2VSYA

Xanthomonas campestris putative ogt (xcc0866), apostructure
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
547
structure length
547
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XCC0866
publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 208
structure length 547
sequence length 547
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsyA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsyA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsyA02
3TGOA 2GPBA 2SKDA 3OXLA 1WUYA 3MKRA 4BFCA 1JEJA 4LEIA 3LY7A 1WW2A 3IA7A 1UQUA 1NZFA 2HR2A 4KQMA 1JIXA 3CK9A 3BDAA 4NEQA 3LY9A 3S7FA 1QQEA 3OXGA 2O6LA 3CVLA 2KCLA 4APOA 2E2EA 4HOQA 4N3BA 2PYDA 4MHOA 4LEUA 1WUTA 4MICA 3TAXA 3MRXA 2NC9A 2QLNA 2G9QA 3QWPA 4WNEA 3LYAA 4FZRA 3ASGA 3C4VA 4RENA 1XOIA 3ULQA 4ME2A 1B4DA 5BW8C 4BWRA 2WQHA 3L79A 1WM5A 1WV1A 3Q3EA 3O3CA 4QLBA 3AS8A 4HLNA 4KBQA 4MI3A 1HXIA 1FCHA 3BCUA 5ENZA 4Y6CA 2GT1A 3ASHA 3DD1A 3AMVA 2KS6A 8GPBA 3CVQA 2VQ2A 5IKOA 1V4VA 1E96B 2QRHA 2DBAA 1E1YA 4EJ2A 4AMBA 2AMVA 2IW1A 4HWGA 4GPBA 4X7MA 4CGWA 2XA2A 5DU2A 4WNGA 4J8DA 3CVNA 3TOVA 1Y6GA 2KCVA 3E3NA 3CK7A 2BGTA 5FZQA 3QHPA 5IKPA 3N71A 3COPA 2KCKA 3MTAA 4YNDA 5HXAA 4XIFA 3ZGQA 2ECPA 2ASVA 2FFRA 1FU7A 1GFZA 2QN1A 3AS4A 1Z8DA 3RHZA 6GPBA 2ATIA 2VSYA 1BX3A 1C8LA 2PQRA 1UQTA 4RIIA 4YI3A 2QZSA 4KYOB 2G9RA 4AY6A 5LCWC 3U4TA 4I17A 1FTQA 5TMEA 1NA0A 3NF1A 3NC4A 1P2BA 2ACWA 4AIFA 2QNBA 2C0MA 4U04A 1XNFA 5FT9A 1AXRA 2UY1A 3D0RA 4G2TA 3WADA 2XMPA 3BEEA 4KQ1A 3S0JA 4AN4A 2GPNA 5GPBA 2QRGA 2QLLA 4CTOA 5CCMA 3ZCQA 3CV3A 3L7DA 4W9RA 5G05J 4I2WA 2H1HA 4BQEA 3Q15A 3BEOA 1ZU2A 1IHGA 3FWVA 4WNFA 3WXXA 2X0EA 4GZ5A 3EBPA 1GZ5A 1P4JA 1L6IA 2XPIA 1NVKA 3T3EA 1AHPA 4HORA 4KQ2A 2QN9A 3Q5MA 3ZCUA 2YJNA 2Q6VA 3DZCA 3FP3A 4GCOA 4J8EA 1F6DA 5EKQD 2XCIA 3VDNB 1NZDA 4MI9A 2JZCA 3OY2A 3FFLA 3G2LA 1HZ4A 1FU4A 4JA9A 4O6FA 4WUYA 2R60A 2G9VA 3S28A 2PQ6A 3H4TA 4RG6A 3DDWA 1ELRA 2GPAA 2QFCA 3H4IA 2FEZA 2R68A 1EM6A 5D0OD 2XGOA 3CEJA 1L7XA 2XCUA 3KD7A 1UZUA 3MS4A 1SXQA 2XEVA 4UI9K 1XL1A 3C4QA 4MHSA 1KT0A 3HYMB 4H7YA 4JA7A 4GYYA 5DBKA 1NOJA 3GUHA 4GZ3A 4N2QA 2Y4TA 2I6HA 4CDRA 3SF4A 3RIBA 4YUAA 4RG9A 4UQZA 2BUGA 4N5CA 1TJCA 2YQ8A 1IYGA 3D1JA 3MQFA 1ELWA 3HBMA 5KJKA 3MT9A 5G05C 3ZCSA 5LCWJ 4PQGA 5D01A 2C1XA 3BD6A 5A7DB 2C4MA 3NP9A 2QN3A 4YVOA 2QN7A 4W6QA 3UUXA 3CEQA 2IF4A 3MS2A 2IUYA 3TSAA 3GZ2A 1NLMA 4L22A 5I45A 2WPVA 4NQ0A 3G2KA 1GGNA 3MRVA 2VGXB 3CUVA 3Q3HA 1WW3A 1Z62A 2IEIA 4REMA 3VDMA 4RIHA 1M5RA 5M72A 1RZVA 2JJMA 3MV2B 4CTMA 4EL5A 3GW4A 4BQFA 2VYIA 4X7PA 3ASFA 3QOUA 1FTYA 3KS2A 4BTAA 4WADA 3ZCVA 1OUVA 3T3GA 1ABBA 4BT8A 4N39A 3K9IA 3LY8A 4NC9A 1K08A 3QKWA 2X0DA 4G26A 1IIRA 3T3IA 4F96A 1A8IA 5FJYA 3BD8A 3QDNA 3EDTB 4JHRA 1P2GA 4M7PA 4A1SA 1FU8A 4KXKB 4I9EA 3GPBA 2C0LA 3MV3B 3VTYA 2F3PA 4M60A 1XC7A 2VG8A 3SYRA 4GCNA 4N9WA 1WAO1 3QWWA 1W3BA 4G25A 5BT1A 3UYLA 5EX0A 3GZ1A 3S7BA 1PC2A 4EKEA 3Q47B 4U0ZA 4YI5A 2V5FA 1QKJA 2IFUA 2Q7FA 3L7CA 3BCSA 3WC4A 2F3UA 2XCBA 4GYWA 3MRTA 4EKYA 3S29A 2AV6A 5CHEE 4GPKA 3CX4A 5JJ7A 5HQ8A 2BFWA 2PZIA 1RZUA 3NAZA 4G2VA 3S7JA 4GA0A 4MI6A 4G24A 2SKEA 3OKCA 3T3HA 3NCHA 3T7DA 1J39A 3JYSA 4J0UA 1O6CA 3MS7A 4U0SA 3RO2A 5KJLA 1L5QA 3E3LA 4RIFA 2YHCA 1RRVA 3D0QA 4UI9J 2VSNA 1L5RA 2HO1A 2X0FA 4GZ6A 3Q4AB 3UPVA 4HOTA 2PQNA 4B94A 2C2LA 2ACVA 2R66A 3MSCA 3RJVA 1NZNA 3CUWA 3NB0A 2IV7A 5EX3A 1IXYA 3CKCA 1XKXA 4I9CA 3NP7A 3S27A 2OOEA 2PYIA 2QRMA 1C50A 4M83A 1HLFA 2X6RA 3MEKA 1L5WA 3C48A 1C8KA 2BGUA 3RT1A 2ONDA 1P4GA 2PRJA 1JG7A 2QLMA 2R5SA 3L7BA 1P2DA 2QN8A 1A17A 3OKAA 1NOKA 1Y6FA 1KLXA 3URZA 2KATA 3DDSA 3CUUA 2FF5A 5ARFA 3ZPJA 2H1FA 4IN3B 2LSVA 2F9FA 1GG8A 3IEGA 3CUTA 1HH8A 2MHKA 2XGSA 3ZHEA 2F3SA 3OY7A 3PE4A 4AMGA 3PDNA 4WHMA 3VUFA 2IYAA 4X7RA 3QKYA 1FA9A 3ZN3A 3HBFA 2LSUA 3PE3A 5CCLA 2BISA 9GPBA 4UQXA 4UI9C 4EQFA 3T5TA 1GPBA 2ZB2A 4XI0A 2FO7A 4XI9A 3RSCA 1P5QA 4RIGA 2WTXA 2XCCA 4EL0A 2LNIA 2X6QA 2C9ZA 2OFFA 5G04C 2PL2A 4WNDA 3L01A 4G23A 1PSWA 3CEMA 3ZCPA 4U0UA 2XA1A 3LPZA 1XL0A 3SYMA 3TG4A 1WV0A 1E4OA 3S2UA 1PYGA 2HYZA 4N2SA 2IYFA 5TMDA 1EXVA 3G2HA 5ARGA 2G9UA 1PN3A 2QRQA 3BD7A 4X6LA 3CK8A 2XGMA 2C1ZA 4CTNA 5KJNA 1XV5A 3QWVA 3OKPA 3Q3IA 1LWNA 3ZCTA 3GYZA 4HOSA 1K06A 1YGPA 3ASDA 3RSZA 3RKVA 4CGVA 5A6CA 3MT8A 3VUEA 1JG6A 4N3CA 3WAGA 3HBNA 5TVGA 4BTBA 5FTPA 2FBNA 2UWJG 4UQYA 4FKZA 4ABNA 2AVPA 5TMBA 4F3VA 3CVPA 1JIUA 3FROA 3MTDA 3MT7A 1JIVA 5LQDA 1NA3A 5JJ6A 4F9FA 1YA6A 1SXPA 4JL0A 2FF4A 3ZCRA 2UY1B 3LKUA 4N3AA 3R9AB 2VGXA 2GJ4A 3MA5A 2IV3A 1LWOA 4I1AA 4F97A 2GW1A 4J8FA 1FC0A 5DLDA 4G1TA 3MBOA 2SKCA 3SZ7A 4I2ZA 3S7DA 2IEGA 3G2JA 2KC7A 3BCRA 1ZBPA 2J9QA 1QM5A 3OXFA 2QN2A 1YA0A 3Q49B 5C1DA 1VGVA 4NESA 2P58C 4H7XA 1Z6QA 3G2NA 4BQIA 1Y8MA 2GEJA 1FS4A 3IAAA 1F0KA 4GA2A 2FI7A 3E3OA 1B89A 3ZFWA 3KAEA 1GPAA 3L7AA 7GPBA 3HBJA 5AYWD 3RO3A 3OTGA 2AW3A 4LDPA 3O48A 5FZSA 2VCHA 3UYKA 5G04J 5BNWA 2PRIA 2VCEA 1KT1A 3TG5A 4WACA 5DXFA 2AZDA 1PNVA 5JTUA 4GA1A 4U07A 5HI7A 5JTTA 4RELA 4Y6WA 3E4BA 4AM9A 1Y8ZA 1Z6PA 5KJMA 2GM9A 2R4TA 2VGYA 1GPYA 3T3DA 2HY7A 4Z5XA 1L5VA 3NPAA 3ESKA 5DIZA 2P6PA 2QRPA 3OTIA 3G2IA 2R4UA 2JLBA 3RU0A 3LCAA 3ZHEB 2FETA 1QZ2A 2Y4UA 4HOUA 3OTHA 4YVQC 5D00A 1P4HA 5JJTA 3EBOA 4NRHB 2GEKA 4BT9A 1H5UA 3MTBA 2XA9A 1P29A 3OT5A 3AS5A 4MRAA 3CKBA 4GYOA 5FZRA 3U3WA 3CEHA 1NOIA 1C3JA 1FTWA 2F3QA 4RIEA 3CV0A 5D0QD 4RBNA 3UQ3A 3CUYA 3VTXA 4AY5A 2L6JA 1L5SA 1KTIA
chains in the Genus database with same CATH superfamily
1JF8A 3X2SA 1FBTA 4YWJA 4B7UA 4JW1A 1NV8A 1WVMA 1AS2A 4YX9A 3NB2A 3OCUA 2JGDA 1J06A 4DDUA 4DMKA 3LUBA 5F78A 2ZTVA 2Y0PA 2ZJ4A 2CFRA 1DWUA 4RORA 4QECA 4QQKA 4H1TA 3RYIA 5F1YA 2MU1A 4Z54A 1Y6GA 1UKEA 3MPUA 2BHTA 3S2YA 5BUZA 1V11B 3M5CA 4WMLA 2GZ1A 2Q5HA 3V48A 5L53A 4UTOA 3PT5A 3OIVA 1O0BA 1P61B 3G88A 3Q3CA 4G2TA 2O2DA 3Q3VA 5TR9A 1K5PA 2BZ1A 1E5LA 1VL2A 2KW5A 4K8RB 2G9ZA 1HDOA 2RHJA 3BWBA 1WP4A 1IHPA 1VSUA 2CMDA 4BPRA 3E9QA 5KYWB 2VQSA 3A2MA 2X8WA 1A88A 1OLSB 1KJ9A 1I9CA 3PHHA 4MQUA 1TZCA 3RT9A 3PC6A 4NU6A 3CEJA 5ENTD 1MTOA 1BSVA 5EJMA 1ZD8A 3KR0A 4ZIRA 7MHTA 1OB5A 4NENB 4CDRA 2Q0SA 1KIMA 1YQQA 5G0WA 1D2MA 5HMLA 3B7BA 4FVTA 2Z4TA 2CL5A 4Q6WA 3NP9A 1YDHA 4W6QA 4DIFA 3LO5A 1KRXA 2HA0A 4RLSA 2ID8A 2G72A 3DJYA 1PSDA 1IWBB 3DXMG 2O3TA 5FPQA 3LDAA 4YA6A 3RAEC 1DLJA 4HQ6A 4G67A 1U0BB 3T4PA 1NBIA 7ADHA 4DGQA 3GPBA 3SQMA 2QD5A 5JDCC 1F8FA 4XYGA 1T5BA 3G3EA 2F1HA 5A5EA 3HXOA 1NASA 1WY5A 4ENPA 2B9EA 4CG1A 4X91A 1YF3A 2B0JA 5IC5A 2QORA 1OHHA 3P9XA 4JX8A 4C0BA 4GEGA 3EXIA 4RVBA 1IY8A 5DNWA 5CVJA 1EX6A 4GPIB 2Z2YA 3W2HA 1EVJA 4CMCA 3UK7A 5F7ZA 3O4GA 1JAXA 3EIWA 3IUSA 3OPXA 4YECA 4U63A 4O4IA 5KAMA 2NUPB 1O95C 3FWKA 2ICAA 3GFBA 3TOZA 1UXIA 4FFDA 4DG5A 3CW9A 1AGPA 5AHKA 4BE7B 1KQOA 1KOFA 1SH7A 2ZTMA 2JCGA 4OVKA 5BMOA 1ZOSA 1GPBA 1L5LA 1I1QB 2VP2A 4YRAA 4EJSB 1NQ5A 1DDGA 1MA3A 2YHIB 1L7OA 2GBLA 3EG9B 1LJ8A 3FPSA 2JLRA 5EVCA 2ODAA 3ZCTA 4CKBB 3OVMA 1DGQA 4KPEC 5TV2A 3PUXA 2MSCB 1KR5A 1K3TA 4FU3A 4QJ5A 3MT7A 1CERA 3ZHBA 3ENWA 3W3AD 2PUGA 1NT4A 5FUVA 1INLA 3ZYQA 1M1YB 4AZ0B 4MUBA 2NPOA 3RRJA 2GFHA 1RABA 3R0ZA 2RGRA 4M0LA 2AZTA 4GGMX 5CERB 3WHIA 4BGIA 1D1QA 3V4LA 2IOQA 2WXLA 3SF0A 5JS6A 4R84A 5FL7A 2CLOB 2XOKD 3ANMA 3GX1A 9LDBA 1O97C 2XOEA 5IXJA 3L16A 1T5HX 3EC2A 5I4KA 4IIJF 3N8GA 1UFVA 1Y1TA 1VI6A 5CHEA 2BFFB 5FD8A 3R9WA 3LWDA 2P9FA 4QU9A 3ZHSA 4CKEB 3DE6X 4ZO8A 5FTWA 1CULC 4M9QA 5A4AA 3A36A 3AESA 4I6JA 3WG9A 5AT1A 4YCJA 1G9SA 5ADUS 3VISA 1SKMA 8AT1A 3HNPA 1T34A 3KQMA 3COYA 4BQQA 1H23A 3FVQA 2VEOA 1CIVA 3QV1A 1WPQA 3ISVA 2LW7A 3M49A 4IJMA 3BCUA 4Z4IA 2CLMB 1FOEB 1QSGA 1ST2A 2HAEA 1EWRA 3O26A 5EVJA 5CFQA 1CUSA 1CHNA 4W1QA 2JKVA 4LC0A 1ZAKA 2OHJA 2Q9UA 4Z1MA 1W581 4P8RA 1EFTA 5A4FS 3I9NA 3EGDB 1E8ZA 3C8ZA 2J08A 3SKXA 2VSYA 2OA0A 1DCQA 1YCSB 4YIHA 4XASA 4JYCA 1EG2A 3R8XA 1XGKA 4BB6A 2X8AA 1A98A 1UBUS 2Y4OA 3QE4A 1TNDA 1IXZA 1AJEA 4DDWA 3PNQA 4J6IA 2IA5A 1H0RA 1ADFA 1TAHA 4PRKA 4GOLD 4RTRA 3NHUA 3WOVA 2IIBA 3UIEA 4X90A 2QX6A 1ZI8A 1N4RA 1ML3A 4LXGA 1VPVA 1ZM9A 4PRYA 1JMKC 3TTWA 5IARA 3I92A 3FOWA 1SO8A 3F3YA 3VZDA 4DHWA 6AT1A 2FEZA 3T7TA 3F4LA 4YO7A 4EEKA 3R0IA 5FAKA 2NXWA 3QUAA 3AQIA 1RCUA 3FNGA 2JHPA 3IP8A 4QYSA 3FCXA 3HKEB 2GAIA 3PQFA 4WCFA 5EC8A 3PHCA 3USZA 3KTOA 1E2IA 1U8YA 1XYGA 3S2EA 1EP1B 2WUEA 2F3PA 1G20E 4NZMA 1S64A 2D2FA 3V9PA 4PLFA 1AIPA 4DEYA 2Q4BA 2F6RA 1ZSYA 5EJEA 3H99A 3E84A 3FMVA 1D8DA 4XOIA 2V54A 4CFSA 4AUKA 3QHAA 3FKQA 2RHBA 5JMWA 1WZEA 1V43A 2BY4A 2QJOA 1E59A 2BFPA 1RAGA 5H4GA 1RCTE 1YTUA 1H5NA 3MUFA 3NH9A 5ED0A 2XYGA 5C7YA 2IOHA 2XQVA 1YQTA 4ZVTA 4KDFA 5CFZA 1ULZA 3IHYA 4A3VA 4DCUA 2A5JA 3PIDA 4H0FA 4CZ2D 1FUYB 1HLPA 4BIMA 2IEAA 2OV6A 3K20A 2YTZA 2XMBA 4OD0A 4EKGA 2O2CA 3RJZA 2C8VA 5AOBA 3ZHEA 4K6CA 1RW2A 2BFDB 3R0XA 4L74A 3N5KA 1FA9A 4BNXA 3CGGA 2CXPA 3AR5A 3B1JA 1UKZA 2OBYA 4M54A 3ADOA 4MVJE 4XUGB 1NW4A 1SBZA 5JW6A 4HFNA 3AEKB 3P0HA 3RS8A 2C1ZA 3WGGA 2JIPA 4IIVA 5DGIA 3VYUB 3W7BA 3MX3A 5ALUA 3BGIA 1Z0UA 1NYRA 1ZN8A 4FDMA 2BPOA 4GQAA 5HSGA 3ANTA 3FDHA 2Q4RA 4EB6B 4EELA 1R0RE 1DTSA 5IAJA 1JR3D 3KSRA 1I6MA 1V3VA 4DR6B 3G0GA 1GUDA 3DFIA 3SC3A 3UXYA 3AC0A 3H5NA 3P0EA 1BXKA 1MDBA 3BU8A 3NOVA 2V1XA 4Q9LA 2FO1E 3BDIA 3GDHA 3RO3A 2BHSA 3U13A 3DAHA 4QIHA 2IF0A 1F17A 1N6KA 2LBPA 1Z5ZA 1Z8FA 3U81A 1PDOA 1HDXA 1UDAA 4ZP1A 1GHTA 3PP8A 2FNAA 2FSVC 4MW1A 1YJAA 5I7EA 5KPDA 3EDMA 2BFEA 1XDZA 1PGJA 3IOEA 4GGOA 3THOA 1OROA 1PL7A 1GQYA 2O6LA 4AM8A 2IHTA 3TWOA 2EIME 3IEMA 4GR4A 3GDFA 5TPWB 4UE6A 2C5BA 4B71A 2ETVA 4ABYA 4UXIA 3FTPA 2YXDA 3I0ZA 1PZGA 3HH8A 4NIMA 2RH8A 5JECA 1LS6A 1X1CA 4OJNA 5FTMA 1EJBA 2YVAA 1OKKD 1L5FA 2AUNA 5BMVB 1R6DA 3AS4A 2GS9A 1GFIA 4KPFC 2A58A 1M33A 4PTZA 4WWPA 3O3OB 1RAFA 1PO7A 3C70A 2YZMA 1BC5A 1W88B 1UQRA 3ZDDA 1E9VA 1Z39A 4LV5B 2V9PA 4HVBA 4TRJA 4W9RA 2QTCA 2QY7A 5A4IS 3WRXA 3GC6A 1U2SA 2FR0A 2WAAA 4R2IA 3QNMA 3WGZA 1Q50A 4HR7A 5K4HA 5EPOA 3I2FA 1UZLA 2GRAA 3M33A 3FFLA 2J3JA 2IYZA 4DWVA 2OZVA 4BSXA 1A2BA 2ZIAA 5GZ6A 3EK2A 2QSZA 4CBVA 2WJ3A 3AJEA 1I3CA 3TSWA 1U98A 4H7YA 3RODA 1SCUA 4EFNA 1IY1A 2Q62A 4X1IA 4H0CA 1JQAA 2QN6A 4NACA 2EBWA 1Y1LA 2JGKA 4FZJA 3BD6A 2EZTA 2ARKA 1UJ5A 1CYDA 3O3MB 2A5DA 4GUAA 3GRKA 4GKKB 3VYSB 1TKAA 1DINA 1JXMA 1CF2O 2JBAB 1E9DA 3LRTA 1AZWA 3L82A 1HFAA 1QGOA 5ALXA 1XMVA 1XPUA 3FOCA 3X2EA 3NANA 4BNGA 5J08A 1J56A 1GA6A 2WJYA 4DA7A 2GNPA 1KE1A 3QDNA 3NIGB 1H0HA 3GGCA 1SUWA 2ERXA 4OQXA 4GTSA 4C01A 1NIPA 2FWAA 3Q4GA 3ZDXB 1H6OA 1DQYA 4I50B 3H8SA 1KEUA 3F5MA 5FO0A 2VBGA 2WZCA 3BMQA 1QVVA 3HJUA 4X8MA 3T7DA 5ICCA 1QHHB 4PQRA 1QIMA 5EPEA 3STTA 1VCHA 2R47A 5IWAB 3T5DA 4L4UA 3OIGA 4I9HA 1HL3A 1PJQA 2O3JA 4EHKA 4ZKDA 1MHPA 2EHDA 5IVHA 4EBAG 1G5RA 1CS0A 2CYAA 1XK6A 3KB1A 2HR1A 1DIRA 2ZJ6A 4LUNU 3I2JA 4Y1RB 1BNCA 1LU9A 3FLBA 3DSXA 3KP1A 4CKWB 1DO8A 3MCXA 5CJJA 3I52A 3JY6A 3DOHA 2VO1A 2RHCA 2WJAA 3I01A 5FHRA 2CHWA 3U4DA 4KXNA 2DQSA 3OTOB 1YNSA 1D1TA 2BTOA 3FWNA 3AKCA 3SF8A 4OAVB 1IEXA 1O5MA 4ZEWA 3U3ZA 1B93A 2ZDGA 3L8ZA 3IVGA 2WB4A 1WSWA 4E7PA 3CK8A 4L27A 4BFZA 2ZRNA 4LNAA 1TC1A 1XNGA 2WM3A 3PXUA 5CBPB 4PC7A 3G8AA 1BMTA 3H5OA 4QUIA 4MV4A 2H54A 4NNJA 3QY0A 3D6UA 3TIVA 1T6ZA 3LL4A 3WWOA 3ADPA 2J7PA 2MOKA 4QUDA 1TL7C 4LK2A 4GLFA 3IJEB 2PS3A 3PVZA 5J59A 1Y8MA 3IUBA 4U7WA 4FWTA 2WXOA 4H7HA 3IMCA 1U4SA 4BDSA 2JEKA 3U3OA 1KT1A 4GXTA 1MB9A 1NUPA 1U3FA 3D6JA 4Q4AA 5D5QA 1Q57A 4LXYA 3JQRA 1GZVA 4I55A 3VAYA 3WWZA 1WHTA 1G9TA 3DEIA 4UD2A 3CYFA 1RWQA 3TFQA 2GPBA 2Q46A 3EQ6A 4V38A 2XDYA 4HJXA 3NHYA 1NXXA 2O59A 4I4TB 1VG1A 1MFZA 5DB4A 3KSAC 3AHEA 1UAGA 2H7CA 3WHPA 2GEBA 2OB1A 2VNAA 2C96A 1YK1A 1I7LA 1OB2A 2ZRAA 3NM6B 3VTAA 1MB3A 5K3SA 2AN9A 2XNDD 3FHCB 4K6FA 2FDRA 3ZU4A 5DDIP 4RQUA 2CFUA 2YWJA 1MZPA 4X6UA 1EUDB 3GZNA 4O08A 3JATB 4BWGA 3FGPA 4F7WA 3NZEA 3N2GB 5I7WA 2Z5LA 2BGTA 4PGGA 5BXOA 3CFYA 1JMYA 1JQ5A 3ZGQA 1CNEA 2FFRA 4HQLA 3GGJA 5IABA 1D0SA 1ACMA 2JFGA 1RR6A 1M2GA 4RVHA 2NYRA 1E1QD 1U9IA 1I4DD 5KTPA 4RVDA 4O4JF 1MC1A 1NF8A 2P11A 2PYZA 1R6VA 3OT1B 4IAOA 1XQXA 5C3MA 1IVNA 2PQ6A 2YFHA 3TDKA 1YDMA 3IIJA 3A28A 5ERYA 4Z3OA 3CR8A 4C0EA 3O47A 1H6AA 3LPCA 2A78A 1NI5A 1HX7A 2H5IA 5BN4B 4DUGD 2YQ8A 1UPXA 3VSEA 3C3OA 3R9KA 3AI7A 2BCJQ 1BHO1 3VJKA 2PS0A 1VL1A 3UMYA 4HGOA 5BSHA 1PUXA 1N1MA 4JH0A 4ND4A 1KFEB 3I01M 3ZK7A 3NALA 1AQIA 2YYSA 4NYIQ 2DUMA 4F8JA 3LT0A 2IS1A 2C2MA 3FFWA 3AP1A 2FP4A 4KQ6A 1Y3BE 3F46A 2HHCA 5KC8A 4D10C 2VJKA 3A9SA 1SZJG 2JLQA 13PKA 4Z0PA 2XBUA 3HKBA 2ETBA 3JQ0A 1AZLA 3DSUA 1E60A 1Z26A 3VYTB 3GGSA 1WDTA 2PNFA 1KDZA 1M34A 2QAIA 3TLMA 5DSTA 5KYUB 1JPJA 4NPHA 3EWSA 2YWGA 2QBYB 2NO7A 3U7JA 4NCBA 3AG2E 3V00A 3QE2A 3FOFC 4QKQA 1REQA 3UPVA 2C7QA 1ZIDA 1S63A 4X20B 4DL9A 2EKLA 1NZNA 5AVRA 4Y30A 1M8PA 1V9SA 5K4GA 2O05A 4RZIA 1EM8B 4JHXA 4HAOA 2C98A 5F23A 3B85A 3IEIA 1WF3A 1O89A 5F77A 1ENPA 4BNDA 2C5HA 2VRBA 4ES6A 1L7DA 1PYOA 1QAMA 2YMQA 3CLVA 5KCZA 4FMDB 4FDLA 2CB9A 3CBQA 2NLOA 4YPFA 5JEDA 3UGQA 3IHVA 4K5BA 1JW9B 3X1MA 4V2IA 4XVCA 2DR3A 4YK7A 2HX1A 4P58A 5DBGA 4ZCTA 2IYNA 4EHMA 2P3SA 4C0AC 1Z38A 2XECA 1MKYA 4PLYA 2ODEA 2VAVA 4Q47A 2UXBB 2K87A 5DGCA 3KUDA 3HBNA 2H2AA 3WKAA 3LSTA 3O91A 1QHYA 3ET5A 2MSDB 5AOAA 4HMPA 1JKIA 1T0HB 5I4CA 4KXVA 1RP7A 4Z4QA 5ANLA 3FRIA 3Q11A 2JCSA 5DM70 3UXHA 5DM2A 3R7AA 5JAQA 1HF3A 3K0FA 5HQTA 1SVOA 2GARA 3ETNA 1ZK3A 2O5CA 3QVJA 2N3ZA 3AETA 3ZC3A 1E0JA 3D5TA 4GTOA 1AQYA 3AINA 3NBYC 1J0CA 4UMVA 2FWBA 4JT9A 2Y4UA 2BKAA 1UXOA 4I0WB 3RHSA 4LK3A 1PJ2A 3AS5A 2LWIA 2NGRA 5HDBB 2Q6TA 3MAJA 2CKMA 5AVWA 4EGQA 2DF8A 2PL3A 2C78A 1T24A 3DAGA 5DRYA 3H5TA 4XLLA 4QBTA 3BTUA 4KYTA 1W4BA 2R6GA 2C61A 2M2IA 4N76A 3DZHA 1XYYA 2FEAA 1IOVA 3VBCA 2DT8A 2IY0C 1M1NB 1XEWY 2H1VA 1KA9H 4N3BA 2ORWA 1FDUA 1M1UA 1RWWA 4GMXA 2BLLA 4ALKA 1C30B 4URWR 2GZRA 4MI3A 4LF4B 2YC4C 5A0TA 5IAGA 1SPXA 4X0EA 2O8EB 4Z2YA 2EFHB 2QLBA 2C92A 3TQRA 4CGWA 1W5BA 1I32A 4HAXA 3WZ2A 2XVAA 4G9BA 3HA7A 1CDEA 3WI7A 4FWBA 5E2AA 3F9CA 1WRBA 5GIPE 2AB0A 2C1EA 5C53B 5BW4A 3HLTA 1IOZA 1E4EA 1LS1A 3NF1A 3PRKE 1J2JA 3V97A 2OXTA 1XMSA 1FLAA 2V1UA 3V32A 4KQ1A 1N3IA 5COQA 4XX0A 2C00A 4JBLA 5C34B 5E9AA 1EFVA 1XF1A 5C31A 4CV0A 1E66A 4FGZA 3UHAA 4MVJH 2O06A 3SAJA 3NTUA 1U7HA 5DX1A 2B82A 3C2QA 1XCJA 4QSMA 3H4TA 4LRWA 2BI8A 2NV0A 3OCJA 3G68A 5SICE 4AU1A 3ORFA 4NY1A 4X84A 4ZVMA 5ITVA 2W6NA 3LK7A 3HV0A 3I6QA 4LMPA 4P38A 1T1SA 1CRLA 3WGNA 1IJEA 4HAZA 1XZFA 1A5AB 3PLRA 1DKMA 2H6EA 2QN3A 2PBZA 4MINA 3MS2A 2FVYA 3HSKA 3UPUA 1MIOA 4D3XA 4BASA 4QVGA 4EPTA 3HRIA 3HJCA 4P3NA 3RLIA 3ZQ4A 1ABBA 1HUQA 4EOGA 2DJ5A 3PG5A 2JCYA 4I9EA 1RBZA 3E30A 1BRTA 2C5AA 4KO3S 3DUWA 1NURA 3WB0A 2EATA 2JAWA 3CMCO 4AD8A 3CX3A 5B53A 2R11A 5G0SA 4BJ3A 4JYAB 5LKRA 5ICSA 2HF2A 7REQA 4ARIA 3FEXA 2ECOA 3OQJA 3W5UA 5AJYA 2HSWA 4IOJA 1Z34A 3O8QB 4P4NA 1L7VC 5B3JA 3EMVA 5KTNA 2E82A 3IAXA 5F4BA 1Q12A 4JOCA 1W73A 2X6RA 3EGCA 3RRBA 3TZCA 3DAOA 3OEYA 3B8EA 3RBVA 1TJ4A 2LSVA 3GEBA 3L0YA 1VIVA 3VLEA 1J8MF 2CHZA 2F3SA 2H17A 4AQDA 3T5AA 3VNRA 1OT8A 1ZD4A 4TYMA 1QRTA 5HP4A 1CQIB 1RTTA 5A23A 2QUZA 1IZZA 1N0WA 4WUTA 4HX5A 1V6SA 4PV7A 3RRYA 1E3SA 1M2OB 1WG8A 2CCGA 3K9HA 4CT5A 4ALNA 4ENQA 4HQOA 3NXKA 3S6JA 4P5EA 4FCCA 3ZD9A 5L6MB 2ZBVA 3CRNA 2O0KA 3VVBA 4N3CA 3W4JA 1JXAA 4DUIA 1R6BX 2Q7XA 1YBHA 1F8XA 2GWRA 4IRXA 4EGAA 4I6EA 3QBDA 4H7IA 1KMNA 4B76A 1FVOA 1AD2A 1Y8RB 1XXHE 2M63A 1E6WA 3K0EA 3L22A 2DM6A 4KWTA 3T94A 2HSZA 2XRYA 1P7VA 5FYDA 1D4FA 5HG0A 3DE2X 2HD4A 1FS4A 3DEJA 3H8JA 4UNPA 3ZY4A 2H5EA 5AIAA 1H19A 5AYWD 1Y98A 4XWGA 4B1FA 1YL5A 5IEJA 3HZHA 3BIXA 3LZ6A 2HJRA 4FSDA 4NOKA 4TS3A 2DWQA 1HNNA 1MN6A 3TKYA 5JJTA 4FHEA 3AONB 1PT6A 3A4NA 4OHUA 1B8OA 4ZVVA 2HK9A 2FHSA 2ZGGA 4AJ4A 2OKGA 3HACA 1SVSA 3EIHA 3RUAA 1G18A 2VWQA 3W3AA 2O1EA 5BQXA 2XXJA 5EUQB 5J2TA 3ZZMA 2QL6A 2DMRA 4V3BA 1GGFA 1KY4A 3RRMA 1CY1A 3ZJYA 4A23A 2L9BA 3N8NA 1TTTA 2PGOA 1G3MA 4IVRA 2PIAA 3EEFA 5E4FA 1BGVA 3M5WA 2GZAA 2IHVA 4X7MA 5HVNA 3CVNA 3RUDA 5MFPA 4EWLA 2IZ5A 2ZRKA 3MAGA 4HDMB 5FZQA 4LAFA 1UANA 4YS6A 2PGLA 3QEMB 3THYB 2ZGVA 1DQRA 4ZARA 3IS3A 1NBOA 2QUJA 5IW8A 2DECA 2F8YA 5AWFC 1LDNA 3JAWB 4UZEA 3GD5A 1P9OA 3HP4A 4II3A 3VJLA 4ZGBA 3KYDB 2YW2A 1CT9A 4LF8B 3GEMA 4YP9A 4RCVA 3RK0A 10MHA 4ZAVA 2Y1EA 4XFKA 2I0FA 3DNFA 1YHYA 1Z0FA 4KQ2A 4A82A 3ZY2A 2PT9A 1NBME 4PR3A 4TGLA 3K5PA 3FTNA 4AIIA 5KS2A 2VDOB 4O1IA 4EUKA 2W2TA 1COWA 1EYZA 1NOJA 4AG6A 2VPIA 3AL0C 2FR8A 1TC2A 4EGCB 1LJLA 3FBTA 5CT5A 2GGSA 2LUOA 3WLEA 3C72A 3HN7A 4DNPA 1DIAA 4ZCLA 1VXOA 2OP1A 3PRYA 4RMJA 2PSEA 1WQ1R 3ON5A 2ZWVA 3H6HA 3LM8A 2OWDA 5EINA 5C35A 4GTPA 3C98A 4MH0R 1BRMA 1RPAA 1K97A 3A6PC 1EUCA 1I0ZA 2PQ0A 5ENDA 1B3BA 1DZ3A 4N82A 2C97A 5COBA 2DHEA 2GQ0A 1SBIA 3KU4A 3K6SA 1ZMXA 3H87A 1KGSA 5BP7A 3TKLA 4EKEA 3PPWA 5BPHA 3HCBA 3AR4A 4LRSB 3UNXA 1KXJA 5JA4D 4U2KA 3BCSA 1I0LA 4CR6A 1OWNA 4GOXA 2OVFA 3PRZA 4IDNA 3IAHA 3VH1A 3SNXA 1YJ5A 3I61A 2ZRGA 5DE3A 5K9ZA 4QOFA 4PLVA 3L6CA 2ACVA 1HO8A 4QASA 1CS4C 4BY6A 2JJ1D 5DKFA 5DNAA 4EUHA 4O4IF 3UMSA 2VTEA 5JO0A 1L4NA 3W8RA 1UFQA 4RS3A 2R5FA 4MQ5A 4ZT6A 3OA0A 1Z4OA 3NRBA 5CM9C 1YE8A 2WU4A 3W5IA 2PSJA 2GHQA 2HIGA 1WOYA 3W3ZB 2GB4A 4ZI3A 4CLHA 4DJFC 4CFZA 3G7SA 1W1IA 2AXNA 4QPJC 1UZAA 4G4IA 1DJOA 1SQ6A 2BM0A 2LAIA 2PQMA 5GAJA 4DLVA 2YJ6A 4E11A 2O2JA 2XZOA 4IH1A 1SC1A 4BFYA 3UV3A 1OZAA 1XCBA 1D5WA 3E23A 5DP1A 1T91A 3QWHA 2YKGA 4XA8A 3L4SO 4U8VD 4CZ2A 2XMQA 1NZJA 2G4CA 1NHGA 4YXWA 4RTOA 1U2EA 1UOHA 4BVEA 2Q6OA 1EFUA 4O4HB 2VIIA 2B5OA 2P27A 1YU9A 3VHXB 3B3JA 3L46A 3S40A 4V03A 1OVMA 5IVPA 1EQ2A 1UBHS 2RE8A 2R5NA 3F90A 5EJIA 4UTVA 3SS7X 1BKSB 3KKLA 4ECEA 4PN7A 3JSAA 4AG5A 4YGYA 4R5HA 1IHDA 2GRQB 4MAAA 2O3UA 3WIVA 1S0UA 3I64A 4W7HA 1X2EA 3UQ3A 3NBUA 4FQ8A 1A9XA 4NCHA 2O0JA 4E07A 1M1ZA 3Q7SA 3QTTA 5L3VA 2EJBA 5BT8A 4GL2A 3LC0A 1L1EA 4UU8A 3C5HA 1QOQB 4Q3DA 2ASEA 4B6EA 1PD0A 4ME2A 4K9RA 1NI1A 3CVYA 3CRW1 3AHFA 4NDNE 5IT4A 3IV0A 4HDAA 2ZDQA 3DD1A 1XZNA 5CT4A 3J80A 4Y0VA 1KOLA 4EA9A 2BLNA 1N2XA 2REOA 4QPCA 3A4VA 2OSVA 5DT9A 1IBCA 1H2FA 5IT0A 4AZWA 1IPEA 3H2JA 4V1CB 4PH4B 1O94C 4Q48A 1SCQA 4LJ5A 4CEJA 3DTTA 2VJLA 2AZXA 1SHJA 3NEYA 1MABB 3Q7PA 4Y2JA 3QELB 5FADA 1Z2DA 1CIPA 1HTBA 2XE8A 2LCIA 4DE5A 1KKMA 5YASA 3QYJA 1H3FA 3ZJVA 1F6DA 1P77A 3TW8B 1EFRD 2XUKA 3WYDA 5E1OA 5BRJA 2I6XA 2CHGA 3MS4A 3GFVA 1KHTA 3ET4A 4ZT5A 4QJBA 3VR1A 5KVVA 2NUAB 3DO8A 3JVEA 3UFBA 2HLPA 1NULA 4D81A 1PJ3A 4HDSA 1K0FA 4H3KB 1N94A 1DARA 1J7JA 1KAQA 2J3KA 4WEOA 3GFFA 4NZZA 4FHZA 5ECYA 2Y68A 3BGWA 1R9MA 4UHHA 1JX6A 5AXAA 2YV3A 1AKEA 3RWBA 3UPDA 2UVPA 3VU9B 1J0EA 3EPRA 2NU7B 1WR8A 4BEPA 1O9BA 3LDUA 1J0DA 4HRNA 1YNOA 4ILEA 3SYRA 4RPCA 5BT1A 3IH5A 3KO8A 1CTQA 3G5TA 3RJMA 5HJ2A 2CVOA 4HYYA 2VTDA 5SZKB 4MI6A 4BUZA 4ZN6A 4CM8B 2A30A 3E2PA 4H7EA 5KNCA 4X1KA 2CYBA 4RV9A 1UJKA 3QK0A 4HOTA 1WY6A 1ISMA 1D4OA 2FUCA 1ZIXA 2VNKA 4IIJB 2H57A 4JJZA 4MW6A 2X13A 1Q14A 3LTEA 1BKYA 2FOLA 2YQ5A 2I29A 2C57A 3HBAA 1W4LA 3MTJA 4WZBA 4QOSA 3KK0A 3K8ZA 4HH4A 4KGDA 1IXRC 2PH1A 2JI8A 4AULA 2ADFA 4G4JA 3HYSA 1HH8A 2PIDA 1CJMA 2MSEB 1KNXA 1GWNA 3BF7A 2B0CA 1T2EA 4QG3A 5HJ7A 1KO7A 2PSDA 2UDPA 2X7XA 1XP5A 5KKAA 2BW0A 2Y99A 2TECE 4QPZA 5E6UA 5GV7A 3FH8A 1YIDA 2Z83A 4LYYA 2XY4A 4BDTA 1X7DA 2W8ZA 3OX3A 4L9SA 3BD7A 4HBDA 4D9FA 1WDMA 4CKYA 4MVJP 1APBA 2CW5A 4RSHA 5CFPA 4K3UA 2E4ZA 1RWXA 5DTIA 4OBXA 2GN8A 1TCBA 1E8DA 2GW1A 5EXDA 5BNTA 3VZBA 4DM7A 1E3WB 1RXIA 2Q1SA 2IEGA 4EM6A 1VGVA 3TGWA 3AU8A 4JI7B 5L7TA 5J5AA 3MGKA 1E9EA 4HS2A 3SFZA 1J0XO 4DCGA 3TMYA 2EAUA 3R6TA 3SS8A 4J0QA 2HQ1A 4ZOLA 4IIXA 4B4OA 5KTOA 5BN5A 3L40A 2XB4A 5EZYA 1GARA 3U7QB 1GPJA 3OZSA 5D2MC 4K05A 3RQSA 1WU8A 4OHOA 4MYSA 2QIPA 3QUCA 4HEA1 3MWDB 5FZRA 3EPHA 5DYGA 3DCNA 3GG2A 1Y6ZA 4UHFA 1SU8A 4JEMA 4W8OA 3AUUA 2VDRB 4KR3A 2FRXA 3ZDZB 8ABPA 4OI0A 2REQA 2QLNA 1E2NA 3ZGVA 1AKYA 4OYLA 3RVOA 2GLUA 5G02A 4LDNA 4MLDA 2W90A 4DR3B 1FSPA 1K7FB 2IZ6A 3AYZB 1N8SA 3JUEA 1E96B 2YOFA 2WJJA 2VTBB 2AMVA 4NU0A 4N40A 2XF8A 2Z0MA 3JQAA 2XQGA 2XIJA 3I4CA 4GPEA 4P3KA 3OZIA 3RAGA 2NTVA 2WWVD 2O7VA 4CQMD 1YMVA 3ESDA 3ML1A 4F56A 5B55A 2A57A 3FOAA 4L3WA 5BNIA 5ALRA 3IFSA 4LQLA 2C5LA 1R1DA 2N46A 4EFKA 4G63A 3KZXA 2HPHA 2WKWA 2WMOB 2RHLA 3V34A 1WQ4A 1G4UR 1PCXA 2WKRA 3EOAI 2Q6LA 5LNK1 4ZFNA 2GRNB 4TYPA 3IHKA 2ZJYA 3EY9A 3AUKA 3S8YA 3TS1A 1UM9B 2J6CA 3VZQA 3MXOA 3HYMB 5LZ4A 3Q7QA 4JB8A 5IT9A 3HWSA 1N32B 5FL3A 1T8WA 5G05C 2ZB8A 3GRFA 3EYAA 4TWAA 1CJKC 2H2FA 1SKUA 1E2BA 3GJ8A 1DBVO 3TSAA 3ULKA 1JEYB 3WSTA 2WUGA 2ODTX 2NZ2A 2DTDA 1SOAA 3SKYA 3E9EA 3ZZ1A 4O60A 4I2VA 4ZEOA 3HCDA 4XWKA 3DQPA 2J48A 1YONA 5KQRA 1E1QA 4JOQA 1VJCA 3L7IA 5FI1B 1ZWKA 3ND6A 4KPYA 3DV2A 4K9SA 1ZH6A 1AU9A 4QJIA 3WRYC 4LJRA 2ZSFA 1LY1A 2PZEA 2CZCA 3VPSA 3CVUA 4B8WA 5A1JA 2L82A 3MAAC 3RRXA 4DUGA 2W37A 2BGIA 3ZE1B 4MCJA 3KFXA 3Q9NC 1N33B 2P9CA 1DKQA 4JB3A 1FNSA 1OYYA 1X1SA 4DQKA 2Z57A 4JI6B 2WMNB 1WPGA 1E9RA 1XDWA 1WMEA 1TB4A 3HLYA 1CLEA 4ARCA 1R4NB 5EWLB 1GNSA 3ZEAA 1RXVA 2X58A 2FE1A 3ORHA 3AI1A 4WY2A 3TQFA 3TWVA 1UPBA 3PC4A 2H65A 3IB3A 3DBSA 4OXKA 4BMNA 3CUEF 3KJXA 2D8MA 1SU7A 2BGGA 1KQPA 1ZUNB 3KXDA 3PHBE 1T0IA 4DCNA 1JDBB 4J1TC 4RE5A 2ZSUA 3KB2A 4I08A 1ZM2A 1NU8A 2EKBA 5DGHA 3UZUA 1XQWA 1YMUA 1MPXA 3HU5A 4ALJA 1J0BA 4B3CA 5TMBA 6REQA 3X44A 5JCZA 4PYQA 2C4NA 4URKA 3OEWA 3AM1A 4Y2UA 2X19A 3IULA 3FPGA 1GSHA 3CPEA 4UFPA 3K0SA 2JH9A 2HHHB 3RUPA 2WJVA 3CNHA 4XE5A 5CEAA 2EC5A 4OAUC 1THZA 1S0PA 3CLRD 4I55F 1TKBA 3EHRA 1F8YA 4E2WA 821PA 3CB4A 3ASNE 1TIKA 3H9UA 2R62A 3X2FA 5LOZA 3DMGA 2B99A 1Y6RA 2RJ3A 5L4LA 2P67A 5J3JA 2CHQA 1R9NA 5JV5A 1XU7A 4G41A 5EJ7A 4LN1A 4P2GA 3IVRA 3RHFA 3ITNA 2FH5B 3HKDB 2OEPA 2ZCUA 5LU8A 4HX2A 3UG7A 3EDYA 1JKJA 1YS6A 4DLTA 2KBEA 1V9LA 1MO2A 2CJWA 2YMLA 2JDID 2QYOA 3OSZA 1ADJA 5D1HA 4WNEA 5BSUA 4XWAA 3D9NA 4ND8B 2WXFA 5CXXA 1MA0A 2NU8B 1FX0B 4F9GA 3SM3A 3OG9A 4UREA 5KHAA 1Z36A 2QRHA 3PGMA 2P6RA 4Y1FA 2QVBA 3ELUA 5B4TA 1HG2A 2R84A 3UT5B 1N7JA 1U7WA 1JI3A 2W2LA 1T4CA 4YACA 1G66A 1JFFA 1U8CB 1OAOA 3ML9A 2GYUA 1EDDA 1HDEA 3OU7A 1W75A 4KYOB 1YR3A 3E03A 1ZP6A 2Y93A 2IOYA 4NV3A 1SNYA 1VLVA 5AHOA 1NE2A 1J8VA 4TT3A 2V45A 1PEAA 3W6NA 1AUPA 3CKMA 2BFNA 4IXTA 4M46A 3PC8A 5B6JA 1NVKA 4GUDA 4URVR 5CFMA 2CLFB 1BH2A 3N39C 2C7BA 2EL7A 3CLKA 3WL6A 1JR4A 2WLTA 2HL6A 4FFBA 1DT3A 4JYBA 3IUYA 1BE0A 3V1NA 1LF8A 1Q7RA 1TJ5A 1N0HA 3SOZA 3WYEA 3J81k 5E6SB 4J2TA 5ALFA 1AT1A 3IKMB 1LDBA 5HRUA 3KSQA 2G08A 2UU9B 1ESMA 2J3LA 2XNKA 2WZQA 5LCWJ 4FYWA 2G5PA 3E58A 5IF3A 1NM5A 3KB8A 4H16A 4PSDA 4P3OA 3GZ2A 3DE5X 2R9VA 1RSZA 2V4ZA 1T8RA 2RFMA 1SK8A 2PA0A 2VSXA 4RNDB 5AOCA 2VTKA 3QX8A 2YY5A 4GKBA 1LKZA 4ZC1A 3H83A 3ZE9A 2O7NA 4BV2A 4D41A 1WUJS 2FW0A 5BSMA 1YDEA 1YJCA 3L77A 3PEFA 3GUYA 3VR4D 3MRTA 3TTYA 2A7QA 5KNDH 3UGJA 4HZIA 3SBTB 4UHBA 3CHRA 3D0QA 3KKZA 2ONYA 3E0QA 3GI1A 1IBLB 4KMRA 3GQVA 1QANA 3O7MA 3C7CB 1VKRA 1RZ3A 4M76B 2WYUA 3I12A 4FXPA 1D07A 3MB8A 4MDFA 4V0MA 1AO3A 3D3EA 2M9MA 3LL7A 3H2KA 3U09A 3GT4A 1RADA 1Z2NX 4ANXA 3RG2A 2VLIA 3PE3A 2QVLA 4BLRA 9GPBA 1SU4A 4TS9A 3JX9A 4CQNA 2QPTA 1HKUA 2JPDA 3YASA 3EPJA 3HVRA 1XHLA 3OSUA 1WY7A 4Y2VA 5CUQA 1L4BA 1K3FA 1BA3A 5EZ6B 3TIXB 1R3UA 3LFUA 2QT1A 2OO5C 1GNQA 4HH3C 3KWJA 5T6MA 5LQDA 3ZIAA 3DE7X 4QUGA 4WKCA 1JLLA 4MR9B 5FBRB 3ED5A 1RVDA 4XCXA 3BWEA 5CDUA 2WF8A 4RQIA 2KC7A 1UFOA 5IH3A 5LPNA 5FP0A 2L18A 3A3YA 4K5CA 1C3OA 4FD3A 1RI3A 3L8DA 3CN9A 4KE8A 1S89A 4F2WA 2VCEA 1YTLA 5DI3A 1E6LA 1SXJD 4M49A 1FDWA 3IR6A 3S2ZA 5C80A 4O4JB 5KDDA 4WNYA 2EJCA 3ZWMA 2QVYX 2J87A 4J3JA 4ERXA 3F5SA 4G5QA 1ZD1A 3K6JA 3ORQA 2Q5FA 1H5UA 3VR0A 5CHYA 1MENA 4FEGA 4MB0A 1SBCA 5JNSA 4IINA 4UM9B 1SVMA 1UBLS 2AUTA 1M76A 3G0DA 5A5GA 5BW6B 1M2VA 4TWBA 3TCXB 5IULC 3AYXB 2YRXA 2J6IA 3T1VA 4US2R 4WESB 3X3HA 3BX1A 3TWWA 1Y33E 4RK6A 4DLZA 4N0MA 3EEIA 1KH3A 3RANA 4K2AA 1RQRA 4R9RA 5ARBA 3MIZA 3W6ZA 3S44A 5E95A 3JQ9C 3PGVA 5IAOA 2WZDA 1Z4KA 3G9TA 3R7LA 4P4LA 2KB0A 3PHGA 3JQ1A 4NG5A 4BNLA 4HI8A 1WXXA 3VJRA 5GINE 3P96A 4RJJA 1MT0A 1FSSA 2QN1A 3C3KA 4INJA 5F51A 1UQTA 1YAHA 5H9WA 2IHYA 1ZGGA 4TKVA 3DMTC 2M6RA 4XARA 4FGJA 1L5HB 3DR5A 3ZVLA 2FFAA 3V80A 4ZEMA 4LRTB 3C6ZA 4JLKA 4PNEA 5G05J 4Z4HA 4M1ZA 2O7RA 3D2LA 1BDIA 4HH1A 3QUQA 2OV4A 1QH1A 2R2LA 1KSFX 1MVOA 1XK7A 3TR6A 5BYAA 3E6AA 9LDTA 3VYWA 4E5MA 2CDRA 2BJWA 3UO8B 3RG8A 5K51A 4RSYA 4AKHA 4MYHA 2P4HX 4U6SA 4DM3A 4CKXA 2PNJA 1USIA 1FDVA 4GAAA 2AJ8A 5IH7A 1A0OA 4BWVA 2X8BA 3D8BA 1DWQA 5FQ6A 4ZVPA 1GO2A 5EUMA 2C95A 1Z35A 1QWSA 3DVQX 2IJGX 4PX2A 4F9EA 1I3OA 4NC9A 5CVEA 4TXLA 4YFYA 5ECWA 1H1LB 5BSKA 3DVLA 2ZBFA 3H9CA 2Q8NA 3TL5A 1TPZA 4A8JA 1MT3A 3OPVA 2IK8A 1ULTA 1WA5A 5F2OA 2GCGA 2WXPA 1C7ZA 1SZ9A 4YMUA 4U7JA 3JQ7A 4ZZ1A 3UT6A 2J5RA 1DL5A 2DUJA 1IZ8A 5IN5A 4U7EB 5TS3A 5HMMA 4DPLA 2AOVA 4NZNA 4UWHA 3NHPA 3CSSA 4XYMA 4PG8A 2X2PA 4J7AA 1EXWA 1P5RA 5ALIA 2W70A 5HUJA 1RRPA 2ONDA 1TM4E 2QYTA 4JLBA 4YRJA 1QYMA 2R5SA 4A03A 3KCNA 2R6CA 3GEDA 2HMVA 2KATA 3SBSA 3O21A 3CGWA 2V9CA 1F2UB 3LGSA 4RTQA 3H1EA 4YRFA 3K9FC 2PX4A 3IP9A 3O8OA 4F4HA 3CSTA 2IPNA 1KMHB 1X7XA 3IQIX 4N54A 3MPOA 1MX1A 3OIYA 4AYXA 5H82A 5CAEB 4FI3C 1TFUA 3I6ZA 2O07A 2WFZA 1DAEA 1O8CA 3QNWA 2VNSA 4YAIA 4KXXA 2V3CC 1SOUA 1NVTA 4GS5A 1OY3D 1ZS9A 1E7SA 3ZJ5A 4YRZA 5KJNA 2VF4X 5C1IA 2FUG1 1Z74A 4ZQFA 1KZ9A 3THXA 2JLCA 3FA2A 1C8VB 3TG8A 2CK3A 4JBIA 3QB2A 2CVQA 1S1CA 2K5UA 2VC2B 4XYEA 2FZVA 2D7DA 4QJ3A 2DUWA 4PNHA 4QOGA 1MAHA 4M37A 2HK7A 4B3FX 1N4AA 2F43A 3QJZA 2JFBA 4BU1A 3W5HA 3E3OA 1WOMA 3AM5A 1N6HA 3FVRA 2OZLB 2ZJFA 1TAGA 1NHWA 1W36D 2AN3A 3ZV5A 3NUGA 4Z3DA 4CI9A 3K5WA 1RBMA 4KQCA 2VUSA 2FSIA 4G3XA 1XU4A 3U5ZB 3T8YA 5J2TF 4U4AA 3UC5A 3KJEA 1XCGB 3WLHA 4M1QA 2XWPA 1Z33A 1QHNA 2FYTA 4DRXB 2L69A 3AY7A 1ISPA 4LNUD 1NJ1A 4DI3A 1WUTA 1RE0A 1V7ZA 3MRXA 5JSUA 3LYAA 3EGXA 4NBTA 1JTEA 4ZCRA 2W2MA 4B74A 3AS8A 4X3OA 5JAPA 1GZUA 3AF6A 1OIXA 3QXSA 3DXZA 1DS6A 3FSRA 2COEA 1CEYA 2SBTA 3U37A 2FQWA 2XPZA 3N71A 3RARA 4BNFA 2YWEA 3R0JA 5BVHB 3H3XA 4C9BA 5ALTA 4HXEB 2VF5X 1TTHA 3OOEA 3V5NA 5KHOC 5F9FA 4XGKA 5BV0A 2YS6A 4DIEA 1N52A 4HLCA 4ARZB 3W5DA 1AH2A 3GLGA 3S0JA 5E2BA 4RGBA 5ICMA 4DDMA 1VI5A 2R87A 2Q49A 4QGBA 1JHAA 3AO0B 4QD3A 1T0UA 3CX7A 5DHUA 4I1OB 3I4RB 2H2HA 2A6PA 2MYTA 2F1RA 3FN4A 3LLCA 3F6PA 3RH0A 3QU4A 1U04A 2DIWA 1RJ9B 4FMBB 4YT2A 2VYVA 4IGIA 1LV8A 3IELA 5FTJA 1U0LA 2XS1A 4FX2A 5D0OD 1E2HA 3MJFA 2WSBA 1PJBA 1C14A 2QJTA 1WKVA 1UEXC 3NJ4A 1IC6A 4REQA 2ENUA 1D2RA 3UWKA 4Z7JA 3WV4A 2OV2A 4TWRA 5C8YA 1J5PA 2H08A 2Q3BA 1DO2A 3AFGA 1WXDA 1JJBA 2XUPA 2WWXA 1OX6A 3K7EA 1LD7A 2R6DA 3PZ4A 5AKYA 1SBNE 4F4JA 4FDAA 3CC8A 4FFMA 3EZXA 4MVXA 4OI1A 3INNA 5K8CA 1SUPA 1TMKA 3F47A 4U0ZA 2WOOA 4TPKA 4ANFA 2VJ8A 2W83A 4R8KA 2C54A 4N5QA 4M0CA 3RIYA 2BFWA 4JLJA 5FWYB 2OEVA 4D8UA 5LUAA 4JNKA 2QPAA 1ORTA 4MITA 3BL6A 3WLJA 1FP2A 2YWCA 4F0JA 3V46A 1VOTA 3Q8KA 5I8WA 1XPRA 3KLMX 2GEDA 4KLCA 2ZB4A 1ZZGA 1QCZA 3Q5EA 1QFXA 1MR3F 1C8KA 2BVNA 2HC9A 3TSYA 3DZFA 4FQ7A 4DLXA 2H1FA 4IN3B 2JGDB 2V4UA 4Q7QA 4D4KA 3BMNA 3N2KB 1MNQA 4ZYYA 5KNBH 4HWPA 2VAPA 3UENA 4C48B 4JD2G 1O57A 2VJNA 4KQGA 3UJ6A 1RRKA 3KZKA 5CCLA 3D31A 3RYIB 2QW8A 4JU9A 2FO7A 2PRYA 4FEEA 3TI7A 4QT4A 5KAPA 5FIOA 1OCCE 3VSAA 3U64A 2VHQA 4GPTA 3U7FB 3FFAA 5IC6A 2B37A 1Z29A 2BE7A 5CEFA 1EP3B 3IALA 1GAWA 4HOSA 3T0IA 3VU3A 2NXNA 3IAM6 1TK3A 1Y4SA 3BL8A 1CF9A 3HYNA 4TXMA 4NATA 4F9FA 3VMFA 3DEHA 1ZH4A 3WL4A 4L9WA 3WFZA 3QUSA 5LQRA 1R00A 2EJVA 4BJ1A 4OQEA 2WM9A 4NESA 1V5EA 5D85A 5C9ZA 2IY8A 3A9TA 2AW3A 4RTSA 3U3MA 2UVDA 3V30A 3G0IA 4PYNA 2XZTA 2VGYA 4Q1VA 4Y0AA 5D3ZA 2JF0A 2GPTA 4ZIRB 4K6GA 2JLBA 1TUBB 3VR3D 3G2WA 3IQEA 3DFZA 1DAOA 1NOIA 2H8GA 3MJCA 2BKLA 1JQBA 3GJ5A 2WWTA 2XUAA 4ITUA 1YH3A 2CXSA 5AM4A 2QS9A 2VJPA 5CXQA 3SR3A 4P3XA 4WZZA 1YBVA 3BQMB 3UW3A 4D99A 2JLAA 1ODLA 3CG4A 1CUXA 5H1YA 5F2EA 1OFGA 3KTAA 4TTQA 3QJGA 2HJHA 4MUIA 4IKEA 3KB6A 2BOVA 4ACKA 4CMBA 2YY7A 2Z3WA 2B4AA 1MHQA 1P2SA 1JLSA 4H7KA 4GTQA 1ZM4A 2QVGA 4J4BA 2OAQ1 4QDJA 1DUSA 4H60A 3T34A 1BXRB 3EIXA 1YS4A 2JGEA 3ECSA 3HO1A 1Z37A 2KCVA 2FF7A 1O58A 1SA0B 5G40A 3TNFA 3CF0A 5J4VA 5DYIA 1QIEA 1O6GA 4B79A 2D2XA 5C3UA 3V6LA 3CZRA 4I7EA 4D9NA 5JRZA 1XZGA 1SGWA 2V7GA 2ADOA 4WY5A 1PFYA 4W9NC 1E69A 4ZDIA 1XMIA 1MQAA 2I2OA 4O4IB 4RXTA 1ND6A 4M8IA 3WLQA 1Q1EA 5GGYA 3T3EA 3TAHA 3AP3A 4HNRA 1GPWB 4MVJD 2RGWA 3OY2A 4RD4A 5C8DA 4ZOBA 1T5TA 1TYZA 1E99A 4QQ8A 2O1WA 3F1KA 4MHSA 1XRRA 1ZKMA 4LXHA 3AFHA 1RW4A 1ZK0A 4CQMA 4LZOA 4J2OA 2FFQA 2I67A 2ISCA 3RRZA 1N9GB 2CBZA 3GW8A 5CD9A 3ZJUA 4RIHA 5GVSA 4DKXA 3Q73A 2A0KA 3IKLA 3QG5A 3EXFB 1M6YA 5ABPA 2R03A 1O4VA 2HRBA 3K15A 4F1JA 2BKXA 4FU0A 3BK1A 2AQHA 1JXQA 3DZBA 5BPFA 4DLAA 1F60A 3SC2A 5D51S 2PGIA 2O8CA 1GUAA 3VC7A 3E5RA 1CJCA 4ARUA 4LOIA 3KWLA 1B23P 2WNHA 4YCMA 3JPWA 3DPIA 3K09C 5F7OA 5ERGB 2HEGA 3HYTA 3COWA 2ZIUB 3AESB 2DE0X 3PLAE 4FHFA 3OFSA 1JEDA 5BWLA 3F97A 1Q6ZA 3NYWA 3P4UA 3C48A 3EDQA 4KP7A 1WKCA 1QP8A 2QJRA 4H31A 1D03A 2P1RA 1GTL1 2NZWA 5DSZA 3ROTA 1MX2A 3Q79A 5BVGB 3I76A 4NYJQ 4HZUA 3ZY6A 5FEUA 4GRDA 2YV2A 1Z18A 2LXLA 4X97A 4G36A 4ZODA 4UOQA 2UV8A 3RS2A 5JG7A 3BHIA 1XGWA 2NO6A 3KL2A 3LKVA 2D1RA 1Q7EA 4ITVA 2ZT7A 2RG8A 3KR9A 1QB8A 3Q9SA 1JEQA 3RSZA 1OI2A 4LWPA 1NJSA 2XOKA 2HCBA 2C31A 5ARDA 3NLLA 4UVEA 3EQZA 5C5DA 3O4RA 4OI2A 2QUBA 2A84A 3ZUGA 3COZA 5FJIA 2BI4A 5IBQA 4U00A 5CTJA 1J0AA 4JVNA 3NWEA 4A8HA 4IFBA 2X2FA 3S7ZA 3KOMA 4KRGA 4ZOLF 4I3HA 2ONJA 3SXUA 4HNAD 4IDPA 1U65A 1RLIA 5EZYF 4D9CA 5HBGA 3DAFA 1NTOA 4ZZ2A 3RC9A 1GVNB 5EYPA 3KS9A 1LLUA 1FYWA 1T25A 3KE9A 1FT1A 3OTHA 3ZU3A 1KK0A 4UARA 1BDJA 3WSVA 2A3RA 5FNZA 2AE2A 5A9RA 4CN9A 4HGZA 1R64A 4WWHA 4DLLA 3CX6A 1L5SA 1CB0A 1JG3A 3BA1A 3D6FA 5LQSA 4HPJB 2A88A 3GLHB 4DLSA 1BJRE 2XJ4A 2FSUA 3X1KA 1N78A 2VQDA 4KITB 3TAXA 3V1YA 4RMIA 1X3SA 5CNIA 4MR7A 3FYSA 4GYKA 2COUA 4DYHA 3CLSD 2OYRA 3TR5A 1WSBA 3N6RA 3NAWA 4XB2A 4HATA 3N2YA 2ZUTA 2QTRA 4MIYA 4UBKA 3IESA 1HNZB 2KCKA 1MDFA 4J43A 1CBUA 4QULA 3WNZA 5KWVA 2E2WA 3EZ7A 2IHBA 3ETJA 3UV7A 1I4LD 4I1UA 4GZLA 1S2DA 3WL8A 1LF5A 4FOPA 1XEWX 5ADWA 1HA3A 2R6HA 3IBEA 4YJGA 3MT0A 5GPBA 3RE1A 3L7DA 4IG9A 2YOHA 3B7TA 3HADA 4XZ3A 5B3KA 2Y0EA 5DHFA 1IRIA 1INZA 4CM3A 2GOYA 1FYEA 4CQLA 1JIJA 3LE8A 1I3LA 4XQ0A 4DIOA 4M9RA 1XZHA 2MMCA 1NVFA 3PDWA 1WLSA 4YAUA 2RGXA 3OP4A 1TQ6A 3GEGA 1QJ4A 3OBIA 3AKZA 1I2BA 3DOCA 4GZ3A 4UBIA 3T1TA 4OP2A 4II7A 3OLXA 4B48A 1UMCA 4YPVA 1M73E 1DEAA 2ZRLA 4EFMA 1A5SB 1YE5A 3TX6A 4IRMA 1DZIA 1F20A 1JS1X 1AB6A 2HMUA 1ENZA 3OWOA 3Q3HA 3OPYI 1E58A 1ZCFA 4D9JA 4JLMA 3AJAA 5AQ7A 1TO6A 3HS3A 1N8TA 2RBEA 3EASA 2OHGA 1ZUD1 4OP1A 4M7RA 4ICIA 4H6PA 4R8MA 5ICFA 3UYLA 3SY8A 4DUYB 5HILA 3HJNA 3JRXA 2VYCA 1N9AA 5CR9A 1POXA 4OSEA 4GA0A 4OK6A 2CMHA 2GAFA 1NBWB 4OMCA 1S1MA 3GVIA 3R20A 4FOOA 2WWYA 1QONA 3ORYA 2GKGA 2GRJA 5GM1A 3DFMA 5HPYB 2BFEB 1VP3A 4IEIA 5H4HA 5IN4A 2PKCA 4IJWA 4JZKA 3JASB 4EQ6A 1W5SA 4UVIA 2G28A 4RMHA 4WA8A 1RWOA 2VF7A 4G0ZA 4EABA 1QJCA 3HZZA 1NUUA 1PJZA 1SW6A 4DA9A 1AF4A 4RXUA 3QG1A 5G41A 2I9CA 1JR3A 3L92A 3KDAA 1ZEJA 3MWFA 4TMTA 3ZKWA 4PPFA 1PX0A 2PD3A 1GN8A 3TX2A 3LPNA 4XM1A 1Q1GA 4YJ3A 4H1UA 1U2DA 2Q3FA 1F0YA 4A16A 3VNUA 3ILSA 4CTNA 3WGUA 2R59A 4TL6A 4MV8A 5BORA 3OZGA 3G2QA 3EPKA 4UE3S 5EIWA 3FUMA 1SXPA 4PM4A 4YHBA 4BOYA 4LXUA 1DV2A 1W49A 3K1AA 2PE5A 4R05A 3LGXA 2J3DA 4YRCA 2RK6A 1HZZA 2GZDA 2PWYA 1B0AA 4GMDA 2BEWB 5JR3A 1OU4A 4U7GA 3I6IA 4L4YA 5T4HA 2HFKA 3EIUA 3UYKA 1OGYA 4R2JA 1ABEA 4HUTA 2XLCA 4LFAB 2WJIA 4Z68A 3CXUA 1SCUB 1P0FA 3QBVA 4X1IB 4G0PA 4C03A 4PLGA 4HSEA 1CZHA 4BJ6A 3OLZA 4H4CA 1K4YA 4X1YB 1UOPA 1P0QA 4O2LA 1IXSB 2H63A 2GUWA 1VE7A 3OXLA 5IEBA 4ZAZA 3NATA 1QO0D 3L82B 1OKKA 2BTQA 1VCMA 2VK4A 1VP9A 1JN0A 4CLXA 2OQRA 1M6NA 2P65A 5H3LA 2EFDB 5EQJB 4KI7A 4MIKA 621PA 2A14A 2DPGA 2ZYUX 1FNNA 3L6OO 1PK7A 2ZUWA 4NNOA 4P9NA 3ZVVA 1A76A 2IYOA 3SSAA 5EE3A 1VIAA 2GERA 3N0XA 1R50A 2F9LA 1CFZA 3A58B 1IOLA 4Y6OA 4CMJA 5LCWC 1ECBA 5CXSA 1O8BA 3RFTA 2GNAA 4MUAA 1CS0B 2OESA 4U04A 4TMFA 2BEJA 3EHDA 5L3SB 4TMWA 3RUHA 1I1NA 4B75A 2X8JA 4BV8A 2VP0A 4W8HA 4P7KA 3L0PA 1PIWA 1H2YA 3ADCA 3KKNA 3BBLA 5T3YA 4EI9A 4I9GA 3AEQA 3HDVA 2HA2A 4P7GA 4UAVA 4EZLA 2UZ1B 4EHBA 1CUEA 2IT1A 1PSZA 3SF8B 1UAAA 5DLYA 4OBBA 5BWOA 5ED4A 1SC4A 3HP1A 1TM2A 2V7WA 2PGDA 1T2NA 3PA8A 3IQHX 1P8AA 5A7DB 3V1LA 3BF8A 4ATZD 1H8HD 2X0RA 4EATA 5BQFA 2VDLB 5JFTA 5FPSA 1FTGA 2P75A 1Q0TA 1IJBA 3THRA 1M0TA 1Z5UA 3T7SA 4BMSA 5EXPA 2FZEA 1DRWA 3EMDA 3ZGLA 2INGX 4JJGA 2REXB 2VG8A 3CRMA 3KYIB 1CUWA 2E4YA 2RGDA 1Y4AE 2R02A 2ZTSA 3QEOA 1W85A 2Q8PA 4JIGA 2VHXA 3L8YA 1GGVA 2BGJA 3A27A 1XRLA 3ZH9B 3AHDA 4RPHA 2JJQA 3L8CA 4I55B 5JCPA 4L08A 4WRRA 3AJ9A 3A11A 2IY9A 1U1DA 1QTRA 2AC2A 5FTLA 4QEKA 4J90A 1BS9A 1XLUA 5EX3A 4LOLA 4ETIA 4CR7A 3EZ9A 2O54A 2ZRHA 3IVCA 1J90A 2QAGA 5CDGA 3RT1A 3A8TA 4FHGA 1XEXA 3JZMA 4EHJA 4UVDA 3DF7A 1JPUA 5HA5A 2FZ5A 2HDHA 4I2NA 3S2FA 4UQPA 5U4XA 4FNGA 1VIDA 5D7NA 4BBAA 1Y4ZA 1Q2XA 1RQGA 3NWOA 2YHEA 3CU5A 4H6VA 4Q9JA 1ORHA 1Y1KE 3C3RA 1LRKA 2VK2A 2YHAA 1JDPA 3GZNB 1GJRA 1G17A 2NAFA 1H05A 1UIRA 1U28A 1U7PA 4DMGA 1G5TA 3V1MA 3AV0B 4CL8A 1T9BA 1C0LA 2QXUA 4Q39A 4TVKA 4BTBA 1E7WA 4YT4A 1SJ9A 4ABNA 3O4HA 3ZU6A 3JRNA 3UMCA 5CK5A 2QUHA 4PZAA 4PZ0A 4IJVA 1Z2CA 5D6OA 1SA5A 4JLNA 5CFNA 1ZOLA 1TJYA 4QHYA 4F11A 2MYNA 4PQFA 1N2SA 1I4OA 3ND8A 2NU9A 4BQIA 5J9FA 3LIPA 1YU6A 3L7AA 4DWOA 1CP3A 4UCFA 3QVKA 3BG5A 1CDDA 3WKCA 1B74A 3JD0A 3EF0A 3KYCA 1J1UA 5I51A 1XPJA 2B25A 5LDDC 5KYYB 1NVDA 1NN1A 1BTOA 2XNDA 5IJAA 5KJEA 2QV0A 3TL6A 3RVMA 4QPDA 1ZJ5A 1GL7A 1UKYA 3AKEA 3KLNA 1HE8A 1FLDA 1VZ2A 4C2UA 4Q16A 3FCYA 3GP8A 4ALIA 1IUOA 1QIKA 4KODA 5EZSA 1JIXA 3BDAA 4FYJA 4YDQA 4LYJA 2FP4B 1X1RA 3D81A 3HB4X 4R2WA 1XMXA 1W2WB 1EQAA 1LRLA 3OTWA 4QDXA 1VYHA 2IYXA 4HAYA 1JKMA 4KJXA 4XTCS 1LI5A 3JCZA 1XNJA 4RVSA 3IVXA 2ZIZA 1X19A 1V3UA 4LMRA 3CRZA 1M34B 5FO1A 1ISJA 4G5HA 4RL4A 1N6IA 4J8DA 1UWCA 5KSZA 3CMMA 3V8QA 3KQNA 3V7YA 2OM2A 1EHCA 3D3JA 1KEPA 5T8KA 4YB8A 4K6OA 4V1CI 5IKMA 4WCVA 2YZGA 1FTQA 3P9QA 1L4GA 3M4YA 2ACWA 5AJDA 1ZOIA 2LV8A 5CNJA 2QNBA 2C59A 5KMGA 2EZUA 3BGOS 3IOBA 4LJ9A 5T67A 2OR3A 1KRHA 3QVGA 5IBCA 3R6WA 3IP1A 3VDRA 4BNDB 1BXGA 2QN9A 3ENZA 2IHUA 2JABA 3MGAA 4NARA 4NFYA 4F6RD 4RMGA 1D9XA 5EQDA 4M36A 4KREA 4W1PA 1RXUA 3L8FA 3QPDA 1H6PA 3DT8A 3Q98A 5LP6C 1D9ZA 4CKCB 2IXGA 5KSPA 2I71A 1RI4A 1FDTA 4G0OA 5DEIA 4AAYA 1L3IA 3U3XA 3R9MA 1Z62A 3ZNNA 4QGGA 4X7PA 1XG5A 2D2IA 3U3KA 2P0YA 3U4GA 4D9EA 2JVIA 3RM3A 1ZUIA 3TB6A 2CXXA 2P79A 1KK2A 4E3ZA 2NSHA 2UUBB 4L5JA 2VLBA 2AXEA 1K7CA 4R7TA 2FN9A 1E7QA 3N0RA 3L6DA 4UWLA 2PL9A 4DJ5X 4R2KA 4ZANA 1P91A 3IDZA 1VYVA 2P4QA 3PFWO 2JD2A 4W1SA 4UBOA 3TW6A 1PV4A 4ZYTA 1NAIA 5EE9A 1O0SA 4CYMD 3AWDA 4PXYA 5JZSA 3DO6A 1Z5GA 4I9CA 2YYAA 3QKIA 4TWJA 2BEUA 2XKBA 5JMPA 4Q7KA 4G85A 1ONPA 4L5AA 4ND7A 2Q4OA 5SY9A 4WNCA 2H1WA 2QN8A 1N2EA 1Y6JA 4KR0A 4YP1A 2NZ8A 4CODB 1GDTA 1XJ5A 4Q9KA 1NI3A 3GBPA 2XRZA 3PE4A 2DG2A 4BVAA 3FMFA 3CW8X 3E05A 4GMRA 4UDYX 3R8CA 3TDNA 4DR4B 3M0EA 2XTNA 2QM0A 3J5QB 1RRMA 3QOWA 2Y1KA 2I6GA 3JD3A 2CT8A 3P45A 2XVZA 5IZCA 2J3MA 4QTUB 1JB9A 3RDPA 4EB8A 4M9XA 4OFBA 4JSYA 5DCWA 3EVGA 5FPHA 1XWIA 4JI2B 1TGYA 1E4EB 2ZAYA 2AG5A 1ZX1A 4QTYA 3ES9A 3KSUA 1FFCA 4Q4CA 2IOSA 1JHVA 4IWNA 2E89A 3ZCRA 1EEXB 4XX0B 3T9DA 1OE0A 3O03A 3NDBB 4C2TA 1NBMD 4QQIA 1EFVB 1I2AA 1P2FA 3UMFA 3WK4A 1S8OA 2WTNA 2OXFA 1SD5A 2AFIE 2GEJA 3QKTA 1E2MA 4Z0NA 2C9MA 1GPAA 3MOGA 2Z1DA 4YTEA 1UJ2A 4B32A 3C8DA 1SFRA 2B7CA 4G5OA 1V55E 4XDYA 5LMZA 4FYMA 2LGJA 4E6EA 2I3BA 4CG2A 4BNUA 1G291 4I66A 5K3FB 4EW1A 1DPGA 4HNUA 1ORWA 1RPZA 1B0ZA 2PVSA 1YKSA 4HDCA 2EDAA 1UPCA 2Q5IA 2W6ZA 3U62A 3MKRA 1XJ0A 1MIOB 4A92A 1UPUA 4GECA 3PFIA 4N5NA 4OB6A 2I6QA 3TRJA 1KAHA 1L5OA 3WIEA 4HCJA 1OX4B 3DKIA 5KTKA 5EP3A 4BN0A 4MA0A 1PKEA 4FZRA 4C0JA 1CXZA 3F6RA 3Q3JB 1B26A 2W6ID 2IUFA 1G41A 1HXIA 2X0JA 4GNRA 3HXDA 3APFA 1NN0A 3QUTA 3E48A 3IEVA 2QTHA 4JKYA 1MOQA 1I5RA 5KBAA 4QXRA 2PUBA 4IP0A 4DUPA 1Z16A 2JGMA 4YNDA 2GXAA 1GQFA 4BNMA 3RUEA 1YB5A 1XTBA 1NBHA 2IYUA 4Z0TA 1BCRB 4GH5A 4PGHA 4M4SA 3I73A 2C4KA 2X9GA 4BAGA 1G20A 1QO7A 1DIHA 4RADA 1IN5A 1E3TA 1FL9A 1I2DA 4FUQA 3EOZA 3M34A 5LP0A 4U9IS 1Y9DA 3OOJA 3I3NA 2JC3A 2YFYA 4ZU1X 1PI3A 4MAFA 3KKPA 3OO0A 1E3MA 1RD4A 4E1AA 4FE3A 3DHEA 3F74A 5JD4A 3QIVA 2OUIA 2XEVA 4R1NA 2ZBGA 5C8YF 2D0DA 4BNTA 4N2QA 3QEKA 5C7IO 3E53A 3HFJA 4PPQA 4X60A 1D2HA 4R2LA 1NW5A 3CO0S 1JA9A 2ISSD 3C5EA 3B2QA 3JQFC 4QX6A 4KJZA 5FPKA 2IKQA 3ICVA 4DLYA 3LG2A 5KJFA 3CUVA 2NTNA 2VH1A 1C81A 3IDFA 3T3GA 5C1PA 4BT8A 5LYYA 1P80A 4XIYA 3Q6MA 1J9ZA 2PWBA 2G1KA 4A1SA 2GYWA 4KRYA 2WRZA 3UWOA 3REQB 2HA7A 4MB2A 1W3BA 4KKXB 3NTVA 3HXCA 1R6UA 2YV1A 1JZSA 1L8OA 4G89A 5AJXA 1DC4A 1JVNA 2GASA 5EJ2A 4DZTA 4U0SA 1JL3A 1GR0A 2HO1A 5HHTA 4R2MA 1A97A 1HO3A 1XTVA 3TOSA 4Q69A 3T6KA 1RIFA 4QUAA 4ZJYA 3S27A 2BGRA 1Z2EA 3BERA 3JYNA 4MGHA 1ZH2A 1S8AA 1PJTA 1AXGA 1XZPA 4AJOA 1GCGA 3GFOA 5J2TB 4MA4A 1MRNA 4NZYA 4ZTBA 3RRMB 1D7OA 3R9XB 1KAEA 2HPZA 5LQAA 1AP7A 3UPTA 1QGDA 4IVPA 4P98A 5ICEA 4RIGA 5B3LA 5IYZA 4YWHA 1JMVA 1ZD5A 1IM5A 5DJ5A 4EG1A 3TG2A 3HP7A 2J8SD 5EIEA 3RIHA 1EDUA 1HE5A 1VSQA 2O2YA 3BRQA 3DRAA 1XZEA 5I9LA 3B70A 1DDOA 4ZDWA 2W2KA 1WCIA 4JHJA 4F5DA 2KLHA 2HQOA 1HE3A 4Q24A 3JZFA 3X1XA 3V2HA 3LPMA 3PBKA 3AUAA 5KWIA 1RJDA 1NN5A 2ZU0C 3QFHA 4EHNA 4AEZC 1JDTA 5IANA 2P68A 3A9CA 3M4NA 3I23A 1HI9A 4PLCA 4QARA 1T2FA 3LVFO 2QL5A 3JQPA 4Z7OB 2HUNA 1ORVA 1V41E 2F67A 1BE1A 4JI4B 2AR9A 3RPEA 4LF9B 2ZCVA 1RVV1 1GTVA 4MWEA 3UB4A 1BVUA 5DXFA 1J99A 2I2XB 2DP4E 5DM4A 2WWRA 1KU0A 3AHCA 3E1SA 3W77A 1ZN9A 4QU5A 4BZPA 4C4TA 5HE9A 2B1JA 1A8HA 4MR8B 3K96A 1YRWA 3LLVA 2QPOA 2ZRBA 5EYLA 1M9NA 3GGGA 1Y3DE 4JDPA 2ORIA 4R9SA 1DX6A 3DSRA 5EIXA 5HS4A 1A9OA 1ADYA 4YAGA 2VHTA 4LZWA 1EUCB 4FULA 4E51A 3DSTA 1Y8CA 3QGMA 1K8QA 3C3BA 3TTSA 5K0NA 1HG5A 4I14A 1BOOA 4LV8B 1D04A 2HEIA 4PYIA 2OMEA 3Q1KA 5ENZA 4CU5A 4REOA 3W6UA 4J0CA 3HCRA 3QVTA 2PWZA 2DFKB 3L1IA 1K6JA 1N2CE 2BDTA 3I30X 1S6YA 4AMBA 2W22A 1G2IA 1OXMA 3T06B 2P6MA 2PLNA 2PTGA 1XZ8A 3E8MA 3HUDA 1QVWA 1JDSA 3SZGA 5B7PA 4C08A 4AJHA 3TSOA 2B4KA 1HR0B 4AS1A 4KQFA 4EGSA 4R98A 3NBMA 2WTAA 5AVKA 3GAZA 2Y0BA 4HDKA 5E8JA 6YASA 3SSOA 1PR9A 5H5JA 2FJ0A 4HDNA 4LE0A 3HO6A 4IDCA 4Q21A 2BKGA 1T1RA 1K8RA 5KJCA 3GEIA 2FE4A 2BTDA 2R79A 3PNOA 1Q0RA 3FH7A 1NLYA 2R8RA 4UEOA 4RSGA 1NP6A 2O3QA 5FA8A 1ZVMA 2YWDA 2OQ2A 1U31A 3PL1A 2QFCA 2WFMA 4IIDA 4KXLA 1GLVA 1HE2A 4OQDA 4IFEA 4NCXA 1VHLA 4FJ1A 2YICA 4C5BA 3T7IA 2RD2A 1YDWA 4OQYA 3ANYB 3A2LA 1KQ3A 1J24A 5KI6A 4WH0A 3HEMA 4RF5A 1KEZA 5JPCA 4NHOA 4TQAA 1DCKA 1VB3A 3H97A 4XTRA 2XE6A 1NLMA 5EJ5A 4B0PA 3KKEA 3UJBA 2RH5A 3JW8A 2EJTA 2V03A 4RPIA 2FEXA 1DSSG 1X81A 3G6WA 2Y1CA 5F9MA 4P54A 3LCMA 4G1BA 3GVCA 3VZSA 4S0XA 3W05A 1J22A 2FEMA 1QNFA 2JJ1A 1BEZA 4FYYA 4NBKA 4DTIA 3U44A 4Y2YA 5A7HA 4LUCA 5FINA 5DBOA 1S2MA 1MF7A 3KD2A 1VKHA 1E5VA 1XZMA 2DPYA 1YL7A 3MFQA 1QZZA 2XYVA 3CH5A 3D8RA 4CT4A 1RCFA 3BSFA 5JJ7A 5HS6A 1OW3B 2HMWA 3BZUA 4DVGA 5CB8A 3T7EA 2EJUA 2PXXA 4TLDA 1R4ZA 2EBUA 4D9GA 5J58A 2PUWA 3SHVA 5TQJA 2QG9A 5J40A 2C2LA 2DH6A 2FKNA 3V55A 4APFA 4WFJA 3I09A 1A9XB 1P75A 4IJKA 2NM0A 3VI4B 2XIQA 3FPFA 3V4OA 2V5VA 3Q9UA 1JFSA 2WXKA 3MG9A 3FFTA 1Q19A 2XVYA 2KX7A 4LYAA 2GHRA 2C5EA 3NHSA 1J9GA 1ZA2A 1RZRD 2YFKA 3I6YA 4GMLA 3NTRA 2KJQA 1A9RA 1AKRA 2Z6VA 2A5GA 4RD3A 3OM9A 4TLBA 4GMKA 3ABLE 1Y6IA 4FFPA 4HJRA 4DBZA 1L4EA 2P8JA 3W2EA 2VUUA 2AOUA 1E5XA 2G9UA 1YJ8A 2DB3A 1CUGA 3EIQC 3DE1X 3LJKA 4IHAA 1JT9A 4M53A 1SQFA 3DQQA 2QZAA 4CEJB 1DX4A 1BFUA 1WO8A 4F3VA 2YJ5A 5IMSA 2L0XA 2VRNA 3QTLA 2GJ4A 3T9CA 2QMOA 1VJTA 3HU3A 3ACCA 3OHMA 1C2TA 4PW0A 6LDHA 5I9SA 4U7PB 4CLRA 1FFHA 3B7RL 1ZBPA 2WYHA 3FYUA 3BC1A 2HDOA 4R3WA 3MCWA 1PHRA 5EYPF 4ILIA 1YCGA 1WCWA 4D3DA 4UC0A 5LZ7A 3OHPA 2VCHA 1OFIA 4KTTE 3SDBA 4ENSA 1PHPA 4J0FA 4FA6A 5BWNA 4D9MA 3OZUA 1L9KA 1C9YA 2NYJA 4O2BA 3E4CA 1QMPA 4OVVA 2Q21A 3Q72A 4X41A 4HDSB 5ALNA 1NVAA 5IVIA 1OPXA 4IS3A 4ZK6A 5B58T 1YAJA 4XIGS 2A9KA 2JEZA 2TS1A 1PNTA 3RR2A 1ML4A 4TUYA 3CM0A 1PTJC 4QGAA 1OV6A 1T29A 3S7FA 3PRJA 1HT1E 1NJGA 3QXHA 2Q7OE 5IKXA 4Z9AA 3L7NA 3HU2A 3HA5A 2VP9A 5CVDA 3PZ2A 2V7BA 3TW0A 1EB9A 1PQYA 5EMJA 1CEEA 4PLPA 3SY2A 2NXCA 2ZPUA 4KHPB 2HF7A 1JDNA 3WK7A 3S5UA 5JCJD 1UK8A 4Y98A 4XX5A 3SICE 2IHNA 5KYGA 2DFLA 2QZJA 3FVVA 3TRHA 1I2MA 1J97A 1L9XA 4YREA 1G1MA 2DR2A 4L7QA 3SP1A 4PO9A 4X1KB 4IQ4A 1FSFA 5JJLA 1ONOA 3C1AA 2A9JA 6GPBA 4JQZA 1Y6QA 4YRGA 1EFRA 5CGZA 4CDNA 3VZCA 1YKGA 5HZMA 2AYZA 3NC4A 4YMGA 3RSSA 4ZAGA 2C0MA 3CW2A 1UDRA 3HCWA 1GYRA 3Q15A 1VJDA 2ZP1A 4G84A 3TECE 1AXEA 3G85A 2Y0CA 4PSKA 4D5GA 1ZIOA 1FFEA 5BYJA 3O4IA 4MXDA 2IKSA 4Q4HB 1PS0A 1RKBA 4EEXA 1OASA 1M2NA 1E3QA 221PA 2UZAA 2Q5QA 1HFEL 4KIJA 1TVMA 3U0BA 5AK5A 1CUVA 3UWPA 5E6UB 1JQEA 5F21A 3IDSA 1IUPA 3U7EB 2PZGA 4XUCA 2XADA 3AHJA 3FKJA 2X38A 4RK1A 1U2GA 5D3KA 1G5IA 4HUQA 4OTZA 4Q3AA 3L4BC 3BJEA 1VA4A 1DC5A 4HY3A 2X2EA 2ZI6A 2BP7A 1ND5A 1Y37A 3UBMA 3GCXA 1A1SA 3I4LA 1D4AA 5DNEA 1PT9A 3CVJA 2AH5A 3ZHXA 5A6SA 4Q03A 3LU1A 1HM5A 2IS4A 4D3YA 1FS5A 1FXWA 4ZOLB 4LDZA 5KYVA 2FFHA 3TXMA 2EW2A 2QZ9A 1J8QA 4KH1A 5EZYB 2QL9A 3OKCA 1KZ4A 4BGUA 3C3QA 1JDUA 1FNCA 2V7VA 1IPHA 3C3AA 3CX8A 4YR9A 5DMHA 4A2WA 1I3NA 3P1JA 2XQIA 2Q0XA 3C7TA 2WY2D 4O1PA 4HRVA 5K2MA 4CT0A 5C37A 5KVAA 3DC7A 3N2LA 4DIBA 1SVXA 3GFGA 3SQOA 2REQB 3DLBA 4RTMA 2EIHA 3D3QA 3QYAA 3NVDA 4UD6A 2JA2A 3M82A 1E9AA 3KOZA 1PGPA 4TRMA 3FYDA 4C5CA 4EQFA 4OA5A