2VSYA

Xanthomonas campestris putative ogt (xcc0866), apostructure
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
547
structure length
547
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords XCC0866
publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 208
structure length 547
sequence length 547
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsyA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsyA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsyA02
3ASGA 2IYAA 5ARFA 1GPAA 4KQMA 2HYZA 4EQFA 1P2GA 3NP7A 2Y4TA 4F3VA 3FFLA 3QOUA 3MV3B 4N5CA 3QWWA 2JJMA 3E3OA 4F9FA 4JL0A 3OTIA 1C50A 1Z62A 3O48A 3ZHEA 2IV7A 3MA5A 3DD1A 4LEIA 3CEJA 4J8DA 4RG6A 1A17A 1Z6QA 2FETA 4F97A 4U04A 3HBNA 4GZ3A 4HWGA 3MRTA 3S27A 2IV3A 2Q7FA 4G1TA 4W9RA 4G23A 3CVNA 3LY9A 5JJ7A 4N2SA 2IEIA 3C48A 3VDNB 1TJCA 2C9ZA 5IKOA 4KBQA 2GM9A 2X6QA 3K9IA 3LY7A 2C1ZA 2QN1A 3QHPA 3UPVA 3OTGA 2IUYA 1OUVA 5KJMA 2ATIA 2Q6VA 1SXQA 1L5SA 3ZCUA 1NA0A 4G26A 2AZDA 2IFUA 3BD7A 2PRIA 1NZDA 1PYGA 4X7RA 1GG8A 4AM9A 5LQDA 3RHZA 1RZVA 4GA0A 1C3JA 4EKEA 2LSUA 4WNGA 1BX3A 1F6DA 1AXRA 3L7CA 2FF4A 1NOKA 3L01A 5M72A 2ASVA 2GT1A 3S28A 2PRJA 3CEHA 4AIFA 2QN3A 1ZU2A 4BTBA 1XL0A 3TGOA 3TAXA 1E4OA 3MRXA 2UY1B 2ACVA 4N39A 2QRPA 4I9EA 2KATA 5BW8C 3DDWA 4UQZA 5ARGA 5I45A 2XA1A 4MICA 3Q15A 2XCIA 2G9QA 3ASDA 2ACWA 1PNVA 2XMPA 5BNWA 5D0QD 2FF5A 2R4TA 4RIEA 4A1SA 2ECPA 3T3IA 4H7YA 4WADA 3UUXA 4BTAA 3RJVA 3BEEA 1FU4A 2KS6A 5LCWJ 3KAEA 4W6QA 4CTMA 1Y8MA 5DXFA 1FS4A 4X7MA 2WPVA 4NC9A 3NCHA 3UYLA 1SXPA 5TMBA 3BD6A 3VTYA 2HY7A 3OTHA 3OXGA 4B94A 3NC4A 3S2UA 1QKJA 3BEOA 1V4VA 2P6PA 2PZIA 3QWVA 5ENZA 3PDNA 3UYKA 3GW4A 4HOUA 2WQHA 1FU8A 4FKZA 3RKVA 5TMDA 5CCLA 3BCRA 1QZ2A 3ZN3A 4X7PA 2H1FA 4UI9J 1P4HA 2NC9A 5DIZA 3NF1A 3OKPA 4RIIA 2BGTA 2VGYA 1JG7A 1XOIA 2XGMA 3RO2A 2JZCA 3EBPA 4BQFA 3VDMA 1P2BA 5G05C 1P4GA 3CKBA 1IIRA 2MHKA 4JHRA 5A7DB 4M7PA 3OXLA 3PE4A 1RZUA 3ZHEB 2SKCA 3CKCA 3T7DA 2VGXA 3WXXA 3NP9A 4GA1A 1FCHA 4H7XA 1A8IA 3CUWA 2BUGA 1GPBA 4G2TA 4G24A 4U0ZA 4Y6WA 4HOQA 1FA9A 4KQ1A 1UQUA 1FTWA 3S29A 1NVKA 4WACA 3EDTB 3AS5A 1GZ5A 4GPKA 2J9QA 1NOJA 4I1AA 2VCEA 4GCNA 3E4BA 2OOEA 2GPNA 3GUHA 4UQYA 1NZNA 2PQ6A 3L7BA 2IF4A 3LPZA 1WM5A 3T3GA 3CVLA 2GPBA 4Y6CA 4WHMA 4EKYA 1WUYA 1P29A 3U4TA 4PQGA 3LKUA 2KCLA 4Z5XA 5GPBA 3S7FA 2PYIA 4WNEA 5FZQA 2YHCA 3QKYA 1NLMA 2KCVA 4N9WA 1L7XA 3Q3EA 4WUYA 4CDRA 1WW3A 2BISA 2XGOA 3G2NA 4F96A 1P5QA 2QRHA 1Y6GA 2GEJA 3QDNA 4EL0A 1JEJA 1EXVA 2C0MA 3T3EA 4APOA 4O6FA 2C4MA 2XPIA 1YGPA 3VUFA 5D00A 3TG4A 5DBKA 1F0KA 3CEMA 1Z8DA 4RIFA 4XIFA 4HORA 1Y6FA 1LWOA 1IYGA 3MTBA 6GPBA 2O6LA 4NESA 3NB0A 4X6LA 4BT9A 4HOTA 3G2KA 3Q4AB 3RO3A 2Y4UA 3BD8A 3COPA 4WNDA 3MV2B 1Z6PA 3Q5MA 2VSYA 1XKXA 2F3QA 4AMBA 3NPAA 1L5WA 3MTAA 4AY5A 3IAAA 4N3CA 2IW1A 3MS2A 3ULQA 2E2EA 4EL5A 3IA7A 4BT8A 1JIVA 1RRVA 2QRGA 3EBOA 3WADA 1UZUA 4RIGA 5CHEE 3IEGA 4IN3B 3SYRA 4YI5A 3MS4A 3GYZA 1GFZA 5FJYA 3BCUA 5G04C 3DZCA 2F3PA 2GW1A 1KLXA 2XA9A 4M60A 3GZ2A 3RU0A 2H1HA 2AMVA 1IHGA 3G2JA 2C0LA 2GEKA 3CVPA 2LNIA 3G2LA 4CGVA 3ASFA 3SZ7A 3Q3HA 4BFCA 1Y8ZA 5EKQD 2VYIA 4N2QA 1J39A 4XI0A 4BWRA 2HO1A 3UQ3A 3VTXA 3OXFA 4U0SA 3ZCPA 2I6HA 2DBAA 2QN8A 3ESKA 4YNDA 4J8FA 4N3AA 4G25A 2X0FA 2G9UA 4KQ2A 1JIXA 1GGNA 5CCMA 5JTTA 3L7AA 1ZBPA 3OY7A 3BCSA 1EM6A 3QWPA 2QFCA 1PN3A 2PL2A 2F3SA 5D0OD 1FC0A 2VCHA 3CV3A 3KD7A 1L5QA 2YJNA 4AN4A 4GZ6A 2ONDA 2UY1A 1O6CA 2X6RA 2VQ2A 3FROA 3T3HA 1NA3A 2YQ8A 1QQEA 2IEGA 3L79A 3MSCA 1WUTA 3CUUA 3NAZA 2R68A 5EX0A 2G9VA 4I17A 3MQFA 2FEZA 3QKWA 3AMVA 2XCBA 3OKCA 2F3UA 3T3DA 1NZFA 5BT1A 3E3LA 4RENA 2SKEA 2QN7A 5TVGA 5FZRA 3HBJA 3ASHA 3ZPJA 4L22A 3D0QA 4MI6A 3CK8A 3L7DA 2FO7A 3HBMA 1NOIA 3G2IA 3S7BA 3LYAA 3MTDA 1LWNA 3OKAA 3O3CA 1B4DA 1WAO1 3CV0A 5LCWC 2GJ4A 5JTUA 3Q47B 2PQNA 4ABNA 3MT7A 5DLDA 1XL1A 2FI7A 3AS8A 3CX4A 5A6CA 4GYWA 2UWJG 4EJ2A 2BGUA 3GPBA 4GA2A 4YUAA 2V5FA 1ELRA 3ZCRA 1K06A 4U0UA 2KCKA 2QNBA 3WC4A 4YVQC 1IXYA 5HXAA 1HZ4A 7GPBA 1YA0A 2G9RA 4N3BA 3TG5A 5JJTA 2AW3A 3LY8A 4NEQA 2L6JA 1H5UA 3MEKA 3S7DA 4I2WA 2R5SA 1C8LA 2OFFA 4WNFA 4UI9C 2QLMA 3HBFA 3CK7A 3OY2A 4ME2A 4MHSA 4CTOA 2QRQA 4KYOB 3Q49B 5D01A 4GYOA 3ZGQA 3U3WA 1L6IA 3URZA 4AY6A 2QLLA 3MS7A 3ZFWA 5KJNA 3T5TA 1GPYA 3RIBA 4NQ0A 2FFRA 1XNFA 2R60A 3D0RA 1AHPA 3CVQA 4GCOA 2HR2A 3E3NA 5G05J 5TMEA 4I2ZA 3ZCSA 3C4QA 4J8EA 4HLNA 3SF4A 3ZCQA 3CK9A 1JIUA 3D1JA 4QLBA 2XEVA 3HYMB 2VSNA 3CUVA 4MRAA 2R66A 2LSVA 4JA7A 1HLFA 1B89A 1XV5A 4LEUA 2XCUA 8GPBA 3Q3IA 2QN9A 4YVOA 1KT0A 3WAGA 5HQ8A 3ZCVA 4U07A 3S0JA 3MKRA 4RIHA 9GPBA 3MT8A 3OT5A 1WV1A 1W3BA 4UQXA 3TSAA 3H4IA 1VGVA 4KXKB 5KJKA 2X0DA 1HH8A 1WW2A 2ZB2A 1M5RA 1FTQA 2C1XA 2PYDA 2XA2A 2QRMA 4REMA 2VGXB 3FP3A 4I9CA 2BFWA 3RSZA 1ELWA 2FBNA 1QM5A 3RT1A 2JLBA 1KT1A 3KS2A 4RBNA 1E96B 3GZ1A 4HOSA 4BQIA 4MI3A 5HI7A 1L5VA 3LCAA 4MHOA 2P58C 2AVPA 2XCCA 1L5RA 2KC7A 1YA6A 3FWVA 3G2HA 1P2DA 3CUYA 4J0UA 3BDAA 2QN2A 4M83A 2GPAA 1KTIA 4NRHB 2X0EA 4GZ5A 3N71A 1FTYA 2C2LA 1WV0A 1E1YA 3MRVA 1PC2A 3R9AB 2VG8A 1JG6A 1XC7A 5FZSA 2SKDA 1PSWA 3CUTA 2PQRA 5KJLA 4BQEA 3AS4A 3H4TA 5DU2A 4AMGA 4GPBA 5C1DA 3RSCA 3S7JA 1K08A 5EX3A 2AV6A 2WTXA 1C8KA 3C4VA 3TOVA 4LDPA 1ABBA 5IKPA 4XI9A 4YI3A 4CGWA 3MT9A 4MI9A 3JYSA 4GYYA 5JJ6A 2QZSA 2R4UA 4RELA 1P4JA 3CEQA 3MBOA 1HXIA 5FT9A 4FZRA 3ZCTA 3SYMA 2IYFA 3DDSA 2QLNA 4UI9K 5AYWD 1UQTA 1FU7A 4G2VA 4JA9A 2XGSA 3VUEA 3PE3A 2F9FA 5FTPA 5G04J 4CTNA 4RG9A
chains in the Genus database with same CATH superfamily
5CDHA 3RVQA 4IVRA 4YGXB 1ZVKA 1H94A 4V3CA 3BB1A 5MN5A 4RG6A 3PICA 2Q3MA 1DCTA 5ITWA 3AZOA 4Q9DA 5L3VA 3GRUA 5ALHA 1RZRD 1KJIA 4B89A 2LGJA 4KTTE 1G8KA 1WDKA 5KNDA 2L6BA 1OFUX 5DHAA 4OUDB 4WBNA 5LQDA 1QOQB 4EATA 4GOJA 4LERA 4JSYA 3FGZA 3G68A 4ZOLB 3TBFA 5F3DA 1NQXA 2CUTA 1FFWA 3HR4A 5C18A 4UE6A 4MW1A 2GVNA 1ZJWA 2EKZA 2J8ZA 4B6JA 3RS2A 2XMPA 3R6DA 2JNWA 3VZQA 2GBIA 1ISHA 4AL4A 3A7DA 3M3PA 3PWTA 2X3FA 3WAJA 3SBDA 3VAYA 3U6KA 1WVMA 3LM8A 1OYOA 1NI1A 5CLLA 1QHGA 3RYIB 4U96D 1DG3A 3RT7A 3ADBA 2B8EA 3BFPA 5TF4A 3T7KA 1O03A 5JMND 4WPGA 2XE7A 1JFRA 4R9NA 4D41A 3KD3A 1HYHA 1VBFA 3W6UA 1Z0FA 3GAFA 3E7PA 2W6NA 4DV4B 5CLJA 4XPIA 2GPTA 3EE6A 5KTKA 3WWDA 4J75A 2VJQA 1JJ7A 1CS0A 5IW8A 4G8JA 3IIJA 1KMHB 4KVAA 3MJWA 4JJAA 5DLPA 4EPTA 5B53A 3OCZA 4M38A 2I4NA 3CNQS 3WLTA 2QTRA 4YS6A 2P0AA 2DR3A 3I28A 1UWCA 3K5WA 1EWVA 2CNOA 4H1WA 1IZ7A 2XCLA 5BNIA 4BNYA 2I34A 1OJ7A 2YUTA 4YIHA 3EUFA 3W0LB 3T1YB 5JY1A 4RLFA 5JSKA 4QTTB 1ZONA 4JYCA 1NC1A 4FW8A 4LNBA 4W5QA 4O0MA 3E81A 1Y9JA 2C83A 1GSAA 3ZJTA 5IJ0B 4DMUB 3GRVA 2O3QA 3G9XA 1RQRA 1YZGA 3UN1A 4TMKA 4INJA 3T41A 3U3RA 2ZIFA 4QSHA 3ZY4A 3OCXA 3PQCA 1VE6A 1SXJA 2VNIA 5L6MB 1ZK2A 3QOXA 4G25A 1L4KA 3GB9A 3RUDA 4BVKA 1E6UA 4XCQA 2B7LA 4L5CA 3E7FA 4LDJA 4F0JA 3DV0A 4G5YA 1ZG3A 4AQYB 3TMAA 3ZOKA 1QQEA 2XGGA 2R68A 4JYBA 3AMVA 1S4QA 1VLQA 1E1NA 4QGHA 3WLPA 2WMNB 4D45A 4BHTA 1SZJG 4N7JA 2YJGA 3G89A 3D4NA 2B35A 4MMZB 4UBNA 3QYJA 2RHGB 1PR0A 2CD7A 3MT7A 4M46A 3UWSA 4F3KA 3NTQA 4GX0A 5F9HA 5ENDA 4QICA 1H5UA 3T9DA 3VLFA 1KI7A 3C3WA 4N8EA 4KPYA 1RYFA 4M8SA 3UMCA 2FOXA 4YJGB 4U7WA 1A97A 4OXIA 1RWOA 1F9EA 4QLBA 3FM9A 3UXMA 5CM2Z 1G41A 1ZN8A 5JC1A 4RKYA 4B71A 2AQHA 4ID3A 6NULA 3A1EA 3E5HA 2CVOA 2V3CC 1IOWA 2HJVA 3OZFA 4UBJA 621PA 1I2AA 1XQ9A 3DSXA 1UBCA 4HDRA 3QF7A 1HORA 1GZ7A 4LZZA 1P9WA 3IBTA 4DEYA 2M6RA 3FF4A 3N07A 4WINA 4L50A 3OBIA 4FXPA 1TUEA 3ST7A 2NO9A 2DJIA 5D66A 2FYTA 5EE9A 5AW8A 2BM9A 4FWTA 3JVVA 2JFQA 5HE9A 4TZTA 2WY2D 3JZDA 4QRDA 3FFLA 5KNCA 3GJRA 5CX1A 2H1RA 5FL7D 5I7FA 2VHYA 1N2SA 1LNSA 2Q28A 4MYUA 1VE1A 4YMIA 3FH8A 3HVKA 2P2ZA 1KAOA 1TADA 1QNLA 2O8CA 4RK5A 5HE8A 1D1QA 3WKEA 5K51A 1JLSA 5EIAA 2E9SA 2BPOA 3RRUA 5E0OA 3HJBA 1MX5A 2XLBA 4NEHB 2ZKLA 1N3YA 5HF9A 1NVFA 2B0OE 3FUJA 2ISCA 3RVMA 3T0GA 4D4KA 3SIXA 1JXQA 5HKPA 1WCXA 5EVJA 2XMCA 3AY0A 4HLUC 2O0HA 3DPDA 2PJDA 3SXUA 1N75A 4BUCA 1CRLA 3H2JA 2QL9A 2ZAGA 1CUHA 5KSWB 4FKZA 3FPAA 4PVDA 4ERNA 1CJBA 1R6UA 3KKQA 4ZEMA 1UFQA 2AOTB 2R6JA 3GZTB 1JUDA 4UNRA 3M6FA 3SQWA 3TLXA 1UOEA 1W73A 3FPLA 1NJ1A 1ESCA 3PFGA 1RLIA 2P1RA 4G2TA 4HGZA 2JEKA 2WFZA 4GL4A 4I1AA 3H83A 4CMEC 1IMJA 5AHOA 4BUJA 2JKYA 2FUKA 3A1WA 1H3EA 4HDNB 1V54E 4TZKA 2RB5A 4WUTA 4R0MA 5TRTA 1CZLA 3DTYA 1LS1A 1MW8X 2OCBA 2G06A 3FOWA 3FPHA 2BH2A 1R0ZA 3STXA 4Y0AA 3G1WA 4GNRA 1CZHA 4JYPA 4BT9A 4F45A 3UIOC 3G5MA 3KE8A 1WKVA 1CW2B 2G1KA 1MJGA 5FDFA 3ULQA 4EG5A 4Y2GA 2HEIA 3HEBA 2FDRA 1B6SA 2UVDA 1JSLA 1F20A 4BVLA 4O33A 5K8LA 2GMWA 3UBTA 4ARVA 5BN4B 1XSEA 2EFCB 1E6KA 1OCOE 2D2IA 4WY8A 3SC6A 1NUUA 1FUKA 3A25A 2WKRA 3IPCA 4J8FA 3F47A 4AO8A 4F5ZA 1T0PA 1YKGA 3TBKA 1ZBPA 1KZHA 3TXYA 2JHGA 4KFSA 4B3RB 3TRFA 1PT8A 1SEVA 3JAMA 3JALB 3Q9NA 1T35A 3CJTA 1E1DA 2GPWA 3D9HA 3KL4A 5EI5A 5A4IS 3MWDB 4HHEA 3ZWWA 3D0OA 3HFGA 2ZRFA 3R0JA 1PQWA 4LSZA 1NFIE 1GTVA 3P26A 4L8LA 1VYUA 1N2JA 1A50B 5AI0A 4BGEA 1YQXA 2IOFA 2FI7A 2ZS9A 4H6PA 2UWJG 1VZ3A 2BGUA 2O7VA 2JIZA 2WVGA 1ZMRA 4RQBA 5KYVA 3UV6A 1FP1D 2PGJA 5CJPA 1UC8A 3V32A 2X4GA 1O96A 3P9KA 1E2HA 1XCLA 5ECDA 5JZBA 2I3GA 3RAUA 4MQUA 2ZOSA 1VIDA 4GI2A 4DR2B 3EIQA 3IS3A 3I1IA 5TQVA 2D7CA 4BCCA 3K31A 3W77A 2VSNA 2R6ZA 4TGLA 2Y05A 4EYEA 1XV5A 1X9GA 3UH0A 2XMDA 4DV6B 3NEPX 3DS8A 2IQ5A 1WV1A 2WWFA 5TARA 5DK6A 4LG6A 2WHPA 3HKBA 3N86A 3BTSA 2Q21A 1M1UA 3TZLA 1QM5A 1E3SA 5JT1A 4P93A 1TJNA 1YK1A 4BO3A 3TRJA 5JOQA 1E9VA 3IOEA 4C4TA 3DSTA 3TKYA 3PEUB 1XZ8A 3OX2A 1EBBA 4BLQA 1K5GA 2GJKA 5AD1A 4X8MA 1G8JA 3H5IA 3ITKA 3CH6A 4O6VA 3VPSA 1QH9A 4IDGA 5SYNA 4ETWA 4OL9A 4P1ZA 4AROA 1D2CA 3QPVA 1H8HA 3W6NA 1HYGA 3TWOA 2J3IA 2V9PA 3OJCA 2DQYA 2EBUA 4PYOA 3IE2A 1LRKA 4UFNA 2CV1A 2O8BB 4E33A 1RRPA 2AX3A 1FSGA 3W3AD 1J5XA 8LDHA 3IBEA 1NDHA 1H85A 2EZTA 4RTLA 4F2DA 3EUVA 5BPPA 4B4DA 2J7KA 2O0KA 5BSUA 1MO2A 1OWLA 5KMGB 3ROGA 4YDYA 1M34A 3Q6MA 4YT8A 2F8TA 3HDTA 3N58A 3LMKA 2ZJFA 2RARA 4RNDB 1PCXA 2Q2WA 4OJNA 4Y2VA 4HAIA 1FDSA 4F8JA 3RVLA 3WL5A 2YXEA 2FF4A 5COQA 4YJDA 1DKUA 3DR5A 2DWOA 2QMZA 1TC2A 3EEIA 4FSXA 3VYSB 4KW7A 1XTIA 4QDZA 3FVQA 4QODA 1SELA 4PHCA 3B1ZA 1WG0A 1FS4A 4F4HA 2GGFA 5EIDA 1L0BA 4A8HA 4EHHA 3W2IA 5JYBA 5DXJA 1JWFA 1SIWA 4RIIA 4R5MA 1SH7A 4PZZA 3OO0A 3HJCA 4BVFA 3ZE8A 1EWYA 3ACBA 4M7PA 4BCDA 5H3HA 1ZN2A 3KZOA 5KYGA 3UV7A 3NP9A 4KV7A 3H75A 2PZBA 4FN5A 3EJNA 3UT5B 4EQ6A 2AMLA 5CRIA 1QQTA 1RM4A 3Q3JB 2BR3A 1ETHA 4B7CA 2MYNA 1RJEA 3L7BA 2B8JA 4S1VA 4G9GA 1S8AA 2PXXA 4DYVA 3L9TA 4AN0A 2OCLA 5I51A 3BE6A 5AVRA 2RHTA 3JQ7A 3WL7A 5I9MA 2AN5A 5B2FA 2I8AA 2VRCD 3SBXA 4QYIA 2A78A 1U2SA 3IPLA 3OKFA 1MQ9A 1XX6A 1MOZA 1FYVA 2CVZA 3L0YA 4HQNA 1L5WA 1YVUA 5SICE 4UM9D 4AUKA 4C06A 4MPPA 4BN5A 4F3NA 1DAKA 1DLIA 3THOA 3MS4A 2H0AA 2PUCA 5K8CA 5DMXA 4YRNA 2I03A 2LNIA 4MLZA 3RS9A 3FH0A 4IW3B 4KJXA 4IOMA 1ULZA 2Q2VA 3DFIA 1OY1A 3HV0A 4LHWA 4X20B 1ODSA 4FINA 1T5OA 5FBKA 1JIXA 5IWCA 3ACDA 2DY0A 3DBLA 3PGVA 3PJGA 3OPMA 2C3YA 4DADA 3BUAA 4MRVA 2JAPA 4CL3A 4K6HA 3D1VA 3MJRA 2RHJA 3NAZA 3ZV7A 4LOLA 3PEFA 2VI5A 1XCGB 2XMZA 4HRAA 2YZMA 2MMCA 3HBJA 3RJ9A 3GGOA 3WL6A 4K0RA 1MABA 3KQMA 4XGQA 3UATA 1WCIA 2CZCA 2BF0X 4XEIG 2J87A 2HMUA 2QPLA 1YA0A 1TQDA 3MEKA 4DGQA 4W82A 4X62B 2H5IA 4LK2A 4BU1A 4GBGA 4JEMA 4EITA 3AJ8A 2DG2A 5E9WA 4XWAA 1JEOA 3BL6A 3A37A 1P1BA 2IFTA 2C2XA 3D1JA 5JVDA 4EM6A 4LZAA 1UN8A 1VYTA 3VC7A 1WWKA 5E75A 5JDCC 5CEFA 4O2BF 4BL5A 5GY7A 1UOOA 3OFJA 1EGMB 4CKEA 2WFLA 4AMZA 1KDVA 1MORA 1TFRA 3PGXA 1L1EA 1VL8A 3W5VA 3A9UA 3U44A 2I1VB 1NX9A 5AQ9A 4C05A 3EEBA 3R3XA 4E88A 1QRRA 3FFTA 4QXMA 4NOMA 4AO6A 4H7DA 1RPAA 1O57A 4CG1A 5JATA 5JXGA 4YDRA 3C5HA 2A4ZA 1J1ZA 1H8ED 4FX5A 3D9KA 1XXLA 1GNRA 1PJAA 1S3SA 1ZY2A 1RWWA 1UXIA 4TX1A 4GSYA 2C8LA 1FE8A 3RG2A 5HK8A 4ZMBA 1MMFB 1BD8A 1P9LA 1G6KA 1XZPA 2I6XA 3DZBA 3BWYA 4GM1A 2EG5A 3RJ5A 3RUCA 3EPHA 1OLXB 3FFWA 1OWOA 2J6CA 3UF0A 5K0SA 2DH6A 3DVSX 4MR9B 3EPKA 4TXPA 5TQ2B 2OHGA 3WYDA 1OZGA 2P9GA 3LLMA 4DA0A 3PPVA 4EZEA 1TW2A 4B3GA 3EISA 2B21A 4GXNA 1ULHA 4P3KA 3AERB 2H1WA 5C5IA 4OP2A 2ZRPA 2AOWA 2R1VB 2PA0A 4JI3B 4FKBA 1Q16A 5ENSD 5JD5A 5AQAA 2FWJA 4BETA 9ATCA 2VC2B 2HB6A 1MO4A 5FOTA 1RP1A 5AUQA 3IIMA 5D8DA 2MR5A 3PDWA 1TPYA 3QE4A 3L02A 5I7SA 1MPXA 4WNIA 3KKPA 4OQNA 3MERA 1TTPB 1P0CA 4B6SA 3FD8A 1FCHA 3AM3A 4L74A 2O59A 2DFTA 1MJGM 2GPNA 4OB6A 3M33A 2IF4A 2C7VA 4ZO8A 3QA3E 4I6JA 5D3MB 3BMXA 3SZRA 5EZYF 1UP7A 2IP4A 2IVFA 2E49A 2AH5A 5AHRA 5CB6A 3AV0B 1LFDB 3WL3A 4WLVA 2VTKA 2VZ9A 4ODIA 2KSQA 1NL3A 1NUQA 3PR1A 4PPQA 2IO3C 2O2DA 1YGPA 3L0DA 5HHTA 4AUNA 1AKVA 4CF7A 4MWBA 5KTYA 4JGGA 1AKMA 3VOAA 4M99A 3TI9A 3D9NA 3GCGA 3UXHA 1SHTX 4LWPA 3LPLA 3LC0A 5IVDA 4UDNA 4BT8A 3QE9Y 1QHFA 3RNOA 1VI5A 1TYQG 3UW3A 4CKBB 1EFPA 4YI5A 1T15A 4KOEC 1OBHA 1YD7A 3KYIB 4JJFA 3O8CA 3P2OA 4YUVA 1PBNA 4RPCA 4MQFB 2BMJA 1XCMA 2QS9A 1K5PA 3WLEA 1CY6A 2RI6A 1X7WB 2DIWA 3LT1A 5KQRA 3KHSA 1UANA 1JR3A 3R74A 3ISMC 4CV0A 3U60B 3GZSA 3T1TA 1WO8A 5LA6A 3GEHA 3TD9A 5LZ4A 4KQFA 4RK7A 2BJHA 4NBRA 2ZJ1A 2JAXA 1WTCA 1N32B 2WWIA 2X8WA 3H17A 4ALNA 3K8QA 1GIAA 1GW6A 1UJJA 4FHKA 5JAHA 2BRUC 5E2AA 4OQPA 4BJ6A 5TJ9A 2W8ZA 3JQ0A 4PAOA 5JAIA 4X66B 4IY1A 5GONB 2GCOA 4UWFA 3OKAA 3AUXA 1RLOA 1U8EA 3EWNA 3O8QA 3UB2A 2Y1WA 2E0IA 3V33A 3T95A 4MMYB 2NACA 3GRCA 1DKMA 1LGYA 3ECAA 2ZRBA 3JQFA 2CXSA 1EGAA 4NS4A 5BYAA 4V0ME 5LZ7A 3NHYA 3ZFWA 1E61A 2QB5A 3L7MA 4N5HX 1PZHA 1DIBA 3AHIA 3ZXSA 4KGZA 3UGQA 3EULA 3FI9A 1C30B 4X8QA 3FMVA 3DEJA 2A1TS 1AXEA 2BFAA 4IDPA 1Q11A 2YWFA 3M6AA 1Y8QB 4CEHA 3WLNA 5IBPA 1RW2A 2YHEA 2ZGVA 1ZC3A 2I66A 2E4YA 2C0PA 1HBJA 3PDCA 1Z29A 4OQ4A 4RHEA 1EYHA 4ZOBA 5JSZA 1W4RA 2ZM5A 3VC2A 3H84A 4N0PA 5IX8A 1XTZA 1IB0A 2YIDA 3VOTA 3VUEA 3BKXA 3VV2A 3UW1A 2AFRA 4KPFC 4CFZA 4N03A 4EQFA 2M1ZA 1QWOA 2XCQA 4D8UA 3GNQA 1MIOB 2AE2A 4CPDA 2KMLA 3ZHVA 2PPLA 2XBMA 4OLJA 3OM8A 3JQ9A 3PVCA 4PR0A 4JQZA 3R3UA 2OESA 4IZ6A 4RLQA 3BHNA 1NZDA 2P8JA 5FIUA 3GFVA 1UPTA 3S7TA 2IXFA 4R54A 1RJWA 4HWSA 3MTGA 3IA2A 4HXGA 1JEEA 2CXNA 2FSFA 3K7EA 4ILGA 4LJYA 4OSOA 3LYLA 1EA7A 1EQ2A 2UZ3A 1XYVA 4RA9A 3KKLA 2WF8A 1J70A 3LZDA 2C3UA 5BUCA 5TMBA 1BTOA 3OTHA 3ZV3A 5T8IA 3QWVA 2AI2A 2YX1A 2R6DA 3GBVA 1S0PA 2GRLA 3T9BA 2CVQA 1UZMA 2REBA 1JQBA 3IR7A 1OXJA 4JWTA 3VA7A 5F51A 3UCEA 3W6ZA 1QQ6A 1E96A 1OA0A 3PLRA 2Q5CA 4AKTA 1UQUA 1QIIA 1IN4A 3SM3A 4GPKA 5HRCA 2ENWA 3WLAA 2FFQA 2GOYA 5CA1B 1RKXA 1MH1A 1AURA 1YRLA 3RV3A 1QC5A 5B5SA 4TLEA 4IJMA 5E6RB 5C3MA 5JALA 5FULA 5FWYB 3PRHA 1G5HA 1OROA 1LFAA 2NYJA 3ZIUA 4FOLA 1BS2A 3UCXA 5JG7A 1RXWA 2H7XA 1S89A 1YBFA 4R84A 1JVSA 4OXKA 3TWSA 3E3MA 4RZ3A 4K6FA 1BQ4A 1OX6A 5ER9A 4X95A 1CK4A 1I2ZA 5LM3A 4E4TA 4X8OA 1K7FB 3EIFA 4BZZA 2W6ZA 1MB3A 2FJUA 3GJ6A 2VQFB 1PGQA 1QRAA 3CGGA 1XVLA 3NC1C 1PJRA 2G04A 3WR5A 2RH9B 5U1PA 4IO0A 1PD0A 1T29A 3WK7A 2OP0A 4LRUA 3QEMA 2JH3A 3IQZA 4TS9A 4KFUA 4BNDA 2PLWA 3GUYA 3DZDA 1YB1A 3WO1A 2D5IA 2I67A 5KNDH 4KXVA 1TKRA 1GFIA 4QPJC 1IQRA 4FFPA 3H87A 1T9DA 3E22B 1YZLA 3OZDA 2DBRA 2XCTB 4F2GA 3GCZA 4UEOA 1A0OA 5AENA 2YC4C 5DBGA 1XJWA 4YRCA 1GGMA 4WJLA 1TI7A 3L4KA 3CQ9A 1AS3A 1ISIA 2RD0A 4N3BA 4YV2A 1QFSA 3HDQA 3T7RA 5FUVA 3CK7A 1IJBA 4GOMD 3A2KA 1RW4A 3CZPA 3BQOA 2RAVA 4QJBA 2QENA 2VP9A 4INZA 2R60A 3PQEA 1HF8A 1K98A 2NXWA 5LX8A 1LA2A 4CR6A 1RFLA 1XP8A 3F5MA 1NASA 1G20B 3CBGA 2XBUA 2HZ7A 4HYTA 1NXPA 4MDFA 4JUDX 1GAXA 3SNHA 4DY4A 3HB9A 3G1TA 2VGXB 2HJSA 3D81A 2JLBA 2GXQA 5B57C 5H80A 1YA6A 5C1BA 4D44A 3DTVA 3AVXA 3NS7A 3MJVA 2V5UA 3GN1A 4U4AA 1HKHA 3I5AA 3GFGA 1MFZA 4DB4A 2H65A 1T1IA 1DKRA 8OHMA 3MKQA 3I5UA 3SDSA 4MI9A 5J2UB 5BUQA 2XOKD 2G3YA 5AYWD 3KDAA 4JP3A 4PPYA 1E6EA 5G2NA 2E5WA 3ASYA 4II2A 1IULA 1MEJA 3DM9B 4PCAA 2IYTA 5M34A 4YFYA 5HMLA 3IV6A 1NW4A 5JBNA 3CNNA 2G1UA 1JPUA 5IJWA 1E4YA 2NYAA 3V5NA 1GUBA 2W2VA 3MRTA 3L82A 5C46F 2VJKA 2CLLB 1TJCA 1UDRA 1L4MA 4D97A 3OTGA 1OUVA 4P3NA 3I9MA 3H9GA 4RGVA 4BNJA 3H1PA 4QPNA 2JD0A 5ENOD 3PQ2A 1USIA 3EJ6A 3PC8A 1LBHA 3EQ9A 4RF4A 4EUEA 4DX7D 1WOYA 3QX8A 5LBUA 3DOUA 1O94D 2QIOA 2QRPA 2J59A 3PKZA 2OUKA 2SICE 4M22A 3FMGA 2GEUA 3T7JA 5D6NA 1K1AA 3OXGA 2HT1A 2OQRA 3KHUA 2HMVA 1JKIA 1T13A 3PNKA 3IHKA 4TRMA 3C8ZA 3KCQA 3LVQE 4EPVA 4UBOA 3UQZA 4G5RA 4H7XA 1ID1A 3STTA 2AEEA 2P0EA 3H04A 4BRUA 4PXSA 1IBMB 2ZAIA 1VDZA 3LXUX 1I7PA 1Q1BA 2B5WA 1NQVA 1N95A 1HYBA 4CEJA 3C8MA 4TSFA 4C0HA 1R5OA 4MV5A 3S7FA 2PYIA 1MV8A 1X7XB 5TQ0B 1SQ0A 3D3WA 1KJQA 1S2GA 2HDHA 4FS8A 3O4HA 3V8RA 3KQKA 3TTTA 4JUFA 3RAPR 4ZYTA 3AR9A 5BVGA 3KB6A 3LOPA 2PGNA 4IRXA 5BN1A 3U3JA 2DVWA 1IQPA 2BKKB 2QX9A 1N4DA 1T8WA 1L4BA 3NM6B 2YRXA 1AS2A 3L1VA 1Y81A 1MX4A 2XY4A 2W2XA 5KNCH 3KTOA 3RS7A 2G7MC 3KZKA 3H3XA 3P2EA 4ARZB 5JLJA 2QTVA 4DLSA 3LT4A 3L7AA 3UK7A 3IR5A 3GLIE 1HTTA 1K6JA 3B95A 1UJKA 3CMCO 3LX8A 2WXGA 2A5JA 1KYQA 4BO2A 3RAJA 2AHRA 1M7BA 1TL7C 3AR6A 4ZICA 1RZRA 2IONA 5J4LA 1X2EA 1Y63A 5IWAB 1YBAA 1O5TA 2IDZA 4YJHB 2GF2A 2H52A 5CNIA 2AZXA 2XXJA 4DMLA 1GV0A 3SI5A 4GDMA 2NTEA 3F78A 2RI0A 3D2AA 4GXRA 1Y98A 1M0SA 4LF6B 2VL7A 3CB2A 4QVKA 3AZPA 2H29A 3HVIA 3FTFA 3K0EA 1IXSB 1L4LA 4GICA 4IRUB 4JITA 2HLHA 1OCZE 3TRHA 3NAGA 4AUMA 3NASA 2NUAA 2R2AA 1Q0TA 2YBDA 1JZSA 2DQSA 1K7CA 3Q4GA 1VKJA 2DYRE 3LKBA 4EKDA 3F6PA 3G6KA 1KH2A 1I1HA 4GSKA 1DIHA 4O1IA 2OFXA 2MRIA 3D3KA 3MM4A 4XAQA 4C0LA 3EVEA 2HQBA 5FOVA 1XD2A 3KJXA 4FR2A 2FK7A 2P67A 1HE4A 1GZ3A 3BDAA 2P3OA 1H5QA 2YMLA 1RMQA 4DX6D 4EUFA 3GWZA 2YMPA 4IHAA 1W5AA 3RBAA 3PDUA 2YNMC 3WJ2A 3LL4A 5I5GA 1Z2PX 3NX4A 4N49A 3B8HA 4BWGA 3PXXA 2ATCA 4M37A 5JI3E 4FZRA 4R2XA 1KJJA 5FYDA 1WXWA 2HBYA 5LNK1 4PPGA 1MB9A 4JBGA 4ZZIA 2KHZA 4U7DA 4LI3X 5AUPB 5AJHA 2OCAA 3MOIA 2BE7A 5DI3A 4KBYA 2Y2UA 4G4SP 1FVOA 2DJ5A 3UAOA 1G291 4GX5A 1LB1B 2PH7A 3T7EA 1E8DA 4NXMB 3ZV5A 4B2PA 2OBFA 3JAKA 3OBBA 5DTIA 2R59A 1JL3A 2UUBB 2Q1YA 2CCKA 3CRRA 3G0GA 4OFWA 3K0SA 3RJZA 3N53A 4GA0A 2CWDA 3GIWA 2A0UA 1OT3A 4Q1BA 2D1RA 3AH8A 4CM7A 4L7QA 3CEHA 4GQIA 2FN3A 1G17A 4CU5A 3PX3A 1NVDA 2L2QA 1PNVA 1E3EA 3GUVA 4RHYA 3RC2A 2Q62A 4PRZA 1N6HA 3PRKE 2OWDA 2DFVA 4XGRA 2CXHA 5IKXA 3CRZA 4BPBA 1PKXA 1P4GA 5DP1A 2MIIA 3X1MA 3HKDB 2JJ2D 2Z2XA 4DMMA 1JQ3A 4LC0A 2E1PA 4XRRA 5GONF 4O0LA 5DBIA 2IOSA 2X8JB 1RZ4A 1RKUA 1ZNXA 1EDZA 2IHNA 4LRQA 3S2FA 2C9BA 1H1DA 2G63A 3EQ8A 5K4HA 5DNWA 3GDWA 1AXGA 1RPTA 2AN1A 3BREA 1OBVA 2AKYA 1FX0A 1XE3A 1UBHS 1R8XA 2GHTA 3PUKA 4MUYA 3Q9UA 1SG9A 4LJLA 2KYRA 4H3HB 3T3EA 1D0IA 2CLHB 3QV2A 2AE1A 2Z9DA 2PS3A 1QP8A 1L5KA 4RIFA 1Y6FA 4NZZA 1QHHA 3I64A 3SEAA 1SVWA 3IKJA 4ZOEA 1Z6GA 4FFBB 3AXSA 4UQPA 3AHCA 5AKGA 5BWNA 2YVQA 4F6RD 4BJ1A 1I9CA 2B98A 2GN9A 2Z83A 5FQNA 3IXQA 3PIRA 3CS3A 4IKPA 4JUAA 1FDIA 1GTMA 3GVIA 2ZZNA 3AEQA 1W2GA 4R81A 3TDNA 5F1PA 2Z58A 2OCDA 3DR3A 4HOYA 2Q4RA 2I7DA 2CJFA 4UU7A 5DNDA 4ZO4A 3ZXPA 1KC1A 1MU0A 2C2BA 5EQTA 5GINE 3KZNA 1OZ0A 1QKKA 5FL7A 3K6JA 1PN3A 3SHVA 3CF4A 4JVSA 4HMOA 1QHIA 2FUCA 3MT0A 3OM9A 4X8HA 2DP4E 4R1UA 4L0QA 1TF7A 4OHRA 4PQEA 4QGGA 3K5PA 5BV8A 5KBAA 1N57A 3QTTA 2XCBA 2SNIE 5H16A 4BDSA 1AO0A 5KX5F 3WNQA 3K9GA 5DWVA 2W9XA 4PGGA 3I1JA 1NMSA 2X76A 4TXRA 4HAOA 1U2ZA 1YFLA 1YUBA 3E82A 1X1BA 5LP6A 2BFCA 3IJPA 5K0NA 3A31A 3L0PA 1ZRNA 2HF8A 4ISCA 1MAUA 2C9YA 1R4MA 4R05A 2Q5EA 3ETCA 4YQEA 2VA8A 4IFTA 5L9AA 1MX2A 2XR1A 1SNYA 3TH5A 1KMIY 1J8QA 2KBEA 4NOKA 2F1HA 5IMBA 2ZR7A 3O8DA 1JJBA 2D59A 3VR3D 2A5GA 2V55B 2RCYA 3IEUA 4HGQA 3Q40A 4PSUA 2BKUA 3IYLW 1YS4A 5CVJA 5I48A 1LSJA 3HFSA 4EY3A 1WX1A 4KXKB 2WWGA 5EMKA 3V8PA 2I4OA 721PA 4CEMA 3AF6A 4BNKA 5HI7A 5K8UA 1JHAA 1L5RA 3DL7A 4O2BB 3K8ZA 3O74A 2DQ4A 2HK7A 4E11A 1K8QA 2ODPA 3EIOA 1Y8RB 1YCDA 4JDPA 2Z4RA 1RAFA 2W6QA 5ALOA 1YJCA 1ZITA 3HXDA 3MILA 3PUIA 5D6OA 2PM7A 1R10A 1CP2A 1UDXA 1AHIA 2AV6A 1RC0A 5AARA 4YEDA 5IF9A 5CA1F 1D07A 1SUWA 4MWGA 4Z86A 5FA8A 3UMFA 3DZFA 3IALA 3ZH2A 2IWRA 1WZ2A 1CUUA 4MVCA 2Q4BA 2XNCA 1L5HB 3B6IA 1TF2A 3NP7A 2QJOA 1KJYA 2LTAA 4YCJA 1LBIA 4EX6A 1Y7TA 2WILA 1EWRA 1EVZA 2D5AA 4ZAVA 5EC8A 4W63A 1G66A 4RL6A 4QEZA 4OHCA 3ZK7A 2FUG6 1B16A 3G88A 3GJSA 1V25A 4OATA 4D3DA 3M5DA 3DCYA 4L02A 4NQZA 3SQNA 1RKBA 4QFMA 3QE2A 5B6IA 1QUEA 4RPGA 2DWCA 1I14A 4EENA 5L51A 3AXTA 3IBSA 3PVLA 2JLWA 1O7JA 3TCKA 4G5XA 2BAGA 5KVQA 1SRQA 2C4TA 2EHJA 4BEVA 4H7PA 1MT3A 2OY0A 3O47A 3U4AA 2ZSFA 2I4RA 4EGAA 1O0CA 1ODKA 3NC4A 3S2UA 4ROSA 2ZDGA 3CF0A 3OKPA 2P9YA 2ZJ2A 3EBPA 2ZM6B 2NSLA 1Z0SA 1MBZA 2Q8NA 4QPZA 4EP1A 3OP1A 1A9QA 1FP4B 4QNRA 2M98A 3PQ5A 5C8YA 4Y2JA 1X3SA 2JIOA 2I0FA 3SBOA 1WM5A 2UUOA 2OXEA 3QTLA 4M0UA 4TKMA 3CVLA 3UJ3X 3ANLA 1O4WA 5ECYA 4H0NA 4DPMA 1R1DA 4GRAA 1JHMA 3I6QA 3UGJA 1SC1A 2R25B 5EZYB 4KVGA 3M2TA 1ZB1A 5ERXA 2O6LA 2PUFA 4YONB 1WSWA 4PG4A 5LZ9A 2JAUA 5EEHA 1SQGA 1A1SA 1TECE 4D9BA 3U13A 3FHCB 2FPIA 4GXTA 5MGBA 2C2GA 5J1TB 2GYUA 4HFNA 3OJWA 1E7SA 2ZIZA 3RWOA 4HG2A 2YHBA 2J9RA 5EHIA 2H1HA 2HRRA 2QRZA 2ZIGA 4U2BA 3RVPA 5KJ6A 3V00A 1D6NA 1AO3A 3DHYA 3SN6A 2Y6VA 3H2IA 3W3AA 2VAMA 4J0CA 3QNWA 4PHTA 1M1YB 2J5QA 1LRJA 3OX3A 5JTTA 2OR3A 1DSSG 3PR2B 3L6BA 4UMVA 4GP9A 4J8PA 3PSAA 5J2UF 3G5AA 3ZW7A 1X9IA 4RMGA 1TR4A 2RGBA 4S1TA 3KYCA 4Q3DA 5F5LA 2EKLA 3AJAA 3DMRA 3TWXA 1REQA 4B74A 4IHJB 3AHJA 1YH3A 1CUJA 3AVQA 2EIKE 5BQFA 4H31A 4UWLA 2FPWA 4JB3A 3PFCA 2OXCA 1OU4A 5IVIA 3PBKA 3LUFA 1C8LA 2G0NA 3E2MA 3AETA 4CTOA 4EJSB 4IULA 4OKNA 5HQTA 4J8SA 1WHTB 2IZ5A 1B76A 3BIWA 4M8IA 4CG2A 2F8SA 4LJ8A 1Z15A 3LS8A 4ABYA 4ANWA 4KSCA 1YNSA 3WMEA 2LSVA 5H3CA 5J2TA 4TYQA 3QFRA 1TVEA 4FZJA 3G9UA 1JCSA 4RK0A 1FW8A 3GT4A 4XWYA 4ZT5A 1Y1TA 2ZIXB 4AZ3A 1V35A 2Q3LA 1WCYA 3RPEA 2YYZA 5AN8A 2OBXA 2I62A 2C92A 4NRHB 3HSYA 2IUTA 3VPCA 3L1HA 2JCXA 1A7AA 2DLDA 3PHHA 3WQQA 2OCCE 2IGTA 1YVPA 5AP9A 2J4DA 4DRXE 1W34A 2GCGA 1P44A 3RODA 2J5KA 2WXQA 1RD4A 5CBOA 2R6GA 2VRCA 3NHAA 4FBGA 5F12A 5A0FA 4P36A 2BKGA 2IU3A 1BXRA 3HYSA 3S8YA 4I4CA 4MR7A 5JJ6A 2FPSA 2IJGX 1U7WA 3GJ5A 4F7DA 4UE3S 4E31A 2GJ8A 3S2SA 1UUFA 3N87A 3PFHA 5JHBA 4I3FA 4RG9A 1KNXA 1PFVA 4J8YA 4M49A 2JJMA 1UEIA 4PXAA 4IKEA 1Z2EA 2EIJE 3NYIA 2FEWB 1E1QD 4PYMA 5JCXA 2GFQA 4N0MA 1E9SA 3EA4A 3W7BA 3FVWA 2GJ9A 1I3KA 4CG3A 1PT9A 5C34B 4MVJD 4N7BA 1AKWA 3JQ1A 2RAPA 2UUCB 2WXLA 5JJKA 1CJTC 3IESA 5AVYA 2VHTA 3ICCA 1ZMOA 4EJSC 2ILTA 4RV5A 2UZ1A 1MZCA 2WD8A 4WD3A 2IGBA 1V8FA 4IIYA 1JG1A 1R4NB 3PJFA 1YZHA 4MITA 1FFDA 5EQFA 2A5LA 4XLZA 3MTJA 5AW1A 4BX8A 5GJCA 3DEPA 1FPPA 5IT5A 4ZC1A 5IUNC 4KNWA 3U17A 1M2WA 1HE8B 1F14A 4FC7A 4B85A 2MSWA 2NVWA 3CNBA 4GZLA 1BJKA 4P80A 3CURA 3P9NA 4KN8A 2TS1A 4QUDA 4G0OA 2EOAA 2EJWA 1S01A 1GA4A 3UCFA 4YUWA 5CDGA 3DCIA 2ZB8A 2A1UA 1WXFA 1QJ4A 4NCAA 4WESB 2PKEA 1S7GA 2WKQA 4OU4A 5GMOA 3JV7A 5K3CA 2P8SA 4OAVB 1YIOA 4FZ5A 4WA8A 1SHLA 2VWGA 1XWFA 4J1NA 2IHBA 1LPOA 5CW2A 4BBJA 3I45A 1DAPA 4M1KA 3V7WA 2C95A 4GWGA 1BH2A 4ER6A 3NPMA 4KIJA 2A2ZA 2V0PA 2GN8A 4RETA 4EH1A 1L4HA 2V9CA 5G40A 2WB4A 2NT3A 3TLZA 5ANRB 2A4KA 3OT1A 3DKIA 3HPRA 1T4MA 4G8BA 2WA1A 4A27A 1H8EA 4DJJA 3TFWA 3U4QA 4O1HA 2QVCA 2NU7B 1IDN1 3RBXA 1JU3A 1G3MA 1C0IA 2AR7A 3GGCA 4JNCA 3RUPA 1T3TA 4L5BA 4H18A 1XAIA 3WO0A 4B79A 1R8QA 1VKHA 1L3CA 2WT4A 2I2FA 4AZSA 2BF4A 3HXLA 2EQXA 5EIBD 3QVJA 2MSKA 1TJFA 1BLXB 1L7BA 1D03A 2RMKA 4FCTA 4PHHA 5FI1B 2HEGA 5F5NA 3TL6A 5I47A 2YQ8A 2P9EA 4WWNA 1XCJA 3TR6A 2HRQA 3LUCA 4B3FX 3EAFA 1UINA 1WXHA 3HB7A 1UCFA 4UJ5A 1YZQA 3L0BA 3PC3A 4UCXA 1KU0A 4Q3EA 3VO1A 4JVLA 4WZAB 2V7UA 1S63A 1C3LA 1SKQA 2AOXA 4J9UE 2CUZA 1YZYA 5E7JA 1UDAA 3VJMA 5HW0A 3NKLA 4HY3A 4OYLA 2IE0A 5KJNA 1DUIA 5CVEA 5C7OO 3G79A 2FSUA 2DT8A 1N2HA 1Z9BA 1GN9A 3H9JA 2WE8A 4EZIA 4WECA 3K35A 4LTNA 5A0VA 2XRYA 3MKRA 4X1KB 2IIPA 1SCJA 1NPYA 1YB5A 3I72A 3RC1A 1MAHA 3UK0A 2EILE 1PWZA 2VQSA 4RY8A 3HABA 3JUIA 4GZ5A 3EEFA 4QEKA 1QIDA 2YN0A 3QKUA 1YI0A 2PGDA 4RZSA 4U7HA 1ICIA 1BMQA 1Q17A 2E1RA 3A1SA 3C74A 4F12A 3G2QA 2HA4A 4FUQA 3I2GA 2P0YA 2HMTA 1LDNA 4QDKA 2DY1A 1UQTA 3EK2A 3ZVVA 1EJ2A 2G8LA 5TPWB 4H0CA 3PHBE 1LDMA 5IAEA 3BBPA 4H1TA 3H1AA 1ZI9A 1GEEA 2GZAA 1Z3CA 4LQLA 5ECWA 4REQB 1SBQA 5JZVA 4JBYA 1LDGA 3FTCA 2QUKA 2XIJA 2WJZB 3N5KA 2HCFA 3ETGA 4GTMA 2B2XA 3GW8A 1RQNA 4AP6A 3KXIA 2EJUA 1NQTA 4E15A 1W76A 4DLUA 1T25A 4MJ7A 1AQJA 4TWBA 4X1OA 1TVMA 3FTNA 5FRDA 3RNLA 1RABA 4BTBA 4CI9A 1OH8A 4IF6A 2OQVA 3TZQA 2Z1NA 2C77A 4L3OA 3OEEA 1M8FA 4QDXA 5FCDA 3FCSB 1Y48E 1QLJA 2CCGA 2HLNA 1SQSA 2OAEA 1JDNA 5AOVA 3UAVA 4B0OA 3DZKA 1XNQB 4DR3B 1U6IA 4UWGA 3B9PA 2DMRA 5ILOA 5A4JA 4L4UA 4AUEA 4BO8A 2QV0A 3E9EA 2JLRA 1CDEA 1FTWA 3NEYA 3RIGA 2JK1A 1C1DB 4DA9A 3C45A 2WICA 4XYLA 3U7QB 3ZBPA 1NVVR 1F6BA 4PINA 3SGHA 3GLSA 3SBEA 4NPCA 2IXGA 4QUBA 4YBZA 2ZTHA 1Y6GA 3IAFA 3RFCA 5F3RA 4P22A 2WWVD 4ANUA 1YR2A 2CBGA 3PJRA 3RRMA 2QXYA 3K8OE 1ZSVA 1RP7A 2PUGA 3G0BA 4KE9A 3HU1A 4D4IA 5JQWA 1PEKE 4LWQA 2JHFA 3GLHB 2W58A 3I53A 1OXSC 3B7RL 2FDCA 1D7AA 4LFBB 5AIAA 4BY9E 3R7QA 1Y82A 1LPMA 3TB6A 4LKOA 1X1RA 4LW8A 3WJ7A 2B20A 3ASFA 5H59A 2DCMA 2XRZA 3CE9A 5DVZA 3Q7PA 4TS3A 3V7UA 1MOSA 1NVBA 2QZPA 2D8AA 4KHZA 1DBPA 2V7VA 1EM6A 3QWPA 3ORFA 2VF5X 3HQ4O 1KGDA 1KP3A 4Q9AA 1XRQA 2IZZA 4IIFA 4O2LA 3IHTA 4QTXA 1WUTA 4OVUA 2L0IA 5IU6A 3QHQA 1A9XB 3TIVA 3HBMA 1N6PA 5L3SB 3NTUA 3B78A 3DXYA 3FYCA 5IAJA 3HHMA 3Q7SA 4BAZA 1FXWF 2PEZA 1X5BA 2Q3DA 3EGDB 4G0ZA 2FW1A 5J4VA 4TRRA 2O7RA 2IEAA 2YBEA 4P5PA 1FYXA 4YP7A 4WN9A 2XDWA 3OCUA 4Y0VA 4QGAA 4TYMA 3EOZA 1TZCA 4NQ0A 3TJPA 4Q4LA 2HU2A 1OCRE 1YS2X 2D62A 2PMWB 3QVUA 2BSXA 4PTZA 1YZVA 3PC2A 4I2VA 4Y1RA 3CX7A 1MJ5A 4PCVA 4YP6A 3V1UA 1VGVA 1G7TA 3ZUGA 1J5PA 2C88A 3L92A 3GVPA 1K6EA 1N8SA 1XWIA 1E69A 1NE7A 4BVHA 4GU5A 4JBLA 1P2UA 5FH9A 1K8ZB 3HV2A 2VQ3A 3JPWA 2WZCA 2P9ZA 2V6FA 4JSTA 4WXRA 3DSUA 2XDYA 5H81A 3UAXA 2H4WA 3BZWA 3Q12A 3P2MA 4TV8A 1SCBA 1NX6A 3IAEA 3M4XA 4ENRA 3LO5A 2IEZA 5KAMA 2JAOA 3R5JA 5CK5A 3HDJA 3JVIA 4ZXFA 4BRZA 3HO8A 2QORA 5BOSB 1NMEA 1WPXA 4B76A 4G37A 4OL0A 1F6WA 3NM5A 4CEIB 3B1WA 2BCGY 2RGAA 1GY8A 1U2TA 1WKBA 4N6OA 1SBTA 4CM8A 3NHUA 4U3JB 3SZ3A 2Q5LA 3BHIA 4UBMA 2J9GA 2W4MA 3T9EA 2LO6A 2O4CA 2F62A 3EVTA 3QBVA 4HT3B 2ZXEA 4JI1B 2CBZA 5L40A 2ZRNA 2QMOA 1IFXA 5JY6A 3KZVA 3ZLBA 1YNOA 4FLMA 2E4AA 4IEIA 4AZVA 4OGWA 3JQ6A 1HDZA 3T5AA 1KEWA 2FG6C 1Z4QA 1EINA 2FZEA 1KY4A 3FLMA 3GEIA 4GKJB 4IYPA 3F3MA 3FBWA 1I1OA 2ES4A 3ZU3A 4K9MA 1XQ1A 3FULA 1HE2A 1MO3A 4B3JA 1Q1EA 1QKJA 1NW8A 4BVGA 2P6RA 3CRQA 1U2EA 1RU3A 4U0JA 4H15A 1WUKS 5T3RA 1YJ8A 5C2JB 3DAHA 2RHMA 1QUFA 4UC0A 2FPRA 1KO7A 1K5HA 2WYWA 3M5CA 1Z2CA 4J1TA 2HD4A 1D6SA 4OQEA 3CG0A 1VG1A 1QG4A 2OPHA 2GPJA 2UDPA 4IHJF 3WV4A 4P5EA 3AX6A 4B93B 3ONDA 4OF4A 1FA9A 3P1JA 1VKRA 4EGCB 1WDWB 5PNTA 3OEED 4BJHB 3LDUA 1J33A 1JALA 3O4GA 3GK3A 4BO6A 5HF6A 3Q88A 2VHQA 3A26A 1PGJA 4UAUA 4D4MA 2IHTA 5CXSA 2QQ0A 1N36B 3ZNQA 2IS1A 4CRWB 2J3KA 4COKA 3TG4A 3L22A 3F8SA 5ANLA 1RYHA 1JJFA 4IPTA 3MELA 1HDIA 3RSHA 1N2EA 3ITDA 3MWEA 2YWBA 4HSEA 3ICVA 4ZZ1A 1P73A 3SMVA 4I2NA 3COYA 3KPYA 1E2KA 3ZDRA 2Z1MA 2OOSA 2XOKA 1ZMXA 5IXYA 4E5PA 2ZBDA 3P4YA 2FWBA 2P35A 2WXKA 1WBDA 1WMFA 3IOYA 4DNPA 1FS5A 4B4UA 3IBFA 2DVMA 3X2QE 3L8ZA 4OI4A 3F5SA 5E2BA 4D98A 4Q7QA 2ETCA 3K20A 4YALA 1FP6A 2VSOA 3HDXA 4QU9A 5T6MA 4LHEA 4DLPA 3CLUD 5EIWA 3OKCA 5GGXA 5LBTA 3QI7A 4HXEB 4RENA 1KAQA 3VRHA 1DAHA 1BDBA 1L4NA 1I4OA 4PC2A 1FW6A 2FSPA 3CIFA 5JTUA 4JDUA 3NHWA 4O1MA 1O94A 3QUTA 2UVQA 5KX5B 1II8A 3QKIA 1CIVA 1DOZA 3VSDA 2ZP1A 4NEQA 4E5YA 4GI1A 3KJQA 4EZKA 2HJRA 2VNHA 1YB7A 3A3YA 1ZM4A 1L5ZA 1JMKC 4GYOA 3KEOA 3QPBA 2H17A 3T5TA 1P3DA 1YTUA 1DWUA 2R05A 1X42A 1XKQA 3CHRA 2DPHA 4JHXA 3ZCQA 3IUNA 4ACAA 4TM8A 2XXAB 4FFNA 2VK2A 1FFYA 3G5LA 1V9SA 1XZKA 3KZ1E 4QASA 2N75A 2G72A 1AP7A 3BM5A 3F46A 5LQRA 4RWEA 4WX2B 1YVDA 1DO0A 2ZXUA 2GZ3A 3WRYA 3WY9A 1PFWA 4MHOA 4PPFA 5I6DA 4ER5A 1MJHA 3AEUB 3VPXA 3FA2A 4UARA 3FMIA 1IMOA 4OHFA 4TWAA 2QX4A 3M8KA 2CDBA 1E3IA 5GZ3A 4C0QC 2B1JA 2Q5HA 3OJFA 2PKQO 3KNZA 3KETA 2H11A 4BLWA 2ZBUA 1HT3A 2QJTA 3LUGA 1JJAA 2YY7A 4C4AA 1GZUA 1F4PA 1IOVA 2Y3AA 1U4NA 5AVTA 4HRLA 2C7OA 1RVDA 1DKNA 2HA2A 1Y6QA 3A4VA 3RSOA 5IJAA 4G1CA 3TGLA 1QHNA 4F6CA 4TLAA 4XOIA 3R09A 3OFSA 1LLQA 3JQGA 2E6KA 2QMYA 3R76A 1YA4A 4EG3A 3GAZA 1P31A 1HDCA 3HCOA 5JFGA 4Q7MB 3B6JA 5CBKA 3DF9A 4H7IA 2PL9A 4AN1A 4ME6A 3TQHA 4WOKA 3CLRD 5FBLB 1JQAA 4O3MA 4U8HA 1M2OA 3SC2A 4G5OA 2ZI9A 2FPLA 1ULSA 3OHSX 3IEPA 1WDLA 2V7XA 3FUCA 4X24A 3FUEA 3DKPA 1SO8A 1OLOA 4N39A 3IOMA 1WQ4A 2JBWA 4NIKA 1JDBB 4XVHA 1MHQA 2BTOA 2NPIA 2RFAA 1Y8AA 4H7YA 1PDOA 5ISMA 1QVZA 1HLGA 3O6VA 3FHLA 1HDXA 3L7NA 2W8BA 3R6TA 3CLSD 2ZWIA 2Q4DA 4YQYA 3DA8A 3W1WA 2YOGA 2BV3A 4D8TA 2OK7A 4KQCA 3R75A 3BIOA 2QVBA 3DKRA 4BQFA 3K9FC 2PL5A 4JHRA 4JXKA 1FSSA 3DBSA 3B7PA 4XYMA 3OJLA 3B6MA 3DL0A 3FDFA 1TUIA 4IZHA 2CZGA 3BXEA 4RMJA 5DTEA 2CCJA 3V4SA 1YXMA 4WZBB 4P34A 4RTMA 4TM7A 1JKMA 4HLDA 1N2IA 2HJGA 4MPRA 2NMVA 1QRDA 4BATA 3BMQB 1EZZA 1BCRB 4JL6A 2DFDA 1Z36A 4ARBA 3ICWA 1ORIA 4MB2A 2C0MA 4NENA 2JVJA 1QONA 2VT6A 4XM1A 4ZRDA 4FHCA 2IHVA 3NZSA 4HH0A 3BGSA 4XIFA 3JPYA 3L7OA 3SNXA 5EHQA 2FR8C 1DJLA 1T36B 3I37X 3MMXA 1JQKA 1QFXA 4LJ9A 2PUAA 4FGSA 3EBOA 4J2OA 3OUZA 3I6BA 3LQRA 3TLBA 4ZDJA 1RCTE 3LSYA 3W9FA 2Y1DA 3ESDA 1HI9A 1ND6A 3NJ8A 2RGDA 3TWUA 5KJ1A 4TUYA 3BTVA 2WPDD 4R69A 4F5EA 3DG9A 2VDKB 5F2EA 1E5LA 3FH7A 1SOUA 1QBKC 4X64B 1JDBC 2NIPA 5TY0A 4LDRA 3WK6A 3TVYA 1L7RA 3EUAA 1W48A 2WU1A 3HXMA 5GVSA 2QEQA 1M72A 3D4LA 1CC1S 4CM5A 4G65A 1WB9A 3I8SA 3LPNA 3HRHA 2BFDA 3QM1A 3PS6A 1EX6A 2P9CA 4E12A 3R7AA 4UCWA 3CPSA 1ZEJA 4HR7A 1GSHA 4B5LA 3JD0A 4JC0A 3D0QA 4MI6A 4PPNA 4B8AA 2NPOA 4TVOA 1X7YA 3ROEA 2JGFA 3RO7A 1ORTA 2NO0A 3E05A 1JW9B 3SHQA 1HMYA 3HTXA 2V58A 1CDZA 2IQCA 3VISA 4DKXA 3RTEA 2YRFA 3Q87B 4OGLA 2EDCA 2FEOA 1R8YA 5FI3A 3EZ9A 4HBZA 3FBTA 4TWRA 1FQJA 4NY1A 3GRPA 3AL3A 3ZXYA 1CY8A 5FUYA 5JAOA 2JJ2A 1SC3A 2TMKA 3GX1A 4ZVKA 3W5BA 4CLXA 3G5TA 3DRAA 2JATA 1L8AA 3P7MA 4FMBB 1IWOA 3H9UA 3WG9A 4HOSA 1SKMA 3DB1A 3AUUA 2P58C 5KYUA 4JP2A 3MUEA 3ADDA 4B2LA 3IAHA 1UBUS 4M6WB 1G59A 1VLVA 5EY5B 3BBLA 3LFHA 2QSZA 2RGNA 4LOJA 4LDNA 1UZAA 1Z75A 2PQRA 3WWCA 2JG3A 1YL6A 4N4AA 2D6FA 1LQTA 3ZN2A 4MEBA 3S5UA 4LJ7A 1DHTA 5JHGB 4U7JA 1T0UA 3AM1A 3EA0A 2BHNA 4YAGA 5G3YA 3B2NA 2QMUA 3PT9A 4OAQA 1Y1RA 5JMPA 5A6VA 1QCDA 3VZRA 5AVSA 4F6RA 1GPAA 4JOQA 1KAMA 1OYWA 3M5PA 4H7HA 1P3Y1 3K05A 3LJNA 4RAOA 3W3AH 2QD1A 2E18A 3AYXB 2JB9A 1A98A 2EW2A 2A92A 4G23A 3DT6A 2GM9A 1WZUA 1WVGA 2O1XA 3AP3A 1R8JA 1SXQA 1M2VA 3Q5DA 4H1VA 1XZNA 3L6OO 3JATA 4MS3B 3GJ3A 2H9IA 3E7XA 4EHLA 4R0VA 2X7HA 1M1NB 2ZRKA 5K3BA 2Z4TA 1O9BA 4C6HA 3TXXA 1VCMA 4J7AA 4A1GA 3N5CA 2B9EA 4ACBA 3TW8B 4IH4A 1I36A 4LKRA 2ZCUA 3TW6A 4DHWA 3EBLA 1DELA 3V6LA 3HJHA 2V98A 3W5IA 1YDEA 1E8ZA 4TYPA 4DSTA 3A05A 3EDYA 2W90A 4H1UA 2OHHA 3NZUA 4ZVNA 3OSUA 2XB6A 2AG0A 5ER6A 4AS1A 2CFRA 3WB0A 1JJIA 3A10A 3DDCA 3FKJA 4MROA 4MWZA 4RVBA 4R8VA 4EBAA 3B2QA 3VR3A 4BEWA 3AYZB 4M9ZA 1RAHA 5EKTA 1U28C 2PWBA 4P7FA 1R2QA 5DF1A 3OZUA 4C7XA 2F1RA 3EPPA 3U3DA 4OJYA 1J00A 1J0BA 1S3FA 1CCWA 2O3RA 3GEDA 2C4HA 3M7IA 3OWHA 5HILA 3GT7A 3RUEA 3ANSA 3SHWA 1JIIA 2I33A 2OLEA 2WHRA 4WK2B 4F1KA 2OFPA 3LT0A 4TVBA 4XGKA 2AUMA 4WKNA 3LHFA 2D5CA 2I5PO 4UASA 1OB2A 4I6EA 2OO5C 3W9SA 3HG7A 4WT7A 2EEPA 4AP2A 1KLXA 2HJ9A 5CG2A 2HSJA 1HX7A 2VYIA 4N2QA 4U2KA 4BWRA 1MG5A 4B6GA 2GBFA 3MBIA 1CJCA 4B6RA 1SFRA 3O2QB 2O2CA 1X6VA 4E32A 1TU4A 1X80B 1SAYA 4HNQA 4IGEA 5KYNA 4J3JA 4BRSA 1CIPA 2LKCA 2Y1XA 4BFYA 2G4CA 1X1DA 1YCGA 1VSQA 1JKJB 2CMFA 3H7AA 4BNWA 4NMMA 4RZIA 5A6SA 3PX2A 1IOLA 5K05A 4KOAA 3SDBA 1Z6XA 1SZDA 1ZCJA 1UXOA 3NH9A 1JE1A 1DKOA 2QG9A 3ZKJA 3L1UA 5J59A 4MW4A 3I32A 2Z6UA 5AQ1A 4R1TA 3VH2A 4N5LA 4U8VD 2ZYRA 3TLJA 1JR4A 3SJBA 3ASZA 3EGCA 1OWPA 4CBVA 1YQUA 3TZHA 4KH1A 2FSGA 1H2EA 4IL5A 3OY2A 3NJ4A 1AUOA 2X1HA 2VAPA 3IMKA 3ML8A 4JK3A 1JZQA 1HGXA 3A1NA 3DH0A 4TTTS 5FA5A 3I04A 7YASA 1NM5A 4EJ0A 2HR2A 2OB2A 4U8GA 3O8LA 3SU8A 3EGEA 3NNDA 4IXDA 3BIJA 2RG7A 1XO1A 4B3BA 3UHOA 3CVVA 3U3OA 1NRXA 1Z5WA 4KREA 2VPZA 5FUWA 3KXPA 3NORA 3OT5A 4BQQA 1TJ5A 1U9IA 4ZI2A 1G8FA 3GZNB 3TWQA 3A6DA 2NO1A 1DVPA 4WRRA 3MOGA 5TVKA 5KEIA 3GNLA 3MINB 2R4QA 3U4DA 4ALLA 5LPNA 3P45A 4ECAA 2ZPUA 4J7UA 2PUWA 3EW9A 1L5GB 1VIYA 3CVUA 4UEKA 3TNLA 3JASA 5BV0A 4ZZ2A 1OFIA 2IXDA 2OG1A 4EW1A 5KJLA 4F53A 1VHLA 1CHDA 4ZOAA 3GD5A 1TTHA 1MGPA 4BMSA 3MD0A 5D3ZA 3IAXA 1ILWA 4RLSA 3CZQA 1P4JA 4OHWA 1GN8A 3TCXB 1OKKD 5IDYA 2GA8A 4Y7CA 4X5OA 3C3KA 1QFMA 1T2VA 2PFKA 3OQMA 3MV3B 1IY8A 1WCV1 2H4XA 4IIBA 1P33A 3KDPA 1NWHA 1J2YA 4OBWA 4M7OA 1AK9A 4DT1A 1CUAA 1CP3A 3U1VA 1JCQA 1BWPA 1CY2A 4UFOA 5FFNA 3RFFA 4QGFA 1PYGA 2ZI5A 1LI7A 1P7YA 3D3EA 1ARZA 4G1FA 1YOVA 3REOA 5JD6A 4MV3A 2XIQA 5INTA 3LGSA 1QU3A 1E8XA 1AF7A 3MRXA 3PIDA 2P6OA 3WAKA 5KJEA 1PTJA 3I23A 3GLTA 3EGOA 3ISJA 1F5SA 5LLDA 3KE9A 5DBFA 4RDIA 4MOWA 3FUNA 3NHFA 4JXJA 4BNIA 5FPQA 1L9XA 3VDRA 4UD6A 4ZCQA 2QSUA 1A5AB 3ZHBA 4X54A 2X2EA 4R8MA 4DBLC 3JSAA 3NKVA 5LJLA 2C2WA 3ZKAA 1SCDA 3RGWS 2PQMA 1D4AA 3OOSA 4C78A 2PNNA 1QAQA 4G97A 2ZYIA 3AWDA 2H2HA 2WJ6A 5B1SA 1GAJA 1FF9A 3IJEB 4D0NA 3TTWA 4ZAFA 1A77A 3P0EA 4WLEA 4TMXA 4FDTA 3A6LA 2YCLA 3R7SA 1BXKA 4K2AA 2WIDA 3V2IA 1WW3A 2BISA 4CL2A 2QRHA 2FPKA 1F4LA 4CMKA 4WCFA 4LNUA 5KKAA 1WXIA 4R8RA 1R6TA 1N2OA 3ADCA 4KO4S 2D3TA 4QSMA 3RU2A 2Q5QA 4MVJP 2LR0A 1WU7A 5EE3A 2CYBA 2Y1OA 5CVTA 1TM1E 1LK0A 4NX2A 3W9YA 4E7OA 4HGRA 5EJEA 1T1SA 4MYDA 2NN3C 2G76A 2VBFA 4WK6A 3LQQA 4F86A 4C7JA 1LVGA 4WWPA 2BR4A 3Q79A 2AJTA 2SBTA 4Y9TA 3JW8A 1YHYA 3UHAA 5HFAA 1VMKA 3EXAA 4KP7A 3FYUA 3W5JA 3DNFA 2IK8A 4JVMA 1L1FA 2GILA 2XWPA 3QHAA 1VG9B 2A7QA 2VCHA 2CT8A 1E1QA 5F33A 2X6RA 3D4PA 4R2MA 4KGVA 1RTTA 4YMGA 4HLEA 3TNJA 2JVKA 4MVJA 3AL2A 4OOFA 1TCCA 1XF9A 3FTEA 4FGLA 4HQDA 1OTYA 5KTPA 4PE5B 2XZTA 4URYR 2QLFA 4F4JA 1R50A 1NOIA 3H6KA 1JQJC 3V2HA 4JI4B 2P6UA 4L7TA 3N3AC 1F8FA 4G1EB 3NBUA 3UJ8A 2XVYA 3BK2A 3QX9A 2QTLA 4ZVQA 1SEPA 4M89A 5CBPB 4JN6B 4WY2A 1FDOA 4ARCA 1SK9A 1ATZA 3U80A 3NW9A 5MF6A 1E90A 2FQXA 5ED4A 3CZCA 2QTFA 3QXGA 3BWMA 4M0PA 3I05A 3NALA 3AONB 1PHRA 1NRIA 3PDIB 4QQ8A 4M9CA 4QOFA 3TINA 3BB3A 1FSPA 2JEOA 1BX0A 5I7AA 1Y6IA 3K1TA 4RVGA 3VTKA 4CMAA 4CMIA 1KR2A 4EARA 1K92A 3DE4X 3ZGYA 3PXCX 4DAEA 3QMMA 1SPBS 4RHUA 1KO8A 2I6QA 4D5EA 1P2DA 3KDSE 3KKEA 3PPWA 3UJ6A 3GUCA 1DNPA 3AG1E 1QGUA 1M0WA 5KWIA 4L85A 1J42A 4PONA 3JXJA 3FCUB 5EL0A 3K4QA 4WXYB 4FFMA 3QLVA 4C88A 5BSHA 2X6IA 3ID6C 3BUSA 4ZTZB 3FE2A 1UP4A 1O6GA 4J43A 4II3A 2NV6A 3F9IA 3ACCA 2HK9A 2O0LA 1OWNA 2H4JA 2WV7A 4M0LA 4NIMA 3TSZA 4G0UA 3A2LA 4MW0A 4MAFA 3N8GA 4I1YA 1NFFA 2EBWA 1U7TA 3Q5GA 1AQIA 4QNNA 5TC4A 1TF5A 1ECLA 4FIDA 1JP7A 1P4AA 2QSJA 1ELOA 4H3VA 3SPXA 4H59A 2I99A 5BR8B 4QHTA 4LXTA 4C1BA 5DHQA 3DOCA 2A5UA 1VI2A 4C7OA 2N3ZA 1BMFD 1D8DA 4IUCS 1Q0SA 1U7UA 3I5PA 3COZA 3SC4A 1NVEA 4E51A 2QP9X 2Z2ZA 3F7OA 1GTL1 3IP6A 1JA9A 3JAWA 1OTHA 4ILKA 3GLGB 1E1RD 4PH4B 1SQ6A 2NVBA 2OGZA 3THXA 4Y30A 4TTRA 1XA4A 3KQTA 2DPMA 3KAEA 1EM8B 1TNZA 5KSPA 2BR5A 1E5XA 3S68A 3SJUA 4ZIRA 4EO9A 4NNPA 1KQNA 4B5KA 3OQOA 2EDAA 3KQUA 1G2PA 1P0IA 2QDXA 4RH0A 1W5FA 5A71A 2IOLA 2E5LB 5FQ8A 3PYLA 5A7DB 4BP9A 3TFQA 4WNCA 1QIMA 3KPWA 5MFPA 2WZQA 1T0JB 4DANA 3T9FA 3NYWA 5JSQA 5MGNA 2JFZA 3D6VA 4NULA 4Y6WA 2NPFA 4ABTA 4D0SA 4PZPA 2J07A 5JS1A 1H6AA 1QZUA 3ZDXB 4E5KA 4JL5A 3P71T 2PQ6A 4R68A 4QXOA 5FR2A 3IDZA 4X84A 3IURA 4Z5XA 4K9DA 1ZQ9A 4OQXA 4C3VA 2VA9A 3E3AA 4N9QA 2X6KA 4OHYA 1V11A 5D00A 4AICA 2VZ8A 1R0XA 3JQCA 5DLYA 2BWJA 3NOVA 4UE2A 1E5QA 3FWPA 4XXHA 1ULUA 3VJKA 2IHKA 4V0NA 4JYMA 4Q94A 4G4JA 1GU7A 1VL0A 4FR0A 3SYRA 4EDFA 3VDQA 5K0ZA 3VGJA 1WPGA 5IM5A 4TTPA 3NUQA 2FGJA 1CWUA 3WXBA 5CB8A 4IGKA 1IXRC 3W2HA 1DWQA 3SNKA 4EYOA 3S2GA 5A4KA 1GPWB 1BWQA 2FP3A 2QYHA 4LNUD 3PI7A 4KR3A 1UIRA 1Q2UA 5AJZA 1NC3A 1I33A 1QF6A 3W78A 5ARBA 4CQLA 3LLSA 3QK0A 3DEFA 4BXOA 1V2GA 1S1CA 1G98A 4F06A 4YGYA 4WWOA 3R3ZA 3T3HA 4OK5A 4K8RB 1XGWA 1JF8A 1J8VA 2Q6IA 3I04M 5JNSA 2A0YA 1T5SA 1PL7A 4M1SA 4RX1A 2Y69E 3W6PA 4RY9A 3D9LA 5CYFA 3WLOA 3EDQA 4DCNA 5AW5A 4A3VA 3G2MA 5I9SA 1ZJZA 1N0QA 3VKVA 3E9RA 4RCYA 4O4JA 3INNA 4MS4A 4I2WA 3A3PA 4YRTA 4AJOA 3CZ4A 4UBLA 3GL9A 3QELB 2F4NA 1IPHA 1CKEA 1DAOA 4KDFA 1XNFA 1KWGA 4PCLA 1O0BA 5EKSA 1H2BA 1DAIA 4IYJA 2EFEB 3RKSA 1Q6YA 4P98A 2QXTA 3FJ1A 4A10A 1OXMA 3V7YA 5EQJB 3RSZA 1CR2A 4FBMA 4RBNA 2J45A 5FBQB 3VKUA 9MHTA 4QM6A 2C29D 2E5FA 1B6TA 3U0BA 4Z4FA 3IPAA 2EX4A 3WDLA 2WSBA 4OIMA 4RQTA 2ZROA 3AVPA 1Y1PA 2ROQA 5GQSA 1NMXA 2FEMA 4AMGA 1MC4A 3ND5A 1C41A 2AD1A 4B0ZA 3F3KA 2G5GX 2FMUA 4DS3A 1VJ0A 4Q6BA 4GEGA 5A3SA 4PS8A 1V96A 1L8OA 5JS6A 4ZMRA 5DLQC 4B2IA 3IUQA 3B7WA 2RB4A 1J2JA 4LHVA 1Z7EA 3NDBB 3E3OA 3QXCA 4ZFNA 2FWAA 1EBUA 3KSBC 1Z6QA 3HBNA 4G5HA 6PFKA 3E27A 4RMNA 1O8CA 2JKVA 1TNOA 4IP0A 3LBHA 1QDLB 4MV6A 1IZ9A 3SGLA 3NFYA 4XUCA 5JWOA 1Y1QA 4PU0A 3L0ZA 4DWOA 3E1SA 1PV4A 1HQKA 5EMLA 1BX3A 1OGJA 2J9FB 4BP1A 1UKEA 3LHDA 1DBQA 4ZK6A 2XB8A 2DHEA 2P4SA 1O95D 5I45A 3Q6IA 1H4SA 3M1AA 2DWPA 1C7ZA 1PZMA 2GERA 4AX8A 3ZDYB 3BJIC 3OAAA 4P4LA 3VPHA 3DOOA 4KX5A 2WJWA 5E3IA 3OC0A 5GM2A 4F2WA 5CEJA 2W2LD 4Z54A 5KREA 3EZFA 4X7PA 4L5AA 1DRWA 3WGJA 2XGMA 3EZLA 2EZ9A 5AVXA 4UHHA 2BGGA 1G63A 1XD8A 2MHKA 5A4FS 2HHAA 2WMOB 4K5CA 4KXNA 5ED0A 2FHPA 1PJ2A 3W9GA 4YXFA 5HFJA 4J0IA 2E4ZA 3KOYA 2XDQB 5AUOB 3IE1A 1FRZA 2VDVE 3UMJA 3Q1LA 1IHOA 2KLHA 4MV1A 3AJIA 4ALKA 1JDVA 2X1VA 2NNWB 2KCVA 4R4JA 1RIIA 1SUDA 1ZR2A 2MR6A 2ZRQA 4QATA 4X6UA 4KMMA 3IQEA 1XHLA 2AXVA 2Q9BA 2JABA 4MBGA 1OPRA 5BR4A 3D7LA 1A95A 3BWEA 5HJEA 1SULA 2LXNA 2BFEB 4MK4A 4NBSA 1J06A 3AY6A 3EY4A 3PFFA 4AY5A 1H2ZA 5JAQA 2FWIA 4H6WA 1KSFX 5FJYA 2F0YA 4MVJM 4GO1A 3INYA 4GLFA 1E59A 1JS1X 121PA 1FFXA 1ZISA 1L8XA 1OXKB 2WM9B 1E62A 3FDXA 3OIGA 3R8CA 5B12A 4DCPA 4RZHA 4DN6A 3EZYA 3LBIA 3NBFA 3I42A 2O2JA 5DH9A 3L7JA 4AJ4A 4JS0A 1CSEE 4P3YA 1HE1C 5ALDA 4PZDA 2G9VA 4HUQA 4NJEA 3QKWA 2WNSA 1GZSA 4EF6A 5B6PA 1M73E 3SXJA 3ZYLA 4WBNB 2REQA 3LLVA 3OZGA 2GJ4A 2RCNA 3M6LA 2HF2A 2Q29A 2JHAA 2ACEA 3IGFA 3PUHA 2CUKA 3IDSA 3D8BA 5K5EA 4Z3DA 3ZLTA 2V0CA 4LQ4A 3IXMA 2NZWA 2G6TA 3ROFA 1QFJA 1BPOA 3L3BA 5HIMA 4NYMQ 4MVXA 4WKOA 4KXYA 5GWXA 3FFAA 2CLMB 4DX1A 5M3BA 2GO7A 2Q41A 5CNKA 2FK8A 1EDBA 3N2GA 4REMA 3MCTA 4EVIA 4Z2YA 3GH3A 4GT1A 5E6SA 1GUYA 4XPIB 4G3XA 2XCCA 3Q73A 3UBMA 1R5BA 3NGXA 2DU8A 4N7MA 1H22A 3P96A 1HDGO 3GJYA 4BP8A 4Y98A 1CS0B 3C6QA 4BCBA 1G19A 2Q6LA 5IZ4A 4UVDA 1UOQA 4JZYA 2P9NG 4X3CA 4BEPA 2VXYA 1BEEA 2WTXA 2JRLA 2YJ6A 6AT1A 3QU7A 3Q0TA 4BBPA 1JLMA 3UKOA 3FZQA 2GWHA 1QXSA 3L16A 4JT2A 1Z17A 2YJ5A 4E1VA 1R0RE 3GFTA 1CJMA 1ZUWA 1QTNA 3KQWA 3O3NB 3JRWA 1C50A 5COBA 1QG0A 2GZ2A 3CNLA 2R1UA 4DB2A 3A4TA 2WVHA 2ZRJA 3TLCA 1WF3A 3O8BA 2ZUBA 3NDRA 1SXJB 4YECA 3LDZA 1VJ1A 5SV2A 4PTYA 1W87A 3L43A 3ZHXA 1XA3A 4BZWA 1AXRA 1ACLA 3AY7A 3WGUA 4E5MA 2QRVA 3UJDA 3ZW9A 3DV0B 2WKSA 4UDYX 2DSNA 4G8CA 1DFHA 3REGA 1B93A 3C8UA 3Q8WA 2VTVA 3CR8A 4Q3CA 4P82A 5CG1A 5EWJA 4QQKA 1OCCE 4AF6A 5ENZA 2WWWA 4C5BA 3THWB 5LKAA 3IMEA 2WF9A 1EWQA 1RE1A 4JY7A 4ZYYA 1YRHA 5JSFA 1U98A 3PXEA 4CT4A 3MFYA 1JH8A 4L15A 2G9NA 3UOWA 2JPDA 5BSTA 2YV5A 2Z57A 3QVGA 2I6SA 3KJHA 2O05A 3I01A 1D3AA 1N6NA 1IM2A 1JI0A 5FBZA 1FDVA 3OAAD 4D57A 2B83A 3L6EA 3OUUA 1GGKA 2Y1CA 4F92B 2RSLA 1DKPA 4QJ3A 3L05A 2P41A 4G81A 5DYTA 4OA5A 2FW9A 1OU0A 3ZK8A 4D3ZA 4OXNA 1GCIA 1Q0PA 3ZLJA 1FL9A 3QW4B 1FBTA 1Q7TA 1SUCA 4J49A 4DMCA 5KTTA 1LEHA 1U1CA 4UW9A 4HDRB 4NTZA 2BHRA 4TQ9A 2A9QA 3TFOA 3MXOA 3FUDA 4N3CA 3L07A 3IEGA 3OD5A 1QAOA 1MX6A 1SXJC 2QT9A 4OM8A 4KKVA 3I9V6 2OD2A 2C5LA 4G85A 4KSBA 4HDCA 3QJYA 1AK1A 3K8YA 4Z68A 4IQ8A 2M63A 3S3TA 1Z47A 4RLHA 3QUBA 3RB8A 4CU2A 2H6IA 4LE2A 2CJWA 1FNDA 5CX1B 4F56A 3HYRA 5K45A 2ZJOA 4JPSA 4EMSA 8ATCA 1DC4A 4C3OB 3C6ZA 4NBKA 4U00A 2XNHA 4NCJA 3DVAA 3RK4A 1JLLA 2ZGDA 3HM9A 4JKYA 4CMGA 2J30A 1UEJA 4HAYA 4FQ8A 2Y0DA 2FRDA 4Q48A 3PF8A 3WLJA 4B4WA 4O2AA 1JSZA 5SZJA 2O8CB 3CGHA 3THRA 2ZJAA 2H2GA 3WOHA 4K9KA 3ZJUA 1FJ2A 2GBLC 4N41A 4A1FA 3JQ8A 2RHDA 2HADA 3ZVNA 4KJZA 4INAA 5IY5E 4GYKA 4AY6A 4P0PB 4O4IF 3DYIA 2R85A 3MJEA 3ZEIA 4GPD1 1W36D 2G7ZA 1CQWA 4I1RA 1E3LA 2XXBA 4EG1A 2ZUCA 4BWFB 3SZMA 1M76A 3MHTA 3LPAA 4GQBA 1M5RA 4IF4A 3GP3A 3FCOA 2DCPA 1ZD8A 4BQIA 4JX9A 2VLBA 4UQOA 4ZC8A 2NVOA 4KRFA 1KTIA 3REQA 2XPYA 4GMFA 4X1IA 4W9MC 1BXZA 1M2GA 2B82A 1NP7A 5H7XA 4LFAB 5IASA 1P7VA 4EFDA 3ROPA 3K70B 1QIGA 4DI3A 3MT9A 3FPFA 3TN7A 2WHXA 3KLMX 1CT9A 2BLNA 4KLAA 3CF4G 5HFNA 1FMTA 5F21A 1K8XB 4LDZA 3HJGA 5K0CA 1C9KA 1SKBA 5CJ2A 4ESHA 2GNOA 1V7QA 4U04A 4BY6A 2CHUA 4TMYA 2WPDA 1E2QA 1PW5A 2ZVQX 3SS7X 1LLUA 5EXXA 1T1GA 1MYOA 2JFPA 2ZTMA 3E84A 10MHA 4Y3UA 2WSSD 5CCBA 1KHHA 1TC1A 4LSGA 2HNAA 2B1IA 4XDZA 1N33B 4E14A 1XTJA 1TZ2A 4MRRA 3QK7A 3SYNA 2P4QA 5ARGA 2EJVA 4IG4A 2FF5A 2R0QC 3IBYA 3G0CA 1PL6A 2OZKA 4IMJB 3AKEA 4RQUA 4O59O 5G0UA 4UPVA 4BMNA 2JA2A 4KUHA 1L1QA 1SA5A 4DNQA 5EN5D 1NJ2A 3BSWA 2H1IA 1EUQA 3IEVA 3AQ4A 4TT3A 3D9OA 1DFIA 3HKEB 1NN1A 1RZUA 3ZHEB 5E8RA 1FX1A 4AV7A 1O96B 5KYXA 4LX0A 3SZOA 4OXXA 2WG0A 3AS5A 1YBMA 2FUG1 4AJHA 1FXUA 4CLRA 2J9QA 3CZ9A 2GCPA 1EFRA 5EYPA 2GLUA 1I5EA 3NBKA 2NWQA 2OK8A 1CUIA 5CMLA 3K70C 1KOJA 3PJEA 3C41J 3CINA 4JEHA 2X8LA 1ODLA 2E85A 5F52A 4LQDA 3C4JA 2WHPB 3HKBB 4NZNA 5LR6A 4RVDA 5K3EA 1K2WA 4XKJA 2RIPA 1MG0A 3M6XA 4EECA 3LK6A 1SVKA 4YV0A 2GQ0A 2VTEA 3HXTA 3MUOA 1E2NA 1AQYA 1GPUA 2VDWB 4D0RA 4DUZB 2IXBA 4E2XA 4BFUA 2YZGA 2X9VA 1QAMA 3JQBA 4QAQA 3G0OA 3BH6A 4RDCA 1JIJA 4QFBA 3IQHX 1J9ZA 4Y6PA 1SKYE 2ZTLA 3EMKA 2VDRB 1TLFA 3HJTA 2X7JA 4K3VA 3NO4A 4DSUA 4Z4EA 4QHSA 3N76A 3Q9NC 4KN5A 4YLEA 4Y2SA 3S44A 2G70A 2VWPA 1QCCA