4GTOA

Ftase in complex with bms analogue 14
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
317
structure length
317
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 129
structure length 317
sequence length 317
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 4gtoA00
2F0YA 3HXBA 3PZ3A 1QBQA 3DSSA 2BEDA 1FPPA 1TNZA 3DSUA 3SFXA 1TN7A 1KZOA 3DSTA 4YDOA 3HXCA 1O5MA 4GTSA 1TNUA 1TNBA 2H6IA 1D8DA 1N4QA 3DSVA 2H6FA 1FT1A 3E37A 4LNGA 3E34A 1JCQA 3DSWA 1LTXA 3PZ2A 4GTQA 1N9AA 1TNOA 1O1SA 2H6HA 4GTRA 1S63A 1X81A 1NI1A 1MZCA 1S64A 3C72A 2IEJA 3Q7AA 3Q73A 4MBGA 3HXEA 1KZPA 4GTVA 1LD8A 3HXDA 4YDEA 4GTOA 4EHMA 2H6GA 1DCEA 3SFYA 2R2LA 4GTTA 1O1RA 1SA5A 3DRAA 1N95A 3E30A 4GTMA 1JCRA 1N94A 1N4RA 1TN6A 3EU5A 3KSQA 3PZ4A 3Q78A 1O1TA 3Q79A 1JCSA 4L9PA 4LNBA 2ZISA 3DSXA 3PZ1A 1TN8A 1FT2A 1LD7A 1NL4A 1N4PA 4GTPA 1D8EA 1SA4A 3Q7FA 3HXFA 3KSLA 1N4SA 2ZIRA 1TNYA 3DPYA 3EUVA 3E32A 3Q75A 3E33A
chains in the Genus database with same CATH superfamily
2V4HC 1WG0A 4XIFA 4HS2A 4P29A 2A4ZA 3U4TA 3U66A 3SO8A 4BT9A 3LY8A 4OYSA 4TXPA 2J49A 1TNBA 3TJPA 3UT8A 3JQ0A 4XI9A 4FULA 2UY1A 4JXTA 4NURA 3N71A 5B3SE 1JWFA 2HO1A 3L16A 3PZ2A 2CFZA 4V3IA 4U63A 5KBAA 4WWNA 2XHEA 2CHZA 5JJ7A 3PVLA 5BW8C 3APCA 4GYWA 4ANUA 2RFAA 2X38A 1N54A 4UQZA 2GRLA 4GPMA 2XCCA 1H0AA 2R2LA 3FTVA 4I6GA 1JCRA 2A5EA 4GMRA 4AXHA 1QQEA 2KBXA 4HFGA 5FTPA 2WXKA 4DK5A 3DXMG 2HR2A 3L13A 4Y6WA 4XI0A 1FVFA 5EDSA 3AJIA 4JA9A 1GW6A 3SBTB 2UY1B 2Y4UA 1MX2A 1OCRE 1S70B 2PL2A 3AG1E 2ZXWE 1E8XA 3HXBA 3CVUA 3SI5A 2DYRE 4K5CA 1BI8B 3BUAA 2MYOA 1ZU2A 3RRNB 2WXNA 4FJYA 3PE4A 3LCAA 2OEWA 5BT1A 2FI7A 3UT4A 4BX9A 2FF4A 3DPDA 3W9GA 3QNKA 4E6HA 3PRZA 3LY9A 5AJDA 4A63B 4C9BB 3AG3E 2YHEA 3DEPA 5HRYA 2CHXA 4KZCA 3U9WA 4CRWA 4AP2A 5J08A 3QJZA 2VGXA 1SQMA 3EIQC 3Q4AB 2BTDA 4E85A 3PEVB 2J07A 2C0LA 5EYPF 1K1AA 3CVPA 3SFYA 3AS5A 4ME2A 4ACKA 4K5BA 5DIZA 4LCTA 3HHMA 1VDYA 4YVOA 5ARGA 3CGHA 3J5PA 3Q78A 5JHBA 1SVXA 4RG9A 2UWJG 2FULA 4LERA 3RIBA 3RRUA 1ZB1A 2GW1A 2ETAA 3FUMA 5CEAA 3FUNA 3SZ7A 1Z6TA 2DZOA 3V30A 3HYMB 3P1UA 3CVQA 4UQYA 1NZNA 4XEIG 5D2MC 1XGWA 3QK0A 3Q49B 3PZDA 3S7DA 4I9EA 1IHGA 3E32A 4RVBA 5EX0A 4JL0A 1UJJA 4ILGA 4B94A 1FPPA 2ONDA 4AV7A 2VGXB 4J8FA 3UM3A 4IN3B 3HIZA 1TNUA 3G2UA 2WXRA 1UOHA 3FP3A 4X8QA 3UM0A 3CHRA 3ZNGA 2EIKE 2IQCA 4JEHA 2VJ8A 1N9AA 4U0ZA 4NIKA 2GRPB 4F6RD 4LG6A 5JHAA 4J8SA 5G04J 4JPSA 2M63A 1HU3A 3LPZA 4KZ0A 1IQUA 2B0OE 5CRVA 3R9MA 4TV3A 2BKKB 4ILHB 1N0QA 4C0MA 2LO6A 2P58C 4IULA 2J9QA 5G2NA 5E76A 4HNAD 4JD2G 5KNGA 4FC8A 3EU5A 3KSQA 3R7RA 1UW4B 4GPKA 4RLYA 4JEUA 2EIJE 3CKBA 3D9MA 2XPIA 4BWRA 4EZJA 4HRNA 5C2YA 3CSTA 3AAAC 3APFA 3Q9UC 4BTAA 2WXGA 3ZYLA 2F0YA 3OAWA 1QBQA 4UQXA 4BT8A 2AWIA 5CCMA 5G55A 4J0UA 2PQRA 1EF1C 3FUIA 4NQ0A 2XRYA 3L6AA 2OOEA 3FTXA 4YDYA 2ZGGA 3CHQA 4FU3A 2YQ8A 1HG5A 5AJLA 3SD5A 1JPLA 5FT9A 3TXNA 4ANXA 1A5EA 3JYSA 4UWKA 3E34A 4CDNA 2DYSE 4J6IA 4XE0A 4ANVA 3ZUVB 2L9BA 4LRZA 1TNOA 4FHKA 3ZYMA 1HO8A 3CK7A 2H6HA 5CEDB 1NI1A 3R9AB 1HX8A 4AM9A 3URZA 5ENRD 3UIOC 4EQFA 3IKOB 3QB2A 2F8XK 2KZTA 5KWDA 2WMOA 3PH0C 4O1PA 3SHFA 1OY3D 2F37A 3FEYA 3X2QE 3ZN3A 3CVXA 1EDUA 1A17A 3CLJA 3CVWA 2EQXA 2JLBA 2L6BA 3NOGD 3FUDA 3ZVVA 3PEUB 4G26A 1ELRA 5CBOA 1H2TC 4QQIA 5E75A 3TG5A 3KAEA 5EILA 3B7RL 3ABME 4MKTA 1Q2ZA 2ETBA 3SQVA 1S0PA 4A55A 3CKCA 4GZ3A 1EYHA 2WQHA 2FBNA 1TNYA 2AXZA 4KVOA 1JWGA 3GYZA 4M3OA 2QFCA 2J8SD 3FFLA 4XX5A 3TG4A 4Q69A 2P9SG 3PUJA 5CBNA 4MLPA 2WQ7A 5CCLA 4L23A 3UX4A 2XGSA 2KZTB 5ENTD 4U0SA 4WAFA 3DSWA 5ITZF 4JHKA 5EKQD 2IFUA 2KXPC 4QFVA 4NACA 2OCCE 2AXVA 5EN5D 2L0TB 1MZCA 4U8YD 5HKPA 4HOTA 2AVPA 1KZPA 2R5SA 3V79K 1IXVA 3TWVA 1K8KG 4APOA 3ASOE 1JUQA 4ACLA 3C3RA 4YNDA 1FVHA 2E0IA 3IV0A 1MJ0A 1OWLA 5AQBA 3D9NA 4HLLA 5KJMA 2WQ6A 2VTBA 4J8YA 2GRMA 3PZ1A 3DEOA 4ZFHA 4KXKB 1HE8A 2KCLA 4GA2A 3FU3A 3HXFA 3OXLA 3T5XA 2XRZA 3AU4A 4A1GA 1Z5SC 4ILIA 4AIFA 3TWSA 3MZLB 3RRMB 5LCWC 3F6QA 3FTSA 4U8VD 2AJAA 4FHJA 5B1BE 2BEDA 3SY2A 2WXLA 3FH5A 2L6JA 2XPZA 3OTNA 2IONA 1N11A 5C1DA 4LSZE 3QWPA 3ZXPA 3AS4A 4J8EA 4LUNU 2LAIA 2LXLA 2YNQA 3EDTB 2P9LG 4DX6D 1FT1A 3TL5A 2OEVA 5KJLA 4CEMA 4PDXA 4WNDA 1ZBPA 3UM2A 4DRXE 2VTBB 4PUCA 2EILE 3VLDA 5AIJA 3Q7AA 2P9NG 3U3WA 3CSFA 2A5UA 5T4YA 4AOFA 3S2AA 1X5BA 4U0UA 4CDMA 4WNFA 2DVWA 2IY0C 5ENQD 1O1TA 3ASDA 1OT8A 5BPPA 2X3MA 1MX6A 4GMJA 4AVXA 4GB9A 1E8WA 3ZIMA 4KVMA 1YA0A 5BXUA 1NL4A 2DIWA 5AQAA 4YDWA 4HVBA 5AYWD 3ZEFA 2Y69E 1SZ9A 5LCWJ 4O1OA 4N2SA 2V5FA 3D9KA 3LVRE 2XS1A 1IYGA 4GZ6A 3FU5A 3Q75A 5DBKA 3NF1A 3VLEA 3FUJA 4N5QA 1P5QA 2AXUA 4G23A 5A23A 4JW1A 1QNFA 5HI7A 3TWUA 2XZDG 3EHNA 2FO1E 2WXJA 4XZ4A 2V8SE 5JJ6A 2MOWA 3QWVA 3OXGA 4UUCA 2KM4A 2QY7A 2I1KA 4UI9K 2IOLA 3FWVA 3SBSA 5LP0A 3QWWA 1NFIE 3LJ3A 4GMLA 3TWRA 1B89A 2HYZA 3ZRHA 5LX8A 3C72A 2ZU6B 5BUZA 4YDEA 3Q47B 3W9FA 1LF8A 3D9LA 4LNUD 5HS0A 4K0RA 2EIME 1Y6IA 4HB5A 5ANLA 5AENA 4HBDA 2VSOE 3APDA 4B0ZA 3D9IA 4K03A 1HF8A 1ELKA 2I9CA 1BLXB 2E2EA 3NBNB 2QZAA 1OWNA 3DXKG 2ZIRA 3CVYA 2IF4A 5CERB 3ULYA 3CQCB 5T8IA 5ENSD 1NA3A 4B8AA 1H2UA 4TXRA 4TRQA 4U8HA 3PZ3A 3Q15A 1TNZA 5BV0A 4F53A 3L08A 4UWLA 1TN7A 2XPYA 4GU5A 3D9HA 5JJTA 3D3MA 3ZFWA 3CHSA 4IRUA 4JZYA 2H6FA 3E37A 4LEUA 3TXMA 1INZA 3V2OA 2WVIA 4CT0A 4C48B 2VSYA 4GTQA 3ZKJA 2IU1A 2C2LA 5AARA 1V54E 4N3CA 1UG3A 4EPZA 2IO3C 4FLHA 3NOCD 3LS8A 4GTVA 5LOZA 4A3TA 1SA5A 3DRAA 2XCBA 3JQ1A 4GZCA 2FEZA 1DNPA 2XENA 3S7JA 3RO2A 2WPVA 2PZIA 3QOUA 5HQ8A 1MHQA 3ZW3A 3JXJA 4HXIA 4HQDA 2PQNA 2I1JA 2XZTG 2R05A 4CT4A 3ENEA 2NYJA 4URKA 3UTMA 1TR4A 3DPYA 2XQ0A 4EZLA 4BETA 3FH8A 4JHRA 1NA0A 3CVLA 3HXCA 3FU0A 1OWPA 4NRHB 2X6FA 5KJKA 4H7YA 1N52A 3C5RA 4CGVA 1N4QA 3DSVA 2P9UG 2I2OA 3I4GA 3GZ1A 3CEQA 4WNGA 2RG8A 3QARA 3CHMA 4WNEA 2WM9A 2P2CP 3ISMC 3MKQA 3GW4A 4KT6B 4I1AA 3ASNE 4FJZA 5FIOA 4AY6A 4HI9A 3EJNA 2YHCA 3LEWA 3WG7E 1WAO1 4GA0A 1UN8A 4I6JA 1KT0A 4HORA 3ULQA 4BEPA 4OAUC 4L9PA 1AWCB 3CK8A 1HH8A 2ZISA 4EZKA 2VSXE 3L22A 1TYQG 3CHOA 2J08A 5CHEE 2XS8A 3UKUG 4XKBA 5KJNA 2ETCA 5KCMA 2ILRA 3CVVA 3PNLB 4U07A 4FP7A 4ATZD 4DX2A 3LY7A 2XGMA 2I6HA 3R7QA 3QAQA 3B7TA 3ASGA 4DI3A 4DX5D 2HM8A 1FCHA 3C3QA 3RO3A 3JUEA 3FU6A 3B95A 1RW2A 5AAOA 4TXQA 4G1TA 1OWOA 1G3NB 4LNGA 3SFZA 4Q94A 3FEXA 3G2SA 1JCQA 5KNHD 3BU8A 4MS6A 2LUHA 4KYOB 1E8YA 3O4ZA 3UQ3A 4TUMA 2R17C 3FTZA 4U96D 2LAHA 2IEJA 1U3DA 1E8ZA 4GCOA 4F7AA 3L54A 4MBGA 3I5PA 1OCOE 3KEAA 4Y6CA 4GYOA 4R7LA 3LKUA 4EHMA 4I6EA 4GTMA 1N95A 3E30A 2V4LA 5D66A 4G25A 3RU0A 3UKRG 2CHWA 1TN6A 4A1SA 4LNBA 2JABA 2XGOA 4DPRA 2C0MA 4DLOA 4I9CA 2P9IG 4YVQC 3P2BA 2DCPA 4BY6A 4O6FA 2NC9A 3T8KA 4DX1A 5FINA 3UM1A 4G2VA 5ANRA 5CRUA 5G05C 3G2TA 4F1SA 4BTBA 4UI9C 3AS8A 3B7SA 5ENPD 3ZGQA 2AW6A 3EHQA 3RKVA 3FUKA 3FH7A 4EECA 3AG4E 1KZOA 2LNIA 3MYVA 3TWTA 1OWMA 2DBAA 2H6IA 4J7WA 3IHVA 3UIPC 4WWPA 3MX3A 1U3CA 4PH4B 3RAUA 1WDYA 2JEKA 1YCSB 3HRAA 5A7DB 1OCZE 3ZHEA 2VYIA 3MGBA 2GROB 4CYMD 5D0QD 4EBAA 4AJWA 4GZ5A 4JHJA 4GTOA 1IQRA 2H6GA 3JUIA 3UMVA 3IBEA 3Q5MA 3LDZA 4MRUA 5FQ8A 4ANWA 1HZ4A 3MCXA 5AQ9A 3U64A 4UWFA 4G8LA 1H6PA 2Y0BG 4BX8A 3GZSA 1N4PA 2HE0A 3ASFA 3IXEA 2NSZA 3KSLA 3FDHA 5G05J 1K3ZD 3C3OA 4JC8A 3NB2A 4UWHA 2CFUA 4UI9J 1E7VA 5J90A 2WB2A 4WUYA 1L5JA 4FLBA 1YMPA 5AQ7A 5JMND 1Z3XA 2VSNA 1OCCE 1PY1A 3CV0A 2J4BA 3UINC 3LXUX 3VLFA 4YDOA 3ZHEB 4HOQA 3MEKA 4N2QA 4U04A 1UN9A 4AY5A 2IJGX 4JB8P 1D8DA 1HFAA 2RKKA 3EHRA 1MX4A 3O48A 3HG0D 3B13A 2EINE 3ASHA 1E7UA 2YINA 3FHEA 4OVUA 1S63A 4F1PA 1N0RA 3Q73A 5A6CA 4A3VA 3RSEG 3HXEA 4KMOA 1PAQA 1RZ4A 1H6KA 4K5AB 4BESA 3IEGA 1D9SA 1ELWA 2R03A 4N39A 3CK9A 4GTTA 4H7XA 4GA1A 5D0OD 4BERA 4D10C 3UUXA 2J4DA 3LYAA 3ULEG 3FTWA 3Q9NC 2P9PG 4G11A 1WM5A 1K1BA 1KLXA 4RSYA 1D8EA 4HI8A 1KPSB 1SA4A 5BNWA 1IKND 4U7EB 2NXPA 4DI4A 2DZNA 2BKGA 4PS7A 3QC1A 1DC2A 4I2WA 5FWQA 3ONLA 3DSSA 4HOUA 1HS6A 3UT7A 1E96B 3FTYA 1PC2A 5IY5E 5AN8A 1MQSA 3S7FA 4OVVA 4UWGA 3NAWA 4J8DA 5G04C 5CMWA 2RD0A 3EU9A 2PM7A 4ZHBA 5EX3A 3C98A 3MV2B 2Y4TA 1E90A 1HG2A 1X81A 1XNFA 1W3BA 4L2LA 4L2YA 5CECB 2BUGA 1TEZA 2VQ2A 4DJAA 5JA4D 3ESLA 4ATGA 5H7PA 2KCVA 2WXFA 1QYMA 1V55E 3NZUA 3D9JA 3WXXA 3ABLE 5FQ6A 1N94A 2Y1LE 3S7BA 3PZ4A 3PS6A 3Q79A 1QZ2A 2CG2A 3OXFA 4DX7D 5EYLA 3EHMA 1TN8A 3D9PA 1SZAA 4GZDA 1FT2A 3FY4A 1UJKA 4TUUA 3Q7FA 2BF0X 4G8KA 4DLQA 2RFMA 3IHYA 4RQIA 4N3BA 4CCAA 4JA7A 4B89A 1NP7A 3TWWA 2MRIA 5FZSA 3B7BA 2X6JA 3BG1B 4IYPA 3I4RB 2WXHA 3L82A 3T5VA 3V31A 3T8MA 3ML8A 2P9KG 2Y3AA 1BU9A 1O5MA 1TJFA 4GTSA 2LXMA 5FQ7A 2PM6A 1IHBA 2KATA 2J09A 1BPOA 4N3AA 3PREA 5BV1A 3GZ2A 1BD8A 3MJWA 4B8CB 1H2VC 4M7CA 2XEVA 4PS3A 3L17A 3PNTB 1S64A 3MA5A 3ZYQA 4BSXA 5FQ4A 3L9TA 4W9RA 4GAAA 2L0IA 2CG3A 1YYHA 3ZXSA 3DBSA 1BI7B 1OXJA 3D9OA 4G24A 2VGEA 1DCEA 4JVSA 3ZYKA 4APFA 1DCQA 1O1RA 3HVEA 2DWZA 3PUKA 2KC7A 4DUIA 4I1OB 3ONKA 3NZSA 3FTUA 3BEEA 3SNXA 4EBAG 2QYJA 3TAXA 2V5QC 4FADA 4B93B 2X6KA 5EIBE 4CDRA 3KS2A 1HXIA 3FUHA 4GCNA 3ZU7B 4WWOA 5ARFA 4XKCA 3FUFA 2PNNA 4GYYA 2XEHA 2GGFA 4F3VA 4Z68A 1OUVA 3E33A 4HLEA 2GRQB 5ENNA 4FA6A 3AU5A 3SFXA 2FO7A 2WMNA 3G2VA 3ZPJA 3FUEA 1U2VG 2GRNB 4O60A 4I2ZA 2VGYA 1EPUA 5B1AE 3KEZA 2R02A 1H6OA 4HRMB 3HVEB 2LSVA 3MKQB 1LTXA 3PDNA 3MKRA 5CMYA 2Q7FA 4GTRA 2KCKA 3K9IA 4HOSA 2X6IA 3B7UX 3UI2A 2XEEA 2OVFA 3JCKC 4KBQA 3EIJA 3V2XA 2GRRB 3I3NA 4HRLA 3KD7A 1Z3YA 1LD8A 3HXDA 3ESKA 3QDNA 4CZ2D 1N4RA 4CGWA 5EIDA 4C0EA 2F8YA 5FZQA 3DSXA 2LSUA 1LD7A 1TJCA 5BXOA 5FJYA 4I43A 4GTPA 2WXQA 1N4SA 2OV8A 4BSZB 2V0PA 3TGOA 3QKYA 3BG0B 2R59A 3CHPA 3G2WA 2X6HA 3CQGB 5LFAA 3DSUA 3T9KA 4I17A 3VTYA 3DSTA 1MYOA 4L7TA 4N5CA 3JXIA 3RJVA 3TWXA 3FULA 1H19A 1SW6A 3E4BA 3BQOA 4AEZC 3MV3B 4U95D 2B6CA 4RG6A 5FZRA 3J5QB 1DVPA 3LVQE 3TWQA 3CR3A 5ENOD 4ABNA 1O1SA 3CIAA 2WXIA 2MHKA 4BFRA 1Y8MA 2IOSA 4Q96A 3HDXA 3NQPA 3ABKE 3LJNA 1AP7A 3VTXA 2WXMA 2WXPA 3RK6A 4I1MA 1WY6A 3SF4A 3UXGA 5M72A 2QC9A 1JCSA 4OAVB 3AG2E 2QYUA 4PS8A 2IO2C 3ML9A 3CVNA 2WXOA 3DWLG 5T3RA 3UPVA 1KT1A 3PE3A 3EUVA 3SGHA 4L1BA 2ZGDA 2OVBA
chains in the Genus database with same CATH topology
2F0YA 3HXBA 3PZ3A 1QBQA 3DSSA 2BEDA 1FPPA 1TNZA 3DSUA 3SFXA 1TN7A 1KZOA 3DSTA 4YDOA 3HXCA 1O5MA 4GTSA 1TNUA 1TNBA 2H6IA 1D8DA 1N4QA 3DSVA 2H6FA 1FT1A 3E37A 4LNGA 3E34A 1JCQA 3DSWA 1LTXA 3PZ2A 4GTQA 1N9AA 1TNOA 1O1SA 2H6HA 4GTRA 1S63A 1X81A 1NI1A 1MZCA 1S64A 3C72A 2IEJA 3Q7AA 3Q73A 4MBGA 3HXEA 1KZPA 4GTVA 1LD8A 3HXDA 4YDEA 4GTOA 4EHMA 2H6GA 1DCEA 3SFYA 2R2LA 4GTTA 1O1RA 1SA5A 3DRAA 1N95A 3E30A 4GTMA 1JCRA 1N94A 1N4RA 1TN6A 3EU5A 3KSQA 3PZ4A 3Q78A 1O1TA 3Q79A 1JCSA 4L9PA 4LNBA 2ZISA 3DSXA 3PZ1A 1TN8A 1FT2A 1LD7A 1NL4A 1N4PA 4GTPA 1D8EA 1SA4A 3Q7FA 3HXFA 3KSLA 1N4SA 2ZIRA 1TNYA 3DPYA 3EUVA 3E32A 3Q75A 3E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0Y A;  3HXB A;  3PZ3 A;  1QBQ A;  3DSS A;  2BED A;  1FPP A;  1TNZ A;  3DSU A;  3SFX A;  1TN7 A;  1KZO A;  3DST A;  4YDO A;  3HXC A;  1O5M A;  4GTS A;  1TNU A;  1TNB A;  2H6I A;  1D8D A;  1N4Q A;  3DSV A;  2H6F A;  1FT1 A;  3E37 A;  4LNG A;  3E34 A;  1JCQ A;  3DSW A;  1LTX A;  3PZ2 A;  4GTQ A;  1N9A A;  1TNO A;  1O1S A;  2H6H A;  4GTR A;  1S63 A;  1X81 A;  1NI1 A;  1MZC A;  1S64 A;  3C72 A;  2IEJ A;  3Q7A A;  3Q73 A;  4MBG A;  3HXE A;  1KZP A;  4GTV A;  1LD8 A;  3HXD A;  4YDE A;  4GTO A;  4EHM A;  2H6G A;  1DCE A;  3SFY A;  2R2L A;  4GTT A;  1O1R A;  1SA5 A;  3DRA A;  1N95 A;  3E30 A;  4GTM A;  1JCR A;  1N94 A;  1N4R A;  1TN6 A;  3EU5 A;  3KSQ A;  3PZ4 A;  3Q78 A;  1O1T A;  3Q79 A;  1JCS A;  4L9P A;  4LNB A;  2ZIS A;  3DSX A;  3PZ1 A;  1TN8 A;  1FT2 A;  1LD7 A;  1NL4 A;  1N4P A;  4GTP A;  1D8E A;  1SA4 A;  3Q7F A;  3HXF A;  3KSL A;  1N4S A;  2ZIR A;  1TNY A;  3DPY A;  3EUV A;  3E32 A;  3Q75 A;  3E33 A; 
#chains in the Genus database with same CATH topology
 2V4H C;  1WG0 A;  4XIF A;  4HS2 A;  4P29 A;  2A4Z A;  3U4T A;  3U66 A;  3SO8 A;  4BT9 A;  3LY8 A;  4OYS A;  4TXP A;  2J49 A;  1TNB A;  3TJP A;  3UT8 A;  3JQ0 A;  4XI9 A;  4FUL A;  2UY1 A;  4JXT A;  4NUR A;  3N71 A;  5B3S E;  1JWF A;  2HO1 A;  3L16 A;  3PZ2 A;  2CFZ A;  4V3I A;  4U63 A;  5KBA A;  4WWN A;  2XHE A;  2CHZ A;  5JJ7 A;  3PVL A;  5BW8 C;  3APC A;  4GYW A;  4ANU A;  2RFA A;  2X38 A;  1N54 A;  4UQZ A;  2GRL A;  4GPM A;  2XCC A;  1H0A A;  2R2L A;  3FTV A;  4I6G A;  1JCR A;  2A5E A;  4GMR A;  4AXH A;  1QQE A;  2KBX A;  4HFG A;  5FTP A;  2WXK A;  4DK5 A;  3DXM G;  2HR2 A;  3L13 A;  4Y6W A;  4XI0 A;  1FVF A;  5EDS A;  3AJI A;  4JA9 A;  1GW6 A;  3SBT B;  2UY1 B;  2Y4U A;  1MX2 A;  1OCR E;  1S70 B;  2PL2 A;  3AG1 E;  2ZXW E;  1E8X A;  3HXB A;  3CVU A;  3SI5 A;  2DYR E;  4K5C A;  1BI8 B;  3BUA A;  2MYO A;  1ZU2 A;  3RRN B;  2WXN A;  4FJY A;  3PE4 A;  3LCA A;  2OEW A;  5BT1 A;  2FI7 A;  3UT4 A;  4BX9 A;  2FF4 A;  3DPD A;  3W9G A;  3QNK A;  4E6H A;  3PRZ A;  3LY9 A;  5AJD A;  4A63 B;  4C9B B;  3AG3 E;  2YHE A;  3DEP A;  5HRY A;  2CHX A;  4KZC A;  3U9W A;  4CRW A;  4AP2 A;  5J08 A;  3QJZ A;  2VGX A;  1SQM A;  3EIQ C;  3Q4A B;  2BTD A;  4E85 A;  3PEV B;  2J07 A;  2C0L A;  5EYP F;  1K1A A;  3CVP A;  3SFY A;  3AS5 A;  4ME2 A;  4ACK A;  4K5B A;  5DIZ A;  4LCT A;  3HHM A;  1VDY A;  4YVO A;  5ARG A;  3CGH A;  3J5P A;  3Q78 A;  5JHB A;  1SVX A;  4RG9 A;  2UWJ G;  2FUL A;  4LER A;  3RIB A;  3RRU A;  1ZB1 A;  2GW1 A;  2ETA A;  3FUM A;  5CEA A;  3FUN A;  3SZ7 A;  1Z6T A;  2DZO A;  3V30 A;  3HYM B;  3P1U A;  3CVQ A;  4UQY A;  1NZN A;  4XEI G;  5D2M C;  1XGW A;  3QK0 A;  3Q49 B;  3PZD A;  3S7D A;  4I9E A;  1IHG A;  3E32 A;  4RVB A;  5EX0 A;  4JL0 A;  1UJJ A;  4ILG A;  4B94 A;  1FPP A;  2OND A;  4AV7 A;  2VGX B;  4J8F A;  3UM3 A;  4IN3 B;  3HIZ A;  1TNU A;  3G2U A;  2WXR A;  1UOH A;  3FP3 A;  4X8Q A;  3UM0 A;  3CHR A;  3ZNG A;  2EIK E;  2IQC A;  4JEH A;  2VJ8 A;  1N9A A;  4U0Z A;  4NIK A;  2GRP B;  4F6R D;  4LG6 A;  5JHA A;  4J8S A;  5G04 J;  4JPS A;  2M63 A;  1HU3 A;  3LPZ A;  4KZ0 A;  1IQU A;  2B0O E;  5CRV A;  3R9M A;  4TV3 A;  2BKK B;  4ILH B;  1N0Q A;  4C0M A;  2LO6 A;  2P58 C;  4IUL A;  2J9Q A;  5G2N A;  5E76 A;  4HNA D;  4JD2 G;  5KNG A;  4FC8 A;  3EU5 A;  3KSQ A;  3R7R A;  1UW4 B;  4GPK A;  4RLY A;  4JEU A;  2EIJ E;  3CKB A;  3D9M A;  2XPI A;  4BWR A;  4EZJ A;  4HRN A;  5C2Y A;  3CST A;  3AAA C;  3APF A;  3Q9U C;  4BTA A;  2WXG A;  3ZYL A;  2F0Y A;  3OAW A;  1QBQ A;  4UQX A;  4BT8 A;  2AWI A;  5CCM A;  5G55 A;  4J0U A;  2PQR A;  1EF1 C;  3FUI A;  4NQ0 A;  2XRY A;  3L6A A;  2OOE A;  3FTX A;  4YDY A;  2ZGG A;  3CHQ A;  4FU3 A;  2YQ8 A;  1HG5 A;  5AJL A;  3SD5 A;  1JPL A;  5FT9 A;  3TXN A;  4ANX A;  1A5E A;  3JYS A;  4UWK A;  3E34 A;  4CDN A;  2DYS E;  4J6I A;  4XE0 A;  4ANV A;  3ZUV B;  2L9B A;  4LRZ A;  1TNO A;  4FHK A;  3ZYM A;  1HO8 A;  3CK7 A;  2H6H A;  5CED B;  1NI1 A;  3R9A B;  1HX8 A;  4AM9 A;  3URZ A;  5ENR D;  3UIO C;  4EQF A;  3IKO B;  3QB2 A;  2F8X K;  2KZT A;  5KWD A;  2WMO A;  3PH0 C;  4O1P A;  3SHF A;  1OY3 D;  2F37 A;  3FEY A;  3X2Q E;  3ZN3 A;  3CVX A;  1EDU A;  1A17 A;  3CLJ A;  3CVW A;  2EQX A;  2JLB A;  2L6B A;  3NOG D;  3FUD A;  3ZVV A;  3PEU B;  4G26 A;  1ELR A;  5CBO A;  1H2T C;  4QQI A;  5E75 A;  3TG5 A;  3KAE A;  5EIL A;  3B7R L;  3ABM E;  4MKT A;  1Q2Z A;  2ETB A;  3SQV A;  1S0P A;  4A55 A;  3CKC A;  4GZ3 A;  1EYH A;  2WQH A;  2FBN A;  1TNY A;  2AXZ A;  4KVO A;  1JWG A;  3GYZ A;  4M3O A;  2QFC A;  2J8S D;  3FFL A;  4XX5 A;  3TG4 A;  4Q69 A;  2P9S G;  3PUJ A;  5CBN A;  4MLP A;  2WQ7 A;  5CCL A;  4L23 A;  3UX4 A;  2XGS A;  2KZT B;  5ENT D;  4U0S A;  4WAF A;  3DSW A;  5ITZ F;  4JHK A;  5EKQ D;  2IFU A;  2KXP C;  4QFV A;  4NAC A;  2OCC E;  2AXV A;  5EN5 D;  2L0T B;  1MZC A;  4U8Y D;  5HKP A;  4HOT A;  2AVP A;  1KZP A;  2R5S A;  3V79 K;  1IXV A;  3TWV A;  1K8K G;  4APO A;  3ASO E;  1JUQ A;  4ACL A;  3C3R A;  4YND A;  1FVH A;  2E0I A;  3IV0 A;  1MJ0 A;  1OWL A;  5AQB A;  3D9N A;  4HLL A;  5KJM A;  2WQ6 A;  2VTB A;  4J8Y A;  2GRM A;  3PZ1 A;  3DEO A;  4ZFH A;  4KXK B;  1HE8 A;  2KCL A;  4GA2 A;  3FU3 A;  3HXF A;  3OXL A;  3T5X A;  2XRZ A;  3AU4 A;  4A1G A;  1Z5S C;  4ILI A;  4AIF A;  3TWS A;  3MZL B;  3RRM B;  5LCW C;  3F6Q A;  3FTS A;  4U8V D;  2AJA A;  4FHJ A;  5B1B E;  2BED A;  3SY2 A;  2WXL A;  3FH5 A;  2L6J A;  2XPZ A;  3OTN A;  2ION A;  1N11 A;  5C1D A;  4LSZ E;  3QWP A;  3ZXP A;  3AS4 A;  4J8E A;  4LUN U;  2LAI A;  2LXL A;  2YNQ A;  3EDT B;  2P9L G;  4DX6 D;  1FT1 A;  3TL5 A;  2OEV A;  5KJL A;  4CEM A;  4PDX A;  4WND A;  1ZBP A;  3UM2 A;  4DRX E;  2VTB B;  4PUC A;  2EIL E;  3VLD A;  5AIJ A;  3Q7A A;  2P9N G;  3U3W A;  3CSF A;  2A5U A;  5T4Y A;  4AOF A;  3S2A A;  1X5B A;  4U0U A;  4CDM A;  4WNF A;  2DVW A;  2IY0 C;  5ENQ D;  1O1T A;  3ASD A;  1OT8 A;  5BPP A;  2X3M A;  1MX6 A;  4GMJ A;  4AVX A;  4GB9 A;  1E8W A;  3ZIM A;  4KVM A;  1YA0 A;  5BXU A;  1NL4 A;  2DIW A;  5AQA A;  4YDW A;  4HVB A;  5AYW D;  3ZEF A;  2Y69 E;  1SZ9 A;  5LCW J;  4O1O A;  4N2S A;  2V5F A;  3D9K A;  3LVR E;  2XS1 A;  1IYG A;  4GZ6 A;  3FU5 A;  3Q75 A;  5DBK A;  3NF1 A;  3VLE A;  3FUJ A;  4N5Q A;  1P5Q A;  2AXU A;  4G23 A;  5A23 A;  4JW1 A;  1QNF A;  5HI7 A;  3TWU A;  2XZD G;  3EHN A;  2FO1 E;  2WXJ A;  4XZ4 A;  2V8S E;  5JJ6 A;  2MOW A;  3QWV A;  3OXG A;  4UUC A;  2KM4 A;  2QY7 A;  2I1K A;  4UI9 K;  2IOL A;  3FWV A;  3SBS A;  5LP0 A;  3QWW A;  1NFI E;  3LJ3 A;  4GML A;  3TWR A;  1B89 A;  2HYZ A;  3ZRH A;  5LX8 A;  3C72 A;  2ZU6 B;  5BUZ A;  4YDE A;  3Q47 B;  3W9F A;  1LF8 A;  3D9L A;  4LNU D;  5HS0 A;  4K0R A;  2EIM E;  1Y6I A;  4HB5 A;  5ANL A;  5AEN A;  4HBD A;  2VSO E;  3APD A;  4B0Z A;  3D9I A;  4K03 A;  1HF8 A;  1ELK A;  2I9C A;  1BLX B;  2E2E A;  3NBN B;  2QZA A;  1OWN A;  3DXK G;  2ZIR A;  3CVY A;  2IF4 A;  5CER B;  3ULY A;  3CQC B;  5T8I A;  5ENS D;  1NA3 A;  4B8A A;  1H2U A;  4TXR A;  4TRQ A;  4U8H A;  3PZ3 A;  3Q15 A;  1TNZ A;  5BV0 A;  4F53 A;  3L08 A;  4UWL A;  1TN7 A;  2XPY A;  4GU5 A;  3D9H A;  5JJT A;  3D3M A;  3ZFW A;  3CHS A;  4IRU A;  4JZY A;  2H6F A;  3E37 A;  4LEU A;  3TXM A;  1INZ A;  3V2O A;  2WVI A;  4CT0 A;  4C48 B;  2VSY A;  4GTQ A;  3ZKJ A;  2IU1 A;  2C2L A;  5AAR A;  1V54 E;  4N3C A;  1UG3 A;  4EPZ A;  2IO3 C;  4FLH A;  3NOC D;  3LS8 A;  4GTV A;  5LOZ A;  4A3T A;  1SA5 A;  3DRA A;  2XCB A;  3JQ1 A;  4GZC A;  2FEZ A;  1DNP A;  2XEN A;  3S7J A;  3RO2 A;  2WPV A;  2PZI A;  3QOU A;  5HQ8 A;  1MHQ A;  3ZW3 A;  3JXJ A;  4HXI A;  4HQD A;  2PQN A;  2I1J A;  2XZT G;  2R05 A;  4CT4 A;  3ENE A;  2NYJ A;  4URK A;  3UTM A;  1TR4 A;  3DPY A;  2XQ0 A;  4EZL A;  4BET A;  3FH8 A;  4JHR A;  1NA0 A;  3CVL A;  3HXC A;  3FU0 A;  1OWP A;  4NRH B;  2X6F A;  5KJK A;  4H7Y A;  1N52 A;  3C5R A;  4CGV A;  1N4Q A;  3DSV A;  2P9U G;  2I2O A;  3I4G A;  3GZ1 A;  3CEQ A;  4WNG A;  2RG8 A;  3QAR A;  3CHM A;  4WNE A;  2WM9 A;  2P2C P;  3ISM C;  3MKQ A;  3GW4 A;  4KT6 B;  4I1A A;  3ASN E;  4FJZ A;  5FIO A;  4AY6 A;  4HI9 A;  3EJN A;  2YHC A;  3LEW A;  3WG7 E;  1WAO 1;  4GA0 A;  1UN8 A;  4I6J A;  1KT0 A;  4HOR A;  3ULQ A;  4BEP A;  4OAU C;  4L9P A;  1AWC B;  3CK8 A;  1HH8 A;  2ZIS A;  4EZK A;  2VSX E;  3L22 A;  1TYQ G;  3CHO A;  2J08 A;  5CHE E;  2XS8 A;  3UKU G;  4XKB A;  5KJN A;  2ETC A;  5KCM A;  2ILR A;  3CVV A;  3PNL B;  4U07 A;  4FP7 A;  4ATZ D;  4DX2 A;  3LY7 A;  2XGM A;  2I6H A;  3R7Q A;  3QAQ A;  3B7T A;  3ASG A;  4DI3 A;  4DX5 D;  2HM8 A;  1FCH A;  3C3Q A;  3RO3 A;  3JUE A;  3FU6 A;  3B95 A;  1RW2 A;  5AAO A;  4TXQ A;  4G1T A;  1OWO A;  1G3N B;  4LNG A;  3SFZ A;  4Q94 A;  3FEX A;  3G2S A;  1JCQ A;  5KNH D;  3BU8 A;  4MS6 A;  2LUH A;  4KYO B;  1E8Y A;  3O4Z A;  3UQ3 A;  4TUM A;  2R17 C;  3FTZ A;  4U96 D;  2LAH A;  2IEJ A;  1U3D A;  1E8Z A;  4GCO A;  4F7A A;  3L54 A;  4MBG A;  3I5P A;  1OCO E;  3KEA A;  4Y6C A;  4GYO A;  4R7L A;  3LKU A;  4EHM A;  4I6E A;  4GTM A;  1N95 A;  3E30 A;  2V4L A;  5D66 A;  4G25 A;  3RU0 A;  3UKR G;  2CHW A;  1TN6 A;  4A1S A;  4LNB A;  2JAB A;  2XGO A;  4DPR A;  2C0M A;  4DLO A;  4I9C A;  2P9I G;  4YVQ C;  3P2B A;  2DCP A;  4BY6 A;  4O6F A;  2NC9 A;  3T8K A;  4DX1 A;  5FIN A;  3UM1 A;  4G2V A;  5ANR A;  5CRU A;  5G05 C;  3G2T A;  4F1S A;  4BTB A;  4UI9 C;  3AS8 A;  3B7S A;  5ENP D;  3ZGQ A;  2AW6 A;  3EHQ A;  3RKV A;  3FUK A;  3FH7 A;  4EEC A;  3AG4 E;  1KZO A;  2LNI A;  3MYV A;  3TWT A;  1OWM A;  2DBA A;  2H6I A;  4J7W A;  3IHV A;  3UIP C;  4WWP A;  3MX3 A;  1U3C A;  4PH4 B;  3RAU A;  1WDY A;  2JEK A;  1YCS B;  3HRA A;  5A7D B;  1OCZ E;  3ZHE A;  2VYI A;  3MGB A;  2GRO B;  4CYM D;  5D0Q D;  4EBA A;  4AJW A;  4GZ5 A;  4JHJ A;  4GTO A;  1IQR A;  2H6G A;  3JUI A;  3UMV A;  3IBE A;  3Q5M A;  3LDZ A;  4MRU A;  5FQ8 A;  4ANW A;  1HZ4 A;  3MCX A;  5AQ9 A;  3U64 A;  4UWF A;  4G8L A;  1H6P A;  2Y0B G;  4BX8 A;  3GZS A;  1N4P A;  2HE0 A;  3ASF A;  3IXE A;  2NSZ A;  3KSL A;  3FDH A;  5G05 J;  1K3Z D;  3C3O A;  4JC8 A;  3NB2 A;  4UWH A;  2CFU A;  4UI9 J;  1E7V A;  5J90 A;  2WB2 A;  4WUY A;  1L5J A;  4FLB A;  1YMP A;  5AQ7 A;  5JMN D;  1Z3X A;  2VSN A;  1OCC E;  1PY1 A;  3CV0 A;  2J4B A;  3UIN C;  3LXU X;  3VLF A;  4YDO A;  3ZHE B;  4HOQ A;  3MEK A;  4N2Q A;  4U04 A;  1UN9 A;  4AY5 A;  2IJG X;  4JB8 P;  1D8D A;  1HFA A;  2RKK A;  3EHR A;  1MX4 A;  3O48 A;  3HG0 D;  3B13 A;  2EIN E;  3ASH A;  1E7U A;  2YIN A;  3FHE A;  4OVU A;  1S63 A;  4F1P A;  1N0R A;  3Q73 A;  5A6C A;  4A3V A;  3RSE G;  3HXE A;  4KMO A;  1PAQ A;  1RZ4 A;  1H6K A;  4K5A B;  4BES A;  3IEG A;  1D9S A;  1ELW A;  2R03 A;  4N39 A;  3CK9 A;  4GTT A;  4H7X A;  4GA1 A;  5D0O D;  4BER A;  4D10 C;  3UUX A;  2J4D A;  3LYA A;  3ULE G;  3FTW A;  3Q9N C;  2P9P G;  4G11 A;  1WM5 A;  1K1B A;  1KLX A;  4RSY A;  1D8E A;  4HI8 A;  1KPS B;  1SA4 A;  5BNW A;  1IKN D;  4U7E B;  2NXP A;  4DI4 A;  2DZN A;  2BKG A;  4PS7 A;  3QC1 A;  1DC2 A;  4I2W A;  5FWQ A;  3ONL A;  3DSS A;  4HOU A;  1HS6 A;  3UT7 A;  1E96 B;  3FTY A;  1PC2 A;  5IY5 E;  5AN8 A;  1MQS A;  3S7F A;  4OVV A;  4UWG A;  3NAW A;  4J8D A;  5G04 C;  5CMW A;  2RD0 A;  3EU9 A;  2PM7 A;  4ZHB A;  5EX3 A;  3C98 A;  3MV2 B;  2Y4T A;  1E90 A;  1HG2 A;  1X81 A;  1XNF A;  1W3B A;  4L2L A;  4L2Y A;  5CEC B;  2BUG A;  1TEZ A;  2VQ2 A;  4DJA A;  5JA4 D;  3ESL A;  4ATG A;  5H7P A;  2KCV A;  2WXF A;  1QYM A;  1V55 E;  3NZU A;  3D9J A;  3WXX A;  3ABL E;  5FQ6 A;  1N94 A;  2Y1L E;  3S7B A;  3PZ4 A;  3PS6 A;  3Q79 A;  1QZ2 A;  2CG2 A;  3OXF A;  4DX7 D;  5EYL A;  3EHM A;  1TN8 A;  3D9P A;  1SZA A;  4GZD A;  1FT2 A;  3FY4 A;  1UJK A;  4TUU A;  3Q7F A;  2BF0 X;  4G8K A;  4DLQ A;  2RFM A;  3IHY A;  4RQI A;  4N3B A;  4CCA A;  4JA7 A;  4B89 A;  1NP7 A;  3TWW A;  2MRI A;  5FZS A;  3B7B A;  2X6J A;  3BG1 B;  4IYP A;  3I4R B;  2WXH A;  3L82 A;  3T5V A;  3V31 A;  3T8M A;  3ML8 A;  2P9K G;  2Y3A A;  1BU9 A;  1O5M A;  1TJF A;  4GTS A;  2LXM A;  5FQ7 A;  2PM6 A;  1IHB A;  2KAT A;  2J09 A;  1BPO A;  4N3A A;  3PRE A;  5BV1 A;  3GZ2 A;  1BD8 A;  3MJW A;  4B8C B;  1H2V C;  4M7C A;  2XEV A;  4PS3 A;  3L17 A;  3PNT B;  1S64 A;  3MA5 A;  3ZYQ A;  4BSX A;  5FQ4 A;  3L9T A;  4W9R A;  4GAA A;  2L0I A;  2CG3 A;  1YYH A;  3ZXS A;  3DBS A;  1BI7 B;  1OXJ A;  3D9O A;  4G24 A;  2VGE A;  1DCE A;  4JVS A;  3ZYK A;  4APF A;  1DCQ A;  1O1R A;  3HVE A;  2DWZ A;  3PUK A;  2KC7 A;  4DUI A;  4I1O B;  3ONK A;  3NZS A;  3FTU A;  3BEE A;  3SNX A;  4EBA G;  2QYJ A;  3TAX A;  2V5Q C;  4FAD A;  4B93 B;  2X6K A;  5EIB E;  4CDR A;  3KS2 A;  1HXI A;  3FUH A;  4GCN A;  3ZU7 B;  4WWO A;  5ARF A;  4XKC A;  3FUF A;  2PNN A;  4GYY A;  2XEH A;  2GGF A;  4F3V A;  4Z68 A;  1OUV A;  3E33 A;  4HLE A;  2GRQ B;  5ENN A;  4FA6 A;  3AU5 A;  3SFX A;  2FO7 A;  2WMN A;  3G2V A;  3ZPJ A;  3FUE A;  1U2V G;  2GRN B;  4O60 A;  4I2Z A;  2VGY A;  1EPU A;  5B1A E;  3KEZ A;  2R02 A;  1H6O A;  4HRM B;  3HVE B;  2LSV A;  3MKQ B;  1LTX A;  3PDN A;  3MKR A;  5CMY A;  2Q7F A;  4GTR A;  2KCK A;  3K9I A;  4HOS A;  2X6I A;  3B7U X;  3UI2 A;  2XEE A;  2OVF A;  3JCK C;  4KBQ A;  3EIJ A;  3V2X A;  2GRR B;  3I3N A;  4HRL A;  3KD7 A;  1Z3Y A;  1LD8 A;  3HXD A;  3ESK A;  3QDN A;  4CZ2 D;  1N4R A;  4CGW A;  5EID A;  4C0E A;  2F8Y A;  5FZQ A;  3DSX A;  2LSU A;  1LD7 A;  1TJC A;  5BXO A;  5FJY A;  4I43 A;  4GTP A;  2WXQ A;  1N4S A;  2OV8 A;  4BSZ B;  2V0P A;  3TGO A;  3QKY A;  3BG0 B;  2R59 A;  3CHP A;  3G2W A;  2X6H A;  3CQG B;  5LFA A;  3DSU A;  3T9K A;  4I17 A;  3VTY A;  3DST A;  1MYO A;  4L7T A;  4N5C A;  3JXI A;  3RJV A;  3TWX A;  3FUL A;  1H19 A;  1SW6 A;  3E4B A;  3BQO A;  4AEZ C;  3MV3 B;  4U95 D;  2B6C A;  4RG6 A;  5FZR A;  3J5Q B;  1DVP A;  3LVQ E;  3TWQ A;  3CR3 A;  5ENO D;  4ABN A;  1O1S A;  3CIA A;  2WXI A;  2MHK A;  4BFR A;  1Y8M A;  2IOS A;  4Q96 A;  3HDX A;  3NQP A;  3ABK E;  3LJN A;  1AP7 A;  3VTX A;  2WXM A;  2WXP A;  3RK6 A;  4I1M A;  1WY6 A;  3SF4 A;  3UXG A;  5M72 A;  2QC9 A;  1JCS A;  4OAV B;  3AG2 E;  2QYU A;  4PS8 A;  2IO2 C;  3ML9 A;  3CVN A;  2WXO A;  3DWL G;  5T3R A;  3UPV A;  1KT1 A;  3PE3 A;  3EUV A;  3SGH A;  4L1B A;  2ZGD A;  2OVB A; 
#chains in the Genus database with same CATH homology
 2F0Y A;  3HXB A;  3PZ3 A;  1QBQ A;  3DSS A;  2BED A;  1FPP A;  1TNZ A;  3DSU A;  3SFX A;  1TN7 A;  1KZO A;  3DST A;  4YDO A;  3HXC A;  1O5M A;  4GTS A;  1TNU A;  1TNB A;  2H6I A;  1D8D A;  1N4Q A;  3DSV A;  2H6F A;  1FT1 A;  3E37 A;  4LNG A;  3E34 A;  1JCQ A;  3DSW A;  1LTX A;  3PZ2 A;  4GTQ A;  1N9A A;  1TNO A;  1O1S A;  2H6H A;  4GTR A;  1S63 A;  1X81 A;  1NI1 A;  1MZC A;  1S64 A;  3C72 A;  2IEJ A;  3Q7A A;  3Q73 A;  4MBG A;  3HXE A;  1KZP A;  4GTV A;  1LD8 A;  3HXD A;  4YDE A;  4GTO A;  4EHM A;  2H6G A;  1DCE A;  3SFY A;  2R2L A;  4GTT A;  1O1R A;  1SA5 A;  3DRA A;  1N95 A;  3E30 A;  4GTM A;  1JCR A;  1N94 A;  1N4R A;  1TN6 A;  3EU5 A;  3KSQ A;  3PZ4 A;  3Q78 A;  1O1T A;  3Q79 A;  1JCS A;  4L9P A;  4LNB A;  2ZIS A;  3DSX A;  3PZ1 A;  1TN8 A;  1FT2 A;  1LD7 A;  1NL4 A;  1N4P A;  4GTP A;  1D8E A;  1SA4 A;  3Q7F A;  3HXF A;  3KSL A;  1N4S A;  2ZIR A;  1TNY A;  3DPY A;  3EUV A;  3E32 A;  3Q75 A;  3E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...