2VSYA

Xanthomonas campestris putative ogt (xcc0866), apostructure
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
547
structure length
547
Chain Sequence
QDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into Mechanism and Specificity of O-Glcnac Transferase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords XCC0866
total genus 208
structure length 547
sequence length 547
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsyA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsyA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsyA02
3MEKA 3VTYA 1QZ2A 2UY1A 3QWPA 5DLDA 4YI5A 2KCVA 4U07A 5FZRA 2QN2A 4WADA 3CUWA 2OFFA 3TGOA 4KBQA 4WNGA 1OUVA 3G2JA 4N9WA 4EKYA 2VSYA 3QHPA 3ULQA 3UPVA 2GW1A 3IAAA 5KJNA 1XV5A 1EXVA 3FP3A 3PE4A 1FU4A 3CKCA 4KQ1A 5DU2A 2KC7A 2GM9A 2VYIA 4G26A 2KCLA 3CX4A 3G2HA 4UI9K 3UUXA 1YA0A 3QOUA 3CUTA 3ASDA 3CKBA 3QWWA 4BQEA 1JG7A 4GPKA 2VCEA 2QLLA 2SKCA 2XGOA 2F3PA 3T3DA 1E1YA 3NF1A 4W6QA 4KQMA 3MV3B 4GYYA 5BT1A 1FU8A 3G2NA 3ZCQA 2GPNA 3MA5A 3ZGQA 1F0KA 1Y6FA 1WUYA 2PYIA 3ZCVA 1Y6GA 4Y6WA 5CHEE 2I6HA 3S7DA 3OXLA 2FFRA 4AM9A 3WAGA 3OTIA 3LY9A 5FTPA 3SZ7A 2QN9A 1JG6A 5D00A 2LNIA 4GZ6A 3HBMA 3Q3EA 3OXFA 3KD7A 3ZCPA 2ATIA 1XC7A 3S2UA 2IFUA 1FTQA 3MTDA 2VGXA 2IEIA 1SXQA 3MSCA 5TVGA 1FCHA 2KS6A 3O3CA 2VSNA 4UQYA 1H5UA 1XOIA 1FC0A 5ARGA 2XCCA 1SXPA 4GZ5A 5CCLA 2V5FA 2IF4A 2X0EA 2YJNA 2C2LA 2UWJG 1LWNA 4W9RA 1JEJA 2JLBA 4X7RA 4GYOA 3MBOA 4RIIA 1C50A 3AS5A 3BCSA 2F3UA 3MRVA 3RKVA 1P2DA 1FTWA 3S7JA 4EJ2A 4LEUA 1HZ4A 4AIFA 4BTAA 3LPZA 1VGVA 4BTBA 4N2QA 2MHKA 1L5WA 3BD8A 1RZVA 5D0OD 2F3QA 1YA6A 1FA9A 4FZRA 2BISA 2HO1A 4L22A 1GG8A 4I17A 3L7BA 2IW1A 4N2SA 4Z5XA 2XGMA 2QLMA 1J39A 2P58C 4GPBA 2IUYA 2GJ4A 2Y4TA 5CCMA 1QM5A 1ZU2A 4MI3A 2PZIA 3FWVA 3ZCTA 3Q49B 3Q47B 2DBAA 1PSWA 1A8IA 2GT1A 4XI0A 4MHOA 2IYAA 1PC2A 1KT0A 1NZNA 1C3JA 3BEEA 4H7XA 4HLNA 4YVOA 1WAO1 2PQNA 3HBJA 2XCUA 3GPBA 3BEOA 2PQRA 2ACVA 5DXFA 1W3BA 2LSVA 3S28A 4G2TA 1AXRA 1FU7A 1KLXA 4NC9A 3OKPA 4J8FA 5A7DB 2J9QA 2AMVA 2IEGA 5EX0A 4WACA 1GGNA 1ELRA 4YUAA 4RIEA 3CVNA 3S29A 3HYMB 4BT9A 3CK9A 3OKAA 2ZB2A 3UQ3A 3S0JA 1P2BA 3T3HA 4RG9A 3CV3A 2XEVA 4NEQA 1IXYA 3C4VA 5JTUA 5TMBA 2WQHA 2G9UA 4BT8A 2XGSA 2X6QA 3ZCSA 3T3EA 1NLMA 4MICA 3L7AA 1WM5A 4JHRA 5BW8C 4CGWA 3ESKA 3CUUA 3S7BA 2FO7A 3ASHA 4AY6A 3NPAA 3OTHA 2Y4UA 4RG6A 4NESA 4WNEA 3IA7A 1WUTA 2ECPA 2QFCA 3LKUA 3WXXA 3RSZA 3T3GA 3L79A 4YI3A 4HOQA 2QRMA 5AYWD 3SYMA 2AVPA 3GW4A 3Q3IA 1L5VA 3UYKA 4MHSA 3EDTB 1NA0A 4KQ2A 4HORA 2IV3A 4O6FA 5LCWC 2QN8A 5JTTA 1HLFA 2NC9A 1IHGA 3MV2B 3PDNA 3OY2A 5TMEA 4X7PA 4QLBA 5I45A 2ACWA 3E4BA 3CVQA 4RENA 3RO2A 1NOKA 3AS4A 3ZN3A 1NOIA 2E2EA 1BX3A 3HBFA 2L6JA 1L5QA 3CEQA 1L7XA 4RIFA 2QRGA 3DZCA 2HR2A 2VGYA 3BD7A 5HXAA 2WPVA 3ZCRA 4LEIA 1GPBA 5TMDA 2Q7FA 2QNBA 4FKZA 4MI9A 3VTXA 4F96A 9GPBA 1UQUA 4IN3B 1AHPA 3CK8A 3H4TA 3L7DA 4M7PA 5BNWA 3UYLA 3CUVA 2F3SA 5G05J 3QWVA 1QQEA 3K9IA 1WV1A 3OT5A 3DDSA 3WADA 4J8DA 5DBKA 4CTNA 4EKEA 2XMPA 3OY7A 3Q4AB 2IV7A 3MTBA 4NQ0A 2G9VA 5G04C 1HXIA 1TJCA 2R4UA 2VCHA 3ZHEB 4RIHA 3ASFA 2GEJA 2XA9A 3GZ1A 3VDMA 4REMA 4JL0A 2AV6A 1Y8MA 4Y6CA 2X0DA 2O6LA 3L01A 4ABNA 3T7DA 4RBNA 1ZBPA 2JJMA 5IKPA 5KJLA 3SYRA 4JA7A 4X7MA 3VDNB 3RU0A 3MKRA 2FF5A 4JA9A 4G24A 3GZ2A 3E3OA 4HOSA 2AZDA 4F9FA 4WUYA 3NP7A 2FI7A 4APOA 3MRXA 4MRAA 2XPIA 3N71A 3E3LA 3NC4A 1GPAA 1E96B 3Q3HA 1QKJA 3CVPA 2OOEA 1Z8DA 3MT7A 3NP9A 1KTIA 2P6PA 3AMVA 3IEGA 1WW2A 3LY7A 2G9RA 4N3BA 2PRJA 3TG4A 4BQIA 4X6LA 5HI7A 1IIRA 1NVKA 1K06A 3MS2A 3LCAA 3MS4A 5D0QD 4F97A 1ELWA 3CUYA 5ARFA 2R66A 3O48A 1XL1A 2XA2A 1C8KA 4N3CA 3H4IA 4GA2A 4HOTA 3L7CA 2R5SA 3CEJA 2GPAA 5D01A 3ZPJA 2YHCA 5JJ6A 4MI6A 2KATA 1NA3A 3EBOA 2VQ2A 3Q5MA 2QLNA 2PQ6A 2PYDA 2R60A 4I2ZA 1GFZA 4J0UA 4EQFA 2AW3A 1GZ5A 4H7YA 2R4TA 3BCUA 5G05C 4N3AA 3CK7A 4F3VA 4CGVA 2X0FA 5A6CA 2JZCA 4BWRA 2BUGA 1E4OA 3ZCUA 3MQFA 2QN7A 2FETA 4YVQC 5HQ8A 4GCOA 2Q6VA 3U3WA 4BQFA 2BGUA 3E3NA 3EBPA 1JIVA 5DIZA 3BD6A 4AMBA 1L5RA 4KYOB 1NZFA 5IKOA 1P4GA 3RJVA 2BFWA 4U04A 3R9AB 3TAXA 3RHZA 5FJYA 1XKXA 4HOUA 4N5CA 2BGTA 4B94A 4EL5A 1LWOA 4RIGA 1RRVA 1V4VA 3QKYA 4XIFA 3OTGA 1UZUA 3MTAA 2C4MA 4I9CA 4XI9A 2PRIA 4KXKB 3VUEA 3GUHA 4AN4A 4G25A 2HYZA 4ME2A 3U4TA 3OKCA 2QRHA 3PE3A 3ZFWA 4M83A 4EL0A 1PN3A 2YQ8A 5ENZA 1Y8ZA 1ABBA 4YNDA 3RT1A 1K08A 2UY1B 6GPBA 4CTMA 4I2WA 5EKQD 3TOVA 4U0ZA 1A17A 4LDPA 1FTYA 3C4QA 1P29A 4J8EA 2VGXB 4CTOA 3GYZA 1PYGA 3G2KA 3FFLA 1B4DA 4I1AA 3D0QA 4U0UA 3WC4A 5KJKA 4PQGA 2C0LA 2GPBA 2QZSA 2WTXA 2KCKA 3LY8A 1Z62A 4BFCA 2QRPA 4G2VA 4UQXA 5FT9A 1IYGA 1NZDA 3MT9A 1XL0A 2IYFA 3COPA 3JYSA 2H1FA 2R68A 5C1DA 1EM6A 5FZSA 3SF4A 3QKWA 4UI9J 2XCBA 4GCNA 4I9EA 5M72A 3RO3A 3BCRA 3RSCA 2ONDA 4CDRA 1O6CA 2C0MA 3Q15A 5FZQA 2QRQA 1FS4A 1M5RA 1RZUA 2H1HA 4WNDA 4N39A 5JJTA 2FF4A 2SKEA 3BDAA 3MS7A 3OXGA 4GYWA 1XNFA 2C1ZA 4U0SA 3NCHA 4G1TA 3S7FA 1GPYA 3RIBA 3ZHEA 7GPBA 3KS2A 1WV0A 2VG8A 1P4JA 2GEKA 1WW3A 2ASVA 2C1XA 4HWGA 3MRTA 3CVLA 1P2GA 3TG5A 4AMGA 1NOJA 1P5QA 1UQTA 1YGPA 2PL2A 2QN1A 2G9QA 3D0RA 3CEMA 5JJ7A 1B89A 4WHMA 5KJMA 3MT8A 1L5SA 2FEZA 5LQDA 2XCIA 3ASGA 4AY5A 3CEHA 3DD1A 1JIUA 3AS8A 5EX3A 4GA0A 8GPBA 3URZA 2X6RA 3TSAA 3FROA 3CV0A 3KAEA 2SKDA 5G04J 3T5TA 1C8LA 4M60A 4RELA 4UQZA 4GA1A 3VUFA 3HBNA 4NRHB 4GZ3A 1JIXA 1L6IA 1P4HA 1HH8A 2C9ZA 1F6DA 1Z6PA 2FBNA 1PNVA 2XA1A 2LSUA 1Z6QA 3DDWA 3C48A 4WNFA 4UI9C 5GPBA 3NB0A 3D1JA 3LYAA 3QDNA 2HY7A 3S27A 3NAZA 3T3IA 2F9FA 5LCWJ 1KT1A 2QN3A 4G23A 4A1SA 3G2IA 3G2LA
chains in the Genus database with same CATH superfamily
3KLBA 3VTYA 4EY4A 4BC1A 5ITSA 4TWBA 3QWPA 5JADA 3H2BA 1BGVA 4LQ4A 2KCVA 2YRFA 3DLTA 4WNGA 2YVUA 4N9WA 4AUMA 1BQ4A 2DFKB 5CA1F 1DIHA 4NBKA 3SSOA 3HB4X 2ZVPX 1T4BA 2H48A 3GYGA 3N2KB 5B1AE 4OKSA 4DPLA 2Q2OA 4F9GA 1R5OA 3TQOA 1BYIA 1V8DA 2BEVB 3NJ4A 3R3YA 4L8VA 3I39X 4L50A 4MDYA 4XJSA 4U7EB 2J49A 4NSNA 4R1OA 2O05A 3AU9A 3RG2A 1Z5WA 1ZDMA 3BICA 4HGYA 2XW6A 1YZKA 1P2SA 1WDWB 2VPQA 2GNPA 2XLCA 5EWLB 2XRZA 1PDVA 2CVOA 1USVA 1ST3A 4QSMA 2IGTA 4ZHSA 1PL0A 4P5PA 3OM1A 1E90A 3IIMA 3QWWA 5BOVA 3MTIA 4NPCA 3EGEA 3VGPA 4RNDB 2VHVA 5ALKA 1AZWA 3U4HA 2XMCA 5CFOA 2H2DA 1XQ1A 2IY9A 4V2UA 4YRCA 2C04A 4ISBA 1JEAA 1D2HA 4ZAYA 2OMEA 3AGPA 1C3EA 5JCJA 4G65A 2P2SA 4GPZA 5AKYA 1M76A 4BLWA 4RK5A 4AZSA 1HXHA 2G72A 2ZSFA 3F5MA 3IV0A 1I10A 3F9CA 3APFA 5TLSA 4Q1BA 3LX4A 2KZTA 3N0VA 3FVRA 3NV9A 4KH0A 4DJEC 3OMLA 3N07A 5ALQA 1VL2A 1K3FA 4FKBA 3ICCA 3B82A 1PWZA 1N5RA 4IHJF 1MW9X 4MVCA 4OAPA 4B09A 4HLUA 5BYKA 5JHHB 5FTPA 3TLKA 1CKEA 2CVFA 1N1GA 3MD9A 2DYKA 2OBMA 5F1PA 3RRUA 4EUEA 5FL7A 4V0KA 1DPFA 1YR3A 4CMKA 4NZYA 5J59A 2GTHA 5IAGA 3T99A 3TR0A 3WAKA 4BLVA 3UM1A 1QGAA 2LUOA 2PM6A 4N8DA 4RF5A 2FMXA 3BB4A 1FCHA 3ZS9A 4G09A 5DX1A 5FLEX 1SIOA 4BYGA 4CQMD 3HJCA 3IOEA 2O2HA 2VH1A 2C5BA 3GZNB 2BI8A 2B6CA 1KQOA 5DOZA 4DNFA 3VMMA 3QVGA 2BUBA 2Q5CA 2Z08A 3TRDA 1ENZA 2C2LA 1YXMA 5EHIA 2BZ1A 4P36A 2FO1E 4J9UE 1JEJA 4NYJQ 4YAIA 1ZCBA 1RJDA 4U8VD 2IVFA 4KFUA 3HWWA 5CH3A 2D6FA 1MC4A 1S2DA 2QXUA 3GFFA 3NATA 3KPVA 1NR1A 4XD2A 5DHQA 5DM0A 1VECA 4MKIA 1SUAA 2FZGA 5CM8B 5G2OA 5KWDA 1Y6QA 4K6HA 1FOEB 3VJRA 4YIKA 1P45A 2VJCA 1J0CA 4Z99A 3FCXA 4PDXA 1VXOA 5ALMA 4D3FA 3IVXA 1ZVKA 1WKBA 4TUYB 1JAYA 3U1VA 3X43A 4S12A 4B6EA 3RYFA 2BM9A 3SBSA 5I5EA 2WKWA 3QTBA 3SE0A 4OHBA 3KSUA 4L22A 1CZNA 1T4CA 1T8WA 3Q3JB 4QU9A 2JFWA 4R2JA 4OHZA 4FUQA 3W8EA 5HQ3A 4Z5XA 1B73A 3AL3A 2AEJA 4ZAXA 4UOZA 1JPUA 2YWEA 3ANXA 4GHWA 4L75A 3E34A 2CNLA 3EAGA 3LUBA 3N2GA 4C03A 4HVCA 2HT1A 3G8YA 1X1QA 3DFIA 5CVUA 1HE8B 1VLVA 2MT9A 1LDNA 3M7IA 1PSWA 4M3OA 3SQWA 2GPSA 1NVXQ 2ZETA 3OZRA 4JLNA 3W5JA 1NRXA 4LJRA 1RZ4A 2IXAA 2Y67A 3B3JA 1IEXA 2XBLA 4DNXA 4WCDA 4JEMA 2XXJA 4Y0VA 3WIOA 2PCLA 1G3RA 2QRLA 2WMYA 5G2NA 1VKNA 2AQKA 4ZI5A 3F7TA 3IOYA 3TB4A 3TXNA 1G21E 4DJFC 3NJ8A 3JXJA 3HY3A 4BTVA 5GP1A 4C89A 2W0MA 3DE6X 4B9AA 3CK9A 2G17A 1XTRA 2JHFA 3GCGA 2IELA 2WLTA 4R8VA 2JGLA 3R76A 4DOMA 3FGZA 5CFNA 4F04A 1AUQA 2JGAA 1LZLA 1UZMA 4V1CI 2WWHA 2AD1A 3RRMB 4IMIB 4NEQA 2WF6A 3B51X 4EGJA 3QWAA 4XSGA 2G0AA 3IQZA 3VVCA 3QPBA 1APBA 1E6LA 3R5KA 3N3BC 4LPSA 2QPOA 4DS3A 2PMEA 1V37A 5TIIA 1VDZA 1OFVA 3MLAA 2FUNB 2NP6A 5FA6A 4PICA 1WVGA 5KX5A 3EPRA 2XPZA 2JFZA 5JNTA 3PSAA 2GCEA 3SBTB 3A4VA 3RYHA 2H0AA 1F0NA 2QORA 1UM8A 3NM4A 2B3DA 4QXAA 4YY3B 2GA9A 2UAGA 4CKBA 5AK4A 1A9QA 3OSUA 1U3CA 1JFFA 1QHHA 5K05A 4U00A 2XVAA 2CMGA 1H2WA 4G0ZA 1IUKA 3D6AA 2J4DA 1QX3A 3LC7O 4HH0A 1IC6A 4WOBA 4Y6LA 3VYSB 4HI8A 3C1TA 4OBEA 3ZY5A 4HZUA 2QTGA 4L02A 1IY8A 2IHNA 1ADYA 1R15A 4KQ2A 2W2XA 3I28A 1T6XA 3H1BA 1S01A 2ODPA 2FPWA 3G23A 5D86A 4AS1A 4XFDA 4YCSA 1AA9A 5CITA 4HDSA 4V1CB 4I1IA 4TV9F 5C9ZA 4MYCA 1OCEA 4HNQA 3NGXA 1WZNA 4ZHQA 5LOZA 4LRSB 2W00A 4DVJA 3K6SA 3KZMA 1ADFA 1D2NA 3C7KA 1Y8QB 3MCVA 2VK1A 1HG0A 3OLQA 1COWA 3UA3A 1SVIA 3CEQA 2CLHB 5EUMA 2LW7A 3BMQA 1WUKS 1XX6A 5BRJA 1BVHA 2DFLA 2YZ2A 4QC2A 2V7UA 1PLKA 4BQNA 2C57A 1I14A 1E79A 2ATVA 2JLQA 3PQEA 3G5TA 5EESA 3BK7A 4HH4A 1FXUA 5CDHA 1U4OA 2OAEA 4F96A 2FULA 3L9XA 3IV6A 4C29A 5AQAA 2A14A 1T9BA 2Z95A 3D3JA 3GAAA 3K6RA 4IMPA 4XARA 2J6HA 5ULLA 3ZDZB 4LG1A 4AWAA 3T4UA 4KFTA 5IEBA 3R0VA 1JYFA 2VTEA 1YL6A 3EC1A 1IAVA 2IOQA 2SICE 2WF9A 3Q7IA 4FILA 4MRNA 4B3GA 3K9IA 2OZEA 3E5HA 1OFUX 3V4SA 1Y1QA 1C1DB 1OU4A 3PF9A 4IIUA 5TY0A 5ILOA 2JKVA 5LQSA 1U9IA 4H2DA 4N18A 3RK1A 8LDHA 1C41A 4NF2A 2Z2ZA 5IM4F 1DVRA 1GG2A 5K3FA 1IKND 2AIRA 2IO3C 1KBOA 1PLLA 1SPBS 1TIKA 2MINB 2CFUA 1BHO1 3MHPA 5LUBA 3ASFA 5BY2A 1WXDA 3NDPA 3VDMA 3IKJA 1EFHA 2BFFA 1ZI8A 3LFUA 4E30A 4Y6CA 2OSBA 4EHFA 3J80A 4QICA 4W5WA 1N95A 1W46A 2X6FA 5SYNA 1RIIA 2YJ6A 3HNPA 5ALGA 4Q05A 3GX1A 1U1GA 3WTBA 5AW6A 1MH9A 1J24A 4QRHA 2J08A 4U2FA 1ZNQO 3UTMA 1J90A 1JF8A 1RJFA 3RS4A 7MDHA 4OB6A 3F6BX 3R3XA 2VPPA 1NKTA 2TRSB 3L2OB 4LHXA 1SEPA 3ITDA 3CKMA 4P7KA 1BKSB 3IQXA 4LGVA 3TXMA 2IEDA 5D87A 3L8HA 3KKQA 4EUFA 1KO7A 1PY1A 1CDDA 2JGRA 2XNJA 5CEFA 5INTA 2V0GA 2PRJA 4S1VA 1A72A 1A5BB 1ODCA 1LJ8A 2RB5A 1JYEA 1VBFA 2QUHA 4EY7A 1XZCA 1GD1O 3EULA 3KV3O 4KPYA 5D0QD 1ZUIA 2BTQB 5DHTA 5ARFA 2FWJA 2R7AA 1DX6A 4RH0A 3IQFA 5IDXA 4RTMA 4OP2A 1DRUA 3ZDXB 3OLYA 2XNSA 4X7BA 3AUFA 4LA4A 1WDLA 3DEIA 4M1KA 3VYWA 5BNTA 4YMSA 1O94D 1M8GA 3NHSA 2FLKA 4M89A 1RQRA 5MF6A 3ISTA 3VHXB 1EE9A 2EDCA 2GRRB 3KC2A 3D6JA 4XQ9A 9ATCA 2RK6A 1W6RA 4QYTA 4FE3A 4MQEA 1ZG3A 3EMDA 1YVEI 5CGQB 4ZQHA 4EITA 1U0GA 1E61A 2GZMA 2XD4A 4G81A 1UKCA 3GGJA 3KKEA 3QB2A 4IGFA 3EGVA 4II3A 5JY6A 1GA1A 2BFMA 1XRLA 2RONA 3A6HA 1MEJA 2ADFA 2DQZA 3ZI7A 3NOQA 5IYZA 1Z4NA 5KPDA 2WFLA 5IG2A 2BJHA 4YT4A 1HNNA 2V55B 1UFVA 3AKEA 1YZUA 3FSEA 2VPTA 2W2KB 1W9HA 5I8WA 3ZU6A 5ALSA 2X2PA 3TW4A 2F8LA 3A3NA 1G17A 4CHGA 3LL7A 4MX8A 4R0MA 1A4IA 4L3WA 1B3RA 4XKJA 4F6CA 1EP2B 1BCSA 2ZSUA 1NY5A 3HJTA 3KE9A 3OURA 1DNPA 1V54E 3G9QA 4GX1A 4R8SA 3D54D 1B1CA 4KXWA 4LNGA 4HLUC 3TCXB 4RD2A 4DM4A 5CA0F 4C0XA 4PLZA 1VMEA 4B34A 2ECQA 1RKUA 3W06A 1AQYA 1UOHA 1R0SA 4QQRA 5DGDA 5CR9A 2GROB 4CETA 2Q46A 1E5TA 1L2TA 5IKOA 5CDFE 2PUFA 4NJEB 4ITRC 3TAXA 2C2BA 2ZAOA 3B8HA 1F06A 5DIFA 3ZU2A 5A2GA 1JA1A 1PFWA 5FFMA 1TJ5A 4IX1A 4H27A 5A2QA 1E6CA 3JAKA 5LYYA 3HUUA 3IBSA 3SIWA 5JECA 5JROA 2W2MA 5BV7A 2RAUA 3QYFA 1YS6A 1XQXA 1V25A 3EZ6A 4LBZA 4RGVA 4YJGA 4GX2A 2CXQA 3CR3C 1OHHD 4HDMB 3GLQA 4XI9A 2DHCA 1PJAA 2V96A 2VAXA 3I04A 4U63A 3JQRA 3KVVA 4IIGA 3TNJA 1HDYA 2V9PA 4BP3A 4BRSA 5JAIA 1OLUB 1PV4A 3MJ4A 1NMEA 3GUHA 2EINE 3HB1A 4MR9B 3KP1A 1OKKD 1E8DA 1JSXA 4PN3A 1QIHA 1PD0A 1B2LA 1CD5A 1RLJA 4OV6B 4F1PA 2FOLA 4XX1A 3IKOB 2QKYA 4JJIA 5ENZA 2VDUE 1ZJ6A 3CONA 4PYOA 4P9NA 1E6MA 5KTMA 3DE0X 4TT8A 3I04M 4WV3A 1JP7A 1NJ1A 1O77A 4MRPA 4C78A 2RK4A 4NG4A 5B7NA 1KH2A 2JFFA 2OCPA 5JSQA 1A17A 3A28A 3M81A 4K9PA 5FPQA 2PUTA 2VWHA 2C5GA 2QRZA 4CDGA 5JZSA 3A26A 1TQ6A 3KL4A 3OQJA 2ID7A 1GA4A 1P72A 3WL4A 3IPYA 3I2GA 5DGTA 3G2KA 5FBLB 3FFLA 3PS9A 5JLJA 4I1AA 5KNHD 2HDWA 3HJHA 4JXKA 4MV9A 2ZUTA 2HDHA 4Q9HA 2ZI4A 1M8KA 2QD1A 3QKIA 1FE8A 4UWGA 2VQ3A 3AT1A 3PHIA 1WCYA 1EP9A 3FUUA 4G2VA 4UQXA 4GQIA 1WP4A 4JL8A 4RMGA 4EB8A 2XDWA 5CERB 2BM1A 4AKHA 4M6WA 3KFVA 3EHQA 2B1JA 2ZXFA 5FTNA 4LJ7A 2OCXA 2V5UA 2WXKA 4DUPA 3HSKA 3VOTA 3WYBA 4I2VA 4JU8A 5AI5A 3DO8A 3HRIA 1N4PA 3NT5A 4NENB 3RK4A 3WLKX 4BB0A 4EPTA 2BYTA 4KWCA 1T26A 1DCTA 1XSEA 3OCZA 3AY0A 5JS2A 3MTJA 4HVBA 2JJ1A 2V7EA 1G8HA 3PXEA 3RFXA 4JXZA 3FMOB 4Q1CA 2HA4A 2DULA 2IHZA 1TVCA 1XTBA 2EKLA 1U2PA 2R7LA 4PINA 4RY2A 1VG0B 4DCSA 1E62A 4N39A 1ETUA 3VAZA 3KPUA 4URUR 1XCLA 3Q9NA 1I6KA 3IAEA 1ZAKA 1OZ0A 1Z3CA 2CNOA 2WQZA 4FULA 1VPEA 2PX2A 3PFKA 1UKVY 3QMMA 3ITKA 5AYVA 3SQLA 4G1TA 3S7FA 4E21A 1WLSA 1YJ8A 1OFUA 2E9SA 3KS2A 1WV0A 3GRVA 3PGA1 2AZMA 4UAGA 3W6UA 3WE7A 5K6AC 4LHZA 2G4CA 4CF4A 1TVKB 5JCZA 1WD5A 3GFVA 4CLEA 5AK3A 1Q14A 3KT0A 4BMZA 3TJZA 2PUBA 1CUUA 3B78A 2IFTA 2ZR7A 3LDHA 5ECDA 2C5AA 1W2HA 2ID9A 3CE9A 3SFYA 2XDAA 5AO9A 4GWKA 1PJ2A 3ZGXA 4E3WA 4ANWA 4BO4A 4MUYA 1Y6JA 2G9QA 4Y6RA 2V8OA 4MH0R 3VU1A 1QGUA 1GZ4A 4KVOA 1KJIA 2FPOA 2UZ3A 1G64A 2GF9A 3HCAA 3ETNA 1VE7A 4ZDWA 3BB1A 2Z5VA 2XMZA 1ZIDA 2QN6A 2V4MA 3A58B 3VNAA 3ZNPA 5DDIP 1YZVA 3OESA 2WE7A 3ZHBA 1GKUB 1JDJA 1X87A 4G9EA 2YC2C 3U5TA 5ALXA 1I3CA 5AP9A 1Z0KA 2XVXA 2ZWPA 3ZLUA 1YL5A 2DYSE 3NDBB 4FHCA 4MTLA 2D5LA 1JWAB 2VHEA 4US0R 4BO5A 4Y67A 5JMND 1SU7A 1RLOA 1RLMA 1S89A 1TZBA 3ONKA 3K1ZA 3AZOA 5A5DA 4IRUB 4PBTA 5CB4B 2J9RA 5J5AA 5LU9A 4GDFA 4M1YA 5E1OA 1U7DA 3VUFA 3A4YA 4KXMA 3BE5A 5F3RA 3UM2A 2HQOA 3HBNA 4HDSB 5KYTA 4AMUA 1JIXA 4RPLA 2R2LA 1KIAA 3D3MA 2IP1A 2XA1A 3HEMA 1I4LD 1RXEA 1LFAA 4P31A 5EKDA 1EEXB 1JIQA 2GZSA 1KI2A 1N2OA 2VI5A 3KQHA 1R16A 5BPHA 2G63A 3BREA 5AOCA 3A2LA 3RR2A 3WFJA 5C5EA 1LW6E 3WNZA 2PBZA 1TU3A 2RHLA 3JQAA 4D9KA 2PXAA 3CT4A 2I34A 3DZ8A 1T34A 2C8VA 3VMFA 2ST1A 1YS9A 5ED4A 1XLTA 3U3MA 2E4AA 3G2LA 1E3QA 1QCCA 3BJZA 3H1FA 2NQTA 3U9TA 5IW8A 5EP3A 5B2EA 1A9XA 4L74A 1PRYA 3CLRC 3NBZC 5DLDA 5I7AA 2W98A 3U7QB 3VU3A 5FV4A 4JI3B 4R8MA 3T52A 3JQQA 4EK9A 1EQUA 2NSLA 3SR0A 3A1NA 3ETHA 2X4LA 5ALFA 5KSPA 2P6UA 4TS9A 3ZDDA 1L4LA 5DLQC 4B4KA 4EZEA 1YIOA 4A0HA 1D9SA 1MGOA 1BU9A 5KC9A 3HKCA 1JKJB 3GGSA 3OA0A 4AY2A 3SBDA 3FP3A 5GAJA 3HFJA 3KZ1E 3KDAA 5FI3A 1WXQA 3AU4A 3FRIA 4PO8A 1BC5A 1NT4A 4Y8VA 4BVHA 1EVIA 3K9GA 5B64A 3EB9A 1B14A 5EL0A 3QWIA 3OBBA 3UWSA 4FE7A 5TGDA 4FN4A 3FU3A 3C8MA 4LZZA 1CY0A 1T6BY 1KZGB 2R17C 3VFDA 4WBNF 5GZ1A 4DUYB 3PVLA 1SXIA 2OKCA 3CT6A 1VCIA 5ES3A 1DCFA 1PS9A 3RAJA 1EFRD 1NQ5A 3HGQA 3I32A 4FGJA 4JW1A 1Z16A 2L6BA 2C00A 2XYHA 2J3LA 2Z6AA 2ZISA 3KOWA 3ZLBA 3QF4B 4QOJA 3D64A 4H15A 1CQZA 3QIVA 3TGPA 2WICA 4LCBA 4QIHA 2ET6A 1GV0A 1OLUA 1A9ZA 1EG2A 4MIEA 2A4MA 3L7IA 1F14A 1XYGA 1L1FA 2VQ6A 2OVFA 4XGQA 1NZJA 1VC2A 3K7EA 1DLIA 1GQYA 1QXSA 3L0PA 5LXTF 4NQRA 4AM9A 4F91B 3P26A 3WAGA 4DWOA 3UAXA 3WQHA 2CHEA 3FGOA 1U6IA 4Z9FA 4YMIA 5F1KA 1Z82A 4G5QA 4BKQA 2RKKA 3GROA 1N5KA 2QJTA 3K16A 4Y9DA 3PC4A 3KTDA 3UC9A 1G60A 3VISA 1EWQA 1UWVA 2VYNA 3OEWA 5EJEA 4DX5D 3C3OA 1X7YA 4GTOA 5K45A 3S6JA 4RWZA 3F6EX 3HCEA 4UBNA 3EN0A 1JLLA 5CGZA 2ODWA 3E0XA 1JCQA 4QA9A 3Q1LA 2CK3A 2RH9B 4PQYA 4IEEA 3P96A 1NYQA 1W0JD 3EA4A 3PNOA 4H16A 1E9DA 1IE3A 1RMTA 3CLTC 5HVNA 3UTDA 2C2MA 3PYXA 3DGFC 1ZVQA 3MBOA 2AW6A 1P74A 1SWVA 2VH2A 3S2AA 1YBFA 1ZPDA 4W8GA 3MG9A 5F5LA 5HF6A 3OF2A 3KAJA 4QQ8A 3W3ZB 2DZOA 1GLGA 4BNUA 1M8JA 4MR8B 4BFZA 3W5UA 1HF8A 3BAFA 5E3HA 3O8LA 1PU2A 3LPZA 4RETA 2Z6UA 3B60A 4MBGA 3LIIA 4PC3A 4A6XA 2X9LA 5LN1A 3ZW3A 1FDSA 3L1IA 5DPMA 3BGIA 4N12A 3WHLA 3Q2OA 1RYFA 3CG0A 3IAM1 3OQMA 3PIDA 1KOFA 1F2TB 1F6BA 3IOBA 2BISA 4EBAG 1R37A 2BF7A 3C3BA 4GPIB 3RJ5A 1KDPA 3C3YA 2AB0A 1P2VA 4RM2A 2FCAA 3ANYB 2EWMA 2W0SA 2YYAA 3NHPA 4JB8P 4WDQA 1V47A 4FMDF 1I24A 1MMFB 2GJ4A 3IDSA 3KG2A 1B41A 2FWAA 3RTDA 1MV8A 3VGJA 5IF3A 1Q7BA 2G7ZA 3JD4A 3CWCA 3BL5A 1N11A 5JAZA 1FQWA 4FOSA 4QTTB 2XUKA 3PC8C 1PC2A 5BNFA 1XHEA 3VR5D 2PQNA 2B98A 4LRZA 1TJPB 4LJSA 1D4AA 4M8LA 3SMQA 3ZYKA 3KXKA 5AVUA 1PX0A 5DHPA 2PQRA 4WNYA 3TJRA 3VHQA 3HEBA 4K0RA 1G9SA 1PJBA 1Z2NX 3NVAA 5JISA 3GCXA 4L95C 3ZD8A 2YRWA 4GUAA 4UWFA 4A6DA 4BFXA 4ZQFA 4ASUD 3FU6A 1NVWQ 4MMXB 1WIWA 2NZ8A 3E27A 1NNEA 3RHTA 5K2OA 1N52A 2B25A 1T4MA 3FJYA 5ECWA 2W90A 2GQ0A 2NZYA 4OH7A 5JRJA 4RG9A 5EKXA 2MOKA 4JVSA 1J8QA 1K86A 1WDMA 1M0WA 1OF1A 1U1FA 2NNWB 2OD2A 1GQSA 3A1EA 2Z2YA 2CFTA 1TRKA 1L7DA 2ZBQA 1I4WA 3NYRA 1T35A 3U4CA 3DBLB 4XWWA 4C7XA 1YHNA 1O8CA 1DEHA 1QZUA 3BS4A 4LJ9A 2AMLA 5BW4A 4UNIA 2C83A 2JGJA 3BMNA 4AY6A 4U6NA 2IHVA 5CA0A 4BCBA 5KWJA 2WD7A 1Z6GA 2P2YA 2HSDA 3EWAA 1HMPA 3PD7A 2G1AA 2NO6A 3ABIA 4HS2A 1Y1RA 5SY4A 1JR6A 2WZCA 3NU1A 3U9SA 3H86A 2YXNA 3BFXA 3GUYA 1EHIA 3NWEA 2BEDA 5BUSA 1B1AA 1IXKA 2AVPA 1QP4A 1HLPA 2B0CA 1RE0A 4KQIA 2Y1FA 1H2ZA 3JD2A 4ND3A 1X7XB 1PHRA 1XZPA 3AP3A 1CPYA 3EZXA 3L8GA 4G07A 2BMDA 3GD5A 3GNQA 4OEHA 5DYNA 2IV3A 3VBEA 2JVKA 4RPJA 1QS0A 3T1OA 3DMTA 5HUHA 1WXGA 4MCIA 4BUCA 2XKBA 1T3TA 2ACWA 2CV1A 2BVNA 4K6GA 3APCA 2YXDA 3NH6A 3PT9A 1D04A 5PNTA 4ZHQF 1NSFA 5TV2A 3VO9A 2O3UA 4OQPA 1JX6A 2FPLA 3QVXA 4TV8B 2FA9A 4FZVA 2AE1A 4RIFA 3GMSA 4CBVA 2C5FA 3SC6A 3RWBA 1GADO 1K4YA 1HQCA 3V3KA 3H4MA 4C3OB 3H9JA 2B7BA 3W5BA 3NHYA 2A9PA 1VLZA 2HMUA 2Q7FA 3CLUD 3Q3CA 4FHDA 4KH1A 4TRMA 9MHTA 4OLJA 4EPXA 1KU0A 4B7AA 3WK8A 4ESEA 3DLCA 9GPBA 3Q72A 3KHUA 1RPJA 3Q5EA 3QVKA 1PIWA 2FZ5A 1B0AA 4KEAA 3FUMA 4MO9A 3AZPA 4KWTA 4CMIA 1GPKA 2JGDB 4OGLA 1NDHA 4CGZA 2RK3A 2DWQA 1IDOA 3PEUA 5CFQA 1PR5A 2D74A 2NPOA 4FWBA 5BN3A 2XH8A 3QJYA 2XKJE 1OE0A 1NVBA 1T5TA 2GRLA 1VE6A 1T5BA 1ZMXA 1MIOA 3LXRA 3NAGA 5LKAA 5EQJB 3CIOA 4YMVA 2QRKA 1KMHB 3O3MB 3PGMA 2X7XA 1H2BA 3PRYA 4G9GA 4B0PA 4BJHB 6AT1A 1EFRA 2KXPC 1ODSA 5JPIA 3JVVA 2UXDB 3R24A 1JZQA 4IXNA 3L13A 1E2NA 1S7GA 3OF3A 5DCWA 4KNYA 4L8WB 2XB9A 1MVNA 2M1XA 3I8SA 4LYEA 3P9CA 4KO2S 5DN9A 3SOPA 3TTVA 3AFNA 1W5TA 3D7NA 4PTLA 5CD1A 2B8WA 3H7AA 4RGQA 2QY9A 2PS3A 4RV4A 3T7DA 3TO5A 4F45A 2QAGB 1K8YB 2MHCA 2NNLD 2ODTX 2QW8A 3KKZA 4XTCS 5BSTA 2FG5A 5LZ5A 3VDNB 2ZBEA 5K8VA 4Z3DA 3JYHA 2WHYA 2QY6A 3T5MA 5HOEA 2L69A 3VR5A 2Y1LA 3UJ6A 3WL6A 4ZIRB 3OFJA 2X15A 2MSWA 3GJ5A 2PAAA 4MPRA 1CU1A 2ZSDA 1TN7A 1L4KA 1I9GA 1TEHA 4FTWA 5BSRA 3R7AA 1HYQA 3NC4A 4FYHA 4BQQA 1YB7A 3O8DA 4E46A 1EUQA 5F51A 3A9SA 3QLVA 3CVPA 3MT7A 5BR1A 1AJEA 1UFKA 1ZU5A 2D1FA 3E1GA 4F12A 3QP9A 1X1TA 4RLYA 1Q11A 5EE3A 3QVLA 3WJ2A 3VR4D 4ILEA 5FTKA 1TECE 3DNPA 1PWXA 3QVVA 4PLYA 2PUCA 1NVKA 3OIYA 2PO7A 4ABYA 2J0QA 2ETAA 2I8LA 3TSWA 1E2MA 1J2TA 3JRNA 2UVDA 1SQFA 3FAZA 4QPJC 2QSZA 4EA7A 1GPJA 4YMTA 1JLHA 3GU3A 4HWOA 5UKDA 1SG6A 2CNBA 3NBXX 4L5IA 1SKUA 4WOJA 3LY5A 1KC1A 2GO1A 1L5YA 2GZ1A 2IHTA 4WXHA 5EQDA 2UDPA 2XKKA 2L18A 5D01A 1ZIPA 1CY1A 4RHYA 3ND8A 4AF7A 1CHDA 1Z5NA 3DCJA 4BSZB 1BAPA 3IAUA 4KHZA 2QLNA 1DXQA 2PKCA 3U13A 1D1QA 4GP7A 4D4MA 3B1KA 4C6SA 3A4IA 2R84A 1AKUA 2NQ2C 1Y5IA 2QVBA 3ACDA 4OQQA 2HBRA 2IYZA 1N2JA 3ZGYA 1H6DA 3DOCA 2QBYA 2PRZA 1RI3A 1Y48E 1ZN9A 4QYXA 2JFOA 3UUWA 2AZXA 2H4FA 2NAPA 2AZTA 1XZQA 2QIOA 1ZUWA 1JTFA 1LXCA 1AQIA 3HVUA 3EWNA 3PQDA 4G0MA 3ZWPA 2BUGA 3CU5A 4PIMA 1E5LA 4C4OA 4COOA 2V74B 3H9BA 2AN3A 1QGZA 3S2IA 1DQZA 3STUA 5KKCA 3GDWA 1ODFA 1Y4SA 5M7EA 2XTNA 3GB9A 2QTHA 1PL8A 3PA6A 5IUKC 5BYAA 3TAHA 1WHTA 1JEYB 1EP1B 1BDIA 4F2WA 5EXTA 3R8XA 2IVZA 2MYTA 5F9MA 5JMPA 3EIQC 2MDTA 3ORSA 2D2XA 3PVCA 1B0PA 1PEKE 2FHSA 1N77A 5DIZA 1IXSB 2R6DA 1YS2X 3P32A 3LPNA 2Z83A 3RJVA 2E3JA 3R9AB 3A2MA 4LNAA 3L84A 3CHPA 2EWVA 1WTAA 3AU8A 4XCXA 1PTJC 1ZCAA 1VBKA 2P7IA 3DHWC 1MRNA 4HRYA 4Y2HA 5K0TA 1JHQA 4CT0A 3O2JA 4EL5A 5HIKA 3N2LA 1MO5A 4CUJA 4F1SA 4M36A 4U9UA 4EPVA 3NYWA 2BOVA 3ZYZA 3CH7A 3P2OA 1YVUA 4IIJF 3SQXA 3AVUA 2YV2A 3NUZA 2H6GA 4I1YA 4MVXA 3AF3A 2A5YB 5H0IA 4B7UA 1YK1A 3ABQB 1CUGA 1JEOA 5HIJA 2H1OA 4W1SA 4HTFA 4UAVA 3E2IA 2ZU6B 1XAHA 1LV8A 3NFYA 3T0GA 4AN4A 1KEEA 3NCTA 5IS2A 1W44A 3OKCA 2UYGA 5BV2P 1M0SA 1WP9A 3IGFA 4RPCA 1BA2A 3HPRA 1XDDA 1BA3A 2ZYHA 2Z8ZA 4FYMA 2A5FA 2RH8A 3CZAA 3MJTA 4FOTA 4HZIA 4MS1B 2C4WA 5NLLA 2CL7X 2ILRA 1B76A 1Q0SA 4QFVA 1XNGA 2IOFA 3ESYA 4FINA 4GMDA 1S1CA 2RI1A 1V3QE 3U37A 1KQ3A 5KOJA 3ZV6A 3WHIA 3NKVA 3GYZA 4FGZA 4CTOA 1FDRA 4JHXA 4EHAA 1ZSNA 1CK4A 1PR6A 2CXRA 4KVMA 3GW8A 5GWXA 3LC0A 4BKRA 4U0UA 3P19A 5HKKA 5HRCA 1BIFA 1N94A 2C0LA 1O9HA 4JC8A 2KQUA 3T61A 3NBUA 5L7WA 4FU3A 2GTPA 1XTPA 2YJTD 2BM8A 3L1UA 4HDMA 1CEEA 3FUDA 1QOZA 2A84A 2HNBA 1UODA 1Q92A 2P0AA 2Q4DA 2XF2A 2J5RA 4LXQA 4TYPA 4Y9UA 1KIFA 3SMVA 2WAYA 1K3UB 5KJ6A 1ZGHA 2HU2A 3M9XA 2ZM5A 1HDEA 5AOAA 3ZHCA 2IXDA 4JKOA 4BO7A 3W78A 1NVTA 2I67A 4KN5A 1QPGA 4U96D 3I9V6 4D4GA 4TN5A 1YK0A 3C14C 1CJCA 2DQSA 1RI1A 5L3QB 4JHKA 1KZHA 3UMJA 1QO0D 5LFAA 2IT1A 1Q0ZA 2QTLA 2FK8A 3TWXA 2O14A 1K7XB 2P9YA 4TLDA 1C0KA 1QIIA 4UULA 5K0LA 4LZAA 2PXCA 5BR4A 5L3SA 3GBSA 2PFKA 1KQNA 1TTPB 1FFDA 1ORIA 3FUXA 1G2OA 2HLPA 2NU9A 1CQJB 3BDAA 2C1ZA 2GAJA 1J0XO 2I6TA 3EHEA 5AI9A 1ZR4A 3NCHA 1E9SA 3EFHA 1Y34E 3C7DB 3GYBA 1TIPA 3Q7QA 1EYZA 1ODTC 4XCQA 1AS3A 2R6GA 4I5FA 4M3NA 4L5AA 2WKRA 3AR4A 3A32A 4G8CA 3A2KA 4KHPB 3F98A 3I1YA 1WF3A 4I9NA 3TWOA 4M0MA 2EV9A 1XHFA 2P0EA 3WNDA 1SUWA 3QXHA 3IBEA 2AR9A 4O4IA 3CVLA 3RT7A 1CB7A 3O7MA 2XT0A 2CNWD 3G7UA 3TG5A 3M6XA 1YBMA 2MR5A 2BSAA 5G4LA 2OHFA 3WISA 3UICA 1HTBA 3KT6A 4GECA 3P9PA 2DY1A 4JODA 4WHMA 5KJMA 1SZJG 2JI8A 3D2LA 2PKWA 1CY7A 3P2IA 2QYUA 4JHJA 1L5SA 2Y2VA 1U0EA 5DBFA 5A6SB 2WJ3A 2DPYA 3D81A 4ND7A 3REFA 1U8UA 1FVXA 5LP6A 4QT4A 4PXAA 4DV6B 4LYJA 1Q0RA 1XCOA 2VDLB 1XVIA 5LD2B 2IDKA 2PUDA 2GEUA 3T0FA 3AS8A 4ME6A 2WRZA 4Q9JA 2J3IA 4ENRA 1OI7A 1FFBA 3N2ZB 4OXQA 3RSGA 4OVUA 4PGGA 5C81A 1PG5A 2YKGA 4G5YA 1PUIA 2AC2A 1U0OC 1QE3A 4TMKA 3DZDA 3ZHOA 2B7LA 3CLSD 4MDHA 5EY5B 4OFWA 2YIMA 4DV0B 5DLYA 4GPMA 5K3EA 4OQDA 3VH3A 3DOUA 1IAQA 1KEEB 1ORRA 5L4NA 5LL6P 2BD0A 3IHVA 1WNTA 3UIOC 1U1DA 1EWYA 1JMVA 2C9ZA 3FLBA 3GF4A 4WK4B 4YRDA 1VSBA 4MKTA 2QZPA 3HM9A 4I4TF 5HNKA 3AR2A 1OHHA 2RHJA 2M6SA 3D1JA 1Q3KA 3OEED 1FFEA 1MNAA 2Q50A 3UV7A 1M6VA 3ZBUA 4ZV4A 1D2GA 4OAUC 1UAYA 3SEZA 1G20B 4INOA 5FR1A 2XOKD 3LLUA 3NX4A 2VJMA 1O1TA 1OY3D 3PNLB 1MC5A 4W7SA 4WZAA 3TZQA 3G1WA 5EIEA 2AE2A 4G86A 5IF9A 1YE3A 2CXXA 2DY0A 3AY3A 4HNRA 3W05A 2R9VA 5H3LA 3SC2B 5JO0A 2COEA 4HB0A 5CLQA 2VHCA 2R6FA 4CIDA 3MNFA 2ZPAA 2RD0A 3E03A 2HRZA 2ZE8A 1IDN1 3RS0A 3G2JA 1GG5A 1NUSA 2FMIA 4ZHBA 1MQSA 2N3ZA 5TC4A 2WXRA 4YXFA 1XE3A 4I46A 3CKYA 4YWHA 1V5WA 1VKRA 1P5ZB 4QRIA 4B73A 1M2GA 4BZPA 3WWCA 1NF8A 4YV7A 5BVGB 2NOAA 2X6KA 3RV3A 3LP6A 1MDBA 4UE6A 1BRMA 4I08A 4B82A 5SZJA 2XQ0A 4FLHA 4O0MA 4QYIB 4QTYA 1MIOB 4PYNA 4A55A 1HEUA 1C2TA 1AK2A 3OOEA 4PC2A 4WKPA 4DLVA 1KMCA 3E3MA 4EA9A 2OZPA 4J7UA 3V7WA 4MYTA 4EDHA 3QITA 4GI5A 3EWSA 1ULAA 2O9JA 4QQKA 3IFSA 1RQPA 2I1LA 2QP9X 3E7PA 1ULTA 1TKCA 1IXRC 4HS4A 4JP1A 2BGWA 4CEIB 5F76A 4BQEA 2RSLA 4DA8A 1LFDB 3SLGA 4ODIA 3V3TA 4ZI3A 4ZD6A 2GYVA 3NF1A 4ZZ2A 5IEJA 2GKSA 3JQ9C 3OZGA 4F6RD 4PX5A 3QNKA 2BPOA 3TVDA 4UCFA 4KLNA 5JDIC 5JSZB 2A88A 2ZRPA 3FTFA 3SXPA 1TVEA 1SQGA 3CHQA 1OYOA 2VHTA 4QM7A 5A4DA 2FSUA 3FLMA 1AUVA 1RBZA 3IDZA 4WLNA 4NFSA 4DJAA 3BDIA 2EGGA 1Y0BA 5BVHB 4EP1A 1R8QA 2R00C 1MB4A 4PG8A 1GCGA 3BSYA 2XMSA 3NHBA 3Q3EA 3QLTA 4KV9A 1KS2A 1P91A 4NOMA 3V97A 4E1AA 3P2KA 4U7DA 5THKA 4ZQIA 4FYKA 3A11A 3Q7TA 3ICQB 4NK5A 3BUAA 1J42A 2C5EA 1KDYA 4A1OA 1F20A 3R1IA 3AB3A 4E13A 4CKBB 721PA 5AW7A 5IMBA 4LY6A 3NWBA 3V8VA 5JV5A 4PHFA 4RPHA 2JARA 1V3VA 2X3FA 2CXUA 1K89A 3BXEA 3OE1A 3SY8A 5B3SE 3KCNA 4KMMA 4KXLA 4O4JB 1UBMS 3JQFC 1HG5A 3LVFO 4X1IB 4UU7A 1PR1A 4OIMA 1KBQA 4N65A 4OVVA 4X20A 4YR9A 3H7IA 4M0CA 4DUGA 5KJ1A 4WY8A 4QJBA 5D3QA 3I9LA 3ZDRA 1N8NA 2PZBA 4DEYA 5GIPE 1MN6A 1JR3E 1DAEA 1YR1A 2B78A 5GGXA 2VTVA 2XOKA 4LXYA 3DBHB 3FWZA 5FTMA 1L5WA 1T1GA 4QLAA 4CV3A 5B1IA 2FZKA 4EVQA 1H9BA 4KWEA 4CM4A 5EP4A 1CX9B 2LIPA 2A9RA 1UDRA 1ZRHA 3L40A 4WUTA 5DULA 4BUZA 2AT1A 3N0XA 4FZRA 4YUYA 1U28A 4Z4EA 3DV0A 3RS9A 2FR8C 1KH1A 1WABA 3N5CA 1SIUA 3QVUA 4UWKA 4DX1A 1W1WA 4EZKA 1BROA 3AYZB 4PG5A 3ZWYA 3FCSB 3UBTA 2JI6A 3HHEA 5G3YA 1SVNA 2WF5A 3OQIB 1E18A 3FWVA 4RTPA 3UB2A 4CODB 2CJPA 3FTVA 2BGJA 4LVOA 2X38A 2FI1A 2GT1A 2L2QA 3DZJA 5AWFC 3TL6A 3OAWA 2IYAA 3UJ3X 2YVQA 4OH1A 1R3DA 2QX8A 4DTIA 4BEPA 1N7HA 2Y1GA 4RSHA 4OAQA 3RSFA 1XYYA 4CLXA 1Z63A 3R7DA 1A77A 3F6YA 3CO5A 2JAHA 4UVDA 4FFMA 1U3GA 2LVBA 5M5BA 2AN9A 1RWQA 4LJLA 5IK2D 5TEVA 1M6NA 1UDCA 2QTVB 4WW0A 3OEYA 2O7QA 4UMVA 5FBQB 1G8KA 1CJSA 3D9MA 1E0KA 2YOHA 3SNHA 3D9OA 3C2QA 2CE7A 4DSZA 4NTZA 5EJFA 1NA5A 3I53A 3MBIA 2X42A 1NAIA 4Y1RB 3OAAD 3ZYQA 2DECA 1P0PA 2A5UA 4L9PA 1H6CA 2XGSA 1L4UA 3AVOA 2A86A 2V6BA 3CVJA 3OIDA 4P3OA 4D6PA 4D4JA 5LDHA 1XZ8A 1UN9A 4J1TC 4UU1A 4B3BA 2M6KA 1MTZA 4Q1VA 4CM9D 2Y0DA 5AW8A 2Q5LA 1R8SA 4LNUB 4RKQA 4TMWA 3TLBA 4RG6A 2YWRA 5EZYB 3DMTC 3IA7A 2HU5A 4MWEA 4UNQA 3KTAB 4NY1A 7ABPA 4FMCF 5HQTA 1QGYA 1B0ZA 1TUGA 1TPZA 4UDYX 4RTJA 1X9GA 2ECPA 3WIUA 2IYNA 3PRJA 3V7NA 4EA8A 2ZJ7A 4IH1A 1UAGA 1VZ2A 1CJKC 4G1VA 4HC4A 3VPSA 5FBZA 4DIBA 2HWYA 4Z7NB 3O1LA 4AW9A 5IULC 1I2CA 4BNDB 1ZH8A 3FOWA 2C61A 5ALIA 5T67A 2P3OA 5LQMA 3FPFA 5KIAA 1NA0A 2BW0A 2Q2QA 1EUZA 1UBOS 1P5RA 3ITNA 2HM7A 3AIMA 3KEOA 2ZVJA 1THTA 4HQDA 4J0FA 1QH1A 2V4UA 3AFMA 3OAAA 1O8BA 2P9FA 3AV3A 3WDMA 1UKZA 3MV2B 1JWGA 3CNHA 3I6IA 3DE3X 3HR8A 2ONJA 3CF0A 4PFSA 4BWYA 4PIVA 4MJXA 1LD8A 3RO2A 2PH7A 3MW8A 3MYYA 5JS8A 4DUZB 3ZN3A 2D1SA 3LGSA 2RHBA 3WLOA 4F3TA 2ZVDA 4JLAA 5BSUA 1HQYE 1LSJA 1B15A 4GD3Q 3W8DA 4I55A 2HGZA 3B20A 1FDVA 3F90A 4XR9A 2HR2A 1RAGA 3RK0A 2JCVA 2QEQA 2QR2A 2HJHA 4EUSA 1ZISA 4UHDA 5LU8A 1N4SA 4J90A 4ZTUB 4XE0A 1HETA 1YONA 3KB1A 2EJTA 4XUCA 1IBSA 1E1MA 5HCNA 4O2AB 1JUQA 1RABA 4HEA1 4TTIA 4JEHA 5AVRA 1CTQA 3WWDA 1ECLA 2K2WA 1AKMA 2Q4EA 2VRWA 4Q7KA 3DLIA 4MULA 3WZ2A 4I1MA 2DPHA 5DK6A 5BNWA 3N0WA 3G2UA 4IOMA 2EP5A 5TRTA 3HIZA 3SC4A 2GEBA 4BBPA 5E1DA 3M1LA 2CV2A 4CI9A 2AEEA 2OQVA 3Q79A 3IXEA 3P7MA 4MKZA 1M9NA 2B37A 2O5EA 2C9MA 2GAFA 1NLYA 3HZOA 1ZEMA 3RHSA 3K2IA 3M5PA 2HV9A 1D8DA 2XMPA 3TRKA 1DEAA 3D2CA 1V8OA 5M3BA 5B1YA 3E9DA 3BU8A 3E9QA 1UEXC 2JEOA 2OILA 1DQPA 4PQRA 1DDOA 1NC1A 1S96A 1CY8A 1DC7A 1HXIA 1QYXA 2CJWA 2BEJA 3JZAA 3N70A 3QBVA 4KGDA 2WU4A 3TG8A 3LT5A 1MPTA 4BAGA 1EE2A 4IZOA 1EVJA 2YMQA 1F4LA 2IUEA 4X3PA 4OLBA 5EWMB 4EI2A 4ZPJA 5JSUA 1GTRA 1RHMA 3U61B 2P9IG 1N8SA 1OBOA 4AJ1A 1QHGA 4RDIA 2B82A 1U7PA 1BDJA 4UHHA 4YMLA 5IKPA 3D1VA 3IH5A 1T25A 1GPLA 4G24A 3JQ7A 4KQCA 4DCPA 3V8EA 2MWMA 3IMFA 1NVEA 3LM8A 3NP7A 3KSMA 4JVNA 5K2MA 4B33A 1CHNA 4FA6A 1Z5UA 2OD9A 3E3LA 4KW7A 4AIIA 1TNZA 1ZH4A 4WBSA 3OJFA 2Z0MA 1HEIA 3TNLA 4MVJM 4NZPA 4KOEC 3ZOKA 3AMVA 4M21A 4WQMA 4DYDA 3U62A 4HRNA 3CLKA 1Z2AA 4D9IA 1QCZA 2OAQ1 3FUNA 3TIFA 5LBUA 3UGTA 5IFLA 4UNRA 1I0LA 1JHDA 3V8MA 1JDBC 4EG7A 5JXIA 2FFBA 1ITZA 2WP0A 3NASA 5KSZA 1ISRA 4RD0A 4ZGGA 5F7OA 4IRUA 2Z4TA 1Z4MA 2SCUB 3VTKA 2YWXA 3WLNA 4XZ4A 1E58A 1EHYA 3N74A 4XX0A 3QLUA 3MKQB 4R1LA 3SCZA 2CZQA 4J8PA 3SVLA 2YHIA 2ZKIA 4FGUA 3HV2A 2ZSAA 3CEJA 4YDHB 5ERYA 3GRZA 2QTVA 4YJDA 3LO5A 5DCYA 1NL4A 1RKXA 3TDMA 3BB3A 3JSXA 4PZEA 2QV0A 2WFAA 5IN4A 1WSAA 3GJ6A 2V0NA 4ZOLA 2PYDA 2LD4A 2R60A 4L5CA 3UJDA 2C77A 1KRHA 4FBGA 1GZ5A 3DYBA 3HB0A 4PLGA 3IT1A 4D79A 1A4UA 2ROQA 3FM9A 1VI2A 1Y7PA 3CK7A 1TEVA 4FP7A 4POAA 2ZUBA 4ZJUA 2HK9A 4U9IS 4I8IA 5KNCA 3THXB 2YNMC 5A4IS 3A1FA 3QWHA 5AJXA 3U6BA 3WGUA 1ZHFA 4FLBA 2ODQA 4KU4A 4URKA 1DLJA 2PX4A 3QLJA 1EJ0A 1I3OA 1ZOOA 4QPPA 1FMCA 4ZZ1A 3VZQA 5EYPF 1GZVA 1XFDA 2QN7A 4HDCA 2R2GA 3CJTA 3PNTB 3EG9B 2XAUA 3OWHA 4HMPA 5GONB 5KTSA 4AP2A 5TPZA 4FNMA 4C2UA 1UT8A 4XGKA 1AHNA 1SD1A 4Q66C 5TSDA 2B1IA 4A2CA 1IHPA 5AR1A 5HCIA 3D3NA 3FLAA 2LWIA 2WJGA 5E2BA 1EVLA 3DVAA 4CR7A 1O6FA 4ICIA 1FUYB 1P4GA 1T3SA 3ESQA 4CV1A 4PPQA 3N6RA 1YDGA 1DC4A 2ZB3A 3EH1A 3BBPA 3GLVA 4N82A 5A0FA 1HNWB 4ZJPA 2ZJ8A 4ZVMA 3L6EA 5BQ5A 4CU2A 1EYHA 1JPJA 2J4BA 1QORA 4QVIA 3SEQA 3DSWA 3IQWA 3W2GA 1XMQB 3B38A 1G3NB 1N2CB 2X1MA 3NXKA 4OSOA 2XD9A 3HA7A 3SQNA 5HDQA 4F71A 2CLOB 1OVGA 2CKMA 3R5HA 3QEMB 5DN6A 2GH1A 5C18A 2XCLA 4UAUA 1XD8A 1YOVB 2QX9A 4GSLA 1T8UA 4C21A 4AYWA 1J5XA 4FHFA 4TQGA 2G28A 3QARA 2BE7A 1ISHA 1TJ3A 3DBSA 1LTKA 1N4DA 4ME2A 1GP2A 2A9VA 2BEVA 4WTOA 4AL4A 1PLJA 5JNWA 2QI9F 5FPPA 4J75A 2IYWA 3DZGA 4AJHA 1UUFA 3L06A 2GRPB 2FQXA 4HMOA 1R12A 2JRCA 1GY8A 1TGYA 1U9YA 3F49S 1M2EA 4RKWA 4XDZA 4DG5A 1XJWA 5FLXA 4QQNA 1SXJA 3J5PA 3C3QA 4MRMB 2O4CA 4Y1FA 1ULZA 1OYWA 2E6UX 2ZP1A 3CLHA 4ND8B 4OYHA 4QULA 4DC1A 1B43A 2HQSA 4BNNA 4DV3B 2E5WA 3E9CA 1NAHA 3CZRA 2TMKA 1XCMA 3KWJA 3W9YA 3D0QA 3QKSB 1URPA 2BELA 5ALLA 4EJSB 2I6GA 1VA4A 2HX1A 4XSHA 3KO8A 2QZSA 3KPJA 4WXYB 1EUDB 2AR7A 2I4RA 4LECA 4EX7A 4EZBA 4TL6A 5EPUA 5AVVA 3PEWA 1ZOIA 1G21B 4ZMSA 1H4TA 2I2AA 1D8AA 3MT9A 4G0NA 4G36A 1PT5A 4KXXA 3NAWA 4PRLA 1EM8A 5FEUA 3NUGA 4QHSA 4CQNA 2H1CA 2ZTSA 4DPMA 4ENPA 3ZW8A 3THSA 4X6YA 3SF4A 1W581 1YKSA 3TE7A 4CM8B 2OO3A 4IDFA 3O83A 1LDGA 5H81A 4GCNA 1KYQA 4HAVA 1TA9A 3G2SA 3QXSA 1Y3DE 3VDRA 3UAWA 4ZO6A 2P2CA 5REQA 2OGSA 1KQFA 3C5CA 3Q15A 4YGXB 2YHEA 1CDOA 2Y0EA 4Y2UA 5JXWA 3T9AA 4ZOLB 3PH0C 4ZCQA 5BYJA 4D3YA 2CUTA 1EWTA 1KYYA 4IEIA 4G85A 4MP8A 1EU1A 1MB2A 1E8WA 1QVAA 5LBTA 4AECA 3PZ3A 4E22A 1C2YA 2OFOA 4Y9SA 1JI3A 3K0CC 3GZSA 3U4DA 4KN8A 2BKUA 1LPBB 4NMWA 5HF5A 1N0VC 4IHJB 4J0DA 4BDTA 2B5OA 1L5KA 1LEHA 3SQDA 1RXIA 3FGPA 4DDTA 4QUHA 3R5SA 1CZRA 3QX8A 3HK2A 1H0HA 1N5DA 4XOUA 2C1EA 4PYKA 4KR2A 1IZ0A 4UM7A 2VHUA 3VHLB 1P5QA 5HF9A 2HRQA 3BKXA 2IXGA 3DVLA 4JA2A 2ZCUA 4LC9A 1GLVA 1A8QA 5AVOA 4PYMA 3VTAA 4ZVOA 1I0IA 2WHEA 2ZWOA 3JVIA 3Q88A 4X45A 5DMXA 3BWBA 5HEKA 2R6R1 3KCQA 3AEYA 1M2OB 5HM6A 5B1SA 2IY8A 4K86A 4U2GA 2WG1A 2K4MA 3KJHA 2GAIA 3HNOA 3QMVA 1NJ5A 3CEHA 4L7QA 4HAOA 2J9ZB 2X0IA 3GRAA 4H3SA 4L08A 1E2EA 1HPLA 2JA2A 4TL8A 4W7IA 2HPHA 5DXJA 5HK8A 3QELB 3KAEA 1RWKA 1T1SA 3PEYA 4RK0A 3LHIA 1A97A 3UOWA 5J47A 4AZVA 3DUFB 3B1FA 3EQ8A 3AUYA 1Y1LA 5D5PA 1Z4PX 5JWOA 1AX9A 1UT5A 3S5UA 1R0WA 3CZCA 4PFJA 3HKCB 3M6WA 1OX6A 1QV6A 2R62A 1LZKA 1B6SA 2G4LA 2HIGA 3VR2A 1IHBA 3PXUA 3KYJB 4IMJB 2QYJA 1MX2A 5HUQA 5ESDA 3CEPB 2Y1LE 3ZWCA 5MFPA 3QDNA 2EERA 4JQCA 3R7WB 1QVWA 1W85A 4TMVA 5P21A 1HFAA 4D92A 3A25A 1GTL1 4B2IA 4CZ2D 5ELXA 1U0BB 3NANA 13PKA 1MRZA 4FOOA 2WTMA 3MJVA 3W9GA 2V6FA 3O8NA 4J7XA 4AY4A 1G59A 1Z13A 4KDFA 1EVZA 4MRRA 4YQFA 2XB2A 3VOSA 2ZS8A 3PCTA 4PWZA 5EZ6B 2OUIA 2RJ3A 1IZ9A 4TGLA 1LKZA 1Z17A 2YWFA 1XLTC 3PC7A 3WTCA 1ZM2A 2ZI6A 1QLHA 4HNHA 3G13A 3LDUA 1VRCA 3KJNA 3WDLA 3B70A 1L4BA 2DPMA 2VC2B 4IO0A 4TSKA 1A98A 3R7LA 4NCHA 1VPLA 1W4CA 4P58A 4G5HA 2EXXA 3A6JA 2VUUA 3GJ3A 1FRZA 3H1TA 1D2EA 4ID3A 3AV0B 4M87A 4Q5IA 1P62B 3H05A 2IPMA 1EXVA 2DCMA 3R9XA 2PX0A 3EY4A 1V8PA 1NN5A 5BSFA 1RXVA 1FRVA 5FUYA 3ZUPA 3HKEB 3O8QA 2IZ7A 1DO0A 1H1TA 1ILWA 2V97A 1ZKDA 3JYLA 4H1HA 4N6GA 4U7GA 3HXOA 2ZEJA 2COUA 4JKIA 2G80A 3D8NA 2DQ4A 3OOJA 3DGEC 4L8LA 5B58C 4H3KB 3FMGA 2Q6KA 3NH9A 4GW3A 4ZGWA 3NW9A 5FI0B 5LP6F 3I62A 2ZSJA 3M9LA 4AG6A 1EA5A 2XGOA 3WB1A 4ILGA 3DHYA 1E1YA 2F90A 4D56A 2R47A 3JS5A 4E14A 3ZCQA 5IT4A 1G5TA 3A1VA 3AINA 4OBXA 2GMWA 4C0JA 4L0MA 4KMSA 1QP8A 1H6PA 3DLHA 1F0KA 1OD6A 1OLXA 1PKXA 1NI5A 1Y98A 3DYIA 5LX8A 2H4ZA 2FW7A 1M72A 4FGKA 3COYA 4FYVA 1D6JA 5AVYA 2WUDA 3NPMA 5I8ZA 2H0RA 1OAKA 2BLNA 3L54A 3SZ7A 3UKRG 2QZAA 4XQCA 5FYDA 2LNIA 1PZFA 4IUDS 1C3LA 3CX3A 3KD7A 3R6LA 4L7TA 1F5NA 5LB2A 1HKHA 4YECA 3VR6H 5U1PA 1WW8A 1KR2A 1L8OA 1NFIE 3FCUB 5ANLA 3DA8A 3PFBA 3CE6A 5CM2Z 3MTDA 1PBNA 2VGXA 2JH8A 4OOEA 4R16A 3ONNA 2F43B 3WA7A 2K87A 2KS6A 4WD3A 4DDMA 2RIRA 1CQIB 4D8WA 4NNOA 1NBAA 1IHYA 2YR0A 3ETDA 4P2BA 3ORFA 2Z1MA 3P2MA 4UBJA 1CW2B 5TR9A 2M32A 4F4CA 4KNVA 3T8MA 1DBIA 1ZJ5A 2ZM6B 1UJNA 3EF1A 4X1OA 5J2UA 3M6VA 4GL2A 4JI6B 3IX7A 1XRJA 2GD6A 1D09A 1WPQA 2BFPA 2GYUA 1SXGA 2RJOA 2PSFA 4W9RA 1QFJA 2ISQA 3OZ7A 1P81A 5CB4F 1E7RA 4DIOA 1SN7A 2GKOA 1XVTA 3DSRA 4GKAA 4DCOA 1O5OA 1JKIA 3AHGA 1DE0A 1U8XX 5KCMA 1JVBA 1HDRA 4EJ2A 2BEWA 3RVRA 4RL6A 2BH9A 2EC5A 2O6HA 2PMCA 2VBIA 4HNUA 4AYXA 1RZVA 3N7TA 2QGNA 3QX7A 3GDHA 4ZAFA 4HFMA 5IHXA 3ZHYA 2DERA 1II9A 2GEFA 2GCIA 2R7MA 2IUFA 2VXCA 2VXOA 3N8DA 4BVJA 2JI9A 4YV1A 1BYUA 1F9EA 2X9NA 1GG8A 4I17A 5JAQA 3OPYI 3X1DA 3NKLA 1W48A 4BNXA 1KERA 1KYVA 4PZYA 2IF2A 1OAAA 4C6TA 5ENVA 1USWA 1JAXA 3OLCX 3FKSA 4JLPA 5KYWB 1WY6A 1KDRA 2DZDA 2Y4TA 1IXZA 4MVJD 4KV7A 2C7VA 3QV1A 2ZAIA 5KEIA 3MGBA 3G5AA 2FPXA 3T15A 4EHJA 1NG1A 4XI0A 3U48A 1E3LA 4CR8A 2O1SA 5LQJA 1D1PA 1QQBA 3GA0A 3EDMA 3Q6MA 1EQ2A 4B5LA 1PQWA 5FIUA 3OKPA 3H8SA 3PQ5A 3STHA 4TMZA 4FNOA 2HWUA 3VNRA 3BXXA 3Q2IA 3Q6IA 2CL5A 4ALMA 5ADUS 1VG8A 1AY0A 3TTXA 2B21A 2YOGA 4Q7EA 2AOTB 3TRFA 4M9UA 3OHMA 2H5LA 2OHIA 1E94E 3I8XA 4LOIA 5BNZA 1K9SA 1JQDA 4C0EA 1SR8A 1TNYA 1E2FA 1YOBA 1ZNYA 2I7VA 2OENG 1Q17A 3KT3A 3V80A 5JASA 2IQCA 3D4LA 4GMLA 2BZ0A 4R68A 1NDQA 2JIOA 1XTZA 3GLHA 1WEHA 4P4GA 1YQWA 1J23A 3OIUA 4B4DA 4U7TB 3K35A 4JUIA 2O5VA 3ABME 4HDAA 4K87A 3RVOA 2FO7A 3GJRA 2J0SA 1YBVA 2Y4UA 2BGRA 1A5SB 2ONKA 1JFTA 4NYJR 3PQFA 2F3TA 2CBZA 3O21A 3IE2A 3PXXA 1SUEA 3Q5GA 3SN6A 1Q7TA 3GAZA 4FFVA 3TIVA 3K5PA 2QFCA 4EJSA 2WOJA 2UZ1B 1KE2A 4HRMB 2YUTA 4BTEA 3ZOZA 3ZVKA 5DKFA 1N2BA 2J3HA 4IWXA 4ZCIA 2AFHA 1SBYA 2YWDA 4RFVA 1PWHA 3EYWA 5FUBA 1K1BA 5KNGA 4HQFA 3UKDA 3E33A 3HXPA 3L18A 4ZEMA 1R9MA 4CV0A 4OHYA 4ETNA 1QP0A 1Q1GA 4AJNA 2WPDA 1KAQA 1GWNA 1OXUA 3H2GA 2V4HC 3K4HA 4XPIB 1CZOA 2F43A 1VJCA 1ZNZA 3BF7A 4YRQA 1RI2A 1DKRA 4JI8B 4GC9A 3L8ZA 2D1RA 1XMSA 3H6GA 4A3TA 5ICEA 3E4BA 1QQ5A 1E4EB 4PZPA 1YJQA 4TKZA 3KLPX 1VCOA 2NG1A 3CZ4A 1YS7A 4FWIB 1MT3A 2WINI 4D9MA 5TPZD 2IS4A 4E5PA 2H00A 1UMKA 2C4KA 1SFRA 1KORA 1X8XA 2EU8A 2WD7B 3OZAA 1A71A 1JRLA 3BD7A 3NHFA 1OBFO 2HJRA 4FYIA 4LDRA 4PZLA 3UK2A 2AYZA 2WPVA 1IH8A 2JCSA 4FCVA 3ICOA 4L9WA 4TX1A 2QTWB 3FYTA 4LBVA 2YBEA 4OGFA 3SNXA 4KPUB 5BMVF 2EEZA 1LQTA 2IYQA 5YASA 3TCNA 1SXJD 2PZFA 2EFGA 2GBIA 1L8QA 3HU2A 2YFYA 3GN1A 1CETA 4RWEA 4QNMA 5ADVA 1MUUA 2OZVA 2XVYA 4L27A 2G70A 4V03A 4G4SP 4NDAA 1PS0A 4M7PA 1OXVA 4YT5A 4LY9A 1CE8A 2FMKA 4HP8A 1DEXA 4LSGA 3TNDA 4QUEA 4S2UA 2GBLC 2EQBA 2PSSA 2JFPA 3K0SA 4QJ4A 1CUAA 3E81A 2WHPB 2ZULA 1SZAA 1EXMA 1NYLA 2ZYIA 3DHVA 5G0UA 3Q4AB 3EZLA 3TQSA 4E5NA 2JHPA 4KJXA 5IXJA 4TMFA 5KYYA 1H2UA 4E6PA 4ECAA 3V00A 1YRQA 4A6EA 4HYQA 4MVJH 5JD5A 4WCFA 1YIAA 3LHDA 3GVCA 4RVBA 3PUXA 1EFVA 2DLDA 4RIHA 3UHOA 4TVSA 1FX0B 3FUJA 2XA9A 5EMMA 4ZOEA 1E8ZA 3TZHA 5LLTA 1IQPA 1G291 4YH1A 4LDAA 2F62A 5TXGA 2W6NA 1E8XA 4EKDA 3ZGZA 1GRCA 2HTEA 3GEHA 1ONBA 3K8YA 4MQBA 2XENA 2HXSA 1E9AA 1EJ6A 1SOUA 2Q5FA 3F4LA 3A3OA 5F3DA 4AKTA 1Y6RA 1V6AA 2C7GA 1KETA 3NOGD 3LCMA 1OXKB 1N1MA 1QKIA 4KACA 4L73A 5EHQA 4ZFHA 1YB6A 1GYRA 5CFPA 4WUYA 1I4OA 3QG5A 3ZZUA 4C87A 2EHJA 3CHRA 2GXQA 3UM3A 3WO0A 4E4RA 1P8JA 5FQNA 4G4SO 4XRGA 1QKJA 4XLLA 3EFOA 3GIWA 1NTOA 4DEVA 4JLUA 2P6PA 1JA0A 4LPKA 2C5SA 3QX9A 1R5JA 3QEOA 4KQKA 4YJ2F 5FWYB 1ISIA 4ZN6A 1MPXA 5E9QA 1KGDA 1R4MB 4JYZA 4IPTA 1LPMA 4RTSA 1K06A 3R2JA 1KI6A 1UK9A 4GOOD 4BNVA 3D9KA 1TX4B 4BOYA 4HWTA 1K8QA 2V8SE 1QH8B 2CLEB 3GFOA 4RD3A 5FOUA 5KVAA 1SWWA 4MV4A 4OYRA 4LV8B 3RG8A 3RFUA 4RJLA 3O38A 2DLCX 3P2BA 4M1SA 3WRXC 5HS4A 1ID1A 1Z7YA 3PTLA 5JJIA 1GILA 2A92A 1NVDA 3S1LA 3U17A 5A1TA 2GZ3A 3PNMA 3TOSA 2I76A 1RWXA 2XRMA 3WJAA 2QTCA 4NH4A 4IIYA 3DXXA 4HEJA 3QBDA 5DBOA 4C7JA 4DRXE 4AY3A 1ZITA 4C7VA 1LRLA 4RKFA 2CHWA 5L40A 1GPNA 3LXUX 3G5LA 3KFXA 2R1ZA 2QIPA 3LCVB 3PHBE 3P9QA 4ILKA 1JQLB 4M2LA 4R41A 3EQ6A 3W4KA 5K8CA 3V31A 2IE0A 2WJIA 4YAFA 1G16A 2DC1A 2DSTA 1THGA 3AB8A 3QA9A 4FHZA 1JZSA 2WWVD 3APDA 4BL5A 3SQOA 3EOBI 3LP5A 2PE5A 3KEGA 1DJMA 4P22A 1M1NA 3I92A 4ZU6X 1OXJA 1MH1A 1V26A 4NS4A 1TN8A 4WZ6A 3ZIAD 4Z4CA 4A5SA 4HT3B 1P3DA 2C9DA 3A1SA 3NVMB 4WFQA 1LF5A 5SZKB 2Y6VA 3NEPX 4MNTA 2VIIA 3D3QA 5LMZA 2IU3A 2ZCVA 4UTRA 5CEAA 3KZCA 3DKIA 4LXXA 5K51A 3PUZA 3ORYA 4D7AA 2VTBB 4IGKA 5TX7A 4M1MA 5IN5A 3R3UA 3H8WA 4PXYA 5EJMA 4DBLC 1Y5RA 2F67A 2QW1A 4L8FA 1GAJA 5J2TB 2AJCA 2PSHA 3EMVA 3PQ3A 4BESA 1ONNA 4JYPA 1JG3A 2ERXA 1Z74A 4ACBA 1RWWA 2VDKB 4F7DA 3GRRA 3RRFA 4GI1A 2XB8A 3FNGA 4RV5A 3QPWA 3BG5A 1OAOA 3VZCA 4D45A 1UBJS 2GJSA 2B92A 3MWFA 3NTUA 1JLLB 4FU0A 4GBGA 2GN9A 3DRAA 4WY5A 1UKAA 4J0IA 5K4GA 5H4GA 1X14A 2J9FA 3ZFWA 2ZRFA 3LECA 1C0EA 3G8BA 2Z5GA 4PLTA 5ALYA 2YQ8A 2PJUA 4BAZA 4BX0A 3UV6A 3UHJA 3TSCA 3FZEA 4X71A 2FQ1A 2WIKA 4DF3A 1N32B 1FW8A 5KNDH 5HW0A 3AVWA 4JV5B 2FPPA 2H31A 2JIMA 1X86B 1OC4A 1AUPA 2YV4A 3JQPA 3FOZA 5KOIA 4GOKA 4X8MA 3FH0A 2X41A 4MQLA 3G2WA 3RIHA 1G38A 2JVIA 3I9OA 5IZCA 2O8NA 1JHMA 3QLVC 4QFCA 1OLSB 3JSAA 3LAWA 5JZMA 3NV7A 3V9PA 3DG9A 4WN9B 3DFMA 4DPKA 3B13A 1OTHA 4KO1S 1YTLA 4OO3A 2KCKA 1RRFA 2A78A 5CDFA 3SKXA 3ZIDA 4I55B 2QRPA 2Q7OE 3W2FA 2WXGA 4YRSA 1K75A 4OX9B 3LKBA 3A06A 5TEWA 2B35A 3RVPA 5CPFA 2Q2VA 2W8BB 4KXNA 4BFTA 3GLIA 3MQ2A 3QOWA 4O59O 2WF8A 5ICGA 3QK0A 1JGTA 2GPTA 3DE2X 4MA4A 3OZBA 4QPZA 1EJBA 1XEAA 4P1ZA 5DXAA 5FV7A 5H3HA 4BNMA 1LX7A 4R84A 5CW1A 4WZBE 5CEJA 2E4UA 6PFKA 1Y82A 5IWAB 1FFWA 2NPFA 4CKWA 5JQGA 3OCVA 4IW3B 2F0YA 1GGEA 4WLFA 2FN9A 1XXHE 2PS1A 2YFHA 1FS4A 1D6NA 1NMQA 4J49A 2H1HA 4ONEA 3ROZA 1KI9A 1XA3A 5H80A 1IFXA 3DV0B 4EMSA 5AQ9A 3HP1A 5FOSA 3ST7A 1O2DA 2HIHA 4II2A 3MS7A 3TKAA 5J4LA 4BFWA 3HM2A 4ETIA 3AF1A 2BONA 1DXOA 1QFMA 1EK0A 1VHJA 3BTUA 4FD2A 4IILA 1TMYA 3GD7A 1HS6A 3WGGA 2GEKA 4H1VA 1TLFA 2O1EA 3CF4A 1ZLYA 3KOXA 2ASVA 2N1BA 2NTVA 2JIZA 4K6KA 3PCXA 4U2EA 5IMSA 1DDGA 3E2PA 4DCGA 4FFSA 3M1IA 2I7XA 3KR2A 3EJNA 1IOZA 4Q3LA 3TEJA 2C2YA 3TRIA 2PT7A 1I9CA 1KYIA 2NGRA 4PZAA 3S8YA 4DX2A 2PL2A 2OESA 1IVYA 2IEBA 4RADA 1UDBA 1VL5A 1PQYA 1SXHA 2X23A 4ZC8A 3OPQA 2BT4A 2QVZX 2ZJBA 4GMHA 2XMRA 1U7ZA 1Y9ZA 3K0FA 4LZWA 4PS1A 3WZMA 4AS2A 3P1UA 1PFVA 1P80A 1P7ZA 3M34A 3BQMB 1GJRA 2DP4E 3L7BA 2WB2A 3BXZA 4TUYF 5KNBH 4YO8A 3R4VA 1EJ2A 4NKRA 5AI0A 3RC9A 4MWBA 4IDCA 3VX3A 1NLUA 4O3MA 2D8AA 3BHNA 5JJ5A 5CNKA 5DGCA 3HCBA 2FSFA 2X6RA 3IO5A 1OYVA 4J43A 4CM8A 3DLBA 1ULSA 4UEJA 3ACCA 1NRIA 2I1VB 3BDVA 3CNQS 3JATA 3WNVA 4WUVA 4C5CA 1L4HA 3NORA 5G04J 4XASA 5CH5A 2HBQA 1I7QB 4QKQA 2WNSA 2PANA 3B5JA 1NQTA 2V7WA 3EQ7A 4YROA 5HFJA 3H42B 4I9UA 2OEWA 1E0DA 2JL1A 4UQLA 1EPUA 1KK1A 2M2IA 4GZ3A 2QX4A 3NHRA 3SM3A 5CK5A 5HOQA 1DQRA 3OC6A 3T35A 4MKGA 4NZZA 3OPMA 1QGDA 3ML8A 3M6IA 2BEKA 5K0JA 4TV9B 3BH7A 3FH7A 3JY6A 3ED5A 3NAZA 4GMGA 4HTAA 4JSTA 2QM0A 4PTYA 4I3GA 1TUBA 5G3ZA 3R3HA 4BO3A 1SELA 1HTTA 4QZVA 1IUPA 3D43A 2O3TA 1UMCB 4PFKA 2CFIA 1QG0A 4HVLA 2Y0CA 4LTNA 4WFIA 1LVUA 2O3RA 1X3LA 1T8SA 2AI3A 4DQ0A 1JHYA 1MX3A 4WKCA 4E85A 1QV9A 1UMBA 1G5RA 3MWJA 3QUTA 4HNVA 5LJLA 2XCOA 1TD9A 1M1NB 1PFKA 4DZZA 1C9NA 2VSYA 5AENA 1JAIA 4G0PA 1JKMA 3M1AA 1TC2A 4PWYA 2CEAA 3ONDA 4RVGA 2IBSA 3X0DA 3FNRA 2H3EA 3P5BA 1KXJA 2QMHA 2F3RA 3ZJYA 1NJ6A 2LIVA 4BGDA 2GD2A 3CN7A 3SSAA 4F6LA 3HGTA 3LLSA 3O3OB 1SBIA 1OA0A 3E30A 2OCCE 1ZICA 2KHZA 4TLMB 5AKGA 1CIVA 1XNHA 4TXRA 5C37A 5LOVB 4ZVKA 4HB5A 1KVTA 2ZJZA 4IZ6A 1VMKA 4QGFA 1GGVA 1AF4A 3GT4A 2QLLA 3VSEA 2PBLA 1UC5B 1KDZA 4L07A 4CQLB 4G0UA 2QAGA 2R8XA 4KQMA 5BT1A 1G6Q1 4BVGA 3W6PA 3WOHA 1DV1A 2ZB8A 5BQOA 1G6KA 4BHTA 1GITA 3ETLA 4KR0A 1AQJA 4IIHA 1BDHA 2VZLA 2H16A 3FUWA 4Q15A 3P9NA 1XF9A 2X4DA 1UPXA 2YQ5A 1I94B 3LI2A 5JXGA 1TEZA 3ESXA 4JBNA 4BRUA 1Y6GA 3B12A 4Y6WA 1FS6A 4LOLA 5FB3A 5KKAA 1W93A 4GI3A 3KU1A 3NDJA 3HU5A 4RK7A 3C15C 3UMRA 2AI2A 4YBZA 2Y77A 1I4TD 1RDFA 2RARA 3C3MA 3EYAA 3TKLA 4HBGA 4MLPA 1DQSA 3I9JA 4KVZA 4BFSA 1HO8A 1Y89A 4AF6A 2H2FA 2A0XA 1ORHA 5JT1A 3L17A 1ULHA 5LZ8A 2IHKA 1ZMBA 1MDFA 5A6VA 4EZJA 1ZK3A 1RKQA 2DVMA 2Q0SA 2WIBA 2XUAA 4RE5A 2J3EA 4BC0A 2EIKE 3QW4B 4CL8A 3H9EO 1XOIA 2ZBVA 1KJNA 2R5NA 2E7ZA 2OBNA 5BMVB 2CD7A 4M22A 2JZNA 4ZO8A 1IEVA 2HSZA 4Q9NA 3LVRE 4B8WA 3KFLA 4IV8A 1OI4A 2P67A 1HU3A 3BMCA 4D80A 5IRCD 3UMBA 1OLXB 4LCTA 1RHUA 2HRCA 2J85A 2II6A 3HG7A 4KZPA 3EW9A 1T0BA 1Q21A 5TQ2B 1V71A 4NX2A 1WB6A 1X77A 1X94A 4FK8A 1U8CB 4R1NA 3M4XA 3WLTA 5F98A 2J0UB 3DFKA 3T4PA 1JWFA 1TC1A 3DULA 1Z6ZA 2GJAA 4N4AA 4TMYA 4LFCB 4L78A 3LH5A 4J0QA 5KTOA 4KYVA 3U60B 4BTBA 1KI1A 1UEIA 5EHGA 3ZXYA 3TR5A 2H65A 3T8KA 4RK4A 4KN9S 4C0QC 4JD5A 2JJYA 3U64A 3C6XA 3NDRA 4KGVA 3V7FA 3SJBA 5ALWA 4IHQA 1VKOA 4OL9A 4OM8A 4D25A 1XA0A 4EMTA 1TE2A 4ATGA 1EXDA 4NI5A 1FIUA 4JZYA 1GUYA 1W6UA 3IBTA 3AEKA 2HHAA 1SCAA 1JFVA 4DCMA 1WXIA 4UWHA 2VPXA 4OK5A 3C98A 3EUFA 4GQBA 5K8IA 4RV9A 1EK1A 2FR8A 1W30A 4EYSA 4D10C 1NHWA 3I4LA 3KQPA 4OAOA 3AG4E 3O6VA 5CD9A 1JFLA 2BFCA 1EFDN 5CXUA 5KKNB 3M5DA 3OT4A 1NZNA 2QG9A 4HXYA 4YVOA 3HBJA 1MZPA 5EZYA 2QX6A 2ZRMA 1X1AA 2C31A 3WBFA 4NCBA 2C7RA 1D4FA 1JS1X 1NRJB 2OOSA 4JJ6A 1G5QA 5B58T 3I5YA 1X7HA 2J9QA 4FI3C 4Q9DA 1H2TC 5EX0A 2FW0A 1X39A 3IC5A 1FJHA 3O1IC 1OWPA 1X80B 4MWGA 4MSUA 4UPDA 5I9LA 2K7FA 1DRVA 1TCVA 3OKAA 3GLFA 4AURA 3RIXA 3VJKA 4MPTA 4YRKA 5LUAA 3CB4A 3C6QA 1N25A 3P9XA 1P2BA 4DIDA 1B0UA 3WWOA 3C4VA 5JTUA 1P6UA 4IQ4A 4Z3KA 4C0MA 4RL4A 2CJYA 5LQAA 2CLLB 5KB3A 4BECA 1JEQA 4WCVA 3T3EA 1Z2PX 2R8PA 1EB9A 3O9MA 4J8YA 2P2CP 5F12A 3L7AA 4IGAA 3EFEA 4GX5A 2Y6UA 2VDVE 5FHRA 2XWBF 2J7KA 2LXNA 4J8SA 1NVFA 2C4UA 3D4OA 3QPUA 4PHTA 4QFDA 3SAJA 5LOVA 2QTMA 3I4CA 1DC8A 2R03A 5KNCH 3B7WA 3FFXA 1BJRE 1PJZA 5KYXB 1ESZA 3CXRA 5F1OA 2IWHA 3SK0A 3ASYA 3PQ4A 4PANA 2P1RA 1ZBDA 1FSFA 3K72B 4Q12A 1FYEA 1KZ4A 3FHEA 4PHGA 2VEDA 1X0VA 3FCEA 5K3OA 2IGBA 1G55A 2P7HA 4A8PA 4B3XA 3GO4A 1PS8A 1SUSA 2FWIA 3UK0A 5ALOA 4JJZA 2Q3JA 1ZX1A 2QM3A 1WG8A 1HT0A 5EWJB 2HJSA 4K81B 2O23A 4TL7A