1ELKA

Vhs domain of tom1 protein from h. sapiens
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
SDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the VHS domain of human Tom1 (target of myb 1): insights into interactions with proteins and membranes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords TARGET OF MYB1
total genus 57
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elkA00
2KM4A 1LF8A 3LDZA 3ONLA 2MOWA 5J08A 3D9NA 1ELKA 4NACA 1JWFA 1EYHA 2LO6A 3ZYQA 3ZYMA 1JPLA 3G2SA 3D9JA 3D9IA 4AVXA 3D9KA 1UJKA 1X5BA 3G2WA 4JXTA 4Q94A 3ZYLA 3CLJA 4GZDA 4HFGA 1HX8A 2L0IA 3D9OA 5LOZA 2L0TB 3G2UA 3G2TA 2DCPA 3ONKA 1XGWA 4FU3A 1HG5A 1HG2A 5CMWA 4FLBA 2DIWA 1INZA 3D9LA 1DVPA 2QY7A 1JUQA 3ZYKA 2V8SE 3RRUA 3D9PA 2BF0X 3D9MA 1UJJA 4Q96A 1HFAA 1MHQA 5CMYA 5LP0A 1PY1A 1VDYA 1SZAA 4GZCA 1JWGA 3G2VA 1H0AA 1HF8A 1SZ9A 1EDUA
chains in the Genus database with same CATH superfamily
4B0ZA 1QQEA 3LY9A 4L2LA 1O1TA 4EZLA 3T9KA 2WXMA 3RSEG 3QKYA 4DRXE 3RJVA 4KXKB 3ZXSA 4L7TA 3QWVA 1ZU2A 3FHEA 5FINA 5EYLA 1OCRE 1EF1C 1UN9A 3HVEA 1QZ2A 4TRQA 2J4BA 2P9SG 4EBAA 3I4GA 3CQGB 5G55A 5AENA 4FHKA 3ESLA 2BUGA 3OXGA 3DPYA 4N3BA 4I1OB 2J07A 2R03A 2RG8A 3LPZA 3UT7A 1N0QA 4HOQA 3D9PA 3TWXA 2J08A 1JWGA 1PC2A 5J08A 1K1BA 2PM6A 4A3VA 1QYMA 2NSZA 1N11A 1H6PA 1BPOA 3I4RB 3ABKE 1OCZE 1E8WA 2QYUA 3K9IA 1Z3XA 2KXPC 4EPZA 4EBAG 5IY5E 4F6RD 5G05C 1KT0A 2QY7A 2IEJA 2V4LA 3U3WA 2CFZA 5C1DA 5CEDB 2QYJA 4AEZC 1E8YA 1JWFA 1BI8B 4OVVA 5A7DB 3IBEA 4Y6WA 1E8XA 3ZUVB 3FUIA 4TXPA 1SVXA 4KVOA 3FH7A 4KYOB 5BW8C 5EIDA 4G8KA 2X6KA 4I6GA 3PDNA 1X81A 5LX8A 4JEUA 1SQMA 5CBOA 4GTOA 3BU8A 4URKA 3NBNB 5LCWC 3I5PA 2J8SD 4JC8A 3CLJA 2EQXA 4GA2A 4UWLA 2ZGGA 1Q2ZA 2DCPA 3MKQB 4TXRA 4CDMA 2XZDG 4YDEA 3IHYA 1MYOA 2IU1A 3UM1A 2C2LA 2NYJA 4F1SA 3D9KA 3SI5A 3TWSA 2MRIA 2VJ8A 4JA9A 1OXJA 4J8DA 2CHXA 3FH5A 1WM5A 4K0RA 3FUMA 5CHEE 3MV3B 2IOLA 4CCAA 4G25A 1JCRA 5E75A 3FUDA 3SHFA 4PH4B 1S63A 3MV2B 4DX1A 3HIZA 3P1UA 3PE4A 3CK9A 3UX4A 2WMNA 1N4PA 4E85A 3FH8A 3FTYA 3IEGA 4DLQA 3TJPA 4GTSA 4ZFHA 3HXDA 3RAUA 3Q7FA 4U04A 3APFA 1BI7B 3PUKA 3CVVA 5JJ7A 3DSTA 3MX3A 3ULEG 4HRMB 4BERA 3ZPJA 3VLEA 5FZQA 1OWNA 1S64A 1WG0A 4ILHB 3E4BA 5FT9A 2WVIA 1RW2A 2XPYA 3HXFA 2XCBA 4A1SA 4A1GA 2ZGDA 1LD7A 4FJZA 4RG9A 5FTPA 4BWRA 3QDNA 4JHKA 4XX5A 4O1PA 1UN8A 3PRZA 3R9MA 1H2VC 3SNXA 2UY1A 4TV3A 3E30A 5AQ9A 4GPMA 1K8KG 1E90A 3LCAA 4W9RA 4U0ZA 1MHQA 3L82A 4ATGA 3MKQA 3CR3A 4NACA 1LTXA 1AP7A 2V5QC 3ML9A 2OVFA 4GZDA 5HQ8A 4Q69A 4Y6CA 4XIFA 4IN3B 3L08A 4I6JA 4MRUA 3PNTB 2JEKA 3FUEA 3LVRE 4LSZE 2KCVA 4Q96A 1TNZA 4CT4A 3QC1A 1Z6TA 2RKKA 3D9JA 5G04J 2IONA 3E32A 2FBNA 1E7UA 4N5QA 4JEHA 3S2AA 1SW6A 2YHCA 3AU5A 1H2TC 2XS8A 3CHRA 3TG4A 2FULA 5CERB 5FQ6A 2WQ7A 1K1AA 3SBTB 3UM3A 4GMRA 3ZIMA 4BX9A 1X5BA 5KJLA 4KBQA 2H6HA 4DPRA 2HR2A 2L9BA 2OEVA 3KAEA 4LNBA 3SZ7A 3ONLA 2VGEA 1ELKA 2FI7A 3FTZA 3MCXA 4J8YA 4KZCA 1YA0A 3HHMA 2NC9A 1HX8A 2AW6A 4WNEA 3LJNA 4CZ2D 2AXZA 5EX0A 4N5CA 3W9FA 1KLXA 2XEVA 2OCCE 5FQ8A 5ENPD 4A3TA 3GZSA 1FT2A 2KATA 4ACKA 3C3QA 3ZYMA 4N2QA 3G2SA 2Q7FA 4WWOA 2GW1A 4APFA 1NA0A 4B8CB 2ONDA 3AU4A 3PEVB 3HXBA 3KS2A 2YHEA 5T4YA 4ANWA 4HXIA 3E37A 4B93B 2P9PG 3C5RA 2FEZA 1H6OA 5AN8A 5BPPA 4TUUA 1N4QA 3DXMG 4GTMA 2I6HA 3FU6A 2WPVA 3D9OA 4UWFA 2I1JA 3S7JA 4WNFA 4GMLA 2VSNA 3Q78A 2XEEA 4ANXA 5EKQD 4UWHA 4PS7A 4HBDA 4CT0A 2WB2A 3RRMB 1TNBA 5ENRD 3FP3A 4LRZA 4G24A 2WMOA 3U66A 1Z3YA 3C72A 4HB5A 3ZNGA 3L16A 5BXUA 2VGYA 5DIZA 4GZ6A 3PUJA 1JUQA 3JUIA 2L6JA 5KNHD 3CKBA 4A55A 4EZKA 4AM9A 3KSQA 3T5XA 2NXPA 4GZ3A 4G8LA 4AY5A 2L6BA 4GMJA 2H6IA 3TWTA 3UM0A 5CRUA 4GCNA 3ASFA 4UQXA 4DUIA 3Q9UC 3ZEFA 4IRUA 2KM4A 3NOCD 3OAWA 1WAO1 3UI2A 4FADA 4GCOA 4JW1A 2BKKB 2X38A 1XNFA 1BD8A 4LUNU 1FPPA 5KJKA 4AY6A 2ZU6B 3MZLB 3DSXA 2P9UG 4L1BA 1SA5A 1H0AA 3FUJA 3D9HA 5KBAA 3L6AA 3QARA 5ANRA 3NZUA 3LY8A 3CHMA 4NURA 1ZB1A 2DZNA 2AWIA 1UW4B 2MYOA 1OUVA 4HOTA 3UIPC 2WXQA 5B3SE 2IY0C 1HO8A 1V55E 3EUVA 5T3RA 5KJNA 4FLBA 3E33A 1N54A 2GRRB 1LD8A 2Y0BG 4WWPA 3LY7A 2JABA 3IV0A 4F7AA 5ARFA 2Y1LE 2IF4A 4B8AA 4C0EA 3DXKG 4ILIA 4XI0A 4N3CA 3FU0A 3FUKA 1TN8A 2BEDA 1N0RA 1ELWA 4ANUA 5CBNA 2LXMA 4JXTA 5EDSA 2Y4UA 4HI9A 2EIKE 1DVPA 4M3OA 3PZ2A 4U07A 3L22A 4CEMA 4UQZA 4RSYA 2I9CA 4YDYA 4TXQA 2C0LA 3S7DA 3LEWA 2V5FA 1E96B 5J90A 2A5EA 3ZFWA 3BEEA 4U0UA 2QFCA 4LNUD 4GAAA 1IXVA 4AXHA 4BEPA 3RKVA 2WQHA 3UKRG 2GRPB 2MOWA 3X2QE 4NQ0A 3Q49B 3EIJA 2IO3C 2OV8A 2WXFA 3ZW3A 2F8XK 3FTUA 4MLPA 1NA3A 4GU5A 2VQ2A 5T8IA 3UM2A 2GGFA 4O1OA 4ANVA 1YMPA 2XQ0A 3NZSA 1TEZA 2I2OA 4AV7A 1HH8A 2ETCA 5C2YA 2AXUA 3SD5A 1B89A 2R02A 3ABLE 3RRUA 4U96D 4APOA 5FIOA 1LF8A 2LSVA 4I6EA 3Q47B 4GYWA 4ME2A 3ULQA 5ENSD 5BT1A 4I17A 3BG1B 2GRNB 3AS5A 1DC2A 3FULA 5D66A 3LVQE 1UG3A 3AG4E 1OY3D 3QOUA 2Y69E 3Q9NC 3GYZA 4RLYA 4GPKA 3DEOA 1S70B 3DPDA 3PH0C 3QJZA 3NOGD 2XENA 5H7PA 3T8MA 1U3DA 5D2MC 3BUAA 1FVFA 1MX6A 4DX7D 1OCCE 4QFVA 1TYQG 2LSUA 1OCOE 5M72A 1NP7A 4ACLA 4I1AA 3URZA 3JYSA 1JPLA 4FP7A 2OEWA 3SF4A 2KZTB 2WXRA 4M7CA 2RFAA 5A6CA 4GZ5A 2CFUA 1P5QA 3UKUG 4GTTA 2MHKA 1WDYA 3KD7A 1IYGA 1OWPA 1HU3A 2WXIA 4NRHB 2XGSA 5ANLA 3VLDA 2QZAA 3UPVA 1HZ4A 4BY6A 3GW4A 1QBQA 1OWLA 2JLBA 5AQAA 3TWVA 2V4HC 3CHQA 2CHZA 3DRAA 1RZ4A 4HOUA 4H7XA 3LXUX 2ILRA 2A5UA 4J8EA 2X3MA 4JL0A 5JJ6A 1UJKA 4PDXA 3FU5A 3SY2A 2J49A 3B95A 5AJLA 1KZPA 4HQDA 4GYOA 5ENNA 3AG3E 3ZVVA 3FTWA 5EILA 5FJYA 3ZKJA 5JMND 4KT6B 3OXLA 5EIBE 4I43A 4C0MA 2LXLA 3ASOE 5FWQA 2ZISA 2PNNA 1UOHA 3FEYA 3TWUA 3DSSA 1Y6IA 1W3BA 1Z5SC 3RRNB 3WG7E 4K03A 4JB8P 3CVQA 3V31A 3ONKA 2HM8A 2X6JA 1O1SA 1A17A 3PREA 4IULA 3PZ3A 4B89A 4L2YA 4I2ZA 4EECA 3PZ1A 1MQSA 2C0MA 5G05J 3PS6A 2A4ZA 1H6KA 3FTXA 3LKUA 4IYPA 3UUXA 5ENOD 4DK5A 1TNUA 2DIWA 4HRNA 1TJCA 3LS8A 1TNOA 2F8YA 4HLLA 2IJGX 4XEIG 3CVPA 5FZRA 2KBXA 2GRMA 1NFIE 4LERA 5CMWA 4ZHBA 3FY4A 1IHGA 2FO7A 5G2NA 4MBGA 3MEKA 3VTXA 3Q79A 2CG3A 1TN7A 2AJAA 5AJDA 2ETAA 4AVXA 4B94A 3UINC 3W9GA 2R05A 4HVBA 1V54E 4G11A 4K5AB 3QNKA 4GTQA 3HXEA 3ASDA 1UJJA 2RD0A 2UWJG 3AG1E 4MKTA 3KSLA 4HOSA 4F53A 2I1KA 2VSXE 3KEZA 3V2XA 3CVXA 4PUCA 5G04C 2P9LG 4A63B 3Q75A 3AS8A 4MS6A 3EHNA 3SFZA 3D9MA 4U63A 2XS1A 1MX2A 1HS6A 2OVBA 3JXJA 3J5PA 4FC8A 3EDTB 4GTPA 1DCEA 4QQIA 3UIOC 1HG5A 3GZ1A 2X6HA 4LEUA 4U8HA 4RQIA 3IXEA 3LDZA 3Q7AA 4BSZB 2HO1A 4UI9K 4HRLA 4YNDA 2WQ6A 1MZCA 4I9EA 2GRQB 3PVLA 3B7UX 1JCQA 3EU9A 5JJTA 3QB2A 2PM7A 3O4ZA 4JA7A 3B7SA 2IOSA 1ELRA 5KJMA 3PZ4A 3APCA 1D9SA 1BLXB 4WNGA 3CVNA 3Q5MA 3HVEB 2Y3AA 5ENTD 3R9AB 4O6FA 3T5VA 2V8SE 3V2OA 2P9NG 3B13A 3CSFA 3UT8A 5CECB 1O1RA 2R17C 3NAWA 1U3CA 3CVLA 1TR4A 1YYHA 2KCKA 4HFGA 3APDA 2EIJE 3UQ3A 5FQ7A 5HS0A 5KNGA 4CRWA 4BETA 4HNAD 1HF8A 4JPSA 2VSOE 3D9NA 4BFRA 3CHSA 3CV0A 4J8SA 3ASHA 4JHJA 3PNLB 3RK6A 4DI3A 1KZOA 3RO2A 3Q15A 5BNWA 4OAUC 4GB9A 1BU9A 3RU0A 4ATZD 3VTYA 3SO8A 4R7LA 4CGVA 2XCCA 4P29A 3MGBA 2LO6A 3V30A 2WXJA 3TL5A 3JQ1A 1DCQA 1QNFA 1TNYA 5AARA 3JQ0A 4UI9J 4DLOA 4BX8A 4XKCA 4WUYA 5LP0A 5ENQD 2R59A 3LYAA 4LCTA 5KCMA 5AQ7A 3C98A 2IO2C 1NZNA 4L9PA 1IQUA 2E0IA 5AIJA 2BKGA 5EX3A 4XI9A 4DX6D 3BG0B 4WNDA 3CVWA 1PAQA 4GTVA 2PL2A 2EILE 4G2VA 3RO3A 4CGWA 3D3MA 4BTAA 2IQCA 5LOZA 2WM9A 4WAFA 1EPUA 2YINA 3ASGA 1MX4A 4FA6A 4KMOA 4I2WA 1H19A 4AP2A 3ZHEB 1MJ0A 2VSYA 3L9TA 3L17A 4C9BB 3ENEA 4F1PA 3FUNA 4GTRA 4CDNA 1OWMA 1E7VA 5HI7A 2PZIA 4L23A 3AG2E 3Q73A 3EU5A 5EYPF 2EIME 5AAOA 5BV1A 3CQCB 4H7YA 2F0YA 5CMYA 4WWNA 2VYIA 2ETBA 3CVYA 2B6CA 2RFMA 3J5QB 2VGXA 2P2CP 3TWQA 3FEXA 3QWWA 1NI1A 3SFYA 3CIAA 1O5MA 3G2VA 4I9CA 1KT1A 2WXHA 2L0IA 3LJ3A 3P2BA 2XGOA 1H2UA 2V0PA 3VLFA 3TGOA 2WXOA 3U64A 4RG6A 2CG2A 3ZYLA 3SFXA 4FLHA 3IHVA 1IQRA 5B1AE 3DSUA 1JCSA 1Y8MA 2P9KG 5JA4D 2HE0A 3MA5A 1S0PA 3TWRA 4G1TA 2Y4TA 2PQRA 4GZCA 3UT4A 2WXNA 1EYHA 3ZYQA 4U8VD 3HDXA 2XPIA 4DX5D 4YDOA 3JUEA 3FTSA 4JVSA 3DEPA 3FUHA 4AJWA 3HYMB 2GRLA 1D8EA 4UQYA 5CRVA 2BF0X 3IKOB 3FU3A 2J9QA 4GYYA 3PE3A 1SZAA 5BXOA 3RIBA 1E8ZA 4GA0A 3TAXA 2B0OE 3TXNA 5AQBA 1TJFA 4ABNA 2OOEA 3QAQA 2J4DA 4PS3A 2DZOA 4AOFA 3CK7A 5CCLA 4UI9C 4K5CA 3HG0D 1A5EA 5B1BE 5BUZA 4J6IA 1SZ9A 3CSTA 3S7BA 3WXXA 5ITZF 3PEUB 4D10C 3L13A 3OXFA 4JHRA 2L0TB 3AS4A 2WXLA 5DBKA 4PS8A 1GW6A 2QC9A 4NIKA 4N3AA 1NL4A 1WY6A 1HFAA 4HI8A 1G3NB 3R7QA 3I3NA 4AIFA 4UWGA 2H6FA 3SQVA 4E6HA 1XGWA 2VGXB 2BTDA 3MKRA 2X6IA 3CKCA 3Q4AB 5LCWJ 3NF1A 1N4SA 4J7WA 4K5BA 1OWOA 4RVBA 4BESA 3CHOA 4O60A 2XEHA 4XZ4A 4CDRA 2KZTA 3B7BA 4G23A 2LAIA 2DBAA 2GROB 3JCKC 2E2EA 4TUMA 1D8DA 2EINE 4BTBA 1HE8A 3FUFA 4CYMD 2H6GA 2AVPA 4EHMA 4U7EB 3UTMA 2DWZA 4X8QA 4FJYA 3ZRHA 5JHBA 2XRZA 1YCSB 1HG2A 3ML8A 3U9WA 1N52A 3S7FA 4XE0A 3OTNA 3CVUA 2XGMA 4YVOA 4Q94A 4JZYA 3U4TA 3JXIA 3G2UA 3O48A 1U2VG 3DSVA 3C3OA 3SBSA 2WXKA 3FFLA 2UY1B 2J09A 3MJWA 4FULA 2YNQA 3ABME 1FCHA 5FZSA 3KEAA 1N95A 1FVHA 5HRYA 5D0QD 4V3IA 1N9AA 3BQOA 3V79K 2KCLA 4OVUA 3F6QA 4BT8A 4J8FA 4HORA 3ASNE 5JHAA 4G26A 4GA1A 3AJIA 4FHJA 3ZYKA 4U8YD 2XRYA 4J0UA 3HXCA 3FDHA 5KWDA 3CHPA 2VTBA 2LAHA 4LNGA 4BSXA 4UUCA 1TN6A 3TWWA 3DSWA 5ARGA 4YDWA 2WXPA 2R2LA 3DBSA 2X6FA 3TXMA 1PY1A 4DX2A 3NB2A 1EDUA 2F37A 3N71A 4HS2A 4F3VA 5EN5D 4EQFA 1L5JA 5D0OD 1OT8A 4KVMA 3ZXPA 2ZXWE 3C3RA 2HYZA 1DNPA 4YVQC 4KZ0A 3ZU7B 1IHBA 5CCMA 2P58C 5E76A 3B7TA 3ZN3A 4C48B 3ULYA 3L54A 1HXIA 3D9IA 1IKND 5HKPA 1SA4A 2XPZA 3QK0A 3T8KA 3UXGA 3CGHA 1KPSB 4LG6A 3AAAC 3EIQC 3EHMA 2R5SA 2FO1E 3TG5A 5BV0A 3HRAA 2CHWA 3ESKA 3ZHEA 3FWVA 4OAVB 4DJAA 3G2WA 2AXVA 4U95D 2KC7A 2IFUA 1AWCB 4FU3A 4UWKA 3SGHA 3CK8A 3D9LA 3QWPA 2XHEA 2YQ8A 2P9IG 2LNIA 3GZ2A 4OYSA 3EJNA 1ZBPA 5LFAA 3E34A 3UMVA 4N2SA 3G2TA 3EHQA 1N94A 4N39A 1FT1A 2DYSE 4U0SA 3NQPA 4EZJA 2M63A 2WXGA 5CEAA 2ZIRA 2LUHA 2PQNA 4XKBA 2VTBB 3R7RA 5FQ4A 4DI4A 4Z68A 2DVWA 1K3ZD 3DWLG 1INZA 5A23A 3MYVA 3B7RL 3ISMC 3FTVA 2XZTG 5AYWD 4JD2G 3EHRA 4BT9A 4I1MA 2FF4A 3CEQA 4HLEA 1N4RA 4ILGA 3PZDA 3ZGQA 1VDYA 2DYRE
chains in the Genus database with same CATH topology
3LJ3A 3P2BA 4B0ZA 2XGOA 1H2UA 2V0PA 4ACKA 3ZVVA 3FTWA 1QQEA 3ZYMA 4N2QA 3VLFA 5FJYA 3G2SA 2WXOA 3U64A 3TGOA 2Q7FA 3LY9A 4RG6A 2CG2A 2GW1A 4WWOA 4APFA 3ZYLA 4KT6B 4L2LA 4FLHA 1NA0A 4B8CB 2ONDA 3IHVA 1IQRA 3AU4A 3OXLA 4EZLA 1Y8MA 4I43A 4C0MA 3PEVB 5FWQA 3KS2A 2WXMA 2YHEA 3QKYA 5T4YA 3RJVA 4KXKB 4ANWA 4HXIA 3FEYA 3MA5A 1S0PA 4G1TA 3ZXSA 1Y6IA 2Y4TA 2PQRA 4GZCA 1W3BA 3UT4A 2FEZA 2WXNA 3RRNB 4L7TA 5BPPA 4TUUA 1EYHA 3ZYQA 3HDXA 1ZU2A 3QWVA 2XPIA 4K03A 3FHEA 2I6HA 3CVQA 3FU6A 2WPVA 3D9OA 3FTSA 4JVSA 4UWFA 3ONKA 1EF1C 1UN9A 2HM8A 2I1JA 1QZ2A 3FUHA 3HVEA 2J4BA 3HYMB 2X6JA 2GRLA 4TRQA 4WNFA 4AJWA 4EBAA 4GMLA 2VSNA 1A17A 3PREA 4UQYA 3I4GA 2BF0X 4ANXA 3CQGB 3FU3A 3IKOB 5EKQD 4UWHA 5G55A 5AENA 2J9QA 4FHKA 4IULA 4GYYA 3PE3A 1SZAA 4PS7A 4CT0A 2WB2A 3RIBA 1E8ZA 4GA0A 3TAXA 4B89A 3ESLA 3TXNA 3RRMB 4L2YA 4I2ZA 1TJFA 2BUGA 3OXGA 4ABNA 4EECA 1MQSA 2C0MA 2OOEA 3QAQA 5G05J 3FP3A 4LRZA 3PS6A 4G24A 2A4ZA 1H6KA 2WMOA 3FTXA 3LKUA 2J4DA 1Z3YA 4PS3A 3U66A 4IYPA 4N3BA 3UUXA 4AOFA 4I1OB 4DK5A 3L16A 2J07A 2DIWA 3CK7A 2RG8A 2VGYA 5DIZA 3LPZA 5CCLA 4GZ6A 3PUJA 4UI9C 1JUQA 3UT7A 3JUIA 4HOQA 3D9PA 1TJCA 3LS8A 2J08A 5BUZA 2L6JA 1JWGA 4J6IA 1SZ9A 1PC2A 2IJGX 3CSTA 3S7BA 3WXXA 5J08A 3PEUB 3CKBA 4A55A 4EZKA 4D10C 2PM6A 4AM9A 4A3VA 2NSZA 3CVPA 4I9CA 5FZRA 3L13A 3OXFA 3T5XA 2GRMA 4JHRA 2L0TB 2NXPA 3AS4A 4GZ3A 4LERA 4AY5A 5CMWA 2WXLA 3FY4A 1IHGA 4GMJA 5DBKA 2FO7A 4PS8A 5G2NA 1BPOA 1GW6A 3I4RB 3MEKA 4GCNA 3VTXA 4N3AA 3ASFA 1WY6A 1HFAA 4UQXA 1E8WA 3ZEFA 3K9IA 4IRUA 1Z3XA 2CG3A 2KM4A 3R7QA 3I3NA 3OAWA 4AIFA 1WAO1 5AJDA 4EBAG 4EPZA 4FADA 4UWGA 4AVXA 4GCOA 4B94A 5G05C 4JW1A 2X38A 1XNFA 4E6HA 1KT0A 1XGWA 2VGXB 4LUNU 4HVBA 2BTDA 5KJKA 3MKRA 2ZU6B 4AY6A 2X6IA 3CKCA 3Q4AB 4G11A 3MZLB 2QY7A 3QNKA 5LCWJ 2V4LA 3NF1A 3U3WA 2CFZA 3ASDA 1UJJA 4RVBA 1OWOA 2RD0A 2UWJG 4L1BA 5C1DA 4MKTA 4HOSA 1H0AA 3FUJA 4F53A 4AEZC 2I1KA 1E8YA 3CHOA 1JWFA 2VSXE 3KEZA 3L6AA 3QARA 4OVVA 5ANRA 5A7DB 3NZUA 3IBEA 4Y6WA 4XZ4A 4CDRA 2KZTA 3CVXA 1E8XA 3LY8A 4PUCA 4G23A 2LAIA 5G04C 3CHMA 3FUIA 4NURA 3AS8A 2DBAA 2AWIA 4MS6A 4KVOA 1UW4B 3FH7A 3EHNA 1OUVA 4KYOB 5BW8C 3JCKC 4HOTA 3SFZA 2E2EA 2X6KA 4I6GA 2WXQA 3D9MA 4U63A 3PDNA 4BTBA 5LX8A 4JEUA 1HO8A 1HE8A 5T3RA 1SQMA 5KJNA 3FUFA 1HS6A 2OVBA 4FLBA 2AVPA 4URKA 4FC8A 4FJYA 3I5PA 3EDTB 5LCWC 3ZRHA 1N54A 4JC8A 3CLJA 2EQXA 5JHBA 4GA2A 4UWLA 2XRZA 4WWPA 2DCPA 3MKQB 3LY7A 1HG5A 1HG2A 3IV0A 4F7AA 5ARFA 3GZ1A 2X6HA 2IF4A 4LEUA 4B8AA 4U8HA 4ILIA 3ML8A 3U9WA 4C0EA 4XI0A 4CDMA 4N3CA 1N52A 3S7FA 3FU0A 4XE0A 3FUKA 3IHYA 3LDZA 2IU1A 3OTNA 3CVUA 2C2LA 1ELWA 2XGMA 4ANUA 2HO1A 4F1SA 4UI9K 4YVOA 3D9KA 4JXTA 4Q94A 4YNDA 3SI5A 4JZYA 2MRIA 2VJ8A 3U4TA 2WQ6A 4JA9A 3G2UA 3O48A 4I9EA 3PVLA 3B7UX 4J8DA 2CHXA 3FH5A 1WM5A 3SBSA 2WXKA 2Y4UA 3FFLA 2UY1B 2J09A 4K0RA 5EDSA 5JJTA 3MJWA 3FUMA 4FULA 5CHEE 1DVPA 2YNQA 3MV3B 3QB2A 2IOLA 2PM7A 4M3OA 3O4ZA 1FCHA 4G25A 4U07A 5E75A 3L22A 4JA7A 5FZSA 4CCAA 4CEMA 3FUDA 3SHFA 1FVHA 3B7SA 5D0QD 4UQZA 2IOSA 4V3IA 4RSYA 2I9CA 4PH4B 1ELRA 5KJMA 3MV2B 2C0LA 3S7DA 3APCA 3GZSA 3HIZA 2KCLA 4OVUA 3P1UA 4WNGA 4J8FA 4BT8A 3PE4A 3CK9A 3CVNA 3LEWA 3UX4A 4HORA 2V5FA 2WMNA 3Q5MA 5JHAA 4G26A 3HVEB 2Y3AA 4GA1A 4E85A 3FH8A 1E96B 3FTYA 3IEGA 4FHJA 5J90A 4DLQA 3ZFWA 3BEEA 3R9AB 4O6FA 3TJPA 4U0UA 3ZYKA 2QFCA 2V8SE 3T5VA 2XRYA 4GAAA 4J0UA 3B13A 4AXHA 3CSFA 3RKVA 3UT8A 2WQHA 4U04A 2R17C 2MOWA 3APFA 3FDHA 1U3CA 3CHPA 2VTBA 2LAHA 3CVLA 3PUKA 3CVVA 4NQ0A 4BSXA 5JJ7A 2KCKA 3Q49B 4HFGA 3EIJA 3APDA 5ARGA 3MX3A 2OV8A 2WXPA 3UQ3A 5FQ7A 2WXFA 3ZPJA 3DBSA 4CRWA 3VLEA 5FZQA 3ZW3A 2X6FA 1OWNA 3TXMA 1PY1A 3FTUA 4ILHB 3E4BA 1HF8A 4JPSA 1EDUA 4MLPA 2VSOE 1NA3A 5FT9A 3D9NA 2WVIA 3N71A 2XPYA 4GU5A 4HS2A 2VQ2A 5T8IA 4F3VA 4BFRA 3CHSA 3CV0A 3S7JA 4EQFA 4J8SA 2GGFA 3ASHA 1L5JA 2XCBA 4JHJA 4A1SA 4ANVA 3PNLB 5D0OD 4A1GA 3RK6A 2XQ0A 4DI3A 4KVMA 3NZSA 1TEZA 2I2OA 4AV7A 1HH8A 2HYZA 1DNPA 4FJZA 3RO2A 5C2YA 3Q15A 2AXUA 5BNWA 4RG9A 4YVQC 5FTPA 3SD5A 4BWRA 1B89A 4GB9A 3RRUA 3QDNA 4KZ0A 3RU0A 4JHKA 4XX5A 4APOA 1UN8A 3VTYA 4R7LA 4CGVA 2XCCA 3PRZA 5CCMA 2P58C 1LF8A 4P29A 3MGBA 5E76A 2LSVA 3B7TA 3ZN3A 4I6EA 2LO6A 3L54A 3Q47B 4GYWA 4ME2A 1HXIA 3D9IA 3ULQA 1H2VC 2WXJA 3SNXA 2UY1A 4TV3A 3TL5A 5BT1A 4I17A 3BG1B 3JQ1A 2XPZA 3AS5A 3QK0A 1QNFA 3FULA 1E90A 3LVQE 3LCAA 4W9RA 3CGHA 1UG3A 3JQ0A 4U0ZA 4UI9J 1MHQA 3EIQC 4DLOA 3QOUA 3EHMA 4WUYA 4XKCA 4ATGA 2R5SA 4BX8A 5LP0A 3TG5A 5BV0A 2CHWA 2R59A 3MKQA 3ESKA 3CR3A 3GYZA 3FWVA 3LYAA 4NACA 3ZHEA 4LCTA 4DJAA 4GPKA 5KCMA 3G2WA 2AXVA 3ML9A 2KC7A 3DPDA 2OVFA 3PH0C 4GZDA 3QJZA 2IFUA 3C98A 3T8MA 1NZNA 5HQ8A 1U3DA 4FU3A 4UWKA 3SGHA 4Q69A 4Y6CA 1IQUA 1FVFA 2E0IA 4XIFA 5AIJA 4IN3B 3L08A 4I6JA 3CK8A 3D9LA 4MRUA 5EX3A 3PNTB 3QWPA 2XHEA 2JEKA 2YQ8A 3FUEA 3LVRE 2KCVA 4QFVA 4XI9A 2LSUA 4Q96A 2LNIA 4CT4A 3GZ2A 3QC1A 5M72A 3BG0B 4WNDA 1NP7A 3CVWA 4ACLA 1PAQA 4I1AA 4OYSA 2PL2A 1Z6TA 3URZA 3JYSA 4G2VA 1JPLA 3EJNA 4FP7A 3D9JA 5G04J 1ZBPA 2IONA 3RO3A 4CGWA 3SF4A 3D3MA 2KZTB 5LFAA 2WXRA 2FBNA 4BTAA 3UMVA 1E7UA 2IQCA 4N2SA 4JEHA 3S2AA 5LOZA 3G2TA 2WM9A 4WAFA 1EPUA 2YINA 3ASGA 5A6CA 2YHCA 3AU5A 4N39A 1H2TC 4GZ5A 2CFUA 4FA6A 4U0SA 3NQPA 4KMOA 4EZJA 3CHRA 1P5QA 4I2WA 3TG4A 2M63A 2WXGA 1H19A 4AP2A 2FULA 2MHKA 5FQ6A 3KD7A 3ZHEB 2WQ7A 1IYGA 3SBTB 2VSYA 1OWPA 3ZIMA 4BX9A 1HU3A 2PQNA 2WXIA 4XKBA 3L17A 4NRHB 4C9BB 1X5BA 3ENEA 2VTBB 2XGSA 5KJLA 5ANLA 3VLDA 3FUNA 4KBQA 3R7RA 5FQ4A 4DI4A 4CDNA 3UPVA 1OWMA 1E7VA 1HZ4A 5HI7A 4BY6A 2PZIA 4L23A 3GW4A 1INZA 1OWLA 2JLBA 4DPRA 5A23A 2HR2A 3MYVA 3CHQA 2CHZA 3B7RL 5BV1A 3CQCB 4H7YA 4HOUA 5CMYA 2L9BA 3KAEA 4H7XA 3SZ7A 4WWNA 3ONLA 1ELKA 3FTVA 3LXUX 2ILRA 2VYIA 2A5UA 2FI7A 3CVYA 4J8EA 2X3MA 4JL0A 3FTZA 3MCXA 5AYWD 5JJ6A 1UJKA 4KZCA 4I1MA 4BT9A 4PDXA 1YA0A 3FU5A 3HHMA 2NC9A 1HX8A 2FF4A 2L0IA 2AW6A 4WNEA 2VGXA 2J49A 5AJLA 2AXZA 3FEXA 5EX0A 4N5CA 3QWWA 3CEQA 4HLEA 1KLXA 2XEVA 3CIAA 4GYOA 5ENNA 4ILGA 3PZDA 3ZGQA 1VDYA 5FQ8A 4A3TA 3G2VA 1KT1A 2KATA 2WXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KM4 A;  1LF8 A;  3LDZ A;  3ONL A;  2MOW A;  5J08 A;  3D9N A;  1ELK A;  4NAC A;  1JWF A;  1EYH A;  2LO6 A;  3ZYQ A;  3ZYM A;  1JPL A;  3G2S A;  3D9J A;  3D9I A;  4AVX A;  3D9K A;  1UJK A;  1X5B A;  3G2W A;  4JXT A;  4Q94 A;  3ZYL A;  3CLJ A;  4GZD A;  4HFG A;  1HX8 A;  2L0I A;  3D9O A;  5LOZ A;  2L0T B;  3G2U A;  3G2T A;  2DCP A;  3ONK A;  1XGW A;  4FU3 A;  1HG5 A;  1HG2 A;  5CMW A;  4FLB A;  2DIW A;  1INZ A;  3D9L A;  1DVP A;  2QY7 A;  1JUQ A;  3ZYK A;  2V8S E;  3RRU A;  3D9P A;  2BF0 X;  3D9M A;  1UJJ A;  4Q96 A;  1HFA A;  1MHQ A;  5CMY A;  5LP0 A;  1PY1 A;  1VDY A;  1SZA A;  4GZC A;  1JWG A;  3G2V A;  1H0A A;  1HF8 A;  1SZ9 A;  1EDU A; 
#chains in the Genus database with same CATH topology
 4B0Z A;  1QQE A;  3LY9 A;  4L2L A;  1O1T A;  4EZL A;  3T9K A;  2WXM A;  3RSE G;  3QKY A;  4DRX E;  3RJV A;  4KXK B;  3ZXS A;  4L7T A;  3QWV A;  1ZU2 A;  3FHE A;  5FIN A;  5EYL A;  1OCR E;  1EF1 C;  1UN9 A;  3HVE A;  1QZ2 A;  4TRQ A;  2J4B A;  2P9S G;  4EBA A;  3I4G A;  3CQG B;  5G55 A;  5AEN A;  4FHK A;  3ESL A;  2BUG A;  3OXG A;  3DPY A;  4N3B A;  4I1O B;  2J07 A;  2R03 A;  2RG8 A;  3LPZ A;  3UT7 A;  1N0Q A;  4HOQ A;  3D9P A;  3TWX A;  2J08 A;  1JWG A;  1PC2 A;  5J08 A;  1K1B A;  2PM6 A;  4A3V A;  1QYM A;  2NSZ A;  1N11 A;  1H6P A;  1BPO A;  3I4R B;  3ABK E;  1OCZ E;  1E8W A;  2QYU A;  3K9I A;  1Z3X A;  2KXP C;  4EPZ A;  4EBA G;  5IY5 E;  4F6R D;  5G05 C;  1KT0 A;  2QY7 A;  2IEJ A;  2V4L A;  3U3W A;  2CFZ A;  5C1D A;  5CED B;  2QYJ A;  4AEZ C;  1E8Y A;  1JWF A;  1BI8 B;  4OVV A;  5A7D B;  3IBE A;  4Y6W A;  1E8X A;  3ZUV B;  3FUI A;  4TXP A;  1SVX A;  4KVO A;  3FH7 A;  4KYO B;  5BW8 C;  5EID A;  4G8K A;  2X6K A;  4I6G A;  3PDN A;  1X81 A;  5LX8 A;  4JEU A;  1SQM A;  5CBO A;  4GTO A;  3BU8 A;  4URK A;  3NBN B;  5LCW C;  3I5P A;  2J8S D;  4JC8 A;  3CLJ A;  2EQX A;  4GA2 A;  4UWL A;  2ZGG A;  1Q2Z A;  2DCP A;  3MKQ B;  4TXR A;  4CDM A;  2XZD G;  4YDE A;  3IHY A;  1MYO A;  2IU1 A;  3UM1 A;  2C2L A;  2NYJ A;  4F1S A;  3D9K A;  3SI5 A;  3TWS A;  2MRI A;  2VJ8 A;  4JA9 A;  1OXJ A;  4J8D A;  2CHX A;  3FH5 A;  1WM5 A;  4K0R A;  3FUM A;  5CHE E;  3MV3 B;  2IOL A;  4CCA A;  4G25 A;  1JCR A;  5E75 A;  3FUD A;  3SHF A;  4PH4 B;  1S63 A;  3MV2 B;  4DX1 A;  3HIZ A;  3P1U A;  3PE4 A;  3CK9 A;  3UX4 A;  2WMN A;  1N4P A;  4E85 A;  3FH8 A;  3FTY A;  3IEG A;  4DLQ A;  3TJP A;  4GTS A;  4ZFH A;  3HXD A;  3RAU A;  3Q7F A;  4U04 A;  3APF A;  1BI7 B;  3PUK A;  3CVV A;  5JJ7 A;  3DST A;  3MX3 A;  3ULE G;  4HRM B;  4BER A;  3ZPJ A;  3VLE A;  5FZQ A;  1OWN A;  1S64 A;  1WG0 A;  4ILH B;  3E4B A;  5FT9 A;  2WVI A;  1RW2 A;  2XPY A;  3HXF A;  2XCB A;  4A1S A;  4A1G A;  2ZGD A;  1LD7 A;  4FJZ A;  4RG9 A;  5FTP A;  4BWR A;  3QDN A;  4JHK A;  4XX5 A;  4O1P A;  1UN8 A;  3PRZ A;  3R9M A;  1H2V C;  3SNX A;  2UY1 A;  4TV3 A;  3E30 A;  5AQ9 A;  4GPM A;  1K8K G;  1E90 A;  3LCA A;  4W9R A;  4U0Z A;  1MHQ A;  3L82 A;  4ATG A;  3MKQ A;  3CR3 A;  4NAC A;  1LTX A;  1AP7 A;  2V5Q C;  3ML9 A;  2OVF A;  4GZD A;  5HQ8 A;  4Q69 A;  4Y6C A;  4XIF A;  4IN3 B;  3L08 A;  4I6J A;  4MRU A;  3PNT B;  2JEK A;  3FUE A;  3LVR E;  4LSZ E;  2KCV A;  4Q96 A;  1TNZ A;  4CT4 A;  3QC1 A;  1Z6T A;  2RKK A;  3D9J A;  5G04 J;  2ION A;  3E32 A;  2FBN A;  1E7U A;  4N5Q A;  4JEH A;  3S2A A;  1SW6 A;  2YHC A;  3AU5 A;  1H2T C;  2XS8 A;  3CHR A;  3TG4 A;  2FUL A;  5CER B;  5FQ6 A;  2WQ7 A;  1K1A A;  3SBT B;  3UM3 A;  4GMR A;  3ZIM A;  4BX9 A;  1X5B A;  5KJL A;  4KBQ A;  2H6H A;  4DPR A;  2HR2 A;  2L9B A;  2OEV A;  3KAE A;  4LNB A;  3SZ7 A;  3ONL A;  2VGE A;  1ELK A;  2FI7 A;  3FTZ A;  3MCX A;  4J8Y A;  4KZC A;  1YA0 A;  3HHM A;  2NC9 A;  1HX8 A;  2AW6 A;  4WNE A;  3LJN A;  4CZ2 D;  2AXZ A;  5EX0 A;  4N5C A;  3W9F A;  1KLX A;  2XEV A;  2OCC E;  5FQ8 A;  5ENP D;  4A3T A;  3GZS A;  1FT2 A;  2KAT A;  4ACK A;  3C3Q A;  3ZYM A;  4N2Q A;  3G2S A;  2Q7F A;  4WWO A;  2GW1 A;  4APF A;  1NA0 A;  4B8C B;  2OND A;  3AU4 A;  3PEV B;  3HXB A;  3KS2 A;  2YHE A;  5T4Y A;  4ANW A;  4HXI A;  3E37 A;  4B93 B;  2P9P G;  3C5R A;  2FEZ A;  1H6O A;  5AN8 A;  5BPP A;  4TUU A;  1N4Q A;  3DXM G;  4GTM A;  2I6H A;  3FU6 A;  2WPV A;  3D9O A;  4UWF A;  2I1J A;  3S7J A;  4WNF A;  4GML A;  2VSN A;  3Q78 A;  2XEE A;  4ANX A;  5EKQ D;  4UWH A;  4PS7 A;  4HBD A;  4CT0 A;  2WB2 A;  3RRM B;  1TNB A;  5ENR D;  3FP3 A;  4LRZ A;  4G24 A;  2WMO A;  3U66 A;  1Z3Y A;  3C72 A;  4HB5 A;  3ZNG A;  3L16 A;  5BXU A;  2VGY A;  5DIZ A;  4GZ6 A;  3PUJ A;  1JUQ A;  3JUI A;  2L6J A;  5KNH D;  3CKB A;  4A55 A;  4EZK A;  4AM9 A;  3KSQ A;  3T5X A;  2NXP A;  4GZ3 A;  4G8L A;  4AY5 A;  2L6B A;  4GMJ A;  2H6I A;  3TWT A;  3UM0 A;  5CRU A;  4GCN A;  3ASF A;  4UQX A;  4DUI A;  3Q9U C;  3ZEF A;  4IRU A;  2KM4 A;  3NOC D;  3OAW A;  1WAO 1;  3UI2 A;  4FAD A;  4GCO A;  4JW1 A;  2BKK B;  2X38 A;  1XNF A;  1BD8 A;  4LUN U;  1FPP A;  5KJK A;  4AY6 A;  2ZU6 B;  3MZL B;  3DSX A;  2P9U G;  4L1B A;  1SA5 A;  1H0A A;  3FUJ A;  3D9H A;  5KBA A;  3L6A A;  3QAR A;  5ANR A;  3NZU A;  3LY8 A;  3CHM A;  4NUR A;  1ZB1 A;  2DZN A;  2AWI A;  1UW4 B;  2MYO A;  1OUV A;  4HOT A;  3UIP C;  2WXQ A;  5B3S E;  2IY0 C;  1HO8 A;  1V55 E;  3EUV A;  5T3R A;  5KJN A;  4FLB A;  3E33 A;  1N54 A;  2GRR B;  1LD8 A;  2Y0B G;  4WWP A;  3LY7 A;  2JAB A;  3IV0 A;  4F7A A;  5ARF A;  2Y1L E;  2IF4 A;  4B8A A;  4C0E A;  3DXK G;  4ILI A;  4XI0 A;  4N3C A;  3FU0 A;  3FUK A;  1TN8 A;  2BED A;  1N0R A;  1ELW A;  4ANU A;  5CBN A;  2LXM A;  4JXT A;  5EDS A;  2Y4U A;  4HI9 A;  2EIK E;  1DVP A;  4M3O A;  3PZ2 A;  4U07 A;  3L22 A;  4CEM A;  4UQZ A;  4RSY A;  2I9C A;  4YDY A;  4TXQ A;  2C0L A;  3S7D A;  3LEW A;  2V5F A;  1E96 B;  5J90 A;  2A5E A;  3ZFW A;  3BEE A;  4U0U A;  2QFC A;  4LNU D;  4GAA A;  1IXV A;  4AXH A;  4BEP A;  3RKV A;  2WQH A;  3UKR G;  2GRP B;  2MOW A;  3X2Q E;  4NQ0 A;  3Q49 B;  3EIJ A;  2IO3 C;  2OV8 A;  2WXF A;  3ZW3 A;  2F8X K;  3FTU A;  4MLP A;  1NA3 A;  4GU5 A;  2VQ2 A;  5T8I A;  3UM2 A;  2GGF A;  4O1O A;  4ANV A;  1YMP A;  2XQ0 A;  3NZS A;  1TEZ A;  2I2O A;  4AV7 A;  1HH8 A;  2ETC A;  5C2Y A;  2AXU A;  3SD5 A;  1B89 A;  2R02 A;  3ABL E;  3RRU A;  4U96 D;  4APO A;  5FIO A;  1LF8 A;  2LSV A;  4I6E A;  3Q47 B;  4GYW A;  4ME2 A;  3ULQ A;  5ENS D;  5BT1 A;  4I17 A;  3BG1 B;  2GRN B;  3AS5 A;  1DC2 A;  3FUL A;  5D66 A;  3LVQ E;  1UG3 A;  3AG4 E;  1OY3 D;  3QOU A;  2Y69 E;  3Q9N C;  3GYZ A;  4RLY A;  4GPK A;  3DEO A;  1S70 B;  3DPD A;  3PH0 C;  3QJZ A;  3NOG D;  2XEN A;  5H7P A;  3T8M A;  1U3D A;  5D2M C;  3BUA A;  1FVF A;  1MX6 A;  4DX7 D;  1OCC E;  4QFV A;  1TYQ G;  2LSU A;  1OCO E;  5M72 A;  1NP7 A;  4ACL A;  4I1A A;  3URZ A;  3JYS A;  1JPL A;  4FP7 A;  2OEW A;  3SF4 A;  2KZT B;  2WXR A;  4M7C A;  2RFA A;  5A6C A;  4GZ5 A;  2CFU A;  1P5Q A;  3UKU G;  4GTT A;  2MHK A;  1WDY A;  3KD7 A;  1IYG A;  1OWP A;  1HU3 A;  2WXI A;  4NRH B;  2XGS A;  5ANL A;  3VLD A;  2QZA A;  3UPV A;  1HZ4 A;  4BY6 A;  3GW4 A;  1QBQ A;  1OWL A;  2JLB A;  5AQA A;  3TWV A;  2V4H C;  3CHQ A;  2CHZ A;  3DRA A;  1RZ4 A;  4HOU A;  4H7X A;  3LXU X;  2ILR A;  2A5U A;  4J8E A;  2X3M A;  4JL0 A;  5JJ6 A;  1UJK A;  4PDX A;  3FU5 A;  3SY2 A;  2J49 A;  3B95 A;  5AJL A;  1KZP A;  4HQD A;  4GYO A;  5ENN A;  3AG3 E;  3ZVV A;  3FTW A;  5EIL A;  5FJY A;  3ZKJ A;  5JMN D;  4KT6 B;  3OXL A;  5EIB E;  4I43 A;  4C0M A;  2LXL A;  3ASO E;  5FWQ A;  2ZIS A;  2PNN A;  1UOH A;  3FEY A;  3TWU A;  3DSS A;  1Y6I A;  1W3B A;  1Z5S C;  3RRN B;  3WG7 E;  4K03 A;  4JB8 P;  3CVQ A;  3V31 A;  3ONK A;  2HM8 A;  2X6J A;  1O1S A;  1A17 A;  3PRE A;  4IUL A;  3PZ3 A;  4B89 A;  4L2Y A;  4I2Z A;  4EEC A;  3PZ1 A;  1MQS A;  2C0M A;  5G05 J;  3PS6 A;  2A4Z A;  1H6K A;  3FTX A;  3LKU A;  4IYP A;  3UUX A;  5ENO D;  4DK5 A;  1TNU A;  2DIW A;  4HRN A;  1TJC A;  3LS8 A;  1TNO A;  2F8Y A;  4HLL A;  2IJG X;  4XEI G;  3CVP A;  5FZR A;  2KBX A;  2GRM A;  1NFI E;  4LER A;  5CMW A;  4ZHB A;  3FY4 A;  1IHG A;  2FO7 A;  5G2N A;  4MBG A;  3MEK A;  3VTX A;  3Q79 A;  2CG3 A;  1TN7 A;  2AJA A;  5AJD A;  2ETA A;  4AVX A;  4B94 A;  3UIN C;  3W9G A;  2R05 A;  4HVB A;  1V54 E;  4G11 A;  4K5A B;  3QNK A;  4GTQ A;  3HXE A;  3ASD A;  1UJJ A;  2RD0 A;  2UWJ G;  3AG1 E;  4MKT A;  3KSL A;  4HOS A;  4F53 A;  2I1K A;  2VSX E;  3KEZ A;  3V2X A;  3CVX A;  4PUC A;  5G04 C;  2P9L G;  4A63 B;  3Q75 A;  3AS8 A;  4MS6 A;  3EHN A;  3SFZ A;  3D9M A;  4U63 A;  2XS1 A;  1MX2 A;  1HS6 A;  2OVB A;  3JXJ A;  3J5P A;  4FC8 A;  3EDT B;  4GTP A;  1DCE A;  4QQI A;  3UIO C;  1HG5 A;  3GZ1 A;  2X6H A;  4LEU A;  4U8H A;  4RQI A;  3IXE A;  3LDZ A;  3Q7A A;  4BSZ B;  2HO1 A;  4UI9 K;  4HRL A;  4YND A;  2WQ6 A;  1MZC A;  4I9E A;  2GRQ B;  3PVL A;  3B7U X;  1JCQ A;  3EU9 A;  5JJT A;  3QB2 A;  2PM7 A;  3O4Z A;  4JA7 A;  3B7S A;  2IOS A;  1ELR A;  5KJM A;  3PZ4 A;  3APC A;  1D9S A;  1BLX B;  4WNG A;  3CVN A;  3Q5M A;  3HVE B;  2Y3A A;  5ENT D;  3R9A B;  4O6F A;  3T5V A;  2V8S E;  3V2O A;  2P9N G;  3B13 A;  3CSF A;  3UT8 A;  5CEC B;  1O1R A;  2R17 C;  3NAW A;  1U3C A;  3CVL A;  1TR4 A;  1YYH A;  2KCK A;  4HFG A;  3APD A;  2EIJ E;  3UQ3 A;  5FQ7 A;  5HS0 A;  5KNG A;  4CRW A;  4BET A;  4HNA D;  1HF8 A;  4JPS A;  2VSO E;  3D9N A;  4BFR A;  3CHS A;  3CV0 A;  4J8S A;  3ASH A;  4JHJ A;  3PNL B;  3RK6 A;  4DI3 A;  1KZO A;  3RO2 A;  3Q15 A;  5BNW A;  4OAU C;  4GB9 A;  1BU9 A;  3RU0 A;  4ATZ D;  3VTY A;  3SO8 A;  4R7L A;  4CGV A;  2XCC A;  4P29 A;  3MGB A;  2LO6 A;  3V30 A;  2WXJ A;  3TL5 A;  3JQ1 A;  1DCQ A;  1QNF A;  1TNY A;  5AAR A;  3JQ0 A;  4UI9 J;  4DLO A;  4BX8 A;  4XKC A;  4WUY A;  5LP0 A;  5ENQ D;  2R59 A;  3LYA A;  4LCT A;  5KCM A;  5AQ7 A;  3C98 A;  2IO2 C;  1NZN A;  4L9P A;  1IQU A;  2E0I A;  5AIJ A;  2BKG A;  5EX3 A;  4XI9 A;  4DX6 D;  3BG0 B;  4WND A;  3CVW A;  1PAQ A;  4GTV A;  2PL2 A;  2EIL E;  4G2V A;  3RO3 A;  4CGW A;  3D3M A;  4BTA A;  2IQC A;  5LOZ A;  2WM9 A;  4WAF A;  1EPU A;  2YIN A;  3ASG A;  1MX4 A;  4FA6 A;  4KMO A;  4I2W A;  1H19 A;  4AP2 A;  3ZHE B;  1MJ0 A;  2VSY A;  3L9T A;  3L17 A;  4C9B B;  3ENE A;  4F1P A;  3FUN A;  4GTR A;  4CDN A;  1OWM A;  1E7V A;  5HI7 A;  2PZI A;  4L23 A;  3AG2 E;  3Q73 A;  3EU5 A;  5EYP F;  2EIM E;  5AAO A;  5BV1 A;  3CQC B;  4H7Y A;  2F0Y A;  5CMY A;  4WWN A;  2VYI A;  2ETB A;  3CVY A;  2B6C A;  2RFM A;  3J5Q B;  2VGX A;  2P2C P;  3TWQ A;  3FEX A;  3QWW A;  1NI1 A;  3SFY A;  3CIA A;  1O5M A;  3G2V A;  4I9C A;  1KT1 A;  2WXH A;  2L0I A;  3LJ3 A;  3P2B A;  2XGO A;  1H2U A;  2V0P A;  3VLF A;  3TGO A;  2WXO A;  3U64 A;  4RG6 A;  2CG2 A;  3ZYL A;  3SFX A;  4FLH A;  3IHV A;  1IQR A;  5B1A E;  3DSU A;  1JCS A;  1Y8M A;  2P9K G;  5JA4 D;  2HE0 A;  3MA5 A;  1S0P A;  3TWR A;  4G1T A;  2Y4T A;  2PQR A;  4GZC A;  3UT4 A;  2WXN A;  1EYH A;  3ZYQ A;  4U8V D;  3HDX A;  2XPI A;  4DX5 D;  4YDO A;  3JUE A;  3FTS A;  4JVS A;  3DEP A;  3FUH A;  4AJW A;  3HYM B;  2GRL A;  1D8E A;  4UQY A;  5CRV A;  2BF0 X;  3IKO B;  3FU3 A;  2J9Q A;  4GYY A;  3PE3 A;  1SZA A;  5BXO A;  3RIB A;  1E8Z A;  4GA0 A;  3TAX A;  2B0O E;  3TXN A;  5AQB A;  1TJF A;  4ABN A;  2OOE A;  3QAQ A;  2J4D A;  4PS3 A;  2DZO A;  4AOF A;  3CK7 A;  5CCL A;  4UI9 C;  4K5C A;  3HG0 D;  1A5E A;  5B1B E;  5BUZ A;  4J6I A;  1SZ9 A;  3CST A;  3S7B A;  3WXX A;  5ITZ F;  3PEU B;  4D10 C;  3L13 A;  3OXF A;  4JHR A;  2L0T B;  3AS4 A;  2WXL A;  5DBK A;  4PS8 A;  1GW6 A;  2QC9 A;  4NIK A;  4N3A A;  1NL4 A;  1WY6 A;  1HFA A;  4HI8 A;  1G3N B;  3R7Q A;  3I3N A;  4AIF A;  4UWG A;  2H6F A;  3SQV A;  4E6H A;  1XGW A;  2VGX B;  2BTD A;  3MKR A;  2X6I A;  3CKC A;  3Q4A B;  5LCW J;  3NF1 A;  1N4S A;  4J7W A;  4K5B A;  1OWO A;  4RVB A;  4BES A;  3CHO A;  4O60 A;  2XEH A;  4XZ4 A;  4CDR A;  2KZT A;  3B7B A;  4G23 A;  2LAI A;  2DBA A;  2GRO B;  3JCK C;  2E2E A;  4TUM A;  1D8D A;  2EIN E;  4BTB A;  1HE8 A;  3FUF A;  4CYM D;  2H6G A;  2AVP A;  4EHM A;  4U7E B;  3UTM A;  2DWZ A;  4X8Q A;  4FJY A;  3ZRH A;  5JHB A;  2XRZ A;  1YCS B;  1HG2 A;  3ML8 A;  3U9W A;  1N52 A;  3S7F A;  4XE0 A;  3OTN A;  3CVU A;  2XGM A;  4YVO A;  4Q94 A;  4JZY A;  3U4T A;  3JXI A;  3G2U A;  3O48 A;  1U2V G;  3DSV A;  3C3O A;  3SBS A;  2WXK A;  3FFL A;  2UY1 B;  2J09 A;  3MJW A;  4FUL A;  2YNQ A;  3ABM E;  1FCH A;  5FZS A;  3KEA A;  1N95 A;  1FVH A;  5HRY A;  5D0Q D;  4V3I A;  1N9A A;  3BQO A;  3V79 K;  2KCL A;  4OVU A;  3F6Q A;  4BT8 A;  4J8F A;  4HOR A;  3ASN E;  5JHA A;  4G26 A;  4GA1 A;  3AJI A;  4FHJ A;  3ZYK A;  4U8Y D;  2XRY A;  4J0U A;  3HXC A;  3FDH A;  5KWD A;  3CHP A;  2VTB A;  2LAH A;  4LNG A;  4BSX A;  4UUC A;  1TN6 A;  3TWW A;  3DSW A;  5ARG A;  4YDW A;  2WXP A;  2R2L A;  3DBS A;  2X6F A;  3TXM A;  1PY1 A;  4DX2 A;  3NB2 A;  1EDU A;  2F37 A;  3N71 A;  4HS2 A;  4F3V A;  5EN5 D;  4EQF A;  1L5J A;  5D0O D;  1OT8 A;  4KVM A;  3ZXP A;  2ZXW E;  3C3R A;  2HYZ A;  1DNP A;  4YVQ C;  4KZ0 A;  3ZU7 B;  1IHB A;  5CCM A;  2P58 C;  5E76 A;  3B7T A;  3ZN3 A;  4C48 B;  3ULY A;  3L54 A;  1HXI A;  3D9I A;  1IKN D;  5HKP A;  1SA4 A;  2XPZ A;  3QK0 A;  3T8K A;  3UXG A;  3CGH A;  1KPS B;  4LG6 A;  3AAA C;  3EIQ C;  3EHM A;  2R5S A;  2FO1 E;  3TG5 A;  5BV0 A;  3HRA A;  2CHW A;  3ESK A;  3ZHE A;  3FWV A;  4OAV B;  4DJA A;  3G2W A;  2AXV A;  4U95 D;  2KC7 A;  2IFU A;  1AWC B;  4FU3 A;  4UWK A;  3SGH A;  3CK8 A;  3D9L A;  3QWP A;  2XHE A;  2YQ8 A;  2P9I G;  2LNI A;  3GZ2 A;  4OYS A;  3EJN A;  1ZBP A;  5LFA A;  3E34 A;  3UMV A;  4N2S A;  3G2T A;  3EHQ A;  1N94 A;  4N39 A;  1FT1 A;  2DYS E;  4U0S A;  3NQP A;  4EZJ A;  2M63 A;  2WXG A;  5CEA A;  2ZIR A;  2LUH A;  2PQN A;  4XKB A;  2VTB B;  3R7R A;  5FQ4 A;  4DI4 A;  4Z68 A;  2DVW A;  1K3Z D;  3DWL G;  1INZ A;  5A23 A;  3MYV A;  3B7R L;  3ISM C;  3FTV A;  2XZT G;  5AYW D;  4JD2 G;  3EHR A;  4BT9 A;  4I1M A;  2FF4 A;  3CEQ A;  4HLE A;  1N4R A;  4ILG A;  3PZD A;  3ZGQ A;  1VDY A;  2DYR E; 
#chains in the Genus database with same CATH homology
 3LJ3 A;  3P2B A;  4B0Z A;  2XGO A;  1H2U A;  2V0P A;  4ACK A;  3ZVV A;  3FTW A;  1QQE A;  3ZYM A;  4N2Q A;  3VLF A;  5FJY A;  3G2S A;  2WXO A;  3U64 A;  3TGO A;  2Q7F A;  3LY9 A;  4RG6 A;  2CG2 A;  2GW1 A;  4WWO A;  4APF A;  3ZYL A;  4KT6 B;  4L2L A;  4FLH A;  1NA0 A;  4B8C B;  2OND A;  3IHV A;  1IQR A;  3AU4 A;  3OXL A;  4EZL A;  1Y8M A;  4I43 A;  4C0M A;  3PEV B;  5FWQ A;  3KS2 A;  2WXM A;  2YHE A;  3QKY A;  5T4Y A;  3RJV A;  4KXK B;  4ANW A;  4HXI A;  3FEY A;  3MA5 A;  1S0P A;  4G1T A;  3ZXS A;  1Y6I A;  2Y4T A;  2PQR A;  4GZC A;  1W3B A;  3UT4 A;  2FEZ A;  2WXN A;  3RRN B;  4L7T A;  5BPP A;  4TUU A;  1EYH A;  3ZYQ A;  3HDX A;  1ZU2 A;  3QWV A;  2XPI A;  4K03 A;  3FHE A;  2I6H A;  3CVQ A;  3FU6 A;  2WPV A;  3D9O A;  3FTS A;  4JVS A;  4UWF A;  3ONK A;  1EF1 C;  1UN9 A;  2HM8 A;  2I1J A;  1QZ2 A;  3FUH A;  3HVE A;  2J4B A;  3HYM B;  2X6J A;  2GRL A;  4TRQ A;  4WNF A;  4AJW A;  4EBA A;  4GML A;  2VSN A;  1A17 A;  3PRE A;  4UQY A;  3I4G A;  2BF0 X;  4ANX A;  3CQG B;  3FU3 A;  3IKO B;  5EKQ D;  4UWH A;  5G55 A;  5AEN A;  2J9Q A;  4FHK A;  4IUL A;  4GYY A;  3PE3 A;  1SZA A;  4PS7 A;  4CT0 A;  2WB2 A;  3RIB A;  1E8Z A;  4GA0 A;  3TAX A;  4B89 A;  3ESL A;  3TXN A;  3RRM B;  4L2Y A;  4I2Z A;  1TJF A;  2BUG A;  3OXG A;  4ABN A;  4EEC A;  1MQS A;  2C0M A;  2OOE A;  3QAQ A;  5G05 J;  3FP3 A;  4LRZ A;  3PS6 A;  4G24 A;  2A4Z A;  1H6K A;  2WMO A;  3FTX A;  3LKU A;  2J4D A;  1Z3Y A;  4PS3 A;  3U66 A;  4IYP A;  4N3B A;  3UUX A;  4AOF A;  4I1O B;  4DK5 A;  3L16 A;  2J07 A;  2DIW A;  3CK7 A;  2RG8 A;  2VGY A;  5DIZ A;  3LPZ A;  5CCL A;  4GZ6 A;  3PUJ A;  4UI9 C;  1JUQ A;  3UT7 A;  3JUI A;  4HOQ A;  3D9P A;  1TJC A;  3LS8 A;  2J08 A;  5BUZ A;  2L6J A;  1JWG A;  4J6I A;  1SZ9 A;  1PC2 A;  2IJG X;  3CST A;  3S7B A;  3WXX A;  5J08 A;  3PEU B;  3CKB A;  4A55 A;  4EZK A;  4D10 C;  2PM6 A;  4AM9 A;  4A3V A;  2NSZ A;  3CVP A;  4I9C A;  5FZR A;  3L13 A;  3OXF A;  3T5X A;  2GRM A;  4JHR A;  2L0T B;  2NXP A;  3AS4 A;  4GZ3 A;  4LER A;  4AY5 A;  5CMW A;  2WXL A;  3FY4 A;  1IHG A;  4GMJ A;  5DBK A;  2FO7 A;  4PS8 A;  5G2N A;  1BPO A;  1GW6 A;  3I4R B;  3MEK A;  4GCN A;  3VTX A;  4N3A A;  3ASF A;  1WY6 A;  1HFA A;  4UQX A;  1E8W A;  3ZEF A;  3K9I A;  4IRU A;  1Z3X A;  2CG3 A;  2KM4 A;  3R7Q A;  3I3N A;  3OAW A;  4AIF A;  1WAO 1;  5AJD A;  4EBA G;  4EPZ A;  4FAD A;  4UWG A;  4AVX A;  4GCO A;  4B94 A;  5G05 C;  4JW1 A;  2X38 A;  1XNF A;  4E6H A;  1KT0 A;  1XGW A;  2VGX B;  4LUN U;  4HVB A;  2BTD A;  5KJK A;  3MKR A;  2ZU6 B;  4AY6 A;  2X6I A;  3CKC A;  3Q4A B;  4G11 A;  3MZL B;  2QY7 A;  3QNK A;  5LCW J;  2V4L A;  3NF1 A;  3U3W A;  2CFZ A;  3ASD A;  1UJJ A;  4RVB A;  1OWO A;  2RD0 A;  2UWJ G;  4L1B A;  5C1D A;  4MKT A;  4HOS A;  1H0A A;  3FUJ A;  4F53 A;  4AEZ C;  2I1K A;  1E8Y A;  3CHO A;  1JWF A;  2VSX E;  3KEZ A;  3L6A A;  3QAR A;  4OVV A;  5ANR A;  5A7D B;  3NZU A;  3IBE A;  4Y6W A;  4XZ4 A;  4CDR A;  2KZT A;  3CVX A;  1E8X A;  3LY8 A;  4PUC A;  4G23 A;  2LAI A;  5G04 C;  3CHM A;  3FUI A;  4NUR A;  3AS8 A;  2DBA A;  2AWI A;  4MS6 A;  4KVO A;  1UW4 B;  3FH7 A;  3EHN A;  1OUV A;  4KYO B;  5BW8 C;  3JCK C;  4HOT A;  3SFZ A;  2E2E A;  2X6K A;  4I6G A;  2WXQ A;  3D9M A;  4U63 A;  3PDN A;  4BTB A;  5LX8 A;  4JEU A;  1HO8 A;  1HE8 A;  5T3R A;  1SQM A;  5KJN A;  3FUF A;  1HS6 A;  2OVB A;  4FLB A;  2AVP A;  4URK A;  4FC8 A;  4FJY A;  3I5P A;  3EDT B;  5LCW C;  3ZRH A;  1N54 A;  4JC8 A;  3CLJ A;  2EQX A;  5JHB A;  4GA2 A;  4UWL A;  2XRZ A;  4WWP A;  2DCP A;  3MKQ B;  3LY7 A;  1HG5 A;  1HG2 A;  3IV0 A;  4F7A A;  5ARF A;  3GZ1 A;  2X6H A;  2IF4 A;  4LEU A;  4B8A A;  4U8H A;  4ILI A;  3ML8 A;  3U9W A;  4C0E A;  4XI0 A;  4CDM A;  4N3C A;  1N52 A;  3S7F A;  3FU0 A;  4XE0 A;  3FUK A;  3IHY A;  3LDZ A;  2IU1 A;  3OTN A;  3CVU A;  2C2L A;  1ELW A;  2XGM A;  4ANU A;  2HO1 A;  4F1S A;  4UI9 K;  4YVO A;  3D9K A;  4JXT A;  4Q94 A;  4YND A;  3SI5 A;  4JZY A;  2MRI A;  2VJ8 A;  3U4T A;  2WQ6 A;  4JA9 A;  3G2U A;  3O48 A;  4I9E A;  3PVL A;  3B7U X;  4J8D A;  2CHX A;  3FH5 A;  1WM5 A;  3SBS A;  2WXK A;  2Y4U A;  3FFL A;  2UY1 B;  2J09 A;  4K0R A;  5EDS A;  5JJT A;  3MJW A;  3FUM A;  4FUL A;  5CHE E;  1DVP A;  2YNQ A;  3MV3 B;  3QB2 A;  2IOL A;  2PM7 A;  4M3O A;  3O4Z A;  1FCH A;  4G25 A;  4U07 A;  5E75 A;  3L22 A;  4JA7 A;  5FZS A;  4CCA A;  4CEM A;  3FUD A;  3SHF A;  1FVH A;  3B7S A;  5D0Q D;  4UQZ A;  2IOS A;  4V3I A;  4RSY A;  2I9C A;  4PH4 B;  1ELR A;  5KJM A;  3MV2 B;  2C0L A;  3S7D A;  3APC A;  3GZS A;  3HIZ A;  2KCL A;  4OVU A;  3P1U A;  4WNG A;  4J8F A;  4BT8 A;  3PE4 A;  3CK9 A;  3CVN A;  3LEW A;  3UX4 A;  4HOR A;  2V5F A;  2WMN A;  3Q5M A;  5JHA A;  4G26 A;  3HVE B;  2Y3A A;  4GA1 A;  4E85 A;  3FH8 A;  1E96 B;  3FTY A;  3IEG A;  4FHJ A;  5J90 A;  4DLQ A;  3ZFW A;  3BEE A;  3R9A B;  4O6F A;  3TJP A;  4U0U A;  3ZYK A;  2QFC A;  2V8S E;  3T5V A;  2XRY A;  4GAA A;  4J0U A;  3B13 A;  4AXH A;  3CSF A;  3RKV A;  3UT8 A;  2WQH A;  4U04 A;  2R17 C;  2MOW A;  3APF A;  3FDH A;  1U3C A;  3CHP A;  2VTB A;  2LAH A;  3CVL A;  3PUK A;  3CVV A;  4NQ0 A;  4BSX A;  5JJ7 A;  2KCK A;  3Q49 B;  4HFG A;  3EIJ A;  3APD A;  5ARG A;  3MX3 A;  2OV8 A;  2WXP A;  3UQ3 A;  5FQ7 A;  2WXF A;  3ZPJ A;  3DBS A;  4CRW A;  3VLE A;  5FZQ A;  3ZW3 A;  2X6F A;  1OWN A;  3TXM A;  1PY1 A;  3FTU A;  4ILH B;  3E4B A;  1HF8 A;  4JPS A;  1EDU A;  4MLP A;  2VSO E;  1NA3 A;  5FT9 A;  3D9N A;  2WVI A;  3N71 A;  2XPY A;  4GU5 A;  4HS2 A;  2VQ2 A;  5T8I A;  4F3V A;  4BFR A;  3CHS A;  3CV0 A;  3S7J A;  4EQF A;  4J8S A;  2GGF A;  3ASH A;  1L5J A;  2XCB A;  4JHJ A;  4A1S A;  4ANV A;  3PNL B;  5D0O D;  4A1G A;  3RK6 A;  2XQ0 A;  4DI3 A;  4KVM A;  3NZS A;  1TEZ A;  2I2O A;  4AV7 A;  1HH8 A;  2HYZ A;  1DNP A;  4FJZ A;  3RO2 A;  5C2Y A;  3Q15 A;  2AXU A;  5BNW A;  4RG9 A;  4YVQ C;  5FTP A;  3SD5 A;  4BWR A;  1B89 A;  4GB9 A;  3RRU A;  3QDN A;  4KZ0 A;  3RU0 A;  4JHK A;  4XX5 A;  4APO A;  1UN8 A;  3VTY A;  4R7L A;  4CGV A;  2XCC A;  3PRZ A;  5CCM A;  2P58 C;  1LF8 A;  4P29 A;  3MGB A;  5E76 A;  2LSV A;  3B7T A;  3ZN3 A;  4I6E A;  2LO6 A;  3L54 A;  3Q47 B;  4GYW A;  4ME2 A;  1HXI A;  3D9I A;  3ULQ A;  1H2V C;  2WXJ A;  3SNX A;  2UY1 A;  4TV3 A;  3TL5 A;  5BT1 A;  4I17 A;  3BG1 B;  3JQ1 A;  2XPZ A;  3AS5 A;  3QK0 A;  1QNF A;  3FUL A;  1E90 A;  3LVQ E;  3LCA A;  4W9R A;  3CGH A;  1UG3 A;  3JQ0 A;  4U0Z A;  4UI9 J;  1MHQ A;  3EIQ C;  4DLO A;  3QOU A;  3EHM A;  4WUY A;  4XKC A;  4ATG A;  2R5S A;  4BX8 A;  5LP0 A;  3TG5 A;  5BV0 A;  2CHW A;  2R59 A;  3MKQ A;  3ESK A;  3CR3 A;  3GYZ A;  3FWV A;  3LYA A;  4NAC A;  3ZHE A;  4LCT A;  4DJA A;  4GPK A;  5KCM A;  3G2W A;  2AXV A;  3ML9 A;  2KC7 A;  3DPD A;  2OVF A;  3PH0 C;  4GZD A;  3QJZ A;  2IFU A;  3C98 A;  3T8M A;  1NZN A;  5HQ8 A;  1U3D A;  4FU3 A;  4UWK A;  3SGH A;  4Q69 A;  4Y6C A;  1IQU A;  1FVF A;  2E0I A;  4XIF A;  5AIJ A;  4IN3 B;  3L08 A;  4I6J A;  3CK8 A;  3D9L A;  4MRU A;  5EX3 A;  3PNT B;  3QWP A;  2XHE A;  2JEK A;  2YQ8 A;  3FUE A;  3LVR E;  2KCV A;  4QFV A;  4XI9 A;  2LSU A;  4Q96 A;  2LNI A;  4CT4 A;  3GZ2 A;  3QC1 A;  5M72 A;  3BG0 B;  4WND A;  1NP7 A;  3CVW A;  4ACL A;  1PAQ A;  4I1A A;  4OYS A;  2PL2 A;  1Z6T A;  3URZ A;  3JYS A;  4G2V A;  1JPL A;  3EJN A;  4FP7 A;  3D9J A;  5G04 J;  1ZBP A;  2ION A;  3RO3 A;  4CGW A;  3SF4 A;  3D3M A;  2KZT B;  5LFA A;  2WXR A;  2FBN A;  4BTA A;  3UMV A;  1E7U A;  2IQC A;  4N2S A;  4JEH A;  3S2A A;  5LOZ A;  3G2T A;  2WM9 A;  4WAF A;  1EPU A;  2YIN A;  3ASG A;  5A6C A;  2YHC A;  3AU5 A;  4N39 A;  1H2T C;  4GZ5 A;  2CFU A;  4FA6 A;  4U0S A;  3NQP A;  4KMO A;  4EZJ A;  3CHR A;  1P5Q A;  4I2W A;  3TG4 A;  2M63 A;  2WXG A;  1H19 A;  4AP2 A;  2FUL A;  2MHK A;  5FQ6 A;  3KD7 A;  3ZHE B;  2WQ7 A;  1IYG A;  3SBT B;  2VSY A;  1OWP A;  3ZIM A;  4BX9 A;  1HU3 A;  2PQN A;  2WXI A;  4XKB A;  3L17 A;  4NRH B;  4C9B B;  1X5B A;  3ENE A;  2VTB B;  2XGS A;  5KJL A;  5ANL A;  3VLD A;  3FUN A;  4KBQ A;  3R7R A;  5FQ4 A;  4DI4 A;  4CDN A;  3UPV A;  1OWM A;  1E7V A;  1HZ4 A;  5HI7 A;  4BY6 A;  2PZI A;  4L23 A;  3GW4 A;  1INZ A;  1OWL A;  2JLB A;  4DPR A;  5A23 A;  2HR2 A;  3MYV A;  3CHQ A;  2CHZ A;  3B7R L;  5BV1 A;  3CQC B;  4H7Y A;  4HOU A;  5CMY A;  2L9B A;  3KAE A;  4H7X A;  3SZ7 A;  4WWN A;  3ONL A;  1ELK A;  3FTV A;  3LXU X;  2ILR A;  2VYI A;  2A5U A;  2FI7 A;  3CVY A;  4J8E A;  2X3M A;  4JL0 A;  3FTZ A;  3MCX A;  5AYW D;  5JJ6 A;  1UJK A;  4KZC A;  4I1M A;  4BT9 A;  4PDX A;  1YA0 A;  3FU5 A;  3HHM A;  2NC9 A;  1HX8 A;  2FF4 A;  2L0I A;  2AW6 A;  4WNE A;  2VGX A;  2J49 A;  5AJL A;  2AXZ A;  3FEX A;  5EX0 A;  4N5C A;  3QWW A;  3CEQ A;  4HLE A;  1KLX A;  2XEV A;  3CIA A;  4GYO A;  5ENN A;  4ILG A;  3PZD A;  3ZGQ A;  1VDY A;  5FQ8 A;  4A3T A;  3G2V A;  1KT1 A;  2KAT A;  2WXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...