2VSYA

Xanthomonas campestris putative ogt (xcc0866), apostructure
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
547
structure length
547
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords XCC0866
total genus 208
structure length 547
sequence length 547
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsyA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsyA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsyA02
2XMPA 4AMGA 1FU8A 4GPKA 2UWJG 3C4VA 2UY1B 4ME2A 3ZGQA 2FF5A 1TJCA 1HLFA 3U3WA 5EKQD 4GYYA 3S28A 3QDNA 3OTHA 4X6LA 3SF4A 2WTXA 3T3DA 3MKRA 3HBMA 3BD8A 3PE4A 5LQDA 4HOTA 1NZFA 5LCWC 5AYWD 3MRXA 4U0UA 1FU4A 5FT9A 4BT9A 2VCHA 4N5CA 1FA9A 5HQ8A 3BCRA 3T3HA 1P4JA 3CUYA 3IAAA 3NAZA 4KQMA 2L6JA 1GGNA 4G26A 3T3IA 1L5WA 3CUVA 1E4OA 5FZQA 1BX3A 3CKCA 3MV2B 4XI9A 5D01A 4BFCA 2QNBA 3UYKA 2FBNA 3LCAA 1NOJA 1GZ5A 4BTAA 1C3JA 3SYRA 1WW3A 3RT1A 1WUTA 2FETA 1K06A 4A1SA 1GPYA 2ECPA 2QFCA 1E96B 5A7DB 3CEHA 2X0DA 3CKBA 2F9FA 2QN2A 4M7PA 4X7PA 1K08A 5M72A 2XPIA 2P6PA 5JTTA 3E3LA 2QN1A 5I45A 4RIHA 2IEIA 3RO3A 4O6FA 2KATA 3OKPA 2PRIA 4WADA 1J39A 1Y6FA 4NC9A 1WM5A 1KT1A 1AHPA 3OT5A 3ZCUA 1HH8A 2BISA 1B89A 5FTPA 3BD6A 3MS7A 3CV3A 4HOQA 4I9CA 5TMEA 4RIIA 4F3VA 6GPBA 2F3PA 1SXQA 4I2ZA 2JJMA 2VGXB 3MT8A 3O48A 2IW1A 4AY6A 5DU2A 4F96A 2HR2A 3OXLA 1JEJA 5TMDA 5KJNA 2R66A 1Z8DA 4N3CA 3D0QA 1ABBA 5D0QD 4UI9C 3WAGA 2C2LA 1L5SA 3QHPA 3UPVA 4KQ2A 3K9IA 4CTOA 1PYGA 1H5UA 4GPBA 2C0LA 3H4TA 1XL0A 3E4BA 2F3UA 3QKWA 5CHEE 4RG9A 4EL5A 3L7BA 3T3GA 2XGSA 3G2HA 1RZVA 2KCVA 2BFWA 4BT8A 2PL2A 4FKZA 1FS4A 5JJTA 3NCHA 2C1ZA 3NPAA 2HYZA 3ULQA 5EX0A 2WPVA 4RELA 4HLNA 3O3CA 1XC7A 2C4MA 1QKJA 2SKEA 4Y6CA 3WXXA 1F6DA 1WV0A 3T5TA 3MS2A 1IYGA 4AM9A 3ASDA 3LKUA 2JZCA 1YA0A 2BGUA 2FEZA 4RIFA 3JYSA 3LY8A 4I17A 4X7RA 3CK7A 2X6QA 1XKXA 2ATIA 3L79A 4N9WA 2OFFA 2VSYA 1EM6A 2F3QA 3CVQA 2H1FA 2LNIA 2IUYA 1L5VA 2XA2A 3D0RA 5D0OD 3RU0A 2QRMA 3MSCA 2QN9A 1P4HA 4N2QA 2Q6VA 2R4UA 1WAO1 4KXKB 3MTBA 4GYWA 2PRJA 3UQ3A 4UQYA 2IYAA 1P5QA 3ESKA 3FWVA 4GZ6A 4YUAA 3GYZA 2C0MA 2VGYA 2BGTA 3GZ2A 1C8LA 5EX3A 4WNGA 3TAXA 5HXAA 2GPBA 3OTIA 3CVLA 3T7DA 4F97A 1UQTA 3MTAA 3ZCTA 3AS4A 4JL0A 5FZRA 1Z6PA 4RIEA 4U04A 4MI6A 3CVNA 4N3BA 2WQHA 5DBKA 2YJNA 4YI5A 2XGOA 3QOUA 1GFZA 2R5SA 1KLXA 1PSWA 4LEUA 3LY9A 3KAEA 3EDTB 3BEEA 1L6IA 2SKCA 2XCUA 3GPBA 1FTYA 2X0FA 8GPBA 2QLLA 3Q47B 5FJYA 2ACWA 3TOVA 3NC4A 5LCWJ 1HZ4A 2X6RA 2XCIA 2GPNA 2P58C 1AXRA 3SYMA 4ABNA 2Y4UA 4AY5A 1LWNA 1WV1A 2BUGA 4CTMA 4X7MA 2J9QA 5DIZA 2VGXA 4M83A 2G9VA 3Q3IA 3CEMA 4BQIA 1NVKA 3DDWA 3KD7A 4AN4A 4N3AA 2PQ6A 4CGWA 3IA7A 4BTBA 2I6HA 1O6CA 5JJ6A 3N71A 1PC2A 4AIFA 3S7FA 1JG6A 2PQRA 2GEJA 2H1HA 2VG8A 1JIVA 1Z6QA 2GT1A 3OKCA 1UQUA 4N39A 3C4QA 4LEIA 4YVQC 5CCMA 1WW2A 2IF4A 4UI9J 2KS6A 3RJVA 1B4DA 3FROA 4JHRA 5G04C 2O6LA 3L01A 2QLNA 1SXPA 4B94A 3GUHA 1YA6A 2Q7FA 1XNFA 1IHGA 3UUXA 3Q49B 3S2UA 1LWOA 1QM5A 3U4TA 3TGOA 1XOIA 4EKEA 5JTUA 3MBOA 1F0KA 4U0ZA 4MRAA 2VCEA 3VDMA 1QZ2A 2YQ8A 4G23A 3OKAA 3Q15A 4XIFA 3CV0A 2QZSA 3MQFA 3L7CA 4MHOA 3MEKA 4GA2A 4I9EA 3CK8A 3G2LA 1YGPA 2FFRA 1NZDA 3VUEA 2SKDA 4G24A 2JLBA 3OXGA 2ZB2A 4U07A 3VTXA 1ZBPA 5BW8C 4KYOB 4W9RA 2IFUA 1W3BA 1FTQA 1FTWA 1P2GA 1JIXA 2AMVA 3CEJA 3PE3A 3COPA 3MA5A 4G2TA 4RIGA 5TMBA 3NP7A 2PYIA 4RENA 4CGVA 3BCSA 3Q3HA 4F9FA 4WNDA 4WHMA 1ZU2A 4REMA 3AS5A 3VDNB 2F3SA 2XA1A 5DXFA 3DD1A 4BQFA 3QWPA 3AMVA 3T3EA 7GPBA 3ZCVA 4IN3B 2KCLA 3ZN3A 4GZ3A 3D1JA 1V4VA 1P29A 5G05J 2VSNA 3NF1A 2QN7A 3VTYA 4Y6WA 2GM9A 4UQZA 2XA9A 2R4TA 3UYLA 2NC9A 1JIUA 3OXFA 1KTIA 1L5QA 4UQXA 4H7YA 3DZCA 5CCLA 3ZCRA 3ASFA 3FFLA 2FI7A 1A17A 3QKYA 4H7XA 1IIRA 1JG7A 3BDAA 4UI9K 2PQNA 2AZDA 5ENZA 3SZ7A 3MT9A 2R68A 2KC7A 3OY7A 2Y4TA 4GYOA 4J8EA 1NLMA 4MHSA 5IKPA 2G9RA 2XCCA 5KJKA 4HOUA 5DLDA 3ASGA 3CUWA 3E3NA 4GA0A 4BQEA 4YI3A 3S29A 5GPBA 2FO7A 4APOA 4WUYA 1GG8A 1FCHA 4G2VA 2ACVA 2IEGA 4L22A 4PQGA 3BCUA 5IKOA 1RRVA 2C9ZA 2QN8A 1A8IA 1L7XA 4CDRA 5G05C 3L7AA 3CVPA 3G2NA 3S27A 3NB0A 4N2SA 4AMBA 3RHZA 3S0JA 2X0EA 5FZSA 4M60A 3GW4A 3HBNA 4G1TA 5ARGA 3R9AB 3QWVA 1L5RA 3ASHA 4J8FA 1Y8MA 3RSCA 4NQ0A 2QRQA 2XCBA 1NZNA 4YVOA 5ARFA 4RG6A 2GPAA 3C48A 3GZ1A 2LSVA 3KS2A 3BD7A 5JJ7A 3MRVA 1NOIA 4YNDA 2QRGA 1VGVA 2IV3A 4NRHB 1IXYA 3HYMB 4W6QA 1NOKA 4LDPA 5KJMA 4Z5XA 3ZHEA 4QLBA 2VYIA 3G2KA 3S7BA 1PN3A 2IV7A 2VQ2A 1QQEA 2AV6A 3ZHEB 2G9UA 3TG4A 3S7DA 1PNVA 2FF4A 4MI9A 4J8DA 1M5RA 2R60A 5C1DA 4XI0A 1GPAA 2HO1A 3PDNA 3BEOA 3URZA 3HBJA 1WUYA 2G9QA 2QRPA 3CUUA 4HOSA 3LPZA 4WACA 4EL0A 1KT0A 3OTGA 2LSUA 3CK9A 3QWWA 2XEVA 2KCKA 2OOEA 4HORA 4RBNA 3ZCQA 2DBAA 4JA7A 1FU7A 3CX4A 4MICA 2QLMA 4MI3A 1HXIA 2E2EA 3LY7A 3Q5MA 4GCOA 3RO2A 3WC4A 2C1XA 4G25A 2ONDA 3RSZA 1RZUA 2GEKA 3OY2A 3ZCPA 1OUVA 1NA3A 2PZIA 4EKYA 1ELWA 9GPBA 2ASVA 3ZCSA 3AS8A 4I2WA 3Q3EA 1P2DA 4NEQA 4J0UA 3TSAA 3VUFA 1GPBA 4CTNA 3NP9A 1P4GA 2IYFA 4BWRA 3CUTA 3MT7A 1FC0A 2QN3A 3G2IA 1P2BA 4EQFA 1Z62A 5BT1A 2MHKA 5G04J 4WNEA 3WADA 3Q4AB 2GJ4A 3FP3A 3MV3B 4I1AA 1Y6GA 5A6CA 1XV5A 3EBOA 3RKVA 1ELRA 3TG5A 2V5FA 4KQ1A 1NA0A 5D00A 4KBQA 5TVGA 5HI7A 4NESA 1C50A 3MS4A 2PYDA 3EBPA 4FZRA 4EJ2A 1XL1A 3L7DA 5KJLA 4GZ5A 2QRHA 3MTDA 4JA9A 3ZFWA 5BNWA 1E1YA 3S7JA 3RIBA 3E3OA 3HBFA 4WNFA 3MRTA 4HWGA 3G2JA 1C8KA 3DDSA 3ZPJA 1Y8ZA 1EXVA 1UZUA 2AW3A 3CEQA 4U0SA 2HY7A 2YHCA 3IEGA 4GA1A 3H4IA 2AVPA 2GW1A 4GCNA 3LYAA 2XGMA 2UY1A
chains in the Genus database with same CATH superfamily
1KEVA 4KFTA 2V4UA 1GTMA 3ANYB 3KR2A 1AUQA 4LJ8A 3DEAA 2XLBA 1YVPA 1SULA 1A8QA 1SG6A 5E7QA 4HNGA 3L82A 1N5IA 1EDEA 1ZA1A 1UBLS 3ZDAA 5AJWA 4J0KA 2VP2A 5JI3E 4BMXA 4HDNA 2IXTA 1F20A 1LJ8A 2Y68A 3K9LA 5KAMA 4TRQA 1O6ZA 3LCMA 3LWBA 3JYOA 2KW5A 2H65A 3ORHA 5CMLA 3ZCXA 2XXAA 2JFXA 1KPHA 4WNAA 5IN5A 3N74A 3G68A 2YRXA 2GTPA 4BPRA 4D96A 1KARA 3A10A 3GUUA 3QWIA 4QOHA 1ZQ1A 1RI1A 5GOZA 1R0YA 2YJZA 2VJLA 4IYJA 4EX6A 3ELDA 4KOEC 3PQ4A 3GB9A 3TLYA 1UBHS 2OECA 1MIOB 4YP9A 4QJBA 1QE3A 2PKQO 1ZJYA 2GARA 4AJKA 4ZPXA 5LM3A 4JFRA 4PM4A 3ABME 3QBJA 1M0EA 4O60A 2FW1A 1II8A 1P1RA 5JDCC 1KF0A 1MX9A 3PL5A 2H1VA 3NI2A 4RX1A 4JLNA 4BFCA 1IBCA 3APFA 1NT2A 1XRLA 2PSJA 3CGWA 3PHIA 4RD0A 3VPGA 1QIHA 1OI4A 5BMVF 3HR8A 5K0GA 3PEUB 1TA9A 1B8OA 2QTAA 1OFUA 2XJ9A 4B7ZA 2WXFA 4RZIA 1RAHA 5TPZD 4I9GA 3VOTA 1KQGA 2YVAA 1XAHA 5F9FA 3C14C 4E7PA 4AUKA 2EQAA 4TV9B 3FCAA 3FDZA 3T4XA 1UZLA 3UG7A 3JTMA 5LPNA 3BGWA 2OCKA 1E96B 1P81A 5IM4A 2ZUUA 1VE7A 3T8KA 4KIJA 1XJ0A 1F17A 1OWOA 2WHQA 2RONA 1DQNA 4OP3A 1AKWA 3DVSX 3H1FA 2PTGA 5DM2A 3M82A 1ECGA 2F6RA 3L5OA 1B6TA 5AR1A 2AK2A 3RODA 2X58A 3LWDA 4AULA 4IDFA 3HRHA 2WF6A 3JD1A 4GIBA 4QGSA 4CMEC 4PX2A 5BN1A 4H3VA 4IV5A 1HH8A 4O4LF 3GRZA 4IZ6A 5FTPA 3PIDA 4BQPA 1T13A 1G59A 2QU7A 4DIFA 1PRYA 2Q0QA 1RQ7A 3BXEA 4I6GA 3D8NA 4I9CA 3TOCA 4BTEA 5EIWA 4RIIA 4J75A 4O4JA 1S63A 1JFSA 3Q9UC 3KVYA 2WD8A 5JQWA 1R10A 1AA6A 3OQBA 4DPRA 2ZOSA 4HQNA 2A5GA 1TO2E 2IU0A 2HR2A 3RQIA 2P1RA 5ECGC 1S4QA 2BFFB 2APJA 1NNLA 2J0EA 3CSFA 4NFSA 4QECA 5HK8A 3RVNA 5HKBA 3EHDA 2WD7A 3K6SA 5D1NA 3K5IA 5EZQA 4LFCB 4X24A 1PYGA 5JHBA 2P65A 1OXKB 3ADOA 5A1TA 2JI7A 2QQFA 2W2KA 2JK1A 2DKNA 3A04A 4EY5A 1J5XA 3CH4B 4GBJA 1M6VB 1P72A 5ER6A 4GMLA 4C0HA 1D4ZA 2X1MA 5F1OA 1DP4A 1MB9A 2IPMA 1AXGA 4S1VA 4DIMA 5BW5A 3T4EA 3M9LA 2BGJA 1KJNA 3CPSA 4W5OA 4KBGA 4ARCA 3PNKA 2D3WA 2W5UA 1N4RA 1UBCA 4NK5A 4ENSA 2WPVA 4RXUA 3WB0A 2EF1A 5I7VA 1M1YA 3T5TA 1PIWA 4ZHBA 4FLFA 3L82B 4K9DA 4K5BA 4MUGA 4C0WA 2Q5CA 4AM9A 2FVYA 2OY0A 4PC6A 2JZCA 3R23A 2AG0A 1H85A 1BGVA 2P9TA 4RIFA 5AI0A 4HDNB 4TT3A 4LMAA 3T0GA 3RYFB 4UUMA 2NVUA 1TR4A 4U7TB 5A7FA 1WXGA 3UTDA 5EQTA 1B14A 3GVPA 1D7OA 3S7ZA 3PWTA 2B83A 1L5VA 1XTKA 3ND7A 2M2IA 4Q3NA 1G41A 1XZBA 4PQRA 4PG8A 2KBEA 2R4UA 2A78A 4RACA 3V4ZA 4MAMA 3UQ3A 2C2KA 2XDQB 1M6NA 1JQJC 3ZW8A 1F51E 3L46A 2IXAA 2ATCA 3BA6A 4H7HA 1XMIA 3A4IA 1FIUA 3AEQB 1XTSA 2ACKA 5LUBA 2ZIRA 1P9RA 5KBAA 2IDJA 3GROA 3DV2A 3P9RA 4FFRA 5EWLB 2FFAA 3LGSA 3TAXA 1JWLA 3GOHA 3ITNA 4MBGA 4FKMA 1CUEA 5GONB 3WB2A 2FSGA 4DV2B 4IHAA 2QI9C 1WZNA 2WNHA 2O1EA 5EKXA 2D2XA 3PVLA 1UQTA 2ZU0C 4PZPA 3ZJ4A 3ZCTA 2UXCB 3CURA 1PT8A 3SF0A 2FWRA 1UDAA 5FZRA 4W7SA 1Z6PA 2HBQA 1V16A 1T0UA 3NTXA 3ZK7A 4RIEA 1RZ4A 2IPAB 4GM4A 3AR4A 2XIQA 4BO8A 2PZ8A 1JVBA 3BZBA 3U3KA 4HEA6 3CW9A 4LRQA 1H4TA 1GZ4A 2WQHA 4IQGA 3F98A 4Y2TA 3W5IA 5BR8B 4PVDA 3DQZA 4TLMB 4D9BA 5B55A 1Q0LA 1F1BA 3G1UA 3ZV7A 3IP5A 4OU5A 4I6EA 1PFKA 4LHSA 4MO9A 5DJ5A 3U3OA 2IZ6A 3Q7EA 1R8JA 2VXBA 3HXMA 4QBIA 3B1JA 2MIIA 3SN6A 3BEEA 3C8DA 1K1EA 3GPBA 3OCWA 2WKWA 2WVIA 1Q21A 3IDQA 3WA6A 2DX7A 5EN4A 1G3MA 5A71A 3LBAA 4E5PA 4EUSA 1RQLA 3H2JA 1L2TA 3ZDXB 1VLLA 2FQ1A 4J6EA 3A1FA 5FPPA 1B3BA 3WY9A 2H7VA 1VBMA 4O2LA 1ENYA 2BGWA 1EZZA 1OQAA 1U99A 2ZRMA 3UJ8A 5BV0A 1B6SA 1K6EA 4I8DA 4K6FA 3WNQA 4HXFB 2CNDA 1GZUA 3SYMA 3EUAA 5KNCH 4O4JB 4IIBA 1XT6A 1Q7TA 1WV1A 3B82A 1O1TA 4F4FA 3Q3IA 5CAEB 3DDWA 4GL4A 1BCRB 2F0YA 1O94D 1H2ZA 5AI8A 4AN4A 4CKZA 2O2DA 3UI2A 1QBQA 1SHKA 2BFFA 2NSDA 2DWQA 1H66A 4ZI3A 4I46A 3P2BA 1PWHA 4GPTA 5JBIA 1IHBA 4TMKA 1D5CA 2EJUA 4LWOA 1T3LA 1U0OC 2EW2A 1U8AA 4O3FA 2EIHA 4LX8A 1PC2A 4AIFA 2CNLA 5EP3A 4F7DA 4UNRA 4FLHA 4X44A 5DT2A 4YRCA 3OKCA 2PX4A 5AW1A 1KAOA 2W2KB 2IO2C 4XB2A 4MUYA 4B3FX 1CUYA 5CLIA 2J45A 1OZHA 1BFKA 1TOAA 2Y0BA 1QOQB 5HG0A 5LLTA 2E0IA 1PW7A 3O9VA 5EKTA 1RXEA 1AO0A 1RLMA 2JBWA 4Q12A 2FW9A 3CO0S 4ND8A 3TLJA 4UEKA 3ZK9A 1OPXA 3KPJA 4RF2A 2R1VB 3KXLA 1HNXB 4DIDA 1NVUQ 3LV8A 4IMIB 4PCVA 2MSCB 1X38A 4R31A 3MTGA 1XOIA 3OZWA 1G2QA 4IDBA 5G1NA 1UPCA 3UW1A 4D02A 1E98A 2B99A 4YQZA 2BEWB 3VDMA 4F0JA 1ZD3A 5AVVA 4A8JB 4ML3A 1ZH4A 5CECB 4LJ7A 3DW3X 2O52A 2UVPB 1W0KA 4JJ6A 4OLAA 5AVXA 1OWNA 3AG2E 3CK8A 2IEAA 5C35A 5KTTA 1QNLA 3TLEA 3OXGA 1E6LA 1JHQA 3T0FA 4U07A 3VTXA 1IXKA 2QRVB 3Q3CA 5K8UA 2YBEA 1J8YF 1EYZA 3JD4A 4UAJA 1L5GB 4JA0A 1PWEA 4F91B 3OPYB 5DKFA 3ZI4A 1LSSA 2COUA 4E3WA 3LBYA 3NASA 1G8AA 4NE7A 1EGAA 3UFXB 5AQ7A 3RRFA 4OX9B 3I6BA 1JIXA 4O1IA 5GGYA 2YYYA 1HM5A 3KOMA 3OMWA 4M1QA 5JSFA 5EHQA 1TUGA 3TTSA 2TECE 4WY5A 2WJAA 3ZHCA 5LQJA 3AKCA 1CHDA 4YMSA 3WYEA 3B7GA 4LNUA 5T8IA 1HRDA 1PUXA 3U4DA 3GMIA 3PENA 2ISSD 4DFDA 5L3SA 2NM0A 4S3MA 1U9IA 4CLDA 4Y3UA 5JJKA 2NYAA 3A2LA 4JEUA 4KWIA 1UFKA 1VJGA 2JIOA 5H82A 3KKPA 4JQSA 3VR6D 4EGQA 1ML4A 2J48A 1TUIA 2P9JA 2QENA 2H4YA 2VT6A 2XLCA 2XECA 5L8VA 3Q6IA 5G1OA 5C4GB 4DLSA 1CF9A 3ZCVA 7GPBA 3BWYA 1P1HA 2XT9A 1I10A 2OZKA 2PSSA 2IUTA 5KWVA 4GL2A 3LUGA 4ACBA 4JYMA 3R9IA 1HDZA 1U1IA 2I9CA 2LO6A 4G0MA 4ZQFA 4II7A 1NW9B 1BOOA 5G0VA 4YXWA 1O0SA 1XMPA 2PYZA 3A3PA 4YUYA 4L6IA 2QAGB 1CJTC 3KPYA 1TRHA 2IS4A 2ODEA 1X7GA 3FVWA 3T61A 4R51A 2VDMB 4ZGGA 4YUWA 5CVUA 5JMPA 3PFWO 1CUAA 1QGOA 2O3RA 3W5DA 4AZ3B 5CCLA 2FN4A 2WHYA 3MUEA 3DV9A 2OFOA 5TIIA 2Z98A 1FMTA 1QNFA 3QEAZ 2ZRFA 5B2FA 4HTFB 5CM9C 3FUJA 2FI7A 3E15A 3T1QA 1NRWA 7REQB 4LF7B 1W87A 2HI0A 4IVPA 1REQA 4MRUA 2WWHA 1OI2A 2GNAA 3O8NA 3P0HA 3LWNA 3PDIA 5K1ZA 3USES 5CAEA 2FJ0A 1TGYA 4LCJA 1BCRA 1C3EA 1Z18A 1H9BA 3B1XA 3ICOA 2COEA 2KC7A 1VPTA 2O05A 1K5DA 3MRSA 1ZGGA 3IJ5A 1Q7CA 4IIJF 1LTXA 3HA7A 2EFEB 4ZV7A 1DX4A 1QFSA 4NH4A 1E7YA 4BNVA 4CZ2D 4HOUA 1YA8A 2FF7A 4CU5A 5FDFA 1RR6A 2YIDA 3ELUA 1I2CA 4IV0A 4N8SA 3VV2A 2EJTA 3B89A 3T5GA 2QY7A 4G0WA 3QE2A 2BY4A 2E37A 2CE7A 4AOFA 4YI3A 1OTXA 2DZDA 1WDYA 4KB5A 1GG8A 2ZSAA 4EHBA 4H1VA 1P1IA 1T29A 3Q5EA 4Z54A 5KDOA 1H05A 4I4TA 3SDZA 1JT2A 1YHZA 4GOJA 2O2HA 4DNXA 4MGEA 1DTEA 2DWCA 3SXJA 4M1YA 4O25A 4TUUA 4F11A 4N2SA 1NI3A 2DOKA 2I80A 3BC1A 3EQ9A 3HDXA 4OVVA 3FJYA 4DCJA 2C7OA 2Q1YA 2G4CA 1UOPA 1V37A 4C7KA 5ALRA 3EQ7A 3EB9A 3HYTA 4A8JA 5ELXA 3OJCA 4LJLA 5BV8A 5IJ9A 2Q3FA 2UVPA 1C3XA 4PHFA 1AQUA 1ZJWA 1NUHA 2AF4C 2CXRA 2PVPA 3BFJA 3KV1A 2QR5A 5M29A 1IXVA 3ZLBA 4DOMA 4N76A 2A94A 2XNKA 2Q29A 1CB0A 2QRVA 2PKRA 4PO3X 1PWYE 1FRQA 3FBGA 1F7UA 4IICA 1Z5SC 2FZ4A 4XLTA 1EFAA 3OPYA 2AUTA 3C5HA 1AKUA 3QF7A 2GAIA 5TRTA 3ZIMA 3BILA 1I51A 4EPWA 4HNUA 3CW8X 4DABA 1DXOA 1J0BA 3T5MA 1K97A 1Z12A 2Q8NA 4GU5A 2OO3A 3MYRA 4NDNE 4C7VA 1YTUA 2FRXA 4MW9A 5KJMA 1G16A 1TTPB 2GCOA 3JS5A 3M6WA 4WBNF 4RPCA 2VNKA 1P0CA 4LRYA 3S7BA 1ODIA 1PN3A 1XZJA 3UM3A 2VA9A 3NWPA 4ENRA 1DMSA 3GEHA 4MJLA 1BWPA 1KMIY 1AGPA 5DTRA 2X6HA 2FZ5A 1XZAA 2V96A 3TGPA 1OLOA 2MHCA 2PL1A 4EQ6B 2BR4A 2NXCA 3RGGA 5BOVA 2QTTA 3CVWA 4H6WA 4UBOA 2H4WA 4AF7A 3NH9A 2ZXUA 2UUCB 1NLYA 3AEYA 2AJDA 5CMYA 1U9IC 2G9QA 4FXOA 4I2NA 1Z39A 4MQ6A 5EQFA 3ZPXA 3RS4A 3R5XA 4J7XA 3OEEA 3PNSA 3HB4X 3CLTC 4WW0A 2G7ZA 1O08A 3AW8A 4AJ1A 3SBDA 2D8AA 4A2QA 2WJJA 3UKDA 1T1SA 4YAJA 2CBGA 4MVJP 2D1SA 4BWVA 4G8JA 2R11A 2QB5A 1LTQA 2VHVA 4FBGA 4G4IA 2COKA 3OFSA 3QPCA 2ZB7A 4QWWA 4U39A 3UHAA 4X94A 4EEKA 3FDJA 1EK1A 4E88A 2YHIA 5A4IS 1SBIA 5AK0A 2GEKA 3L1KA 3ZHRA 3IR6A 2HMSA 3OQNA 1KK3A 1NI4A 4G11A 1AQLA 4OHMA 5I7HA 3ZDYB 1TF2A 4CKCB 3IKMB 3AS8A 1DUSA 2CEAA 1K2WA 2M32A 7REQA 5JBNA 1P7PA 1RZRA 2O54A 4Q4AA 5K9ZA 2V9PA 3RG8A 4BEJA 1ZEMA 1H2BA 1M54A 2OXFA 3KX2A 3PDIB 3RK4A 5ALEA 2VRNA 1GW6A 3UATA 3WTCA 1PFWA 4ITRC 5HM8A 3EIQC 4TYWA 4C01A 1KAEA 1XZIA 1EBFA 3V34A 2OHOA 3ILVA 1GTG1 3RU7A 4EQFA 5MN4A 3D59A 4QFBA 3SQWA 4PHTA 1N52A 5D86A 3Q7IA 3W5AA 3DT6A 3EFEA 4KG7A 1XV5A 1Z8NA 1UJ5A 2H9YA 3ENZA 4RK1A 1YB1A 4LYGA 4YP0A 3JQ7B 4X60A 3GC6A 1N94A 2BMDA 3JVEA 3CUKA 4BNWA 4EJ2A 2IEZA 3LVFO 4I4TB 1I13A 4XR9A 1K3TA 4HGYA 1OZ0A 3E3OA 3PHCA 2BM0A 3FWNA 3HBFA 3VPDA 3WWDA 1M6HA 4GKJB 1DRVA 1YIAA 1NSYA 3HYRA 2FEPA 5J2TB 2EKBA 3WB9A 2QYTA 3UKUG 3AVWA 2X9LA 3B2QA 3UAOA 1YZGA 3FPHA 5G1PA 1EGQA 2HYIC 1Z8HA 2Y76A 3DMYA 3OFND 1JQ3A 4G5GA 1SRQA 1BDBA 2PA3A 1WY5A 3FVRA 1SZJG 1T2DA 4GMJA 3R7WB 4PN3A 1NVTA 3WLMA 5EIEA 4XD7D 3WSTA 5MN6A 4FK8A 5FOTA 1HDRA 1XFAA 2OLJA 3GVXA 1UBEA 5CPFA 3UEOA 4CLRA 1HX7A 2JRCA 3QYFA 1DLJA 2FN3A 1N9KA 1RJEA 5FWQA 1SOUA 3FX2A 2FF5A 4WZBA 5C2JB 3AVVA 4TKLA 2DULA 3IDOA 2R59A 1DEHA 4FOTA 3QDNA 1ZA2A 4N0PA 4NMMA 4B7CA 5JYDA 1D4AA 1SUDA 1Z7BA 3ABRB 3EIUA 3WK9A 4FN5A 1FOEB 1Z6YA 3C85A 4RU1A 5T67A 3RWBA 1HLPA 3O2JA 3SFTA 2ZVPX 2YY6A 3F5MA 3M33A 3LXMA 1NRXA 2N42A 3BMXA 3FPEA 5JAQA 4DVGA 1AN9A 5A3RA 4EHLA 2YY7A 3AIKA 3R41A 4HWKA 4N5CA 2ZJ2A 5E7MA 4HWRA 4M7OA 3TJMA 4DNFA 2GJ9A 1TYQG 3EPKA 1F7VA 4PO9A 1K5HA 1TNUA 1U2QA 4BO1A 2ANBA 4AKSA 3EUEA 3PGLA 4NRDA 4OD0A 5G0WA 5JOQA 5LWQA 2XRFA 1WD7A 4G26A 4RULA 4O08A 3KT0A 2WINI 3AR5A 3R0JA 2PGJA 3CIOA 5FZQA 2PS9A 1XNGA 2BI4A 3NWOA 4UVIA 5T8KC 4QPDA 3BXXA 4XI9A 1CW2B 3X1JA 3O1JC 4JK3A 1KO4A 3PHLA 3HFSA 3K0AB 5KOJB 1GO2A 4FJYA 2GYVA 5AM1A 1GU0A 1TCAA 3GZSA 5D66A 4JGIA 2YHIB 3CNBA 2IBSA 1MW8X 1JJ7A 3LT1A 3ZWYA 2HJ9A 4YRPA 4KPYA 1IJFA 4C0SA 1M73E 5A04A 1J6UA 1NI4B 2ZE6A 2VHQA 1Y6ZA 2GPJA 1E66A 1L5HA 1GQOA 5DF1A 4Z9AA 2IS6A 2BSXA 2GXUA 4QBKA 4ER3A 3OT1A 3M4JA 4TM7A 1QTRA 2OSBA 1DFIA 4Q4AB 2P78A 1EFHA 1KBZA 4AURA 4C4YA 5IXYA 2VYQA 1NN0A 4LNBA 1Y37A 3RSQA 5CCDA 1P9LA 3FUDA 4ME6A 3CHYA 4GTVA 2FU5C 2FA9A 2PV0A 2WZBA 3CM0A 3MQ4A 3H42B 5LVAA 5J1SB 1TKBA 5EN5D 4WADA 2HFKA 2LE0A 1T34A 3CZ4A 3FOEC 3FU5A 4J91A 5JSYA 5AJZA 1IBLB 4ALJA 5IG2A 3STVA 2BV3A 2ZJ7A 1O58A 3PDUA 3HDHA 4GO1A 4ZN6A 4RESA 2IITA 2TYSB 1D7AA 1N75A 4ON9A 2OQVA 1DDOA 4P4LA 1MDBA 4H60A 1Z5NA 2ZE7A 1KDVA 4BETA 1OMOA 3L1UA 2F3PA 2QPOA 3H87A 4WUVA 1H8ED 2QUJA 3Q9SA 1T6NA 2FPPB 2IW1A 3ZXUB 1GKUB 1JLLB 3CWCA 3H2BA 3K1TA 4HGZA 4P32A 4UMDA 3ACBA 2ZSBA 2BMVA 4WXYB 3PG5A 4J76A 3ROEA 1XZDA 3UPVA 1QB7A 2OHXA 1MQAA 2BOVA 4KQ2A 1AQ6A 3BF7A 4QWMA 5F98A 3NANA 4GTTA 2B2NA 4QM6A 1X7WA 3H4TA 4TROA 3D9QX 3KCQA 4KIGA 4LDZA 3E4BA 2OUIA 3QUQA 4CG3A 5DMHA 3NH6A 4RANA 4ZT5A 4J94A 1AGYA 3NBMA 1XF1A 3MWLA 2J3KA 2FUKA 4MCIA 1FP2A 2SHKA 3L0OA 2O8VA 3VZCA 3KKMA 1U3CA 5JJTA 4LGVA 4FI3C 1OI3A 2XHEA 1GAQA 1QIEA 3K8ZA 4LGMA 3W4IA 4FEYA 2C9MA 4WZBB 4EHHA 4C22A 1G38A 1N57A 2ZUBA 3EZNA 4FHCA 1U3UA 2X5XA 3C3XA 3OQHA 2XNDD 3SZ3A 2O5CA 4ISCA 4MWEA 5FUYA 2RHCA 3JR7A 3SQOA 3JYSA 1IEQA 1FJXA 2ZVDA 5TEVA 3V4OA 4F72A 5KWJA 5K45A 3EZGA 1ZNZA 2LXNA 3IERA 3O95A 3GCGA 2VSYA 5ALUA 2BEUB 2D1RA 2F3QA 1N34B 3K4PA 3W5VA 5AHKA 4JA2A 5TSDA 1RRCA 1IG3A 2DUMA 4AYXA 3MSCA 3WYGA 1KS9A 1L4YA 2FMTA 5JQGA 4BFVA 4B76A 1K7CA 3SJCA 1YOVA 4WX2B 3T95A 2H0RA 1SVWA 2Y6VA 3OA2A 1J06A 3RUEA 2CFTA 2ZQ5A 3E6AA 1XDZA 2CBZA 1E8DA 3WMXA 2BMFA 3A0RB 1M67A 3FSRA 4Q3CA 2V7XA 3B48A 4DJJA 1O0BA 1UKZA 1A72A 1LKZA 2Q2OA 4XVQA 1ZH2A 3R7AA 2OCLA 1KRXA 3K0AA 5KOJA 1G42A 1ZRSA 2FOIA 1L5ZA 5CNMA 4L9AA 4UTZA 4EYQA 3EU9A 3N05A 4QICA 4PNZA 1OFUX 2QMOA 4HYQA 1E9AA 4V3IA 2NZWA 4ZOEA 2B82A 3RDPA 2ONZA 4J0EA 3NKVA 4D80A 4BV2A 3O3NB 3OT1B 2PPLA 1I3LA 4DLLA 2NPOA 4IY1A 1EI9A 4IHJF 1W581 1U28A 2VS1A 4L8LA 5H02A 4AC9A 3G8BA 1VKZA 1DDGA 3EPRA 4QQFA 4OP1A 4A3SA 4HQ0A 2BFDB 1BI7B 1S2DA 1TPYA 4Y2HA 1WUIS 4RXTA 1GRCA 2DH6A 4L73A 5HA5A 1T0IA 2PU5A 2PZMA 4WNIA 4GX2A 1JDSA 5JFOA 4DI4A 4QGAA 4WCFB 2JL1A 2ZBGA 5CXUA 2IZZA 1BGXT 5KYYB 1TUBB 1RXYA 2LKDA 2D7CA 2JBHA 3CXUA 3G02A 4UNIA 3ZNNA 3MX3A 2B5WA 3TTVA 4C4XA 2KX7A 3EXHB 2P1ZA 1EP2B 1CQIB 3ZY3A 2NX2A 1A7UA 2CZQA 1N5LA 4Q5IA 2NQTA 2FR8C 1NVKA 4L76A 4EG1A 2PQ6A 4DAOA 4GTMA 1KZ9A 1RZ3A 4E6EA 2HHCA 4OFZA 5AI6A 3TI9A 1JZQA 1AMUA 3WL3A 2XQKA 3CPHA 1E77A 2AZ4A 3GG2A 3DXMG 4XCXA 2ADMA 3EC2A 4TKUA 3GUCA 3KEMA 1YKFA 5CRIA 3P0JA 1D9ZA 4YDEA 2O3UA 3O82A 5HCNA 1QRSA 3ORQA 2EX0A 4CM4A 5AYVA 4YPVA 1MJ0A 2XEDA 4NMWA 3TZQA 1B1CA 1X77A 3OLWA 4MPRA 3IEXA 4JYZA 3D43A 4GTRA 2GEFA 4B94A 4PBSA 1PO7A 4JJEA 1U2GC 3LGAA 3CC8A 3S2UA 1M75A 1F8XA 3FJOA 4G09A 4HI8A 4QEDA 3UIPC 3TGOA 1PJ3A 4BYMA 4EI2A 3LO8A 4WKBA 2KYRA 4B6SA 5KMGB 1UPUA 1XQYA 2D2EA 5J5CA 1XP8A 4QIHA 1FSZA 4R1TA 1CWUA 1E7MA 3B1WA 1BD8A 3ULKA 3UAGA 2OILA 3ASOE 3WJ1A 4ARVA 2QMUA 5KZMB 3QY0A 4E11A 2XOEA 5BSWA 2YV4A 4TWZA 2G1PA 3G9UA 4W5JA 1IRIA 3UTCA 1TZ2A 2W4MA 1NZDA 2GS9A 4XGIA 1E3MA 3BWXA 4CLXA 1KK2A 4HGQA 4ZCQA 1WB5A 2Q6KA 5JJCA 4A0FA 3ECAA 5JSQA 1PT6A 4D45A 2HJRA 2D3TA 5TJHA 5KKNB 3BCHA 5JQGB 3H2IA 3PIRA 1J21A 2P3LA 3DZFA 2IJGX 3BGSA 2YHEA 1QO7A 1E8MA 1EU1A 1QR6A 3B2NA 4MMZB 4DV5B 4G5OA 3T9AA 1UWLA 4B8AA 3PE6A 5I7UA 5HOQA 1L4LA 5F64A 3UOWA 3ZYLA 2Q21A 3B9RA 4OB7A 4AAYA 3F6QA 1CRLA 1EVZA 1WXIA 5TMBA 3T1OA 1U0GA 1ZUNB 2F1IA 3HDQA 3BQ9A 5I4KA 1JPUA 3G2TA 3QNMA 1D2HA 4IIJA 5FJIA 3GCDA 2B0CA 2X6JA 3OOSA 3U39A 5IRCD 3BSWA 1HPLA 4Y0AA 2NXJA 1I2DA 2C29D 3DVQX 5AVYA 1HQDA 2IXFA 1H2TC 1KJWA 2W2OA 4M86A 1H9AA 1IB6A 3HU2A 3PQ8A 3QJZA 3PD1A 5PNTA 1ODKA 1KDZA 4G01B 5J59A 3DAGA 4TQAA 5CCEA 4P36A 5LQAA 1NKVA 2KCLA 3TL6A 3ZN3A 1FTNA 2GKOA 3TSWA 1KGSA 2PJUA 1GPJA 2R79A 2WLSA 2ZZKA 3ILHA 3TBFA 1HUQA 4TMXA 5TR9A 3D9LA 4ZYTA 1NVAA 3DWIA 1A2OA 4E08A 1M2HA 4E4RA 2Y9MB 4R0NA 2E1PA 2QN7A 1SCUB 2V4MA 4Y6WA 4D82A 3IEUA 3R9MA 2OZEA 4UQZA 2H48A 2PMCA 2W22A 1E0DA 3IT1A 4IVQA 1T4CA 2H57A 4NR0A 5FNVB 1GYQA 1WMBA 3FH8A 2QIPA 3I9OA 3PJEA 5EIAA 4ZVPA 4EFLA 1N95A 4YT4A 5LYJF 1ZXLA 1UZMA 1S89A 1Y8RA 2RGDA 4HADA 3ELYA 3FFLA 2DC1A 3DLTA 2YN4A 1TF5A 1TUBA 4I50F 2O2JA 2Q5OA 4DEYA 1L7VC 2FTKE 1O6BA 5HHTA 4QD3A 3L1HA 1O8BA 3GW8A 3P97A 4NAUA 1KQNA 3EXHA 1QE5A 2A0KA 2O2YA 2WMYA 2JFWA 3OLCX 4TXNA 2PUFA 2Z2YA 3MMZA 4Q15A 4UI9K 3T9EA 3IDFA 5EFZA 3T1NA 2X9VA 2FH5B 3O94A 1CZOA 3DVAA 3GJTA 2QAJA 1XROA 3M4ZA 3CJRA 3T9FA 4X97A 3U81A 4RUKA 1YB7A 2DJIA 3EVCA 1D2NA 2Q1TA 4MYTA 1SZAA 2XUJA 3RASA 3SFVA 5BW6B 2BFBA 1W36D 3QV1A 5FV7A 2V03A 1KZOA 3G0DA 4CXMA 4JIMA 1VL2A 5HTKA 1W1WA 1MF7A 3RV3A 3IXEA 1RRVA 1JSXA 1Q7RA 3ZTTA 2N1MA 1FT2A 3PBKA 2P4EA 1ZUD1 3C72A 4Q02A 3VVBA 5H3HA 5ESDA 1KJIA 1DIBA 1XHEA 2PT5A 3KSZO 3OJLA 3P26A 3LQ1A 4R3NA 5JZ9A 2DWPA 1XVLA 3GH3A 5ULLA 1YS7A 4ANWA 2A14A 4JQCA 4WVLA 4LY6A 2OUKA 3G1WA 5DISB 5K8LA 4Z53A 3VKGA 4M60A 4IJUA 2OCCE 1FVFA 2G8LA 3DSUA 4PF1A 4UMVA 1FQOA 4LOJA 1T24A 3AIMA 2WM8A 1F2TB 4GP6A 3JARA 1OVGA 3F8SA 4FOPA 4UNSA 5CB6A 4F2WA 3OE5A 2YVQA 2GD0A 5JV5A 1Y3IA 4MPTA 3GZ1A 2E7ZA 1S2OA 4ZXFA 3EDMA 3TO5A 3SVLA 3CT6A 4DWOA 4ND2A 2WXKA 2DFVA 2PZAA 3MTQA 3TIGA 4DR1B 3ISJA 2FWAA 3F3MA 3S8YA 4YX9A 4LCBA 1A76A 4E13A 1Y0BA 4RVDA 5LDHA 3TMYA 4QLBA 3RUPA 1E2QA 1EG2A 1M1ZA 3AFNA 1ZUNA 4K86A 1P7VA 1BKSB 3LF2A 4L3WA 1WUKS 2AR0A 4IIJB 3HWX1 4PINA 2ZBVA 4G1CA 1Q1ZA 1WPXA 3I4LA 3W3AA 4Q4LA 5C1DA 2Q1UA 1M5RA 1MG5A 5JCJD 5DWQA 4KMOA 4Q19A 5EIBC 5JH7A 4WACA 4UW9A 2FEKA 2V6IA 4Q1FA 1TK3A 2WYVA 5KOHA 3BE6A 4ARZB 4ZJPA 2C94A 2G08A 1JLRA 4L02A 1ZOSA 2R5FA 4KPUB 2WVGA 2VRBA 4FADA 3L18A 3R7DA 2Y71A 4KMMA 1RNLA 1BQ3A 1LX6A 1SQGA 2ORIA 5A7HA 2QLMA 4WV3A 2HK7A 3N53A 1WCXA 1RKVA 2AE2A 4DSUA 4DSTA 1HKUA 2JKVA 4JOSA 4HEA1 4F38A 1V11A 1FXWA 1N36B 3ZDDA 4XA8A 1WKBA 3AETA 1MC5A 5FI5A 3NGLA 3CF4A 2W42A 1MAAA 1U9CA 2WA2A 3CB2A 4OQDA 3FN4A 4PSAA 5AK4A 3ZGNA 4PANA 2ZK7A 2JGJA 2ZT5A 2VHJA 1OFGA 3LLSA 2GBIA 3VR4D 1Y81A 2HJHA 2P4QA 1W4ZA 2VZ0A 3LP6A 3AHIA 3MJ4A 5KNHD 1TZMA 2DMRA 4JBGA 3UAYA 2YV5A 4CEIB 1JDNA 5HW0A 3T9KA 3QFTA 3U64A 2A9PA 4YAUA 5CJ2A 1CLUA 4KQWA 4BJ3A 5EXPA 3B3QA 3EGEA 1ZD1A 3KQLA 4L85A 2GJ4A 1XJQA 4OH7A 3DEOA 2CZCA 3AIIA 2G76A 2FG6C 2UZIR 3LC1O 3Q98A 4LWPA 5E1BA 3TM5A 3U40A 4O33A 4UTVA 1NA0A 2G9ZA 4RETA 5K4GA 1HO8A 1R2QA 4BOYA 1SUSA 1ESNA 2GAOA 1OGYA 2W2LD 2YVLA 4HB4A 3BWVA 4LTDA 4FZRA 1YR6A 2VCYA 1SWWA 3VPFA 4DCTA 5I7SA 4UNQA 4RVUA 3F71A 2V4HC 4B8YA 2JKZA 1R4ZA 2ZYTX 4P22A 4A5SA 4N0MA 1TM1E 1CIJA 1YS4A 2XUDA 5KCMA 2VJ8A 1CS4C 1PJQA 2EFDB 3KJZA 4GMGA 2QAIA 4OUDA 3REQA 4Z7QB 1EG7A 2GXQA 2HY7A 3RIMA 1NAIA 4WZAB 2BTOA 3QYPA 1SAYA 5GAJA 2GA8A 3K16A 3SBEA 1Q0TA 1F2TA 3MJVA 121PA 5BSVA 5KHOC 1QRDA 1ZCFA 2PBLA 2R6DA 3JARB 3HCCA 2WPDD 3BL5A 4MV7A 3FOCA 3DMNA 4XB6B 5JD6A 5J3JA 5KOIA 5ESWA 3T5VA 4PPGA 4JB0A 2QJOA 2FMHA 2UYOA 3VC1A 4BX0A 3IUBA 4PFKA 5DXAA 5IJXA 4YRKA 3U5ZB 2WTAA 1NW6A 5DNDA 3FZNA 3GT3A 2W4IA 5DYGA 3WL6A 1TNOA 3LLMA 5HE9A 2XBMA 1QZ3A 1NF8A 3KTOA 3KXPA 4RPJA 3I2FA 2GLUA 1S8FA 2YDYA 4LZZA 2Z2ZA 4H77A 3HNRA 3L9TA 5FT9A 1NVFA 1UEXC 2B30A 2VWGA 2VAWA 3MPOA 3IHTA 2ILTA 2PUEA 1A5AB 1AC5A 5THXA 2ET6A 4M49A 2WU0A 2Y1CA 5LXTF 4HWOA 1J9EA 3TJPA 1IOLA 1Z88A 2J30A 3K1YA 3V46A 1E64A 4BMCA 4EGJA 3D64A 2J87A 3EDRA 4M87A 1FUYB 2BUBA 4YRAA 3SBSA 1C4OA 3MM4A 3ABOB 3PWKA 4CF3A 1PSDA 4I4IA 3TUZC 2KM1A 1F8GA 2QJTA 1DQPA 2FR0A 3GVHA 3Q7AA 3H1TA 3PGMA 2EZ8A 4KPUA 3F6RA 5AHOA 1MJ5A 3LOPA 3WIDA 4YEDA 2AG6A 5ERXA 1Z0IA 1FK8A 1I4LD 3MWJA 1GV0A 1WUTA 2OORA 1Z0KA 4E22A 4LKOA 1VL0A 3T35A 2OVFA 2O8FA 3DTNA 1AZWA 2BZ1A 4KR3A 3VYSB 4MW5A 1RADA 4B8WA 5AXAA 1II0A 3DCIA 2DUWA 1ZHHA 1XRRA 1Y1RA 5A7DB 4RD3A 4YJ3A 3ZU7B 3O31A 3KQVA 3QWHA 4CIXA 3H83A 1G20B 3IJPA 4J4BA 4EA6A 3R3HA 1XDGA 5B3JC 1LBQA 2R5WA 2GCIA 2V7QD 1KFJB 1V2GA 4DRXB 1VG8A 1Y8QB 4YRNA 5JUWA 4AN1A 1PSZA 4B3HA 4RHCA 2XPIA 2F3TA 1TA0A 3NYQA 5C32A 3MMSA 2DPYA 1A2BA 3WK4A 3HJTA 4OL9A 1WU7A 2MTBA 3G17A 5LU9A 2QGFA 1JNYA 2ETAA 1GTVA 2YCBA 3ZCUA 3TNJA 5LA6F 5KBYA 1A9SA 1LLDA 1PT7A 3AXTA 4UARA 2OOKA 2FLWA 4OLHA 3RFUA 3RK0A 2P0EA 4C3VA 1NYLA 5ENOD 1QHHB 3CHRA 2RHMA 2UYGA 4HOQA 1QRAA 2WC1A 3NWEA 3WMGA 5GV8A 5BXOA 3UW3A 3O3OB 4HY3A 4IDEA 3AESA 1EIWA 3RJZA 1Y6JA 1JCRA 5IUJC 1WLYA 1J7KA 1XQ1A 1SCAA 2Z83A 3MEQA 3D2CA 3BL6A 2CYCA 4AY6A 2VPYA 3MT8A 3Q41A 4I5FA 4KZPA 5A7GA 2Q4RA 5LNK6 2DHQA 1NJ5A 2C2BA 3O83A 4J49A 5IUKC 1GJRA 3E1GA 2AHOA 3PFGA 1VKHA 3ECCA 1NVVR 2IQIA 4F1WA 5BN4A 4JJKA 4R5HA 3LT5A 1PEKE 3IODA 2FVXA 2PUTA 4OUDB 2CNBA 1EK0A 2W8BA 2QTBA 1WKVA 1HZJA 1AQYA 1GADO 1HG1A 3ID6C 2VF2A 3MLBA 3TD6A 4I55F 4BWGA 5EJ9A 2X6KA 3DL4A 1YZYA 5B12A 3VNAA 2ZB4A 3K94A 5LZ4A 1QRRA 5EGSA 3DCNA 1S96A 3TFQA 3VTAA 2DFDA 2J41A 1VPWA 3N0VA 3T3GA 4N9QA 4FKZA 3F9CA 1B7GO 3NPAA 3RSLA 1QGZA 4HPXB 4EFKA 5JSUA 4XYEA 3I34X 4GEKA 3A25A 2BW0A 2Y93A 3V79K 4ZICA 3ASDA 3PJGA 2FAXA 1WSDA 3WLIA 4DWJA 5HGXA 1N54A 5B1EA 1QWOA 4LV6A 2Q4DA 3EVZA 1KI4A 4I17A 2PNJA 1WHSB 2R1TA 3X1WA 4WCVA 3QH4A 4ZI7B 2IUYA 4EHDA 3R3WA 3UT8A 3DFUA 1XNRB 2FG5A 3ORFA 4R8RA 3T7TA 4QG3A 2JLVA 3Q7SA 4L4RA 1Z0UA 4D9GA 1TU3A 2VHTA 3TXAA 3ZWVA 3P27A 4OOEA 4J7CA 2XD4A 4WOBA 3B9PA 5K8TA 3FH7A 4HSEA 1G5QA 5FLEX 5DHUA 1WABA 4EJ6A 3ZG6A 4GMKA 2RFMA 3LT0A 2H4HA 3AVUA 2GWRA 3GZ2A 1XDWA 4NJEB 1JU9A 1QJ4A 1VRCA 3FTPA 1EDUA 3Q0EA 4WK0B 5TX7A 4N12A 3UT0A 5H9WA 3GRYA 4Q1EA 2HM8A 1YE3A 1MIHA 2ZDGA 5ICCA 1FZTA 1Z2PX 2W83A 3DGEC 3JRWA 4Q69A 1GRQA 1BXRA 2BGLA 3NALA 1KVSA 4CIWA 1XYGA 4NTZA 3RFFA 4US0R 2VYND 1MYOA 5G02A 4W1SA 4F3TA 2D7JA 2X8AA 1E2GA 1C0KA 2FY8A 4BBJA 4MDHA 2CLIB 4IW3B 3CJQA 1D0VA 3R75A 4BKPA 3KQUA 4EUHA 1FFYA 3V7NA 5JSKA 1CR0A 1YKGA 3IXQA 5ER9A 4IDPA 1DX6A 3R3SA 4QSMA 1IWOA 2AJAA 5JG7A 3FSGD 1EKXA 3I5YA 4N5NA 4X6YA 2B0JA 4NCHA 2H51A 4AXBA 2RHHA 4YONB 1RZRD 2HGZA 4ZODA 1W35A 3TKLA 5KTYA 3U9LA 1G3UA 2FSUA 3L84A 4NENA 1AGXA 3BD9A 3KU1A 4RPGA 1P73A 3F6CA 5FJYA 3KJQA 3NUZA 3MGBA 4H7IA 4IIUA 4LAFA 3UB3A 6AT1A 1QDEA 2C7BA 4TT3D 5LCWJ 4TXLA 3FUEA 3RKRA 4CEHA 3A9VA 3GEIA 1WDTA 1CRQA 1O77A 5E95A 5B3SE 4P93A 2ZAGA 2O9JA 2UYYA 3C1TA 3I2YX 2IHJA 1WP4A 4CMHA 1L7NA 1LWNA 4UWHA 2OZVA 1JTEA 2Q4TA 1JUDA 1LPMA 3D3WB 3QHAA 4QGGA 3W9FA 4R3UC 5E9QA 3UH1A 3UMFA 3NHFA 4YYEA 1OIVA 3DWEX 4PBRA 1NA5A 1JWBB 3C3WA 4LNUD 2V65A 2D1YA 3BXFA 1E1QA 3TWVA 1AKQA 3PDJA 4HYYA 4E2WA 3RTBA 2V9CA 3K5PA 4NVRA 3WLRA 4Z0TA 3C5VA 4IKEA 3ZS9A 2QUZA 5BN3A 1ORIA 5JPIA 3R7RA 5JYEA 2P9NG 1E79A 1HRKA 2HA0A 4XGRA 3KOUA 6PFKA 2H1HA 5TQ2A 3V5NA 3BRSA 3WKCA 5HDQA 2FN9A 4WLFA 1EESA 5K8IA 5LU8A 3A8TA 1SOVA 2CG2A 2RGNA 2YJTD 4ZOCA 2X5KO 2CXOA 2JG3A 3KJHA 3NBAA 1NDHA 1YUMA 4RJ2A 2CUZA 2ZJ5A 3LP8A 1YA6A 3H9EO 4YT5A 3UM2A 4I55A 3RABA 5AHWA 1IHGA 2WXOA 2DY0A 3LPMA 3WKAA 2IQCA 4FC7A 3ROXA 3DL2A 4H17A 2P3QA 1SFRA 4U0ZA 1SC9A 1USVA 3A9SA 1BD4A 3HCDA 4LK3A 1Q20A 1HO3A 4GMHA 3KR9A 4XQCA 4N3NA 4N0EA 1YCHA 4WFQA 1Q0SA 3VMMA 4DDWA 4ND4A 4XIFA 1DVPA 3MQFA 1JU3A 4DIOA 5HBRA 3QKRB 2OO5A 3I64A 3ZKJA 4YCNA 2JI9A 3RREA 1NBWB 3KYCB 2HA4A 3FCUB 3W5HA 5CBNA 1DDIA 1H2FA 3QU2A 4TS4A 3JXJA 3FNEA 4TKVB 3U44A 4RH3A 4TLEA 4OHWA 1W9MA 3AU9A 1UZAA 4XX0B 4BSZB 3PNQA 2H8GA 1T9BA 1CUVA 1FP1D 1R0XA 3IXMA 4BVKA 4ZA2A 2QE7D 2AMVA 4QDJA 2DT8A 2HHJA 2P2YA 3ROZA 3UCXA 2XGJA 4LNHA 2X40A 4JC8A 2NYUA 2WFZA 1XELA 1JHZA 4LWZA 2HD4A 2JEZA 3NHPA 3PR2B 3IALA 3ZIDA 4NJEA 4UAUA 2A33A 1CJMA 2Q3LA 3F73A 1QU2A 4R9RA 2O8EA 2PH3A 1GP2A 2PRYA 1FCJA 4YLEA 1ZB1A 3I09A 3CRQA 4F9FA 3PRZA 4JV5B 2L82A 1BX0A 1LBEA 1U7TA 3A1VA 4K9PA 4YCBA 3M7IA 3QWPA 4Y9UA 2NZ8A 1B26A 3O8QB 2VKTA 2BR5A 4NZPA 1G2PA 2L2QA 4NBNA 4PYQA 2XRZA 1YAJA 4DZRA 2ZG6A 1E8YA 1FQKA 1J9GA 2IYOA 3BORA 5EZ6B 2BEKA 3TXMA 4KNYA 3ESAA 1MX6A 1OPRA 1RKQA 3Q7PA 4FYPA 3JQFA 5IEBA 5HVNA 3KYBA 2OTCA 1CDEA 1OASA 3KLBA 1HDOA 1KYVA 1MQ9A 2VSNA 1OUMA 3FMPB 2ZTLA 5GOTA 1L5MA 1PD1A 2CHWA 1UBNA 3VTYA 2NSJA 3CX3A 3ZU3A 4PR3A 4D43A 3QX3A 3V2OA 1Q92A 1S64A 3QVMA 5JJBA 2JVJA 4YASA 1XDSA 2YWRA 5EJEA 3KSBC 1TTTA 4FHEA 1PJLA 3GEEA 2DR2A 1JIQA 3IESA 5DULA 5JWOA 2YFQA 2AC4A 2MSNA 3HDJA 3OPMA 4QRHA 1L8QA 2QQEA 3GYGA 3KWFA 4C20A 1BFUA 4F46A 3TEJA 5BRJA 1SUEA 3CMMA 3VNUA 4BFSA 3T38A 4QJIA 3SICE 2YUTA 1MAWA 3FOWA 1VGRA 3D3WA 1YR7A 5BN5A 2PFSA 5B7PA 3IBEA 3BXOA 2RFAA 3EVBA 4TL9A 4ZV9A 1UJBA 3RADC 1PJCA 4XTRA 2DFTA 5TQ0A 2I99A 2PO7A 1OT8A 2IXBA 2RKBA 4XYLA 3PHJA 1SIBE 2Y6UA 1DEKA 3DFKA 2HF9A 3OJEA 4DLWA 4YR9A 5IMSA 3CSDA 3RAJA 2VDOB 1C7FA 4GOLD 2F1KA 4R7ZA 2P35A 5ILGA 1NSTA 4EA7A 3TNYA 5LC1A 1LBSA 1D3AA 2Y9PB 4CCWA 1PFGA 3KKQA 3TFOA 3ABQB 1ACLA 5GPBA 2GN1A 2FO7A 2C4NA 1TX4B 1XUOA 3PXUA 4RKFA 3KB2A 5DBEX 5CT8A 3USCS 4TN1A 2QN8A 2XCRB 2FDCA 4GMXA 1KOGA 2C3PA 5G05C 4FFDA 4QC2A 1I4OA 2PUHA 4R05A 3RS7A 2IOHA 4I55B 3UV6A 5HJEA 4EG0A 5EJIA 2KHZA 3I6IA 4HBZA 2WQ6A 2YINC 2J1LA 2RG8A 2XODA 3TE7A 1H2YA 5LDGA 1T91A 4LC0A 2F1OA 3ZKAA 2ADOA 4FC6A 4D57A 1JLMA 4R98A 5KHLB 5FINA 4X93A 1RHRA 1UKYA 1AUPA 3K6RA 3LKDA 5ADVA 3LHFA 3U4MA 1A5SB 4G5RA 3PVCA 4EPVA 3E34A 4ZWNA 3J5QB 3KCNA 2WF8A 4RE6A 5JCOA 4XX5A 3PNVA 4TKVA 1WAMA 2X7XA 3KLPX 4RG6A 3LZDA 4KQGA 4QAQA 4XX0A 3HY4A 3TK1A 1LTKA 4QJ5A 4B75A 2IOQA 1DGQA 4P3KA 2XZTA 2CCGA 3G0GA 3NLLA 2N0SA 3ZD9A 1NOIA 3AY7A 1G6Q1 2OKCA 3CS3A 2NTJA 4J1SA 4K9OA 5E6RA 3I52A 4D3XA 3F4LA 3TFWA 1OU4A 2R05A 3PHHA 4KVOA 4MUEA 4DA8A 1TAUA 4YRMA 1DC2A 4IRMA 1XCGB 2YVKA 2ID9A 1JHRA 2ZRHA 4PS0A 3FHLA 3L07A 3L9WA 4TWBA 4PSKA 4I8XA 1WRBA 1KI3A 4J2HA 2YWEA 2Q4BA 4J8DA 2Q6IA 1PL7A 1C1DA 4FFWA 1Q2UA 5IVKA 1X9IA 5EIXA 4JC0A 1WUYA 3R40A 1IZYA 4HOSA 3WXBA 5FEUA 5KDDA 2ZWPA 3RSOA 4BNYA 2G63A 1H69A 4MYSA 2O2XA 2QTGA 4RPKA 4EYGA 4B7UA 4NCBA 4EG5A 3C2QA 1N6KA 1ODTC 2K2QB 3BUAA 1OX4A 2P4UA 3O47A 4OFXA 4BO7A 4O8CA 4CM1A 1G5IA 2GHQA 3P9XA 4L15A 1M34E 1PK9A 4D0NA 2AS0A 3CX4A 2B2XA 3F8WA 4G67A 1IC6A 3AUXA 2Q5IA 4B40A 4DREA 2WICA 4DR6B 1DMRA 1QAMA 2V6BA 1FFGA 3OX2A 1H94A 1VBNA 3OCJA 3OX4A 4KFSA 4NK4A 2AFIE 5FI1B 3WC4A 4JI5B 3RSZA 1LU9A 3FF4A 2I2BA 1X13A 1WBBA 4GVLA 4CRWA 3T8MA 4Q7MB 2E5WA 3C6MA 3WR5A 3OQ6A 3ZVNA 2ZQZA 2ZRKA 5LB4A 4K8RB 4DGSA 5FIOA 1SUBA 2GZMA 4D9NA 1X1TA 2G5PA 3DZBA 3BIFA 2X9QA 4NAVA 1X1BA 2HRBA 1KYQA 1N5OX 3FUWA 3BJMA 3F78A 3VYUB 2AOXA 3KQOA 3DWGA 2AVNA 3QA9A 4R3WA 4PS7A 5TQ0B 2H59A 2ZDHA 1ZDMA 4U9IS 5IHXA 2IYVA 4BWRA 1I1HA 5JDCA 4I14A 1UFOA 5DEOA 2FEOA 4JLSA 3NU1A 4CKWB 1QYRA 1F5NA 1MR3F 3G2UA 4ZCPA 3AIOA 3B38A 4WZ6A 4IFBA 3CLUC 2EYQA 3EVNA 1NU8A 1IY0A 2CHGA 3GGJA 5F76A 1W48A 3RKVA 2HCRA 3LA6A 3VPHA 4DJDC 2FPWA 4TMWA 4F3NA 2QS9A 2EG9A 1E1QD 5T41A 1GVNB 2A8YA 4NESA 1OLSA 4DDTA 1BRMA 2V5VA 3G8DA 3R6GA 2GK3A 2I4LA 3DL7A 5E1DA 2BM1A 2Q9AA 2AX3A 5E4YA 4US2R 2XDAA 2DQSA 2VF8A 3WYAA 2X8LA 5TEWA 3R3UA 1FT1A 3U0BA 4C0LA 3IBYA 4HWGA 1PS9A 4DDUA 5HZMA 3K0CC 4ZHQF 1DINA 1OH7A 2R7MA 5KNDH 1D09A 3FWZA 1O2DA 4IKPA 4X7BA 4U0SA 2WD9A 3K70C 4PH4B 4Y6QA 4H9GA 3ZQKA 1QG6A 5K3OA 4JDUA 4UVHA 5EQDA 5TQJA 2WXMA 3SEQA 2IH4A 4LF8B 3CRNA 4HAWA 1JYEA 1NBME 4XCQA 1JJVA 5FR1A 2Z57A 2O8DB 1KVQA 5AKGA 5FBZA 2GILA 2WYIA 4MRSA 3PZ3A 3CHPA 2HUPA 3C6ZA 4GPEA 2EGHA 2CC2A 2JAXA 3PCTA 2UY1B 5DXJA 4ME2A 4MUIA 4FILA 2YS7A 3HDTA 4S1PA 1KJ9A 4CNBA 1K0UA 3HU5A 1SCBA 1QHEA 2AJLI 1LF8A 4U7EB 3FSJX 4KZKA 2WTXA 3PUVA 4OL0A 3RYHA 3JZDA 2YNMC 3G0OA 3R4VA 4HOTA 2EHJA 4H7PA 4N03A 3BXGA 3A4MA 1PJSA 2YXNA 1JLSA 3ZUPA 1P1BA 1SZ9A 3AJIA 1CLEA 1D03A 2D62A 4QRIA 3RKUA 4OK6A 1N2JA 1CUIA 5GMOA 1T35A 1RACA 1KMQA 2ZRJA 3I62A 4WSOA 3VSEA 1EUZA 4LHWA 1NU6A 1T8YA 1GPKA 1W44A 1Z4QA 4BLUA 3ED1A 4V0RA 1UM9B 3PX2A 3TEFA 2EERA 3C6QA 3HEAA 1FNSA 1AA9A 1QHNA 1GGNA 1ZPDA 3GJ8A 2KMLA 2WXJA 2XOKA 3WL4A 2TMYA 5BSUA 1P7ZA 4I43A 3HV2A 3K9CA 3SX0A 1DBWA 2C7GA 2FJUA 3BIWA 3FYTA 5KYKA 1IWPB 2Z4SA 3JZIA 1IBKB 1BI8B 1A4UA 1C7ZA 1ZJ6A 2JARA 3LHDA 1MHTA 1VE6A 3HNOA 3OPNA 4G4SP 3WK8A 4WGFA 1UWKA 5IEJA 2X13A 3TBKA 3HPQA 3TIIA 4JBYA 7ADHA 3KVRA 1EAMA 4CRWB 3QMWA 3KQQA 1UKAA 2OC9A 3S2SA 2ECPA 4EKDA 4K6HA 1T2FA 1PVDA 4I8IA 4GX0A 2JFYA 5GVSA 3H0KA 2XNDA 1R8SA 4XD7A 1N8SA 3CKBA 3IAM6 4BMDA 3UV3A 5IC4A 2FP4B 2GGFA 3IR7A 2O2SA 5CA0F 3L8HA 4QRDA 2BI8A 1VE9A 1T8SA 5DSZA 1NNUA 3ZI7A 3THWA 3T1YB 1WL8A 2WSBA 1UC4B 1G1MA 4TL7A 4GZCA 2GEDA 1HSOA 2YHBA 1IUNA 2KATA 2X19A 2PRIA 2PU7A 1RWKA 4OLFA 4JI1B 3U49A 2PJRA 2ORED 4CKWA 4N18A 4ER0A 3AHCA 3ZTWA 2BISA 4JX9A 1Z0ZA 2O57A 1XQ9A 3TX2A 4W5RA 3HV0A 4UTRA 2BFAA 3HS3A 3VKUA 1OOEA 1JKIA 2GJAA 2OXRA 4QFVA 3MYYA 3WL5A 4CETA 4RE5A 5TMEA 3UK7A 3IPCA 2ZAOA 3M6XA 4B32A 2IUUA 4IJKA 3VR4H 1Y42X 5J2UA 2FSIA 5DMXA 3I45A 4ZANA 4EEXA 5FOXA 5JAIA 3BMOA 2I5PO 5JHGB 2NUPB 1AKTA 3IPAA 2OENG 3DOFA 1JFFA 1F6BA 2LUHA 2I2OA 2PX8A 2AW6A 4NYJQ 1YUBA 4RHEA 2C2LA 1Z5WA 3N7AA 2ZWMA 3NYWA 4FJZA 4KQIA 3VR0A 3ZY5A 4DB2A 3LMKA 2H6GA 4Q3AA 4BGEA 3PGKA 4BPBA 5CM2Z 2IX3A 4OK5A 3GRAA 5IBCA 4IFEA 1QZXA 1XL0A 2E2WA 2X77A 4Q7KA 4B7XA 1LUAA 3QLUA 2R85A 3GMDA 3W7AA 2O8DA 1JVNA 1UOOA 2UXBB 4NF2A 2G83A 4D6YA 4FD3A 2P4HX 4M9UA 5AH0A 4OBXA 4QQIA 3L6BA 5J08A 4LVOA 4CMGA 2P9UG 3L93A 5AOAA 4YV0A 5ALGA 1FXSA 2J32A 2X2EA 3GGDA 3AT1A 3C8UA 4UUBA 2HM7A 1OXUA 2WP8J 3ZC3A 1DC3A 1RYEA 3IQIX 4UVGA 3SP1A 3ZW9A 4Y9DA 3KFVA 3G7NA 3D6TB 4IXMA 2JJQA 4S2UA 3CK7A 1JEAA 4P3NA 4H2DA 5KJEA 3DMHA 3G2PA 4FHKA 3K0EA 1M2EA 5ILQA 1VYUA 1E6CA 4YQEA 5K0ZA 5K8VA 3WIVA 4B6FA 5KYTA 3RFCA 4BAGA 2IU4A 1ZINA 4KXVA 1S6YA 3NTLA 1X0XA 2PS1A 4KC0A 2FMUA 3E2MA 4JELA 4Y2YA 4Y2PA 1JQEA 3L0BA 3RI3A 3T34A 3OH8A 5F9HA 2C0CA 5K0SA 1P33A 4UQYA 1GSAA 1CZKA 5FB3A 2JAHA 3PLAE 4WLUA 2M1ZA 3O4FA 7MDHA 3OF3A 2WSIA 4W7IA 3SNKA 2TS1A 1SWVA 2JH9A 3O0TA 3I72A 1YL5A 5FUMA 1DCQA 4WDRA 3QXHA 1TPZA 4ZVKA 1NJFA 5FP0A 4PZUA 3MCAA 4R1PA 1DG9A 3DXFA 3GJQA 3AS4A 1Z56C 3QPDA 4LOLA 3OQJA 4AK9A 3EJ6A 1EGMB 4YMUA 4RZSA 2J7PD 5EIOA 1VJ5A 4X61A 1RMTA 3VSBA 2EKDA 2EATA 3SLGA 4K3UA 3Q7FA 1DCEA 4G41A 3BJEA 1GNVA 3GLQA 4NI5A 2X4DA 3OAAA 2H6EA 1Q22A 2DVMA 1PSWA 2KBXA 4P54A 1YVDA 3T15A 2DGDA 5CP8A 2VT2A 3THWB 1F14A 3KKZA 4ZYUA 4WWNA 1NUQA 2P8SA 5GGXA 4GYKA 5JHAA 4U3JA 2ZUFA 1K3ZD 4UWKA 1FTYA 5LX8A 4I9UA 5E4FA 2A4ZA 3MJWA 1OLXB 3O90A 1ELOA 1UN9A 2V7EA 2RAUA 3FOAA 2VPTA 1CUWA 3KSDO 3DZDA 3Q9LA 5C31A 2Z9CA 3I76A 4FI3F 4BBZA 1E1DA 2J6BA 3F47A 4XZ3A 5DK4A 4OY3A 1UADA 1A98A 1V9LA 3GHYA 3UMYA 5A3SA 2BUGA 4Q3DA 4N1AA 2IL1A 4DNPA 1PNRA 1CIPA 1RRMA 1JMKC 4N3AA 4ZZ0A 4ZVUA 1MDFA 2G77B 3EIFA 1JFFB 1RAFA 4EKNB 3BQMB 3R5TA 3ZN2A 3EA4A 2W98A 2RIPA 1Z17A 1JFLA 1K7EB 3GVIA 4M6WA 1Z15A 4EVIA 1U3GA 1YVUA 5AW6A 4URKA 2Z8ZA 2ZGDA 3AQIA 4B5KA 3I58A 4WXHA 2ZIAA 1BNCA 5CCMA 1UBKS 1NMYA 3A6KA 3I9KA 3UICA 3EMKA 1MB4A 1Y7TA 5JCPA 4L3VA 4CM6A 5LMNB 2F00A 4KEAA 5IXJA 1WQ3A 2FB9A 1LZLA 3QU9A 4HYTA 5HUHA 4ILEA 1NW5A 4X62B 1DFGA 4O2AB 4GM1A 3EC1A 3OLXA 5FBKA 1DIGA 1PG0A 1ZLXA 1XWFA 2JEYA 3M5PA 4Y2QA 3TVYA 3U3ZA 2PZGA 1JPJA 1UK8A 2FSVA 3O7WA 4XWGA 4ARAA 4ZZ2A 4FU3A 2JHAA 2W90A 4K9RA 5BVHA 1LW6E 5GZ1A 2E5LB 1QZ2A 4G23A 2PZBA 1NG1A 2QZSA 4GA2A 3T6KA 3G2LA 3MB8A 2H29A 3LDGA 2VJKA 4R68A 3SI7A 2YBDA 3AI3A 3BHNA 3GD7A 4JLAA 1O95C 3EHNA 3B5IA 2Y8EA 5E1MA 2I4TA 5E38A 2K87A 3WDKA 4EEZA 1I3MA 1M2JA 3BEDA 1J2JA 2GA9A 2XUHA 1Z08A 4OA5A 2X1VA 1ZGCA 2F1JA 4LVNA 1PNOA 1G21A 4IIDA 3PKIA 1EVKA 5ELLA 3W2GA 5JNRA 4H3SA 4YWJA 5GWXA 4GAEA 2PYIA 2XZTG 3A1NA 4BFXA 2BHSA 3Q3HA 4D9CA 2H85A 2W6MA 3DXKG 1LC3A 3NJRA 2Y99A 1HYHA 2GM5A 2HIAA 5A5VA 3RVDA 2X2FA 1N0RA 5HS4A 4MYCA 1ORHA 4Y6LA 3BWBA 5B1SA 1EQAA 4IDDA 2PT9A 1TO1E 2H1WA 3EY9A 2XE7A 4KQ6A 5F2OA 3RD5A 2IGTA 3WLJA 2J0SA 4GZ3A 1FPMA 5C37A 5IY5E 3IP3A 3Q15C 3RSEG 1OXMA 4WWPA 1Q14A 1Z4IA 2D5AA 2MMGA 4CFSA 4HS4A 1W4RA 2WZCA 4HI0E 2PWAA 4FCVA 3EGIA 3RS0A 4AY2A 2GHIA 1GA1A 2KWIA 3KK0A 3FFXA 3ISVA 1RI2A 2QVCA 3OHPA 1BWRA 1NUAA 3U62A 3RUFA 4KGZA 4L2YA 3QOFA 5HF9A 3ZU5A 1ZJ4A 1KDPA 2JGEA 3HG0D 1QVAA 4RY8A 3KVOA 4DQUA 521PA 2P27A 3JQFC 3QE3A 2NQ2C 2ZFUA 4RMHA 1QMGA 5DYIA 3HVUA 3ZGZA 2GROB 4S2EA 3R7LA 2QY9A 1Q1BA 3EG9B 4B71A 1XRPA 1JG7A 1W4AA 3DOUA 3ADPA 1Z07A 2H11A 1N9GB 1P2TA 2PQNA 1R0RE 1ZMTA 2F1RA 3MT0A 3Q85A 4MITA 1IQPA 2P5TB 3I3NA 2HEIA 3L06A 2B7LA 4UCFA 3TXYA 3N07A 1Z0AA 2C8LA 3OY7A 3RWMB 5JNUA 4QA9A 4ZYXA 4KHZA 3FCXA 1FMLA 4J8EA 2REOA 2AQIA 1CBUA 1Q15A 4A8TA 4GECA 1FNDA 2YZKA 3VAAA 3PRHA 3TLGB 1ZD2P 2Q6OA 1QQ6A 4L0DA 4M6WB 3WP0A 1VCIA 3JALB 3Q5GA 4AKEA 5CVTA 4RKEA 3A1TA 2XMZA 2IZ0A 4BQEA 3EUWA 5E76A 3EDQA 5E8RA 5AI4A 5JARA 1XMJA 4HF7A 3PXCX 1E0JA 4APOA 3HJHA 3T7CA 2IEGA 5DNWA 5IKOA 3DZHA 2BH9A 5LP6C 3NTVA 5C8DA 3BICA 3MCUA 1GUBA 4IJVA 2WOOA 1T0JB 1WMDA 2MJLA 1VFNA 2QC9A 1Q7EA 1KWKA 2AN5A 1R5OA 2JJ1D 3IDZA 4RVFA 4PNHA 4EF6A 5A4MS 4TV3A 3OU7A 4FWIB 4LMPA 3V8VA 3U6BA 2ZYDA 5FZSA 5EP2A 3THRA 2GBLC 2ASEA 4C06A 1TM2A 2HCFA 4KPEC 1I2AA 1ADCA 5DYYA 4NL4H 3W6OA 3GLIB 4YRDA 2FZCA 4MVJF 5GONF 1TN6A 2DKFA 2NSHA 3AR7A 4JVMA 3ORRA 1EX6A 2JH3A 2O1XA 3BULA 3HU1A 3TLZA 2A9QA 4KITB 5MDHA 4G36A 1I7QB 2YMLA 1LSOA 1QZUA 2PMKA 4MTLA 4HDMA 2IWHA 3OP1A 2L19A 4YCSA 1LLQA 3PYXA 5LZ8A 3G2WA 1G21B 1XWWA 3LA8A 3BFKA 3DNFA 1NW4A 2I7TA 4UKDA 1W4LA 5DBHX 4EATA 3TG4A 5ALIA 2DB3A 4TQGA 1XTIA 3I39X 1ZW1A 2FF4A 1YBMA 3ASUA 3L40A 2QM0A 2CVQA 4EGSA 2QRJA 5GZ6A 4H1UA 3PU6A 2EKZA 5LYYA 3JUEA 2P2GA 1IIBA 4LYAA 4IJ5A 5BQPA 3TS1A 4IGAA 3BIXA 4MX8A 3UB2A 4B79A 4HVLA 3RE1A 4LOHA 3PHBE 4GXNA 5J2TF 3TLMA 4DX2A 3SYNA 2H2FA 3W4JA 1OYVA 3WX0A 3RT7A 4AZWA 4BKUA 2CD7A 1Q0RA 3QEJA 4FSXA 4RHFA 3WG9A 2VJOA 5HJ2A 1BMFD 1E60A 1RYBA 3T4PA 4BGUA 4DYVA 1GKYA 2J5RA 3DCYA 4TMVA 2OWEA 4AF8A 1N7IA 1WPQA 2BCGY 2QYHA 1J25A 4C78A 1YC5A 3KQWA 4FSDA 3U7RA 4C0JA 5LQNA 4AKTA 1AB6A 1AUOA 3ICWA 3H19A 4DADA 1GUDA 4AYTA 3ESYA 5CH5A 2X15A 2DFKB 3ZW3A 1WPGA 1ZRNA 2B37A 3G23A 3RCBA 1ORTA 3RNLA 3SM9A 1ZHFA 2Y0PA 4NCJA 5LQKA 2FO1E 3E2IA 1JP7A 3DTVD 1F12A 4BFLA 3I2IA 5ARDA 1HT1E 3LNTA 3TSAA 1RAGA 3VUFA 5AKEA 2FRDC 4CTNA 3Q6NA 3N9IA 4U8GA 5JISA 2DPLA 5IHPA 2IYFA 2GSWA 1L4MA 1AU9A 4KSYA 4P5DA 4ENVA 1L7MA 1O8CA 1SXJB 1J2TA 2A59A 3L7LA 3X1DA 1H65A 4HLUA 1Z62A 5BSHA 4QEKA 2F37A 5T6MA 3IKJA 4ZEMA 3QF4B 4YAGA 1O1YA 3QXGA 4MV1A 4D9MA 3JALA 3PH0C 4KE9A 4XSVA 1KOLA 4H1WA 2BBWA 4P98A 2WXNA 3HL4A 3PP8A 4OFBA 3UHOA 1SVMA 4J1TC 2RKOA 2A0YA 4KODA 2W2TA 4MB6A 2G4LA 1JW9B 1DAKA 4QBTA 2FSPA 4NPAA 3BE8A 2QRHA 1R0ZA 3K0SA 4Y1RB 5K03A 2G09A 2WV9A 2F62A 3MTEA 4S12A 3UT4A 5K0TA 3IHLA 1E5LA 2BHTA 4XR4A 5CURA 4Z4CA 5I5EA 1UBRS 4DILA 1BVHA 1G63A 5CERB 3L4BC 3HO8A 4UU7A 5EJGA 5LOVB 1EVYA 2XB4A 1NVEA 1WCWA 4IIVA 2C5LA 1EFTA 3SDBA 5LOVF 1E92A 2TMDA 4RQAA 4OQ4A 4ZO6A 3PKJA 1F38A 1P9OA 4X8MA 2BTEA 1U5CA 1FVHA 3H5WA 4HVBA 1TYEB 2GLTA 2MDTA 2FX3A 2NXWA 3BRQA 3EA5A 1XPJA 1HOTA 3FUVA 3RYTC 3GJZA 5A5DA 4GE0A 1N3IA 4ZPJA 1Q6YA 1XRMA 2P2SA 4Q3OA 1QK3A 3IP9A 4WT7A 3VC7A 5I8PA 5LP6F 2EKLA 9LDTA 1COZA 1J70A 4GUDA 4YRIA 4KE6A 1J0XO 4ZEVA 4TSRA 2J4BA 2VF4X 1XZMA 4QAJA 3EPJA 1RE1A 4FOOA 5EZ5A 3SOZA 4JITA 4BERA 1O1RA 1EX7A 2JLZA 4MIEA 1D8AA 3H9CA 4B44A 1L7BA 4RKYA 1MFZA 2JGDA 2X4LA 3EEBA 5IVPA 4YMWA 4WK2B 3TSYA 3VTZA 1F8YA 1QV7A 2XOXA 3EIEA 1R6TA 4G8BA 1SBHA 4HSGA 4MZXA 3VBCA 1NRIA 3KU4A 1U3FA 2AK3A 4QX6A 5FPTA 3AXSA 2DUNA 4FC8A 3NEPX 4RMGA 4HUQB 1YB5A 4INPA 1YS9A 1ZM3A 4XWAA 4A7PA 4V0OA 1MB3A 3D3KA 3DEIA 2QP4A 5CDHA 4NXMB 4ZOAA 1DXHA 3AG5A 1V47A 2I54A 4O2BB 3UAZA 3NOXA 3BKWA 3DTYA 2CXNA 1DO0A 2GTHA 1I0ZA 3PPYA 3PNYA 4YPFA 5LBUA 2GHTA 3MV2B 3F7NA 3MCVA 2ATXA 4FGLA 4P9NA 4BO4A 4FKBA 1QF9A 4M3OA 1GZ5A 5I3ZA 4LRUA 1T4DA 3SYRA 4FGUA 4LF5B 2AG5A 2ZIEA 1IK4A 2XRMA 2DAPA 3FYSA 2G3YA 1GNPA 1W5TA 3EDCA 3OCCA 4EGAA 2AJBA 5FUQA 4B34A 4LY3A 3UBMA 2GCPA 4HCJA 3V1LA 2QUBA 5LIPA 1W7AA 4Y2JA 2YRWA 4YRGA 1RAAA 3M0EA 2OK7A 1ND6A 3OWOA 3DMRA 2HW8A 3LU1A 1KJQA 2V6FA 2F3RA 3IB6A 4WFKA 2QN2A 4JB8A 4KREA 1DIAA 1AZLA 4EG8A 1K63A 1ZNXA 3N2GB 5M72A 1GPUA 1X1AA 5H68A 1HA3A 2ZUVA 1YRLA 1CIVA 2C04A 2IEIA 3DXZA 3GQBB 1J8MF 4RIHA 3LJKA 4XJXA 4LYYA 4F2PA 2XUGA 1JMYA 3FU3A 5KTNA 1PJBA 4E32A 4QEZA 2EKPA 3EGXA 4G5QA 4OAUC 1V8FA 2PBRA 5ENPD 3IGFA 2G06A 1ZK2A 2AMLA 2XT0A 3EZ7A 4R2IA 5FI0B 2GKSA 5L40A 1AX9A 3CNHA 5GINE 4Z4GA 2YHSA 3PC7A 4PYKA 1WKCA 2MINA 2WWFA 1U0SY 2GN2A 3SD7A 3AJ9A 3QXJA 1QQAA 3UA4A 2WTEA 5L4NA 1G4AE 1L5KA 3NTOA 4BVLA 1CB7A 3M70A 2O59A 2Q9BA 4EB6B 1G0NA 4QGHA 2QROA 4WI1A 1CEYA 5MF6A 2HJGA 4HFJA 4M1KA 5LOVA 4JC4A 1OH6A 1M10A 3KUUA 3F6SA 2BEJA 5H3LA 5D84A 3DEFA 2R6AA 3QU4A 4BFRA 3SCZA 1LJUA 3X2QE 4RG9A 4UOQA 4EL5A 3L7BA 1ZI6A 4IG4A 4UU0A 4J0DA 1RZVA 2BCEA 4MKTA 5WRFA 1T8WA 1MMFB 4RD2A 1FS4A 3OEWA 4U02A 5FQOA 4DRXE 3RTEA 4JP1A 3NV9A 4B48A 2PZKA 4RELA 2RHOA 4BB0A 5JXIA 4DQKA 2WJ3A 1CNEA 2Z9BA 3AYXB 1RJGA 2RK3A 1Z8FA 3UWKA 1LW7A 3QWBA 3S1AA 5A5EA 4MO2A 3UX4A 1JAHA 1XEXA 4FBMA 3OI7A 3GHHA 4UWLA 5I9LA 4N9WA 1NBEA 2Q3DA 4DC9A 2P6OA 3KETA 4PAGA 2J6CA 3AEUB 1GOTA 1IONA 1TDJA 2NV6A 2ODWA 3I9LA 4HHEA 4HUQA 3P2OA 4U1RA 5AKYA 5JSHA 5EZYA 5IMBA 4BBAA 4GDFA 4JYAB 3QMPA 2C3OA 3HADA 3VR5D 3QWFA 2G5CA 1GT91 4O2BA 4FHZA 3PR1A 1A7AA 1KO1A 3JWJA 1FEZA 3FR8A 1I3CA 2ZU6A 3IUJA 3TCKA 1K3FA 3QBDA 3DBHB 4IQ8A 1MZCA 3IIMA 2IYTA 3D3QA 3GWZA 3ROKA 2EZTA 3GFTA 3T3NA 1SW6A 1NJ6A 2C2GA 4U2DA 3DBLA 4NBVA 3MWKA 2OD9A 5K3FA 3ZV4A 4EKIA 5MFZA 1G4UR 4OU4A 2F2TA 2Y1EA 4V2IA 4C30A 3JAKA 1OCRE 3T41A 2V4LA 4U2KA 3WZ2A 3L04A 4RJLA 2OE2A 2IO3C 1DHRA 2JZOA 3V00A 1ZMBA 3SEFA 2IWRA 1NMXA 1A69A 2OPBA 3HUEA 2EARA 5A3JA 3Q7TA 3T7AA 4MI6A 2ZI5A 3NMUF 1S4MA 1S2NA 2QTCA 3N0WA 3PCRB 3A70A 2DE0X 2YV3A 4YJ2B 3OC0A 4CMJA 3HN7A 3I9V6 5EJ4A 1EWTA 2QVYX 3CVXA 1YDGA 4UHJA 1D8EA 4URYR 3K70B 1N6PA 2VQ3A 5KAPA 2ZPTX 4BUZA 5EHXA 2PA0A 4AUEA 4CUJA 3LKBA 4QQNA 1SVUA 3VR5H 2B3DA 3GQBA 5LR6A 3HYNA 5LFAA 4LISA 1KMHB 1XMQB 1USWA 3NBFA 2OXIA 3TNDA 4Z99A 4CWAA 4V1CA 9LDBA 4G89A 5FFNA 5BYKA 1KJZA 3ETGA 4KQFA 4ETNA 3C1OA 3HZHA 3STTA 2ZAYA 4BX3A 1ID1A 1I33A 1U3VA 3X1XA 4DLOA 2XV1A 2MINB 2HJVA 4Y1EA 4EM6A 3QTLA 1PR9A 4CTKA 1P18A 1NVMB 4Z7OB 5H5JA 1R37A 4QUKA 5EHZA 4Z3DA 3UT6A 1IG0A 1RYMA 4NBSA 4MZDA 3P1UA 1RWXA 3CRW1 2QG6A 3WNVA 4GSKA 2R96A 4R2WA 4GKKB 3KEZA 3DUWA 1EP3B 4D25A 5CXXA 1K3UB 2H4XA 1KNQA 1STOA 1HYBA 1XVAA 2JAQA 3CEPB 2GEJA 3CE9A 3FPKA 4G07A 1ES9A 2NVBA 2FQYA 4F5YA 3KLOA 4RF4A 2NO6A 2VIIA 3IULA 2KS6A 5EE3A 5FO0A 4HDRB 2IZ1A 3NBNB 4B3BA 1UXIA 3WSWA 1MAVA 1SXPA 2R8YA 4QYWA 3EIXA 1AURA 1HTBA 1X1QA 1ZN7A 1X5BA 2P2ZA 3LIPA 1JB1A 1FL9A 1Y1PA 2HSGA 2MSLA 3ZRHA 4M46A 5HMLA 4IH9A 2I8AA 1BAPA 3M4YA 4R41A 3TGWA 1FFCA 1U2DC 1QF7A 1PT9A 5KO2A 2YIMA 1MNAA 2XH8A 2D2FA 3FCCA 4EVQA 4B3RB 5D8DA 2VTBB 4XPZA 3K9FC 1K7SN 1IZZA 4MRAA 4J29A 3NT2A 1UT8A 4LJ9A 3E18A 3HIZA 1SURA 2XS8A 2YQ8A 3R0QA 3S1AB 1IVNA 4EMBA 3WISA 3HG7A 4DV4B 4AZTA