2VSYA

Xanthomonas campestris putative ogt (xcc0866), apostructure
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
547
structure length
547
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCC0866
publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 208
structure length 547
sequence length 547
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsyA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsyA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsyA02
1K06A 3CK7A 3EBOA 2ZB2A 5G05C 2IEIA 1SXPA 2QRMA 4RBNA 3IA7A 1QZ2A 2ONDA 3CVPA 5EKQD 5TMDA 4WNDA 2JLBA 4N3BA 4WNFA 1XL0A 5JJ7A 2E2EA 1E96B 2G9QA 4GZ3A 4RG9A 1KT1A 4RIEA 4AY6A 3ASHA 3VUFA 2P6PA 4U0ZA 2C4MA 2R4TA 3BEEA 2ECPA 1A17A 4KQMA 4I1AA 5CHEE 4X6LA 3HBNA 4KXKB 2FI7A 3OTHA 1C8KA 2BGUA 3BD8A 2XPIA 2XGMA 3FROA 3GUHA 3MT8A 3LCAA 1IIRA 1KT0A 1ZBPA 3U4TA 4UQXA 1NOIA 3COPA 3Q3IA 2JZCA 2F3QA 3E3NA 3NPAA 1WUYA 2P58C 2WTXA 1BX3A 2GT1A 1NVKA 4GYWA 3CEMA 1HXIA 5A7DB 5CCMA 2QN1A 1QQEA 3QOUA 3MBOA 4FZRA 4MHSA 3SYRA 3G2KA 3EDTB 3SF4A 4UI9C 2VYIA 3VTXA 1P4GA 2VG8A 4I17A 4KQ2A 3AMVA 4G2TA 1RZUA 3KS2A 1F0KA 1NA0A 2XA9A 3MA5A 2IUYA 3G2IA 4MHOA 2JJMA 4YVQC 2SKEA 1UQUA 3OKPA 2OOEA 1Y8MA 2DBAA 1L5RA 3D1JA 3Q3EA 3VDNB 1C8LA 4WACA 2ACVA 3NP7A 5FT9A 3QDNA 3C4VA 1FU7A 3NCHA 4GZ5A 3ASFA 5LQDA 2HO1A 3G2LA 3IEGA 3MV3B 3CV0A 4BTBA 4BT9A 3TG4A 4YI5A 4GYOA 2R4UA 1V4VA 3CV3A 4HLNA 3K9IA 3QWVA 4RIIA 2PZIA 1Y8ZA 3LY8A 3NF1A 4U0UA 4WNGA 4NESA 2XCUA 2YQ8A 4N3AA 3S7JA 3OT5A 1PC2A 5ARFA 4KQ1A 2AZDA 4JHRA 2VCEA 4LEIA 2F3PA 2KC7A 4APOA 1JEJA 1L5QA 2PYIA 3OKAA 2GPNA 1Z62A 4U0SA 1F6DA 2SKCA 1B89A 4N2QA 2F3UA 3ZCVA 5KJLA 4W9RA 4LEUA 4CTOA 1Z6PA 3RSZA 2XGOA 3G2JA 1HLFA 2Q6VA 3RT1A 3SYMA 2I6HA 5FZSA 1E4OA 3MRVA 5KJKA 3LPZA 3H4IA 1C3JA 4WADA 3S7FA 3TSAA 1FU8A 1PYGA 4J8FA 1J39A 3CKBA 4EL0A 1L5VA 3OY7A 1L6IA 2Y4UA 1P29A 2X0DA 2KCLA 4NC9A 6GPBA 4G26A 4ME2A 1Z8DA 3RO2A 2OFFA 3OKCA 2LSVA 1JIUA 3R9AB 1GPAA 1LWNA 3MT9A 1NA3A 2QFCA 4M7PA 4A1SA 2F9FA 2V5FA 5LCWJ 1RRVA 3BCSA 3CEQA 3MEKA 2QLMA 2VCHA 2PYDA 7GPBA 2IV7A 4L22A 3ZN3A 2LNIA 2KS6A 1XV5A 3T5TA 1PSWA 2GEJA 3CX4A 4EJ2A 4JA9A 3UPVA 2PQ6A 4Z5XA 1LWOA 5JJ6A 4BWRA 3G2NA 4GPBA 3S0JA 2XCBA 4GYYA 2XA2A 3GW4A 2KCKA 3TG5A 4BQEA 3MT7A 1YA6A 2GEKA 1GGNA 3TGOA 4XI9A 1FU4A 3Q49B 1P2BA 2QN3A 1NOJA 3MTAA 5FTPA 3WXXA 4CTNA 4YI3A 2FF5A 3CUUA 4G25A 1KLXA 4WUYA 1HZ4A 5G04J 4N3CA 5GPBA 3N71A 4I9EA 2GPBA 4MICA 3BCUA 2IFUA 1GZ5A 2QRPA 3DDWA 4U07A 3MTBA 3URZA 4GPKA 2IYFA 5FZQA 3Q47B 4HORA 3Q5MA 4N5CA 4RENA 2QRGA 5HQ8A 5M72A 1O6CA 1IHGA 4UQYA 2HY7A 3NP9A 4MI3A 3PDNA 4XIFA 3FFLA 5A6CA 5I45A 3AS8A 4XI0A 3BCRA 4MRAA 2AVPA 5G05J 4GA2A 2IYAA 3GZ2A 4X7MA 1XNFA 2QN2A 3ZCQA 3HYMB 5IKPA 4QLBA 4BQFA 3HBMA 4NQ0A 4NRHB 3L7AA 3CK9A 1JG7A 3S29A 1EM6A 5HXAA 2HYZA 3GYZA 1L5SA 3TOVA 4HOUA 2UY1A 2PRJA 4UI9K 3Q4AB 5JJTA 3BEOA 5D0OD 5DXFA 2KCVA 3MS2A 9GPBA 2LSUA 1E1YA 1JIXA 5FJYA 3MKRA 5DIZA 2NC9A 2SKDA 1NLMA 3L01A 3NAZA 1FS4A 2QLNA 4N9WA 5TMBA 5KJMA 4F3VA 4BFCA 4N39A 1P4JA 5DBKA 1UQTA 3OTGA 1FCHA 3BDAA 4JA7A 2GPAA 1QKJA 2IW1A 4EKYA 3D0QA 3MTDA 4EKEA 4IN3B 3ASGA 2FBNA 3AS5A 3MV2B 2VGXB 4GCOA 2R68A 2AV6A 4F96A 2FO7A 4KBQA 4GZ6A 1XC7A 1ZU2A 2GJ4A 1M5RA 5EX0A 1ELRA 2X0FA 3U3WA 4RIHA 4UI9J 2GM9A 1GPYA 4W6QA 2XCIA 4CDRA 1AXRA 4Y6WA 2WQHA 3MS7A 1Y6FA 4AMBA 4M83A 2XCCA 2GW1A 3ZPJA 3CUWA 2KATA 3T3GA 3DZCA 3MSCA 3DDSA 2C2LA 1NOKA 5IKOA 2R60A 1WW3A 3CKCA 2XA1A 3WC4A 3E3OA 1AHPA 4YNDA 5CCLA 3OY2A 4NEQA 4WHMA 4AY5A 4RIFA 3S2UA 4EQFA 1H5UA 2IF4A 2VQ2A 3ULQA 2BGTA 3KAEA 4AN4A 3RJVA 2XMPA 3TAXA 1YGPA 2ACWA 2XGSA 4J0UA 4GCNA 3WAGA 5KJNA 4AM9A 4BT8A 4CTMA 1NZFA 1HH8A 3KD7A 4WNEA 1P4HA 3CEHA 2QNBA 3L7BA 4HOQA 3S7DA 3NB0A 1UZUA 3RHZA 2UY1B 4U04A 2R66A 4GA1A 4H7YA 2G9VA 2O6LA 2WPVA 3ZCSA 8GPBA 5AYWD 4MI6A 2VGXA 2Q7FA 4AMGA 3L7CA 3H4TA 5C1DA 2C0MA 3O3CA 1Y6GA 1FC0A 3WADA 2C9ZA 4HOTA 5D0QD 2XEVA 1YA0A 3LY9A 1L5WA 2IV3A 1W3BA 1FTQA 3ESKA 4G23A 4GA0A 4I2ZA 2QLLA 2C1ZA 4G1TA 3S28A 3ZHEA 5BT1A 2PQNA 2QRQA 3S27A 3G2HA 3VUEA 2AW3A 2YHCA 1P5QA 2BUGA 1WV1A 2PRIA 4EL5A 4M60A 3CEJA 3UUXA 3CUTA 3OXGA 3QWPA 2HR2A 2G9UA 4F97A 3JYSA 3RKVA 1VGVA 3GPBA 1ABBA 2QRHA 1Z6QA 4I9CA 5TVGA 3CK8A 3ZCPA 1FA9A 3GZ1A 3MQFA 5ENZA 1WM5A 4CGVA 1NZNA 2VSYA 2FETA 2F3SA 2QN7A 3E3LA 1GG8A 4PQGA 3ZCUA 3BD7A 3OXLA 3L7DA 2C1XA 4BQIA 1FTWA 2FF4A 2G9RA 4YVOA 4YUAA 3SZ7A 3L79A 3UYLA 3ZCRA 1OUVA 4N2SA 3CUYA 4LDPA 2H1HA 2C0LA 3RU0A 3UYKA 2QN9A 3PE3A 1C50A 2PQRA 1NZDA 3O48A 4B94A 4REMA 3QWWA 4X7PA 5D00A 4I2WA 3DD1A 4JL0A 5BNWA 5D01A 3RIBA 5BW8C 2ASVA 3MRXA 3T3DA 3Q3HA 2FEZA 4UQZA 1KTIA 3Q15A 3VTYA 2FFRA 1WUTA 3ZCTA 1EXVA 4Y6CA 1GFZA 1WV0A 2L6JA 1L7XA 2X6RA 3MS4A 2R5SA 5EX3A 4MI9A 3E4BA 2IEGA 4O6FA 1WW2A 5HI7A 1P2GA 1GPBA 5DLDA 3ZFWA 4HWGA 3HBFA 2PL2A 1XOIA 4RG6A 2MHKA 1PN3A 3ZHEB 2Y4TA 4G2VA 2UWJG 2X0EA 4ABNA 5JTUA 3T3EA 1WAO1 3ZGQA 2X6QA 3CVQA 3RSCA 2QZSA 3MRTA 1K08A 3IAAA 5LCWC 2BISA 4FKZA 3C4QA 3QHPA 5JTTA 1IXYA 3LYAA 1QM5A 3UQ3A 4RELA 4F9FA 1IYGA 1B4DA 2AMVA 3CVLA 4AIFA 3T3HA 3LY7A 4BTAA 5DU2A 3HBJA 1XL1A 4J8EA 4RIGA 3RO3A 2QN8A 3CVNA 4KYOB 1XKXA 3VDMA 3FP3A 3CUVA 2J9QA 3S7BA 1TJCA 5ARGA 1JIVA 2VSNA 5TMEA 1FTYA 4J8DA 2VGYA 4CGWA 3NC4A 3EBPA 4X7RA 2BFWA 2YJNA 3T3IA 3ASDA 2ATIA 5G04C 3QKYA 3FWVA 1P2DA 5FZRA 3C48A 4HOSA 3D0RA 3LKUA 3OTIA 4G24A 3QKWA 2H1FA 1A8IA 3OXFA 3AS4A 4H7XA 3PE4A 1JG6A 3T7DA 1RZVA 3BD6A 1ELWA 1SXQA 1PNVA
chains in the Genus database with same CATH superfamily
4YV7A 3VI3B 4MS4B 1KEWA 2VPIA 4I5FA 1N0WA 4TZKA 3WLIA 4IIFA 4KXFB 3CR8A 1E61A 1XDDA 4ZVVA 2P6PA 4XFJA 3GFVA 1LRKA 4NCNA 4DMHA 4LECA 2QTBA 4Y1RA 3AFGA 3GPDG 1YCHA 1TYQG 5KNBH 2HEGA 3R7WA 4GYKA 4GXRA 1DTWA 2JJ1A 1Q1GA 1EFRA 3T5GA 1Z6ZA 4OGGA 3G8DA 2WVIA 4TXHA 4ADSG 1M8FA 1Z07A 3NP7A 2JKZA 3L92A 4EENA 1EXMA 3D02A 4Q3EA 1I7SB 4FONA 3P52A 4B6JA 2R6FA 1C9EA 4PO9A 2R8PA 4S1PA 4MUKA 5I7OA 3KEMA 5LQJA 4LYEA 1TVCA 4B85A 1X1DA 3R0ZA 1Z7YA 2EKDA 1KS9A 3A58B 1D2AA 1NV9A 4WADA 3N0RA 3OY7A 1Y4ZA 3Q6IA 2WLSA 2HOQA 3X1YA 3F9IA 1WSAA 4F9TA 4JI8B 5KEIA 2UDPA 4JP3A 3FU5A 3LP5A 4LBWA 5KIAA 2NZ8A 1VPTA 4HXYA 2WU0A 3I4LA 2ZIEA 3IAHA 3BL8A 1K7CA 4F0JA 2GEBA 5KTNA 2JGMA 1RI5A 2R9VA 2YNQA 3LX5A 4MRPA 4FFBB 3ERCA 1XKLA 4E11A 1XZNA 1I33A 2AB0A 2E2WA 4F71A 1DRJA 5P8WA 3QVTA 1KJJA 3TSCA 3I9V6 5KQGA 1ARZA 1P3JA 2K4MA 3ZY4A 2DY0A 1KMQA 2IYWA 1UEXC 1YB4A 2MMCA 4N6NA 3G0DA 1R8SA 2GETA 1N95A 3GX1A 3L1UA 4KFCA 2GJ4A 4J1TA 2R8XA 2R11A 2PG3A 1APBA 3VKWA 3D9JA 2OZPA 2C7BA 3TD6A 4RLHA 1ZAYA 3IQFA 4TMZA 3EF0A 4CF6A 4D4KA 2OYSA 2HW8A 2J9YB 3ULQA 2SECE 1D2NA 4B8WA 2QP9X 1MABA 4M0MA 2VCYA 3DSXA 2DVWA 4MI1A 4AJ9A 3E22A 2EDCA 5CPBA 1LBEA 4Q03A 4YNBA 3OT1B 3H1TA 1MC5A 1AUPA 3TIVA 4HCJA 2XKJE 4MI6A 4ZPJA 2O57A 1TL7C 4RNCA 3IYLW 3NBKA 3WADA 2EQAA 3D9IA 4HK4A 2EZUA 2X1MA 2R6DA 2QN6A 3KFXA 3Q73A 1DAIA 2YN2A 2DLDA 4WOPA 5E95A 2IF2A 4DBLE 5BMVA 3OZDA 3E7WA 2DHCA 3O2NA 3AVYA 8ATCA 3AINA 4H18A 2JL1A 4IHKA 3RKVA 3QXGA 2IP2A 5BSGA 2RAFA 1Q0RA 1A5SB 3R3YA 2CDAA 1NP6A 3FPJA 2P2CA 3UI2A 3B8EA 2H57A 2MYPA 2L6BA 1UXGA 2VDOB 4QTTB 1PEYA 1SIBE 3JW8A 2BR3A 3GHHA 2FPPB 2QP4A 3EHRA 4TPKA 4B4OA 4B8YA 4Y2RA 3LAWA 1LC0A 1PUJA 5TJHA 4BVGA 1Z5GA 3ZOKA 2GK7A 5B53A 2PL2A 2XR1A 3P4XA 3JQBA 4ABNA 1FTSA 2AN9A 3DOUA 3FHJA 3RUPA 3FRHA 2CMKA 3C4QA 1D1QA 1ZC4A 2OHXA 2ZJ0A 2L69A 3EK2A 2PKQO 1AO3A 4XWTA 2H2FA 4NBWA 5JU6A 5JANA 2JBAA 4EA7A 1K4YA 3AI3A 3WSTA 1HDRA 3EN0A 3K16A 5GADl 3H8WA 4HGNA 2FSVC 3PNMA 3SC4A 1Z2OX 3L8MA 3MZLB 1RP7A 1EVZA 4IULA 3R7RA 1YZUA 3ONLA 5DDIP 4MW0A 2AQIA 2C58A 4ENQA 3L3BA 3HB9A 3KQYA 2ERCA 2WD7B 4TS4A 1GKLA 4MHTA 3PHCA 3Q7FA 4BUJA 1GCUA 2BFPA 5A1TA 1FXSA 1GW6A 2IH5A 1I6WA 1NJ1A 4Q47A 1A3CA 4MV7A 5L3QA 4FDUA 3OIDA 5C8XA 5FOVA 1D2RA 4GLJA 3T99A 1PJZA 1X94A 3K53A 5HZHA 4YAEA 2WD9A 1X9GA 2CB9A 3W9SA 1NY5A 4EI8A 1I6LA 1C0EA 3LCMA 1GXSB 4L7TA 4V03A 4WZBB 2C7QA 2JJMA 3T9DA 2R8BA 5FT9A 4N12A 1YDWA 3IHLA 4ZI7B 2XDYA 3OG9A 4E22A 2GKGA 5K3CA 2FW0A 2DU8A 4DV6B 3JWGA 3EASA 2O2GA 1SUDA 4NZNA 4XTRA 4LYYA 2R6AA 4HJRA 3W5DA 1YVDA 5KTOA 4YEDA 4QICA 3NWEA 4WKCA 2V4LA 4OJMX 4FYYA 1U7TA 5JXWA 2IH2A 1L7RA 1TW3A 3RG8A 4FJ0A 2DR3A 2WAXA 1SWVA 2XBUA 1ZRMA 1OAOA 1PIWA 4X1YB 1O95C 7ABPA 2Q6KA 1EFPB 3VPCA 2WAMA 3MEKA 1NPYA 2PYDA 2C5HA 2DSTA 1YZKA 4YT5A 2GTPA 1MO6A 5CAEB 1T0HB 2NLOA 2P11A 5JAUA 4JI6B 5EJ2A 4BBPA 1NQXA 3FRJA 1DFIA 3GLFA 4LF5B 1I6MA 3QXCA 1ND6A 3ENWA 3UM1A 3UJ9A 3TEFA 4JP1A 4QOHA 4D98A 2PUHA 4C4XA 1WM1A 4KO1S 3E9YA 3AF2A 1A0OA 3JVIA 2DBZA 3FA2A 4JYCA 3PI7A 5IF9A 4E30A 1EIWA 2XY4A 4DYDA 4GQBA 3D0KA 4BVHA 5JJTA 4DLAA 1RABA 2EYQA 1XN1A 1S2GA 4ODIA 1FS4A 1HORA 4BMOB 4JA7A 3ZD8A 1FMCA 4IINA 4ISCA 3ET5A 2PVPA 2DFLA 1LUAA 1Q0TA 1DPFA 3JUEA 3VZQA 3AHEA 1DT5A 3CZAA 5CEDB 1U8CB 4DARA 3S2UA 3E5RA 1CZNA 4GKKB 1ENYA 2I1LA 4PFSA 1CUEA 1P4HA 1RC1A 3BJRA 4XEHA 4HOQA 1S8OA 3AEUA 5JCOC 2Z83A 1EK2A 3WKCA 4P93A 3ZH2A 3N3AC 5JZBA 3NZEA 3TZKA 3X1MA 1QH9A 3KQHA 4HDKB 3B5IA 4EOGA 2Y1WA 2CXHA 3FZYA 3FAZA 1SUEA 5EHGA 4UDYX 3OEEA 1EBUA 1RZRD 4ZVOA 1Q0QA 2AFIE 5HZKA 3DXMG 4N54A 4AT1A 4B93B 2PUVA 2HU2A 5J5AA 1GYPA 4FFPA 4KBYA 4RCZA 3CKKA 4ZXFA 3ZDBA 4E51A 4X65B 3NOGD 1Z0AA 2HX1A 1O6FA 3T4EA 4TKVA 4NICA 4YR9A 3L8ZA 1RXUA 4LKOA 2XEHA 3IOYA 5CW2A 1GFZA 4BC0A 4AB1A 4ZQEA 2P9UG 4KW7A 1GPBA 1MN6A 5K6RA 1F4VA 1ZVKA 3G2MA 3G49A 4W8OA 4RMJA 1Q50A 4EY7A 4F3YA 3BIWA 1K9VF 3WLAA 4OLAA 1RJEA 2BLLA 3R9XB 4BFTA 1G20A 3A3NA 4QUKA 4RU1A 3ZHYA 1U7WA 1JAYA 1E7UA 4APFA 4W7HA 2ZU6B 4MA5A 1SG6A 3UQZA 5F3RA 4YDOA 2X42A 5FFFA 4MWBA 4NULA 4WX2B 2XYRA 4TMVA 1QPGA 4UTRA 2I33A 4JMLA 1CVIA 1J0DA 4A23A 4G0PA 2EFJA 5ALKA 4RIEA 3GVIA 1J1UA 4NCIA 3QYAA 2BFBB 4DNXA 1JDJA 3FWZA 3N39C 2BFMA 4RGVA 1IIRA 3OLYA 1IQPA 3VLDA 3COPA 3KQQA 2WMNB 3JQAA 3HKBB 4M88A 4RPGA 4WZ6A 4MHSA 3ZR4B 2NTYC 2RHBA 3JAWB 3M33A 1GA4A 3E8XA 4B5KA 1H1TA 3S5JA 4ESHA 1MHQA 1MX2A 1JUDA 1SWWA 2VRWA 4ZHSA 4F3KA 3RVRA 3ASZA 2FMFA 2PJZA 4O4LB 1RHRA 4MYSA 3NF1A 1QHNA 4LQCA 4B0ZA 4AIRA 3Q6MA 5HA5A 4R1TA 2WV9A 1JHZA 1U99A 4MRVA 4RVCA 3IIJA 1ZH2A 3R8FA 3AO0B 3I1JA 2O59A 1G21A 1KS2A 1T9KA 3A0RB 1HYBA 2I1WA 1H4TA 2H17A 1A98A 3H3FA 3W9GA 5DHUA 3WRXC 1AA9A 3CEQA 1NLFA 3T9FA 5FUWA 1XPJA 3GXBA 2ZKLA 2JD1A 4CM6A 3LGXA 4LX0A 3MT7A 5GONB 2O3QA 5EWMA 3DEPA 5FQ7A 4MJ7A 2NZXA 3OLCX 2AXVA 1GUZA 3FPAA 1XQXA 3EHMA 1TNUA 3MTBA 4K40A 2A2ZA 1BA3A 4ZK2A 4EPVA 2I7CA 1NN1A 3X2EA 4QLBA 1VJ0A 5HOEA 4PSAA 1FDSA 4UI9K 1VHTA 1LPMA 3S2EA 3HVKA 4A5SA 1D7OA 5J23A 2VJMA 1QKJA 1V4BA 4QU0A 1AURA 1F2TB 4WNAA 4HNAD 2OOKA 2E4VA 4GMXA 1ELRA 1TEVA 4EB0A 3PNKA 1AXRA 2HMUA 4UNSA 3VX3A 2INGX 2ARKA 2AOTB 2HSZA 4MVJA 1H2XA 5LQNA 1D8TA 5K6AC 3Q78A 3V7FA 4P4GA 2BP7B 3AV3A 3W6NA 2QHXA 1GGEA 1Q57A 5B4VA 1P4RA 1NNSA 2I6QA 2PL5A 3SJZA 2AF3C 4R7LA 5I9TA 2PA3A 1P6UA 3B36A 5AJWA 3A3KA 5EIDA 4O4JF 4HT3B 1WCWA 3QVXA 3RU2A 2HHAA 1XJCA 1Q1EA 2QBYB 2Q9UA 5JAQA 2JGAA 2AG0A 2QY7A 2BHSA 1PEKE 2QZ9A 4UZEA 4C3OB 2WWIA 1SU6A 4A9AA 3M70A 4PHTA 3HRAA 2WU8A 3GP8A 1MJ5A 3N2KB 4QU9A 4S2UA 4LJ9A 1KJQA 2BI4A 3RVSA 4M7RA 5SY9A 4EUKA 4BEWA 2ZSEA 4A2WA 4YJ2F 4B94A 1DRVA 3UX4A 4DMFA 4XGKA 2HPVA 2GRAA 3EUVA 1A8UA 2WXQA 4C6TB 3JD1A 2NVOA 2BFNA 1AJEA 3QU5A 3WYDA 1RWQA 4CCYA 1P7CA 4CYMD 2IEGA 3GEBA 4KUGA 2FMIA 1DV2A 2IWRA 1GPDG 2XTMA 1VKRA 1R0RE 2CNWD 3OA0A 1QPZA 4RJIA 5JQGB 3E8SA 4AWBA 1TF5A 3JQ8A 2EBHX 3W78A 3ICVA 5TMEA 4B89A 1RLOA 2XVXA 4H1VA 1XNRB 2OXRA 4O25A 5K3AA 4A16A 3OXFA 1Q7CA 2IXGA 2FW8A 5DXJA 4JNKA 3I2FA 3BD6A 2PUBA 1WY6A 3C1AA 3OOHA 4AWXA 2B2CA 1Z82A 5A05A 4TYPA 3VM6A 2C97A 3K0CC 2PX0A 2QW0X 2V7WA 2O2SA 4Y2VA 2PXHA 1YFJA 4X6LA 2A0XA 3WWCA 3WL8A 3ICQB 3ZLJA 4NP6A 4LDZA 1MT3A 4MPTA 3T0GA 5LIPA 2VDVE 2PZKA 5FJJA 4GLLA 4CLXA 2ZWMA 1Z3IX 2B82A 4BO2A 2G4VA 3PVLA 2A6PA 2C5SA 1L5RA 2CF6A 3SSOA 4Z99A 5CGQB 3T35A 4ZZIA 3LE8A 1K63A 3EFHA 1TLTA 5LIRA 1E2UA 1YVPA 5AKJA 4EGFA 1MO4A 1RPTA 3RR2A 2O05A 1SZDA 4CKCA 3KHUA 4EP1A 2I6HA 1ZGHA 4QOJA 3H11B 2ICAA 1BO6A 2J9FB 1NMXA 3GUCA 4JVOA 2QSZA 5E8RA 4JHKA 1CUFA 1U98A 3DR3A 4B3RB 3KELA 2ZT5A 2CFZA 1KETA 2RBGA 5HF9A 5LCWJ 2ODTX 1YB6A 2ZJBA 3RIEA 5I4CA 1HF3A 2RAUA 2OSVA 3FU0A 3IODA 4PCLA 1A5BB 2OBFA 2LR0A 4MKRA 3N71A 5F2OA 2AOUB 2C95A 3BWVA 2YHBA 1UBSB 2ZYHA 4D8XA 3TF5A 1TMOA 3RYHB 3NP9A 1EZ1A 4DV2B 1XE3A 1L5GB 3WXMA 3ND5A 3G85A 1R6AA 4XCQA 4LXGA 3VPHA 3IKLA 2F62A 1LDGA 4K9NA 4H3HB 5ILQA 3MJ4A 4JU9A 4ND2A 4W5RA 2H2WA 3GD5A 3I42A 4XEIG 1R2QA 4QA9A 2LIVA 5AXAA 5KOHA 3UMCA 4RTMA 1P6QA 1Y4UA 1SXIA 4M89A 4GVXA 2IODA 1GO2A 3JQDA 4CM9A 2WQHA 4IILA 4YUXA 2C5EA 4WWNA 2IYVA 2R3SA 4NR0A 4NEQA 1EHYA 4YV1A 2P9NG 1QUFA 2QENA 3S81A 2O0LA 3UMFA 5I7AA 2C2ZA 3ZKAA 3VU1A 5LDGA 1IYZA 4HVAA 3BICA 3DZBA 2D8AA 4PZAA 1W5SA 2R5NA 1SVSA 4UWFA 2ZI4A 4Q1BA 4NK5A 1TQDA 3UT8A 1CUSA 2ZG6A 2ISSD 3U61B 2GF0A 2HIGA 5LLDA 2QL5A 4YP0A 4DV1B 4K9OA 5ICGA 2EJTA 3M8KA 1UWKA 1NUSA 1JF8A 3DTYA 3FUIA 4OI1A 2O3JA 3HCCA 1UPTA 2XMCA 1T3LA 3QWPA 3WQHA 4MW5A 4PSKA 2AOWA 1F8XA 2JW5A 1ABBA 1LV8A 4HUTA 3RFTA 1LA2A 4CCWA 1ZM2A 3QUAA 1E58A 1M73E 7MDHA 3TFOA 4UMVA 5LXTF 1TU0A 2HQ1A 3UEOA 1IUPA 1CUHA 1F3LA 3EDQA 1P80A 3CH5A 4NMHA 3ILSA 1QYCA 1SOAA 2J32A 2H2IA 4TZ0A 1XU9A 4F9GA 3WIVA 1R8JA 3MB8A 3DVAB 3TPZA 5T8KC 3TUZC 3WK8A 5AKXA 1NN0A 5JH7B 1AG9A 2JKVA 1ACLA 3HYSA 1ZDMA 1REQA 3WLQA 2J46A 4E4TA 2PT7A 2KLBA 3C1OA 2O0HA 2GCOA 2VSNA 1MEEA 1XRMA 4MWEA 4EZJA 2Q99A 1W0JD 5ESRA 2ZIWB 1V8FA 3LKUA 5CH5A 3EUAA 2RIRA 5AHXA 1RKXA 3GLIE 5FORA 1IPFA 2BEJA 3P0FA 4N82A 3GNLA 1XN4A 3RUCA 3GZ4A 1S96A 1QC5B 4C0HA 4CMBA 3B3QA 5A03A 1W4ZA 3B6ZA 1S4QA 1KT1A 4AS1A 4OSEA 3ZIAD 5ICMA 5IX8A 3OD5A 3GG9A 3LOQA 2GUWA 3O90A 5DK4A 2QD5A 1UJNA 3E3NA 1B6GA 2PPVA 2VS1A 5K0SA 2A8YA 3VO8A 2ZS7A 3RABA 3IO5A 3R6LA 5HS4A 3WRVA 1O1YA 3L9WA 1Y1LA 2XQFA 4IHJF 5EXDA 2EGUA 1J5PA 3WKAA 3NKFA 1JR3E 4BDTA 4G5XA 3PEYA 1I2CA 4EWLA 3A9RA 2CJYA 1MJFA 1V96A 3DB1A 4G9GA 5TQ2A 4FGJA 2XTJA 5G1OA 3EHNA 4GNKA 3IQDB 3K20A 2W8ZA 2JLCA 1RAGA 4K6MA 3T0IA 2W37A 3HG0D 1DQYA 1Z8DA 3AR8A 5EMNA 2IGTA 3C7TA 5EE1A 5IM5A 3W2EA 2CMDA 2L82A 4NTZA 5SICE 4N48A 5A9SA 3AWDA 1G21E 1ZNQO 5KVQA 5B3SE 9MHTA 3FFXA 5DLYA 3VNAA 5KNLA 2Y0BA 1N8KA 5AESA 3DPSA 5DBGA 3GCDA 3TE7A 3TFQA 2HO5A 4QQ8A 4QGFA 1P1KA 5I3ZA 3CA8A 5JATA 5I45A 3QJYA 3Q0TA 4YJDA 4BP3A 4L9SA 4B4UA 4HB2A 3IA2A 4DCVA 4B43A 1SQFA 3Q3GE 3D4IA 1YJ5A 1IY8A 4UTPA 1IN8A 3E2IA 1WXGA 5IHXA 1DXHA 1XWWA 1C9YA 4B7CA 4CEHB 2IX9A 4BFCA 4G8CA 5AKLA 5BUZA 2PUDA 2EFEB 1P7YA 3DMYA 1B8OA 2X58A 3QIAA 1XB2A 4OSOA 3FR8A 2J3HA 3EZ6A 1SOUA 5I7EA 5F7XA 3PYLA 4RIFA 1UFVA 5A7FA 2NP7A 4JXXA 4MYHA 5IH7A 1EUDA 3BRWD 3AX6A 4YPOA 3UJPA 2H11A 4XZ3A 4U7HA 2HBQA 3LT1A 1BXGB 3D1LA 1CC1S 7AT1A 5FR2A 4A10A 4FB5A 1T8RA 5CNMA 4X60A 3HO1A 4GA0A 2GUGA 3ONWA 3RK4A 3HRKA 3ZU3A 2PR2A 3AFMA 4JIMA 3NGXA 2CVFA 1BPOA 1PGNA 3ZNPA 5LB4A 2J87A 5KNHD 4BS9A 1ZJ4A 3MQFA 3C3QA 1GTG1 2FN4A 2ST1A 4BO0A 2FPIA 2RGGA 3GH1A 2QPTA 3LVBA 3SXUA 3HB1A 4L28A 4LDPA 4LZAA 1NLUA 4BATA 2PQRA 4BV3A 3D3QA 1K6XA 4ZHQB 1DC4A 3U5TA 2P9BA 4AZ3B 1LK7A 3N86A 2GN8A 3H1FA 4CL3A 3TLZA 1QGED 4O6FA 4FBLA 3BE5A 2B8EA 3IAEA 5TF4A 1DCQA 3WIBA 3ASVA 3EFOA 3ED1A 1VHLA 5HRAA 2DZOA 1GRCA 2Y0PA 3NT4A 3A4NA 2C9CA 4IUYA 2WHPB 2RKKA 1OX6A 3PXEA 2RG8A 3NOOA 3FSRA 3HUUA 1DQZA 5TGTA 3PBKA 1GLNA 3PREA 2UUCB 3DZHA 1JEOA 3JVEA 3ONKA 2J67A 3DBLA 3E9QA 3V7UA 2P27A 4D9BA 2FX2A 2G72A 4TYWA 1SXPA 3U3XA 2NUPA 2FP3A 3IJRA 5LQSA 1FX0A 1U7ZA 1YBAA 2QMZA 2JIBA 3H9QA 4MDEA 2WK1A 1JXQA 3HJUA 3WL5A 4C7MA 1UWCA 4ERXA 4C43A 3I5YA 3R77A 1AQNA 3MLBA 4I5EA 3FEYA 3VJLA 3MWEA 3KJZA 5AK6A 4XOUA 1P4GA 4AV7A 2YS7A 2PGXA 2JF0A 3NNDA 3Q3EA 4WACA 4TQUS 5IANA 3ZK7A 3NCHA 4KREA 3VYUB 3GT7A 4WXRA 1WCXA 2CMGA 3WGGA 5CH8A 1KQOA 4HDCA 4LY0A 2CJXA 4G0QA 4OQDA 4RA6B 5HEKA 2QAGC 4NS1A 5BYJA 4JLWA 1HE2A 4TLCA 1CQJA 1K6JA 3B7GA 4FYIA 1DEKA 1XIVA 4IZIA 2BBTA 2Q2NA 4YRSA 3AVPA 4CM3A 4KH0A 2OO7A 3V3TA 3I0ZA 4DPKA 2X0IA 3L13A 2LZ0A 4AKTA 1H1LA 4R2MA 1A8QA 3I1IA 2F2TA 1R9JA 4GUDA 5FHQA 3D9NA 3BH7A 1W52X 4G4GA 4Z1MA 2XCBA 5EWLB 1A76A 3HJTA 4G63A 4BLQA 4FK8A 2E37A 5DGHA 4D8VA 3TLGA 4PS3A 4S24A 1P8JA 3U48A 1T4CB 1YV9A 2X4DA 4H08A 2ODQA 3NANA 2YYZA 1YHZA 5JXGA 2WKRA 4Y2TA 4QYTA 2FP4B 1CZOA 1ONSA 3GH3A 3O1IC 4O5OA 2ZSFA 4V2UA 1WBJB 2LKCA 5C5IA 3PXGA 3UW3A 4K46A 1BU8A 2HWYA 2WTMA 3V6LA 2VGXB 2AN1A 2WAYA 2QG6A 3WYGA 3DTTA 4B6QA 2Q2QA 4MV8A 2EDAA 2AI3A 4TMYA 1GA6A 1HS6A 2DQZA 3TWUA 1TNZA 3QVGB 1C80A 3LQFA 1B0ZA 4IFEA 4QJBA 3GQBB 3C8ZA 3DXFA 3EZXA 3LK6A 3ZX4A 3RHSA 3R2JA 4I6EA 5DBEX 1V8ZA 3U2QA 1Y37A 5M3BA 2G9VA 4IJUA 2CLHB 2HLPA 3N7TA 4O60A 5ALTA 2C9ZA 2Z3VA 3SC2A 1ZJ5A 3Q3CA 3Q7TA 4MEAA 4EG8A 4ARZB 4F4HA 1JHXA 3SX2A 1ZK4A 4MITA 3KEAA 1T26A 2IV3A 2WWRA 3VNBA 1W93A 1BXKA 3W6ZA 1ZNWA 4UWHA 4OYRA 5FWDA 3CEJA 5CFNA 2I7DA 1UBMS 4E2YA 3AETA 2XXAA 3T6KA 3CNOA 4PTZA 6YASA 4ZYTA 5HS6A 3GPCA 3T1YB 4EW1A 5K0GA 1UJJA 5JAHA 2G40A 2C1XA 1UT5A 2QE7D 4WKPA 1U2ZA 1VXOA 1DKOA 2B5VA 5DE3A 1GQFA 2REBA 2PWZA 4PWZA 3FULA 4B5LA 3VNRA 3GT3A 4M38A 2ZQZA 2ZRIA 1YQWA 5ENOD 3GJ7A 4LJ8A 2CD9A 4V0KA 3A4YA 2H4ZA 4I50F 4Q1FA 3FZNA 4CI9A 4E33A 4FYHA 3DWLG 2BF4A 4HDNB 2R5WA 2AFHB 5KPDA 3ZV6A 1PTJA 2IHUA 3EPRA 2QT1A 2RGYA 4B3BA 5ARGA 2O3TA 2R03A 4GMGA 5IJ0A 2FGJA 4W63A 3C6YA 1TD9A 1Y5IA 2Q1XA 4Y6QA 3D3JA 3M0EA 5EIBC 1JG2A 3DWIA 1COWA 4FEAA 1P74A 3CW9A 2WYIA 3B82A 1A7UA 1E6KA 4FKBA 2Q5EA 2Z8XA 3PKJA 4LJ4A 3KOWA 3OPYA 1QGUB 2A1UA 1GUFA 1UR5A 4BQPA 1E9FA 3WMRA 4O2AF 4ZOLA 2OB2A 4B44A 2F8XK 3P94A 1AMUA 1QHEA 4KN8A 5KQLA 2XCQA 2H7XA 3L0BA 3SYRA 2GJ9A 4LBYA 1NRWA 4AJJA 4I9HA 4EG1A 5IP5A 1TVEA 5LZ9A 3DKKA 3WS7A 4O8CA 5EIWA 2W93A 4FNMA 2ZJ4A 5BXUA 1BW9A 2H51A 2C0PA 1H2TC 2PH5A 3MJHA 2P35A 1JBQA 3OKAA 5A0VA 4BYMA 1PS9A 3TOCA 3VH1A 3FCEA 4LJYA 1FDWA 1GTJ1 3SBDA 4NSNA 3B9RA 2WE8A 3H9CA 1TJPB 3F6RA 3VZSA 3H2BA 4FFOA 8AT1A 2C1EA 2V03A 2WI8A 4KZ0A 4YQZA 3ZW3A 2FO1E 3RM3A 1SIUA 2EF0A 4AAYA 3AF0A 4CZ2D 4QQRA 1ANKA 1N34B 4HF7A 3T41A 4INZA 3R5XA 5ALZA 2FF5A 2O7SA 4JYZA 2BMDA 2ODBA 1LD3A 1MVLA 4LMAA 3H87A 4R0VA 5ES3A 5F64A 1JKXA 1MZVA 1RTKA 3ZDYB 2CNKA 2YCLA 1EK1A 2OMEA 3EXIA 1B3RA 3ZCQA 1KQ3A 1DCTA 1T8SA 1SD1A 3L7AA 1QVAA 2IGBA 2NOAA 3DEKA 3CZMA 1X38A 1TK3A 1E9VA 2HJGA 4NJEA 4DUGD 2AXPA 5FJIA 4ZVPA 3P1UA 1NUTA 5BUQA 3I01A 4K9SA 1PL0A 4K03A 4BO1A 4MO9A 2RHTA 3V1TC 5BN4B 3OCJA 1R74A 4GVLA 5CDFA 5IUKC 1ZXXA 4HDRB 1XXHB 2H7VA 5E3IA 3R20A 2DQSA 3FDZB 2Q5QA 2J7PA 4EVRA 1F6BA 2HA4A 1BLXB 4IVQA 1QFYA 1MHTA 3PEUA 2VYNA 4GCNA 3HS3A 1DHTA 4RESA 3MHTA 2HV8A 5ESDA 3JAMA 4A92A 3DVLA 1PJQA 1XZFA 2IC5A 2IXAA 3VPSA 1HE5A 3B1YA 4J0HA 2I67A 1Z17A 1ZICA 4ESEA 5LNK6 2BEKA 4M6WB 1LPSA 2HAEA 3N70A 2ANCA 3L7MA 5GZ1A 4ZT5A 4RLFA 4Q7QA 4M0PA 3HJGA 2REQA 1FXWF 2IYOA 1JTFA 4B0PA 1J49A 5DSXA 4U0JA 2FDXA 3K1AA 3P19A 4AG6A 1M34A 3ROZA 1YJXA 4Y9TA 5C34B 4XDGA 2YMPA 2WJYA 1OYOA 3DW3X 3MILA 1IG3A 4K9RA 3ANXA 3IR5A 4UBNA 2OP0A 4K6KA 3LQRA 1F20A 3OJCA 2GCPA 2FVXA 3CC8A 1WS6A 4M0EA 5KAMA 3RJ9A 1N92A 5TE9A 4EHHA 5JR3A 1ULHA 1CF2O 4J07A 4MB6A 4N6GA 4QXAA 3H7AA 4QQFA 2XZTG 3RO3A 1MNAA 3OF3A 3ZNNA 4GG1A 3QEKA 2Y77A 2A5EA 1UKBA 1DB3A 1WXIA 3EBPA 1EJ0A 2RHMA 4EO7A 3IT0A 5B2EA 1D9ZA 2IP1A 2O2EA 1IH8A 3WYFA 4XWGA 5T41A 4TVKA 5G05C 2ONDA 4P6VF 4ARIA 3H5IA 1WBDA 1SEPA 1MB2A 2Q27A 1NY6A 3U64A 1DEOA 3FG9A 4FZ3A 3DP9A 2YHIB 4HAIA 5EXSA 1CF4A 4ZAWA 3U56A 2R7NA 3CHPA 4MPRA 3GP3A 1OC4A 3KQOA 2HWKA 3QUSA 2R7MA 4E5PA 5KTSA 4NBLA 5AW3A 3CM0A 4EJSB 5I9NA 1EP2B 1JSXA 3NRCA 4A0GA 3L7YA 4E21A 3CUSA 3CRVA 5FUVA 5JOQA 2QLTA 3SS7X 3TYXA 1JKJA 4Y6GB 1K3UB 2YJ4A 4XX1A 3OH8A 2WFMA 2O7RA 3RIMA 4HAOA 3E27A 3L08A 2PO7A 3ZJVA 1P9NA 4G3XA 4LF4B 5EUMA 2XRYA 1G8PA 5ES4B 2JAXA 2WHQA 4FYWA 4L4YA 3FOEC 2QMOA 4XA8A 4HGQA 4C3VA 2WB4A 3AC0A 1UFOA 4CQLA 3RYFA 3KWMA 2AEJA 4K6CA 1BJKA 2P65A 1DWQA 3JTEA 4DIDA 1JCQA 2UAGA 2FY8A 4MW2A 1PKEA 2QWXA 2C7GA 1KLXA 4GGOA 2L0XA 4L15A 4G1CA 4KO3S 1SAYA 2IYFA 1QCZA 5FX2A 2QD1A 3ST7A 3AERA 2AN5A 1PTKA 4GA2A 5SY4A 2CT8A 4D3FA 5CPFA 3HQ4O 5C32A 3I45A 1YA4A 1FJHA 3O26A 4L2IB 1J9EA 4MS1A 3LC7O 4PHFA 2R86A 7MHTA 5JECA 3HRHA 4KRFA 4YECA 3HMQA 4WVLA 2VBFA 2BFAA 2H1IA 4FR0A 5B3JA 2OGWA 3G0OA 3HR7A 2VJLA 4OXNA 4EO9A 4LMBA 3INNA 2Q46A 2GHTA 2NN3C 1KP3A 2V4HC 2BL4A 2BLNA 1X1SA 2NT3A 2FQQA 3O8OB 3CUWA 4OH1A 3NNNA 3DMGA 1OXKB 3UWSA 1DTSA 4CF7A 5CNKA 4TXPA 3CH6A 1BU5A 3AG5A 4LFAB 1PR2A 1RW4A 4HLUC 2ZKIA 1E7VA 1LDYA 2C4KA 5HKBA 2GBGA 4CLRB 3N7UA 3SP1A 4NZOA 3UBMA 3GBVA 1CRLA 5JNTA 4M9RA 3BK1A 4Y6LA 4E5NA 1QH1B 1ODJA 2Q0SA 5EYPB 3FHOA 3ESKA 3O83A 1QQBA 3FMIA 1FQJA 3S28A 1G5FA 4UHEA 1OIWA 3GJZA 3TD9A 3H5NA 4Q3DA 5K01A 3GMDA 2WT4A 4UVIA 1GPJA 4P31A 1GPLA 4HDMA 2B8WA 3CISA 3PKIA 2ZATA 2AI2A 4BQIA 2CB0A 4CN9A 3L1IA 2ZIXB 3ZYCA 3S1SA 2B21A 4DLNA 1DAPA 4FWBA 2ETAA 4IDOA 4UQZA 1J33A 3VFDA 5HW0A 2FFRA 3EU5A 2NTNA 3JRXA 1JSRA 2GZ3A 2KLHA 4P36A 3EEQA 4QOGA 2J3IA 4AUKA 1DSSG 4XH9B 1VDZA 1OBFO 3E48A 5KVCA 4LMPA 1R8QA 4B6SA 1O5MA 1C3VA 1ORTA 3CVLA 4YP5A 2RI1A 1YKFA 3IUBA 1NE2A 2WM8A 2XRFA 3W5VA 3GGJA 1DDGA 3MMXA 4HI8A 5FQ8A 3RD5A 2P9QA 1JUQA 4Z0HO 2AKYA 1FJXA 3R44A 2J6CA 2PKEA 1Z88A 1EDDA 4E4RA 2GN1A 2ODPA 5JWRA 5EKUA 1FFBA 3H6GA 1UMKA 1JG6A 4Z9AA 1QF9A 5EXTA 1GL6A 3IKTA 1R0BA 3U3RA 3HUTA 3NWPA 2ZSHA 1EQUA 2BFDA 2FV8A 5EIFA 1GOTA 1DARA 2D7DA 1P61B 3AKYA 2B8TA 4MULA 5ALEA 1GNPA 2WYVA 4GTOA 3GNQA 3IE0A 1W19A 1O3YA 5ALMA 1O87A 1DAGA 5JBQA 1NDHA 2EW8A 3SLKA 3MJRA 3WDKA 4FKMA 1U0SY 3A25A 1OAKA 1EHIA 3T1VA 1E2FA 3AXSA 3VOBA 3IALA 1R0SA 3CJRA 3CLHA 2J4DA 2OG2A 4E6HA 3VDNB 2Z3WA 1C8LA 1R6VA 4LZWA 1KMIY 3ASNE 4WXYB 2W2NA 1F1BA 1BRMA 4W5QA 3AFHA 4QRDA 2LDBA 4UFPA 3I5MA 3AFNA 4UU1A 1F4LA 4DEYA 4D4JA 3HXPA 4G5YA 5AVKA 2J5RA 4NV1A 4B0OA 4CR8A 1XF9A 3O38A 1OXTA 4RSGA 5IC4A 1HLGA 2DFDA 4RPIA 2W8BB 4NS4A 4Y1GA 3IQXA 3ZHRA 2JIPA 1KYXA 1YIDA 3LM8A 4DF3A 3TI7A 2RK6A 3VZRA 4DIFA 5IAKA 1M2OB 3UANA 4MSUA 1QK4A 1AB5A 4S0ZA 1ZX1A 5GPBA 2O8DB 3JSXA 1JSLA 3FUDA 3FUNA 5FKJA 4FMPA 2BM8A 1XELA 4EFLA 2CJPA 4F1SA 1OLXB 3B2EA 4MRNA 3LQYA 5DNWA 5HIMA 4MKGA 2EBWA 4U1RA 5F78A 1MFZA 3PWZA 5DRTA 1NI4B 2FRDC 1V7ZA 4TMKA 2IVFA 1NW5A 3STVA 3C3RA 3GOHA 1A4RA 1BMFD 1OMOA 1N0UA 3EFEA 4YO8A 2QGZA 4P4UA 2DKNA 3VKUA 4M53A 4OHRA 1N2ZA 3VR5A 2EINE 3COJA 4A0SA 2Z2ZA 1HUQA 2V9PA 4BMDA 4TTQA 1SMKA 3RT9A 2XA1A 3PEFA 2CD7A 3M3HA 5D2MC 1N5MA 1DJMA 4GOLD 3RSLA 1FVHA 1R4ZA 5F12A 2V8BA 3J81k 5E4JA 2WSLA 5CDFE 1RCUA 1N94A 2ABWA 1ZJZA 3GLIA 1X74A 3PT9A 2GPWA 4UNPA 4OHBA 4GMDA 2I55A 4GA1A 3I6IA 3PRYA 5UKDA 3LCUA 2H1LA 3L1KA 2OKCA 3BXGA 3D7KA 4Y6SA 5E0OA 4BERA 3VHQA 2VHUA 4WAUA 3L93A 4JBNA 2X5OA 2ZRAA 1GAQA 4C06A 2QSJA 4U2EA 2OCLA 5HIJA 3ZGZA 3P7MA 5FWXA 3B7UX 3BB3A 4RZSA 1G0NA 3ZWMA 4D92A 1P9WA 1FA9A 4GTPA 2HJSA 1VQ1A 5I9SA 2QMYA 4AJNA 3UFXA 5DISB 1GDHA 1JXAA 3D3WB 4JLSA 2PS9A 2VPTA 1RYDA 2OBYA 5TC4A 4N1AA 4P7JA 2C8JA 1JR3A 3QBJA 4KGZA 3KYDA 4DT1A 3ZIDA 5DT2A 4XYMA 3UY4A 1M34E 3TN7A 4DA8A 1Z08A 4MCHA 1P2GA 3SCZA 1FS6A 5DLDA 3OSUA 3D8UA 1WA5A 2XB6A 1PU2A 3GHYA 2FPGB 5EJ6A 3EIUA 1O4WA 3LKBA 3IIEA 3DZDA 1CY1A 2A35A 3P8ZA 2HUNA 3HU5A 3PFWO 2P9CA 1C3OB 1S4MA 1YQTA 1U3FA 4YJ3F 3SWWA 4B3SB 4LWPA 3V33A 1AA6A 3PC4A 4MRRA 3K4PA 1TTTA 3TCNA 3PDIA 4XJXA 4JAVC 1VIDA 5F4ZA 3B60A 5IM4A 2PPLA 1D9SA 4JSRA 1JAXA 1NUPA 4W9MC 4FFVA 5LYJA 2E2EA 1V39A 2WG0A 1NVGA 1NVDA 5L3ZA 2CC2A 2K7FA 5FBWB 3ETJA 3P96A 4L0DA 4B9EA 3F7MA 4OHYA 2NV2B 4JHLA 4H0NA 4PCVA 5K4GA 2Q4BA 4AP5A 3Q8MA 4DIOA 2RB5A 4P0QB 1U11A 1EWKA 4CKEA 3KSAC 2FHPA 1DX6A 3C72A 3HACA 5ESWA 4IIEA 2ALJA 3CQGB 4BQRA 3C4VA 2B4TO 4QEDA 2YZNA 4BLWA 3BA1A 3O1JC 5KNCA 2H4JA 2OGTA 3T9KA 2BH9A 1C0PA 2H29A 3IC5A 3TSZA 3Q8LA 3FNEA 1EWQA 2O52A 3UMMA 1DWUA 5C0OE 1WB4A 4NOKA 5GGXA 1XPUA 3FYUB 1GTMA 4BNYA 2H1WA 3I8XA 5JCJD 2YXNA 4HGYA 1QG0A 2VPPA 2NYRA 4UTXA 3UPTA 3FYSA 3QUTA 1BMTA 3HIZA 1UC5B 4MGIR 4ND7A 1XFAA 5G0UA 5JPCA 4PYIA 4IV8A 1GHTA 2PSJA 2IQCA 2GERA 4K1LA 1NV8A 3GJ8A 2AG8A 1EP1B 5AKEA 3BE4A 3MTAA 1EK5A 1JQAA 4JJKA 4B2YA 1T5BA 1JHUA 4K5CA 4QG7A 3UNXA 5A6CA 4C1BA 3LPMA 2VPZA 1OTHA 1LV7A 5KKAA 3TLKA 3RGGA 4KVOA 2CHWA 3F67A 1OOEA 5CIYA 1E1YA 4PPYA 2H48A 1RQXA 3PITA 1E64A 4QDKA 3QOYA 3F5SA 1RXYA 4PICA 4IN3B 1ZP6A 1NLZA 3AZOA 3CGGA 2WSBA 4D6PA 1KY5A 3QE3A 3TQCA 3GLGB 5D51S 3CW8X 4EMUA 3GLHB 2G8NA 5JWOA 2X8LA 2WXOA 1UXHA 4EPRA 1EH5A 3ROKA 3I3OA 3TECE 4DX5D 4PTYA 4YT4A 5BSKA 4BZXA 1LLFA 2ZANA 4A63B 5EJFA 2GM5A 3L7BA 2FEMA 1W5AA 4N8DA 3DLTA 3AONB 2O6LA 4E5KA 2QR3A 5AD1A 1VCHA 4QC2A 2AKEA 1TKAA 1VE3A 1X3LA 4H1HA 5A7GA 5F5XA 2HADA 1LBSA 2FN7A 3BSWA 4AL4A 3IBFA 3GDFA 2VQDA 3GFSA 1O08A 1UM9B 1KJZA 2YMMA 1KERA 3JQEA 5GJCA 3B3JA 4KQJA 1P60A 4BN0A 3HA5A 4EZLA 1B74A 5L7TA 1DC8A 1BX0A 4FC8A 3FNFA 3WRYA 4C3UA 5HMMA 3RSOA 4G86A 3RIBA 4LSWA 1PFWA 2QYHA 3Q40A 3V55A 2GCGA 1QLHA 4J7CA 3SNXA 4MV1A 1Z0KA 4NIMA 3OFKA 2WA2A 4BFRA 2R85A 5ALWA 1Z4PX 2J5XA 3PS9A 4LJSA 1L5NA 1EZ4A 5EE0A 4UM9B 2Q4TA 1XZIA 1BD8A 1IHDA 4YCCA 3BJIC 5J2UB 1A9XB 4GWKA 4BGDA 3C87A 1UXOA 3ZDXB 2VH2A 5JSUA 3QNUA 4TZ6A 2WOJA 3ECSA 5FBHA 1KQPA 3B12A 4XX5A 3KR1A 3M82A 2K6GA 4B2PA 3RRFA 1YQEA 3BB4A 5JDIA 2QUAA 2XT6A 3CEAA 2PUWA 4RK6A 2CF5A 1U2DA 2WHXA 1Z73A 2ZJ5A 1YTLA 1NRXA 4PHGA 3OETA 1I4OA 3DC7A 2VJ8A 1FQOA 4CG2A 1AS0A 3K15A 3AVXA 2NTJA 1DBWA 5A62A 2PU7A 3D9KA 4CV0A 3AM3A 5PGMA 2CFRA 3UT7A 2B94A 3EH2A 1ESNA 3NORA 5H4GA 3BWDD 3ZWKA 2VYIA 3W5IA 1JMYA 3ETCA 2PM8A 1E2HA 2NU6B 3KTFA 2ZRMA 4HVBA 3VLFA 2CLIB 1CB0A 2OXFA 2PLAA 1ZMOA 3KXPA 4LS3A 4AKSA 2WUWE 1KVQA 3P9QA 1T1SA 2LCQA 2ZBGA 3GJQA 2P2CP 3E23A 5TQJA 5JD3A 4YAWA 5BVHB 4EQZA 2I6UA 4Q7MB 2MSDB 3HTXA 1T2VA 1DG1G 3OX1A 2AJTA 2NSZA 3AF5A 4CTOA 2HSEA 1P3DA 2I2XB 1IWBB 3ZYMA 1UOEA 4ND5A 4RJTA 2AZXA 2VT7A 3WDMA 1J4AA 1F0YA 2YWGA 1UXIA 1XMXA 1R0ZA 1J0BA 2H65A 2G76A 3A0UA 2LSVA 5AW9A 5JAZA 2GA9A 1OU4A 4ED9A 3VSDA 5LLTA 3U7RA 4ZOCA 1QJCA 3I92A 1MHPA 2P7IA 3PDWA 2XTAA 3PXBA 4IWYA 1U5CA 2PZAA 3UM9A 1MW9X 5A23A 3RRMB 1EUCA 2GGFA 3HVJA 3W05A 4Z68A 1SHKA 4HWOA 4AU1A 4ML3A 4AJWA 2YIMA 2ZDGA 4W5HA 4AEZC 3HXKA 1J09A 1ZFNA 4XIFA 1QX4A 1GGHA 2BY4A 4R2JA 4AKHA 3W9UA 2FA9A 4GP6A 5FOUA 3T0FA 3GYZA 1P2UA 4X61A 1DAEA 2D2IA 3HHMA 3TR5A 1C2TA 3ZZ1A 3A37A 4R3UC 5WRFA 3RBVA 1IXRC 4Y0VA 2SKDA 3B9PA 4NURA 1YZYA 3NBNB 3U7HB 1M1XB 2XS1A 1PJBA 3HCRA 5KSPA 4RJ2A 5EP3A 4C7JA 2X3YA 3T9EA 3MEQA 3J80A 4PYNA 1XAJA 2H06A 4UBKA 2OQVA 2MWMA 2Z9BA 3AW9A 2B83A 2G67A 3NUQA 4UWGA 4IGKA 1ZEJA 4AY5A 2Q50A 5CMYA 1KFJB 2YHAA 2GK4A 5H7PA 4QWMA 1N6OA 5J2TA 1NZFA 4NDZA 2EJUA 1D0VA 4CKWB 3ENEA 3IVCA 4DRYA 5JBIA 1V43A 2IEJA 1OAAA 121PA 3FDXA 2X76A 1S9DA 4LA4A 1FC0A 3OCZA 1J8YF 1HT2E 3CHSA 3V00A 4LTDA 2WR8A 3GFPA 2DSNA 2OCBA 4TS3A 5JY6A 2BGWA 4Q4CA 2E5WA 3FTUA 2GXAA 5E9QA 3ZXXA 2PH7A 4FBGA 4F97A 2I2OA 4K9DA 4TZTA 3OJXA 4WH0A 5DYYA 3NHJA 3AH8A 2GNPA 1K75A 4GXTA 2V5QC 3DDOA 2PZMA 1MMFB 1OWLA 2WFLB 3A9CA 3JD3A 1DBPA 4UTNA 2JBWA 3FUUA 5KHAA 4A82A 1V3TA 3PLRA 3VMMA 1IZ0A 3J7TA 1W8IA 1U5AA 4AS2A 1G38A 2XHZA 1N6HA 1SCAA 3DHYA 4MQ6A 4BKOA 4CV1A 3EXEB 3TQHA 2DQKA 1AGYA 1PAQA 4PYKA 3UQ3A 1IYGA 4HP8A 1GT6A 1E6EA 1HFWA 3A1SA 5BRAA 3U7QB 1QDUA 3H86A 4PSCA 1E8ZA 1G5RA 2X8JA 3AIMA 3VO1A 4F5YA 3WB1A 4XX0A 2V98A 4NYJR 4DE5A 4KR0A 3CR3A 5JSZB 1CV2A 5E7IA 5IKXA 4ZCTA 1C4WA 1X19A 2XMBA 1KWKA 2NVUB 3SZMA 4M7OA 5AK3A 2WUVA 4IQFA 3LWZA 5KO2A 3IO3A 4U6NA 3BRCA 1QORA 3VNVA 4MQEA 3URKA 1P62B 2EZ4A 1TKRA 1CZKA 2FHSA 3MWDA 3OWHA 3SZGA 4LVUA 1WSWA 5DBHX 1CG6A 2H9YA 1R5JA 1W0KA 2V6FA 3FPFA 5KBYA 2OPBA 2OCIA 2YVUA 4RDCA 4Q9LA 1ZU5A 4N0MA 1FMFA 2RGEA 2P30A 3HEBA 3NTVA 3TG4A 1UFQA 2QMEA 1C4KA 3PENA 2O14A 1QMPA 3GB9A 4WESA 4IQGA 1SELA 2F3PA 1F51E 3HM2A 3N75A 4JJEA 4MDYA 3WGQA 2C82A 4F85A 3HDJA 4GRAA 5FTWA 3LTNC 4X1KB 3CWCA 3O9ZA 1J25A 1KI9A 1Q21A 1SU7A 3ABOB 1MJHA 1R18A 3WGJA 2DHDA 2W2MA 4CHTA 2XYVA 4LFBB 2OV6A 2ZVQX 5F52A 4QJ3A 2FFAA 3H42B 2JI4A 2R6HA 2V5FA 3U37A 2ZXUA 5HJEA 5JHBA 4E2WA 2AEMA 3EVNA 1Y89A 2JHCA 5F73A 3OIYA 2V65A 1TAGA 3T5BA 1WDTA 3EE6A 4BQEA 2FG6C 4Q1VA 5B1AE 4DIUA 4LJ6A 3ORRA 2I6FA 1F14A 4RQBA 4NYJQ 5FZQA 1ULUA 3AG4E 2YY5A 3SJCA 4WVFA 3NV9A 1NBOA 4F3RA 5AJHA 4R1MA 1PF7E 5ICFA 4QQNA 3RKSA 2E87A 5DFAA 1KU0A 4HS4A 1QANA 5LSAA 2F3TA 2AC2A 3L01A 2PCLA 4RL4A 4QYIA 3DYBA 4JROA 1GP2A 1AVTA 1H9BA 2XQ0A 3AI7A 1YONA 1YIOA 3NBMA 3DVRX 3ODGA 4JDPA 1FFXB 2A0YA 2I2CA 4S3MA 2D4HA 2Q1YA 4Q4JA 2EG5A 1PZMA 3WI7A 3H9GA 4DJ5X 4XM1A 3DZCA 4ZI5A 3CHOA 5LQRA 1T6BY 4IDFA 3BBPA 4PQFA 4L0CA 2FEAA 2W58A 4JEMA 4ZYWA 5CT4A 1O96B 2Q3EA 3RHFA 1CFJA 2SNIE 2H08A 3B6IA 1W4CA 4F4CA 5D2CA 1MGPA 2Y1CA 4W5OA 3D54D 2GR9A 3A27A 2PH1A 1WVGA 4F6LA 2ZSKA 1H2UA 3NTUA 2CBXA 2G0NA 2P8SA 1T24A 4EHJA 3VC3A 5D0QD 3L0ZA 4II7A 1QCCA 1SBNE 1A4IA 3DKIA 3OE4A 3MCZA 4I2ZA 3ISTA 4F3TA 3G2HA 4XFDA 4PLCA 1P5QA 3MWLA 1YVRA 2OD7A 3BWCA 1P9RA 1QB8A 4CMEA 1BXZA 1WCIB 2QRHA 3R7BA 5FFNA 1XTRA 3ROTA 1J7JA 3Q9UA 3VISA 1T15A 4Q19A 4C0JA 5AICA 2O8CB 3FSJX 3KQTA 4P22A 3QLEA 3OZWA 4OFBA 2J5QA 5T4FA 4ILEA 4JXZA 2VF4X 3GFFA 4ZI7F 5A4IS 4NBVA 5AJDA 3PA8A 4L4SA 3C8MA 3AIOA 1U0RA 4Q01A 1VP9A 3NWBA 5GJBA 1SCDA 1DZ3A 3EQ7A 2ATCA 4DBZA 3HKEB 5BPFA 3SBOA 1NGSA 3LMKA 1FFSA 5CEAA 4EPXA 3SVZA 3JQ1A 5LP1A 4TL6A 3I2HA 3SF8A 4GMKA 5BSRA 3CUKA 1IN7A 5KZMB 3D9OA 1DC5A 3RAJA 4BLOA 1ISPA 4YQEA 2J31A 5I7SA 5IXYA 4LRSB 2IPOA 4RAQA 4OHXA 2BFEB 2C5LA 4C4PA 1KIMA 1A04A 2RGNC 4QO8A 4LZLA 4J7XA 2ERXA 1FXUA 1JVSA 2CLLB 3IP1A 3U9SA 2P9HA 2ZYGA 1T9ZA 2RC5A 5TLSA 5EXEA 4ISBA 2P9PG 5IBRA 3T1HB 4MVJP 3ZDZB 1SXQA 1IBLB 1I2MA 3QKSA 4IG9A 3CRW1 4I5GA 3MA0A 3W4KA 4UTVA 4DZTA 1J70A 3D6HA 2OO5C 3KFVA 2HCRA 1KE1A 1CQWA 1CB7A 1VLLA 4EF4A 4JC0A 4QPZA 4COKA 3IHVA 4PR0A 5G55A 3HBNA 1KNXA 1YB1A 3ME5A 3OIGA 3DDZX 3B1FA 2GN9A 4C0XA 3IXMA 3HBLA 4FU3A 1QE5A 1INLA 2YNMA 3SFTA 5CCMA 1FRVA 3AJAA 2HMAA 3WYNA 2VG8A 4NYMR 3Q15C 4E70A 5K0JA 5CITA 4WY2A 5D7NA 2CMHA 4V2IA 5KNBA 2C8LA 2QB5A 3ZD7A 4GI1A 3ENVA 3ZU4A 3OJLA 2BHRA 4QAQA 2G88A 1GKUB 1UK9A 3RVLA 3WO1A 3SMQA 4B7UA 1PWYE 4YXWD 1B2LA 1YB5A 2CLEB 3C6ZA 4RVOA 3QFHA 1XD2B 3CSDA 2ZS9A 3TKYA 3HVHA 2BD0A 1KGSA 2VC2B 1CK4A 3L8HA 5T5QA 4HD8A 3BMCB 4DQKA 1IFXA 1WMAA 4CL0A 3ZDFA 4HGPA 1JRLA 2FVYA 5HG0A 3LZ6A 1N5JA 1H8HD 3PC2A 4YJFA 3HY4A 3CIFA 1C81A 3EXHA 3IE2A 1YQ9A 4AUNA 5BQ3A 1X7ZA 2RKBA 3T52A 4QDTA 5JALA 1NVEA 1EXNA 2BN4A 4LGYA 1HNXB 3MYRA 5IT0A 3JXEA 1UDBA 1RU3A 4KPEC 3BREA 3CF2A 3DAYA 4QNNA 3X0DA 1SM4A 3O8QB 3E9EA 1RPNA 4JQZA 5IAEA 2UUOA 2BEVB 2VUIB 4ZVNA 1BFUA 4FHCA 3L04A 3UKDA 2XCSB 1XTZA 4YDRA 2IFTA 4M9XA 1OFUX 3GGSA 3WLMA 1WX1A 3RFVA 4EHIA 1S64A 3KOUA 3RC9A 4MWSA 5MF6A 4EKIA 3LDZA 4S1OA 2Z95A 3ZEIA 3EUEA 4YLEA 4NCXA 3DT9A 5IAGA 1MRSA 4NYMQ 1P5JA 1MW8X 5DN6D 4H7HA 4HR7A 3V8MA 3BG0B 1DDOA 3CCCA 3BVPA 1H2EA 3VZBA 5DM1A 3JALB 1UBNA 5E4FA 2YMQA 5L6LB 5AKGA 3ABQB 3K0AB 5ER9A 4OXIA 2EILE 4D2IA 4PIVA 1P4AA 4KYIB 4AMGA 2GRMA 3KLNA 1EUQA 1XNJA 1U8XX 1ADFA 1WU7A 2IVZA 2CZCA 4CEJA 1RJ9B 1R9GA 3WGUA 1QO0D 1AT1A 3UUXA 4G37A 1OX4B 4NU0A 4EMSA 3P97A 4NABA 1K7EB 3HWRA 2E6KA 1RI2A 3ITKA 3ZD9A 1OKKD 4HMPA 2NO4A 1GNVA 3G23A 4YRAA 1ZRNA 4Z53A 4OK3A 5G3ZA 1M6WA 2WT8A 2QUZA 1ONNA 1WZ2A 3PC3A 1TC2A 2B0OE 4O4LF 4G1MB 2LW7A 4DR4B 1G2IA 4BCDA 4BEPA 1X1CA 1BC5A 3HN2A 3IEUA 1ZVQA 1KAHA 2OY0A 3LPAA 5KYWB 3LZCA 4Y30A 1XVAA 2DPLA 1H23A 3OZBA 3A4VA 4NFSA 4WCFA 3T8YA 2XV1A 4HLEA 3V8NA 1MFPA 4KLCA 5T7BA 3V4FA 4TYQA 2ETBA 2VP2A 3G5MA 1IXYA 2F9LA 3BGIA 5AVRA 1JB1A 1B4DA 3TTXA 1QAMA 4P80A 2VZ0A 4AS3A 2V55B 1JKFA 1NI5A 2G8LA 2WJ4A 2VWHA 5G04C 3KSBC 3KHTA 4AO6A 1YDGA 5GONF 4GKAA 2X1LA 3RTBA 4POAA 1USWA 4X8MA 4FI3C 3TMYA 4YIKA 4N4AA 3EB9A 1PR0A 3Q12A 3FGZA 5CBOA 3UKUG 4OAVB 5P21A 1DGQA 4ZVLA 1YNSA 2C4MA 5DVZA 1N9ZA 3I58A 1U02A 4LC0A 3KDSE 5A0FA 2HHJA 2FXIA 1T2DA 1H6PA 2WTXA 1SXJB 3ZE8A 1SG0A 1P1CA 5BQOA 3EDTB 3EMBA 5DN9A 3PI6A 4TV3A 1BCRA 3B52X 1C5KA 2ZQYA 1NXWA 4A4DA 4BTBA 1PQYA 1QUEA 4Z4IA 4GPD1 4OU4A 1Q5PA 4BGVA 1FLAA 1GV0A 1XZJA 3MUNA 5TS2A 2BFCA 4HGZA 4X85A 4WNGA 5BUCA 3TOSA 3PA6A 2ZRPA 3BCHA 1VTKA 2XSZD 1KMHB 4DR1B 3HGQA 1BS9A 3ZG6A 1DG3A 5SYAA 3NOXA 1Z6PA 3N2YA 3SPXA 4URUR 2PH3A 2R8YA 5E4YA 3O0TA 2X6JA 2DEUA 2POCA 3FLAA 3OLQA 3ZUGA 4QFCA 3JWPA 3MOIA 3WNVA 5EQJB 4G4SO 2PBZA 4PYMA 1CXZA 1G3IA 2AQ8A 2A1IA 1E1CB 4BO6A 1XTVA 5IJAA 5JWHA 1L0BA 1NJSA 1C0KA 3AU8A 1P2SA 2TRSB 5AM2A 3LO5A 4AJ1A 5KOJB 4X00A 1AGNA 1F48A 5C7OO 3L07A 5KHOC 3BCRA 1SR8A 5G05J 4FYXA 3ETEA 2VYQA 1XRQA 4GB9A 4ALMA 5BRNA 3QWHA 4KPFC 1DINA 4BZWA 1UODA 1JEYA 3OA2A 2NU9A 4H3SA 4DG9A 2CXQA 2TSYB 2PUFA 1Z5WA 5D0OD 1A97A 2EL9A 2G1UA 1QAOA 4D25A 3OO1A 1OA0A 2AXNA 3PKZA 5LP6B 3OURA 4RPLA 4KXUA 3VYWA 2WG2A 4FB4A 1QTRA 4INJA 2NUAA 3UGJA 4FI3F 2VJYA 2JEZA 3RAPR 2E82A 5JQGF 2GPTA 4CDRA 5EMMA 2FG7C 1TZJA 3MPOA 3WV4A 1GL9B 3ZWDA 4YGXB 4B2LA 4J8SA 1XZAA 5TPZD 3C3JA 3L7NA 1TA0A 5U4QA 4ZAFA 4U7DA 2ZSAA 2Q3BA 1QK5A 1CULC 4MQBA 3WZMA 1EVEA 5HJ5A 3RTGA 4OGLA 3H8JA 2B92A 1RVDA 3GJTA 3D6VA 5MN4A 1H0SA 1TM4E 5L3RA 5C1DA 4NX2A 1MO3A 3WV5A 3IUQA 1HQCA 3L9XA 2HD4A 3IPLA 4WXEA 1CX9B 4JNCA 2DLCX 4MO2A 4CT4A 3O4JA 2IEYA 1I4WA 2ZWIA 5ARCA 3G3EA 4QRHA 4RH1A 3PG5A 4IICA 4O4HB 4YHHB 1V9CA 3DZIA 2O6HA 5TY0A 4IUBS 4U9IS 1L9XA 4AVYA 4KFTA 4C04A 2CE7A 5LQKA 2G80A 4JD2G 1NJGA 3VSBA 1K7FB 3T3NA 5A5GA 2Q4OA 3S68A 1LY1A 3OICA 3FTSA 1F9AA 5BW8C 1GTVA 2G4LA 5DWQA 3T3DA 1G7CA 3N3BC 2C5AA 4H15A 1RHKA 2MR5A 5FTLA 4N3NA 4GAEA 2XPZA 1BJRE 2UV8A 4RE5A 2UYYA 2I65A 4RSYA 2WJVA 5CDGA 3Q0IA 1NMSA 5J2UF 3TDNA 3IDAA 4JHXA 2AMLA 4TTSA 3EDYA 4G0YA 3CXRA 4F9FA 3F5MA 3MM4A 2PX5A 2BFFA 1A50B 4QT4A 3EISA 4E15A 3FB1A 1GYQA 4AZ0B 3OZIA 2Z8YM 5HQJA 4YJHB 2XOKA 4NMWA 3JCKC 2AQHA 2QD2A 2BKLA 2J8SD 3MUEA 1LBHA 4Y1FA 2JH3A 4DV7B 2JFYA 3D2LA 3G02A 3QVWA 1LD8A 2ZRNA 2P9IG 4HJXA 1WKBA 3KVNA 5H9VA 5DGCA 2P69A 3COWA 4QUDA 1YMVA 1QTQA 5BRJA 3PFKA 3R6DA 3AR6A 5JMOA 1WVIA 2FNAA 4RY8A 2P3LA 4G0NA 3AESA 4URFA 2FZKA 1W85A 1LS6A 3QV2A 3RFFA 4S35A 4TMXA 1XJ5A 4PHCA 3UUFA 4ZV7A 3LVFO 1DMRA 1DT3A 5HTOA 5K9ZA 3MJCA 1JKIA 2ZWPA 4Q1EA 1TEHA 4OJTA 4XR9A 5E38A 2D7JA 4BMZA 1WSDA 5DH9A 3PZDA 1RYBA 1XZGA 3S2YA 5AH0A 4OB7A 5KBAA 3WQRA 3CSFA 1HO8A 4HWPA 3MZ0A 1ZCAA 2BKVA 3G2SA 4BEBA 1UBUS 3U17A 2G83A 5CIWA 3IAXA 4DDVA 4G81A 1AXGA 4CE6A 1Y3FE 1YS6A 5DULA 2PMEA 4GPIB 1RXEA 1N5DA 4G26A 1SCUA 4RMNA 5BURA 3E35A 2DG2A 4N18A 4A1SA 2HUPA 4CUZA 2ZGDA 4BMXA 2C61A 4LY9A 2JGNA 2EFCB 3UAZA 1HH4A 1TO1E 5EEHA 1ES9A 3RC1A 3TRHA 5A06A 3BWXA 4YI3A 4WUYA 4CF4A 3SQVA 2V54A 1U5BB 1T91A 4R1OA 3DDWA 3NBXX 5CNJA 1Q44A 4DNOA 4AECA 1Y7IA 1LK0A 3X1WA 1WU8A 3CO0S 4Y7CA 4MPDA 4IXWA 4YDHB 4BFWA 4ND4A 4D0GA 5I9IA 1HL7A 4JLPA 2GYWA 4FEGA 1L5SA 4GSLA 2IOHA 3N2EA 2CK3D 4MR8A 4L76A 4BBAA 4X8OA 3ML9A 2I4IA 5H02A 3LNCA 2QLNA 3RJ5A 3RH0A 4REQB 2MRIA 3INGA 3NHAA 2CUKA 1BROA 4HBDA 1ODLA 1O97C 1GSIA 1Y6FA 5JH7F 1KXJA 3ILVA 4QPJC 3MJVA 3TIIA 1RLIA 2HQBA 2NVBA 2GXUA 3ETHA 5BOVA 2XDQA 1VP3A 4D4IA 1SZCA 1AV7A 4U39A 3RSHA 1XCGB 3RB8A 4RYDA 4KXVA 4CEMA 3B13B 4OYHA 4BUCA 1AKMA 3E61A 2B8NA 1DC3A 2QRJA 1EFCA 4GLOA 2HGZA 1JQDA 2FB9A 1T3HA 5KYVA 3W1EA 1HT0A 1G3NB 1CQPA 2YV4A 2XQKA 2VZLA 2OAQ1 1PZEA 5FULA 3F7OA 4HQ6A 2C84A 2WEKA 5DLQC 3ROPA 4BWGA 1RAAA 5FPYA 1Y3DE 3ND9A 1G4HA 2BEUB 2P0EA 4CM1A 4JBYA 1VRWA 1OV4A 2C3MA 3DPIA 3NCTA 1AV6A 1RBMA 4U7TB 2B25A 1W96A 4YVFA 4M8LA 2H6HA 4N7MA 1NQUA 3ESQA 2HK9A 3PE3A 3QNWA 4IQ8A 4ZOBA 4FP9A 1UUFA 2XE7A 3RUEA 4WY8A 4X92A 3JYOA 5IAJA 2VPXA 1WUTA 2AXQA 3DEJA 2IZ0A 3DBRA 1EFTA 4X94A 3AM4A 3C5CA 4XWYA 2ZJYA 3FUCA 4X1IB 1GLGA 4Z4CA 1OGIA 4DW8A 4EDFA 1S1MA 2VJCA 1CUBA 2FH5B 3LTEA 2QXTA 1JDTA 4QJ5A 4H4EA 4H0CA 1MIHA 1M7BA 1WW8A 1INZA 2QSUA 2RG1A 4J8EA 1JDPA 4YRTA 3FMOB 3PB3A 1IOVA 5ABPA 4QGGA 1B6SA 1Q22A 4G1UC 1JCSA 2XCTB 1E1MA 1MCZA 4AZVA 4G24A 5E7QA 1BN7A 3ZWBA 5JVDA 4MUXA 1P5FA 3K0EA 1YJ8A 1I4LD 1U7PA 1OZ0A 4NKRA 2EWWA 2CVZA 4PG8A 3JVUA 1PV4A 4B46A 3PFIA 5EZQA 4ARVA 2XNDA 4Z7QB 1I2BA 2V7GA 3AR5A 1A17A 1T2AA 3QFTA 1JLHA 1AKEA 1G60A 4JENA 3BSYA 1YK1A 3EEIA 1OZHA 3DXXA 1JLLA 5JD4A 2TYSB 3ADCA 4IY1A 5BNTA 3NHZA 3LHKA 3A9WA 5KTMA 2TECE 4FZVA 4EY8A 4AY3A 3DMTC 4N49A 2JB9A 4KQXA 4P3OA 2IUYA 4QECA 4G11A 1GNSA 2ACVA 3B7RL 4R54A 4KXXA 1UADA 2VHXA 4N41A 1XVVA 1KMCA 4ZKDA 2NQ8A 4Q4AB 1FYDA 2Q62A 5AO9A 5JHGB 4L50A 5GJWC 3PQEA 2OA0A 5HPYB 4LWZA 1CIJA 3EXFA 4NBRA 3V2GA 3ZCXA 3SVTA 3Q85A 2Q6VA 1ETUA 3SEQA 2QRVA 4BNUA 2C00A 3N87A 3M4JA 2CNLA 1DVPA 1ZC3A 3SSNA 2I71A 5FLEX 4WBNB 1KJ9A 5FI5A 4XD7D 3C3BA 4LHXA 3Q49B 3L1HA 3N7AA 3X1ZA 3KB2A 4DAOA 2QRPA 5JYCA 3QXHA 1E3LA 1CUZA 1O6CA 5AXCA 2IBMA 4IMPA 2MYNA 1JPVA 3NDBB 2GO1A 3G7NA 5CP8A 1TK9A 2A0WA 4N40A 4DPRA 4FW9A 3VR3D 1FP1D 4ZHQF 1X92A 1EM6A 4HN9A 4IRXA 4G0VA 4ZVQA 3RSQA 2LSUA 2FE1A 1U6KA 1CLUA 5EIHA 4IXNA 3QBVA 1RKUA 4FU0A 4RFVA 1HA3A 1R0LA 1M8JA 2HR1A 3F6PA 1R0KA 2Y71A 1I14A 3LL4A 3KQSA 3O1HB 4QEZA 2GM9A 3Q2IA 2VTEA 4BX0A 1Y4DE 1ZR4A 4EPZA 3PQCA 3UMSA 5B3AA 1A9TA 2V7PA 5G0VA 2OENG 1L3BA 4DPLA 2Z08A 3DFUA 5CB8A 2Y0CA 5KYUB 5GZ6A 5AW5A 2JG3A 4H35A 1CDEA 2YVAA 2YIVX 3HI6A 2XJ9A 2X3MA 3QELA 4XJVA 4JUCA 4DUPA 1QH8A 4L8LA 4TRQA 1KZ6A 2GH1A 1C1XB 4ZOQI 1SW6A 1E8YA 4K8OA 4QTZA 3IMFA 2Z57A 1IN4A 1N32B 4ZT7A 1U28A 4LY6A 4A6DA 5FDFA 3TBKA 2Y76A 5IZCA 4IIYA 4QLOA 1UDWA 3VTZA 5EESA 1KY2A 2O06A 4ND8A 4DLKA 4LAFA 5EHQA 4NPHA 5D5QA 2QG9A 1Y7PA 4OXXA 1X7XB 2F3SA 4D8UA 1T2CA 4F6RB 1CETA 1TA4A 2B1RA 2VDUE 3RU3A 1P1IA 2PO5A 1DQRA 2NU7B 3K9BA 4Y98A 3SQMA 3I3NA 3OFVA 4CFYA 3OX2A 2VF8A 4PGFA 3BHJA 1QIKA 4FNGA 3ML1A 5KKCA 3VTYA 5GY7A 4RW0A 1YF3A 4DA4A 5KDOA 5JXIA 1U8EA 4KLRA 1Q2XA 4L1KA 1SQGA 4EZIA 5JTUA 5K0CA 1L4UA 2BKGA 5MGBA 1MDFA 5TS3A 4P4TA 1OCRE 1JQEA 1KY4A 4F2PA 1HV8A 5GIOE 2HKIA 3UINC 1Z0SA 3QLVA 2I62A 3JQFC 1VE5A 1UWVA 1RQGA 3FGOA 5DOVA 2IHYA 1XMIA 2E6UX 5KJ6A 2RONA 3KZXA 4PYOA 4TSFA 3E7FA 1TMKA 2RH9B 4JJFA 2P0AA 8MHTA 4ZV4A 4L9PA 3HFGA 1OX5A 4DR3B 1C1YA 2RH4A 1NUUA 2W2XA 3C3XA 1YMQA 2VO1A 4M99A 1LNSA 4LDAA 2I66A 2W22A 3ZGNA 4DSOA 2JC3A 4F60A 3W9FA 5FYDA 1O9HA 1GPWB 2HA3A 2ZJZA 1UMCB 4G5FA 5KWEA 3KQNA 1U0NA 1Y9JA 3RROA 4C4RA 3TQTA 2PL9A 3PZ1A 4Y18A 1FPPA 4KACA 3PFFA 4Z9FA 4FXOA 3H9UA 1LGYA 3AEQB 1EXDA 2G1PA 3HB4X 2XIJA 1LJ8A 3CCFA 5AJTA 1BYUA 1U2RA 4QPPA 4FX2A 3AUSA 3U4HA 1TJYA 3VU0A 2ZR8A 2V58A 1N7JA 4J76A 2FRVA 1AGPA 5C8VA 3OBIA 3J5PA 3DOJA 1HO3A 3QPWA 2Q49A 3ZWNA 3LJ3A 2AW6A 3IB3A 4I46A 1QPBA 3FOBA 1IVNA 4BXOA 3I9V1 4ETNA 3FYDA 4I55B 4C0AC 4DX2A 1C3JA 4I4TB 2JHPA 4ALLA 4BNGA 1TU3A 1YR9A 3HXMA 4ESOA 1N7HA 3AQ4A 3KQWA 3R7LA 5JJBA 1E94E 4FR2A 5IVPA 3M9LA 1W59A 1PJSA 5DP1A 3LRPA 5GVRA 3HRIA 1JPLA 1WXQA 1VE9A 1SZJG 1KOLA 3G2NA 5DTRA 3N2ZB 3UFBA 1Q19A 4FQ8A 2XMGA 2YRXA 2O8BB 2CUTA 3I32A 3V9AA 4FINA 2VTBA 3THXB 3TWRA 1LDNA 2C9BA 5EDSA 2Y1OA 1LZKA 1TI7A 1IHGA 2LDXA 3MTQA 4O2LA 2J9RA 3RLFA 4YFVA 2VJNA 3ES9A 1RBQA 4NOLA 2ZBFA 1JG7A 5E6RB 4X3PA 1FFGA 2O50A 3ABSB 1ZJ6A 5BWCA 2XUIA 4C7VA 2J1LA 1WHTA 2PNFA 2R1ZA 3ND7A 5C51B 1T0JB 3N59A 3CJQA 3JQ7A 5F1KA 1XC7A 3RAUA 3FUHA 1M5RA 3S8YA 4LVOA 2CLSA 3ZZMA 4N0QA 1QTIA 4J0DA 2JFWA 3SR4A 1CBUA 1JKMA 1YBHA 3I04M 2JFOA 3WC4A 2QGNA 3OY2A 2PS3A 2ZBEA 4QOIA 1H5UA 1ZISA 2WAAA 4RFSA 1I2AA 2HSGA 3QU9A 5GV7A 2FEPA 3GO4A 1QGYA 2J33A 1JHAA 1D0IA 4MGYR 4EBAA 1ZM9A 1YT5A 1EK6A 3ZOZA 4LHVA 4E1BA 3KX2A 3TTTA 1UZAA 3NO4A 2DMRA 3TQRA 1BH6A 2PRIA 2DPHA 3CRMA 2JLZA 3JZDA 4HLCA 1LFAA 2NZJA 3N2NA 4KVFA 2C2OA 5DX1A 2ZR0A 4PGHA 4W5TA 3VQTA 4RK5A 4GLBA 2GRJA 4GS5A 2R751 3LUCA 3W9YA 4UHKA 4QM7A 2C57A 2FQXA 4I9UA 2PMWB 1FFYA 3EA4A 4BNIA 4DNQA 4EUEA 2GKOA 1O95D 1R0YA 2L6JA 1TLLA 4WW0A 3L6AA 3PNSA 5M04A 2YC4C 1P8AA 2PBLA 1TYDE 4FLBA 2XRMA 3L7LA 3U7FB 5AI6A 2X0EA 4R6WA 1WPXA 5J4KA 3PNYA 1HEUA 5F2EA 1J2UA 5KS2A 2ZB7A 3NLLA 5BVGB 2I3DA 2E3JA 2ZJ3A 1RAIA 1FL9A 3VDMA 5EZYA 3RE1A 2ZSBA 4TM7A 4IIHA 5LP6C 1RWKA 1CDOA 4UASA 1RWOA 1K1EA 1IONA 3H5AA 4Q16A 3I6ZA 1LQTA 5CNIA 1GAJA 3PE4A 5K0FA 1YRYE 4PZLA 1QIDA 2AH5A 4XOIA 1JQLB 1U9IC 1H66A 4HRAA 4DV3B 4PPFA 1XA3A 1VLQA 2NT4A 2ZBDA 4GRIA 3EF1A 1PI3A 3UHJA 4LNUB 5FBZA 3TLAA 5BOSB 5TMPA 4ZQIA 3WNZA 1Q3TA 2AJDA 2PCJA 5CLHA 2H2DA 1F17A 2CZGA 1SHJA 4O1OA 4YRIA 4IOMA 4W9NC 5I01A 4YMHA 4KE8A 3F3YA 3ZW8A 3ZE0B 1VE7A 1H4QA 4E5YA 4EY6A 5L3SB 4GE0A 3G2IA 2D1RA 1U6JA 4WLUA 2J48A 2WIKA 3D2AA 1E1NA 1A5ZA 3GVHA 4MW9A 3K2IA 2JK0A 2HM8A 2D1QA 2VHJA 4RIIA 2Q7OE 3NBAA 4BNLA 3I28A 3OMLA 4TSKA 1BE8A 2G77B 4A8JB 1U7DA 4OLJA 3H65A 3G2JA 4DS3A 1NU8A 3L8EA 1KMMA 4LV6A 1ODFA 3QXJA 1NXPA 1Z5UA 3UJDA 4EJSC 4Z8YA 4ME2A 4P0TA 3N9IA 4ILHB 4NVRA 2B0JA 1PFQA 3D2BA 4AUMA 2ZSJA 1V37A 5IJZA 1JHVA 3UUGA 1OXJA 1LW6E 3O93A 4RKWA 3EPJA 2KCKA 3P9RA 1XDBA 2HMTA 3E05A 4ZZ0A 1PS8A 4ZDWA 5CA1B 3O5AA 3EDOA 4OA8A 5KYXB 1C7EA 1KH2A 4UE2A 1RRGA 2IV2X 4WMLA 4U6QA 3WLTA 5BSTA 1KO8A 2E49A 1NURA 4W1QA 1I5EA 5LP6F 1E5TA 1C9NA 5J47A 4B45A 4LNAA 3WA7A 4Q9IA 3GYBA 4FOSA 4S1NA 4O3FA 4OIFA 1VBFA 2AZMA 1SBZA 1H5NA 5JPIA 1E77A 3EZ9A 1JDUA 3ZS9A 2H6GA 5J08A 1Z4IA 3DCIA 3HV0A 3HI4A 5KYTA 2XCCA 3LV8A 1L7QA 4I1UA 1SJ9A 1G55A 4XUGB 5F1PA 1UBFA 2A4KA 5AMXA 1CUIA 2DBRA 4LJRA 2NSDA 3HCNA 2OFWA 2I2AA 1VIAA 4KXYA 4KOEC 3LP8A 3ORSA 3S2FA 3D8SA 5FB3A 1KDPA 5ED4A 4R8RA 3K6SA 4OQPA 4HADA 1XVTA 4XLTA 3ZBTA 2NM0A 4KFRA 2QI9C 2FZGA 4C7XA 2QY9A 4G0UA 3TW8A 5L9AA 2YHEA 4JBXA 2ZXEA 3B2NA 1PQUA 2UYCA 1XMQB 2QTLA 3DE5X 5JZ9A 3HEMA 2WXLA 3LKVA 4GC5A 3CE6A 3O8BA 4XPIB 5LJIA 3ZU5A 2JJ2D 4OHMA 1F7UA 2ZLBA 2P90A 1TVMA 4UVGA 3VDRA 4EGAA 5KUTA