1ELKA

Vhs domain of tom1 protein from h. sapiens
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
153
Chain Sequence
SDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords TARGET OF MYB1
publication title Structure of the VHS domain of human Tom1 (target of myb 1): insights into interactions with proteins and membranes
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1elkA00
4GZDA 1HFAA 3ZYQA 2L0IA 1EDUA 2V8SE 3D9JA 2DCPA 1SZAA 1HG5A 3ZYKA 1H0AA 2LO6A 3LDZA 4Q94A 3D9OA 3ONLA 1JWFA 1SZ9A 1X5BA 1ELKA 2QY7A 4NACA 1PY1A 5J08A 5LP0A 1MHQA 1JPLA 1UJJA 3D9PA 1XGWA 3CLJA 3D9MA 3G2SA 1UJKA 3G2UA 3ZYMA 4AVXA 4Q96A 1HX8A 4GZCA 1LF8A 5LOZA 5CMWA 1DVPA 2BF0X 3D9KA 3ONKA 3G2WA 1HF8A 4JXTA 2DIWA 2KM4A 3D9NA 1VDYA 2L0TB 3D9LA 3G2VA 1HG2A 1JWGA 3D9IA 4HFGA 5CMYA 3RRUA 3ZYLA 2MOWA 4FU3A 1JUQA 4FLBA 1INZA 1EYHA 3G2TA
chains in the Genus database with same CATH superfamily
3AAAC 4MS6A 1YCSB 3E33A 3ML9A 3UPVA 3SBSA 3QAQA 4CT0A 2PM6A 4I9EA 3PNTB 2I1JA 1PAQA 4AJWA 4G11A 2R59A 4OVUA 4BTBA 2E0IA 4L2YA 3ZHEB 2XS8A 5B3SE 1H6OA 4B8CB 5CECB 1OWLA 3NB2A 4U63A 3Q47B 2FF4A 3ONKA 2XEHA 3D9NA 3PZ2A 2GROB 1E90A 4NIKA 4A1GA 4TRQA 4RG6A 3V31A 3C98A 3LPZA 1GW6A 4F53A 3D3MA 3LCAA 4ATZD 3IEGA 3SF4A 2ZXWE 1LD8A 2Y0BG 4RSYA 2FULA 1DNPA 4CCAA 1BD8A 4JB8P 5ENTD 3ZXSA 4HVBA 2V8SE 2VSOE 1TN6A 2CG2A 1TN7A 4HNAD 2WXHA 3B95A 2Y4TA 1NFIE 2UY1B 4PS8A 3G2WA 3ZIMA 4N5QA 2H6GA 5BNWA 3FY4A 4XKBA 4EZLA 3CVWA 4J8EA 5FT9A 3CVLA 1S63A 3RRMB 2RG8A 2PM7A 1PY1A 5FZSA 4B94A 4EZJA 1G3NB 4FHKA 2OVFA 4XX5A 3ASFA 2V5QC 2R17C 5HQ8A 5KJKA 1D8EA 4FJYA 3TGOA 1DC2A 4UUCA 5AIJA 2DYSE 3NQPA 4JW1A 3BEEA 5FZQA 3ABLE 4G8KA 4A3TA 2YHCA 3Q9UC 2VGXB 1MZCA 4U07A 1UN9A 2KCKA 2BUGA 4J6IA 5AAOA 4GYOA 3JUIA 2YINA 4KYOB 2IJGX 1TNYA 1EPUA 2P2CP 1OCZE 2KC7A 4N2QA 2OV8A 3FUHA 3APDA 2ZGGA 3D9KA 3AG3E 2I2OA 2CFUA 5EX0A 4GCOA 4EPZA 1P5QA 3CR3A 3TXMA 1U2VG 3Q79A 2AXVA 3RSEG 3AS4A 4NACA 1A17A 3GZSA 2EIJE 4HOQA 2C0LA 4AVXA 1N4PA 4PUCA 1HXIA 4J0UA 2DIWA 3D9IA 5A6CA 2XPIA 4I6GA 3Q4AB 3PH0C 5G05J 4KZCA 3L16A 1NL4A 1IKND 1MQSA 4UWGA 1Z3YA 1ELKA 5ANLA 1KZPA 4DI3A 3B7SA 2P9LG 3UXGA 3T5XA 2R03A 5C1DA 2H6HA 3BUAA 5KBAA 4L9PA 2GGFA 4YDWA 1QZ2A 3CKBA 3FTXA 3NAWA 3B7BA 4GA1A 1JPLA 1W3BA 1YA0A 4RLYA 3C3QA 3S7FA 4FC8A 4AY6A 3FUKA 4BX8A 3ZXPA 3AU5A 3ESKA 4N3CA 4DRXE 2FO1E 3ULQA 1SZAA 2XGMA 3DXKG 2ZU6B 2F8YA 3Q7FA 5G05C 4KXKB 4ANVA 4IULA 5AJDA 2C0MA 3QNKA 1ZU2A 4EHMA 2JABA 3EUVA 1BU9A 4G23A 3QOUA 2WXGA 3TWVA 4NRHB 3UT8A 2I6HA 1LD7A 3BU8A 1HFAA 3MKQA 4N3BA 3O48A 4TXQA 2QFCA 3QKYA 3IHVA 2A5EA 2WXQA 3G2SA 3Q78A 4YVOA 4DK5A 4K5AB 4O6FA 3FU0A 5LCWJ 3FUMA 3V30A 4LUNU 2MOWA 4J7WA 3SQVA 3LVRE 4IRUA 1XNFA 3CVQA 3Q5MA 5HKPA 5FWQA 3SBTB 2BKKB 4I2ZA 2KCLA 5AJLA 4N2SA 4EQFA 1H2UA 1K1BA 1FVFA 5ENNA 3HHMA 4DI4A 2V4HC 4BT8A 5FJYA 4CDMA 1EDUA 5IY5E 3ZFWA 1N11A 2J07A 4Y6WA 4UQZA 4YVQC 4F1PA 4JL0A 2HYZA 5A7DB 5FQ4A 4JA9A 4L1BA 3U64A 3NOCD 5G2NA 4NURA 2LXMA 3B7TA 5LCWC 4HRLA 3U9WA 5AENA 4U7EB 1SW6A 2J49A 3ZHEA 4PS7A 2V0PA 2HM8A 5EDSA 3AS8A 3SD5A 3TWTA 4R7LA 3B13A 1HH8A 3FTSA 2XPZA 3ASDA 3HXCA 3D9MA 4GYWA 4ABNA 3OXLA 3R9AB 3CHMA 2LSUA 3CIAA 3TAXA 4U96D 3VLFA 1TNZA 4CYMD 4F6RD 3R7RA 4UI9J 2QC9A 4I2WA 3E34A 2OOEA 3UM0A 3G2UA 4GTMA 2P9KG 2WQHA 1JCSA 1Y6IA 4N3AA 3VLDA 5T4YA 2X3MA 4AV7A 2NSZA 3FTUA 1UW4B 2GW1A 2Y69E 2UY1A 3LJNA 3UT7A 2ZIRA 5BXOA 5CERB 4DPRA 1UJKA 4K5BA 1NZNA 1IHBA 2ONDA 3ISMC 3FP3A 4ACKA 4CT4A 2WMOA 4GZDA 3V2OA 1TNBA 1NI1A 2GRLA 2IOSA 1E8WA 2FI7A 4WWNA 3ASHA 4UI9C 4GZCA 3MA5A 1E8YA 3FTZA 3RU0A 3ZRHA 3TWUA 4U0SA 4DLQA 1TYQG 3ZPJA 3DWLG 3ZYQA 2VGXA 4GTQA 2ETAA 3ONLA 4OVVA 3HXDA 3CHQA 4JD2G 1YMPA 3EHRA 2VSXE 2KM4A 5CMYA 1V54E 2P58C 2AXUA 4JHJA 5J08A 3W9FA 2P9IG 2XGOA 1HG5A 4BFRA 3CEQA 3E4BA 5BT1A 1H2TC 1ELWA 4ILIA 4Z68A 4TXPA 4LRZA 3BQOA 5A23A 3ZEFA 1K8KG 5ARFA 2L6JA 4DLOA 4JZYA 4APOA 4WUYA 5LX8A 2J4BA 3FWVA 2EQXA 2VGYA 3RAUA 4MKTA 4DJAA 1OUVA 5AARA 1QQEA 2IFUA 4UWFA 4XZ4A 4Q96A 3L08A 2ETCA 4C9BB 5E76A 2CG3A 5AQAA 5CRVA 5EIDA 1TJCA 1MJ0A 1WDYA 1WG0A 4K5CA 3UI2A 1E8ZA 2GRMA 1D9SA 3U4TA 3MV2B 3HDXA 5ENSD 2WXNA 5J90A 4A63B 5KJNA 3LJ3A 5JA4D 2WB2A 2X6HA 3D9LA 2B0OE 2OVBA 4U0ZA 3LY8A 4GU5A 1Z3XA 1JWFA 3HIZA 3MKRA 3BG1B 3SY2A 3UM1A 4BSXA 2L9BA 4I6EA 1KT0A 4GTSA 4CDNA 4GTRA 3NZUA 4V3IA 2P9PG 4WNEA 2FO7A 3KEZA 4WNDA 3HRAA 4A55A 1MX4A 2PNNA 5EILA 5ARGA 3UT4A 1IQRA 3S7JA 3T8KA 2Y4UA 3HXFA 4UQXA 5KJLA 2IONA 5EX3A 3QWPA 1Z5SC 2WXRA 2MRIA 3LXUX 5D0QD 2WM9A 4ATGA 4GMRA 2XHEA 1UN8A 3TG4A 3PVLA 3QJZA 3RRNB 4BESA 1SZ9A 1TNUA 1S64A 4AEZC 3V79K 5D0OD 4TUMA 1TN8A 4GPKA 4WNFA 3GYZA 2RKKA 5AN8A 2PL2A 3CVVA 5ENRD 3MYVA 3IHYA 2WQ6A 1DVPA 2X6FA 3SFYA 3ENEA 4G25A 4CGVA 3OXFA 3UTMA 3CVUA 5CBOA 1O1RA 2JEKA 3T8MA 4PS3A 4L7TA 3D9HA 1HO8A 2QY7A 3WG7E 3FUDA 3ML8A 5KWDA 2KXPC 1OWNA 3FTWA 5DIZA 4BWRA 3LY7A 2UWJG 4W9RA 2IY0C 3CHPA 1EYHA 4UQYA 3L82A 4APFA 1N94A 2RFAA 3DSSA 3CLJA 2WPVA 4LNUD 3FU6A 2Y3AA 3UUXA 3I5PA 1JUQA 3G2TA 2J09A 3L17A 4WNGA 5CRUA 3VTXA 3DPDA 3PDNA 1H19A 1HE8A 4EECA 2YQ8A 1SA5A 1SA4A 5ENPD 1FVHA 2L6BA 1PC2A 1H6PA 3KEAA 3PEVB 5KJMA 1Z6TA 4PH4B 1L5JA 4IYPA 3FTYA 4KVMA 4B8AA 3S7DA 3DSVA 1AWCB 2MHKA 3L6AA 4QFVA 3GW4A 2J8SD 2ZISA 1MX6A 1FT1A 3QB2A 5FIOA 3S2AA 4BSZB 4HQDA 4DX6D 3V2XA 2P9NG 1LTXA 3LS8A 3ABME 1NA0A 4DX7D 1FCHA 5CCMA 4GMLA 4OAUC 3FULA 5KCMA 4E85A 3FUNA 1N4QA 4FULA 3EDTB 2KATA 1Y8MA 2WXLA 3AU4A 5JHAA 3CHRA 4HB5A 3I4RB 5D2MC 4AP2A 1N9AA 1DCEA 3IKOB 5BW8C 4ME2A 2BEDA 1KLXA 3CSTA 4I1OB 3E37A 3OXGA 1E96B 1OCRE 3DSUA 4GMJA 4J8YA 4UI9K 4CGWA 3PE3A 1FT2A 4FA6A 3EHQA 4KMOA 4RVBA 3Q73A 2NXPA 4MLPA 2GRQB 2WVIA 1OWOA 4AXHA 3ZN3A 2WXMA 4JXTA 3Q15A 5KNGA 3SI5A 3PREA 3K9IA 4C0MA 1NP7A 5JJ7A 2XENA 4FLBA 1ZBPA 3EHMA 1D8DA 3T5VA 1H0AA 1E8XA 3J5PA 1MHQA 2XQ0A 2VTBB 2F0YA 4G1TA 3T9KA 2GRNB 3ULYA 2ILRA 4FU3A 3CGHA 2OCCE 3EHNA 3ZYKA 3KAEA 2DYRE 3L54A 4UWLA 3FU3A 3FU5A 4HLEA 3FEYA 2I9CA 4LERA 2BF0X 3P1UA 3ASOE 3E32A 3LEWA 4LEUA 1HG2A 4A3VA 1S70B 3CK9A 3LYAA 2P9UG 3JYSA 4H7YA 3ASGA 3CK7A 2IOLA 1HU3A 3NBNB 3QDNA 1V55E 3ZU7B 5FQ8A 1TR4A 1IYGA 2H6FA 2XZDG 3ULEG 2CHXA 2CHZA 3SZ7A 5HRYA 3OTNA 3DSTA 4IN3B 4GTTA 3KSQA 4ZFHA 2QZAA 3EU9A 4XIFA 3NZSA 2IO2C 4I1MA 3FH7A 4LNBA 2HO1A 3ZVVA 3PRZA 1MX2A 2R05A 4GZ3A 3KS2A 1BLXB 4MRUA 3ASNE 4HRMB 1JCRA 4U8HA 4RQIA 4XKCA 3LKUA 3U66A 4JVSA 3GZ2A 4GZ5A 3PZ1A 4F3VA 4WAFA 4I17A 4BT9A 3Q7AA 2J4DA 3C5RA 4FJZA 2XCBA 4FLHA 1QBQA 3TWWA 4BTAA 3DXMG 5KNHD 1E7VA 3FDHA 4O60A 4PDXA 3PS6A 1MYOA 4GA0A 3SHFA 1LF8A 1U3CA 4BEPA 4CZ2D 1OWMA 3FH5A 2IQCA 5BXUA 2YNQA 2CHWA 2LXLA 1RZ4A 1IQUA 2GRPB 5ENOD 4AIFA 1QNFA 3X2QE 4LG6A 1A5EA 5DBKA 2Y1LE 3BG0B 4H7XA 2LAHA 4TUUA 3CV0A 1N4RA 4GYYA 3I4GA 1BI8B 2WXIA 4CDRA 3PEUB 2DBAA 4HORA 3ZUVB 1HS6A 3D9OA 1FPPA 5BV1A 4YDYA 4G24A 3ZYMA 2F37A 3UKUG 2LSVA 3Q9NC 4FP7A 4TV3A 3PZDA 4HI9A 5HI7A 4F7AA 5AQ9A 3RIBA 3MGBA 2EINE 3CVXA 2I1KA 3CVNA 2P9SG 5D66A 5B1BE 3TJPA 3G2VA 5CCLA 4XEIG 3DSXA 5FTPA 1EF1C 4KZ0A 2XRYA 4U8YD 3TWXA 3MEKA 4E6HA 2MYOA 1KT1A 1HF8A 3RO2A 4JHRA 3DRAA 3L9TA 2VSNA 4JHKA 3HVEB 4P29A 3CKCA 3LVQE 1OT8A 3B7UX 1YYHA 3DBSA 4BX9A 3FHEA 2DZOA 3JQ1A 4U95D 1U3DA 5EYPF 3FUJA 4GB9A 3SNXA 2XS1A 3SGHA 1TJFA 5LOZA 3TG5A 3R9MA 3FEXA 4MBGA 2F8XK 2OEVA 4LCTA 4OAVB 5ITZF 5JHBA 3UX4A 4JPSA 4U8VD 4HS2A 1TNOA 4QQIA 2X38A 3AJIA 5LP0A 2J08A 4G8LA 1IHGA 1K3ZD 2IF4A 5AYWD 3C3RA 3L13A 4RG9A 3JUEA 3ZGQA 5C2YA 4HXIA 4L2LA 2VYIA 5E75A 1JCQA 2BTDA 4NQ0A 1KZOA 2C2LA 3QWWA 5JMND 2J9QA 3CHOA 5ANRA 2R02A 2AVPA 3ZNGA 3RRUA 5T8IA 2IEJA 2EIKE 3AG4E 4BERA 3D9JA 4ANWA 3CK8A 3CHSA 5T3RA 4L23A 4BETA 2XCCA 4Y6CA 3CVPA 4JA7A 1UJJA 5G55A 5JJTA 5M72A 3W9GA 5BUZA 3QARA 5AQBA 3PUKA 3PZ3A 5FINA 3HXEA 2IO3C 5FQ6A 4JC8A 2DZNA 2XEEA 4AM9A 2M63A 4K0RA 4DX2A 1HX8A 3VTYA 3SO8A 2HR2A 3I3NA 3UM3A 1OWPA 1OCCE 2VQ2A 1DCQA 3RK6A 3E30A 2VTBA 1OXJA 4KVOA 4XI0A 3UQ3A 4WWPA 1WM5A 4G2VA 2AW6A 2LO6A 4BY6A 3S7BA 4F1SA 3JCKC 4OYSA 4EZKA 2KCVA 4TXRA 2KZTB 5CBNA 4M3OA 2JLBA 1N95A 3EU5A 4ILGA 1KPSB 3UIOC 4O1OA 1N54A 2GRRB 2A4ZA 2A5UA 4UWHA 2H6IA 2AWIA 3QC1A 1O1TA 2WQ7A 2RFMA 1BPOA 2LAIA 3FUFA 4KT6B 4GCNA 3CQCB 5BV0A 3ZKJA 2PQNA 1B89A 5JJ6A 3TWQA 1ELRA 3FTVA 4UWKA 3RJVA 2FBNA 1ZB1A 2WMNA 2WXKA 4ILHB 3APFA 4J8FA 5BPPA 3WXXA 4U04A 5AQ7A 4D10C 1N52A 2WXJA 2R2LA 3DEOA 3P2BA 3SFXA 3HG0D 2QYJA 5HS0A 3PUJA 5ENQD 5EIBE 3QWVA 4HLLA 3TL5A 4AY5A 3URZA 1BI7B 3APCA 2VGEA 1XGWA 2XZTG 3JXIA 3RKVA 3C72A 3DPYA 2ETBA 3TWSA 2L0IA 1SVXA 3IBEA 4Q94A 4GAAA 1N0QA 4GTPA 3UMVA 3Q75A 4GZ6A 4ANUA 4GPMA 5B1AE 3Q49B 2V5FA 2B6CA 4HFGA 4GA2A 4FHJA 3GZ1A 5CEDB 2WXFA 4HI8A 4LNGA 4EBAG 3NF1A 2LUHA 5EYLA 2VSYA 4HOUA 4XE0A 3UKRG 2DVWA 4CEMA 5FZRA 3U3WA 3VLEA 4DX1A 3EIQC 3IV0A 4I6JA 3MV3B 4GTVA 1UOHA 4G26A 4KBQA 1Q2ZA 3AG2E 2AJAA 4YDOA 4ACLA 3IXEA 1S0PA 3UINC 4I1AA 2QYUA 3J5QB 4HRNA 4B89A 2L0TB 3HXBA 3AS5A 3ZYLA 3L22A 5CHEE 4ZHBA 3OAWA 2VJ8A 2HE0A 3LDZA 4J8DA 3JXJA 4CRWA 3CSFA 2X6JA 3PZ4A 4HOSA 4Q69A 4JEUA 3O4ZA 4JEHA 4DX5D 5G04J 4N39A 1IXVA 2NYJA 2Q7FA 1E7UA 3FUIA 3NOGD 4YDEA 4J8SA 3SFZA 4HBDA 2X6KA 2RD0A 4B0ZA 4DUIA 3C3OA 3MCXA 4WWOA 2EILE 3PE4A 4K03A 3RO3A 2CFZA 2LNIA 4X8QA 3PNLB 4O1PA 2XGSA 2XEVA 3R7QA 3JQ0A 4I43A 1X5BA 3QK0A 1AP7A 3HVEA 3KSLA 1TEZA 4XI9A 5CMWA 3DSWA 1K1AA 3MJWA 2WXOA 1INZA 5H7PA 1O5MA 3LY9A 2AXZA 5G04C 2DCPA 3ZW3A 1N0RA 4LSZE 3KD7A 2DWZA 1VDYA 3HYMB 4C0EA 3FFLA 3EJNA 3MZLB 5FQ7A 1QYMA 4YNDA 1SQMA 3DEPA 5LFAA 2X6IA 3D9PA 3TXNA 3B7RL 4EBAA 4GTOA 1WY6A 2XRZA 2FEZA 2XPYA 4HOTA 1OCOE 1HZ4A 1UG3A 4B93B 3TWRA 3F6QA 3UIPC 4C48B 4URKA 3N71A 3FUEA 1X81A 2V4LA 3ABKE 4FADA 2OEWA 2WXPA 3MKQB 1RW2A 4M7CA 4I9CA 2IU1A 4ANXA 1WAO1 5CEAA 2PZIA 1N4SA 3EIJA 2EIME 3MX3A 1JWGA 3CVYA 1H2VC 5EKQD 2R5SA 4N5CA 3FH8A 2E2EA 2KBXA 2NC9A 5EN5D 4U0UA 1H6KA 2YHEA 1O1SA 3ESLA 3AG1E 3UM2A 4AOFA 1OY3D 2BKGA 4A1SA 2ZGDA 2KZTA 1NA3A 2PQRA 3CQGB
chains in the Genus database with same CATH topology
3AS8A 3SD5A 5FQ6A 4JC8A 4R7LA 4MS6A 3B13A 3I4RB 4AP2A 1HH8A 3FTSA 3IKOB 4AM9A 3ML9A 2M63A 3UPVA 3SBSA 5BW8C 4ME2A 2XPZA 3ASDA 3D9MA 3QAQA 4GYWA 4K0RA 4ABNA 4CT0A 3OXLA 2PM6A 3R9AB 4I9EA 1HX8A 1KLXA 3CSTA 4I1OB 3VTYA 3PNTB 2HR2A 3I3NA 3CHMA 3OXGA 1E96B 1OWPA 2LSUA 2VQ2A 2I1JA 3CIAA 3RK6A 2VTBA 3TAXA 1PAQA 4AJWA 4G11A 4KVOA 2R59A 4XI0A 4OVUA 4WWPA 4GMJA 3UQ3A 3VLFA 1WM5A 4UI9K 4CGWA 3PE3A 3R7RA 4UI9J 4G2VA 4BTBA 4FA6A 2AW6A 2E0IA 4I2WA 4KMOA 4L2YA 2LO6A 4RVBA 3ZHEB 2NXPA 3S7BA 4MLPA 4BY6A 3JCKC 4OYSA 4F1SA 4EZKA 2KCVA 2KZTB 2OOEA 2WVIA 1OWOA 4B8CB 3G2UA 4AXHA 4M3OA 2JLBA 1OWLA 4U63A 3Q47B 4ILGA 2FF4A 2WQHA 3ZN3A 3ONKA 2WXMA 4JXTA 1N54A 1Y6IA 3D9NA 4N3AA 3Q15A 3VLDA 5T4YA 3SI5A 2A4ZA 2X3MA 2A5UA 3K9IA 3PREA 2NSZA 4UWHA 4AV7A 3FTUA 1NP7A 1E90A 4C0MA 5JJ7A 1UW4B 1ZBPA 4FLBA 4A1GA 2AWIA 2GW1A 2UY1A 3QC1A 4TRQA 4RG6A 3EHMA 3C98A 3LPZA 1GW6A 3T5VA 1H0AA 4F53A 3UT7A 2WQ7A 3D3MA 3LCAA 1E8XA 3IEGA 3SF4A 1MHQA 2XQ0A 2VTBB 4DPRA 1UJKA 1NZNA 4RSYA 2ONDA 2FULA 1BPOA 2LAIA 3FUFA 4G1TA 4KT6B 1DNPA 4CCAA 4GCNA 2ILRA 3CQCB 3FP3A 4ACKA 5BV0A 4CT4A 2PQNA 1B89A 5JJ6A 1ELRA 2WMOA 3FTVA 4FU3A 4UWKA 3ZXSA 3RJVA 3CGHA 2FBNA 4GZDA 4HVBA 2V8SE 2WMNA 2WXKA 2VSOE 2GRLA 3EHNA 2CG2A 3ZYKA 2IOSA 4ILHB 1E8WA 3APFA 3KAEA 2WXHA 4J8FA 2FI7A 3L54A 2Y4TA 4UWLA 3FU3A 4WWNA 3FU5A 5BPPA 3ASHA 4HLEA 2UY1B 3WXXA 4U04A 3FEYA 4UI9C 4GZCA 2I9CA 4LERA 3MA5A 4D10C 2BF0X 1E8YA 1N52A 2WXJA 3G2WA 3P1UA 4PS8A 3LEWA 4LEUA 3ZIMA 1HG2A 3FTZA 3P2BA 3RU0A 3ZRHA 4A3VA 4U0SA 3CK9A 3LYAA 4DLQA 5BNWA 3FY4A 3ZPJA 3JYSA 4XKBA 3PUJA 4H7YA 4EZLA 3ASGA 3ZYQA 2VGXA 3CK7A 3CVWA 4J8EA 5FT9A 2IOLA 3QWVA 3CVLA 3ONLA 1HU3A 3RRMB 3TL5A 4AY5A 2RG8A 2PM7A 1PY1A 3QDNA 3URZA 3APCA 5FZSA 1XGWA 4B94A 5FQ8A 4OVVA 4EZJA 4FHKA 1IYGA 3CHQA 2OVFA 4XX5A 3ASFA 3RKVA 3SZ7A 2CHXA 2CHZA 2R17C 2VSXE 2KM4A 5HQ8A 5KJKA 3OTNA 5CMYA 4FJYA 3TGOA 4IN3B 2P58C 2AXUA 4JHJA 5J08A 4XIFA 5AIJA 2L0IA 3IBEA 3NZSA 3NQPA 4JW1A 3BEEA 2XGOA 5FZQA 1HG5A 4BFRA 3CEQA 4Q94A 4I1MA 3FH7A 3E4BA 5BT1A 1H2TC 4GAAA 1ELWA 4ILIA 3UMVA 4GZ6A 2HO1A 4A3TA 4ANUA 3Q49B 2YHCA 3ZVVA 2V5FA 3PRZA 2VGXB 4LRZA 4U07A 5A23A 3ZEFA 1UN9A 2KCKA 2BUGA 4GZ3A 3KS2A 4HFGA 5ARFA 4MRUA 2L6JA 4GA2A 4DLOA 4J6IA 4U8HA 4FHJA 4JZYA 3GZ1A 4XKCA 4APOA 3LKUA 4WUYA 3U66A 4GYOA 3JUIA 4JVSA 2YINA 4KYOB 5LX8A 3GZ2A 2J4BA 2WXFA 2IJGX 4GZ5A 3FWVA 4F3VA 2EQXA 4WAFA 2VGYA 1EPUA 4I17A 4MKTA 4DJAA 1OUVA 4BT9A 4EBAG 3NF1A 2J4DA 2KC7A 4N2QA 1QQEA 2IFUA 4UWFA 2OV8A 4FJZA 3FUHA 4Q96A 4XZ4A 3APDA 3L08A 2VSYA 4C9BB 3D9KA 4HOUA 5E76A 2CG3A 2XCBA 4FLHA 1TJCA 2I2OA 4XE0A 2CFUA 4CEMA 5EX0A 1E8ZA 5FZRA 4GCOA 3U3WA 2GRMA 4EPZA 1P5QA 3VLEA 3U4TA 4BTAA 3MV2B 3EIQC 3IV0A 4I6JA 3CR3A 3MV3B 3TXMA 4G26A 3HDXA 1E7VA 2AXVA 2WXNA 4KBQA 3FDHA 5J90A 4PDXA 3AS4A 3PS6A 1A17A 4NACA 3GZSA 4HOQA 4ACLA 2C0LA 5KJNA 4AVXA 1S0PA 4PUCA 3LJ3A 4GA0A 4I1AA 1LF8A 1HXIA 1U3CA 3SHFA 2WB2A 4J0UA 2X6HA 2DIWA 4B89A 2L0TB 3D9LA 1OWMA 3FH5A 3D9IA 5A6CA 2IQCA 2XPIA 3AS5A 3ZYLA 2YNQA 2CHWA 4I6GA 3Q4AB 3PH0C 5G05J 3L22A 1IQUA 2OVBA 4KZCA 4U0ZA 3LY8A 5CHEE 3L16A 1MQSA 4UWGA 3OAWA 2VJ8A 3LDZA 4J8DA 4GU5A 4AIFA 1Z3XA 1QNFA 1JWFA 1Z3YA 3HIZA 1ELKA 3MKRA 3BG1B 5ANLA 4BSXA 4CRWA 3B7SA 3CSFA 5DBKA 4DI3A 2L9BA 4I6EA 2X6JA 4HOSA 1KT0A 4CDNA 3BG0B 4Q69A 4JEUA 3NZUA 3O4ZA 4JEHA 4H7XA 2LAHA 4V3IA 3T5XA 4TUUA 3CV0A 5G04J 4GYYA 3I4GA 5C1DA 4WNEA 2FO7A 4N39A 2WXIA 3KEZA 4WNDA 4CDRA 2GGFA 3PEUB 4A55A 2Q7FA 1QZ2A 1E7UA 3FUIA 3CKBA 2DBAA 5ARGA 4HORA 3UT4A 4J8SA 1HS6A 3D9OA 3FTXA 3SFZA 2X6KA 5BV1A 4GA1A 1IQRA 4G24A 1JPLA 3S7JA 1W3BA 2RD0A 3ZYMA 1YA0A 2Y4UA 4B0ZA 4UQXA 5KJLA 2IONA 5EX3A 3MCXA 3QWPA 4FC8A 3S7FA 4AY6A 2LSVA 2WXRA 2MRIA 3FUKA 3LXUX 5D0QD 4BX8A 4WWOA 3PE4A 3AU5A 4K03A 2WM9A 3RO3A 2CFZA 3ESKA 2LNIA 4FP7A 4TV3A 3PNLB 3PZDA 4N3CA 5HI7A 2XHEA 4ATGA 2XGSA 3ULQA 1UN8A 1SZAA 3TG4A 4F7AA 3PVLA 2XEVA 3QJZA 3RRNB 2XGMA 3JQ0A 4I43A 3R7QA 1SZ9A 1X5BA 3QK0A 3RIBA 4AEZC 2ZU6B 5D0OD 3MGBA 5G05C 4GPKA 4WNFA 3GYZA 3HVEA 3CVXA 2PL2A 2I1KA 3CVVA 1TEZA 4XI9A 3MYVA 3IHYA 2WQ6A 4KXKB 5CMWA 1DVPA 2X6FA 3CVNA 3ENEA 4G25A 3TJPA 3G2VA 3MJWA 4ANVA 4IULA 5CCLA 4CGVA 2WXOA 5AJDA 3OXFA 2C0MA 3CVUA 1INZA 3QNKA 1ZU2A 3LY9A 2AXZA 2JEKA 5FTPA 3T8MA 4PS3A 5G04C 2DCPA 1EF1C 4KZ0A 3ZW3A 4L7TA 2XRYA 1HO8A 4G23A 2QY7A 3KD7A 3QOUA 2WXGA 3FUDA 3MEKA 4E6HA 3ML8A 4NRHB 1KT1A 1OWNA 3UT8A 3FTWA 5DIZA 4BWRA 1HF8A 3RO2A 3LY7A 1VDYA 2I6HA 4JHRA 3HYMB 4C0EA 2UWJG 4W9RA 3FFLA 2VSNA 3CHPA 1EYHA 4JHKA 4UQYA 3HVEB 1HFAA 4P29A 4APFA 3CKCA 3EJNA 3LVQE 3B7UX 3MKQA 3MZLB 4N3BA 5FQ7A 3DBSA 4BX9A 3O48A 3FHEA 5LFAA 4YNDA 1SQMA 2QFCA 3JQ1A 3QKYA 3IHVA 1U3DA 2X6IA 3FUJA 2WXQA 3D9PA 3G2SA 3CLJA 4GB9A 3SNXA 3SGHA 4YVOA 2WPVA 3TXNA 4DK5A 3FU6A 1TJFA 2Y3AA 5LOZA 3B7RL 3TG5A 3FEXA 3UUXA 4O6FA 3I5PA 3FU0A 4EBAA 5LCWJ 3FUMA 4LUNU 4LCTA 2MOWA 1JUQA 1WY6A 3G2TA 2J09A 3LVRE 4IRUA 3L17A 4WNGA 5JHBA 2XRZA 3VTXA 1XNFA 3CVQA 2FEZA 2XPYA 1H19A 3DPDA 1HE8A 3PDNA 3Q5MA 1HZ4A 4JPSA 3UX4A 4HOTA 4EECA 5FWQA 1UG3A 2YQ8A 4HS2A 3SBTB 2X38A 1FVHA 5LP0A 1PC2A 2J08A 2KCLA 3N71A 3FUEA 4I2ZA 4URKA 2V4LA 5AJLA 1IHGA 4FADA 2IF4A 5AYWD 2WXPA 3MKQB 3PEVB 4N2SA 4EQFA 5KJMA 1H2UA 3L13A 1FVFA 5ENNA 4RG9A 3HHMA 1Z6TA 4DI4A 4I9CA 4PH4B 3ZGQA 1L5JA 5C2YA 4HXIA 2IU1A 4IYPA 1WAO1 1EDUA 5FJYA 4ANXA 4L2LA 4BT8A 2VYIA 4CDMA 3FTYA 4KVMA 3ZFWA 5E75A 2J07A 4B8AA 4Y6WA 4UQZA 3S7DA 2BTDA 4NQ0A 4YVQC 2MHKA 4JL0A 2HYZA 2C2LA 3L6AA 3QWWA 4QFVA 5A7DB 5FQ4A 3GW4A 2PZIA 2J9QA 3CHOA 3EIJA 4JA9A 4L1BA 5ANRA 3QB2A 3MX3A 1JWGA 3U64A 3S2AA 2AVPA 3CVYA 3RRUA 5T8IA 5G2NA 1H2VC 5EKQD 2R5SA 4NURA 4N5CA 3FH8A 2E2EA 3LS8A 3D9JA 2NC9A 1NA0A 1FCHA 3B7TA 4ANWA 5CCMA 3CK8A 3CHSA 4U0UA 5LCWC 4GMLA 5T3RA 1H6KA 2YHEA 4L23A 2XCCA 3FULA 4Y6CA 3CVPA 4JA7A 1UJJA 5KCMA 4E85A 3U9WA 3FUNA 5G55A 5AENA 5JJTA 3ESLA 2J49A 3ZHEA 5M72A 5BUZA 4AOFA 4FULA 3EDTB 3QARA 4PS7A 3PUKA 4A1SA 2KATA 2V0PA 1Y8MA 2KZTA 1NA3A 2HM8A 2PQRA 5EDSA 2WXLA 3CQGB 3AU4A 5JHAA 3CHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZD A;  1HFA A;  3ZYQ A;  2L0I A;  1EDU A;  2V8S E;  3D9J A;  2DCP A;  1SZA A;  1HG5 A;  3ZYK A;  1H0A A;  2LO6 A;  3LDZ A;  4Q94 A;  3D9O A;  3ONL A;  1JWF A;  1SZ9 A;  1X5B A;  1ELK A;  2QY7 A;  4NAC A;  1PY1 A;  5J08 A;  5LP0 A;  1MHQ A;  1JPL A;  1UJJ A;  3D9P A;  1XGW A;  3CLJ A;  3D9M A;  3G2S A;  1UJK A;  3G2U A;  3ZYM A;  4AVX A;  4Q96 A;  1HX8 A;  4GZC A;  1LF8 A;  5LOZ A;  5CMW A;  1DVP A;  2BF0 X;  3D9K A;  3ONK A;  3G2W A;  1HF8 A;  4JXT A;  2DIW A;  2KM4 A;  3D9N A;  1VDY A;  2L0T B;  3D9L A;  3G2V A;  1HG2 A;  1JWG A;  3D9I A;  4HFG A;  5CMY A;  3RRU A;  3ZYL A;  2MOW A;  4FU3 A;  1JUQ A;  4FLB A;  1INZ A;  1EYH A;  3G2T A; 
#chains in the Genus database with same CATH topology
 3AAA C;  4MS6 A;  1YCS B;  3E33 A;  3ML9 A;  3UPV A;  3SBS A;  3QAQ A;  4CT0 A;  2PM6 A;  4I9E A;  3PNT B;  2I1J A;  1PAQ A;  4AJW A;  4G11 A;  2R59 A;  4OVU A;  4BTB A;  2E0I A;  4L2Y A;  3ZHE B;  2XS8 A;  5B3S E;  1H6O A;  4B8C B;  5CEC B;  1OWL A;  3NB2 A;  4U63 A;  3Q47 B;  2FF4 A;  3ONK A;  2XEH A;  3D9N A;  3PZ2 A;  2GRO B;  1E90 A;  4NIK A;  4A1G A;  4TRQ A;  4RG6 A;  3V31 A;  3C98 A;  3LPZ A;  1GW6 A;  4F53 A;  3D3M A;  3LCA A;  4ATZ D;  3IEG A;  3SF4 A;  2ZXW E;  1LD8 A;  2Y0B G;  4RSY A;  2FUL A;  1DNP A;  4CCA A;  1BD8 A;  4JB8 P;  5ENT D;  3ZXS A;  4HVB A;  2V8S E;  2VSO E;  1TN6 A;  2CG2 A;  1TN7 A;  4HNA D;  2WXH A;  3B95 A;  2Y4T A;  1NFI E;  2UY1 B;  4PS8 A;  3G2W A;  3ZIM A;  4N5Q A;  2H6G A;  5BNW A;  3FY4 A;  4XKB A;  4EZL A;  3CVW A;  4J8E A;  5FT9 A;  3CVL A;  1S63 A;  3RRM B;  2RG8 A;  2PM7 A;  1PY1 A;  5FZS A;  4B94 A;  4EZJ A;  1G3N B;  4FHK A;  2OVF A;  4XX5 A;  3ASF A;  2V5Q C;  2R17 C;  5HQ8 A;  5KJK A;  1D8E A;  4FJY A;  3TGO A;  1DC2 A;  4UUC A;  5AIJ A;  2DYS E;  3NQP A;  4JW1 A;  3BEE A;  5FZQ A;  3ABL E;  4G8K A;  4A3T A;  2YHC A;  3Q9U C;  2VGX B;  1MZC A;  4U07 A;  1UN9 A;  2KCK A;  2BUG A;  4J6I A;  5AAO A;  4GYO A;  3JUI A;  2YIN A;  4KYO B;  2IJG X;  1TNY A;  1EPU A;  2P2C P;  1OCZ E;  2KC7 A;  4N2Q A;  2OV8 A;  3FUH A;  3APD A;  2ZGG A;  3D9K A;  3AG3 E;  2I2O A;  2CFU A;  5EX0 A;  4GCO A;  4EPZ A;  1P5Q A;  3CR3 A;  3TXM A;  1U2V G;  3Q79 A;  2AXV A;  3RSE G;  3AS4 A;  4NAC A;  1A17 A;  3GZS A;  2EIJ E;  4HOQ A;  2C0L A;  4AVX A;  1N4P A;  4PUC A;  1HXI A;  4J0U A;  2DIW A;  3D9I A;  5A6C A;  2XPI A;  4I6G A;  3Q4A B;  3PH0 C;  5G05 J;  4KZC A;  3L16 A;  1NL4 A;  1IKN D;  1MQS A;  4UWG A;  1Z3Y A;  1ELK A;  5ANL A;  1KZP A;  4DI3 A;  3B7S A;  2P9L G;  3UXG A;  3T5X A;  2R03 A;  5C1D A;  2H6H A;  3BUA A;  5KBA A;  4L9P A;  2GGF A;  4YDW A;  1QZ2 A;  3CKB A;  3FTX A;  3NAW A;  3B7B A;  4GA1 A;  1JPL A;  1W3B A;  1YA0 A;  4RLY A;  3C3Q A;  3S7F A;  4FC8 A;  4AY6 A;  3FUK A;  4BX8 A;  3ZXP A;  3AU5 A;  3ESK A;  4N3C A;  4DRX E;  2FO1 E;  3ULQ A;  1SZA A;  2XGM A;  3DXK G;  2ZU6 B;  2F8Y A;  3Q7F A;  5G05 C;  4KXK B;  4ANV A;  4IUL A;  5AJD A;  2C0M A;  3QNK A;  1ZU2 A;  4EHM A;  2JAB A;  3EUV A;  1BU9 A;  4G23 A;  3QOU A;  2WXG A;  3TWV A;  4NRH B;  3UT8 A;  2I6H A;  1LD7 A;  3BU8 A;  1HFA A;  3MKQ A;  4N3B A;  3O48 A;  4TXQ A;  2QFC A;  3QKY A;  3IHV A;  2A5E A;  2WXQ A;  3G2S A;  3Q78 A;  4YVO A;  4DK5 A;  4K5A B;  4O6F A;  3FU0 A;  5LCW J;  3FUM A;  3V30 A;  4LUN U;  2MOW A;  4J7W A;  3SQV A;  3LVR E;  4IRU A;  1XNF A;  3CVQ A;  3Q5M A;  5HKP A;  5FWQ A;  3SBT B;  2BKK B;  4I2Z A;  2KCL A;  5AJL A;  4N2S A;  4EQF A;  1H2U A;  1K1B A;  1FVF A;  5ENN A;  3HHM A;  4DI4 A;  2V4H C;  4BT8 A;  5FJY A;  4CDM A;  1EDU A;  5IY5 E;  3ZFW A;  1N11 A;  2J07 A;  4Y6W A;  4UQZ A;  4YVQ C;  4F1P A;  4JL0 A;  2HYZ A;  5A7D B;  5FQ4 A;  4JA9 A;  4L1B A;  3U64 A;  3NOC D;  5G2N A;  4NUR A;  2LXM A;  3B7T A;  5LCW C;  4HRL A;  3U9W A;  5AEN A;  4U7E B;  1SW6 A;  2J49 A;  3ZHE A;  4PS7 A;  2V0P A;  2HM8 A;  5EDS A;  3AS8 A;  3SD5 A;  3TWT A;  4R7L A;  3B13 A;  1HH8 A;  3FTS A;  2XPZ A;  3ASD A;  3HXC A;  3D9M A;  4GYW A;  4ABN A;  3OXL A;  3R9A B;  3CHM A;  2LSU A;  3CIA A;  3TAX A;  4U96 D;  3VLF A;  1TNZ A;  4CYM D;  4F6R D;  3R7R A;  4UI9 J;  2QC9 A;  4I2W A;  3E34 A;  2OOE A;  3UM0 A;  3G2U A;  4GTM A;  2P9K G;  2WQH A;  1JCS A;  1Y6I A;  4N3A A;  3VLD A;  5T4Y A;  2X3M A;  4AV7 A;  2NSZ A;  3FTU A;  1UW4 B;  2GW1 A;  2Y69 E;  2UY1 A;  3LJN A;  3UT7 A;  2ZIR A;  5BXO A;  5CER B;  4DPR A;  1UJK A;  4K5B A;  1NZN A;  1IHB A;  2OND A;  3ISM C;  3FP3 A;  4ACK A;  4CT4 A;  2WMO A;  4GZD A;  3V2O A;  1TNB A;  1NI1 A;  2GRL A;  2IOS A;  1E8W A;  2FI7 A;  4WWN A;  3ASH A;  4UI9 C;  4GZC A;  3MA5 A;  1E8Y A;  3FTZ A;  3RU0 A;  3ZRH A;  3TWU A;  4U0S A;  4DLQ A;  1TYQ G;  3ZPJ A;  3DWL G;  3ZYQ A;  2VGX A;  4GTQ A;  2ETA A;  3ONL A;  4OVV A;  3HXD A;  3CHQ A;  4JD2 G;  1YMP A;  3EHR A;  2VSX E;  2KM4 A;  5CMY A;  1V54 E;  2P58 C;  2AXU A;  4JHJ A;  5J08 A;  3W9F A;  2P9I G;  2XGO A;  1HG5 A;  4BFR A;  3CEQ A;  3E4B A;  5BT1 A;  1H2T C;  1ELW A;  4ILI A;  4Z68 A;  4TXP A;  4LRZ A;  3BQO A;  5A23 A;  3ZEF A;  1K8K G;  5ARF A;  2L6J A;  4DLO A;  4JZY A;  4APO A;  4WUY A;  5LX8 A;  2J4B A;  3FWV A;  2EQX A;  2VGY A;  3RAU A;  4MKT A;  4DJA A;  1OUV A;  5AAR A;  1QQE A;  2IFU A;  4UWF A;  4XZ4 A;  4Q96 A;  3L08 A;  2ETC A;  4C9B B;  5E76 A;  2CG3 A;  5AQA A;  5CRV A;  5EID A;  1TJC A;  1MJ0 A;  1WDY A;  1WG0 A;  4K5C A;  3UI2 A;  1E8Z A;  2GRM A;  1D9S A;  3U4T A;  3MV2 B;  3HDX A;  5ENS D;  2WXN A;  5J90 A;  4A63 B;  5KJN A;  3LJ3 A;  5JA4 D;  2WB2 A;  2X6H A;  3D9L A;  2B0O E;  2OVB A;  4U0Z A;  3LY8 A;  4GU5 A;  1Z3X A;  1JWF A;  3HIZ A;  3MKR A;  3BG1 B;  3SY2 A;  3UM1 A;  4BSX A;  2L9B A;  4I6E A;  1KT0 A;  4GTS A;  4CDN A;  4GTR A;  3NZU A;  4V3I A;  2P9P G;  4WNE A;  2FO7 A;  3KEZ A;  4WND A;  3HRA A;  4A55 A;  1MX4 A;  2PNN A;  5EIL A;  5ARG A;  3UT4 A;  1IQR A;  3S7J A;  3T8K A;  2Y4U A;  3HXF A;  4UQX A;  5KJL A;  2ION A;  5EX3 A;  3QWP A;  1Z5S C;  2WXR A;  2MRI A;  3LXU X;  5D0Q D;  2WM9 A;  4ATG A;  4GMR A;  2XHE A;  1UN8 A;  3TG4 A;  3PVL A;  3QJZ A;  3RRN B;  4BES A;  1SZ9 A;  1TNU A;  1S64 A;  4AEZ C;  3V79 K;  5D0O D;  4TUM A;  1TN8 A;  4GPK A;  4WNF A;  3GYZ A;  2RKK A;  5AN8 A;  2PL2 A;  3CVV A;  5ENR D;  3MYV A;  3IHY A;  2WQ6 A;  1DVP A;  2X6F A;  3SFY A;  3ENE A;  4G25 A;  4CGV A;  3OXF A;  3UTM A;  3CVU A;  5CBO A;  1O1R A;  2JEK A;  3T8M A;  4PS3 A;  4L7T A;  3D9H A;  1HO8 A;  2QY7 A;  3WG7 E;  3FUD A;  3ML8 A;  5KWD A;  2KXP C;  1OWN A;  3FTW A;  5DIZ A;  4BWR A;  3LY7 A;  2UWJ G;  4W9R A;  2IY0 C;  3CHP A;  1EYH A;  4UQY A;  3L82 A;  4APF A;  1N94 A;  2RFA A;  3DSS A;  3CLJ A;  2WPV A;  4LNU D;  3FU6 A;  2Y3A A;  3UUX A;  3I5P A;  1JUQ A;  3G2T A;  2J09 A;  3L17 A;  4WNG A;  5CRU A;  3VTX A;  3DPD A;  3PDN A;  1H19 A;  1HE8 A;  4EEC A;  2YQ8 A;  1SA5 A;  1SA4 A;  5ENP D;  1FVH A;  2L6B A;  1PC2 A;  1H6P A;  3KEA A;  3PEV B;  5KJM A;  1Z6T A;  4PH4 B;  1L5J A;  4IYP A;  3FTY A;  4KVM A;  4B8A A;  3S7D A;  3DSV A;  1AWC B;  2MHK A;  3L6A A;  4QFV A;  3GW4 A;  2J8S D;  2ZIS A;  1MX6 A;  1FT1 A;  3QB2 A;  5FIO A;  3S2A A;  4BSZ B;  4HQD A;  4DX6 D;  3V2X A;  2P9N G;  1LTX A;  3LS8 A;  3ABM E;  1NA0 A;  4DX7 D;  1FCH A;  5CCM A;  4GML A;  4OAU C;  3FUL A;  5KCM A;  4E85 A;  3FUN A;  1N4Q A;  4FUL A;  3EDT B;  2KAT A;  1Y8M A;  2WXL A;  3AU4 A;  5JHA A;  3CHR A;  4HB5 A;  3I4R B;  5D2M C;  4AP2 A;  1N9A A;  1DCE A;  3IKO B;  5BW8 C;  4ME2 A;  2BED A;  1KLX A;  3CST A;  4I1O B;  3E37 A;  3OXG A;  1E96 B;  1OCR E;  3DSU A;  4GMJ A;  4J8Y A;  4UI9 K;  4CGW A;  3PE3 A;  1FT2 A;  4FA6 A;  3EHQ A;  4KMO A;  4RVB A;  3Q73 A;  2NXP A;  4MLP A;  2GRQ B;  2WVI A;  1OWO A;  4AXH A;  3ZN3 A;  2WXM A;  4JXT A;  3Q15 A;  5KNG A;  3SI5 A;  3PRE A;  3K9I A;  4C0M A;  1NP7 A;  5JJ7 A;  2XEN A;  4FLB A;  1ZBP A;  3EHM A;  1D8D A;  3T5V A;  1H0A A;  1E8X A;  3J5P A;  1MHQ A;  2XQ0 A;  2VTB B;  2F0Y A;  4G1T A;  3T9K A;  2GRN B;  3ULY A;  2ILR A;  4FU3 A;  3CGH A;  2OCC E;  3EHN A;  3ZYK A;  3KAE A;  2DYR E;  3L54 A;  4UWL A;  3FU3 A;  3FU5 A;  4HLE A;  3FEY A;  2I9C A;  4LER A;  2BF0 X;  3P1U A;  3ASO E;  3E32 A;  3LEW A;  4LEU A;  1HG2 A;  4A3V A;  1S70 B;  3CK9 A;  3LYA A;  2P9U G;  3JYS A;  4H7Y A;  3ASG A;  3CK7 A;  2IOL A;  1HU3 A;  3NBN B;  3QDN A;  1V55 E;  3ZU7 B;  5FQ8 A;  1TR4 A;  1IYG A;  2H6F A;  2XZD G;  3ULE G;  2CHX A;  2CHZ A;  3SZ7 A;  5HRY A;  3OTN A;  3DST A;  4IN3 B;  4GTT A;  3KSQ A;  4ZFH A;  2QZA A;  3EU9 A;  4XIF A;  3NZS A;  2IO2 C;  4I1M A;  3FH7 A;  4LNB A;  2HO1 A;  3ZVV A;  3PRZ A;  1MX2 A;  2R05 A;  4GZ3 A;  3KS2 A;  1BLX B;  4MRU A;  3ASN E;  4HRM B;  1JCR A;  4U8H A;  4RQI A;  4XKC A;  3LKU A;  3U66 A;  4JVS A;  3GZ2 A;  4GZ5 A;  3PZ1 A;  4F3V A;  4WAF A;  4I17 A;  4BT9 A;  3Q7A A;  2J4D A;  3C5R A;  4FJZ A;  2XCB A;  4FLH A;  1QBQ A;  3TWW A;  4BTA A;  3DXM G;  5KNH D;  1E7V A;  3FDH A;  4O60 A;  4PDX A;  3PS6 A;  1MYO A;  4GA0 A;  3SHF A;  1LF8 A;  1U3C A;  4BEP A;  4CZ2 D;  1OWM A;  3FH5 A;  2IQC A;  5BXU A;  2YNQ A;  2CHW A;  2LXL A;  1RZ4 A;  1IQU A;  2GRP B;  5ENO D;  4AIF A;  1QNF A;  3X2Q E;  4LG6 A;  1A5E A;  5DBK A;  2Y1L E;  3BG0 B;  4H7X A;  2LAH A;  4TUU A;  3CV0 A;  1N4R A;  4GYY A;  3I4G A;  1BI8 B;  2WXI A;  4CDR A;  3PEU B;  2DBA A;  4HOR A;  3ZUV B;  1HS6 A;  3D9O A;  1FPP A;  5BV1 A;  4YDY A;  4G24 A;  3ZYM A;  2F37 A;  3UKU G;  2LSV A;  3Q9N C;  4FP7 A;  4TV3 A;  3PZD A;  4HI9 A;  5HI7 A;  4F7A A;  5AQ9 A;  3RIB A;  3MGB A;  2EIN E;  3CVX A;  2I1K A;  3CVN A;  2P9S G;  5D66 A;  5B1B E;  3TJP A;  3G2V A;  5CCL A;  4XEI G;  3DSX A;  5FTP A;  1EF1 C;  4KZ0 A;  2XRY A;  4U8Y D;  3TWX A;  3MEK A;  4E6H A;  2MYO A;  1KT1 A;  1HF8 A;  3RO2 A;  4JHR A;  3DRA A;  3L9T A;  2VSN A;  4JHK A;  3HVE B;  4P29 A;  3CKC A;  3LVQ E;  1OT8 A;  3B7U X;  1YYH A;  3DBS A;  4BX9 A;  3FHE A;  2DZO A;  3JQ1 A;  4U95 D;  1U3D A;  5EYP F;  3FUJ A;  4GB9 A;  3SNX A;  2XS1 A;  3SGH A;  1TJF A;  5LOZ A;  3TG5 A;  3R9M A;  3FEX A;  4MBG A;  2F8X K;  2OEV A;  4LCT A;  4OAV B;  5ITZ F;  5JHB A;  3UX4 A;  4JPS A;  4U8V D;  4HS2 A;  1TNO A;  4QQI A;  2X38 A;  3AJI A;  5LP0 A;  2J08 A;  4G8L A;  1IHG A;  1K3Z D;  2IF4 A;  5AYW D;  3C3R A;  3L13 A;  4RG9 A;  3JUE A;  3ZGQ A;  5C2Y A;  4HXI A;  4L2L A;  2VYI A;  5E75 A;  1JCQ A;  2BTD A;  4NQ0 A;  1KZO A;  2C2L A;  3QWW A;  5JMN D;  2J9Q A;  3CHO A;  5ANR A;  2R02 A;  2AVP A;  3ZNG A;  3RRU A;  5T8I A;  2IEJ A;  2EIK E;  3AG4 E;  4BER A;  3D9J A;  4ANW A;  3CK8 A;  3CHS A;  5T3R A;  4L23 A;  4BET A;  2XCC A;  4Y6C A;  3CVP A;  4JA7 A;  1UJJ A;  5G55 A;  5JJT A;  5M72 A;  3W9G A;  5BUZ A;  3QAR A;  5AQB A;  3PUK A;  3PZ3 A;  5FIN A;  3HXE A;  2IO3 C;  5FQ6 A;  4JC8 A;  2DZN A;  2XEE A;  4AM9 A;  2M63 A;  4K0R A;  4DX2 A;  1HX8 A;  3VTY A;  3SO8 A;  2HR2 A;  3I3N A;  3UM3 A;  1OWP A;  1OCC E;  2VQ2 A;  1DCQ A;  3RK6 A;  3E30 A;  2VTB A;  1OXJ A;  4KVO A;  4XI0 A;  3UQ3 A;  4WWP A;  1WM5 A;  4G2V A;  2AW6 A;  2LO6 A;  4BY6 A;  3S7B A;  4F1S A;  3JCK C;  4OYS A;  4EZK A;  2KCV A;  4TXR A;  2KZT B;  5CBN A;  4M3O A;  2JLB A;  1N95 A;  3EU5 A;  4ILG A;  1KPS B;  3UIO C;  4O1O A;  1N54 A;  2GRR B;  2A4Z A;  2A5U A;  4UWH A;  2H6I A;  2AWI A;  3QC1 A;  1O1T A;  2WQ7 A;  2RFM A;  1BPO A;  2LAI A;  3FUF A;  4KT6 B;  4GCN A;  3CQC B;  5BV0 A;  3ZKJ A;  2PQN A;  1B89 A;  5JJ6 A;  3TWQ A;  1ELR A;  3FTV A;  4UWK A;  3RJV A;  2FBN A;  1ZB1 A;  2WMN A;  2WXK A;  4ILH B;  3APF A;  4J8F A;  5BPP A;  3WXX A;  4U04 A;  5AQ7 A;  4D10 C;  1N52 A;  2WXJ A;  2R2L A;  3DEO A;  3P2B A;  3SFX A;  3HG0 D;  2QYJ A;  5HS0 A;  3PUJ A;  5ENQ D;  5EIB E;  3QWV A;  4HLL A;  3TL5 A;  4AY5 A;  3URZ A;  1BI7 B;  3APC A;  2VGE A;  1XGW A;  2XZT G;  3JXI A;  3RKV A;  3C72 A;  3DPY A;  2ETB A;  3TWS A;  2L0I A;  1SVX A;  3IBE A;  4Q94 A;  4GAA A;  1N0Q A;  4GTP A;  3UMV A;  3Q75 A;  4GZ6 A;  4ANU A;  4GPM A;  5B1A E;  3Q49 B;  2V5F A;  2B6C A;  4HFG A;  4GA2 A;  4FHJ A;  3GZ1 A;  5CED B;  2WXF A;  4HI8 A;  4LNG A;  4EBA G;  3NF1 A;  2LUH A;  5EYL A;  2VSY A;  4HOU A;  4XE0 A;  3UKR G;  2DVW A;  4CEM A;  5FZR A;  3U3W A;  3VLE A;  4DX1 A;  3EIQ C;  3IV0 A;  4I6J A;  3MV3 B;  4GTV A;  1UOH A;  4G26 A;  4KBQ A;  1Q2Z A;  3AG2 E;  2AJA A;  4YDO A;  4ACL A;  3IXE A;  1S0P A;  3UIN C;  4I1A A;  2QYU A;  3J5Q B;  4HRN A;  4B89 A;  2L0T B;  3HXB A;  3AS5 A;  3ZYL A;  3L22 A;  5CHE E;  4ZHB A;  3OAW A;  2VJ8 A;  2HE0 A;  3LDZ A;  4J8D A;  3JXJ A;  4CRW A;  3CSF A;  2X6J A;  3PZ4 A;  4HOS A;  4Q69 A;  4JEU A;  3O4Z A;  4JEH A;  4DX5 D;  5G04 J;  4N39 A;  1IXV A;  2NYJ A;  2Q7F A;  1E7U A;  3FUI A;  3NOG D;  4YDE A;  4J8S A;  3SFZ A;  4HBD A;  2X6K A;  2RD0 A;  4B0Z A;  4DUI A;  3C3O A;  3MCX A;  4WWO A;  2EIL E;  3PE4 A;  4K03 A;  3RO3 A;  2CFZ A;  2LNI A;  4X8Q A;  3PNL B;  4O1P A;  2XGS A;  2XEV A;  3R7Q A;  3JQ0 A;  4I43 A;  1X5B A;  3QK0 A;  1AP7 A;  3HVE A;  3KSL A;  1TEZ A;  4XI9 A;  5CMW A;  3DSW A;  1K1A A;  3MJW A;  2WXO A;  1INZ A;  5H7P A;  1O5M A;  3LY9 A;  2AXZ A;  5G04 C;  2DCP A;  3ZW3 A;  1N0R A;  4LSZ E;  3KD7 A;  2DWZ A;  1VDY A;  3HYM B;  4C0E A;  3FFL A;  3EJN A;  3MZL B;  5FQ7 A;  1QYM A;  4YND A;  1SQM A;  3DEP A;  5LFA A;  2X6I A;  3D9P A;  3TXN A;  3B7R L;  4EBA A;  4GTO A;  1WY6 A;  2XRZ A;  2FEZ A;  2XPY A;  4HOT A;  1OCO E;  1HZ4 A;  1UG3 A;  4B93 B;  3TWR A;  3F6Q A;  3UIP C;  4C48 B;  4URK A;  3N71 A;  3FUE A;  1X81 A;  2V4L A;  3ABK E;  4FAD A;  2OEW A;  2WXP A;  3MKQ B;  1RW2 A;  4M7C A;  4I9C A;  2IU1 A;  4ANX A;  1WAO 1;  5CEA A;  2PZI A;  1N4S A;  3EIJ A;  2EIM E;  3MX3 A;  1JWG A;  3CVY A;  1H2V C;  5EKQ D;  2R5S A;  4N5C A;  3FH8 A;  2E2E A;  2KBX A;  2NC9 A;  5EN5 D;  4U0U A;  1H6K A;  2YHE A;  1O1S A;  3ESL A;  3AG1 E;  3UM2 A;  4AOF A;  1OY3 D;  2BKG A;  4A1S A;  2ZGD A;  2KZT A;  1NA3 A;  2PQR A;  3CQG B; 
#chains in the Genus database with same CATH homology
 3AS8 A;  3SD5 A;  5FQ6 A;  4JC8 A;  4R7L A;  4MS6 A;  3B13 A;  3I4R B;  4AP2 A;  1HH8 A;  3FTS A;  3IKO B;  4AM9 A;  3ML9 A;  2M63 A;  3UPV A;  3SBS A;  5BW8 C;  4ME2 A;  2XPZ A;  3ASD A;  3D9M A;  3QAQ A;  4GYW A;  4K0R A;  4ABN A;  4CT0 A;  3OXL A;  2PM6 A;  3R9A B;  4I9E A;  1HX8 A;  1KLX A;  3CST A;  4I1O B;  3VTY A;  3PNT B;  2HR2 A;  3I3N A;  3CHM A;  3OXG A;  1E96 B;  1OWP A;  2LSU A;  2VQ2 A;  2I1J A;  3CIA A;  3RK6 A;  2VTB A;  3TAX A;  1PAQ A;  4AJW A;  4G11 A;  4KVO A;  2R59 A;  4XI0 A;  4OVU A;  4WWP A;  4GMJ A;  3UQ3 A;  3VLF A;  1WM5 A;  4UI9 K;  4CGW A;  3PE3 A;  3R7R A;  4UI9 J;  4G2V A;  4BTB A;  4FA6 A;  2AW6 A;  2E0I A;  4I2W A;  4KMO A;  4L2Y A;  2LO6 A;  4RVB A;  3ZHE B;  2NXP A;  3S7B A;  4MLP A;  4BY6 A;  3JCK C;  4OYS A;  4F1S A;  4EZK A;  2KCV A;  2KZT B;  2OOE A;  2WVI A;  1OWO A;  4B8C B;  3G2U A;  4AXH A;  4M3O A;  2JLB A;  1OWL A;  4U63 A;  3Q47 B;  4ILG A;  2FF4 A;  2WQH A;  3ZN3 A;  3ONK A;  2WXM A;  4JXT A;  1N54 A;  1Y6I A;  3D9N A;  4N3A A;  3Q15 A;  3VLD A;  5T4Y A;  3SI5 A;  2A4Z A;  2X3M A;  2A5U A;  3K9I A;  3PRE A;  2NSZ A;  4UWH A;  4AV7 A;  3FTU A;  1NP7 A;  1E90 A;  4C0M A;  5JJ7 A;  1UW4 B;  1ZBP A;  4FLB A;  4A1G A;  2AWI A;  2GW1 A;  2UY1 A;  3QC1 A;  4TRQ A;  4RG6 A;  3EHM A;  3C98 A;  3LPZ A;  1GW6 A;  3T5V A;  1H0A A;  4F53 A;  3UT7 A;  2WQ7 A;  3D3M A;  3LCA A;  1E8X A;  3IEG A;  3SF4 A;  1MHQ A;  2XQ0 A;  2VTB B;  4DPR A;  1UJK A;  1NZN A;  4RSY A;  2OND A;  2FUL A;  1BPO A;  2LAI A;  3FUF A;  4G1T A;  4KT6 B;  1DNP A;  4CCA A;  4GCN A;  2ILR A;  3CQC B;  3FP3 A;  4ACK A;  5BV0 A;  4CT4 A;  2PQN A;  1B89 A;  5JJ6 A;  1ELR A;  2WMO A;  3FTV A;  4FU3 A;  4UWK A;  3ZXS A;  3RJV A;  3CGH A;  2FBN A;  4GZD A;  4HVB A;  2V8S E;  2WMN A;  2WXK A;  2VSO E;  2GRL A;  3EHN A;  2CG2 A;  3ZYK A;  2IOS A;  4ILH B;  1E8W A;  3APF A;  3KAE A;  2WXH A;  4J8F A;  2FI7 A;  3L54 A;  2Y4T A;  4UWL A;  3FU3 A;  4WWN A;  3FU5 A;  5BPP A;  3ASH A;  4HLE A;  2UY1 B;  3WXX A;  4U04 A;  3FEY A;  4UI9 C;  4GZC A;  2I9C A;  4LER A;  3MA5 A;  4D10 C;  2BF0 X;  1E8Y A;  1N52 A;  2WXJ A;  3G2W A;  3P1U A;  4PS8 A;  3LEW A;  4LEU A;  3ZIM A;  1HG2 A;  3FTZ A;  3P2B A;  3RU0 A;  3ZRH A;  4A3V A;  4U0S A;  3CK9 A;  3LYA A;  4DLQ A;  5BNW A;  3FY4 A;  3ZPJ A;  3JYS A;  4XKB A;  3PUJ A;  4H7Y A;  4EZL A;  3ASG A;  3ZYQ A;  2VGX A;  3CK7 A;  3CVW A;  4J8E A;  5FT9 A;  2IOL A;  3QWV A;  3CVL A;  3ONL A;  1HU3 A;  3RRM B;  3TL5 A;  4AY5 A;  2RG8 A;  2PM7 A;  1PY1 A;  3QDN A;  3URZ A;  3APC A;  5FZS A;  1XGW A;  4B94 A;  5FQ8 A;  4OVV A;  4EZJ A;  4FHK A;  1IYG A;  3CHQ A;  2OVF A;  4XX5 A;  3ASF A;  3RKV A;  3SZ7 A;  2CHX A;  2CHZ A;  2R17 C;  2VSX E;  2KM4 A;  5HQ8 A;  5KJK A;  3OTN A;  5CMY A;  4FJY A;  3TGO A;  4IN3 B;  2P58 C;  2AXU A;  4JHJ A;  5J08 A;  4XIF A;  5AIJ A;  2L0I A;  3IBE A;  3NZS A;  3NQP A;  4JW1 A;  3BEE A;  2XGO A;  5FZQ A;  1HG5 A;  4BFR A;  3CEQ A;  4Q94 A;  4I1M A;  3FH7 A;  3E4B A;  5BT1 A;  1H2T C;  4GAA A;  1ELW A;  4ILI A;  3UMV A;  4GZ6 A;  2HO1 A;  4A3T A;  4ANU A;  3Q49 B;  2YHC A;  3ZVV A;  2V5F A;  3PRZ A;  2VGX B;  4LRZ A;  4U07 A;  5A23 A;  3ZEF A;  1UN9 A;  2KCK A;  2BUG A;  4GZ3 A;  3KS2 A;  4HFG A;  5ARF A;  4MRU A;  2L6J A;  4GA2 A;  4DLO A;  4J6I A;  4U8H A;  4FHJ A;  4JZY A;  3GZ1 A;  4XKC A;  4APO A;  3LKU A;  4WUY A;  3U66 A;  4GYO A;  3JUI A;  4JVS A;  2YIN A;  4KYO B;  5LX8 A;  3GZ2 A;  2J4B A;  2WXF A;  2IJG X;  4GZ5 A;  3FWV A;  4F3V A;  2EQX A;  4WAF A;  2VGY A;  1EPU A;  4I17 A;  4MKT A;  4DJA A;  1OUV A;  4BT9 A;  4EBA G;  3NF1 A;  2J4D A;  2KC7 A;  4N2Q A;  1QQE A;  2IFU A;  4UWF A;  2OV8 A;  4FJZ A;  3FUH A;  4Q96 A;  4XZ4 A;  3APD A;  3L08 A;  2VSY A;  4C9B B;  3D9K A;  4HOU A;  5E76 A;  2CG3 A;  2XCB A;  4FLH A;  1TJC A;  2I2O A;  4XE0 A;  2CFU A;  4CEM A;  5EX0 A;  1E8Z A;  5FZR A;  4GCO A;  3U3W A;  2GRM A;  4EPZ A;  1P5Q A;  3VLE A;  3U4T A;  4BTA A;  3MV2 B;  3EIQ C;  3IV0 A;  4I6J A;  3CR3 A;  3MV3 B;  3TXM A;  4G26 A;  3HDX A;  1E7V A;  2AXV A;  2WXN A;  4KBQ A;  3FDH A;  5J90 A;  4PDX A;  3AS4 A;  3PS6 A;  1A17 A;  4NAC A;  3GZS A;  4HOQ A;  4ACL A;  2C0L A;  5KJN A;  4AVX A;  1S0P A;  4PUC A;  3LJ3 A;  4GA0 A;  4I1A A;  1LF8 A;  1HXI A;  1U3C A;  3SHF A;  2WB2 A;  4J0U A;  2X6H A;  2DIW A;  4B89 A;  2L0T B;  3D9L A;  1OWM A;  3FH5 A;  3D9I A;  5A6C A;  2IQC A;  2XPI A;  3AS5 A;  3ZYL A;  2YNQ A;  2CHW A;  4I6G A;  3Q4A B;  3PH0 C;  5G05 J;  3L22 A;  1IQU A;  2OVB A;  4KZC A;  4U0Z A;  3LY8 A;  5CHE E;  3L16 A;  1MQS A;  4UWG A;  3OAW A;  2VJ8 A;  3LDZ A;  4J8D A;  4GU5 A;  4AIF A;  1Z3X A;  1QNF A;  1JWF A;  1Z3Y A;  3HIZ A;  1ELK A;  3MKR A;  3BG1 B;  5ANL A;  4BSX A;  4CRW A;  3B7S A;  3CSF A;  5DBK A;  4DI3 A;  2L9B A;  4I6E A;  2X6J A;  4HOS A;  1KT0 A;  4CDN A;  3BG0 B;  4Q69 A;  4JEU A;  3NZU A;  3O4Z A;  4JEH A;  4H7X A;  2LAH A;  4V3I A;  3T5X A;  4TUU A;  3CV0 A;  5G04 J;  4GYY A;  3I4G A;  5C1D A;  4WNE A;  2FO7 A;  4N39 A;  2WXI A;  3KEZ A;  4WND A;  4CDR A;  2GGF A;  3PEU B;  4A55 A;  2Q7F A;  1QZ2 A;  1E7U A;  3FUI A;  3CKB A;  2DBA A;  5ARG A;  4HOR A;  3UT4 A;  4J8S A;  1HS6 A;  3D9O A;  3FTX A;  3SFZ A;  2X6K A;  5BV1 A;  4GA1 A;  1IQR A;  4G24 A;  1JPL A;  3S7J A;  1W3B A;  2RD0 A;  3ZYM A;  1YA0 A;  2Y4U A;  4B0Z A;  4UQX A;  5KJL A;  2ION A;  5EX3 A;  3MCX A;  3QWP A;  4FC8 A;  3S7F A;  4AY6 A;  2LSV A;  2WXR A;  2MRI A;  3FUK A;  3LXU X;  5D0Q D;  4BX8 A;  4WWO A;  3PE4 A;  3AU5 A;  4K03 A;  2WM9 A;  3RO3 A;  2CFZ A;  3ESK A;  2LNI A;  4FP7 A;  4TV3 A;  3PNL B;  3PZD A;  4N3C A;  5HI7 A;  2XHE A;  4ATG A;  2XGS A;  3ULQ A;  1UN8 A;  1SZA A;  3TG4 A;  4F7A A;  3PVL A;  2XEV A;  3QJZ A;  3RRN B;  2XGM A;  3JQ0 A;  4I43 A;  3R7Q A;  1SZ9 A;  1X5B A;  3QK0 A;  3RIB A;  4AEZ C;  2ZU6 B;  5D0O D;  3MGB A;  5G05 C;  4GPK A;  4WNF A;  3GYZ A;  3HVE A;  3CVX A;  2PL2 A;  2I1K A;  3CVV A;  1TEZ A;  4XI9 A;  3MYV A;  3IHY A;  2WQ6 A;  4KXK B;  5CMW A;  1DVP A;  2X6F A;  3CVN A;  3ENE A;  4G25 A;  3TJP A;  3G2V A;  3MJW A;  4ANV A;  4IUL A;  5CCL A;  4CGV A;  2WXO A;  5AJD A;  3OXF A;  2C0M A;  3CVU A;  1INZ A;  3QNK A;  1ZU2 A;  3LY9 A;  2AXZ A;  2JEK A;  5FTP A;  3T8M A;  4PS3 A;  5G04 C;  2DCP A;  1EF1 C;  4KZ0 A;  3ZW3 A;  4L7T A;  2XRY A;  1HO8 A;  4G23 A;  2QY7 A;  3KD7 A;  3QOU A;  2WXG A;  3FUD A;  3MEK A;  4E6H A;  3ML8 A;  4NRH B;  1KT1 A;  1OWN A;  3UT8 A;  3FTW A;  5DIZ A;  4BWR A;  1HF8 A;  3RO2 A;  3LY7 A;  1VDY A;  2I6H A;  4JHR A;  3HYM B;  4C0E A;  2UWJ G;  4W9R A;  3FFL A;  2VSN A;  3CHP A;  1EYH A;  4JHK A;  4UQY A;  3HVE B;  1HFA A;  4P29 A;  4APF A;  3CKC A;  3EJN A;  3LVQ E;  3B7U X;  3MKQ A;  3MZL B;  4N3B A;  5FQ7 A;  3DBS A;  4BX9 A;  3O48 A;  3FHE A;  5LFA A;  4YND A;  1SQM A;  2QFC A;  3JQ1 A;  3QKY A;  3IHV A;  1U3D A;  2X6I A;  3FUJ A;  2WXQ A;  3D9P A;  3G2S A;  3CLJ A;  4GB9 A;  3SNX A;  3SGH A;  4YVO A;  2WPV A;  3TXN A;  4DK5 A;  3FU6 A;  1TJF A;  2Y3A A;  5LOZ A;  3B7R L;  3TG5 A;  3FEX A;  3UUX A;  4O6F A;  3I5P A;  3FU0 A;  4EBA A;  5LCW J;  3FUM A;  4LUN U;  4LCT A;  2MOW A;  1JUQ A;  1WY6 A;  3G2T A;  2J09 A;  3LVR E;  4IRU A;  3L17 A;  4WNG A;  5JHB A;  2XRZ A;  3VTX A;  1XNF A;  3CVQ A;  2FEZ A;  2XPY A;  1H19 A;  3DPD A;  1HE8 A;  3PDN A;  3Q5M A;  1HZ4 A;  4JPS A;  3UX4 A;  4HOT A;  4EEC A;  5FWQ A;  1UG3 A;  2YQ8 A;  4HS2 A;  3SBT B;  2X38 A;  1FVH A;  5LP0 A;  1PC2 A;  2J08 A;  2KCL A;  3N71 A;  3FUE A;  4I2Z A;  4URK A;  2V4L A;  5AJL A;  1IHG A;  4FAD A;  2IF4 A;  5AYW D;  2WXP A;  3MKQ B;  3PEV B;  4N2S A;  4EQF A;  5KJM A;  1H2U A;  3L13 A;  1FVF A;  5ENN A;  4RG9 A;  3HHM A;  1Z6T A;  4DI4 A;  4I9C A;  4PH4 B;  3ZGQ A;  1L5J A;  5C2Y A;  4HXI A;  2IU1 A;  4IYP A;  1WAO 1;  1EDU A;  5FJY A;  4ANX A;  4L2L A;  4BT8 A;  2VYI A;  4CDM A;  3FTY A;  4KVM A;  3ZFW A;  5E75 A;  2J07 A;  4B8A A;  4Y6W A;  4UQZ A;  3S7D A;  2BTD A;  4NQ0 A;  4YVQ C;  2MHK A;  4JL0 A;  2HYZ A;  2C2L A;  3L6A A;  3QWW A;  4QFV A;  5A7D B;  5FQ4 A;  3GW4 A;  2PZI A;  2J9Q A;  3CHO A;  3EIJ A;  4JA9 A;  4L1B A;  5ANR A;  3QB2 A;  3MX3 A;  1JWG A;  3U64 A;  3S2A A;  2AVP A;  3CVY A;  3RRU A;  5T8I A;  5G2N A;  1H2V C;  5EKQ D;  2R5S A;  4NUR A;  4N5C A;  3FH8 A;  2E2E A;  3LS8 A;  3D9J A;  2NC9 A;  1NA0 A;  1FCH A;  3B7T A;  4ANW A;  5CCM A;  3CK8 A;  3CHS A;  4U0U A;  5LCW C;  4GML A;  5T3R A;  1H6K A;  2YHE A;  4L23 A;  2XCC A;  3FUL A;  4Y6C A;  3CVP A;  4JA7 A;  1UJJ A;  5KCM A;  4E85 A;  3U9W A;  3FUN A;  5G55 A;  5AEN A;  5JJT A;  3ESL A;  2J49 A;  3ZHE A;  5M72 A;  5BUZ A;  4AOF A;  4FUL A;  3EDT B;  3QAR A;  4PS7 A;  3PUK A;  4A1S A;  2KAT A;  2V0P A;  1Y8M A;  2KZT A;  1NA3 A;  2HM8 A;  2PQR A;  5EDS A;  2WXL A;  3CQG B;  3AU4 A;  5JHA A;  3CHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...