2VSYA

Xanthomonas campestris putative ogt (xcc0866), apostructure
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
547
structure length
547
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords XCC0866
total genus 208
structure length 547
sequence length 547
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsyA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsyA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsyA02
1Z8DA 4GPKA 3UYKA 5LQDA 3G2HA 3BEOA 3BCRA 4BQFA 5D01A 4Y6CA 4GA1A 5D0OD 2IEGA 3CEQA 4AMGA 1IXYA 2X0DA 1WW3A 4BWRA 3OKAA 3ASGA 2VCEA 2WQHA 5G05C 5CCMA 2AMVA 4ME2A 4U0UA 1ZU2A 4EKEA 2XA1A 3OTHA 4NC9A 4WNFA 3CUUA 3PDNA 2J9QA 1L5SA 2QN8A 1P2BA 1L5QA 1RZVA 1C50A 5G04C 4MHSA 4NESA 2Y4UA 3ZFWA 4AMBA 4JA9A 3CK7A 2DBAA 4KQ2A 4GCOA 3L7AA 4U07A 3QWVA 3R9AB 5IKPA 2KCVA 1UQTA 4B94A 3TOVA 3LY9A 2QLLA 1ELWA 4GPBA 3IEGA 3QWWA 4N3BA 2SKEA 1Y8MA 2LSVA 4HORA 2P6PA 1E96B 1XV5A 1GGNA 1GPAA 4N2QA 3C48A 3LKUA 4WNGA 3T3EA 4QLBA 3URZA 4WACA 5TMBA 6GPBA 1HLFA 3MRXA 4N2SA 1E1YA 5BNWA 4Y6WA 5JJTA 3D0QA 3WC4A 4RIHA 3Q3EA 5EX0A 1NZFA 3COPA 3UPVA 4CDRA 1XNFA 2XMPA 1FU8A 2BGUA 5TMDA 1LWNA 2LNIA 1K06A 2LSUA 2PQRA 1JG7A 1WAO1 3RT1A 2XGMA 1TJCA 5EX3A 3HBFA 5HI7A 3Q49B 2V5FA 3DD1A 1UZUA 3G2IA 5HXAA 3ASHA 3S27A 5GPBA 1C8LA 3G2NA 5FJYA 5DU2A 4GCNA 3OY2A 2QRMA 3RO2A 4MI3A 4X7PA 1FTYA 4CTNA 1AHPA 4G2VA 3TAXA 4G25A 4JL0A 4I1AA 4F9FA 3Q3IA 2YQ8A 3ULQA 4BT8A 4F96A 2AZDA 3ZCRA 3RKVA 1A17A 1XC7A 5IKOA 2JZCA 3WADA 3NPAA 2F3UA 4HOUA 3E3OA 3OY7A 4BQIA 2PYIA 3Q3HA 1YA0A 2VG8A 2L6JA 4RIFA 2FI7A 4EJ2A 2GT1A 3L7CA 1NLMA 3TSAA 1E4OA 3NB0A 2OOEA 1Z6QA 4RBNA 4UQZA 2VGXB 2I6HA 4XIFA 5G05J 4UQYA 4HOQA 5BW8C 2F3SA 3ZCQA 3MTAA 2PQNA 3CVNA 3L79A 1ZBPA 1JIXA 2FETA 2GPBA 2R4TA 3ZHEB 4UI9J 4M60A 2X6QA 4AY6A 3ZCTA 5JJ6A 4EQFA 4IN3B 1C8KA 4APOA 5G04J 4HLNA 3BD6A 4WNEA 4LEUA 2VYIA 3Q15A 3UQ3A 5FZQA 4U0ZA 3S7JA 4NRHB 3CK8A 1PC2A 3TGOA 3BD7A 5DXFA 5KJMA 3RIBA 4BTAA 5TMEA 4W9RA 3WAGA 3TG4A 3L01A 2X0EA 1Y8ZA 1XKXA 3G2KA 4GZ6A 4I17A 3MRTA 4MI6A 3Q5MA 4F97A 3D0RA 3OT5A 2ACVA 3BCSA 1C3JA 1P4JA 2XGOA 2QRHA 1NOJA 1L5WA 1PYGA 3FFLA 2ONDA 3AS5A 1NOKA 3S7DA 3MTBA 4F3VA 2QFCA 5BT1A 3D1JA 5FZSA 3MBOA 3T3DA 3NAZA 4J8DA 3SYMA 5KJKA 4CGWA 1PNVA 1KLXA 2QZSA 3RHZA 2C9ZA 5A7DB 1KTIA 3MEKA 1HXIA 4AM9A 1P2GA 2QRGA 3ZCUA 3RU0A 4X7MA 1JG6A 4W6QA 2XPIA 4GYOA 3U4TA 2KCKA 3OTIA 5FTPA 3O48A 3CKBA 2F9FA 2BUGA 2FFRA 2QN7A 3S29A 1EM6A 1P29A 2QLMA 1L6IA 3Q47B 3S7FA 3CV3A 4RG9A 2UWJG 3PE3A 3EDTB 4N5CA 3N71A 2QN1A 5DBKA 4FKZA 4O6FA 3C4VA 3NCHA 4LDPA 4CGVA 4LEIA 4Z5XA 2SKDA 4BFCA 3IAAA 2VGXA 2XCUA 1M5RA 3T3GA 1HH8A 3CEJA 3ZHEA 3IA7A 4CTMA 2KCLA 2Q7FA 2AV6A 2GEKA 2AW3A 1NA0A 3E4BA 4BTBA 2FF4A 4G24A 4GA0A 4XI9A 1PN3A 3UUXA 2QRPA 4X6LA 2R4UA 1NOIA 5FT9A 5ARGA 1L5RA 3K9IA 4N9WA 4RIEA 3LY8A 2IYFA 3G2JA 2XCIA 2OFFA 2VCHA 2GPNA 3G2LA 4NEQA 1XL1A 1O6CA 2R5SA 3NP7A 2VQ2A 2YHCA 3Q4AB 2P58C 3OXFA 2BGTA 3ZPJA 2PRIA 3S2UA 5JTUA 1IYGA 4KYOB 1FS4A 4WNDA 3TG5A 4YI5A 2IFUA 5HQ8A 1FTQA 5EKQD 2XA9A 2FBNA 3PE4A 3L7DA 3RO3A 4H7YA 3LCAA 3CUTA 4RENA 2GW1A 4KBQA 3GUHA 2KC7A 3ZCSA 3CVLA 2UY1B 2ACWA 2QRQA 4EKYA 4AIFA 1GPYA 1Y6FA 5C1DA 3VDMA 3LYAA 4G2TA 1NZNA 5A6CA 1IIRA 3S28A 4J8EA 1IHGA 3MSCA 3MQFA 4YNDA 4G26A 3LY7A 3ASFA 4KQ1A 2F3PA 1WM5A 3VTYA 2C1ZA 3GZ2A 4MICA 4ABNA 2H1FA 3ASDA 3GYZA 2IYAA 5M72A 2AVPA 4GZ3A 2Q6VA 3H4TA 2VSYA 5LCWJ 3EBPA 4GYYA 1A8IA 1SXQA 2PZIA 3QKYA 1HZ4A 4G23A 3T7DA 3BCUA 5KJNA 3VUEA 1QZ2A 2C2LA 3KD7A 3KS2A 2FEZA 1UQUA 3FWVA 1KT1A 5KJLA 2SKCA 2X6RA 2KS6A 1FTWA 1W3BA 2MHKA 3CVQA 3HBJA 2VGYA 3NC4A 3MS2A 3MA5A 1QM5A 3ZCVA 2QN2A 5JJ7A 3RSZA 1JEJA 3CEHA 1V4VA 1YA6A 1L7XA 4HOSA 3LPZA 2PQ6A 5ENZA 3CKCA 1L5VA 1WV1A 2GJ4A 1QQEA 1OUVA 1J39A 1H5UA 4GYWA 3NF1A 3NP9A 1GFZA 1GPBA 2QNBA 5CCLA 3AS4A 3DZCA 3MS7A 3MV2B 3RJVA 1P4GA 3CUYA 4X7RA 8GPBA 4MRAA 2QN3A 1P5QA 3MRVA 3MV3B 3T5TA 2HR2A 3QKWA 3DDWA 2G9QA 1NA3A 4I9CA 3HBNA 2XGSA 2IF4A 3BD8A 3BDAA 3FROA 1SXPA 2R68A 4A1SA 5AYWD 3ZCPA 2FO7A 2YJNA 3VDNB 4YUAA 4L22A 3AS8A 4G1TA 2QLNA 4WADA 2ECPA 4CTOA 1AXRA 1B89A 1FCHA 1PSWA 5CHEE 3SYRA 4KXKB 1FA9A 1Z6PA 3OXLA 1RRVA 2GPAA 2QN9A 2IUYA 1JIVA 4N3CA 3CX4A 2G9VA 4M7PA 1WUYA 1FC0A 1ELRA 3EBOA 2KATA 2UY1A 1F0KA 3ZGQA 3JYSA 4YVQC 3WXXA 2PRJA 4UI9C 4N3AA 3S7BA 3AMVA 3E3LA 4BT9A 2WTXA 2FF5A 2GEJA 5TVGA 2BISA 4KQMA 4UQXA 4U0SA 1LWOA 4M83A 5D00A 3MS4A 5LCWC 3CEMA 3OTGA 4PQGA 3HYMB 4GA2A 2XCCA 3MTDA 1GG8A 1NZDA 2ASVA 1XL0A 2X0FA 1WW2A 3CK9A 1B4DA 3H4IA 4H7XA 4U04A 2IW1A 9GPBA 2GM9A 2PYDA 2G9RA 1P2DA 4RELA 5I45A 4MI9A 2C1XA 3T3HA 2JJMA 4J8FA 1FU4A 2WPVA 2R60A 4FZRA 2F3QA 3MT9A 2BFWA 4XI0A 2IEIA 4AY5A 3ESKA 1YGPA 4HWGA 1RZUA 2HY7A 3L7BA 3OKCA 3CVPA 1NVKA 3QDNA 3UYLA 3MT8A 4NQ0A 3QHPA 1K08A 5DIZA 4RIGA 4HOTA 2E2EA 3QOUA 4WHMA 3U3WA 3C4QA 1KT0A 4GZ5A 4JA7A 3BEEA 2IV7A 3KAEA 1VGVA 3CUWA 3OKPA 4REMA 1Y6GA 4I2ZA 4RIIA 2C0LA 1F6DA 5DLDA 3GZ1A 3SF4A 4I9EA 2XA2A 1FU7A 2VSNA 2O6LA 4N39A 4I2WA 2C4MA 4J0UA 2XEVA 1P4HA 2HYZA 3MKRA 3GPBA 3QWPA 7GPBA 1JIUA 3CV0A 2IV3A 3SZ7A 5JTTA 1XOIA 3HBMA 5D0QD 3MT7A 1QKJA 3FP3A 2PL2A 3VUFA 3E3NA 2JLBA 2XCBA 4YVOA 2HO1A 2NC9A 3GW4A 1GZ5A 3CUVA 3DDSA 4MHOA 4UI9K 4WUYA 2G9UA 3OXGA 3VTXA 2ATIA 2Y4TA 1EXVA 2C0MA 1WUTA 1WV0A 4YI3A 2R66A 2H1HA 3RSCA 4RG6A 3O3CA 3T3IA 4JHRA 4AN4A 4EL5A 2ZB2A 4BQEA 1ABBA 3ZN3A 1Z62A 3S0JA 5FZRA 4EL0A 5ARFA 1BX3A
chains in the Genus database with same CATH superfamily
2A5EA 4LWOA 3DMTC 1Y80A 1D4ZA 4UAGA 3EGIA 5FCDA 3J81A 3A3PA 1MRSA 4BQFA 1AF4A 2W90A 4LZOA 4JC5A 4UBOA 4B1FA 1AB5A 3U4CA 1G5RA 2E5LB 4IFBA 4X1KB 4JYMA 4M1ZA 1SUIA 2C2KA 5ALZA 4RACA 3QOYA 4BNJA 3HNPA 5BQ3A 1MQ8B 1H22A 1NVVR 3OU2A 4RDCA 1B2LA 1Y9AA 2PWAA 3A26A 4GP9A 4CLDA 5I5EA 2IY8A 4DKJA 2NU6B 3K0HA 2GN2A 1HDOA 2AKAB 2ZS8A 1DJNA 4HNAB 4WNFA 1H9BA 2V3WA 2AHRA 3E6AA 3OZGA 2ZXWE 4I55F 1U7WA 2WXJA 2Y3AA 4MB2A 4FQ7A 4O2BB 1V96A 3QY9A 2B8TA 2CLMB 4P4NA 4KXLA 1SVUA 4DR5B 3ASZA 2PU7A 5DE3A 3NOVA 3L8YA 4QPJC 3KZMA 2J6CA 3GUCA 4MHSA 3V7UA 1UP4A 2QLJA 2X7XA 3TZEA 4IMJB 5FI3A 3EG9B 1Y3CE 3MA0A 4EDHA 5KREA 1HE8A 2Q3EA 3ZNGA 1OPXA 2JKYA 4TTQA 3QPVA 3VR6D 2V7EA 3NH9A 4BQQA 3K1AB 3L7AA 4KT6B 1RM5A 1MV5A 3HADA 2CVQA 4EAAA 1JWAB 2V96A 1FXWF 3NDBB 5HJ2A 4S05A 4U8YD 5JVDF 1NPTO 3CO5A 5JSQA 2YN0A 3AOGA 4QGGA 1LLQA 3QV2A 4MH0R 3TS1A 4CLXA 1U3UA 1XAJA 3NYRA 4B94A 3PGKA 1C9NA 3TOVA 4IQ8A 2YWXA 4UXIA 3D64A 2B1QA 4MWOA 3CT6A 3CW8X 3IEIA 3JYNA 3BFVA 3TZ6A 5LQAA 3RYFA 1W34A 3TL3A 2DB3A 2VXOA 1GPLA 4MRMA 3OAAD 4LC1A 2IX9A 1XTKA 3IQIX 4DAEA 1KJNA 3OWXA 4JSRA 4PS8A 3D6NB 1GGNA 3A1FA 2GGSA 1SUEA 1XHFA 2GROB 4YDQA 3RAEC 2IXGA 3BRSA 3UWPA 2Q7OE 4M0DA 3B85A 5TMBA 3D43A 5CPBA 1BHJA 3UICA 4BJHB 1Q7GA 4DJDC 1WB9A 2XXAA 1C0IA 5B58C 1U2GC 3EXAA 1AF7A 2BEKA 2C83A 1SEPA 1HG1A 1M2VB 5AJTA 3TDKA 3QVOA 2DUNA 2I8CA 5HF9A 3RFTA 3SE0A 1KMMA 1RQRA 2II6A 3HR8A 2OCGA 3JQFA 2AC2A 1R9GA 3LRXA 3UM9A 1OX4B 4BEBA 1I7LA 3LP8A 3QU4A 1E1RD 5AIJA 4Q4HA 4FJ2A 4KLAA 1XBTA 3T7IA 1LPOA 1NW3A 3AOEC 1DCQA 2J1LA 2ZJBA 2N1BA 3DJYA 1XVTA 3D6TB 2GCNA 3FVQA 3H4MA 3N86A 1JG7A 2F90A 2VDLB 3HM2A 1JQAA 3L1IA 4UE6A 2FWBA 3F7OA 4PS7A 3PRHA 3WQRA 9ATCA 2ZZMA 2NP7A 4HLUC 2C04A 4OLHA 4WX2B 3R9IA 4X45A 2JJYA 2FN7A 3WDSA 3TK1A 4DPKA 2J3JA 5JMND 1M6VA 1RRPA 5F23A 2FE4A 2R86A 1J8DA 3WO0A 1AK2A 2W4MA 5A3SA 4NIKA 1UZNA 1GPMA 3E82A 3G2NA 4FZVA 3I2FA 4JJEA 4IICA 2H7CA 3EUVA 1D0VA 1VZ3A 4C4RA 4KO2S 4A0SA 2WF6A 5FOXA 4G4SP 1GKUB 1BOOA 4F5DA 4V02A 1G20A 1UJCA 4G56A 1YZHA 5EIAA 3BSFA 4XQCA 5E38A 1YXMA 3IEUA 3BXGA 4QQFA 5AKKA 3SJBA 1ZUIA 5JCXA 3STWA 4JEMA 4QTYA 2QTMA 3QKSB 4GG1A 4EP1A 4PCAA 1MVLA 3QPBA 2YQ8A 2FULA 1RYBA 1QG2A 4HGNA 3T0FA 2HNKA 4JR1A 4FN5A 2G1UA 4YASA 3WGJA 3A6FA 3FN4A 3TOCA 4F21A 4KVOA 1MEJA 1G8PA 1T3HA 2F3UA 2VWPA 4JL5A 5BV1A 3D9HA 1EVIA 2Q4RA 4P29A 3GOHA 3ILXA 3W9FA 3W1WA 2FI7A 1YBHA 1D2EA 2JB9A 4EKNB 4HXFB 2WA1A 2IWHA 4B89A 3ZGYA 2NN3C 1Z6QA 4MW2A 2XZTG 4BQNA 2HRRA 1U2TA 3HG7A 4FGWA 5CNMA 4LBVA 1OIVA 5BMVA 1TYDE 1XTTA 1Y37A 2BKLA 2DQ4A 2RC5A 1HL7A 3ZRHA 1XCJA 2VI5A 3DFKA 5G0WA 4KDFA 4QTZA 1U8EA 5FTNA 1U8XX 4BLSA 2X6QA 2GEBA 2WXPA 2G9NA 1UBTS 3IMEA 3ZWPA 4HRAA 1OFHA 1PL0A 3V4LA 1IOLA 5H3CA 1W5SA 2VZ0A 3PG5A 1SZPA 3BD6A 5HMLA 4EPXA 2IOFA 1RKBA 1U0TA 3HXEA 2QPTA 4MVJI 1Y8RA 2R751 3D5QA 3ECAA 1M9NA 3QXXA 4LJ6A 2BJWA 1OMOA 5DK6A 2BGRA 3CF4G 2WE7A 4Y6QA 2ZPAA 1FP6A 3B7TA 3TGOA 2W2MA 1I2AA 1F8XA 2P2CA 4RDXA 1JSLA 2B8EA 2V58A 4BLOA 3OPYI 1V8ZA 1ORDA 2IOQA 1QNFA 4WOPA 3OSZA 2K4MA 3N6VA 4OSPA 1CV2A 1KI1A 3G2KA 3PDWA 4JT2A 1ZK3A 3A1WA 1K9SA 4ZK6A 1ULTA 1F6WA 1KH1A 1NNUA 2FK7A 3IAM6 4GOKA 5HMMA 1HBJA 4F97A 1IBMB 4ZQHA 5JO0A 4KLRA 2NT3A 3GT7A 4QYWA 1QTQA 4U8VD 1KJIA 4F86A 3E84A 3AS5A 3EEQA 3QKRA 4Y6OA 4C7KA 1YDMA 3MWJA 4BO1A 2VJMA 3K70C 4O8ZA 3DMRA 4ZHQB 3N6RA 3WA7A 2GD6A 3PFGA 4K87A 3CR7A 3DKVA 1VJ0A 2JBWA 1WCV1 4NPCA 3C1TA 3PZ1A 3JQAD 3W3AA 1P3Y1 5GOTA 3RRBA 2G5TA 3BA1A 3CMCO 3TXXA 3ZEFA 4C48B 4AS1A 3FTWA 1Y4ZA 5FFFA 5P21A 1HXIA 1P0FA 2PQ2A 3G23A 2CXHA 1PSDA 4C78A 4ARCA 1XTBA 2ZPTX 1C0LA 3R6GA 4MUXA 4MWTA 3TKYA 1N4QA 1XI2A 5DLEA 4GMJA 4PC7A 5ICFA 3OM9A 1E9BA 3O48A 3AESB 3R3WA 5GGYA 3WBFA 1XTZA 4G3XA 4JENA 3OI7A 4L7QA 5EMHA 4EUKA 3UKOA 2CNBA 4QG3A 1FUYB 3LPAA 2Q8QA 4DJ5X 3PUJA 1PGPA 3LV8A 3MFQA 2WDPA 4Z0PA 1WA5A 2YBDA 4RVFA 3ZJUA 2QW8A 3NJ8A 5EN4A 4AMVA 3OO0A 5CRIA 4OJNA 5A06A 4BJ6A 2HHAA 2WT9A 2H1OA 5JQWA 1GQOA 1SQGA 4O4LF 1K63A 2UWJG 3TNJA 2GVNA 4DVGA 3OIGA 3ROMA 2OT3B 2R6HA 3UC5A 1E5XA 3HP4A 3M6LA 4U02A 2B8JA 2XT6A 3B5EA 1Y63A 1U1EA 4PFJA 4XXHA 3T7AA 1NQXA 2OGWA 3AERB 3U80A 4IDEA 5JXWA 2OZLA 2NPOA 5FR1A 4OU4A 1L7OA 4K5CA 2A1TR 1BQ4A 2KM1A 2O2ZA 1KDTA 4IZOA 1EZ1A 4TTTS 1OXXK 4EMUA 1IC6A 2CLEB 4A1GA 1C80A 1ZXXA 1HH8A 1GGMA 1W2WB 2J5QA 1SVLA 2Q2VA 3CEJA 4MVJP 1JL3A 4RPCA 4TSFD 4CL8A 1GV0A 2CT8A 1G8HA 4ZVSA 2AV6A 2HBQA 2Q4DA 1RCUA 3TB6A 5DISB 1I8TA 3NMUF 2MDTA 2FU5C 3DVAA 1VL5A 1XTVA 4NJMB 4JIMA 2UXCB 1ZKDA 4JVMA 4URHA 1MVOA 3AY0A 4URYR 5ARGA 5DBGA 4CM8A 1T9DA 3CU5A 1C5KA 2ZVQX 2ONZA 2FB9A 3ZUGA 1NY6A 3G2LA 5EINA 2ZWOA 3IHTA 4NJMA 3FLMA 1ADCA 4Y7DA 3KOZA 2W5UA 3HG0D 4CKWA 4YJGB 4B46A 3I1FA 1KFEB 1BHQ1 2ZYWX 1W75A 3QG1A 4HGQA 4CMCA 4RTNA 3Q2OA 4XR9A 1Z34A 1G5FA 1LD3A 3TE7A 3U4GA 2R05A 3JD3A 3H3FA 3CUKA 1JDTA 1IYGA 3EIJA 1A50B 3UT4A 2AZTA 2NTEA 1ZM7A 1Z2DA 2M98A 4O6VA 4A16A 3I76A 4RPIA 1UBMS 2IZ7A 3H9CA 4J94A 2D5BA 3AF4A 1VXRA 5IVIA 3NASA 1G5QA 4COKA 4DSOA 3DOOA 1B41A 3TEFA 3EYAA 1KY3A 3W5AA 3TR6A 2JA2A 2O5EA 1TU3A 2W6ZA 1GGHA 2WZDA 4QSMA 4TT3D 3TLXA 3BBLA 1P74A 4ZI7F 4RDHA 3DW1X 4Q3NA 4U7HA 1EYHA 4CEIA 1D2RA 3LLVA 4GM0A 1LSOA 5A03A 1X38A 3HJBA 2X22A 3ONEA 3JAMA 2HUPA 3F98A 4YAUA 3N7AA 2Y1XA 2AMJA 5M5BA 1DC5A 1KZ7B 4RFVA 3K70D 2MTBA 4OAQA 4LOAA 3BIFA 2FR0A 3TL6A 3D2LA 5ALGA 3L93A 4LDZA 1TYEB 1P1FA 4Y0VA 4F4IA 3GZ2A 2E0IA 1DCEA 3ZY2A 4CKZA 1GR0A 3X1XA 4P5PA 4YDYA 2GM5A 3E7XA 3N8IA 3RYCA 1OUMA 2J09A 1KR5A 2AVPA 4HVTA 4JQCA 4ZP1A 3A6EA 3RS5A 4YC7A 3WRYC 1QRDA 3DVSX 1TM5E 1HZ4A 5G2NA 3T7DA 3AEKB 2DBYA 1NSTA 1NUSA 1V25A 2EX0A 3MHPA 1EP1B 1NI5A 1W88A 4YV1A 1C2YA 1B6GA 3JSAA 3GPCA 5BW8A 5IK2A 3PEYA 3KEZA 1OFUX 1FUIA 2RK6A 2AQIA 1KT1A 5K51A 1ZQ9A 1E2EA 4FI3F 2LR0A 4OH1A 2VDKB 2KS6A 2TMYA 1HDGO 3OLCX 1DRVA 2YYAA 2MHKA 4P92A 1U3VA 4XGRA 1AKQA 1N7GA 1F0PA 1VHLA 2QVYX 3G2OA 3REFA 4D7AA 1I7NA 4MUNA 1PS9A 1YR2A 3CSSA 1DKPA 3G8AA 3OCXA 1BXGB 1CB0A 1S96A 5KNDH 2IY9A 5JHBA 1YZGA 3HB9A 3ZOKA 2XLBA 3E48A 2ID4A 3VH4A 2P9LG 4AZSA 2BRUA 3ANYB 3VC2A 3AG1E 2WG1A 3GVHA 3MTEA 3R1IA 3DLBA 2AXUA 3DZCA 3OD5A 3LC2O 3TMKA 5ES3A 3K6SA 3OEWA 4HSGA 3QP9A 3DDNA 2FMIA 2E4UA 1IZ9A 2WB4A 1OILA 3U4HA 2HU8A 2XAAA 2HGSA 3BTOA 1QIEA 4AJEA 2AB0A 2LUHA 2CHZA 1QDUA 3F6YA 5THQA 3RLIA 3NHLA 4FKMA 2QP4A 3HEMA 1IK6A 3HNOA 3VHLB 4DHWA 1SXPA 1WZEA 1M34A 1WSAA 2C78A 2I6TA 1YB5A 3RHTA 5LLDA 4CEHA 4I3FA 2QD2A 3B7UX 1JFFA 1IHUA 3U3KA 1Q0PA 4L22A 4JQYA 1Q3TA 1V45E 2V5QC 3NZUA 3L6EA 4XQGA 4Y98A 4F85A 4M1QA 1D9XA 1XWFA 2ZUBA 2IA5A 2ZYUX 3GO4A 1Q91A 2Z2KA 2YHIA 3N8HA 4H7HA 5AI6A 1ZJ6A 2IP2A 1S02A 1OQAA 2J3KA 1DKRA 2AG8A 1HLDA 2VBCA 2Y27A 2WF5A 3IP9A 3L1JA 4I5IA 1N8NA 5AN8A 2HLDD 3E1SA 3G5AA 1TCUA 3PZBA 4JD5A 1YK1A 3MWFA 2ZRHA 1R88A 3PHCA 2ZWVA 3I3SR 4R5HA 2OXIA 4AJJA 4DCGA 2XYQA 3JAKA 4ZCPA 2WXOA 5AXAA 2KLHA 2IHVA 1MO4A 4JS0A 4JT8A 3VR0A 4L72A 3BSSA 3GXOA 3L13A 3PQ5A 5HWSA 4JHXA 1IONA 1CEQA 1CG6A 2BLNA 4G0NA 2HHCA 4D0GA 4DWWA 2NV2B 1MT3A 3MWYW 4UQXA 2OQRA 1E3SA 3MS4A 4MYRA 2R6DA 3D3KA 3G2MA 5H0IA 2V6JA 3ZH9B 5TIIA 2IC5A 3GXBA 1K88A 4H59A 4UULA 1INZA 2PD6A 1QK3A 2YY5A 2HWWA 3BGVA 4MZDA 2X0FA 2NQ2C 3X3HA 1GZHB 5JROA 2C61A 1QE0A 3ASUA 4HQ0A 4RF3A 3ZXSA 1VL6A 1GUDA 2EG9A 4UVDA 2AVDA 1IEQA 4BVJA 3I2YX 2VJCA 1QBGA 4N5MA 1SHJA 4BJ1A 2JLVA 2AX3A 2ARKA 3K8QA 4AO8A 3WYNA 2XZDG 1P80A 3DSXA 3GLKA 4MRSA 3FEXA 1J5PA 1U0NA 3FVRA 4LF8B 4DUPA 2FRXA 2WEKA 1MN6A 1ZVKA 4ZYTA 4LDQA 3GJTA 2DY1A 3H19A 3Q2IA 1MX1A 4GOLD 3T6KA 1WJGA 4PVDA 4C7BA 5GIOE 1RWBA 1RQNA 4F6RD 1P5JA 3RUAA 3V8BA 1HTBA 3LGSA 3VH2A 3G2TA 2WIGA 5IPFA 3ANMA 3BSWA 3LZ6A 5JSYA 4FYIA 3LM8A 3NBKA 3CZ4A 4DMMA 2NIPA 3D0OA 4QE3A 3LLSA 5LZ8A 4XTRA 4ON9A 1GU0A 1GCAA 3UJ9A 3FPKA 2XENA 5GONA 4EPTA 1JYSA 4O5AA 3ULKA 2B34A 3BM5A 3LX5A 2Y6VA 4DJEC 5KWIA 1P4HA 1QKKA 2HRCA 4L9WA 3P9IA 3PUWA 4W1RA 5FQOA 4BU1A 2HU5A 4R1QA 3MZLB 1ZNXA 3AF5A 1YRHA 1WXXA 4P36A 3DMYA 3PA6A 1RAFA 3PXUA 4L2YA 1DC2A 1D2CA 4KAXA 1DUVG 3VJRA 3KSQA 5A2QA 4K03A 1DEXA 1D5CA 3OBIA 1E59A 2G0NA 2P69A 2Q0HA 4KFRA 2Z56A 4V0KA 4AI6A 3PJDA 3V1UA 3DL0A 3F8WA 1NE7A 3VQTA 3MXTA 2EOAA 1SCKA 2JFBA 4NCXA 1R4MA 4FR5A 4HUQB 4Z4EA 4ILIA 3ND6A 3CKMA 5AKHA 3P9XA 1J0DA 5KTTA 4S0ZA 3ROZA 2VP2A 3ZS8A 1NMEA 2VUUA 1F60A 3PKIA 3R8CA 3ML1A 5IT5A 2CXPA 2BELA 2GDJA 4P7KA 3JQRA 1SXGA 3D4NA 4XJSA 2HK7A 4UM9D 3T5DA 3AEZA 2D0OB 1WHTB 2IOYA 3BA6A 3HWWA 3ISVA 4OBWA 4CQJA 4EAQA 4PINA 4DZTA 3ZHZA 2Q4BA 4K6HA 2R00A 1L8XA 3ZE6A 3V30A 2Q49A 3QELB 1R9JA 5D01A 4BFUA 4ZICA 1DBVO 5H81A 4EYGA 4AULA 4QYXA 4RSYA 5IN4A 2A1UB 5KNDA 2VHYA 1BU5A 1RYFA 2DT8A 1E1NA 2X0DA 2OAEA 2CDRA 2FZWA 3LRPA 5K7SA 5K45A 5CCMA 2GXUA 2VTEA 4NZ9A 4W9NC 4QFMA 3AHGA 3A2LA 2GPYA 1AQ6A 5CRUA 4GTOA 4RZQA 3QPAA 2PUDA 2ZQ5A 3KJFA 4DYVA 1DCTA 4OI1A 3GUYA 5JS7A 2ZUEA 1GO2A 2J0VA 2LW7A 3AYZB 4RTLA 1SNYA 3CNQS 4R7GA 4M88A 1PLKA 4IDAA 1PBNA 1NTOA 4JLDA 5A9RA 1F20A 3PLRA 1ZW6A 2OILA 4AMBA 3VNBA 4JA9A 4EHJA 4ESHA 2J0UB 5E75A 4MUYA 1JEYB 3IQFA 2RI0A 5G41A 3SC4A 1N57A 5ALUA 1Z6XA 5HIKA 3FGZA 4CT4A 1EAYA 4IMPA 3WLOA 4Q19A 1MYOA 2O2XA 2NT4A 4NZYA 4F1WA 5JYDA 2BTDA 1ANKA 1RRFA 3ICCA 4DIEA 2Y1WA 4CV0A 1OXKB 2CHFA 4R69A 4QTXA 1V1JA 2YOHA 2YZGA 3HUEA 5ECDA 3DEHA 5F78A 5B1SA 3ZKAA 1QIHA 5FWQA 1SOAA 3MKQB 2JEYA 3C5WP 4BVFA 3UTDA 4IIBA 1SURA 1B8PA 3UANA 3M82A 3KS9A 3OFJA 3CXRA 5DOZA 5REQA 1KP9A 4GNRA 3SMQA 3UK2A 4S12A 1XP5A 1VFNA 4OHRA 2GASA 4ZT5A 3SC3A 3EG5A 5EFZA 4C01A 4QDJA 5ER6A 2W2LD 3PCRB 5DNAA 4Y2XA 2VP0A 1HQYE 4Q3KA 2HYIC 1P3JA 1GTSA 4K5QA 3C7DB 4L75A 4HB4A 2LXLA 4ZZ2A 1I0IA 3SS8A 2PLNA 3CO0S 4OI2A 4XH9B 3E70C 4HEJA 4M0KA 2XMZA 5G0VA 1QGDA 3NEAA 3UNXA 2IU3A 3GD5A 5LQNA 2AWNA 3OFNA 3PICA 2QA5A 3FOEC 3BH6A 1KDYA 2RFMA 3EU5A 1A76A 2VUTA 3A6LA 3DZBA 4NMHA 4O4HF 3RF6A 2BKVA 4RCZA 1XNFA 2PZLA 1VHQA 2O59A 1VHTA 3E15A 3K0CA 4RE5A 3APDA 1KPSB 1HEUA 2DP4E 2C8LA 2I03A 2WMNB 3PNOA 4N40A 5HM8A 3ZYKA 4DDUA 4I1VA 2WM9A 1SIUA 2I1VB 4JI5B 1QU2A 1BLXB 1BS1A 1U0FA 5AW7A 3WLIA 1YZVA 2CWDA 1EVJA 3UJCA 4H6WA 4BOYA 1DXYA 4Y6GB 3A7DA 4RQIA 3AJDA 5KU7A 1CERA 2FW8A 4E5SA 3HVIA 5E4JA 5L3QA 3LX4A 1CJKC 2ZKLA 2IOSA 2XYVA 3OY2A 4ZYLA 3G8BA 3ADBA 3E35A 3Q9UA 2BR3A 5EUBA 4BAGA 3DLAA 1Q14A 2E7ZA 4JR2A 4LYHA 3RYHA 2FUEA 4IZHA 1WMAA 1Y1PA 3GT0A 4MCAA 1QFYA 1XPOA 5A4FS 3HVRA 2IYUA 3K8OE 4OXRA 4I1AA 4LOJA 5KNBA 4JR0A 4F9FA 1HLGA 3W90A 2VP6A 2FDRA 1RRMA 4YIHA 1O58A 3BTUA 3C1UA 3QNUA 3INTA 5B6PA 2ZRFA 2X5JO 3ZU3A 4EK9A 1QTRA 4OP3A 4GGPA 4U7JA 4DA9A 1NYQA 3JQAB 1OW3B 3AXTA 2MU1A 2YWFA 1C7RA 2DBVO 4DDVA 1GWNA 3PC4A 4LVUA 4PO3X 4GZDA 4H0CA 1BW9B 4BX9A 3PITA 1C4WA 2DIWA 5JYEA 1HR0B 5B1AE 1KOFA 4E11A 4CIWA 3KEAA 3TXNA 1KP2A 1NXOA 1YJBA 2B5OA 3NB0A 1PV2A 3U81A 3R9WA 2NTVA 2FW0A 2YYSA 1NN3A 3HJRA 3KR2A 1P7PA 3DE2X 3UWKA 3ZCQA 3GRYA 4E5KA 4L9PA 1FW8A 2XUFA 3O8OB 4LCJA 4U9UA 5C1OA 1MHTA 4O8CA 1GIAA 5DHTA 5ALLA 3S99A 3IB3A 1XMXA 4MYUA 4OUDB 4UM8B 4PU0A 4QATA 3DAOA 1MJ5A 1O95A 1G9SA 3EXHB 3KZKA 2RKBA 2A84A 2P5YA 1JHYA 2CHGA 2R00C 2MINA 2FZ4A 3GFSA 4LHEA 1U6IA 4RVNA 1YFKA 3N5CA 4I9FA 4I9HA 2CUZA 5AHWA 1F14A 1Z3YA 3BMOB 1NT2A 1TAQA 4DCTA 3ESCA 4P5EA 3KE9A 1KYWA 1NGSA 4DUGD 3O03A 1YULA 5CGZA 1IZ0A 3L46A 1E7QA 1VGQA 4JLPA 1IWPB 3G02A 5B30A 3KOXA 5JEEA 2CL6X 4TKVA 2ZRAA 4BTAA 4JJIA 2DUMA 3QX8A 4MKXA 3U26A 5CURA 4OYSA 4BZZA 1Y8ZA 2Q6KA 1FLAA 3W2IA 4I17A 1CW2B 1HG0A 3QKTA 1K5PA 4UU1A 3PUYA 5I7RA 4RTJA 3F73A 3TCXB 1N4PA 1SVXA 5BVHA 3NBMA 5ARCA 3TZKA 3DS8A 4TTSA 2F1KA 2RIRA 1GZVA 3WY9A 2ZAYA 4D25A 3MTBA 3TLGB 3IEVA 3UTMA 4F3VA 5B5SA 3EHEA 1X15A 4MVJF 1X87A 1PGJA 3AIMA 4BUZA 1ABFA 2GS9A 1NSFA 3A27A 5DV9A 5JXGA 3BK1A 3NT4A 4ZQFA 1WD7A 3WSWA 5EKXA 1G55A 3P9KA 1B3RA 3A37A 3ZJ5A 1KLXA 5AI0A 1SZDA 3MWEA 5A7DB 2GM4A 2A5LA 1G20E 1KJWA 1T5SA 1A7UA 1P2GA 3AR9A 4BE4A 5BV7A 1UPXA 1BWSA 2VDVE 2W42A 2AUMA 3IX7A 4X7MA 3OCYA 5EWLB 2WINI 3LBYA 3Q4GA 5CIWA 3AG2E 1JLKA 2D59A 2RBEA 1R5BA 2GJSA 3OTIA 2C7RA 1DV1A 3OFSA 3KB1A 3RHSA 4P81A 5T64A 3T1NA 3U1TA 2DOKA 1AS0A 1E4EA 4TV9B 3RV3A 1A8SA 4BNZA 2YVUA 1U3WA 3Q1KA 3F8TA 3HACA 5J2TF 1RJGA 1IEVA 1NXXA 1TUGA 4NBLA 3NG1A 1DU4A 4J2OA 1O4VA 3BMOA 3CZQA 9MHTA 5FLYA 2GZMA 3FR8A 1H9AA 3A0UA 4KUEA 3M0EA 1JXOA 2HRZA 4FWBA 4D4GA 2IPAB 4DREA 3KCQA 1UQRA 1UXOA 2UYCA 3WWOA 1KYYA 4NCKA 1OZAA 4JBXA 3FHCB 1QQ7A 2AR0A 2PH1A 2Q3FA 3PS9A 2G63A 2FQWA 3JRNA 1NDQA 2R6FA 3FNFA 4FNAA 3TW0A 4YCCA 2G7ZA 2HUNA 2IDJA 4P31A 3W3ZB 3W4JA 1SUFA 5FADA 4AROA 1TYAE 3H5OA 3PEEA 3WWPA 2LCQA 1QIDA 2JA1A 1QYVA 1CY7A 2B78A 4MWZA 1Y6RA 2LTAA 4N0MA 2X7JA 5FIOA 3Q7SA 1STOA 3JCKC 1L5RA 2CNNA 2QLFA 3HYCA 2CNOA 3HV0A 3T34A 2IHNA 1NVMB 3K71B 5TGDA 4J6IA 4AX4A 4FC7A 2VOEA 3O8QA 1CDEA 4UTNA 3OJXA 1A7KA 5T67A 1VE5A 3OXFA 4KQKA 2O2SA 6ADHA 4EYOA 2XQGA 5I51A 1T1RA 2EVWX 4CETA 3WKCA 1R0BA 5DO9A 1ZIYA 5LYJB 3KYIB 1SHUX 1HRDA 3VR1A 1YJAA 5C37A 2X6IA 2MR5A 2J46A 2PMFA 2Q0SA 2R79A 4AQYB 1R0WA 3GFRA 8ADHA 1UJ5A 1EEXB 4Q02A 3PE4A 2BFOA 3RO3A 3BG0B 2QW0X 2GW1A 1KORA 1N5MA 4FQ5A 5AJXA 5DLQC 3ID6C 2Z0MA 2GXSA 3GRZA 5TY0A 2ODWA 4MKRA 2Z30A 4IIYA 1M5TA 3R7RA 1JKMA 1I3CA 1Q50A 4X93A 3GRVA 1K2VN 1Z45A 1R15A 2Q3DA 4RVGA 3WFZA 4DLNA 2M6SA 3RDPA 5KHOC 1A9ZA 4B6FA 4C7OA 1A9TA 3I83A 4LQ4A 3ASFA 4NDAA 5T5QA 4BBPA 1NUTA 3TW6A 3G1WA 3MWDA 5AKLA 4KAJA 2PS3A 3UQYS 3JYPA 1YBMA 3GAAA 1AQIA 4AIIA 3FIUA 5AHOA 1Z0FA 2Z9CA 3EBPA 2XXBA 4YDWA 1B0UA 1XU7A 3PVCA 5BNZA 1A8IA 1JHXA 3P2YA 3U48A 2BM1A 4FNGA 3UCXA 4JXTA 5JC8A 1JTEA 3REQA 1UN8A 3KD7A 1T5IA 2HMAA 3EVZA 1KXJA 5E2AA 5J1SB 1U9CA 2W6NA 3FWVA 2GHIA 2WKWA 2X2PA 4QASA 4Q4JB 5CB4B 1FJXA 1T1JA 4M8SA 1RJ9B 2AG0A 1ISJA 4BV3A 3F7MA 1PJBA 2AOXA 2XQFA 2CXNA 5L51A 1S64A 1PAUA 2IXFA 3DCJA 4H3KB 5IJ0B 3NC4A 1X77A 3AF1A 2FEMA 3P96A 2XLCA 1DWQA 3PFIA 4MQEA 3ENNA 4Q48A 3UFXA 1QQBA 3R3HA 3GEMA 3UQZA 2AVNA 4O2RA 1W0CA 1DMSA 4HOSA 1G9TA 3WLJA 2V1UA 1FSSA 1T35A 3LNCA 3DMPA 2AC7A 3IAFA 5DMXA 3WGIA 1DEKA 4M1MA 4W63A 3KDPA 3FU5A 5IF9A 3MQ4A 1P9WA 3L8EA 3DSUA 1EFVA 3AUYA 3CKKA 3OOJA 4MWGA 2DCMA 1JWFA 3KG2A 5EP1A 1P4GA 2GH1A 4UDOA 5HK9A 4DLSA 4J4BA 4NRDA 1C7QA 1V5GA 4PFQA 1U5CA 2DH6A 1LF8A 1GPJA 1JVSA 1K5DA 1TB4A 1YE3A 2FPWA 3IPCA 4PAOA 3WWDA 3SEFA 2YJ3A 3TWTA 2H0AA 1OKKA 3G5UA 4DC1A 1WIWA 1E5QA 3PZ3A 2PSJA 4PAQA 5LP6B 1WDYA 1Q44A 3CF0A 4FB5A 4RM3A 4KG7A 1KETA 4YECA 2H9AA 1KYZA 3DLCA 2QMHA 1IN8A 3VDNB 3LSYA 4BLRA 4B87A 4GIBA 3FBTA 4Q21A 4EPZA 4YRJA 5B3LA 3KSAC 1E9RA 3C3AA 5CFNA 1NVGA 2V7PA 3QVMA 4MW4A 3V1LA 4CTOA 1XQWA 3SQXA 1Z17A 1N5LA 2ADFA 2WP0A 5B2EA 2QN9A 2A5GA 2OBYA 3ER6A 1P39A 4JB2A 4MPPA 2X7HA 2FPGB 4TUMA 4UTOA 4CGYA 5BYBA 2IYQA 3HU3A 2GFQA 4TVSA 5AVXA 2AHOA 4O1HA 1Z6AA 3ETLA 5H83A 3W77A 4F4HA 4R6WA 4Q96A 2PMBA 4DFDA 2FW1A 3RNLA 4XB6B 1M1NA 1OV6A 4IDDA 4MTCA 3WXXA 2ZIZA 4A0QA 3S7BA 2HREA 1SELA 1TCAA 3O1IC 1N3IA 4YA6A 4YQYA 4YRSA 4KTVE 1E90A 1YVEI 2F1HA 2OZLB 1N95A 1MNQA 3DNFA 3KYJB 4F6RA 4HI0E 5IXJA 4H18A 5KQMA 1KTVA 4UAVA 3OZEA 3N87A 3GUVA 2BHSA 3OKCA 1YRWA 2AJTA 4JUAA 5AUPB 3PXAA 3WXBA 4R41A 3DZGA 3CNBA 3R4CA 2HGZA 2XCCA 3D8RA 4MQMA 2KWIA 4U2FA 5BNFA 4O02B 2FRDC 5KNLA 2YJTD 3BKWA 2ZSUA 1PAQA 1E1KA 1B4DA 1KS2A 4W9MC 1O9HA 3D5TA 3TRFA 4UUPA 4C14A 2FJPA 3WK5A 1DBPA 3E9CA 1C30A 3RFCA 4BN4A 5IAOA 4HQDA 1XZQA 4R83A 4R8VA 4YO7A 2P30A 2R60A 1K98A 4JHLA 1V4BA 3O94A 3ENKA 4GAEA 4QGAA 4BNDA 3T41A 4AY5A 4JNCA 3FNBA 4HRVA 1YGPA 2PMCA 3KVNA 3LP5A 3FMIA 4BVEA 4DQUA 1KGDA 4UXJA 1VE9A 4Q1EA 1BXRA 3AHJA 4CJXA 2GZ1A 3FB1A 3U3WA 1W76A 3NBFA 4GKJB 4CTKA 4EHIA 4YALA 3HJHA 1KT0A 5LJLA 1XELA 3ZD8A 3BG1B 4CMKA 2YZNA 5EPOA 1WXGA 2B2CA 2FZGA 3UATA 4D3DA 5CBOA 3GLSA 4O4HA 5B37A 5C81A 3OKPA 1KMCA 3SFZA 2YZ2A 1B1AA 4OXIA 4GO1A 5HZGA 4RIIA 4JYBA 2H7VA 1I24A 1W85A 2O4CA 4IXWA 4FT2A 1ZU4A 4L9RA 4TVOA 4PRKA 4OHWA 4Q1AA 5B3AA 2GZ2A 1EPUA 1EVKA 1GD1O 4GVLA 3RC7A 3UM1A 2WD8A 1APBA 4HAZA 3FUIA 1EKXA 1DWOA 3PHBE 4BWVA 3U49A 5LZ9A 2VSQA 1E6CA 3G5LA 3LIIA 4L5BA 4YJ3A 3CVOA 1Y6IA 4CL3A 1VRCA 5JHGB 5JHHB 1XMOB 5F98A 3PQ7A 2CHWA 1LW6E 1VPEA 3GFVA 2A3RA 4QQ8A 1EAMA 3ORYA 1HFAA 4YJ2F 2P4EA 4YR7A 3MLAA 5KQPA 3K9WA 1IXZA 2OCXA 1E8ZA 4CI0B 1S2GA 3U7QA 3L6DA 3WO1A 4Q7KA 2CB9A 2F3RA 4UHHA 4WESB 4C3VA 4YS6A 1XJCA 2OCIA 1T5TA 1KZ6A 3MEQA 4IIXA 3U9LA 3FOZA 1QZUA 1BHO1 2QGZA 2V4UA 1M2NA 3H8WA 4WLUA 4CG1A 4DX2A 2ZBRA 2KBEA 5IM4F 3GEGA 4A23A 1CS0A 1Z62A 2I7VA 2P4SA 2VNHA 3H2YA 4BATA 4L27A 4UBMA 4HL6A 3V2IA 2ZT6A 3JWEA 2GN8A 1CX9B 3NUQA 4FFRA 4J0JA 1HQCA 2PX4A 2Z3WA 3WWEA 5M2QA 3PEWA 1YU9A 1WWKA 3P4UA 4QYIA 5LUAA 5C1PA 1R4NB 1RWVA 2GEFA 1LPNA 4L4ZA 4IXMA 1NMXA 2K6GA 3GMDA 4ZRMA 3AI2A 3RJMA 1N6RA 3TMYA 1TCBA 2IYWA 2XE7A 3KWMA 4G1EB 1M73E 1U8FO 4ARUA 1WW3A 4BWRA 1OYVA 4YT5A 2CVZA 2VCEA 2ZT8A 4F1KA 5JZ9A 4YCMA 4M55A 1JTFA 5KYWA 4DR7B 3E1KA 3DLPX 1U7OA 3L8GA 4B6PA 4UHJA 3PHLA 3B13B 1SUPA 1II9A 3R5TA 3I2KA 3MRSA 5A3JA 5BMVF 4CLOA 4GD3Q 4JLSA 3ZYMA 1P2BA 3QELA 4B4OA 2VRWA 2Q2QA 5J2TA 1U2PA 3V79K 3D3WA 4D26A 4OQEA 1ORRA 2V7VA 3FDZB 4DCUA 2Y4UA 1RAIA 1Y1TA 5LR6A 4WY2A 2AFIB 2H9IA 5CDTA 2EW1A 4FGKA 1W5AA 4INZA 4U7PB 3G9TA 4UNRA 4GFDA 2DBAA 3K7EA 1JEDA 5LYYA 3V55A 3Q73A 2WRZA 5T8IA 1K5HA 3A2MA 4HDMA 3QKUA 4YRDA 4YPFA 5A7GA 3VAAA 2XCRB 3UHPA 3DEKA 1JI3A 3TQQA 1XTJA 3ENVA 3OFND 4NMMA 1DP4A 4LF4B 4GXQA 3ZC3A 5ALYA 2F9MA 1P81A 4A26A 1F8FA 4WJLA 3MERA 2QUBA 4RESA 5C7OO 4IL5A 1ZEMA 4NBKA 4UAUA 1GTRA 1L9XA 1CCWA 1EF1C 2QJFA 1XJ0A 2XUDA 2OGZA 3C7AA 3L0ZA 3NC1C 3VPCA 3VYRB 4DILA 5JAZA 2AFRA 2FGJA 2GD0A 1V7CA 1ZD8A 4FBGA 6Q21A 4LHVA 1DX6A 4OGGA 2J7KA 5ELXA 3H5VA 1Y7LA 2EX1A 3AI7A 3AJIA 3EB9A 1ZUWA 1UPTA 4IGKA 2VDQB 3ELWA 1X70A 3BN3A 5HP4A 3BORA 3RIXA 5KTPA 1N1MA 2OBLA 3LKUA 3KFVA 4N0QA 1JDSA 1JF8A 1MG0A 1HLFA 5JLJA 4K8OA 3RVBA 4X91A 4QXAA 1E9AA 2FN3A 2GK3A 4A5SA 4BO8A 1AGNA 1U3TA 2QE6A 2GLUA 1ZUNA 5BXUA 4WMLA 5JJ5A 4JUCA 1VE1A 5EX0A 1U1CA 3CSTA 3BRQA 4N5LA 1N4AA 3W6PA 3C74A 1ZL0A 3CUSA 3COPA 2B0OE 4IMRA 2W0MA 5DM2A 4WLNA 3HN7A 1XZNA 1GZDA 3VSDA 2TMGA 2W9XA 4LMAA 3HVJA 1UPAA 4LNAA 4LYEA 2XMSA 3LS2A 4JLVA 3RT1A 3IBSA 4J8SA 2O2JA 2Z2ZA 4HBDA 5TS3A 4DWOA 1QYMA 5CDYA 1LJUA 4RWZA 2G1AA 3I9KA 1WG0A 2IP1A 2EFCB 3BL5A 1EBBA 2PUHA 3O83A 1C1XA 4ZU1X 5IZCC 2PJDA 1DJQA 5BT8A 3S70A 2D7CA 4FOPA 2CXQA 2NYAA 1VLVA 1P18A 1WXIA 4OMDA 4DGQA 4EY4A 1OXSC 4C05A 3CR3C 4DM3A 4E3ZA 2F8YA 1WOYA 2P9ZA 4LRSB 4R16A 3RTGA 3WLHA 4U7DA 1KYXA 1KQFA 1RVDA 2YHSA 4MTLA 4X54A 1AHPA 4K9SA 5AK3A 3CISA 2XBLA 1GSOA 3DDZX 5FQ8A 2F0YA 2QUAA 3UI2A 4UOZA 5IX8A 3ETCA 2FSGA 3ULQA 2MRIA 1JBKA 1V11B 2WWTA 4DLRA 3A1SA 4LMRA 4LZAA 4PHHA 4Y1GA 3WADA 5CYPA 2XS8A 2IF2A 4HPWA 4OJTA 3BFXA 2IH2A 3A3NA 2JK0A 4PC1A 1CFZA 1KDPA 1W5TA 1T5LA 1TF7A 4OA5A 4R2MA 3X2EA 1FIUA 1RW4A 3CINA 3ADDA 5BSEA 1N11A 1BEUB 4I9NA 4YJHA 5AI9A 4OHBA 3OZIA 5I8WA 1ZJZA 2CVPA 5BPHA 4UQZA 1YF3A 4O5OA 1NE2A 3D9OA 1D2GA 1MGPA 1XCBA 4YDOA 1YQUA 1OOEA 2O23A 3RH0A 2OXTA 4HZIA 1CJBA 1FP2A 1WY5A 3B3JA 3P5BA 4MR8B 1NFIE 2GPBA 4R1UA 3DNMA 3ZHEB 4JOQA 4UI9J 1A4IA 1XRRA 5BVGA 4RTOA 5LZ4A 4W7IA 2OEWA 1LBIA 1LBTA 2Q21A 4H1HA 4EFMA 1YDWA 4C0MA 3MGGA 1C8KA 2QTZA 3LDGA 3Q3VA 5G04J 3UPUA 2Q9AA 5FB3A 3T8YA 4JIGA 3L49A 2Q5IA 2YV3A 3LTEA 4YJFB 2LWIA 1OBCA 1ECBA 4D79A 4EW2A 1WVGA 3HO8A 1INLA 2XZPA 3VR5H 3VZBA 4F93B 1D03A 4S2EA 4BVKA 1CUFA 1PZHA 5AQ1A 5KJMA 1XAGA 1SXJD 1UJ4A 4ISCA 3NHBA 4H77A 5K3FA 3ZNNA 4C20A 4I50A 4EJ6A 1A2BA 4G0OA 5A04A 2FV8A 3JTEA 2OLEA 1OYWA 3ZDRA 3SKXA 1OH6A 1CIJA 1J07A 2B2NA 3QM1A 4TLAA 2CHQA 16PKA 4IUBS 1JALA 3NWBA 4TPKA 2QRHA 3LX6A 5LZ5A 5ECYA 4CMEA 1XPUA 3RWMB 1NOKA 1W8DA 2OLKA 4EABA 1FMCA 3IXMA 3K1TA 4ETWA 5BT1A 5KKNB 2B7CA 5L45A 3U09A 4OLBA 2F43B 1HDXA 5DXJA 3C6KA 1OCEA 4KH0A 2RH4A 3UK1A 1NIJA 5ILGA 5CG1A 4KR2A 4D44A 1IBCA 4MA5A 1LVHA 1AQLA 2G40A 1PT8A 1D9SA 5E95A 4YNBA 4QM7A 4R2LA 3CKYA 5PGMA 2QRGA 1VJ1A 3IOYA 1B8VA 2NO6A 3HE3A 4LDJA 3CLVA 2FYTA 1ZUNB 1G2QA 4GYOA 1Y6QA 2DPLA 2ORVA 4OQYA 5KVSA 3AEKA 1Z7GA 5CA0F 5FTPA 3ND9A 2DMRA 5BVHB 2A67A 3LIPA 1DAMA 4ZC8A 1LSSA 2J85A 3RYCB 4M38A 1SC1A 2QUJA 1U8UA 3OM1A 3FNRA 3P2BA 1FFXB 2ODEA 1MIOA 4LG6A 4R51A 5K0CA 3PWSA 1RQPA 1GOTA 4A1OA 4W5JA 2FUG1 1N9GB 2DFDA 4QQKA 4NHOA 1EFLA 3IOBA 4JOCA 1JMYA 1S8NA 2J7PA 5TEVA 4KMOA 3PDUA 2X38A 2O7QA 2V3VA 4GSLA 4P2GA 5FA8A 3WK6A 3MJVA 3KAKA 4BDTA 3BWEA 1AGRA 2COEA 3LI2A 1GKLA 2AG5A 1BX1A 2BPOA 1JP7A 2BZGA 5AJVB 4PG7A 1R9NA 3V2HA 4AD8A 1NT4A 2MINB 3NETA 5B1BE 3ZBTA 3QNKA 1A8QA 1RQXA 1EK6A 2FRDA 3EUFA 2XCUA 3VPXA 1YVUA 3R9XA 3ADCA 3LH5A 4Q6WA 3A8TA 1PEDA 2PBRA 3AUUA 2GMWA 2X40A 3IA7A 1KOLA 1KFCB 4CTMA 3S68A 1ECFA 2QVLA 3WL4A 1UBSB 5JZSA 4KREA 4XI9A 1MB2A 2P67A 4D41A 2OHFA 2GGFA 3NM5A 3SP1A 3C3CA 4LXIA 3B13A 1Z4JA 5E9QA 1QNLA 2FUCA 3T4UA 2OQ2A 5AR1A 4HWRA 1GG5A 4L0MA 3R9MA 1QAMA 2C88A 1GYPA 3CQGB 2P6MA 3KXPA 3CNLA 4NEHB 4R4JA 4S1PA 4IM7A 3CZPA 3H9UA 4F1PA 3TIFA 5I01A 4RHCA 4V1CI 1MUUA 5J58A 4CM9A 1C1YA 3VO2A 2ECQA 1A04A 1E5LA 1F4VA 1VMEA 4LHZA 2P2DA 1R4NA 2VQFB 2JABA 3QE2A 3WQHA 3NCTA 1DDOA 3DMTA 4GR5A 3OEYA 4AXBA 5KX5B 1FMLA 1W87A 2VH1A 1E2GA 1VCMA 5F4BA 5K0ZA 1QP7A 1BXRB 1OTHA 2ZE7A 2BKXA 4ZXFA 1L4UA 1QH0A 1V1RB 1XKQA 5ENSD 4IDCA 2ZAIA 3GAFA 2I3ZA 1DJMA 3IPYA 4PLFA 2X1HA 4EA8A 3LPMA 1E99A 2GZAA 2B3DA 2Z4RA 4XCQA 4MR7B 1JHMA 1F8UA 2W7TA 2B6HA 3EZ2A 3UPDA 3UTCA 5C1DA 1WB4A 2FCAA 4FZ5A 2LGJA 3T7TA 5KS2A 2VYVD 4X7BA 4XUDA 4BNVA 4K5BA 1KO4A 1MO2A 2GM3A 1I2ZA 3ZIAA 1NX6A 3MJ4A 4IJ6A 5AVZA 1KYTA 4J0IA 4LZPA 3RAFC 2H57A 5C4IA 3L84A 1DCMA 1SBIA 2QZAA 2F1JA 3MTQA 5JPDA 2F3PA 1N1GA 4P9NA 4Q4AB 1JDBC 2O8BA 4GQAA 1E8NA 2B1IA 2QTTA 1ZK2A 1W94A 2GCIA 2NUAA 3BWCA 2ZP1A 4HG2A 1SU8A 4NNPA 4RU1A 1VYHA 5LQKA 2GK6A 4GGMX 1XZHA 3ZWCA 3KP1A 4DPRA 1LSUA 3B1YA 4GP6A 4G5OA 4N18A 4G9BA 5C0OE 4TLDA 4DLVA 4J7CA 4WKCA 2AMFA 3S81A 1I1OA 4RF2A 1PGQA 1EUQA 5EFOA 2QX4A 3R3XA 1XA3A 1BVHA 2WJ4A 4IO0A 4ZVLA 3HXQA 2AK3A 3G6WA 3NHRA 3FDIA 1UR5A 1PL6A 1E6KA 2BSXA 2CBXA 2HWKA 3M5WA 1M2HA 3A9RA 3LLCA 4ND6A 4R8SA 4UVHA 1SUDA 5DVZA 3NRJA 2C7PA 3K09C 4KKVA 5CBPA 2IQIA 3SMVA 1PVDA 5KNCH 2ZRJA 4D57A 3ZCVA 1TZBA 2ZB8A 2C5HA 4G4SO 3ETEA 1GXSB 1AU9A 1K7SN 1E1LA 4AOFA 2ZJ7A 4JU8A 2OYCA 3OTNA 1DG1G 1LLDA 1NRWA 3DOJA 4QG7A 4RPJA 1R74A 1QE5A 3BE5A 1VECA 4H7KA 4PW0A 4RK1A 5DHSA 4DBLE 2UYGA 5MHTA 4GYWA 3QMWA 4O4IF 2HR1A 5BUZA 4KN6A 2O54A 1T2EA 2QNBA 1R12A 2ZLBA 2ZRGA 3RJVA 4P5DA 1XQ6A 3EHDA 3EZ9A 3QVTA 4P86A 1JG2A 4E2XA 5LIPA 1TT7A 4ZT6A 1KIAA 4HNTA 3OE1A 4EI9A 1QPBA 2XMGA 4FWIB 3IMGA 2OMKA 3C2QA 5TR9A 5FI5A 5BQ5A 2ZJZA 1MABA 2XHEA 4AX8A 5C4GB 3BDAA 3HKBA 2XQ0A 1J0BA 1TEVA 2DVMA 4E0BA 2GZHA 4BYGA 4EHNA 2YVAA 3WMWA 4PPFA 4EGCB 1L5FA 3HZHA 5C35A 4FFVA 3NLLA 2IHJA 3ZVLA 4ZN6A 2WTUA 2J48A 1O08A 4AZTA 2P9NG 1XZLA 5FNVB 3VOSA 4TYQA 4X00A 3AS8A 1T5DX 3WKEA 3BSYA 2M6RA 1EDDA 4NIMA 4FHKA 1VJCA 5CHEE 1ZK0A 3C3QA 3OXLA 2RFAA 1J5EB 5E6RB 4RA9A 1XRJA 2ZSJA 1NI4A 1O5MA 1NJ6A 2BTQB 4MQUA 2I6XA 4V0ME 4YJKA 3ZWVA 2HRQA 2D13A 2CV1A 2WMYA 3ELBA 3L0SA 1CK4A 1XTQA 3IQGX 2KATA 2MSNA 4G0VA 4FFSA 2JJ8A 4PZDA 3D6FA 2XUKA 4KFTA 4YLEA 3QC1A 2F17A 1GKYA 1G8FA 1N5DA 1SUWA 3KZOA 1ZA1A 3VR4A 5CTJA 3WDLA 3TG2A 3L08A 1UC9A 3I9JA 4QAQA 5B3JC 3E3LA 2EGHA 1UXGA 4IAOA 4OAPA 3V4OA 3OBBA 5E9JA 4HEHA 1V71A 5JFGA 4NYMQ 5LNK1 3COYA 2HM7A 4PBSA 1QAOA 4WFKA 3VSBA 3OTGA 4KSYA 5IBRA 5C7LO 1E1CA 4FFMA 4RA6B 5KYNA 1AZSC 2IZ1A 1SEVA 4HWKA 3C6MA 4B3RB 1KZOA 5FPYA 3T1HB 4H7XA 3BWVA 1Y9EA 2GM9A 4Y6PA 1OZ0A 1A4UA 1P19A 1GTL1 2H1SA 2JHPA 3F7NA 3CPEA 4L0CA 3T7SA 2WHQA 5G0SA 3STVA 4XVQA 1WDTA 3OAWA 3I9OA 2E9SA 3B1WA 2F3QA 2YHBA 3DZHA 5L7YA 3WTCA 3I6BA 5ENRD 5GONB 1G17A 1YASA 5F9MA 4C0HA 4YQFA 4Q1DA 1ZB1A 4Z1MD 5JXHA 5KWEA 3IT2A 3ZCXA 2BEJA 4L6IA 5KI6A 4W6ZA 1WLYA 1JFLA 1QBKC 3B1JA 3EQ2A 2AUNA 4FMPA 4KGVA 8LDHA 4NQ0A 3U13A 3HI6A 3IT0A 1PJTA 4WGGA 2VAMA 3QOUA 1J4AA 2B4RO 1E32A 1ZOSA 1G42A 3DSSA 3A1NA 1RPZA 2XUQA 1CRQA 3ZDXB 4GE0A 5FAXA 4JA7A 3W9GA 1H23A 3BEEA 4FULA 1VIDA 3KQPA 3WQBA 4ZGWA 3OZTA 5GV8A 1M7GA 2O8FB 2C0LA 4KRXA 2MMCA 2IUEA 3X1MA 2JZOA 4GMFA 4YX9A 3GCXA 2C4MA 4EUNA 4D5GA 5TMPA 1DC4A 3GPBA 2OZPA 3N8GA 4Y1RA 3K53A 1EG2A 2OB2A 2PSEA 1UT5A 1JIUA 4FYJA 2P35A 4G1VA 3DHEA 2PWBA 1WCXA 1ZBDA 1LRKA 2EJTA 3RRYA 1IH8A 5D0QD 1NMQA 4B3BA 1PT9A 2PL2A 5KMGA 1VJTA 5CX4A 5ED0A 4R8RA 4U6QA 1N1EA 1AOXA 3C6ZA 1IL0A 3T94A 3X44A 4CMAA 4MZXA 3F3YA 4L4RA 4DM7A 4U2EA 5J4YA 4LDRA 5JVDA 2F3TA 4WNCA 1J8QA 4I5EA 3KHUA 1QH1A 3AP2A 1YA8A 3PHIA 5G53C 1RM3A 4ZD6A 6LDHA 3VTXA 2XKJE 3A2NA 3RKUA 4OKIA 4W1PA 5CVCA 3TKAA 3TPZA 2R66A 3D8BA 2OV6A 3HDGA 3SSNA 2CG2A 1EQ2A 1FVHA 1OWPA 4TXPA 2IOHA 1ZITA 2QSZA 3B3FA 3PH0C 3C1AA 3EF1A 3EZFA 2DTDA 4JBHA 5F12A 5F1OA 1HE8B 4BS9A 3KSLA 3QAQA 1P4RA 2FFJA 2HC9A 3IOCA 1D09A 4GLLA 4JODA 2OVBA 2O8VA 2VNJA 4YRNA 4C2TA 1QR6A 4BWFB 2HDHA 1PZFA 2A57A 4P80A 4X61A 4ZKDA 3GQVA 1KH3A 2HLNA 4OAOA 4ZZ1A 4ZJUA 4NDNE 2ERYA 2VDNB 4MUIA 1PFYA 3RVDA 3CEQA 1RLJA 5AM2A 3A6PC 1T8WA 2IYPA 1S2NA 4XLZA 4HQOA 1Y9ZA 2CK3D 1TQ8A 2V97A 2GAOA 2NUAB 5E1BA 1H5QA 3QMMA 3IHYA 3PFWO 2AMVA 3E9QA 3D4IA 4H60A 3OLZA 2H7XA 5KDDA 1UK9A 4MYHA 3OP4A 2J9QA 4LIPD 2H51A 2QN8A 2X6FA 1VKRA 4IBOA 4FCTA 1JQJC 1SA0B 5DNVA 3V33A 2FX3A 1LW7A 5FEUA 2DPMA 4AS2A 4C43A 1E2BA 3BIOA 4ACKA 2NQTA 1XQYA 3K6SB 2GK4A 4OBEA 2LUOA 4MWEA 3MGKA 4N12A 2EQXA 1ZMXA 2FQXA 3FULA 1L1QA 3SM3A 1BXZA 1XYVA 2QJRA 2IV2X 4QRHA 1TTQB 1HE3A 2GCOB 1O6ZA 4TSKA 3LXMA 1JU9A 2NYUA 3MUNA 3I1JA 3LKBA 4MLDA 2NP6A 4ILEA 4C1BA 1NF2A 5H68A 5JANA 4MV1A 5KYGA 4R71A 3IHLA 1PGOA 2R47A 4A27A 4KJXA 4AJNA 2VK1A 4MDEA 1TMGE 3VO9A 2I3GA 1C1HA 3RUCA 3TVDA 1Y7HA 1ISMA 3QUSA 4IQ0A 3AW8A 2EKBA 3JQGA 5F35A 4YAIA 1E7UA 5EZYB 1SHTX 3N05A 4O0MA 4PLZA 3KXDA 3UBMA 5HKKD 2QY9A 4BFWA 3GA7A 1YSCA 2KX7A 3KXLA 2D06A 4L74A 3DT9A 1ZRNA 4LGCA 1F51E 2WF8A 3N1UA 3D3NA 3GA0A 1PLJA 4S0XA 5LBUA 3UJHA 4QLBA 4YMLA 4OVVA 5KUTA 2PT7A 1G18A 4BB5A 1PRYA 4M0UA 5DTRA 3DBSA 1J2YA 1G7CA 4XWOA 3RV4A 2PD4A 5GOZA 1VIAA 8MHTA 1Q15A 2EKDA 2FOLA 2OGSA 4DMUB 3HIZA 1XYYA 2N3ZA 5EYPF 2JRCA 5I7SA 3DEAA 1VHWA 3HPQA 1T36B 2QRKA 4DNFA 4YRQA 1HS6A 4AY4A 4URVR 4WFJA 3UM3A 2KHZA 2H2GA 4L5AA 1ZW1A 3DLIA 2YIVX 3H87A 4RFSB 2YV1A 3THOA 2C2HA 2Z57A 1WXQA 2C42A 4DOMA 5HUJA 5I8ZA 2YOGA 4GQBA 1R4MB 1IATA 2JS7A 4HUQA 4QT4A 3MCVA 4D4IA 5H4GA 3G79A 3BJZA 1QWSA 2JNWA 4IZIA 4OVKA 4MRRA 2EINE 4MV5A 3BUSA 4Q47A 2C99A 4BY6A 1SOUA 5FTMA 5JMPA 3TLCA 4MVCA 1AKVA 2XWPA 3PXXA 3RVOA 1ZNZA 5TF0A 3HJTA 1T5OA 4R2XA 4MYCA 2WXHA 2VRCD 3NEPX 4YEDA 2V0PA 2V6BA 4AVXA 2EQ5A 3ZJ4A 1AC5A 3LPNA 4DWVA 3EIWA 1A7AA 4QVGA 4C0LA 4BMDA 4DKXA 1VG8A 1XXHB 4F9TA 4ER6A 4UJ5A 2D3WA 3N9IA 3BC1A 3R40A 3N7UA 1OI7A 5IK2D 4JN6B 4MULA 3M5DA 4G25A 3SJ7A 1S3GA 5LWHA 1MKYA 1X3LA 4AP9A 4BLUA 4WN3A 1PFKA 1KQ3A 3WV4A 2V0GA 4XDHA 4BSXA 1A4RA 3ESQA 1RBZA 4CKWB 2AKYA 2ZBEA 4MPTA 2EX4A 1QFXA 2FEPA 1FJHA 4OK6A 5EIWA 1X7XA 2YL2A 1O87A 2WM9B 3PRYA 4QOEA 3T7KA 3DTNA 4WCFA 1EDZA 1R6VA 2HTFA 4YO8A 3SX4A 4BASA 3Q8KA 2A7QA 5HFNA 1DKQA 3TLJA 3LEWA 2I3BA 3L7CA 3SS7X 3TSAA 3NWEA 4NCJA 5HX7A 3CCFA 1QFZA 3MAGA 4NMWA 2XECA 1SCUA 4WZ6A 4M1OA 1TI7A 1XEAA 3M5CA 1G64A 3JVUA 3EC1A 5GZ6A 3MCZA 2OXRA 5AW9A 1KDZA 1L8LA 5CBKA 4CLRA 2FWAA 3NWJA 4R9NA 5ADUS 1TLTA 2W2VA 5JC1A 3VTZA 1Z3XA 3P2MA 1OY3D 3VKUA 2B5WA 3LZCA 5JWHA 3W8RA 1X7ZB 4IWXA 4BFRA 1P9OA 1NI1A 3I01M 3DXFA 2PZMA 3M4XA 2EJBA 5EXPA 4EEZA 1I94B 1SOMA 1P17A 2QRZA 4MB0A 5D3MB 5C5CA 2DLNA 1CE8A 1THGA 2SCUA 5LLTA 3U16A 4PRYA 4ZZ3A 2O2HA 4GDFA 3SE7A 2VFAA 3X2FA 2FQYA 2YVLA 2WV9A 4O3FA 2R03A 3N74A 5REQB 1GZ3A 4PC6A 3AG4E 1WSBA 3A3KA 5I7FA 4TTAA 4EHMA 2AEJA 3PE6A 2YX1A 3TG4A 5KDOA 2Q5QA 3CLKA 3JALB 2DPYA 4UWHA 5IJWA 2FZEA 3RFVA 1A9SA 1YS6A 3K8ZA 3WR5A 1CVIA 1H2VC 3R3YA 4D92A 2WXQA 2D4HA 3RVKA 2BGWA 4MVJE 4I1YA 4CT4B 5EJMA 2OP0A 1B0AA 1MC1A 3I01A 4J75A 4PYOA 5EHZA 3O84A 2B36A 5EP2A 1PJAA 3HVEB 4W8OA 2D1RA 2OO3A 2HMUA 2X1MA 4FP9A 3SVTA 1UC8A 2XH8A 1EUYA 3NAZA 1FW6A 3PGA1 4J8DA 1U98A 1C8BA 1OHHD 2M63A 2BFCB 4KX3A 4BCBA 4CEJB 3N2LA 1EFCA 4LBYA 2RHRA 3Q3CA 4MO2A 4PZCA 1KEKA 5EILA 4PG6A 4Q9JA 1KNXA 4J03A 4Q7EA 5AVJA 2IS1A 1RJWA 1M34B 1C3XA 1JLSA 3VZPA 5CEEA 1RLOA 1AGYA 2XPIA 1SVOA 1A1SA 1ML3A 2FPMA 4OX9B 5CT9A 3T52A 2EILE 2R8RA 4B44A 1U7DA 3P4XA 3CRMA 4G0QA 1XTPA 3K72B 1J56A 3N59A 1NASA 2FFQA 4JB8P 2DR3A 3DPUA 3ORSA 3MIZA 4JLKA 2HF8A 4ZK2A 1ECGA 3HZRA 2X14A 1Y8QB 2E4ZA 4B0OA 2B98A 1K6IA 4CHTA 2B69A 4RHFA 2NO1A 3HL4A 1M10A 3B51X 4LOHA 4LRXA 3PE3A 4PO1A 1RWOA 4NYJR 1BX0A 4HUJA 1WVIA 1XR3A 4CM9D 4PQEA 2J3IA 4UU8A 4EGFA 2Q6LA 2Z9BA 2QSJA 4CGVA 1D2NA 4PZLA 5K6AC 2A3NA 1N2ZA 4ZXPA 3C8MA 2W11A 1XGWA 2WB2A 1UIRA 2B0JA 2WFLB 3GG9A 1YDGA 3SDSA 2W2KA 3X0DA 1A9QA 1U7TA 4CEMA 2BBSA 2V74B 4HNSA 4XQEA 1A8PA 4AVYA 4B31A 1PBTA 2Q7FA 3NTRA 5BMVB 2YUTA 5JYBA 2O8BB 1VG1A 2ALJA 3P9RA 4MPRA 2YNQA 3S2GA 1RZRA 1JLMA 3I9NA 3K5HA 1RVV1 3CX8A 5DWQA 4OH7A 2YN2A 4WLOA 3VPAA 3B1ZA 4M0MA 3FWPA 1C2TA 1XUOA 3IP3A 4TMZA 5K2OA 3IAM1 2R9VA 3LY8A 3R3ZA 4YGXB 3R7QA 2WIJA 2VCHA 2V9ZA 1SIWA 3OO1A 4JBGA 4M9CA 4HDRA 2JI6A 1TUBB 1SH7A 3SFVA 4KPFC 1NXSA 1BFKA 1EJ0A 3R7FA 4ILKA 1JG1A 3FTQA 2NWQA 2PTGA 4MJ3A 3O8CA 1HL3A 2BT4A 3CJQA 1T15A 1VRVA 2CYCA 3NHPA 3L1UA 1GPUA 3GJ3A 5FBLB 1FDSA 2GPTA 3VU3A 4BKMA 4EI7A 5EJ7A 1AO0A 3QLVA 3FOWA 3AVTA 1M0EA 3VO1A 3HSYA 2GBFA 2XJ4A 4EEKA 5HPYB 1UJNA 3ZW8A 1TD9A 4V0SA 5HM6A 2WVGA 3ZVNA 4MRUA 4LVOA 5EXSA 4IOMA 3GUHA 4Q7JB 3ZCSA 1HGXA 1RJDA 1Z56C 2BGMA 2FR1A 2I76A 2NO4A 1LUAA 3H2IA 3VC7A 4H1UA 1UBRS 4LXXA 2QW1A 3VNAA 2GERA 1THZA 3TWUA 3EZ7A 3HCEA 3N2KB 1Y6FA 3I30X 2HJWA 4HYQA 1QANA 1N6KA 4U00A 5TQ2B 4I50F 4BRSA 6CHYA 5L9AA 1IIRA 2NOAA 2PBLA 2RH5A 3F49S 3Q0IA 4AP5A 4RWEA 4F2HA 3I5UA 5CFPA 3ZHBA 1GM5A 1ZMBA 2XPCA 3U5ZB 2BMEA 5BP7A 1BA2A 2CSUA 2OV4A 4BNWA 1K1EA 1AUXA 1Q2XA 1Q7CA 1V6CA 1UWLA 4AJWA 3E5MA 4DCSA 4ZZIA 1XF9A 5L3SB 1UEXC 3FZEA 4IIJF 2QT9A 5AJHA 1USKA 3UA3A 2AYYA 4HXIA 1KMQA 3PZ2A 1ZXBA 3JATA 2WKQA 3IIMA 4RJ2A 4RV5A 4RGQA 5ALPA 5LCWJ 2AJAA 4NZPA 3TQFA 5AM4A 3GEIA 2Q07A 4WZZA 4HWTA 5KYVA 4EMSA 4F91B 2GRQB 3QARA 1ODKA 1EUDA 4KBGA 5CXSA 2OQIA 3L5KA 4FX2A 2WTBA 2HSDA 1EE2A 4L4UA 4Q7LA 1B8OA 2EBHX 5GVRA 4E6EA 3ZY5A 4P7GA 2PX0A 1BO6A 3FDHA 4F72A 1NJGA 4K3VA 5DM70 2VHEA 3ZYZA 3HWX1 3KVOA 1V3QE 3QV1A 1T9HA 5K8IA 1UMBB 1T4CA 2XPZA 4F12A 4F2PA 1HKHA 3K3PA 3MTIA 3TWOA 2HXSA 2QN2A 3DE0X 3FMPB 2X8BA 3CF6R 3RSZA 4HRNA 3U7QB 3I62A 4CDMA 1J97A 2D1TA 4RZ3A 4E07A 1Z0UA 2NZJA 4JLMA 3DZ8A 4QBIA 3LPZA 4Q6BA 3HL0A 3UMGA 4N76A 4EA6A 2W2TA 4KIUA 4OXNA 2FXVA 3AVQA 4M0LA 1NBME 1ZCZA 1RRCA 1VJGA 3M8KA 3VU0A 4LMPA 2V7GA 2LCFA 3K1AA 4U2CA 4C3ZA 2M32A 3QWAA 4YRGA 2X8LA 1U0EA 4XEHA 2X9GA 3DV9A 1JIKA 1MH9A 2QN3A 4YBRA 4Q37A 3FLBA 4Q3CA 2ZR0A 1DSSG 4FDUA 2HR2A 2Q5LA 3MTJA 3O92A 1VJDA 1PW7A 2EQBA 4MLZA 2GVZC 2O3JA 3L02A 2PTHA 3E81A 5BSTA 4ENUA 4OK3A 1DBRA 3F96A 5EL0A 1WPQA 2A8YA 4AKGA 1I9GA 3IUMA 2C7GA 3ZU5A 1P2TA 1PG0A 4QU8A 3WLKX 1E7YA 2QM3A 4OI4A 4TVBA 4E46A 4S35A 3ZU6A 1H1TA 4D56A 1X7DA 4GTSA 4WBNF 2CFUA 5BV2P 2NV0A 2ZIWB 2ECPA 2XBUA 1H1DA 4H6XA 2OFXA 5FFNA 4E32A 1VKHA 3PR1A 1CRLA 3SYRA 1JDZA 3V80A 2IOLA 1KEPA 2WAOA 2JGJA 4HO1X 4HX5A 1ZLXA 4OOEA 1I01A 5TC4A 5EE9A 3OQIB 3ZE1B 4F56A 2HT6A 1E2NA 3NFYA 1TZJA 3LDZA 3TIVA 5CU7A 4EO4A 2JI7A 3SDBA 5JD4A 1CJVC 3LVBA 4B47A 4I4NA 3QY0A 1F2DA 3PREA 3OF2A 4ROSA 2H00A 5EIBE 3HRKA 3DD5A 4OGFA 2O57A 1D8EA 3HXTA 1G16A 2YH2A 4RUKA 1H6OA 1EVQA 2XTJA 4FVTA 5DW3A 1C3VA 5LDDC 1B0PA 2BI4A 2EEPA 2I9PA 3NWOA 3GZJA 5IEJA 1JN0A 4GEKA 4ZOQI 1N52A 1AKWA 3T7EA 4JL8A 1CY1A 1GILA 1XZGA 5B7PA 1VM6A 3FWZA 2NSZA 1WB6A 4LSGA 3ONVA 5E1DA 5EI5A 5JS8A 3SLKA 1SCIA 1E3EA 1NURA 2EC5A 2OYRA 4AN1A 2IYOA 4WRRA 2XMRA 3ZTWA 2I1WA 3G85A 3HCWA 4OEHA 4CLHA 5C5IA 4HFGA 3RF7A 2VHTA 4C7XA 3T7CA 3T3HA 3MCTA 1RXVA 3ZDCA 4LFBB 1YFLA 3ZGVA 1DAKA 2GRMA 3TM4A 2ZRDA 1HY3A 3K6KA 4J07A 3VJKA 1C9JA 2O2CA 3MCWA 4G5RA 1U8AA 4OREX 4AAYA 1MW8X 2DECA 5K3EA 4Y8VA 3DTYA 5AQ7A 1T4GA 2ERXA 4HOTA 4R1LA 4Q7QA 1OAAA 2BBTA 3T54A 4RM2A 4F8EA 1Q7BA 1OLSB 4GXNA 5IBCA 2VSXE 1DLJA 3FX2A 4Z2AA 3THSA 2BGIA 3T5VA 4DMKA 2WFLA 4UUMA 2Q0XA 2OESA 4EELA 1S0UA 1LX6A 3MVEA 5LQUA 3UG7A 2XR1A 2GXAA 2CLFB 4RHEA 2XQVA 3A14A 4JV5B 1Z5NA 1NVDA 4HMPA 1J70A 1UBCA 4D5EA 2PUGA 1E94E 5AKYA 2O6LA 3AFNA 3FYTA 3GJQA 1BXKA 1KDOA 2BH9A 2GD2A 2QEQA 1KJYA 2HWYA 1TM1E 1L8QA 4P4UA 4MA0A 1KJQA 3UKUG 1BJKA 3LVQE 4KMSA 2VJ8A 3SZ7A 3QLUA 2OSVA 1YZQA 4D4JA 4DA4A 4JJKA 4B9EA 3E4DA 3GYGA 2VAWA 1MX3A 4I6JA 1H4TA 2FVXA 1I30A 2ZVJA 1POXA 2HEIA 4MHOA 1SMKA 2G70A 3HMKA 2H65A 3V9PA 2D7DA 3JV7A 1SD2A 1WDKA 2X1VA 3CZRA 4AF8A 3DSWA 2XRZA 4KLZA 4R5MA 2AYZA 8AT1A 3CC8A 4AWAA 3T9AA 1Z7WA 2A59A 2WYVA 3A70A 1OC2A 4HQ6A 4YI3A 5JAPA 4FEYA 2LD4A 2RHWA 2PUAA 1RJ9A 4EL5A 1J09A 4R9RA 3BAZA 3GEPA 3R6LA 2ESRA 3DE1X 3ZD7A 3O38A 2GO7A 4C07A 3KETA 4LAFA 2BZSA 1JEOA 2MSEB 4YJ3B 1FXSA 2QZ9A 2H1IA 3IEPA 4KH1A 5AHKA 3BB1A 2WVIA 2ET6A 4A0FA 3T8MA 1L5LA 1J99A 1X8LA 4GA1A 2C94A 1EEHA 2BFBA 2RC6A 1H65A 1R16A 4OYHA 4ZREA 1EG7A 1IXVA 2ZEJA 3K96A 1CY4A 1U02A 3A1UA 4FOLA 3JALA 4LI0A 2Y3IA 1W19A 2AR7A 2B7BA 1ZU2A 4DLUA 5EEHA 3UO8B 4YYEA 1RJFA 1PY1A 1GTJ1 1PJCA 1TZKA 1TDJA 4NC9A 5DHPA 5EHNA 1N6OA 2MWMA 5BT9A 4B48A 4YRTA 4CM8B 4CV1A 1QV9A 2V9PA 3L5OA 4IV0A 4UDYX 4Y2HA 3SC2B 4MIEA 4QUKA 4GX1A 3KWJA 3SZOA 4NNOA 5DB4A 2GAFA 2PBZA 3ZZTA 1ADYA 4ZALA 4GL2A 1FDVA 5IJXA 3ZFWA 2Q41A 1L7PA 4YONB 4EJFA 5IUJC 3FOCA 4BNMA 5CVTA 2PIAA 4D0LB 3HA2A 4JB8A 2EGUA 2KM4A 4GI7A 4EW1A 3CR8A 4LXUA 5IAAA 4OHVA 1XMSA 4YK7A 1RBQA 3UY4A 1OFGA 1PHRA 1KI2A 2XMCA 3IGFA 1Z3CA 2XEHA 4L28A 5SY9A 3K9HA 2ZM5A 1JECA 1S89A 4HB0A 4KLCA 3LUAA 5CLLA 5EGSA 5LMNB 5AQ9A 5BXYA 1ELWA 4GU5A 1Y3AA 3FAKA 3JQ9A 1GNSA 4J43A 3QWWA 3MBIA 3ROKA 1K4YA 4O3MA 3E7WA 1MJHA 3QXGA 1UP6A 1YR6A 1K0UA 3MMXA 3O0TA 3L9WA 3NTUA 4N8EA 4TS3A 5FV7A 5K4HA 2UVPA 2XWQA 1LFDB 4E94A 1L1RA 2WVHA 1W4CA 5HS6A 1JXMA 1HLPA 2RH9B 2RGWA 3AYXB 3JX9A 3NBZC 4PGFA 3BMXA 3C48A 3ZYQA 2J6BA 1DBSA 1U2RA 1NX9A 6GPBA 4LSZE 1N4DA 3NYQA 4LJAA 1YQEA 4AJKA 2BLLA 1A88A 2ZQZA 2OHXA 3UAWA 5KVCA 1M1NB 1P9NA 4NU5A 3U6BA 1G6HA 1TO6A 1DPGA 3GFQA 2Z1MA 2IXEA 4CU5A 3NBAA 4BV8A 1JQ5A 1YZ3A 2IXTA 2P5SA 2QTBA 1BH2A 3JZMA 2Y71A 4LECA 2BIFA 5AVUA 4F4FA 3D7MA 2CE2X 1NW9B 2QZJA 3T0IA 4E31A 2XZLA 2W2XA 3GPLA 1W73A 5BRNA 1LPPA 3EEFA 1V5WA 4Y1EA 1H0AA 3T5GA 1EFRD 4J0EA 4MS4A 4TMXA 2CXRA 1NW8A 2O05A 4A2QA 1HF3A 1K7XB 2FPPB 5LA6F 2B4QA 1Z2CA 2GCPA 2ONKA 3BAFA 4RJIA 4LK3A 2QVZX 4NYMR 3SKYA 4C2BA 3H9EO 3HA3A 3KQQA 5GZ3A 3AQIA 3ENZA 3S27A 5LP6A 1ISHA 4A3VA 3RS0A 2E1PA 1GU7A 2GSWA 4RFSA 4ZQEA 1X1DA 2AFHB 3QX9A 2VPYA 4A8JC 1U4OA 3PC2A 3VHXA 4IDFA 1QIJA 4X8OA 2PUBA 3E3AA 4KK4A 2BN4A 3WGGA 3VSCA 5J4VA 2N9UA 8ABPA 2JHFA 2ZBPA 1WEHA 4HD8A 4ND3A 1JUDA 4CN9A 1Y8QA 1CUGA 1E3DA 3ON5A 1Z6YA 3EVGA 3RIHA 1ZVJA 1I6LA 4TMVA 3AWDA 2NVUB 3ETHA 3W1EA 1TYQG 1QP4A 5CUQA 5CDUA 4F3TA 1NU6A 1GLGA 3AB7A 2XX3A 3U62A 4ZI3A 4RY2A 4NJEA 1RXWA 2HBZA 2XZTA 1F5SA 3F4BA 3D3JA 3NPAA 3OY7A 4K6CA 1Q17A 1EA5A 5EYPB 4GOJA 1NBHA 1H2HA 3EZ6A 3W9YA 2O1XA 3ZDFA 2XXJA 3VVBA 7REQB 4HJRA 1QGAA 4CDNA 4YV2A 4H1VA 2IGTA 1LNZA 1E4OA 1EX1A 4I5GA 2CVFA 3RQSA 4OYRA 5GAJA 5IYZA 4X66B 1ZA2A 3GARA 3CQCB 4UQYA 1GG2A 3K0BA 4QRIA 4URZR 1Z68A 2JJ1D 1I5EA 3RS9A 5LXTB 5EA2A 3ZNPA 1SKYE 2XEEA 1ICIA 3D7SA 1OGIA 3F6SA 3F90A 4GECA 3U4QB 1UM8A 1M2GA 1YNSA 1FFCA 1BRTA 3MF4A 5DFAA 4DNPA 3ABZA 3BTVA 2Y1LE 3LXXA 2YNMA 4GE3A 4PZ9A 3ZCTA 5K1ZA 2QSUA 5ECGC 3AR2A 3KRTA 4P22A 1A5BB 5JNTA 1II8A 3ER9A 1TA4A 4TQGA 4XUGB 3MG9A 4X41A 2OEVA 3WA6A 2V5UA 5T4YA 3L1VA 4I7EA 4F45A 4B3GA 5TQ0A 1HM5A 1OTYA 1ORIA 1RYNA 1G20B 1Z39A 2FOXA 5EKTA 3R5KA 1JEAA 3FHOA 4AZVA 5AM3A 1U7PA 3G3EA 4G0UA 2GPWA 2H6FA 4W9RA 3RUPA 3BIXA 2G1JA 1CQJA 2FW6A 2BKUA 1S1MA 4KIFA 3LHIA 2W2LA 3CF4A 4J7UA 3WNVA 1HG2A 3FUKA 4F1SA 3Q5MA 3HZZA 3VISA 4RSGA 3EDCA 4R1PA 3ZQKA 3D0RA 1HU3A 1C3JA 2A9JA 2ZBQA 2FO1E 1M54A 3TLZA 1PYGA 3LGXA 1I3MA 3D7KA 2PX3A 2OFOA