1ELKA

Vhs domain of tom1 protein from h. sapiens
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
b'SDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TARGET OF MYB1
publication title Structure of the VHS domain of human Tom1 (target of myb 1): insights into interactions with proteins and membranes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 57
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elkA00
1JUQA 1SZ9A 2L0TB 3CLJA 4FU3A 4JXTA 4Q94A 1HG5A 3ZYKA 2MOWA 1EDUA 1HF8A 1HX8A 1UJKA 2LO6A 3D9OA 3G2WA 3G2SA 4GZDA 5LOZA 3ZYMA 2L0IA 1PY1A 1INZA 3D9NA 2KM4A 2DIWA 1HFAA 5CMWA 1XGWA 4AVXA 1X5BA 1VDYA 3LDZA 1MHQA 1SZAA 2BF0X 2V8SE 3D9LA 5CMYA 4GZCA 4Q96A 3D9PA 1JPLA 1LF8A 1DVPA 3D9IA 3G2UA 3G2VA 3ONLA 2QY7A 3ZYQA 5LP0A 4HFGA 1EYHA 4NACA 3D9MA 3ONKA 1UJJA 1ELKA 3D9JA 3G2TA 5J08A 2DCPA 1H0AA 3D9KA 4FLBA 3RRUA 1HG2A 1JWFA 3ZYLA 1JWGA
chains in the Genus database with same CATH superfamily
4U07A 3ABKE 5HQ8A 3C3QA 2CHZA 4NIKA 1KPSB 1K8KG 4G11A 2ETBA 3TWQA 4AV7A 3ULQA 1OCOE 3FUHA 3L13A 3Q9UC 3SF4A 2P9PG 3GZSA 3EHMA 4JD2G 5B1AE 4G8LA 3EDTB 3LY8A 2WMOA 4GZ5A 3AG2E 4RQIA 1E8YA 1K3ZD 2WXRA 2HO1A 3RIBA 3UM2A 1N52A 3LEWA 2CFUA 4O1OA 4GMRA 1Z3XA 3ISMC 3Q7AA 4IYPA 2XRZA 2KATA 4I2WA 5ITZF 4BESA 4HFGA 3SBSA 3PRZA 3T5XA 1IYGA 1V54E 1X81A 2EILE 3FUNA 3NOCD 3G2SA 1LD7A 2OVBA 3CVVA 1OCCE 1Y6IA 3CQCB 3G2VA 1H6OA 4I6EA 5JMND 5G2NA 1EYHA 2PM7A 2ZXWE 4APOA 2P2CP 1TNBA 5EX0A 3ZXSA 5EIBE 4GMJA 2L9BA 4KVMA 2FEZA 3LJ3A 2L6JA 1UN8A 2CHXA 4BSZB 3UIPC 4J8YA 3RU0A 5EYPF 3FTWA 4P29A 3IV0A 2J07A 4GZCA 1YYHA 2Q7FA 2ILRA 2LAHA 3APFA 4GYOA 4CGWA 4H7XA 4BEPA 2VGXA 3OXLA 4ANVA 4U0SA 2KCLA 1Q2ZA 3FUMA 3PUKA 3O48A 2OOEA 1BI7B 2XENA 4GCNA 4TV3A 4GU5A 5CEDB 3CHMA 4XEIG 4ANWA 1SA4A 2DZOA 3ZVVA 3EIJA 3IHVA 4OVUA 4IRUA 2RKKA 3CR3A 3R9AB 3UTMA 2KXPC 4A3VA 4HXIA 5E76A 3SZ7A 3IHYA 2KM4A 3MKQB 4RG9A 4LERA 3CVYA 2WXOA 3BEEA 2HE0A 1HXIA 2WXJA 1HG2A 4I9EA 3SFYA 2P9UG 4QFVA 1TN7A 2DZNA 5JHBA 1N4PA 1O5MA 2ETAA 3FUKA 3TWTA 3EU5A 3OAWA 4GPMA 1UJJA 1SW6A 2R2LA 2PNNA 2XHEA 4C9BB 2LUHA 4A63B 2V5FA 4HBDA 2X6JA 1XNFA 3TWRA 4M7CA 4F1SA 3JUIA 1IQRA 3JUEA 4I1AA 1MJ0A 3CIAA 4HB5A 3C98A 3LYAA 4JHJA 2XCBA 2KCKA 4IULA 4EZKA 4JPSA 2IEJA 1XGWA 3U3WA 3LDZA 1WY6A 3CEQA 2C0MA 3C3OA 3QC1A 4GTOA 4AIFA 5A7DB 3CHQA 4IN3B 4HRNA 2X6HA 4B94A 3V79K 3B7SA 4HNAD 3ZN3A 4L7TA 4DX1A 3ASHA 1KZOA 4U63A 4Q96A 3CHRA 5LP0A 1D8DA 3LY7A 2R03A 3ULEG 1ELKA 2V4HC 5J90A 4FLBA 3Q9NC 2JABA 1KLXA 1TN8A 3B7TA 5FJYA 3E30A 2WXQA 4BX9A 4DPRA 4HOSA 1E96B 3Q5MA 1OXJA 4HLEA 1A5EA 3MKRA 5BNWA 4YDOA 4A1GA 4OVVA 3LVQE 2PL2A 1KZPA 3DXKG 1SA5A 2A5EA 4J7WA 3W9GA 2KCVA 1PC2A 1UOHA 1HFAA 4TXRA 5AQAA 3ZXPA 3MYVA 4FHJA 2JEKA 1S0PA 2MRIA 1DC2A 4ME2A 4TXQA 3P2BA 1U3CA 1N54A 4HS2A 2BTDA 3FUEA 4GA2A 4DX7D 5DBKA 4G1TA 4QQIA 1ZB1A 2NXPA 3SFXA 3F6QA 2XEHA 4JC8A 1DVPA 5LFAA 4XX5A 2VTBB 4WNGA 4K5BA 2XZTG 4B0ZA 4CDRA 3LPZA 3RKVA 4YDYA 1H2UA 2WXHA 3UINC 2BKGA 1FVHA 5ANLA 3FFLA 2VYIA 4MLPA 3VLEA 4HI8A 3S2AA 2H6IA 4DK5A 2PQRA 3PZ3A 4KXKB 3D3MA 1A17A 1DCEA 4JZYA 3SHFA 3D9KA 3E33A 3DSSA 1JUQA 3SY2A 4HOTA 1WDYA 1HG5A 4DX2A 2DIWA 4J8EA 2WVIA 4HI9A 4G26A 5A6CA 3GW4A 4O60A 5KNGA 3FTZA 3ASDA 4JXTA 4F53A 3GZ1A 5FZSA 4RG6A 3KSQA 5G04C 3FWVA 3CKBA 3PDNA 4R7LA 2RFAA 4DRXE 2VGEA 4LNBA 4GTTA 1OY3D 3PS6A 4PH4B 4B93B 3PEUB 1GW6A 3L08A 3TWVA 2LSVA 2WXGA 3BG0B 2RD0A 5G05C 2DWZA 3AU4A 4DI4A 2BEDA 5AARA 3R9MA 1JWGA 1SVXA 4WWNA 4XZ4A 2YHEA 2FO1E 2GRNB 3FHEA 3PNTB 5AN8A 3PZ4A 2BF0X 3AS5A 3CSTA 3NBNB 4KZ0A 2VJ8A 3HXDA 5CECB 2I1JA 3DSUA 2L0TB 3AAAC 3MKQA 3CQGB 1AWCB 2XCCA 2OCCE 3SD5A 2X6IA 3VLDA 2M63A 1N4SA 1X5BA 2XPZA 2IO2C 4U95D 2KC7A 3QARA 4J8SA 3AS8A 4FHKA 3TL5A 2E0IA 4GA1A 3ZHEB 5ANRA 5AQ9A 3CVLA 5EYLA 5ENNA 4LEUA 4N3AA 2AVPA 1EDUA 2X3MA 3SNXA 4UWFA 2XGMA 4ANUA 3HXBA 4L2YA 4HRMB 2DBAA 3V2XA 2J49A 2B0OE 4FP7A 3KD7A 4G24A 2FULA 3DSXA 5LX8A 4ABNA 5JJ7A 3FUFA 2AW6A 4FLHA 4LCTA 5KJMA 4XKBA 3TAXA 2FBNA 3RO2A 3VLFA 4BX8A 3Q15A 3PH0C 1Z5SC 4MS6A 2P9IG 4XI0A 1DNPA 3L82A 4WNEA 5BV1A 5B3SE 3HRAA 5C1DA 5CCMA 2WXNA 1PY1A 4DJAA 1VDYA 1FT1A 4ZHBA 4RLYA 4AY6A 4OAVB 5BPPA 3ML9A 3T5VA 1K1AA 3C72A 3LVRE 3WG7E 2WB2A 4U7EB 4L2LA 1E90A 4GB9A 4JHRA 5CHEE 4K0RA 2YHCA 3T8KA 3ESLA 3T8MA 3FU0A 3DEOA 2CG2A 5IY5E 2I9CA 3B7RL 4N5CA 2Y0BG 5EDSA 2B6CA 2XZDG 4C0EA 3HG0D 1S63A 2GRPB 3QB2A 1MYOA 3N71A 3EUVA 4L9PA 3J5PA 3PZDA 4B8AA 3TXMA 3UKUG 1N94A 5AJLA 1Z3YA 2LXMA 1MX6A 3QOUA 2GROB 3UT4A 1FVFA 2YQ8A 3ML8A 5JA4D 4BSXA 4WWOA 1TYQG 4AVXA 5AYWD 2P9KG 3NQPA 1OCZE 5JJTA 1H6PA 4EECA 4X8QA 2OV8A 5EIDA 4F3VA 3V2OA 2J4DA 5CBOA 4FADA 2VSNA 1H0AA 2R05A 3Q79A 3FTYA 4JHKA 3FTVA 3B7UX 3U64A 4GZ6A 3L22A 4H7YA 2PZIA 2P9NG 4CEMA 1S64A 4YDWA 4ACLA 4Y6WA 3OTNA 4EZJA 3FH5A 2EIME 1NFIE 3RO3A 3EIQC 2VTBA 3D9JA 3AG4E 3FEYA 3B7BA 4J0UA 4A3TA 2XS1A 4GZ3A 4Z68A 3CVUA 4XE0A 2J9QA 2F37A 2E2EA 1D9SA 1TN6A 3DRAA 1NI1A 4O6FA 4WNDA 3FUDA 4ANXA 3S7JA 1BI8B 2IFUA 2ZGDA 3CV0A 3DWLG 2KBXA 3VTYA 3L17A 5ENRD 1U3DA 2EIKE 2LXLA 2WMNA 4JVSA 3D9IA 3ONLA 3I4GA 1OT8A 2FF4A 2GRMA 3I4RB 5E75A 1H2TC 3ASGA 1NL4A 1QYMA 4GTRA 3ZIMA 3E4BA 4N3BA 3CVWA 5FQ4A 4GCOA 3T9KA 3CKCA 4GTSA 4BWRA 2WQ6A 2DVWA 4ILGA 4F1PA 5BUZA 5CRVA 4BT8A 5HS0A 3S7DA 4UI9C 3UM3A 4ATGA 4NRHB 4ILHB 2XPIA 4CRWA 4GA0A 2AJAA 2WQ7A 3G2UA 5FTPA 2NYJA 3TG4A 4U8VD 1PAQA 2XRYA 3SGHA 2KZTB 4CZ2D 3MV2B 3FUJA 3UKRG 3PE4A 4N5QA 3L16A 1TNZA 5FWQA 3HVEB 3J5QB 4FULA 3AG1E 4DI3A 1U2VG 5ENTD 3UI2A 3URZA 3IXEA 1E8XA 3ZPJA 4DX6D 2IQCA 2H6GA 1JWFA 3C3RA 1HZ4A 2VQ2A 3GYZA 4YDEA 2PM6A 5AENA 4GYYA 1Z6TA 1N4QA 1E8ZA 5AQBA 1JCQA 5FT9A 1HF8A 4UQYA 5HRYA 5HKPA 1AP7A 3AU5A 4UQXA 1E8WA 3ZHEA 3ZGQA 3PZ1A 5JHAA 1NA0A 3ABME 3ZYLA 1B89A 3FH7A 3O4ZA 4XIFA 3S7FA 1TR4A 1IHBA 2EQXA 1JCSA 4DX5D 2MHKA 4U8HA 2UWJG 3SFZA 3CHSA 5AAOA 3FP3A 3D9HA 3NZUA 3D9MA 3UT7A 2QFCA 3CK7A 1WAO1 2GRQB 2P58C 1YCSB 2IU1A 1QNFA 1E7UA 5LCWJ 1HS6A 5D2MC 4CT4A 3D9OA 3EHRA 4JW1A 3BU8A 1NA3A 5CMYA 1UG3A 2IY0C 1IHGA 2DYRE 1LTXA 4UUCA 3TWWA 2P9LG 3UM0A 2J08A 3JXIA 4TXPA 1NP7A 4K03A 1HX8A 4NURA 1MX4A 3LJNA 3L6AA 3UM1A 5CMWA 3EJNA 5G55A 4KZCA 3D9LA 3U4TA 2I2OA 2EINE 2AXZA 4TUUA 5T3RA 3V30A 1N9AA 1KT0A 2LO6A 2QYJA 3R7QA 4GZDA 1FT2A 5BW8C 2FI7A 4UQZA 4K5AB 4JEUA 1Y8MA 4B8CB 3U66A 1MZCA 2CFZA 3MZLB 2Y69E 2LNIA 4CT0A 3HYMB 3LS8A 5T8IA 1K1BA 1NZNA 1N0QA 3CK9A 4F6RD 3HXCA 2HYZA 3D9NA 3CK8A 4WWPA 4L23A 4MKTA 3FULA 4HVBA 3RRNB 2QC9A 3FDHA 1MX2A 1UW4B 3QDNA 4JA9A 5M72A 4O1PA 1IXVA 5KJKA 3APDA 4E6HA 5HI7A 4U0UA 3EHQA 5KJLA 3GZ2A 1H6KA 3LXUX 4OYSA 2XPYA 5KNHD 4C0MA 2QYUA 1TNYA 5A23A 1UJKA 4XKCA 3ZYMA 2P9SG 4LUNU 4APFA 4K5CA 2V5QC 1TNUA 1WM5A 4RVBA 1O1TA 4N2QA 4N2SA 4JEHA 4ACKA 4AJWA 4HLLA 5FQ8A 1SZ9A 2R5SA 3BQOA 3KS2A 2J8SD 2L6BA 3MCXA 3Q7FA 5KWDA 3AJIA 2WXFA 3KSLA 5FINA 4EBAG 3UMVA 2XQ0A 1HU3A 3I5PA 4D10C 4I6JA 2XGOA 4DLQA 2VSOE 4UWHA 4JB8P 2DYSE 2I1KA 3Q75A 3LCAA 2XEEA 3C5RA 2BKKB 2I6HA 4BY6A 4HRLA 5C2YA 2UY1B 4XI9A 4AM9A 4FA6A 2OVFA 2C2LA 3E34A 3DBSA 3L9TA 3HXEA 3EU9A 1L5JA 4GYWA 5BXOA 4ILIA 3PE3A 2QY7A 3TWXA 3PREA 2IONA 3ASOE 2CHWA 4YNDA 3TWSA 4FU3A 4UWKA 4DUIA 3OXGA 3ZYKA 2LAIA 2GW1A 2OEWA 3MGBA 3OXFA 4AEZC 5FQ6A 2V8SE 3RRMB 1EF1C 3BUAA 2KZTA 5ENSD 1HO8A 4AOFA 3E37A 4J8FA 3WXXA 5EN5D 3JXJA 4BFRA 1RW2A 1RZ4A 4YVQC 3HVEA 3MV3B 3DSVA 4CGVA 3APCA 4WUYA 4AY5A 2H6FA 1ELWA 3NOGD 2IF4A 3QWPA 3U9WA 4OAUC 2X6KA 3K9IA 3ASNE 4BTAA 3ZKJA 3JCKC 3TGOA 2VGYA 3ZW3A 2RFMA 5AIJA 4I2ZA 1BU9A 2R59A 1ZU2A 1HH8A 5DIZA 1QQEA 3QWVA 4EBAA 2WXPA 3FU3A 5G04J 4U04A 5KCMA 5LCWC 2L0IA 3QWWA 3S7BA 4KT6B 3CSFA 4I6GA 1W3BA 3IEGA 3BG1B 5EX3A 1O1SA 1TEZA 1N4RA 3ENEA 3CHPA 5ARFA 3MX3A 4KBQA 4KMOA 5G05J 4BERA 4YVOA 5KBAA 3SI5A 3ZU7B 2NC9A 2AWIA 5FIOA 1OWPA 2YINA 4PS3A 4LNUD 1QZ2A 3FY4A 3RAUA 2EIJE 5BT1A 2YNQA 2GRLA 3QJZA 1H2VC 3FU5A 2F0YA 4A1SA 1TJCA 4LNGA 3ABLE 1INZA 2Y4UA 1MQSA 4HORA 2WPVA 4FC8A 4TUMA 2XGSA 4MBGA 2OEVA 4L1BA 2HR2A 3RRUA 3UXGA 3TG5A 3CVPA 3IBEA 4HOQA 1E7VA 5KJNA 4EPZA 4FJYA 2GRRB 4G8KA 2VSYA 2X38A 3FTXA 3L54A 1JCRA 1H19A 3CHOA 2A4ZA 3RSEG 4HOUA 3PEVB 2F8YA 3LY9A 3RK6A 2WXIA 3PZ2A 4LSZE 2IO3C 4B89A 3TJPA 5FQ7A 1BD8A 2MYOA 1V55E 5ENOD 1MHQA 3KAEA 4CDMA 2A5UA 3CVNA 2F8XK 1JPLA 3ZYQA 3FH8A 3DEPA 3Q73A 2C0LA 1TNOA 5D0QD 2R17C 4KYOB 1WG0A 3VTXA 2H6HA 3DXMG 3FTUA 3QNKA 3QKYA 3Q47B 4DLOA 4N39A 4U0ZA 2ZGGA 2RG8A 3UUXA 1OWOA 3FU6A 5D0OD 3ZRHA 4GPKA 2WM9A 1LF8A 3MA5A 4LRZA 4PDXA 1OCRE 2DCPA 4G25A 4AXHA 3NF1A 3AG3E 4BETA 3FUIA 1G3NB 3NB2A 2VSXE 4AP2A 3UIOC 3W9FA 5D66A 2V4LA 5CRUA 4WNFA 4PUCA 2ETCA 1O1RA 3I3NA 1TJFA 4CDNA 5T4YA 2ONDA 3P1UA 1QBQA 4J6IA 1DCQA 2VGXB 3V31A 3B13A 4U96D 5LOZA 4W9RA 1OUVA 2ZU6B 4I17A 4CCAA 4M3OA 4UWLA 4C48B 5FZRA 5ENPD 2WXKA 4PS7A 4E85A 4BTBA 3ONKA 4JL0A 2NSZA 3DSWA 1UN9A 4EZLA 2JLBA 4TRQA 5BXUA 4JA7A 3ZFWA 1N95A 3HXFA 3QAQA 4G2VA 2XEVA 2J09A 3ZEFA 2LSUA 3ULYA 3PUJA 4HQDA 4EHMA 5H7PA 5AQ7A 3HIZA 3JQ1A 1SQMA 3PVLA 3Q49B 4Q69A 4N3CA 2CG3A 5AJDA 1N11A 2UY1A 3UT8A 3AS4A 5ARGA 2X6FA 2Y1LE 1EPUA 4I1OB 4U8YD 3CLJA 4NQ0A 1ELRA 2GGFA 4BT9A 1IKND 5CCLA 1FPPA 3E32A 3ESKA 1IQUA 2IOLA 4GTMA 3UPVA 3D9PA 2PQNA 4RSYA 3FTSA 1OWLA 3ZUVB 3MJWA 2FO7A 3IKOB 5FZQA 3TXNA 3JQ0A 4EQFA 2WXLA 3G2WA 4I43A 1YA0A 3DPDA 1D8EA 3NAWA 2Y3AA 3ZNGA 4G23A 4ATZD 2V0PA 4ZFHA 2ZIRA 5JJ6A 4URKA 2IJGX 1FCHA 4F7AA 2MOWA 5EKQD 1KT1A 4GAAA 4GMLA 3PNLB 4CYMD 4I9CA 3SQVA 4A55A 1LD8A 4WAFA 2R02A 5BV0A 2XS8A 1BPOA 1N0RA 5CBNA 3MEKA 3R7RA 4GTQA 3FEXA 5J08A 4FJZA 2ZISA 2AXVA 1P5QA 3HHMA 4Q94A 3TWUA 3Q78A 4UI9K 3UQ3A 3KEAA 3CVQA 5EILA 4V3IA 4UI9J 3KEZA 4LG6A 2AXUA 3SO8A 3B95A 3NZSA 3RJVA 4NACA 5B1BE 3DPYA 2WXMA 3LKUA 2IOSA 4Y6CA 4KVOA 5ENQD 5CERB 4GTPA 3ASFA 3DSTA 1OWNA 4I1MA 3JYSA 2J4BA 4MRUA 3G2TA 3HDXA 3SBTB 1S70B 1HE8A 3CGHA 2BUGA 1ZBPA 3EHNA 1BLXB 1OWMA 3CVXA 3UX4A 2Y4TA 1SZAA 3Q4AB 2WQHA 2QZAA 3X2QE 4PS8A 2HM8A 4J8DA 5CEAA 3QK0A 4GTVA 4UWGA 1YMPA
chains in the Genus database with same CATH topology
4U07A 1JUQA 3MV2B 5HQ8A 2WXPA 4HOTA 3FU3A 5G04J 1HG5A 2CHZA 3FUJA 4U04A 3PE4A 5KCMA 5LCWC 2L0IA 3QWWA 4G11A 3L16A 3S7BA 5FWQA 2DIWA 3HVEB 4J8EA 4KT6B 2WVIA 3CSFA 4I6GA 1W3BA 3IEGA 3BG1B 4FULA 5EX3A 4AV7A 4DI3A 1TEZA 4G26A 3ULQA 3ENEA 5A6CA 3URZA 3GW4A 1E8XA 3CHPA 3ZPJA 3FTZA 2IQCA 1JWFA 3ASDA 3FUHA 3L13A 4JXTA 3MX3A 5ARFA 3SF4A 4F53A 3GZSA 3EHMA 3GZ1A 5FZSA 4KBQA 4KMOA 5G05J 1HZ4A 2VQ2A 4RG6A 5G04C 3EDTB 3FWVA 3LY8A 2WMOA 3CKBA 4YVOA 3GYZA 3SI5A 3PDNA 2NC9A 4GZ5A 2AWIA 4R7LA 1OWPA 2PM6A 1E8YA 2YINA 5AENA 4PS3A 4GYYA 2WXRA 2HO1A 1Z6TA 3RIBA 1QZ2A 1E8ZA 3FY4A 1N52A 3PS6A 4PH4B 3LEWA 5BT1A 2CFUA 2YNQA 3PEUB 1GW6A 2GRLA 3L08A 5FT9A 3QJZA 1H2VC 3FU5A 1HF8A 4A1SA 2LSVA 2WXGA 1TJCA 3BG0B 1INZA 2RD0A 4UQYA 1Z3XA 4IYPA 2Y4UA 1MQSA 2XRZA 2KATA 5G05C 3AU5A 4I2WA 3AU4A 4UQXA 4DI4A 4HORA 1E8WA 2WPVA 4FC8A 3ZHEA 4HFGA 3ZGQA 2XGSA 3SBSA 4L1BA 3PRZA 5JHAA 1NA0A 3T5XA 1IYGA 2HR2A 3RRUA 3ZYLA 1JWGA 4XZ4A 4WWNA 1B89A 3FH7A 3FUNA 3O4ZA 3TG5A 4XIFA 2YHEA 3CVPA 3S7FA 3IBEA 4HOQA 3FHEA 1E7VA 2EQXA 5KJNA 3PNTB 3G2SA 2MHKA 4EPZA 4U8HA 2UWJG 4FJYA 2OVBA 3SFZA 3CVVA 3CHSA 2BF0X 1Y6IA 3FP3A 3CQCB 3AS5A 2VSYA 3CSTA 2X38A 3FTXA 3L54A 3G2VA 4I6EA 1H19A 3NZUA 4KZ0A 5G2NA 3CHOA 1EYHA 2PM7A 2A4ZA 3D9MA 3UT7A 4APOA 2QFCA 3CK7A 4HOUA 5EX0A 1WAO1 2P58C 2VJ8A 3PEVB 3ZXSA 4GMJA 2I1JA 2IU1A 2L9BA 1QNFA 1E7UA 3LY9A 2FEZA 2L0TB 4KVMA 3LJ3A 2L6JA 3RK6A 2WXIA 5LCWJ 1HS6A 1UN8A 3MKQA 3CQGB 2XCCA 3D9OA 4B89A 4CT4A 3SD5A 2CHXA 2X6IA 3VLDA 2M63A 3TJPA 5FQ7A 4JW1A 5KJMA 3RU0A 1X5BA 3FTWA 2XPZA 3IV0A 4P29A 1MHQA 3KAEA 4CDMA 2A5UA 1NA3A 2J07A 2KC7A 5CMYA 3QARA 1UG3A 4GZCA 3CVNA 1JPLA 2Q7FA 3ZYQA 4J8SA 3AS8A 2ILRA 3FH8A 2LAHA 3APFA 1IHGA 4GYOA 4CGWA 4FHKA 4H7XA 2VGXA 2C0LA 3OXLA 5D0QD 2R17C 3TL5A 2E0IA 4GA1A 4KYOB 2J08A 3FTUA 3VTXA 3ZHEB 4ANVA 3QNKA 4U0SA 5ANRA 3CVLA 3QKYA 2KCLA 5ENNA 3Q47B 1NP7A 4LEUA 4N3AA 3FUMA 2AVPA 3PUKA 1EDUA 1HX8A 3O48A 2OOEA 4K03A 4NURA 4N39A 4DLOA 2X3MA 4U0ZA 3SNXA 4UWFA 2XGMA 4ANUA 4GCNA 3L6AA 2RG8A 5CMWA 3UUXA 3EJNA 4TV3A 4GU5A 5G55A 4L2YA 1OWOA 4KZCA 3FU6A 2DBAA 5D0OD 3CHMA 3D9LA 3U4TA 3ZRHA 2I2OA 2J49A 4ANWA 4GPKA 4FP7A 2WM9A 1LF8A 3MA5A 4LRZA 2AXZA 3KD7A 4G24A 4TUUA 5T3RA 2FULA 4PDXA 3ZVVA 5LX8A 2DCPA 4AXHA 4G25A 3EIJA 3IHVA 4OVUA 3NF1A 4IRUA 4ABNA 3FUIA 5JJ7A 3CR3A 3FUFA 1KT0A 3R9AB 2AW6A 2LO6A 4FLHA 4A3VA 3R7QA 4HXIA 5E76A 4GZDA 3IHYA 3SZ7A 2VSXE 4LCTA 5BW8C 4XKBA 2FI7A 2KM4A 2FBNA 4UQZA 3RO2A 3TAXA 3VLFA 4AP2A 4BX8A 3MKQB 3Q15A 4JEUA 4RG9A 4LERA 3CVYA 1Y8MA 4B8CB 2V4LA 3PH0C 2WXOA 3BEEA 3U66A 2CFZA 3MZLB 4MS6A 4WNFA 2LNIA 4PUCA 1HXIA 4CT0A 3I3NA 1TJFA 2WXJA 3HYMB 3LS8A 5T4YA 4CDNA 4XI0A 2ONDA 5T8IA 1HG2A 1DNPA 3P1UA 4WNEA 5BV1A 1NZNA 4I9EA 4J6IA 3CK9A 2VGXB 4QFVA 5C1DA 3B13A 5CCMA 2WXNA 5LOZA 2HYZA 1PY1A 4W9RA 3D9NA 4DJAA 1OUVA 3CK8A 1VDYA 2ZU6B 4WWPA 4L23A 4I17A 4MKTA 4CCAA 5JHBA 4M3OA 4UWLA 4AY6A 3FULA 5FZRA 3FUKA 4HVBA 3RRNB 2WXKA 3FDHA 4PS7A 3OAWA 4E85A 5BPPA 3ML9A 4BTBA 3ONKA 1UJJA 4UWGA 3T5VA 4JL0A 3LVRE 2NSZA 1UN9A 1UW4B 3QDNA 4JA9A 4EZLA 2XHEA 2JLBA 5M72A 4C9BB 4TRQA 2WB2A 4JA7A 2V5FA 5KJKA 4L2LA 1E90A 3ZFWA 3APDA 4GB9A 2X6JA 1XNFA 3QAQA 4JHRA 4G2VA 5CHEE 4E6HA 4F1SA 2XEVA 3JUIA 2J09A 5HI7A 3ZEFA 2LSUA 3PUJA 4K0RA 2YHCA 3ESLA 1IQRA 3T8MA 4U0UA 4I1AA 3HIZA 3FU0A 5KJLA 2CG2A 3CIAA 3JQ1A 3GZ2A 3C98A 1H6KA 2I9CA 3LXUX 4OYSA 3LYAA 2XPYA 3B7RL 4N5CA 1SQMA 5EDSA 4C0MA 3PVLA 3Q49B 4JHJA 2XCBA 2KCKA 4C0EA 4Q69A 4N3CA 4IULA 2CG3A 4EZKA 5A23A 4JPSA 1UJKA 4XKCA 3ZYMA 3QB2A 4LUNU 5AJDA 2UY1A 3N71A 4APFA 1XGWA 3UT8A 3PZDA 3U3WA 3LDZA 3TXMA 1WY6A 3CEQA 4B8AA 1WM5A 3AS4A 5ARGA 4RVBA 2C0MA 3QC1A 2X6FA 4AIFA 4N2QA 4N2SA 5AJLA 3CHQA 5A7DB 1Z3YA 4IN3B 3QOUA 4JEHA 3UT4A 4ACKA 1FVFA 1EPUA 2X6HA 4I1OB 4B94A 4AJWA 5FQ8A 2YQ8A 1SZ9A 3B7SA 3CLJA 2R5SA 4NQ0A 1ELRA 3ZN3A 2GGFA 3ML8A 4BSXA 4WWOA 3KS2A 4BT9A 4L7TA 5CCLA 3MCXA 3ASHA 4AVXA 5AYWD 2WXFA 4U63A 3NQPA 3ESKA 1IQUA 2IOLA 4Q96A 5JJTA 3D9PA 3CHRA 3UPVA 2PQNA 4EBAG 3UMVA 4RSYA 4EECA 2OV8A 5LP0A 2XQ0A 3FTSA 3LY7A 1HU3A 4F3VA 1OWLA 1ELKA 2J4DA 4FADA 2VSNA 5J90A 1H0AA 3MJWA 4FLBA 3I5PA 2FO7A 3IKOB 4I6JA 5FZQA 3FTYA 2XGOA 4JHKA 3TXNA 3FTVA 4D10C 3B7UX 4DLQA 3JQ0A 3U64A 4GZ6A 1KLXA 2VSOE 3B7TA 3L22A 4UWHA 5FJYA 4H7YA 2I1KA 2PZIA 4EQFA 2WXLA 2WXQA 3G2WA 4CEMA 3LCAA 1YA0A 4I43A 4BX9A 3DPDA 4DPRA 2Y3AA 4ACLA 2I6HA 4Y6WA 4HOSA 4BY6A 3OTNA 4G23A 4EZJA 1E96B 5C2YA 2UY1B 4XI9A 3Q5MA 3FH5A 4AM9A 2V0PA 3RO3A 4HLEA 4FA6A 2OVFA 3EIQC 2C2LA 2VTBA 3D9JA 3DBSA 3MKRA 5BNWA 5JJ6A 3FEYA 4A1GA 4OVVA 3LVQE 4URKA 2PL2A 2IJGX 4J0UA 4A3TA 1FCHA 1L5JA 4F7AA 4GZ3A 2MOWA 5EKQD 3CVUA 4XE0A 4GYWA 2J9QA 2KCVA 1KT1A 4GAAA 4GMLA 4ILIA 3PNLB 1PC2A 1HFAA 2E2EA 4I9CA 4A55A 3MYVA 4WAFA 4FHJA 2JEKA 1S0PA 5BV0A 2MRIA 3PE3A 1BPOA 4O6FA 4ME2A 2QY7A 4WNDA 3MEKA 3PREA 3FUDA 3P2BA 4ANXA 1U3CA 1N54A 2IONA 3R7RA 3S7JA 3FEXA 4HS2A 5J08A 4FJZA 2CHWA 2BTDA 4YNDA 3FUEA 4GA2A 4FU3A 4UWKA 2AXVA 1P5QA 3HHMA 3OXGA 2IFUA 3CV0A 4G1TA 4Q94A 5DBKA 4UI9K 3ZYKA 3UQ3A 2LAIA 3VTYA 3CVQA 3L17A 2NXPA 2GW1A 4V3IA 1U3DA 4UI9J 3MGBA 3OXFA 4AEZC 5FQ6A 3KEZA 2V8SE 3RRMB 1EF1C 2AXUA 2WMNA 4JVSA 4JC8A 3D9IA 2KZTA 3ONLA 1DVPA 3I4GA 2FF4A 2GRMA 1HO8A 3NZSA 3RJVA 4J8FA 4AOFA 3I4RB 5E75A 3WXXA 1H2TC 3ASGA 4NACA 5LFAA 3ZIMA 3E4BA 4BFRA 2WXMA 4YVQC 3LKUA 4N3BA 3CVWA 4XX5A 2IOSA 4Y6CA 5FQ4A 2VTBB 3HVEA 4KVOA 3MV3B 4GCOA 4WNGA 3CKCA 4BWRA 2WQ6A 4CGVA 4ILGA 3ASFA 4B0ZA 4CDRA 3APCA 3LPZA 5BUZA 3RKVA 1OWNA 4WUYA 4BT8A 4I1MA 3S7DA 3JYSA 4UI9C 4AY5A 1H2UA 2WXHA 2J4BA 4MRUA 1FVHA 5ANLA 4ATGA 3FFLA 3G2TA 3HDXA 4NRHB 3SBTB 4ILHB 1HE8A 3CGHA 1ELWA 2BUGA 1ZBPA 3EHNA 2VYIA 2IF4A 1OWMA 3QWPA 3U9WA 2X6KA 2XPIA 3K9IA 4BTAA 3CVXA 3UX4A 4MLPA 3VLEA 2Y4TA 4CRWA 3JCKC 3TGOA 1SZAA 2VGYA 3Q4AB 4GA0A 3S2AA 2WQHA 3ZW3A 2WQ7A 3G2UA 4DK5A 4I2ZA 5FTPA 5AIJA 2PQRA 2R59A 1ZU2A 4PS8A 3TG4A 1HH8A 2HM8A 4KXKB 1PAQA 3D3MA 2XRYA 4J8DA 1A17A 3SGHA 4JZYA 5DIZA 3SHFA 3QK0A 1QQEA 2KZTB 3D9KA 3QWVA 4EBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUQ A;  1SZ9 A;  2L0T B;  3CLJ A;  4FU3 A;  4JXT A;  4Q94 A;  1HG5 A;  3ZYK A;  2MOW A;  1EDU A;  1HF8 A;  1HX8 A;  1UJK A;  2LO6 A;  3D9O A;  3G2W A;  3G2S A;  4GZD A;  5LOZ A;  3ZYM A;  2L0I A;  1PY1 A;  1INZ A;  3D9N A;  2KM4 A;  2DIW A;  1HFA A;  5CMW A;  1XGW A;  4AVX A;  1X5B A;  1VDY A;  3LDZ A;  1MHQ A;  1SZA A;  2BF0 X;  2V8S E;  3D9L A;  5CMY A;  4GZC A;  4Q96 A;  3D9P A;  1JPL A;  1LF8 A;  1DVP A;  3D9I A;  3G2U A;  3G2V A;  3ONL A;  2QY7 A;  3ZYQ A;  5LP0 A;  4HFG A;  1EYH A;  4NAC A;  3D9M A;  3ONK A;  1UJJ A;  1ELK A;  3D9J A;  3G2T A;  5J08 A;  2DCP A;  1H0A A;  3D9K A;  4FLB A;  3RRU A;  1HG2 A;  1JWF A;  3ZYL A;  1JWG A; 
#chains in the Genus database with same CATH topology
 4U07 A;  3ABK E;  5HQ8 A;  3C3Q A;  2CHZ A;  4NIK A;  1KPS B;  1K8K G;  4G11 A;  2ETB A;  3TWQ A;  4AV7 A;  3ULQ A;  1OCO E;  3FUH A;  3L13 A;  3Q9U C;  3SF4 A;  2P9P G;  3GZS A;  3EHM A;  4JD2 G;  5B1A E;  4G8L A;  3EDT B;  3LY8 A;  2WMO A;  4GZ5 A;  3AG2 E;  4RQI A;  1E8Y A;  1K3Z D;  2WXR A;  2HO1 A;  3RIB A;  3UM2 A;  1N52 A;  3LEW A;  2CFU A;  4O1O A;  4GMR A;  1Z3X A;  3ISM C;  3Q7A A;  4IYP A;  2XRZ A;  2KAT A;  4I2W A;  5ITZ F;  4BES A;  4HFG A;  3SBS A;  3PRZ A;  3T5X A;  1IYG A;  1V54 E;  1X81 A;  2EIL E;  3FUN A;  3NOC D;  3G2S A;  1LD7 A;  2OVB A;  3CVV A;  1OCC E;  1Y6I A;  3CQC B;  3G2V A;  1H6O A;  4I6E A;  5JMN D;  5G2N A;  1EYH A;  2PM7 A;  2ZXW E;  4APO A;  2P2C P;  1TNB A;  5EX0 A;  3ZXS A;  5EIB E;  4GMJ A;  2L9B A;  4KVM A;  2FEZ A;  3LJ3 A;  2L6J A;  1UN8 A;  2CHX A;  4BSZ B;  3UIP C;  4J8Y A;  3RU0 A;  5EYP F;  3FTW A;  4P29 A;  3IV0 A;  2J07 A;  4GZC A;  1YYH A;  2Q7F A;  2ILR A;  2LAH A;  3APF A;  4GYO A;  4CGW A;  4H7X A;  4BEP A;  2VGX A;  3OXL A;  4ANV A;  4U0S A;  2KCL A;  1Q2Z A;  3FUM A;  3PUK A;  3O48 A;  2OOE A;  1BI7 B;  2XEN A;  4GCN A;  4TV3 A;  4GU5 A;  5CED B;  3CHM A;  4XEI G;  4ANW A;  1SA4 A;  2DZO A;  3ZVV A;  3EIJ A;  3IHV A;  4OVU A;  4IRU A;  2RKK A;  3CR3 A;  3R9A B;  3UTM A;  2KXP C;  4A3V A;  4HXI A;  5E76 A;  3SZ7 A;  3IHY A;  2KM4 A;  3MKQ B;  4RG9 A;  4LER A;  3CVY A;  2WXO A;  3BEE A;  2HE0 A;  1HXI A;  2WXJ A;  1HG2 A;  4I9E A;  3SFY A;  2P9U G;  4QFV A;  1TN7 A;  2DZN A;  5JHB A;  1N4P A;  1O5M A;  2ETA A;  3FUK A;  3TWT A;  3EU5 A;  3OAW A;  4GPM A;  1UJJ A;  1SW6 A;  2R2L A;  2PNN A;  2XHE A;  4C9B B;  2LUH A;  4A63 B;  2V5F A;  4HBD A;  2X6J A;  1XNF A;  3TWR A;  4M7C A;  4F1S A;  3JUI A;  1IQR A;  3JUE A;  4I1A A;  1MJ0 A;  3CIA A;  4HB5 A;  3C98 A;  3LYA A;  4JHJ A;  2XCB A;  2KCK A;  4IUL A;  4EZK A;  4JPS A;  2IEJ A;  1XGW A;  3U3W A;  3LDZ A;  1WY6 A;  3CEQ A;  2C0M A;  3C3O A;  3QC1 A;  4GTO A;  4AIF A;  5A7D B;  3CHQ A;  4IN3 B;  4HRN A;  2X6H A;  4B94 A;  3V79 K;  3B7S A;  4HNA D;  3ZN3 A;  4L7T A;  4DX1 A;  3ASH A;  1KZO A;  4U63 A;  4Q96 A;  3CHR A;  5LP0 A;  1D8D A;  3LY7 A;  2R03 A;  3ULE G;  1ELK A;  2V4H C;  5J90 A;  4FLB A;  3Q9N C;  2JAB A;  1KLX A;  1TN8 A;  3B7T A;  5FJY A;  3E30 A;  2WXQ A;  4BX9 A;  4DPR A;  4HOS A;  1E96 B;  3Q5M A;  1OXJ A;  4HLE A;  1A5E A;  3MKR A;  5BNW A;  4YDO A;  4A1G A;  4OVV A;  3LVQ E;  2PL2 A;  1KZP A;  3DXK G;  1SA5 A;  2A5E A;  4J7W A;  3W9G A;  2KCV A;  1PC2 A;  1UOH A;  1HFA A;  4TXR A;  5AQA A;  3ZXP A;  3MYV A;  4FHJ A;  2JEK A;  1S0P A;  2MRI A;  1DC2 A;  4ME2 A;  4TXQ A;  3P2B A;  1U3C A;  1N54 A;  4HS2 A;  2BTD A;  3FUE A;  4GA2 A;  4DX7 D;  5DBK A;  4G1T A;  4QQI A;  1ZB1 A;  2NXP A;  3SFX A;  3F6Q A;  2XEH A;  4JC8 A;  1DVP A;  5LFA A;  4XX5 A;  2VTB B;  4WNG A;  4K5B A;  2XZT G;  4B0Z A;  4CDR A;  3LPZ A;  3RKV A;  4YDY A;  1H2U A;  2WXH A;  3UIN C;  2BKG A;  1FVH A;  5ANL A;  3FFL A;  2VYI A;  4MLP A;  3VLE A;  4HI8 A;  3S2A A;  2H6I A;  4DK5 A;  2PQR A;  3PZ3 A;  4KXK B;  3D3M A;  1A17 A;  1DCE A;  4JZY A;  3SHF A;  3D9K A;  3E33 A;  3DSS A;  1JUQ A;  3SY2 A;  4HOT A;  1WDY A;  1HG5 A;  4DX2 A;  2DIW A;  4J8E A;  2WVI A;  4HI9 A;  4G26 A;  5A6C A;  3GW4 A;  4O60 A;  5KNG A;  3FTZ A;  3ASD A;  4JXT A;  4F53 A;  3GZ1 A;  5FZS A;  4RG6 A;  3KSQ A;  5G04 C;  3FWV A;  3CKB A;  3PDN A;  4R7L A;  2RFA A;  4DRX E;  2VGE A;  4LNB A;  4GTT A;  1OY3 D;  3PS6 A;  4PH4 B;  4B93 B;  3PEU B;  1GW6 A;  3L08 A;  3TWV A;  2LSV A;  2WXG A;  3BG0 B;  2RD0 A;  5G05 C;  2DWZ A;  3AU4 A;  4DI4 A;  2BED A;  5AAR A;  3R9M A;  1JWG A;  1SVX A;  4WWN A;  4XZ4 A;  2YHE A;  2FO1 E;  2GRN B;  3FHE A;  3PNT B;  5AN8 A;  3PZ4 A;  2BF0 X;  3AS5 A;  3CST A;  3NBN B;  4KZ0 A;  2VJ8 A;  3HXD A;  5CEC B;  2I1J A;  3DSU A;  2L0T B;  3AAA C;  3MKQ A;  3CQG B;  1AWC B;  2XCC A;  2OCC E;  3SD5 A;  2X6I A;  3VLD A;  2M63 A;  1N4S A;  1X5B A;  2XPZ A;  2IO2 C;  4U95 D;  2KC7 A;  3QAR A;  4J8S A;  3AS8 A;  4FHK A;  3TL5 A;  2E0I A;  4GA1 A;  3ZHE B;  5ANR A;  5AQ9 A;  3CVL A;  5EYL A;  5ENN A;  4LEU A;  4N3A A;  2AVP A;  1EDU A;  2X3M A;  3SNX A;  4UWF A;  2XGM A;  4ANU A;  3HXB A;  4L2Y A;  4HRM B;  2DBA A;  3V2X A;  2J49 A;  2B0O E;  4FP7 A;  3KD7 A;  4G24 A;  2FUL A;  3DSX A;  5LX8 A;  4ABN A;  5JJ7 A;  3FUF A;  2AW6 A;  4FLH A;  4LCT A;  5KJM A;  4XKB A;  3TAX A;  2FBN A;  3RO2 A;  3VLF A;  4BX8 A;  3Q15 A;  3PH0 C;  1Z5S C;  4MS6 A;  2P9I G;  4XI0 A;  1DNP A;  3L82 A;  4WNE A;  5BV1 A;  5B3S E;  3HRA A;  5C1D A;  5CCM A;  2WXN A;  1PY1 A;  4DJA A;  1VDY A;  1FT1 A;  4ZHB A;  4RLY A;  4AY6 A;  4OAV B;  5BPP A;  3ML9 A;  3T5V A;  1K1A A;  3C72 A;  3LVR E;  3WG7 E;  2WB2 A;  4U7E B;  4L2L A;  1E90 A;  4GB9 A;  4JHR A;  5CHE E;  4K0R A;  2YHC A;  3T8K A;  3ESL A;  3T8M A;  3FU0 A;  3DEO A;  2CG2 A;  5IY5 E;  2I9C A;  3B7R L;  4N5C A;  2Y0B G;  5EDS A;  2B6C A;  2XZD G;  4C0E A;  3HG0 D;  1S63 A;  2GRP B;  3QB2 A;  1MYO A;  3N71 A;  3EUV A;  4L9P A;  3J5P A;  3PZD A;  4B8A A;  3TXM A;  3UKU G;  1N94 A;  5AJL A;  1Z3Y A;  2LXM A;  1MX6 A;  3QOU A;  2GRO B;  3UT4 A;  1FVF A;  2YQ8 A;  3ML8 A;  5JA4 D;  4BSX A;  4WWO A;  1TYQ G;  4AVX A;  5AYW D;  2P9K G;  3NQP A;  1OCZ E;  5JJT A;  1H6P A;  4EEC A;  4X8Q A;  2OV8 A;  5EID A;  4F3V A;  3V2O A;  2J4D A;  5CBO A;  4FAD A;  2VSN A;  1H0A A;  2R05 A;  3Q79 A;  3FTY A;  4JHK A;  3FTV A;  3B7U X;  3U64 A;  4GZ6 A;  3L22 A;  4H7Y A;  2PZI A;  2P9N G;  4CEM A;  1S64 A;  4YDW A;  4ACL A;  4Y6W A;  3OTN A;  4EZJ A;  3FH5 A;  2EIM E;  1NFI E;  3RO3 A;  3EIQ C;  2VTB A;  3D9J A;  3AG4 E;  3FEY A;  3B7B A;  4J0U A;  4A3T A;  2XS1 A;  4GZ3 A;  4Z68 A;  3CVU A;  4XE0 A;  2J9Q A;  2F37 A;  2E2E A;  1D9S A;  1TN6 A;  3DRA A;  1NI1 A;  4O6F A;  4WND A;  3FUD A;  4ANX A;  3S7J A;  1BI8 B;  2IFU A;  2ZGD A;  3CV0 A;  3DWL G;  2KBX A;  3VTY A;  3L17 A;  5ENR D;  1U3D A;  2EIK E;  2LXL A;  2WMN A;  4JVS A;  3D9I A;  3ONL A;  3I4G A;  1OT8 A;  2FF4 A;  2GRM A;  3I4R B;  5E75 A;  1H2T C;  3ASG A;  1NL4 A;  1QYM A;  4GTR A;  3ZIM A;  3E4B A;  4N3B A;  3CVW A;  5FQ4 A;  4GCO A;  3T9K A;  3CKC A;  4GTS A;  4BWR A;  2WQ6 A;  2DVW A;  4ILG A;  4F1P A;  5BUZ A;  5CRV A;  4BT8 A;  5HS0 A;  3S7D A;  4UI9 C;  3UM3 A;  4ATG A;  4NRH B;  4ILH B;  2XPI A;  4CRW A;  4GA0 A;  2AJA A;  2WQ7 A;  3G2U A;  5FTP A;  2NYJ A;  3TG4 A;  4U8V D;  1PAQ A;  2XRY A;  3SGH A;  2KZT B;  4CZ2 D;  3MV2 B;  3FUJ A;  3UKR G;  3PE4 A;  4N5Q A;  3L16 A;  1TNZ A;  5FWQ A;  3HVE B;  3J5Q B;  4FUL A;  3AG1 E;  4DI3 A;  1U2V G;  5ENT D;  3UI2 A;  3URZ A;  3IXE A;  1E8X A;  3ZPJ A;  4DX6 D;  2IQC A;  2H6G A;  1JWF A;  3C3R A;  1HZ4 A;  2VQ2 A;  3GYZ A;  4YDE A;  2PM6 A;  5AEN A;  4GYY A;  1Z6T A;  1N4Q A;  1E8Z A;  5AQB A;  1JCQ A;  5FT9 A;  1HF8 A;  4UQY A;  5HRY A;  5HKP A;  1AP7 A;  3AU5 A;  4UQX A;  1E8W A;  3ZHE A;  3ZGQ A;  3PZ1 A;  5JHA A;  1NA0 A;  3ABM E;  3ZYL A;  1B89 A;  3FH7 A;  3O4Z A;  4XIF A;  3S7F A;  1TR4 A;  1IHB A;  2EQX A;  1JCS A;  4DX5 D;  2MHK A;  4U8H A;  2UWJ G;  3SFZ A;  3CHS A;  5AAO A;  3FP3 A;  3D9H A;  3NZU A;  3D9M A;  3UT7 A;  2QFC A;  3CK7 A;  1WAO 1;  2GRQ B;  2P58 C;  1YCS B;  2IU1 A;  1QNF A;  1E7U A;  5LCW J;  1HS6 A;  5D2M C;  4CT4 A;  3D9O A;  3EHR A;  4JW1 A;  3BU8 A;  1NA3 A;  5CMY A;  1UG3 A;  2IY0 C;  1IHG A;  2DYR E;  1LTX A;  4UUC A;  3TWW A;  2P9L G;  3UM0 A;  2J08 A;  3JXI A;  4TXP A;  1NP7 A;  4K03 A;  1HX8 A;  4NUR A;  1MX4 A;  3LJN A;  3L6A A;  3UM1 A;  5CMW A;  3EJN A;  5G55 A;  4KZC A;  3D9L A;  3U4T A;  2I2O A;  2EIN E;  2AXZ A;  4TUU A;  5T3R A;  3V30 A;  1N9A A;  1KT0 A;  2LO6 A;  2QYJ A;  3R7Q A;  4GZD A;  1FT2 A;  5BW8 C;  2FI7 A;  4UQZ A;  4K5A B;  4JEU A;  1Y8M A;  4B8C B;  3U66 A;  1MZC A;  2CFZ A;  3MZL B;  2Y69 E;  2LNI A;  4CT0 A;  3HYM B;  3LS8 A;  5T8I A;  1K1B A;  1NZN A;  1N0Q A;  3CK9 A;  4F6R D;  3HXC A;  2HYZ A;  3D9N A;  3CK8 A;  4WWP A;  4L23 A;  4MKT A;  3FUL A;  4HVB A;  3RRN B;  2QC9 A;  3FDH A;  1MX2 A;  1UW4 B;  3QDN A;  4JA9 A;  5M72 A;  4O1P A;  1IXV A;  5KJK A;  3APD A;  4E6H A;  5HI7 A;  4U0U A;  3EHQ A;  5KJL A;  3GZ2 A;  1H6K A;  3LXU X;  4OYS A;  2XPY A;  5KNH D;  4C0M A;  2QYU A;  1TNY A;  5A23 A;  1UJK A;  4XKC A;  3ZYM A;  2P9S G;  4LUN U;  4APF A;  4K5C A;  2V5Q C;  1TNU A;  1WM5 A;  4RVB A;  1O1T A;  4N2Q A;  4N2S A;  4JEH A;  4ACK A;  4AJW A;  4HLL A;  5FQ8 A;  1SZ9 A;  2R5S A;  3BQO A;  3KS2 A;  2J8S D;  2L6B A;  3MCX A;  3Q7F A;  5KWD A;  3AJI A;  2WXF A;  3KSL A;  5FIN A;  4EBA G;  3UMV A;  2XQ0 A;  1HU3 A;  3I5P A;  4D10 C;  4I6J A;  2XGO A;  4DLQ A;  2VSO E;  4UWH A;  4JB8 P;  2DYS E;  2I1K A;  3Q75 A;  3LCA A;  2XEE A;  3C5R A;  2BKK B;  2I6H A;  4BY6 A;  4HRL A;  5C2Y A;  2UY1 B;  4XI9 A;  4AM9 A;  4FA6 A;  2OVF A;  2C2L A;  3E34 A;  3DBS A;  3L9T A;  3HXE A;  3EU9 A;  1L5J A;  4GYW A;  5BXO A;  4ILI A;  3PE3 A;  2QY7 A;  3TWX A;  3PRE A;  2ION A;  3ASO E;  2CHW A;  4YND A;  3TWS A;  4FU3 A;  4UWK A;  4DUI A;  3OXG A;  3ZYK A;  2LAI A;  2GW1 A;  2OEW A;  3MGB A;  3OXF A;  4AEZ C;  5FQ6 A;  2V8S E;  3RRM B;  1EF1 C;  3BUA A;  2KZT A;  5ENS D;  1HO8 A;  4AOF A;  3E37 A;  4J8F A;  3WXX A;  5EN5 D;  3JXJ A;  4BFR A;  1RW2 A;  1RZ4 A;  4YVQ C;  3HVE A;  3MV3 B;  3DSV A;  4CGV A;  3APC A;  4WUY A;  4AY5 A;  2H6F A;  1ELW A;  3NOG D;  2IF4 A;  3QWP A;  3U9W A;  4OAU C;  2X6K A;  3K9I A;  3ASN E;  4BTA A;  3ZKJ A;  3JCK C;  3TGO A;  2VGY A;  3ZW3 A;  2RFM A;  5AIJ A;  4I2Z A;  1BU9 A;  2R59 A;  1ZU2 A;  1HH8 A;  5DIZ A;  1QQE A;  3QWV A;  4EBA A;  2WXP A;  3FU3 A;  5G04 J;  4U04 A;  5KCM A;  5LCW C;  2L0I A;  3QWW A;  3S7B A;  4KT6 B;  3CSF A;  4I6G A;  1W3B A;  3IEG A;  3BG1 B;  5EX3 A;  1O1S A;  1TEZ A;  1N4R A;  3ENE A;  3CHP A;  5ARF A;  3MX3 A;  4KBQ A;  4KMO A;  5G05 J;  4BER A;  4YVO A;  5KBA A;  3SI5 A;  3ZU7 B;  2NC9 A;  2AWI A;  5FIO A;  1OWP A;  2YIN A;  4PS3 A;  4LNU D;  1QZ2 A;  3FY4 A;  3RAU A;  2EIJ E;  5BT1 A;  2YNQ A;  2GRL A;  3QJZ A;  1H2V C;  3FU5 A;  2F0Y A;  4A1S A;  1TJC A;  4LNG A;  3ABL E;  1INZ A;  2Y4U A;  1MQS A;  4HOR A;  2WPV A;  4FC8 A;  4TUM A;  2XGS A;  4MBG A;  2OEV A;  4L1B A;  2HR2 A;  3RRU A;  3UXG A;  3TG5 A;  3CVP A;  3IBE A;  4HOQ A;  1E7V A;  5KJN A;  4EPZ A;  4FJY A;  2GRR B;  4G8K A;  2VSY A;  2X38 A;  3FTX A;  3L54 A;  1JCR A;  1H19 A;  3CHO A;  2A4Z A;  3RSE G;  4HOU A;  3PEV B;  2F8Y A;  3LY9 A;  3RK6 A;  2WXI A;  3PZ2 A;  4LSZ E;  2IO3 C;  4B89 A;  3TJP A;  5FQ7 A;  1BD8 A;  2MYO A;  1V55 E;  5ENO D;  1MHQ A;  3KAE A;  4CDM A;  2A5U A;  3CVN A;  2F8X K;  1JPL A;  3ZYQ A;  3FH8 A;  3DEP A;  3Q73 A;  2C0L A;  1TNO A;  5D0Q D;  2R17 C;  4KYO B;  1WG0 A;  3VTX A;  2H6H A;  3DXM G;  3FTU A;  3QNK A;  3QKY A;  3Q47 B;  4DLO A;  4N39 A;  4U0Z A;  2ZGG A;  2RG8 A;  3UUX A;  1OWO A;  3FU6 A;  5D0O D;  3ZRH A;  4GPK A;  2WM9 A;  1LF8 A;  3MA5 A;  4LRZ A;  4PDX A;  1OCR E;  2DCP A;  4G25 A;  4AXH A;  3NF1 A;  3AG3 E;  4BET A;  3FUI A;  1G3N B;  3NB2 A;  2VSX E;  4AP2 A;  3UIO C;  3W9F A;  5D66 A;  2V4L A;  5CRU A;  4WNF A;  4PUC A;  2ETC A;  1O1R A;  3I3N A;  1TJF A;  4CDN A;  5T4Y A;  2OND A;  3P1U A;  1QBQ A;  4J6I A;  1DCQ A;  2VGX B;  3V31 A;  3B13 A;  4U96 D;  5LOZ A;  4W9R A;  1OUV A;  2ZU6 B;  4I17 A;  4CCA A;  4M3O A;  4UWL A;  4C48 B;  5FZR A;  5ENP D;  2WXK A;  4PS7 A;  4E85 A;  4BTB A;  3ONK A;  4JL0 A;  2NSZ A;  3DSW A;  1UN9 A;  4EZL A;  2JLB A;  4TRQ A;  5BXU A;  4JA7 A;  3ZFW A;  1N95 A;  3HXF A;  3QAQ A;  4G2V A;  2XEV A;  2J09 A;  3ZEF A;  2LSU A;  3ULY A;  3PUJ A;  4HQD A;  4EHM A;  5H7P A;  5AQ7 A;  3HIZ A;  3JQ1 A;  1SQM A;  3PVL A;  3Q49 B;  4Q69 A;  4N3C A;  2CG3 A;  5AJD A;  1N11 A;  2UY1 A;  3UT8 A;  3AS4 A;  5ARG A;  2X6F A;  2Y1L E;  1EPU A;  4I1O B;  4U8Y D;  3CLJ A;  4NQ0 A;  1ELR A;  2GGF A;  4BT9 A;  1IKN D;  5CCL A;  1FPP A;  3E32 A;  3ESK A;  1IQU A;  2IOL A;  4GTM A;  3UPV A;  3D9P A;  2PQN A;  4RSY A;  3FTS A;  1OWL A;  3ZUV B;  3MJW A;  2FO7 A;  3IKO B;  5FZQ A;  3TXN A;  3JQ0 A;  4EQF A;  2WXL A;  3G2W A;  4I43 A;  1YA0 A;  3DPD A;  1D8E A;  3NAW A;  2Y3A A;  3ZNG A;  4G23 A;  4ATZ D;  2V0P A;  4ZFH A;  2ZIR A;  5JJ6 A;  4URK A;  2IJG X;  1FCH A;  4F7A A;  2MOW A;  5EKQ D;  1KT1 A;  4GAA A;  4GML A;  3PNL B;  4CYM D;  4I9C A;  3SQV A;  4A55 A;  1LD8 A;  4WAF A;  2R02 A;  5BV0 A;  2XS8 A;  1BPO A;  1N0R A;  5CBN A;  3MEK A;  3R7R A;  4GTQ A;  3FEX A;  5J08 A;  4FJZ A;  2ZIS A;  2AXV A;  1P5Q A;  3HHM A;  4Q94 A;  3TWU A;  3Q78 A;  4UI9 K;  3UQ3 A;  3KEA A;  3CVQ A;  5EIL A;  4V3I A;  4UI9 J;  3KEZ A;  4LG6 A;  2AXU A;  3SO8 A;  3B95 A;  3NZS A;  3RJV A;  4NAC A;  5B1B E;  3DPY A;  2WXM A;  3LKU A;  2IOS A;  4Y6C A;  4KVO A;  5ENQ D;  5CER B;  4GTP A;  3ASF A;  3DST A;  1OWN A;  4I1M A;  3JYS A;  2J4B A;  4MRU A;  3G2T A;  3HDX A;  3SBT B;  1S70 B;  1HE8 A;  3CGH A;  2BUG A;  1ZBP A;  3EHN A;  1BLX B;  1OWM A;  3CVX A;  3UX4 A;  2Y4T A;  1SZA A;  3Q4A B;  2WQH A;  2QZA A;  3X2Q E;  4PS8 A;  2HM8 A;  4J8D A;  5CEA A;  3QK0 A;  4GTV A;  4UWG A;  1YMP A; 
#chains in the Genus database with same CATH homology
 4U07 A;  1JUQ A;  3MV2 B;  5HQ8 A;  2WXP A;  4HOT A;  3FU3 A;  5G04 J;  1HG5 A;  2CHZ A;  3FUJ A;  4U04 A;  3PE4 A;  5KCM A;  5LCW C;  2L0I A;  3QWW A;  4G11 A;  3L16 A;  3S7B A;  5FWQ A;  2DIW A;  3HVE B;  4J8E A;  4KT6 B;  2WVI A;  3CSF A;  4I6G A;  1W3B A;  3IEG A;  3BG1 B;  4FUL A;  5EX3 A;  4AV7 A;  4DI3 A;  1TEZ A;  4G26 A;  3ULQ A;  3ENE A;  5A6C A;  3URZ A;  3GW4 A;  1E8X A;  3CHP A;  3ZPJ A;  3FTZ A;  2IQC A;  1JWF A;  3ASD A;  3FUH A;  3L13 A;  4JXT A;  3MX3 A;  5ARF A;  3SF4 A;  4F53 A;  3GZS A;  3EHM A;  3GZ1 A;  5FZS A;  4KBQ A;  4KMO A;  5G05 J;  1HZ4 A;  2VQ2 A;  4RG6 A;  5G04 C;  3EDT B;  3FWV A;  3LY8 A;  2WMO A;  3CKB A;  4YVO A;  3GYZ A;  3SI5 A;  3PDN A;  2NC9 A;  4GZ5 A;  2AWI A;  4R7L A;  1OWP A;  2PM6 A;  1E8Y A;  2YIN A;  5AEN A;  4PS3 A;  4GYY A;  2WXR A;  2HO1 A;  1Z6T A;  3RIB A;  1QZ2 A;  1E8Z A;  3FY4 A;  1N52 A;  3PS6 A;  4PH4 B;  3LEW A;  5BT1 A;  2CFU A;  2YNQ A;  3PEU B;  1GW6 A;  2GRL A;  3L08 A;  5FT9 A;  3QJZ A;  1H2V C;  3FU5 A;  1HF8 A;  4A1S A;  2LSV A;  2WXG A;  1TJC A;  3BG0 B;  1INZ A;  2RD0 A;  4UQY A;  1Z3X A;  4IYP A;  2Y4U A;  1MQS A;  2XRZ A;  2KAT A;  5G05 C;  3AU5 A;  4I2W A;  3AU4 A;  4UQX A;  4DI4 A;  4HOR A;  1E8W A;  2WPV A;  4FC8 A;  3ZHE A;  4HFG A;  3ZGQ A;  2XGS A;  3SBS A;  4L1B A;  3PRZ A;  5JHA A;  1NA0 A;  3T5X A;  1IYG A;  2HR2 A;  3RRU A;  3ZYL A;  1JWG A;  4XZ4 A;  4WWN A;  1B89 A;  3FH7 A;  3FUN A;  3O4Z A;  3TG5 A;  4XIF A;  2YHE A;  3CVP A;  3S7F A;  3IBE A;  4HOQ A;  3FHE A;  1E7V A;  2EQX A;  5KJN A;  3PNT B;  3G2S A;  2MHK A;  4EPZ A;  4U8H A;  2UWJ G;  4FJY A;  2OVB A;  3SFZ A;  3CVV A;  3CHS A;  2BF0 X;  1Y6I A;  3FP3 A;  3CQC B;  3AS5 A;  2VSY A;  3CST A;  2X38 A;  3FTX A;  3L54 A;  3G2V A;  4I6E A;  1H19 A;  3NZU A;  4KZ0 A;  5G2N A;  3CHO A;  1EYH A;  2PM7 A;  2A4Z A;  3D9M A;  3UT7 A;  4APO A;  2QFC A;  3CK7 A;  4HOU A;  5EX0 A;  1WAO 1;  2P58 C;  2VJ8 A;  3PEV B;  3ZXS A;  4GMJ A;  2I1J A;  2IU1 A;  2L9B A;  1QNF A;  1E7U A;  3LY9 A;  2FEZ A;  2L0T B;  4KVM A;  3LJ3 A;  2L6J A;  3RK6 A;  2WXI A;  5LCW J;  1HS6 A;  1UN8 A;  3MKQ A;  3CQG B;  2XCC A;  3D9O A;  4B89 A;  4CT4 A;  3SD5 A;  2CHX A;  2X6I A;  3VLD A;  2M63 A;  3TJP A;  5FQ7 A;  4JW1 A;  5KJM A;  3RU0 A;  1X5B A;  3FTW A;  2XPZ A;  3IV0 A;  4P29 A;  1MHQ A;  3KAE A;  4CDM A;  2A5U A;  1NA3 A;  2J07 A;  2KC7 A;  5CMY A;  3QAR A;  1UG3 A;  4GZC A;  3CVN A;  1JPL A;  2Q7F A;  3ZYQ A;  4J8S A;  3AS8 A;  2ILR A;  3FH8 A;  2LAH A;  3APF A;  1IHG A;  4GYO A;  4CGW A;  4FHK A;  4H7X A;  2VGX A;  2C0L A;  3OXL A;  5D0Q D;  2R17 C;  3TL5 A;  2E0I A;  4GA1 A;  4KYO B;  2J08 A;  3FTU A;  3VTX A;  3ZHE B;  4ANV A;  3QNK A;  4U0S A;  5ANR A;  3CVL A;  3QKY A;  2KCL A;  5ENN A;  3Q47 B;  1NP7 A;  4LEU A;  4N3A A;  3FUM A;  2AVP A;  3PUK A;  1EDU A;  1HX8 A;  3O48 A;  2OOE A;  4K03 A;  4NUR A;  4N39 A;  4DLO A;  2X3M A;  4U0Z A;  3SNX A;  4UWF A;  2XGM A;  4ANU A;  4GCN A;  3L6A A;  2RG8 A;  5CMW A;  3UUX A;  3EJN A;  4TV3 A;  4GU5 A;  5G55 A;  4L2Y A;  1OWO A;  4KZC A;  3FU6 A;  2DBA A;  5D0O D;  3CHM A;  3D9L A;  3U4T A;  3ZRH A;  2I2O A;  2J49 A;  4ANW A;  4GPK A;  4FP7 A;  2WM9 A;  1LF8 A;  3MA5 A;  4LRZ A;  2AXZ A;  3KD7 A;  4G24 A;  4TUU A;  5T3R A;  2FUL A;  4PDX A;  3ZVV A;  5LX8 A;  2DCP A;  4AXH A;  4G25 A;  3EIJ A;  3IHV A;  4OVU A;  3NF1 A;  4IRU A;  4ABN A;  3FUI A;  5JJ7 A;  3CR3 A;  3FUF A;  1KT0 A;  3R9A B;  2AW6 A;  2LO6 A;  4FLH A;  4A3V A;  3R7Q A;  4HXI A;  5E76 A;  4GZD A;  3IHY A;  3SZ7 A;  2VSX E;  4LCT A;  5BW8 C;  4XKB A;  2FI7 A;  2KM4 A;  2FBN A;  4UQZ A;  3RO2 A;  3TAX A;  3VLF A;  4AP2 A;  4BX8 A;  3MKQ B;  3Q15 A;  4JEU A;  4RG9 A;  4LER A;  3CVY A;  1Y8M A;  4B8C B;  2V4L A;  3PH0 C;  2WXO A;  3BEE A;  3U66 A;  2CFZ A;  3MZL B;  4MS6 A;  4WNF A;  2LNI A;  4PUC A;  1HXI A;  4CT0 A;  3I3N A;  1TJF A;  2WXJ A;  3HYM B;  3LS8 A;  5T4Y A;  4CDN A;  4XI0 A;  2OND A;  5T8I A;  1HG2 A;  1DNP A;  3P1U A;  4WNE A;  5BV1 A;  1NZN A;  4I9E A;  4J6I A;  3CK9 A;  2VGX B;  4QFV A;  5C1D A;  3B13 A;  5CCM A;  2WXN A;  5LOZ A;  2HYZ A;  1PY1 A;  4W9R A;  3D9N A;  4DJA A;  1OUV A;  3CK8 A;  1VDY A;  2ZU6 B;  4WWP A;  4L23 A;  4I17 A;  4MKT A;  4CCA A;  5JHB A;  4M3O A;  4UWL A;  4AY6 A;  3FUL A;  5FZR A;  3FUK A;  4HVB A;  3RRN B;  2WXK A;  3FDH A;  4PS7 A;  3OAW A;  4E85 A;  5BPP A;  3ML9 A;  4BTB A;  3ONK A;  1UJJ A;  4UWG A;  3T5V A;  4JL0 A;  3LVR E;  2NSZ A;  1UN9 A;  1UW4 B;  3QDN A;  4JA9 A;  4EZL A;  2XHE A;  2JLB A;  5M72 A;  4C9B B;  4TRQ A;  2WB2 A;  4JA7 A;  2V5F A;  5KJK A;  4L2L A;  1E90 A;  3ZFW A;  3APD A;  4GB9 A;  2X6J A;  1XNF A;  3QAQ A;  4JHR A;  4G2V A;  5CHE E;  4E6H A;  4F1S A;  2XEV A;  3JUI A;  2J09 A;  5HI7 A;  3ZEF A;  2LSU A;  3PUJ A;  4K0R A;  2YHC A;  3ESL A;  1IQR A;  3T8M A;  4U0U A;  4I1A A;  3HIZ A;  3FU0 A;  5KJL A;  2CG2 A;  3CIA A;  3JQ1 A;  3GZ2 A;  3C98 A;  1H6K A;  2I9C A;  3LXU X;  4OYS A;  3LYA A;  2XPY A;  3B7R L;  4N5C A;  1SQM A;  5EDS A;  4C0M A;  3PVL A;  3Q49 B;  4JHJ A;  2XCB A;  2KCK A;  4C0E A;  4Q69 A;  4N3C A;  4IUL A;  2CG3 A;  4EZK A;  5A23 A;  4JPS A;  1UJK A;  4XKC A;  3ZYM A;  3QB2 A;  4LUN U;  5AJD A;  2UY1 A;  3N71 A;  4APF A;  1XGW A;  3UT8 A;  3PZD A;  3U3W A;  3LDZ A;  3TXM A;  1WY6 A;  3CEQ A;  4B8A A;  1WM5 A;  3AS4 A;  5ARG A;  4RVB A;  2C0M A;  3QC1 A;  2X6F A;  4AIF A;  4N2Q A;  4N2S A;  5AJL A;  3CHQ A;  5A7D B;  1Z3Y A;  4IN3 B;  3QOU A;  4JEH A;  3UT4 A;  4ACK A;  1FVF A;  1EPU A;  2X6H A;  4I1O B;  4B94 A;  4AJW A;  5FQ8 A;  2YQ8 A;  1SZ9 A;  3B7S A;  3CLJ A;  2R5S A;  4NQ0 A;  1ELR A;  3ZN3 A;  2GGF A;  3ML8 A;  4BSX A;  4WWO A;  3KS2 A;  4BT9 A;  4L7T A;  5CCL A;  3MCX A;  3ASH A;  4AVX A;  5AYW D;  2WXF A;  4U63 A;  3NQP A;  3ESK A;  1IQU A;  2IOL A;  4Q96 A;  5JJT A;  3D9P A;  3CHR A;  3UPV A;  2PQN A;  4EBA G;  3UMV A;  4RSY A;  4EEC A;  2OV8 A;  5LP0 A;  2XQ0 A;  3FTS A;  3LY7 A;  1HU3 A;  4F3V A;  1OWL A;  1ELK A;  2J4D A;  4FAD A;  2VSN A;  5J90 A;  1H0A A;  3MJW A;  4FLB A;  3I5P A;  2FO7 A;  3IKO B;  4I6J A;  5FZQ A;  3FTY A;  2XGO A;  4JHK A;  3TXN A;  3FTV A;  4D10 C;  3B7U X;  4DLQ A;  3JQ0 A;  3U64 A;  4GZ6 A;  1KLX A;  2VSO E;  3B7T A;  3L22 A;  4UWH A;  5FJY A;  4H7Y A;  2I1K A;  2PZI A;  4EQF A;  2WXL A;  2WXQ A;  3G2W A;  4CEM A;  3LCA A;  1YA0 A;  4I43 A;  4BX9 A;  3DPD A;  4DPR A;  2Y3A A;  4ACL A;  2I6H A;  4Y6W A;  4HOS A;  4BY6 A;  3OTN A;  4G23 A;  4EZJ A;  1E96 B;  5C2Y A;  2UY1 B;  4XI9 A;  3Q5M A;  3FH5 A;  4AM9 A;  2V0P A;  3RO3 A;  4HLE A;  4FA6 A;  2OVF A;  3EIQ C;  2C2L A;  2VTB A;  3D9J A;  3DBS A;  3MKR A;  5BNW A;  5JJ6 A;  3FEY A;  4A1G A;  4OVV A;  3LVQ E;  4URK A;  2PL2 A;  2IJG X;  4J0U A;  4A3T A;  1FCH A;  1L5J A;  4F7A A;  4GZ3 A;  2MOW A;  5EKQ D;  3CVU A;  4XE0 A;  4GYW A;  2J9Q A;  2KCV A;  1KT1 A;  4GAA A;  4GML A;  4ILI A;  3PNL B;  1PC2 A;  1HFA A;  2E2E A;  4I9C A;  4A55 A;  3MYV A;  4WAF A;  4FHJ A;  2JEK A;  1S0P A;  5BV0 A;  2MRI A;  3PE3 A;  1BPO A;  4O6F A;  4ME2 A;  2QY7 A;  4WND A;  3MEK A;  3PRE A;  3FUD A;  3P2B A;  4ANX A;  1U3C A;  1N54 A;  2ION A;  3R7R A;  3S7J A;  3FEX A;  4HS2 A;  5J08 A;  4FJZ A;  2CHW A;  2BTD A;  4YND A;  3FUE A;  4GA2 A;  4FU3 A;  4UWK A;  2AXV A;  1P5Q A;  3HHM A;  3OXG A;  2IFU A;  3CV0 A;  4G1T A;  4Q94 A;  5DBK A;  4UI9 K;  3ZYK A;  3UQ3 A;  2LAI A;  3VTY A;  3CVQ A;  3L17 A;  2NXP A;  2GW1 A;  4V3I A;  1U3D A;  4UI9 J;  3MGB A;  3OXF A;  4AEZ C;  5FQ6 A;  3KEZ A;  2V8S E;  3RRM B;  1EF1 C;  2AXU A;  2WMN A;  4JVS A;  4JC8 A;  3D9I A;  2KZT A;  3ONL A;  1DVP A;  3I4G A;  2FF4 A;  2GRM A;  1HO8 A;  3NZS A;  3RJV A;  4J8F A;  4AOF A;  3I4R B;  5E75 A;  3WXX A;  1H2T C;  3ASG A;  4NAC A;  5LFA A;  3ZIM A;  3E4B A;  4BFR A;  2WXM A;  4YVQ C;  3LKU A;  4N3B A;  3CVW A;  4XX5 A;  2IOS A;  4Y6C A;  5FQ4 A;  2VTB B;  3HVE A;  4KVO A;  3MV3 B;  4GCO A;  4WNG A;  3CKC A;  4BWR A;  2WQ6 A;  4CGV A;  4ILG A;  3ASF A;  4B0Z A;  4CDR A;  3APC A;  3LPZ A;  5BUZ A;  3RKV A;  1OWN A;  4WUY A;  4BT8 A;  4I1M A;  3S7D A;  3JYS A;  4UI9 C;  4AY5 A;  1H2U A;  2WXH A;  2J4B A;  4MRU A;  1FVH A;  5ANL A;  4ATG A;  3FFL A;  3G2T A;  3HDX A;  4NRH B;  3SBT B;  4ILH B;  1HE8 A;  3CGH A;  1ELW A;  2BUG A;  1ZBP A;  3EHN A;  2VYI A;  2IF4 A;  1OWM A;  3QWP A;  3U9W A;  2X6K A;  2XPI A;  3K9I A;  4BTA A;  3CVX A;  3UX4 A;  4MLP A;  3VLE A;  2Y4T A;  4CRW A;  3JCK C;  3TGO A;  1SZA A;  2VGY A;  3Q4A B;  4GA0 A;  3S2A A;  2WQH A;  3ZW3 A;  2WQ7 A;  3G2U A;  4DK5 A;  4I2Z A;  5FTP A;  5AIJ A;  2PQR A;  2R59 A;  1ZU2 A;  4PS8 A;  3TG4 A;  1HH8 A;  2HM8 A;  4KXK B;  1PAQ A;  3D3M A;  2XRY A;  4J8D A;  1A17 A;  3SGH A;  4JZY A;  5DIZ A;  3SHF A;  3QK0 A;  1QQE A;  2KZT B;  3D9K A;  3QWV A;  4EBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...