1ELKA

Vhs domain of tom1 protein from h. sapiens
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
SDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the VHS domain of human Tom1 (target of myb 1): insights into interactions with proteins and membranes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords TARGET OF MYB1
total genus 57
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elkA00
1ELKA 3ZYKA 1JWGA 3G2TA 3G2UA 3D9IA 3D9MA 4JXTA 1JWFA 1VDYA 2BF0X 2L0TB 2QY7A 3D9OA 3LDZA 2L0IA 3D9PA 1SZ9A 4NACA 5LP0A 3CLJA 1DVPA 3D9NA 1JUQA 3ZYQA 1HG2A 2DIWA 4FLBA 4FU3A 1EDUA 2LO6A 2V8SE 4AVXA 4HFGA 5LOZA 2KM4A 3ONKA 1X5BA 1HFAA 3G2VA 1SZAA 3RRUA 1JPLA 1INZA 2DCPA 1HX8A 1XGWA 5CMWA 5J08A 2MOWA 1PY1A 4GZDA 4Q96A 1HF8A 3D9KA 1H0AA 1HG5A 1UJJA 3D9JA 4GZCA 4Q94A 5CMYA 1EYHA 3ZYLA 3ZYMA 3ONLA 3G2WA 1UJKA 1MHQA 3D9LA 1LF8A 3G2SA
chains in the Genus database with same CATH superfamily
2GRQB 3FUNA 2ETAA 2WPVA 5AQ7A 1U3DA 1S63A 1Q2ZA 3IHVA 5HRYA 4K5AB 3TGOA 4Y6WA 5G05C 4ZFHA 3DRAA 4BWRA 5BNWA 2LAIA 2KZTB 2JABA 5D0OD 4I6JA 1N11A 3OTNA 4BY6A 3UUXA 1RZ4A 4JC8A 5HI7A 3RRNB 4CEMA 1RW2A 4GYOA 4E85A 1D8DA 2XGMA 2XRZA 3NF1A 3FUIA 1DCEA 1QNFA 3C72A 1LD8A 3FTUA 1TNUA 2LUHA 3ZXPA 5CRUA 1UOHA 3AS8A 4MLPA 1TNYA 3K9IA 1N9AA 1K3ZD 4BX9A 3QWVA 4I1AA 4PUCA 3FEXA 5IY5E 5FT9A 1MX2A 3FU5A 3TG5A 1H0AA 3DSUA 4G1TA 3Q9NC 3UMVA 4D10C 1NA3A 4GTTA 3ZRHA 1KZOA 3OXFA 1ZBPA 2KATA 3SQVA 4DK5A 3VLEA 4J0UA 3UM3A 3FEYA 3R9MA 4WNFA 2EIJE 3CIAA 1PAQA 4RG9A 4L23A 3BG1B 2EINE 2QZAA 1N54A 4UWKA 1E8WA 5KJNA 2Y4UA 2OCCE 2AXUA 5BT1A 3PZ2A 3ML9A 4B8CB 2UY1A 3S7JA 1PC2A 3AG1E 4ILGA 2CHWA 3PUKA 5AQAA 3FY4A 3MX3A 3MGBA 3Q78A 1B89A 5E75A 3L13A 4CGVA 2L0IA 5EYLA 2WQ6A 2FO7A 1E7VA 1O5MA 3FUDA 4A3VA 1DC2A 5ENOD 1TJCA 2UWJG 1IHGA 3UT7A 4U0ZA 3W9GA 4DI3A 3ISMC 5BV0A 5BUZA 1HXIA 4JXTA 5AN8A 4BSZB 2WXIA 1HE8A 2ONDA 3TG4A 5ENRD 3ABKE 4AOFA 3PH0C 3CQCB 3FWVA 4GA0A 5CMWA 4YDOA 1V54E 4XKBA 1KPSB 3Q73A 1N0RA 2FO1E 5HS0A 2XENA 3HXEA 4U8YD 3QNKA 4N5QA 3Q5MA 3OXGA 4BERA 3EHMA 2XZDG 4JA7A 2IO3C 3X2QE 3MJWA 1HZ4A 4UUCA 3MV2B 5LOZA 2DYRE 4EBAA 2H6HA 4DLOA 3MA5A 3RAUA 2WXHA 2GRMA 1JCRA 2J8SD 2EQXA 4EHMA 4LCTA 2X3MA 3V79K 4ANVA 3UPVA 2E2EA 4HBDA 5KNGA 4F7AA 2DVWA 3C3QA 3UKRG 1H6KA 3G2VA 3CHPA 5FQ6A 5G04C 2V0PA 3RO3A 4CT4A 2NYJA 2I1KA 2GW1A 1E90A 4C0MA 1KT0A 3DSTA 4URKA 3VTYA 4Y6CA 4GA2A 2CG2A 2IEJA 4KXKB 1K8KG 3MEKA 1NI1A 4FJZA 1N4QA 3D9HA 2C2LA 2ETBA 2XPZA 1H6OA 1BI7B 3CHOA 3FU6A 3IKOB 4I6GA 3LEWA 2P2CP 3JUEA 3FUMA 4F1PA 2XEEA 4ZHBA 3ZYMA 4EZJA 4N3BA 2BUGA 4GMLA 4L7TA 4GCOA 3SNXA 3HG0D 3TWTA 4GTOA 2XEVA 4FU3A 3TJPA 4DPRA 2ZIRA 3QDNA 1HFAA 1IKND 4U07A 2FBNA 5T3RA 4DUIA 3Q79A 5DIZA 1YCSB 3D9OA 1SQMA 2ZGGA 4WWOA 4F3VA 3UX4A 3RSEG 4BETA 3SHFA 1H6PA 2BEDA 4B8AA 4J8SA 4NIKA 4W9RA 4GZCA 4KVOA 4IN3B 2RFAA 2EIME 1WM5A 4LUNU 2LAHA 4IYPA 2ZGDA 1MX6A 4I9CA 3B13A 1HU3A 2MHKA 2XS8A 4NQ0A 3L17A 5ENQD 2VGEA 3TL5A 3EJNA 3AJIA 3E4BA 4NACA 3UTMA 1Y6IA 5G04J 3T8KA 4JHRA 3KD7A 1AP7A 2MRIA 3CLJA 3FUFA 5E76A 3KEAA 4XKCA 3V2XA 1V55E 2KC7A 4Z68A 4AY6A 3CHSA 3O48A 3UT4A 2VJ8A 3KSQA 5FTPA 4F53A 4G26A 3JUIA 4B89A 4IRUA 4HI8A 3ASNE 4O60A 5J08A 1OXJA 5FZQA 3PZ1A 4PH4B 1ZB1A 4WWNA 1OT8A 3MV3B 1ELKA 3RU0A 4AY5A 2GRLA 3G2TA 5JA4D 3AAAC 3NBNB 3I3NA 1SA4A 4I1MA 4JZYA 4JB8P 4UI9J 2LSVA 1TN6A 3LXUX 2CHZA 2FI7A 1UG3A 2XCCA 2X6FA 2Q7FA 1N95A 2CG3A 3L08A 2YNQA 3SO8A 2F0YA 2J08A 3IBEA 2LO6A 2HE0A 5EILA 1DNPA 4MBGA 1OWPA 3DPDA 3EU5A 2WXNA 5CCMA 4Q96A 4PS8A 2R05A 3HVEA 4G24A 5HQ8A 4CYMD 2PZIA 4E6HA 3ZXSA 3DEPA 4GCNA 2YHEA 3ZEFA 3Q49B 4AIFA 1LTXA 2UY1B 4BT8A 3GYZA 2FULA 2AJAA 3FTWA 4HOUA 2Y0BG 1FT1A 1HG2A 4KBQA 3JQ1A 3U3WA 4RLYA 3TWXA 4TV3A 1INZA 3GZ2A 2E0IA 4LG6A 4O6FA 3IEGA 3RRMB 4HNAD 3NOCD 4XZ4A 1H2VC 3VTXA 4N3AA 4U04A 3ONKA 5FQ4A 1IQUA 3AU4A 2LSUA 1FT2A 1OY3D 5G55A 1TR4A 3MCXA 3N71A 5AYWD 4HRNA 4ACLA 4KMOA 3ASDA 3RJVA 2R5SA 3UXGA 2P9PG 5LCWJ 2V4LA 3ZHEB 1HX8A 5HKPA 1WAO1 1HH8A 5KWDA 3P1UA 2FF4A 2PL2A 4KVMA 4BESA 2L0TB 3SBSA 4YDYA 3CHRA 3CR3A 3B95A 4A55A 3GW4A 4A3TA 3UINC 4GZ6A 3U4TA 3WG7E 3APDA 4OYSA 2EIKE 5DBKA 1JCQA 5EX3A 3MYVA 3SFYA 4GTPA 4BSXA 1Z6TA 2XEHA 3EU9A 3TWSA 4ME2A 3ENEA 4JD2G 3E37A 2ZU6B 3EUVA 3D9KA 1KLXA 3I5PA 1S64A 2B0OE 4DLQA 2WVIA 3SFZA 1IQRA 3B7TA 3DBSA 1O1RA 3VLDA 4QQIA 5B1AE 2VGXB 4K03A 3AU5A 3FP3A 1Z3XA 4UI9K 4AJWA 2R02A 1X81A 5EDSA 2A4ZA 5FJYA 1FCHA 2DIWA 3QKYA 3PS6A 3TWRA 3BQOA 1NL4A 2MOWA 3FTSA 4U0SA 3ZYKA 2IOSA 5FZRA 2H6GA 3AS5A 3D9NA 5D66A 5AIJA 3PRZA 3FH7A 3Q15A 2KBXA 3QARA 4G2VA 1A5EA 2BKGA 3QWPA 3FTZA 3L82A 3CVNA 4GMRA 3CHMA 1NA0A 3FUJA 4TXQA 3LVRE 2VSYA 5EIDA 1DVPA 5EN5D 4PDXA 1QYMA 4L2YA 4B94A 4JPSA 4XE0A 3KSLA 4A63B 4GYWA 4U95D 2P9IG 4OAUC 2J9QA 4A1SA 3QAQA 3D9MA 4G8KA 1FVHA 3F6QA 1MZCA 2OVFA 3JXIA 1WDYA 4YVQC 4F6RD 3L16A 3LY9A 3S2AA 2KM4A 3PE4A 4G23A 5BPPA 3DSWA 2H6FA 3DWLG 2KZTA 3AG4E 4RQIA 1O1TA 3ABLE 2JEKA 1BI8B 3LJNA 3DXMG 3QOUA 1N4SA 3PZ3A 3UI2A 3B7UX 5FIOA 3T5XA 4HOQA 4C9BB 5CCLA 4GTRA 1TNOA 4FHKA 2NC9A 4HRMB 1SVXA 4DX5D 3LJ3A 4DX6D 4LNBA 3QB2A 4AEZC 2KCVA 2HR2A 4JEHA 3HXFA 3UM0A 1H2UA 2RD0A 3ASFA 2XCBA 4Q94A 2OEWA 5BXOA 4OAVB 1LF8A 2KCKA 4XI9A 5KJMA 3NOGD 2ZXWE 5CEAA 2EILE 1HS6A 4G8LA 3E30A 4N2SA 4AVXA 5LCWC 4XI0A 4EECA 3G2SA 3L9TA 2CFZA 5CBNA 2KXPC 4DX7D 2DYSE 3D9PA 4UQZA 4P29A 3TWVA 2J09A 4X8QA 4YNDA 3EHRA 5AQBA 5CECB 3AG3E 3DSSA 3L22A 4BT9A 5ARFA 2VTBA 1H2TC 3RKVA 5AQ9A 4C48B 3Q9UC 3ZVVA 3FUEA 5AJLA 2AXZA 3HIZA 3S7BA 2XQ0A 4CGWA 4EBAG 3PEVB 5T4YA 4LRZA 4U96D 3U64A 4DX2A 3CEQA 4AV7A 3CK7A 1PY1A 1K1BA 4L2LA 4QFVA 3QJZA 1WY6A 3APCA 2WMNA 4HB5A 2DBAA 1U2VG 2P9LG 1N94A 3B7BA 3PNTB 4FADA 1SA5A 5CHEE 4L9PA 2WM9A 3MZLB 4FA6A 1X5BA 4WNEA 2I1JA 4L1BA 3AG2E 4K0RA 2WXMA 4FP7A 5EX0A 4BX8A 5AJDA 2RKKA 2HYZA 4UWHA 4GPKA 3SFXA 3UM1A 3ZPJA 4KZ0A 2YHCA 3HXBA 5T8IA 2LXMA 5EYPF 2WXOA 5CEDB 2F8YA 4BFRA 2GGFA 1FPPA 1TN7A 3G2WA 4GYYA 2C0LA 4TUUA 4K5CA 2L6JA 4OVUA 3JXJA 2AW6A 4JEUA 4I2WA 1UN8A 4UWFA 4U8VD 2XHEA 1JCSA 5G2NA 2MYOA 4XX5A 3ULQA 1BPOA 3D3MA 3CKBA 1W3BA 1VDYA 3JYSA 1MJ0A 2HO1A 3EIQC 3SGHA 4WWPA 1N52A 3CK8A 4GTSA 5BXUA 2YQ8A 4PS7A 1OWLA 4B0ZA 2GRNB 3E34A 4U8HA 2XRYA 4ACKA 3V2OA 4HI9A 4V3IA 3I4GA 1OWOA 4GTMA 2V5FA 3KS2A 3UM2A 3T5VA 4U0UA 4JW1A 2V8SE 4GZ3A 2AXVA 4J8YA 2VGYA 2X38A 3ESKA 1E8XA 5ITZF 5A23A 4B93B 5LX8A 4GMJA 5C2YA 3B7SA 5BV1A 1TNBA 1YMPA 4MRUA 3BEEA 4HS2A 1MQSA 5FQ8A 3J5PA 1HG5A 3KEZA 5B3SE 4XEIG 2BKKB 3NZSA 1U3CA 3DXKG 5JJ7A 1UW4B 4LERA 4TXRA 2WXPA 5CRVA 3ML8A 5LP0A 3FFLA 5LFAA 1OWMA 2VQ2A 1NP7A 3FULA 4N39A 5C1DA 3PVLA 3R7QA 3HDXA 1S0PA 2V4HC 3UT8A 1Z3YA 3LPZA 2XPYA 1P5QA 3SF4A 1A17A 5B1BE 1IXVA 4AM9A 3R7RA 2A5EA 2WQHA 2I9CA 4FULA 5G05J 5FQ7A 1TN8A 1UJKA 2J07A 3TXNA 5AARA 1OUVA 4I2ZA 5FWQA 4CRWA 2M63A 1WG0A 5KNHD 4J8FA 5KBAA 3SY2A 4H7XA 2Y69E 4FJYA 4C0EA 4ATGA 3MKQB 3D9JA 1AWCB 4GB9A 2LNIA 3MKQA 2BTDA 4CDMA 4HVBA 4MS6A 3J5QB 2PM6A 1E96B 3FH5A 5AAOA 3CV0A 2IY0C 2QC9A 4TRQA 2H6IA 3CQGB 4DX1A 3HXDA 4GZDA 3V31A 3DSVA 3CVYA 3OAWA 1Z5SC 3D9LA 3FTVA 4LEUA 1OCRE 1OCOE 3D9IA 2PQNA 2IFUA 3QK0A 4FHJA 4BTBA 3CSTA 4ANXA 3ZIMA 4UQYA 5CMYA 3C98A 3S7DA 4HOTA 3AS4A 5D2MC 3L54A 1MHQA 3L6AA 4N5CA 2XZTG 3TWQA 2WXGA 5KJLA 2J49A 1O1SA 3LDZA 3W9FA 2IQCA 3SZ7A 3ABME 2L6BA 4DI4A 4OVVA 4WAFA 3LVQE 5D0QD 4H7YA 3ZHEA 3Q75A 2OOEA 3U9WA 2R17C 2KCLA 3Q4AB 3EIJA 2QYJA 2XGSA 3ZYQA 5AENA 4IULA 4O1PA 2NSZA 3OXLA 1JPLA 5JHBA 2VSNA 1YA0A 3Q47B 3KAEA 4BTAA 4RSYA 3IHYA 3RK6A 4UQXA 3Q7FA 2QFCA 3CVXA 1FVFA 3PEUB 2P9KG 1TNZA 3FH8A 4J6IA 1YYHA 4I9EA 3VLFA 4JA9A 4RVBA 2AWIA 1N4PA 2WXFA 4APOA 1NZNA 4I6EA 3CK9A 2PM7A 1KZPA 4DRXE 4FLHA 4HOSA 5KCMA 3IXEA 2VSXE 4G25A 3CVQA 3ULEG 2J4BA 4EZLA 3SBTB 3ZKJA 2P9UG 2IU1A 4DJAA 3PNLB 4NRHB 5JJTA 1IYGA 1HO8A 2VSOE 1HF8A 3QWWA 3E32A 1XNFA 3BUAA 1E7UA 1N0QA 1E8ZA 3Q7AA 1JUQA 5BW8C 3R9AB 4KT6B 3CKCA 2R03A 3DSXA 3ZNGA 1TEZA 2DCPA 4EZKA 1UJJA 3LYAA 3LKUA 2L9BA 3EHNA 2QYUA 4J7WA 5CERB 4AP2A 3UQ3A 4EPZA 4I1OB 1L5JA 1QQEA 2Y3AA 1EDUA 2WXJA 2PNNA 3EDTB 2X6HA 3JQ0A 1XGWA 4ANWA 4GAAA 3ESLA 4MKTA 2CHXA 4GTVA 1QBQA 3E33A 1EYHA 2FEZA 1SZ9A 4HORA 1TJFA 5ANRA 3T9KA 4JL0A 4FC8A 3HHMA 4RG6A 2Y1LE 4U63A 4LNGA 2IO2C 3NAWA 1LD7A 2DZNA 1E8YA 5FZSA 1MX4A 1BLXB 3BG0B 4R7LA 2WB2A 4TUMA 2GROB 2HM8A 2I2OA 4G11A 5CBOA 1MYOA 3DPYA 3UIOC 3RRUA 3JCKC 1EPUA 2OVBA 3MKRA 2IJGX 4UWGA 2XS1A 4K5BA 4YDWA 3CVPA 2WMOA 1OCCE 3TWWA 3HVEB 3RO2A 4AXHA 4BEPA 5JHAA 3IV0A 1GW6A 1Y8MA 1D9SA 3WXXA 2IOLA 2J4DA 4KZCA 2A5UA 4N2QA 4HQDA 3ZGQA 2ETCA 5KJKA 3EHQA 1NFIE 3ZUVB 4WUYA 2P9NG 2Y4TA 2P58C 2WXQA 1JWGA 3FTYA 3CVVA 3RIBA 1TYQG 3G2UA 2ILRA 5M72A 2NXPA 4A1GA 4I17A 2DZOA 4JHJA 1D8EA 2WQ7A 1S70B 3C3OA 4UI9C 3C5RA 4F1SA 4U7EB 5A7DB 2RG8A 3HRAA 2V5QC 3ASGA 4GTQA 5JJ6A 3NB2A 5ARGA 2JLBA 4YVOA 5ENPD 2X6KA 1OCZE 4WNDA 3ZFWA 3PDNA 4J8DA 3FUKA 3ONLA 3UIPC 4CZ2D 5ENNA 4YDEA 4ATZD 4HRLA 4WNGA 3ZN3A 2X6JA 2QY7A 2RFMA 4ILHB 4HLLA 3CHQA 3HYMB 4TXPA 4ABNA 4HFGA 4I43A 3CSFA 5H7PA 1BU9A 3PE3A 3TWUA 2XPIA 1OWNA 3FUHA 1SW6A 5JMND 1N4RA 1H19A 3LS8A 3T8MA 3PUJA 3CVLA 4CT0A 3S7FA 1EF1C 2ZISA 3U66A 2BF0X 4GPMA 1DCQA 5EIBE 3GZ1A 4FLBA 3CGHA 4XIFA 1IHBA 3NQPA 3QC1A 4CDNA 3TAXA 4LNUD 2F37A 4NURA 1UN9A 3APFA 2DWZA 2OV8A 1G3NB 3PREA 2B6CA 3ULYA 4HLEA 4JVSA 1K1AA 3LCAA 4GZ5A 2GRRB 3C3RA 3ZW3A 4LSZE 5J90A 1ZU2A 3URZA 3PZDA 4JHKA 3PZ4A 3V30A 3P2BA 2P9SG 2R2LA 3HXCA 2YINA 3FDHA 4KYOB 5EKQD 1ELRA 4GA1A 2F8XK 4ANUA 3ZU7B 2VGXA 3UKUG 2XGOA 5ENTD 1QZ2A 4N3CA 3NZUA 3CVUA 3FU3A 3TXMA 3BU8A 4Q69A 4ILIA 3LY8A 5ENSD 3LY7A 1BD8A 2IF4A 4GU5A 4EQFA 4J8EA 2AVPA 2C0MA 2LXLA 2PQRA 2VYIA 2WXLA 5A6CA 4M7CA 3SD5A 1SZAA 3O4ZA 5FINA 2VTBB 4O1OA 4CDRA 2CFUA 3ASOE 5ANLA 1KT1A 3I4RB 3ASHA 3FU0A 4M3OA 2GRPB 2I6HA 1JWFA 3B7RL 4UWLA 3CVWA 1ELWA 3DEOA 4HXIA 3FHEA 3GZSA 2R59A 2WXKA 4APFA 2IONA 4PS3A 2WXRA 2OEVA 4CCAA 3SI5A 2X6IA 3FTXA 3ZYLA
chains in the Genus database with same CATH topology
2QFCA 2KCKA 3CVXA 1FVFA 3PEUB 3FUNA 4XI9A 3FH8A 4J6IA 5KJMA 2WPVA 5FTPA 4F53A 4I9EA 1U3DA 4G26A 3VLFA 3JUIA 4JA9A 1HS6A 4RVBA 4B89A 3IHVA 4N2SA 4AVXA 2AWIA 4IRUA 3TGOA 5LCWC 4Y6WA 2WXFA 5G05C 4APOA 4XI0A 1NZNA 4I6EA 5J08A 3CK9A 2PM7A 4BWRA 5FZQA 4PH4B 4FLHA 5BNWA 2LAIA 2KZTB 4EECA 3G2SA 4WWNA 4HOSA 3MV3B 1ELKA 3RU0A 2CFZA 5KCMA 4AY5A 2GRLA 3G2TA 2VSXE 4G25A 5D0OD 3CVQA 3D9PA 4I6JA 2J4BA 4UQZA 3SBTB 4EZLA 3I3NA 4P29A 2IU1A 4DJAA 3PNLB 2J09A 4NRHB 4YNDA 3OTNA 4I1MA 4JZYA 5JJTA 4BY6A 4UI9J 2LSVA 3UUXA 1IYGA 1HO8A 3LXUX 2VSOE 2CHZA 2FI7A 1HF8A 3L22A 5ARFA 4BT9A 4JC8A 1UG3A 3QWWA 5HI7A 1XNFA 2XCCA 3RRNB 4CEMA 1H2TC 2VTBA 4E85A 4GYOA 2X6FA 3RKVA 2Q7FA 1E7UA 3ZVVA 3FUEA 2CG3A 5AJLA 2AXZA 3HIZA 3L08A 2YNQA 2XGMA 2XRZA 3NF1A 3FUIA 1E8ZA 3S7BA 1QNFA 2XQ0A 4CGWA 2J08A 1JUQA 4EBAG 3IBEA 3PEVB 5BW8C 5T4YA 3R9AB 4LRZA 2LO6A 3FTUA 4KT6B 3CKCA 1DNPA 3U64A 1OWPA 3DPDA 2WXNA 2DCPA 1TEZA 5CCMA 4EZKA 3CEQA 3CK7A 1PY1A 4AV7A 3AS8A 4MLPA 4Q96A 3HVEA 4PS8A 4G24A 1UJJA 3LYAA 5HQ8A 4L2LA 4QFVA 3QJZA 1WY6A 3K9IA 2PZIA 3LKUA 3APCA 2L9BA 4E6HA 2WMNA 3EHNA 3ZXSA 2DBAA 4AP2A 3UQ3A 4BX9A 4EPZA 3PNTB 3QWVA 4I1AA 4PUCA 3FEXA 4I1OB 4FADA 5CHEE 1L5JA 4GCNA 2WM9A 1QQEA 2YHEA 1EDUA 2Y3AA 5FT9A 3ZEFA 3MZLB 3Q49B 4AIFA 2WXJA 4FA6A 3FU5A 1X5BA 3EDTB 4WNEA 2X6HA 3TG5A 3JQ0A 2UY1B 1XGWA 2I1JA 3GYZA 4GAAA 4L1BA 4ANWA 4BT8A 4K0RA 3ESLA 4MKTA 1H0AA 2CHXA 4G1TA 2WXMA 3UMVA 4D10C 1EYHA 2FEZA 1NA3A 2FULA 4FP7A 1SZ9A 4HORA 3FTWA 3ZRHA 1TJFA 5ANRA 5EX0A 4HOUA 3OXFA 4BX8A 1ZBPA 2KATA 4DK5A 3VLEA 4J0UA 4JL0A 5AJDA 2HYZA 4UWHA 3FEYA 4FC8A 4WNFA 1HG2A 3HHMA 4KBQA 4RG6A 4GPKA 3JQ1A 3U3WA 3ZPJA 4KZ0A 4U63A 2YHCA 3CIAA 1PAQA 4RG9A 4TV3A 5T8IA 1INZA 4L23A 3BG1B 2WXOA 3GZ2A 1E8YA 2E0IA 4O6FA 5FZSA 4BFRA 2GGFA 1N54A 3G2WA 4UWKA 1E8WA 3BG0B 5KJNA 4R7LA 4GYYA 2Y4UA 2WB2A 2AXUA 3IEGA 2C0LA 4TUUA 5BT1A 3CVVA 2L6JA 4OVUA 2HM8A 2I2OA 3ML9A 2AW6A 4G11A 2UY1A 4JEUA 4I2WA 1UN8A 4UWFA 3RRMB 4B8CB 4XZ4A 3S7JA 1PC2A 4ILGA 1H2VC 2CHWA 3PUKA 3VTXA 2XHEA 4N3AA 4U04A 3ONKA 3RRUA 3JCKC 5FQ4A 1IQUA 1EPUA 3FY4A 5G2NA 3MX3A 2OVBA 3MKRA 3AU4A 2IJGX 2LSUA 4XX5A 4UWGA 3ULQA 1BPOA 3CVPA 3MGBA 2WMOA 3HVEB 5G55A 3RO2A 3D3MA 3CKBA 4AXHA 1B89A 3MCXA 5E75A 3N71A 5AYWD 1W3BA 5JHAA 3L13A 4CGVA 3IV0A 1VDYA 1GW6A 1Y8MA 2HO1A 3JYSA 2L0IA 3WXXA 4ACLA 2WQ6A 2FO7A 3EIQC 4KMOA 1E7VA 3SGHA 2IOLA 2J4DA 3ASDA 4KZCA 3RJVA 2A5UA 4N2QA 2R5SA 4WWPA 1N52A 3FUDA 3ZGQA 5LCWJ 3CK8A 5KJKA 2V4LA 4A3VA 3ZHEB 1HX8A 2YQ8A 1TJCA 4PS7A 1OWLA 4WUYA 4B0ZA 2Y4TA 2P58C 2UWJG 1WAO1 1IHGA 3UT7A 4U0ZA 2WXQA 2XRYA 4U8HA 1JWGA 4DI3A 4ACKA 3FTYA 1HH8A 4V3IA 3RIBA 5BUZA 3I4GA 3P1UA 1OWOA 2FF4A 2PL2A 1HXIA 3G2UA 4JXTA 4KVMA 2L0TB 2WXIA 3SBSA 2ILRA 1HE8A 2V5FA 3CHRA 2ONDA 3TG4A 3CR3A 5M72A 2NXPA 3KS2A 3T5VA 4U0UA 4JW1A 4A55A 2V8SE 4GZ3A 4A1GA 3GW4A 4A3TA 3PH0C 4I17A 3CQCB 4JHJA 4AOFA 2AXVA 4GZ6A 3FWVA 3U4TA 2WQ7A 3APDA 4GA0A 5CMWA 4UI9C 2VGYA 2X38A 3ESKA 4XKBA 1E8XA 4OYSA 5A23A 4F1SA 5DBKA 5EX3A 3MYVA 5A7DB 3QNKA 5LX8A 2RG8A 3Q5MA 3OXGA 3EHMA 4GMJA 4JA7A 4BSXA 3ASGA 5C2YA 3B7SA 1Z6TA 3MJWA 4ME2A 5BV1A 1HZ4A 3ENEA 5JJ6A 4MRUA 3MV2B 5ARGA 2JLBA 3BEEA 5LOZA 4HS2A 4YVOA 1MQSA 4EBAA 2X6KA 4DLOA 4WNDA 2ZU6B 5FQ8A 3MA5A 3ZFWA 3PDNA 3D9KA 4J8DA 1HG5A 3FUKA 3KEZA 2WXHA 3ONLA 1KLXA 3I5PA 2GRMA 5ENNA 3NZSA 1U3CA 4DLQA 4WNGA 2EQXA 3ZN3A 5JJ7A 1UW4B 4LERA 2X6JA 2X3MA 4LCTA 2WVIA 3SFZA 2QY7A 4ANVA 2WXPA 1IQRA 3ML8A 3UPVA 3B7TA 3DBSA 5LP0A 3FFLA 5LFAA 4ILHB 2E2EA 3CHQA 3HYMB 3VLDA 1OWMA 4F7AA 2VQ2A 4ABNA 1NP7A 3FULA 4HFGA 4N39A 4I43A 5C1DA 3CSFA 1H6KA 3PE3A 2VGXB 2XPIA 1OWNA 3G2VA 3PVLA 4K03A 3FUHA 3R7QA 3HDXA 1S0PA 3CHPA 3UT8A 1Z3YA 1H19A 3LS8A 5FQ6A 3T8MA 5G04C 2V0PA 3LPZA 3CVLA 3PUJA 3RO3A 3AU5A 4CT0A 3FP3A 3S7FA 1Z3XA 1EF1C 2XPYA 4UI9K 4CT4A 1P5QA 4AJWA 2I1KA 3SF4A 1A17A 2GW1A 5EDSA 1E90A 2A4ZA 3U66A 2BF0X 1KT0A 5FJYA 4C0MA 4URKA 3VTYA 4AM9A 4Y6CA 3GZ1A 1FCHA 3R7RA 2DIWA 4FLBA 3CGHA 2CG2A 4GA2A 4XIFA 3NQPA 2WQHA 3QKYA 4KXKB 2I9CA 3PS6A 4FULA 3MEKA 5G05J 3QC1A 4CDNA 2MOWA 3FTSA 5FQ7A 3TAXA 4FJZA 1UJKA 2J07A 4NURA 3TXNA 1UN9A 4U0SA 2C2LA 3ZYKA 2IOSA 3APFA 2XPZA 1OUVA 5FZRA 4I2ZA 5FWQA 2OV8A 3PREA 3AS5A 3CHOA 3D9NA 3FU6A 3IKOB 4CRWA 2M63A 5AIJA 4J8FA 4I6GA 3LEWA 4HLEA 4H7XA 3PRZA 4JVSA 3FH7A 4FJYA 4C0EA 3FUMA 3Q15A 3LCAA 4ATGA 4GZ5A 3ZW3A 3QARA 3MKQB 4G2VA 3QWPA 5J90A 1ZU2A 3D9JA 3FTZA 4GB9A 3URZA 2LNIA 3MKQA 3ZYMA 3PZDA 4JHKA 2BTDA 3CVNA 4N3BA 2BUGA 4CDMA 4EZJA 3P2BA 4GMLA 4MS6A 4HVBA 3CHMA 1NA0A 3FUJA 4L7TA 4GCOA 2PM6A 2YINA 3FDHA 4KYOB 5EKQD 3LVRE 2VSYA 1ELRA 3SNXA 1E96B 1DVPA 2XEVA 3FH5A 4GA1A 4PDXA 3CV0A 4L2YA 4FU3A 4ANUA 3TJPA 4DPRA 4B94A 4JPSA 3QDNA 4TRQA 3CQGB 1HFAA 4U07A 4XE0A 2FBNA 4GZDA 2VGXA 5T3RA 4GYWA 5DIZA 3CVYA 3OAWA 2XGOA 3D9OA 3D9LA 3FTVA 4LEUA 1SQMA 1QZ2A 4N3CA 2J9QA 3NZUA 4WWOA 4A1SA 3QAQA 4F3VA 3D9IA 3D9MA 3CVUA 3FU3A 2PQNA 3UX4A 1FVHA 2OVFA 3SHFA 2IFUA 3QK0A 4FHJA 4YVQC 4BTBA 3L16A 3LY9A 3S2AA 3TXMA 2KM4A 3PE4A 4G23A 5BPPA 4Q69A 4B8AA 4ILIA 3LY8A 3CSTA 4ANXA 3LY7A 4J8SA 3ZIMA 4UQYA 2KZTA 4W9RA 5CMYA 4GZCA 4KVOA 3C98A 3S7DA 4IN3B 3AS4A 4HOTA 2JEKA 2IF4A 1MHQA 3L54A 4GU5A 4EQFA 3L6AA 3QOUA 4J8EA 4N5CA 1WM5A 2AVPA 3B7UX 2C0MA 2WXGA 4LUNU 5KJLA 2J49A 3LDZA 2IQCA 2LAHA 3T5XA 4HOQA 4IYPA 3SZ7A 4C9BB 2PQRA 5CCLA 2VYIA 2WXLA 5A6CA 4I9CA 3B13A 1HU3A 2MHKA 4DI4A 4NQ0A 4OVVA 3SD5A 3L17A 4WAFA 1SZAA 3LVQE 3O4ZA 5D0QD 3TL5A 4FHKA 2VTBB 2NC9A 4CDRA 2CFUA 4H7YA 5ANLA 3ZHEA 2OOEA 1KT1A 3EJNA 3ASHA 3FU0A 3I4RB 3U9WA 3E4BA 2R17C 3LJ3A 4M3OA 4NACA 2KCLA 1Y6IA 5G04J 3Q4AB 3EIJA 3QB2A 4JHRA 2XGSA 3KD7A 4AEZC 2I6HA 2KCVA 1JWFA 2HR2A 4JEHA 2MRIA 3B7RL 4UWLA 3CLJA 1ELWA 3ZYQA 4HXIA 3CVWA 3FHEA 4IULA 5AENA 3GZSA 2R59A 3FUFA 2NSZA 2WXKA 5E76A 1H2UA 2RD0A 4APFA 3ASFA 2IONA 4XKCA 4PS3A 3OXLA 2WXRA 1JPLA 4CCAA 5BV0A 2VSNA 5JHBA 3SI5A 1YA0A 2XCBA 2KC7A 2X6IA 3Q47B 4AY6A 3FTXA 4Q94A 3KAEA 4BTAA 3CHSA 4RSYA 3O48A 3ZYLA 3IHYA 3UT4A 3RK6A 4UQXA 1LF8A 2VJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELK A;  3ZYK A;  1JWG A;  3G2T A;  3G2U A;  3D9I A;  3D9M A;  4JXT A;  1JWF A;  1VDY A;  2BF0 X;  2L0T B;  2QY7 A;  3D9O A;  3LDZ A;  2L0I A;  3D9P A;  1SZ9 A;  4NAC A;  5LP0 A;  3CLJ A;  1DVP A;  3D9N A;  1JUQ A;  3ZYQ A;  1HG2 A;  2DIW A;  4FLB A;  4FU3 A;  1EDU A;  2LO6 A;  2V8S E;  4AVX A;  4HFG A;  5LOZ A;  2KM4 A;  3ONK A;  1X5B A;  1HFA A;  3G2V A;  1SZA A;  3RRU A;  1JPL A;  1INZ A;  2DCP A;  1HX8 A;  1XGW A;  5CMW A;  5J08 A;  2MOW A;  1PY1 A;  4GZD A;  4Q96 A;  1HF8 A;  3D9K A;  1H0A A;  1HG5 A;  1UJJ A;  3D9J A;  4GZC A;  4Q94 A;  5CMY A;  1EYH A;  3ZYL A;  3ZYM A;  3ONL A;  3G2W A;  1UJK A;  1MHQ A;  3D9L A;  1LF8 A;  3G2S A; 
#chains in the Genus database with same CATH topology
 2GRQ B;  3FUN A;  2ETA A;  2WPV A;  5AQ7 A;  1U3D A;  1S63 A;  1Q2Z A;  3IHV A;  5HRY A;  4K5A B;  3TGO A;  4Y6W A;  5G05 C;  4ZFH A;  3DRA A;  4BWR A;  5BNW A;  2LAI A;  2KZT B;  2JAB A;  5D0O D;  4I6J A;  1N11 A;  3OTN A;  4BY6 A;  3UUX A;  1RZ4 A;  4JC8 A;  5HI7 A;  3RRN B;  4CEM A;  1RW2 A;  4GYO A;  4E85 A;  1D8D A;  2XGM A;  2XRZ A;  3NF1 A;  3FUI A;  1DCE A;  1QNF A;  3C72 A;  1LD8 A;  3FTU A;  1TNU A;  2LUH A;  3ZXP A;  5CRU A;  1UOH A;  3AS8 A;  4MLP A;  1TNY A;  3K9I A;  1N9A A;  1K3Z D;  4BX9 A;  3QWV A;  4I1A A;  4PUC A;  3FEX A;  5IY5 E;  5FT9 A;  1MX2 A;  3FU5 A;  3TG5 A;  1H0A A;  3DSU A;  4G1T A;  3Q9N C;  3UMV A;  4D10 C;  1NA3 A;  4GTT A;  3ZRH A;  1KZO A;  3OXF A;  1ZBP A;  2KAT A;  3SQV A;  4DK5 A;  3VLE A;  4J0U A;  3UM3 A;  3FEY A;  3R9M A;  4WNF A;  2EIJ E;  3CIA A;  1PAQ A;  4RG9 A;  4L23 A;  3BG1 B;  2EIN E;  2QZA A;  1N54 A;  4UWK A;  1E8W A;  5KJN A;  2Y4U A;  2OCC E;  2AXU A;  5BT1 A;  3PZ2 A;  3ML9 A;  4B8C B;  2UY1 A;  3S7J A;  1PC2 A;  3AG1 E;  4ILG A;  2CHW A;  3PUK A;  5AQA A;  3FY4 A;  3MX3 A;  3MGB A;  3Q78 A;  1B89 A;  5E75 A;  3L13 A;  4CGV A;  2L0I A;  5EYL A;  2WQ6 A;  2FO7 A;  1E7V A;  1O5M A;  3FUD A;  4A3V A;  1DC2 A;  5ENO D;  1TJC A;  2UWJ G;  1IHG A;  3UT7 A;  4U0Z A;  3W9G A;  4DI3 A;  3ISM C;  5BV0 A;  5BUZ A;  1HXI A;  4JXT A;  5AN8 A;  4BSZ B;  2WXI A;  1HE8 A;  2OND A;  3TG4 A;  5ENR D;  3ABK E;  4AOF A;  3PH0 C;  3CQC B;  3FWV A;  4GA0 A;  5CMW A;  4YDO A;  1V54 E;  4XKB A;  1KPS B;  3Q73 A;  1N0R A;  2FO1 E;  5HS0 A;  2XEN A;  3HXE A;  4U8Y D;  3QNK A;  4N5Q A;  3Q5M A;  3OXG A;  4BER A;  3EHM A;  2XZD G;  4JA7 A;  2IO3 C;  3X2Q E;  3MJW A;  1HZ4 A;  4UUC A;  3MV2 B;  5LOZ A;  2DYR E;  4EBA A;  2H6H A;  4DLO A;  3MA5 A;  3RAU A;  2WXH A;  2GRM A;  1JCR A;  2J8S D;  2EQX A;  4EHM A;  4LCT A;  2X3M A;  3V79 K;  4ANV A;  3UPV A;  2E2E A;  4HBD A;  5KNG A;  4F7A A;  2DVW A;  3C3Q A;  3UKR G;  1H6K A;  3G2V A;  3CHP A;  5FQ6 A;  5G04 C;  2V0P A;  3RO3 A;  4CT4 A;  2NYJ A;  2I1K A;  2GW1 A;  1E90 A;  4C0M A;  1KT0 A;  3DST A;  4URK A;  3VTY A;  4Y6C A;  4GA2 A;  2CG2 A;  2IEJ A;  4KXK B;  1K8K G;  3MEK A;  1NI1 A;  4FJZ A;  1N4Q A;  3D9H A;  2C2L A;  2ETB A;  2XPZ A;  1H6O A;  1BI7 B;  3CHO A;  3FU6 A;  3IKO B;  4I6G A;  3LEW A;  2P2C P;  3JUE A;  3FUM A;  4F1P A;  2XEE A;  4ZHB A;  3ZYM A;  4EZJ A;  4N3B A;  2BUG A;  4GML A;  4L7T A;  4GCO A;  3SNX A;  3HG0 D;  3TWT A;  4GTO A;  2XEV A;  4FU3 A;  3TJP A;  4DPR A;  2ZIR A;  3QDN A;  1HFA A;  1IKN D;  4U07 A;  2FBN A;  5T3R A;  4DUI A;  3Q79 A;  5DIZ A;  1YCS B;  3D9O A;  1SQM A;  2ZGG A;  4WWO A;  4F3V A;  3UX4 A;  3RSE G;  4BET A;  3SHF A;  1H6P A;  2BED A;  4B8A A;  4J8S A;  4NIK A;  4W9R A;  4GZC A;  4KVO A;  4IN3 B;  2RFA A;  2EIM E;  1WM5 A;  4LUN U;  2LAH A;  4IYP A;  2ZGD A;  1MX6 A;  4I9C A;  3B13 A;  1HU3 A;  2MHK A;  2XS8 A;  4NQ0 A;  3L17 A;  5ENQ D;  2VGE A;  3TL5 A;  3EJN A;  3AJI A;  3E4B A;  4NAC A;  3UTM A;  1Y6I A;  5G04 J;  3T8K A;  4JHR A;  3KD7 A;  1AP7 A;  2MRI A;  3CLJ A;  3FUF A;  5E76 A;  3KEA A;  4XKC A;  3V2X A;  1V55 E;  2KC7 A;  4Z68 A;  4AY6 A;  3CHS A;  3O48 A;  3UT4 A;  2VJ8 A;  3KSQ A;  5FTP A;  4F53 A;  4G26 A;  3JUI A;  4B89 A;  4IRU A;  4HI8 A;  3ASN E;  4O60 A;  5J08 A;  1OXJ A;  5FZQ A;  3PZ1 A;  4PH4 B;  1ZB1 A;  4WWN A;  1OT8 A;  3MV3 B;  1ELK A;  3RU0 A;  4AY5 A;  2GRL A;  3G2T A;  5JA4 D;  3AAA C;  3NBN B;  3I3N A;  1SA4 A;  4I1M A;  4JZY A;  4JB8 P;  4UI9 J;  2LSV A;  1TN6 A;  3LXU X;  2CHZ A;  2FI7 A;  1UG3 A;  2XCC A;  2X6F A;  2Q7F A;  1N95 A;  2CG3 A;  3L08 A;  2YNQ A;  3SO8 A;  2F0Y A;  2J08 A;  3IBE A;  2LO6 A;  2HE0 A;  5EIL A;  1DNP A;  4MBG A;  1OWP A;  3DPD A;  3EU5 A;  2WXN A;  5CCM A;  4Q96 A;  4PS8 A;  2R05 A;  3HVE A;  4G24 A;  5HQ8 A;  4CYM D;  2PZI A;  4E6H A;  3ZXS A;  3DEP A;  4GCN A;  2YHE A;  3ZEF A;  3Q49 B;  4AIF A;  1LTX A;  2UY1 B;  4BT8 A;  3GYZ A;  2FUL A;  2AJA A;  3FTW A;  4HOU A;  2Y0B G;  1FT1 A;  1HG2 A;  4KBQ A;  3JQ1 A;  3U3W A;  4RLY A;  3TWX A;  4TV3 A;  1INZ A;  3GZ2 A;  2E0I A;  4LG6 A;  4O6F A;  3IEG A;  3RRM B;  4HNA D;  3NOC D;  4XZ4 A;  1H2V C;  3VTX A;  4N3A A;  4U04 A;  3ONK A;  5FQ4 A;  1IQU A;  3AU4 A;  2LSU A;  1FT2 A;  1OY3 D;  5G55 A;  1TR4 A;  3MCX A;  3N71 A;  5AYW D;  4HRN A;  4ACL A;  4KMO A;  3ASD A;  3RJV A;  2R5S A;  3UXG A;  2P9P G;  5LCW J;  2V4L A;  3ZHE B;  1HX8 A;  5HKP A;  1WAO 1;  1HH8 A;  5KWD A;  3P1U A;  2FF4 A;  2PL2 A;  4KVM A;  4BES A;  2L0T B;  3SBS A;  4YDY A;  3CHR A;  3CR3 A;  3B95 A;  4A55 A;  3GW4 A;  4A3T A;  3UIN C;  4GZ6 A;  3U4T A;  3WG7 E;  3APD A;  4OYS A;  2EIK E;  5DBK A;  1JCQ A;  5EX3 A;  3MYV A;  3SFY A;  4GTP A;  4BSX A;  1Z6T A;  2XEH A;  3EU9 A;  3TWS A;  4ME2 A;  3ENE A;  4JD2 G;  3E37 A;  2ZU6 B;  3EUV A;  3D9K A;  1KLX A;  3I5P A;  1S64 A;  2B0O E;  4DLQ A;  2WVI A;  3SFZ A;  1IQR A;  3B7T A;  3DBS A;  1O1R A;  3VLD A;  4QQI A;  5B1A E;  2VGX B;  4K03 A;  3AU5 A;  3FP3 A;  1Z3X A;  4UI9 K;  4AJW A;  2R02 A;  1X81 A;  5EDS A;  2A4Z A;  5FJY A;  1FCH A;  2DIW A;  3QKY A;  3PS6 A;  3TWR A;  3BQO A;  1NL4 A;  2MOW A;  3FTS A;  4U0S A;  3ZYK A;  2IOS A;  5FZR A;  2H6G A;  3AS5 A;  3D9N A;  5D66 A;  5AIJ A;  3PRZ A;  3FH7 A;  3Q15 A;  2KBX A;  3QAR A;  4G2V A;  1A5E A;  2BKG A;  3QWP A;  3FTZ A;  3L82 A;  3CVN A;  4GMR A;  3CHM A;  1NA0 A;  3FUJ A;  4TXQ A;  3LVR E;  2VSY A;  5EID A;  1DVP A;  5EN5 D;  4PDX A;  1QYM A;  4L2Y A;  4B94 A;  4JPS A;  4XE0 A;  3KSL A;  4A63 B;  4GYW A;  4U95 D;  2P9I G;  4OAU C;  2J9Q A;  4A1S A;  3QAQ A;  3D9M A;  4G8K A;  1FVH A;  3F6Q A;  1MZC A;  2OVF A;  3JXI A;  1WDY A;  4YVQ C;  4F6R D;  3L16 A;  3LY9 A;  3S2A A;  2KM4 A;  3PE4 A;  4G23 A;  5BPP A;  3DSW A;  2H6F A;  3DWL G;  2KZT A;  3AG4 E;  4RQI A;  1O1T A;  3ABL E;  2JEK A;  1BI8 B;  3LJN A;  3DXM G;  3QOU A;  1N4S A;  3PZ3 A;  3UI2 A;  3B7U X;  5FIO A;  3T5X A;  4HOQ A;  4C9B B;  5CCL A;  4GTR A;  1TNO A;  4FHK A;  2NC9 A;  4HRM B;  1SVX A;  4DX5 D;  3LJ3 A;  4DX6 D;  4LNB A;  3QB2 A;  4AEZ C;  2KCV A;  2HR2 A;  4JEH A;  3HXF A;  3UM0 A;  1H2U A;  2RD0 A;  3ASF A;  2XCB A;  4Q94 A;  2OEW A;  5BXO A;  4OAV B;  1LF8 A;  2KCK A;  4XI9 A;  5KJM A;  3NOG D;  2ZXW E;  5CEA A;  2EIL E;  1HS6 A;  4G8L A;  3E30 A;  4N2S A;  4AVX A;  5LCW C;  4XI0 A;  4EEC A;  3G2S A;  3L9T A;  2CFZ A;  5CBN A;  2KXP C;  4DX7 D;  2DYS E;  3D9P A;  4UQZ A;  4P29 A;  3TWV A;  2J09 A;  4X8Q A;  4YND A;  3EHR A;  5AQB A;  5CEC B;  3AG3 E;  3DSS A;  3L22 A;  4BT9 A;  5ARF A;  2VTB A;  1H2T C;  3RKV A;  5AQ9 A;  4C48 B;  3Q9U C;  3ZVV A;  3FUE A;  5AJL A;  2AXZ A;  3HIZ A;  3S7B A;  2XQ0 A;  4CGW A;  4EBA G;  3PEV B;  5T4Y A;  4LRZ A;  4U96 D;  3U64 A;  4DX2 A;  3CEQ A;  4AV7 A;  3CK7 A;  1PY1 A;  1K1B A;  4L2L A;  4QFV A;  3QJZ A;  1WY6 A;  3APC A;  2WMN A;  4HB5 A;  2DBA A;  1U2V G;  2P9L G;  1N94 A;  3B7B A;  3PNT B;  4FAD A;  1SA5 A;  5CHE E;  4L9P A;  2WM9 A;  3MZL B;  4FA6 A;  1X5B A;  4WNE A;  2I1J A;  4L1B A;  3AG2 E;  4K0R A;  2WXM A;  4FP7 A;  5EX0 A;  4BX8 A;  5AJD A;  2RKK A;  2HYZ A;  4UWH A;  4GPK A;  3SFX A;  3UM1 A;  3ZPJ A;  4KZ0 A;  2YHC A;  3HXB A;  5T8I A;  2LXM A;  5EYP F;  2WXO A;  5CED B;  2F8Y A;  4BFR A;  2GGF A;  1FPP A;  1TN7 A;  3G2W A;  4GYY A;  2C0L A;  4TUU A;  4K5C A;  2L6J A;  4OVU A;  3JXJ A;  2AW6 A;  4JEU A;  4I2W A;  1UN8 A;  4UWF A;  4U8V D;  2XHE A;  1JCS A;  5G2N A;  2MYO A;  4XX5 A;  3ULQ A;  1BPO A;  3D3M A;  3CKB A;  1W3B A;  1VDY A;  3JYS A;  1MJ0 A;  2HO1 A;  3EIQ C;  3SGH A;  4WWP A;  1N52 A;  3CK8 A;  4GTS A;  5BXU A;  2YQ8 A;  4PS7 A;  1OWL A;  4B0Z A;  2GRN B;  3E34 A;  4U8H A;  2XRY A;  4ACK A;  3V2O A;  4HI9 A;  4V3I A;  3I4G A;  1OWO A;  4GTM A;  2V5F A;  3KS2 A;  3UM2 A;  3T5V A;  4U0U A;  4JW1 A;  2V8S E;  4GZ3 A;  2AXV A;  4J8Y A;  2VGY A;  2X38 A;  3ESK A;  1E8X A;  5ITZ F;  5A23 A;  4B93 B;  5LX8 A;  4GMJ A;  5C2Y A;  3B7S A;  5BV1 A;  1TNB A;  1YMP A;  4MRU A;  3BEE A;  4HS2 A;  1MQS A;  5FQ8 A;  3J5P A;  1HG5 A;  3KEZ A;  5B3S E;  4XEI G;  2BKK B;  3NZS A;  1U3C A;  3DXK G;  5JJ7 A;  1UW4 B;  4LER A;  4TXR A;  2WXP A;  5CRV A;  3ML8 A;  5LP0 A;  3FFL A;  5LFA A;  1OWM A;  2VQ2 A;  1NP7 A;  3FUL A;  4N39 A;  5C1D A;  3PVL A;  3R7Q A;  3HDX A;  1S0P A;  2V4H C;  3UT8 A;  1Z3Y A;  3LPZ A;  2XPY A;  1P5Q A;  3SF4 A;  1A17 A;  5B1B E;  1IXV A;  4AM9 A;  3R7R A;  2A5E A;  2WQH A;  2I9C A;  4FUL A;  5G05 J;  5FQ7 A;  1TN8 A;  1UJK A;  2J07 A;  3TXN A;  5AAR A;  1OUV A;  4I2Z A;  5FWQ A;  4CRW A;  2M63 A;  1WG0 A;  5KNH D;  4J8F A;  5KBA A;  3SY2 A;  4H7X A;  2Y69 E;  4FJY A;  4C0E A;  4ATG A;  3MKQ B;  3D9J A;  1AWC B;  4GB9 A;  2LNI A;  3MKQ A;  2BTD A;  4CDM A;  4HVB A;  4MS6 A;  3J5Q B;  2PM6 A;  1E96 B;  3FH5 A;  5AAO A;  3CV0 A;  2IY0 C;  2QC9 A;  4TRQ A;  2H6I A;  3CQG B;  4DX1 A;  3HXD A;  4GZD A;  3V31 A;  3DSV A;  3CVY A;  3OAW A;  1Z5S C;  3D9L A;  3FTV A;  4LEU A;  1OCR E;  1OCO E;  3D9I A;  2PQN A;  2IFU A;  3QK0 A;  4FHJ A;  4BTB A;  3CST A;  4ANX A;  3ZIM A;  4UQY A;  5CMY A;  3C98 A;  3S7D A;  4HOT A;  3AS4 A;  5D2M C;  3L54 A;  1MHQ A;  3L6A A;  4N5C A;  2XZT G;  3TWQ A;  2WXG A;  5KJL A;  2J49 A;  1O1S A;  3LDZ A;  3W9F A;  2IQC A;  3SZ7 A;  3ABM E;  2L6B A;  4DI4 A;  4OVV A;  4WAF A;  3LVQ E;  5D0Q D;  4H7Y A;  3ZHE A;  3Q75 A;  2OOE A;  3U9W A;  2R17 C;  2KCL A;  3Q4A B;  3EIJ A;  2QYJ A;  2XGS A;  3ZYQ A;  5AEN A;  4IUL A;  4O1P A;  2NSZ A;  3OXL A;  1JPL A;  5JHB A;  2VSN A;  1YA0 A;  3Q47 B;  3KAE A;  4BTA A;  4RSY A;  3IHY A;  3RK6 A;  4UQX A;  3Q7F A;  2QFC A;  3CVX A;  1FVF A;  3PEU B;  2P9K G;  1TNZ A;  3FH8 A;  4J6I A;  1YYH A;  4I9E A;  3VLF A;  4JA9 A;  4RVB A;  2AWI A;  1N4P A;  2WXF A;  4APO A;  1NZN A;  4I6E A;  3CK9 A;  2PM7 A;  1KZP A;  4DRX E;  4FLH A;  4HOS A;  5KCM A;  3IXE A;  2VSX E;  4G25 A;  3CVQ A;  3ULE G;  2J4B A;  4EZL A;  3SBT B;  3ZKJ A;  2P9U G;  2IU1 A;  4DJA A;  3PNL B;  4NRH B;  5JJT A;  1IYG A;  1HO8 A;  2VSO E;  1HF8 A;  3QWW A;  3E32 A;  1XNF A;  3BUA A;  1E7U A;  1N0Q A;  1E8Z A;  3Q7A A;  1JUQ A;  5BW8 C;  3R9A B;  4KT6 B;  3CKC A;  2R03 A;  3DSX A;  3ZNG A;  1TEZ A;  2DCP A;  4EZK A;  1UJJ A;  3LYA A;  3LKU A;  2L9B A;  3EHN A;  2QYU A;  4J7W A;  5CER B;  4AP2 A;  3UQ3 A;  4EPZ A;  4I1O B;  1L5J A;  1QQE A;  2Y3A A;  1EDU A;  2WXJ A;  2PNN A;  3EDT B;  2X6H A;  3JQ0 A;  1XGW A;  4ANW A;  4GAA A;  3ESL A;  4MKT A;  2CHX A;  4GTV A;  1QBQ A;  3E33 A;  1EYH A;  2FEZ A;  1SZ9 A;  4HOR A;  1TJF A;  5ANR A;  3T9K A;  4JL0 A;  4FC8 A;  3HHM A;  4RG6 A;  2Y1L E;  4U63 A;  4LNG A;  2IO2 C;  3NAW A;  1LD7 A;  2DZN A;  1E8Y A;  5FZS A;  1MX4 A;  1BLX B;  3BG0 B;  4R7L A;  2WB2 A;  4TUM A;  2GRO B;  2HM8 A;  2I2O A;  4G11 A;  5CBO A;  1MYO A;  3DPY A;  3UIO C;  3RRU A;  3JCK C;  1EPU A;  2OVB A;  3MKR A;  2IJG X;  4UWG A;  2XS1 A;  4K5B A;  4YDW A;  3CVP A;  2WMO A;  1OCC E;  3TWW A;  3HVE B;  3RO2 A;  4AXH A;  4BEP A;  5JHA A;  3IV0 A;  1GW6 A;  1Y8M A;  1D9S A;  3WXX A;  2IOL A;  2J4D A;  4KZC A;  2A5U A;  4N2Q A;  4HQD A;  3ZGQ A;  2ETC A;  5KJK A;  3EHQ A;  1NFI E;  3ZUV B;  4WUY A;  2P9N G;  2Y4T A;  2P58 C;  2WXQ A;  1JWG A;  3FTY A;  3CVV A;  3RIB A;  1TYQ G;  3G2U A;  2ILR A;  5M72 A;  2NXP A;  4A1G A;  4I17 A;  2DZO A;  4JHJ A;  1D8E A;  2WQ7 A;  1S70 B;  3C3O A;  4UI9 C;  3C5R A;  4F1S A;  4U7E B;  5A7D B;  2RG8 A;  3HRA A;  2V5Q C;  3ASG A;  4GTQ A;  5JJ6 A;  3NB2 A;  5ARG A;  2JLB A;  4YVO A;  5ENP D;  2X6K A;  1OCZ E;  4WND A;  3ZFW A;  3PDN A;  4J8D A;  3FUK A;  3ONL A;  3UIP C;  4CZ2 D;  5ENN A;  4YDE A;  4ATZ D;  4HRL A;  4WNG A;  3ZN3 A;  2X6J A;  2QY7 A;  2RFM A;  4ILH B;  4HLL A;  3CHQ A;  3HYM B;  4TXP A;  4ABN A;  4HFG A;  4I43 A;  3CSF A;  5H7P A;  1BU9 A;  3PE3 A;  3TWU A;  2XPI A;  1OWN A;  3FUH A;  1SW6 A;  5JMN D;  1N4R A;  1H19 A;  3LS8 A;  3T8M A;  3PUJ A;  3CVL A;  4CT0 A;  3S7F A;  1EF1 C;  2ZIS A;  3U66 A;  2BF0 X;  4GPM A;  1DCQ A;  5EIB E;  3GZ1 A;  4FLB A;  3CGH A;  4XIF A;  1IHB A;  3NQP A;  3QC1 A;  4CDN A;  3TAX A;  4LNU D;  2F37 A;  4NUR A;  1UN9 A;  3APF A;  2DWZ A;  2OV8 A;  1G3N B;  3PRE A;  2B6C A;  3ULY A;  4HLE A;  4JVS A;  1K1A A;  3LCA A;  4GZ5 A;  2GRR B;  3C3R A;  3ZW3 A;  4LSZ E;  5J90 A;  1ZU2 A;  3URZ A;  3PZD A;  4JHK A;  3PZ4 A;  3V30 A;  3P2B A;  2P9S G;  2R2L A;  3HXC A;  2YIN A;  3FDH A;  4KYO B;  5EKQ D;  1ELR A;  4GA1 A;  2F8X K;  4ANU A;  3ZU7 B;  2VGX A;  3UKU G;  2XGO A;  5ENT D;  1QZ2 A;  4N3C A;  3NZU A;  3CVU A;  3FU3 A;  3TXM A;  3BU8 A;  4Q69 A;  4ILI A;  3LY8 A;  5ENS D;  3LY7 A;  1BD8 A;  2IF4 A;  4GU5 A;  4EQF A;  4J8E A;  2AVP A;  2C0M A;  2LXL A;  2PQR A;  2VYI A;  2WXL A;  5A6C A;  4M7C A;  3SD5 A;  1SZA A;  3O4Z A;  5FIN A;  2VTB B;  4O1O A;  4CDR A;  2CFU A;  3ASO E;  5ANL A;  1KT1 A;  3I4R B;  3ASH A;  3FU0 A;  4M3O A;  2GRP B;  2I6H A;  1JWF A;  3B7R L;  4UWL A;  3CVW A;  1ELW A;  3DEO A;  4HXI A;  3FHE A;  3GZS A;  2R59 A;  2WXK A;  4APF A;  2ION A;  4PS3 A;  2WXR A;  2OEV A;  4CCA A;  3SI5 A;  2X6I A;  3FTX A;  3ZYL A; 
#chains in the Genus database with same CATH homology
 2QFC A;  2KCK A;  3CVX A;  1FVF A;  3PEU B;  3FUN A;  4XI9 A;  3FH8 A;  4J6I A;  5KJM A;  2WPV A;  5FTP A;  4F53 A;  4I9E A;  1U3D A;  4G26 A;  3VLF A;  3JUI A;  4JA9 A;  1HS6 A;  4RVB A;  4B89 A;  3IHV A;  4N2S A;  4AVX A;  2AWI A;  4IRU A;  3TGO A;  5LCW C;  4Y6W A;  2WXF A;  5G05 C;  4APO A;  4XI0 A;  1NZN A;  4I6E A;  5J08 A;  3CK9 A;  2PM7 A;  4BWR A;  5FZQ A;  4PH4 B;  4FLH A;  5BNW A;  2LAI A;  2KZT B;  4EEC A;  3G2S A;  4WWN A;  4HOS A;  3MV3 B;  1ELK A;  3RU0 A;  2CFZ A;  5KCM A;  4AY5 A;  2GRL A;  3G2T A;  2VSX E;  4G25 A;  5D0O D;  3CVQ A;  3D9P A;  4I6J A;  2J4B A;  4UQZ A;  3SBT B;  4EZL A;  3I3N A;  4P29 A;  2IU1 A;  4DJA A;  3PNL B;  2J09 A;  4NRH B;  4YND A;  3OTN A;  4I1M A;  4JZY A;  5JJT A;  4BY6 A;  4UI9 J;  2LSV A;  3UUX A;  1IYG A;  1HO8 A;  3LXU X;  2VSO E;  2CHZ A;  2FI7 A;  1HF8 A;  3L22 A;  5ARF A;  4BT9 A;  4JC8 A;  1UG3 A;  3QWW A;  5HI7 A;  1XNF A;  2XCC A;  3RRN B;  4CEM A;  1H2T C;  2VTB A;  4E85 A;  4GYO A;  2X6F A;  3RKV A;  2Q7F A;  1E7U A;  3ZVV A;  3FUE A;  2CG3 A;  5AJL A;  2AXZ A;  3HIZ A;  3L08 A;  2YNQ A;  2XGM A;  2XRZ A;  3NF1 A;  3FUI A;  1E8Z A;  3S7B A;  1QNF A;  2XQ0 A;  4CGW A;  2J08 A;  1JUQ A;  4EBA G;  3IBE A;  3PEV B;  5BW8 C;  5T4Y A;  3R9A B;  4LRZ A;  2LO6 A;  3FTU A;  4KT6 B;  3CKC A;  1DNP A;  3U64 A;  1OWP A;  3DPD A;  2WXN A;  2DCP A;  1TEZ A;  5CCM A;  4EZK A;  3CEQ A;  3CK7 A;  1PY1 A;  4AV7 A;  3AS8 A;  4MLP A;  4Q96 A;  3HVE A;  4PS8 A;  4G24 A;  1UJJ A;  3LYA A;  5HQ8 A;  4L2L A;  4QFV A;  3QJZ A;  1WY6 A;  3K9I A;  2PZI A;  3LKU A;  3APC A;  2L9B A;  4E6H A;  2WMN A;  3EHN A;  3ZXS A;  2DBA A;  4AP2 A;  3UQ3 A;  4BX9 A;  4EPZ A;  3PNT B;  3QWV A;  4I1A A;  4PUC A;  3FEX A;  4I1O B;  4FAD A;  5CHE E;  1L5J A;  4GCN A;  2WM9 A;  1QQE A;  2YHE A;  1EDU A;  2Y3A A;  5FT9 A;  3ZEF A;  3MZL B;  3Q49 B;  4AIF A;  2WXJ A;  4FA6 A;  3FU5 A;  1X5B A;  3EDT B;  4WNE A;  2X6H A;  3TG5 A;  3JQ0 A;  2UY1 B;  1XGW A;  2I1J A;  3GYZ A;  4GAA A;  4L1B A;  4ANW A;  4BT8 A;  4K0R A;  3ESL A;  4MKT A;  1H0A A;  2CHX A;  4G1T A;  2WXM A;  3UMV A;  4D10 C;  1EYH A;  2FEZ A;  1NA3 A;  2FUL A;  4FP7 A;  1SZ9 A;  4HOR A;  3FTW A;  3ZRH A;  1TJF A;  5ANR A;  5EX0 A;  4HOU A;  3OXF A;  4BX8 A;  1ZBP A;  2KAT A;  4DK5 A;  3VLE A;  4J0U A;  4JL0 A;  5AJD A;  2HYZ A;  4UWH A;  3FEY A;  4FC8 A;  4WNF A;  1HG2 A;  3HHM A;  4KBQ A;  4RG6 A;  4GPK A;  3JQ1 A;  3U3W A;  3ZPJ A;  4KZ0 A;  4U63 A;  2YHC A;  3CIA A;  1PAQ A;  4RG9 A;  4TV3 A;  5T8I A;  1INZ A;  4L23 A;  3BG1 B;  2WXO A;  3GZ2 A;  1E8Y A;  2E0I A;  4O6F A;  5FZS A;  4BFR A;  2GGF A;  1N54 A;  3G2W A;  4UWK A;  1E8W A;  3BG0 B;  5KJN A;  4R7L A;  4GYY A;  2Y4U A;  2WB2 A;  2AXU A;  3IEG A;  2C0L A;  4TUU A;  5BT1 A;  3CVV A;  2L6J A;  4OVU A;  2HM8 A;  2I2O A;  3ML9 A;  2AW6 A;  4G11 A;  2UY1 A;  4JEU A;  4I2W A;  1UN8 A;  4UWF A;  3RRM B;  4B8C B;  4XZ4 A;  3S7J A;  1PC2 A;  4ILG A;  1H2V C;  2CHW A;  3PUK A;  3VTX A;  2XHE A;  4N3A A;  4U04 A;  3ONK A;  3RRU A;  3JCK C;  5FQ4 A;  1IQU A;  1EPU A;  3FY4 A;  5G2N A;  3MX3 A;  2OVB A;  3MKR A;  3AU4 A;  2IJG X;  2LSU A;  4XX5 A;  4UWG A;  3ULQ A;  1BPO A;  3CVP A;  3MGB A;  2WMO A;  3HVE B;  5G55 A;  3RO2 A;  3D3M A;  3CKB A;  4AXH A;  1B89 A;  3MCX A;  5E75 A;  3N71 A;  5AYW D;  1W3B A;  5JHA A;  3L13 A;  4CGV A;  3IV0 A;  1VDY A;  1GW6 A;  1Y8M A;  2HO1 A;  3JYS A;  2L0I A;  3WXX A;  4ACL A;  2WQ6 A;  2FO7 A;  3EIQ C;  4KMO A;  1E7V A;  3SGH A;  2IOL A;  2J4D A;  3ASD A;  4KZC A;  3RJV A;  2A5U A;  4N2Q A;  2R5S A;  4WWP A;  1N52 A;  3FUD A;  3ZGQ A;  5LCW J;  3CK8 A;  5KJK A;  2V4L A;  4A3V A;  3ZHE B;  1HX8 A;  2YQ8 A;  1TJC A;  4PS7 A;  1OWL A;  4WUY A;  4B0Z A;  2Y4T A;  2P58 C;  2UWJ G;  1WAO 1;  1IHG A;  3UT7 A;  4U0Z A;  2WXQ A;  2XRY A;  4U8H A;  1JWG A;  4DI3 A;  4ACK A;  3FTY A;  1HH8 A;  4V3I A;  3RIB A;  5BUZ A;  3I4G A;  3P1U A;  1OWO A;  2FF4 A;  2PL2 A;  1HXI A;  3G2U A;  4JXT A;  4KVM A;  2L0T B;  2WXI A;  3SBS A;  2ILR A;  1HE8 A;  2V5F A;  3CHR A;  2OND A;  3TG4 A;  3CR3 A;  5M72 A;  2NXP A;  3KS2 A;  3T5V A;  4U0U A;  4JW1 A;  4A55 A;  2V8S E;  4GZ3 A;  4A1G A;  3GW4 A;  4A3T A;  3PH0 C;  4I17 A;  3CQC B;  4JHJ A;  4AOF A;  2AXV A;  4GZ6 A;  3FWV A;  3U4T A;  2WQ7 A;  3APD A;  4GA0 A;  5CMW A;  4UI9 C;  2VGY A;  2X38 A;  3ESK A;  4XKB A;  1E8X A;  4OYS A;  5A23 A;  4F1S A;  5DBK A;  5EX3 A;  3MYV A;  5A7D B;  3QNK A;  5LX8 A;  2RG8 A;  3Q5M A;  3OXG A;  3EHM A;  4GMJ A;  4JA7 A;  4BSX A;  3ASG A;  5C2Y A;  3B7S A;  1Z6T A;  3MJW A;  4ME2 A;  5BV1 A;  1HZ4 A;  3ENE A;  5JJ6 A;  4MRU A;  3MV2 B;  5ARG A;  2JLB A;  3BEE A;  5LOZ A;  4HS2 A;  4YVO A;  1MQS A;  4EBA A;  2X6K A;  4DLO A;  4WND A;  2ZU6 B;  5FQ8 A;  3MA5 A;  3ZFW A;  3PDN A;  3D9K A;  4J8D A;  1HG5 A;  3FUK A;  3KEZ A;  2WXH A;  3ONL A;  1KLX A;  3I5P A;  2GRM A;  5ENN A;  3NZS A;  1U3C A;  4DLQ A;  4WNG A;  2EQX A;  3ZN3 A;  5JJ7 A;  1UW4 B;  4LER A;  2X6J A;  2X3M A;  4LCT A;  2WVI A;  3SFZ A;  2QY7 A;  4ANV A;  2WXP A;  1IQR A;  3ML8 A;  3UPV A;  3B7T A;  3DBS A;  5LP0 A;  3FFL A;  5LFA A;  4ILH B;  2E2E A;  3CHQ A;  3HYM B;  3VLD A;  1OWM A;  4F7A A;  2VQ2 A;  4ABN A;  1NP7 A;  3FUL A;  4HFG A;  4N39 A;  4I43 A;  5C1D A;  3CSF A;  1H6K A;  3PE3 A;  2VGX B;  2XPI A;  1OWN A;  3G2V A;  3PVL A;  4K03 A;  3FUH A;  3R7Q A;  3HDX A;  1S0P A;  3CHP A;  3UT8 A;  1Z3Y A;  1H19 A;  3LS8 A;  5FQ6 A;  3T8M A;  5G04 C;  2V0P A;  3LPZ A;  3CVL A;  3PUJ A;  3RO3 A;  3AU5 A;  4CT0 A;  3FP3 A;  3S7F A;  1Z3X A;  1EF1 C;  2XPY A;  4UI9 K;  4CT4 A;  1P5Q A;  4AJW A;  2I1K A;  3SF4 A;  1A17 A;  2GW1 A;  5EDS A;  1E90 A;  2A4Z A;  3U66 A;  2BF0 X;  1KT0 A;  5FJY A;  4C0M A;  4URK A;  3VTY A;  4AM9 A;  4Y6C A;  3GZ1 A;  1FCH A;  3R7R A;  2DIW A;  4FLB A;  3CGH A;  2CG2 A;  4GA2 A;  4XIF A;  3NQP A;  2WQH A;  3QKY A;  4KXK B;  2I9C A;  3PS6 A;  4FUL A;  3MEK A;  5G05 J;  3QC1 A;  4CDN A;  2MOW A;  3FTS A;  5FQ7 A;  3TAX A;  4FJZ A;  1UJK A;  2J07 A;  4NUR A;  3TXN A;  1UN9 A;  4U0S A;  2C2L A;  3ZYK A;  2IOS A;  3APF A;  2XPZ A;  1OUV A;  5FZR A;  4I2Z A;  5FWQ A;  2OV8 A;  3PRE A;  3AS5 A;  3CHO A;  3D9N A;  3FU6 A;  3IKO B;  4CRW A;  2M63 A;  5AIJ A;  4J8F A;  4I6G A;  3LEW A;  4HLE A;  4H7X A;  3PRZ A;  4JVS A;  3FH7 A;  4FJY A;  4C0E A;  3FUM A;  3Q15 A;  3LCA A;  4ATG A;  4GZ5 A;  3ZW3 A;  3QAR A;  3MKQ B;  4G2V A;  3QWP A;  5J90 A;  1ZU2 A;  3D9J A;  3FTZ A;  4GB9 A;  3URZ A;  2LNI A;  3MKQ A;  3ZYM A;  3PZD A;  4JHK A;  2BTD A;  3CVN A;  4N3B A;  2BUG A;  4CDM A;  4EZJ A;  3P2B A;  4GML A;  4MS6 A;  4HVB A;  3CHM A;  1NA0 A;  3FUJ A;  4L7T A;  4GCO A;  2PM6 A;  2YIN A;  3FDH A;  4KYO B;  5EKQ D;  3LVR E;  2VSY A;  1ELR A;  3SNX A;  1E96 B;  1DVP A;  2XEV A;  3FH5 A;  4GA1 A;  4PDX A;  3CV0 A;  4L2Y A;  4FU3 A;  4ANU A;  3TJP A;  4DPR A;  4B94 A;  4JPS A;  3QDN A;  4TRQ A;  3CQG B;  1HFA A;  4U07 A;  4XE0 A;  2FBN A;  4GZD A;  2VGX A;  5T3R A;  4GYW A;  5DIZ A;  3CVY A;  3OAW A;  2XGO A;  3D9O A;  3D9L A;  3FTV A;  4LEU A;  1SQM A;  1QZ2 A;  4N3C A;  2J9Q A;  3NZU A;  4WWO A;  4A1S A;  3QAQ A;  4F3V A;  3D9I A;  3D9M A;  3CVU A;  3FU3 A;  2PQN A;  3UX4 A;  1FVH A;  2OVF A;  3SHF A;  2IFU A;  3QK0 A;  4FHJ A;  4YVQ C;  4BTB A;  3L16 A;  3LY9 A;  3S2A A;  3TXM A;  2KM4 A;  3PE4 A;  4G23 A;  5BPP A;  4Q69 A;  4B8A A;  4ILI A;  3LY8 A;  3CST A;  4ANX A;  3LY7 A;  4J8S A;  3ZIM A;  4UQY A;  2KZT A;  4W9R A;  5CMY A;  4GZC A;  4KVO A;  3C98 A;  3S7D A;  4IN3 B;  3AS4 A;  4HOT A;  2JEK A;  2IF4 A;  1MHQ A;  3L54 A;  4GU5 A;  4EQF A;  3L6A A;  3QOU A;  4J8E A;  4N5C A;  1WM5 A;  2AVP A;  3B7U X;  2C0M A;  2WXG A;  4LUN U;  5KJL A;  2J49 A;  3LDZ A;  2IQC A;  2LAH A;  3T5X A;  4HOQ A;  4IYP A;  3SZ7 A;  4C9B B;  2PQR A;  5CCL A;  2VYI A;  2WXL A;  5A6C A;  4I9C A;  3B13 A;  1HU3 A;  2MHK A;  4DI4 A;  4NQ0 A;  4OVV A;  3SD5 A;  3L17 A;  4WAF A;  1SZA A;  3LVQ E;  3O4Z A;  5D0Q D;  3TL5 A;  4FHK A;  2VTB B;  2NC9 A;  4CDR A;  2CFU A;  4H7Y A;  5ANL A;  3ZHE A;  2OOE A;  1KT1 A;  3EJN A;  3ASH A;  3FU0 A;  3I4R B;  3U9W A;  3E4B A;  2R17 C;  3LJ3 A;  4M3O A;  4NAC A;  2KCL A;  1Y6I A;  5G04 J;  3Q4A B;  3EIJ A;  3QB2 A;  4JHR A;  2XGS A;  3KD7 A;  4AEZ C;  2I6H A;  2KCV A;  1JWF A;  2HR2 A;  4JEH A;  2MRI A;  3B7R L;  4UWL A;  3CLJ A;  1ELW A;  3ZYQ A;  4HXI A;  3CVW A;  3FHE A;  4IUL A;  5AEN A;  3GZS A;  2R59 A;  3FUF A;  2NSZ A;  2WXK A;  5E76 A;  1H2U A;  2RD0 A;  4APF A;  3ASF A;  2ION A;  4XKC A;  4PS3 A;  3OXL A;  2WXR A;  1JPL A;  4CCA A;  5BV0 A;  2VSN A;  5JHB A;  3SI5 A;  1YA0 A;  2XCB A;  2KC7 A;  2X6I A;  3Q47 B;  4AY6 A;  3FTX A;  4Q94 A;  3KAE A;  4BTA A;  3CHS A;  4RSY A;  3O48 A;  3ZYL A;  3IHY A;  3UT4 A;  3RK6 A;  4UQX A;  1LF8 A;  2VJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...