 A;  3ONK A;  2XQ0 A;  1HG5 A;  4I17 A;  4AXH A;  4J8D A;  2LNI A;  4CRW A;  3CK8 A;  2WVI A;  4XE0 A;  4Q96 A;  1E96 B;  4TRQ A;  4GZD A;  5DIZ A;  1A17 A;  4M3O A;  4JL0 A;  4G26 A;  5BT1 A;  3SGH A;  1EDU A;  3HDX A;  3RO3 A;  2HR2 A;  3SBT B;  4PUC A;  4HOQ A;  4A55 A;  3FTS A;  3KS2 A;  1OUV A;  1UG3 A;  4A3V A;  3ZVV A;  2IOL A;  2WQ7 A;  3P1U A;  4GA0 A;  3FU3 A;  2X3M A;  2CHX A;  4ILH B;  4K03 A;  4BX9 A;  4KMO A;  3RU0 A;  3VLF A;  2OV8 A;  3U3W A;  3CVY A;  5T3R A;  3FUD A;  2X6J A;  2Y4U A;  1U3D A;  2E0I A;  3CVV A;  5JHB A;  2WXF A;  3NZU A;  3G2T A;  3SI5 A;  3Q15 A;  1QNF A;  2R5S A;  3QWW A;  4IRU A;  3D9L A;  3FEX A;  4LUN U;  3CIA A;  4NUR A;  4WNG A;  3CVQ A;  2ZU6 B;  2X6K A;  4UI9 K;  4WUY A;  3ZW3 A;  2X6H A;  4GYO A;  5CMY A;  2WM9 A;  4B8A A;  4U07 A;  3G2S A;  3PNT B;  1UJK A;  1FCH A;  3OTN A;  1HZ4 A;  4I1A A;  3ZXS A;  3RRM B;  3URZ A;  3T8M A;  2GGF A;  2AWI A;  3OAW A;  5G55 A;  2QY7 A;  4N3C A;  3PEV B;  4RG9 A;  4XI0 A;  2XRY A;  3EHN A;  5CCL A;  3CEQ A;  5JJT A;  5FZS A;  2KAT A;  4U0Z A;  3HHM A;  4FUL A;  2XEV A;  1MQS A;  1ZU2 A;  1E7V A;  4GZC A;  4BTB A;  3D3M A;  2VSY A;  2WXN A;  4GZ3 A;  2IU1 A;  3D9M A;  2X6I A;  3D9P A;  3MV3 B;  3FH5 A;  2AVP A;  3CQG B;  4ABN A;  4F7A A;  4BT9 A;  3D9K A;  2XPI A;  4JHK A;  2FO7 A;  4ANW A;  4L23 A;  2HO1 A;  4AP2 A;  5KJK A;  2RD0 A;  2MOW A;  4Y6C A;  4FAD A;  5BUZ A;  4GPK A;  2CFU A;  4OVU A;  2FI7 A;  2L0I A;  2LAI A;  4L2L A;  1Z3Y A;  2XHE A;  4NRH B;  3T5X A;  5C2Y A;  5LCW J;  3CVW A;  4XKB A;  4IYP A;  4N3B A;  1FVH A;  2VTB A;  4I9C A;  2ILR A;  4I2W A;  4DI4 A;  2AXZ A;  4GAA A;  5CMW A;  3CHQ A;  3RRN B;  4C0E A;  2OND A;  3NF1 A;  4HLE A;  3JCK C;  3U9W A;  2FBN A;  4I9E A;  5A23 A;  1ELW A;  1HF8 A;  4UWH A;  4IUL A;  2ION A;  3TG5 A;  1PY1 A;  2CG2 A;  3T5V A;  4NAC A;  3FEY A;  3FU6 A;  5G05 C;  2C0M A;  4KVO A;  5AIJ A;  5FJY A;  4GYW A;  3S7D A;  1HXI A;  3Q49 B;  4I2Z A;  2VSN A;  5EX3 A;  1PAQ A;  4ILG A;  4JPS A;  2VSO E;  1HX8 A;  1BPO A;  1TJF A;  3JQ1 A;  4XX5 A;  3MV2 B;  4ACL A;  4AY5 A;  3FUL A;  1Z6T A;  1LF8 A;  2JEK A;  2R17 C;  2WXQ A;  3JYS A;  3PNL B;  4GB9 A;  4NQ0 A;  4YVO A;  3SFZ A;  2IQC A;  3CK9 A;  1N54 A;  4DLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...