4KXKB

Alanine-glyoxylate aminotransferase variant k390a/k391a in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
288
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine--pyruvate aminotransferase
publication title Ligand-Induced Compaction of the PEX5 Receptor-Binding Cavity Impacts Protein Import Efficiency into Peroxisomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
total genus 116
structure length 288
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kxkB00
3ZN3A 1OUVA 4U0UA 5G05C 4GZ3A 2WQHA 1TJCA 3GW4A 5KJKA 4GCOA 2WPVA 3LY7A 2Q7FA 1KT1A 1QZ2A 4H7YA 2OOEA 4WNDA 3VTXA 3LPZA 2KATA 2C0MA 3TG4A 3ASFA 4N3AA 3UQ3A 4BTBA 4G2VA 3OXFA 2FBNA 5LCWC 3RO3A 3CV0A 1E96B 4IN3B 4U0ZA 3Q15A 2KCVA 3ASGA 3UPVA 2Y4TA 3CK8A 4NRHB 4RG6A 4KYOB 1XNFA 2LNIA 4N2QA 2VYIA 2KCKA 2KCLA 4GA0A 3S7BA 3O48A 5KJLA 3ZHEA 5ARFA 2XCBA 3PE3A 4GYWA 3IEGA 3AS8A 4F3VA 4N3BA 4N3CA 3Q47B 4UI9J 2HO1A 4CDRA 3MKRA 4AY6A 4A1SA 3CVPA 2IF4A 3TGOA 2KC7A 4YVOA 2BUGA 2I6HA 4J0UA 3ULQA 4CGVA 4GPKA 5BNWA 3ASHA 1IYGA 4HOUA 4H7XA 4I2WA 3JYSA 4HOSA 3PE4A 4GA2A 2L6JA 2HR2A 5A6CA 3ZGQA 1FCHA 4U0SA 3S7JA 5KJNA 4WNGA 3QOUA 4GA1A 5G05J 4WNFA 1NA3A 4N2SA 3MEKA 4JA9A 4U04A 4N39A 4APOA 4B94A 3Q5MA 4G1TA 4BT9A 3S7FA 1QQEA 4JL0A 4G23A 3CKBA 3WXXA 4G26A 4J8DA 4NQ0A 2XPIA 2YHCA 3QWPA 4J8EA 5HI7A 5ARGA 3GZ2A 4XI9A 5G04J 4JHRA 5AYWD 3QDNA 3LKUA 2XGMA 3QWWA 1KLXA 2R5SA 5CCMA 3U4TA 4AM9A 3SF4A 3Q49B 4GCNA 2XEVA 3FWVA 4KXKB 3ASDA 2C2LA 2FI7A 2VGXB 3E4BA 3KS2A 4HOQA 4N5CA 3ESKA 4W9RA 3RKVA 3BEEA 5C1DA 4HOTA 1A17A 3Q4AB 3CVQA 2XGOA 3MV2B 2XCCA 1ELWA 4I2ZA 5BW8C 4G25A 3LYAA 4KBQA 4WNEA 2VQ2A 3SZ7A 2IFUA 3LCAA 5JJTA 5HQ8A 3MV3B 2UY1B 4LEUA 1HZ4A 2GW1A 3NF1A 3ZPJA 3TG5A 4YVQC 2ONDA 4UI9C 1NZNA 3CK9A 2FO7A 3KD7A 5A7DB 3U3WA 4Y6CA 3HYMB 3CVNA 5M72A 5FZQA 3GZ1A 3K9IA 1ZU2A 1WM5A 1NA0A 3GYZA 4U07A 3CKCA 4HORA 1WAO1 3VTYA 1ELRA 4GYYA 5DIZA 3R9AB 2AVPA 4ME2A 2FF4A 3CK7A 3KAEA 5FTPA 5LCWJ 1PC2A 5D0OD 4JA7A 5KJMA 4WUYA 2HYZA 3PDNA 2VSYA 3QKYA 4XI0A 5CCLA 1YA0A 4EQFA 2UWJG 1HXIA 4GYOA 3CEQA 3LY8A 3OXLA 2NC9A 5FZRA 2J9QA 4ABNA 2V5FA 3AS4A 5CHEE 4BTAA 5JJ7A 1B89A 2VGXA 5FZSA 2FEZA 3UUXA 5EKQD 4I17A 5FJYA 1P5QA 4I9CA 5G04C 4BT8A 3RIBA 2DBAA 2PL2A 2PQNA 4G24A 2Y4UA 2LSVA 4AIFA 4XIFA 1ZBPA 4AY5A 4UQZA 1KT0A 3OXGA 3RO2A 2UY1A 4I1AA 3MA5A 2JLBA 1Y8MA 3EDTB 2P58C 3FP3A 5EX0A 2YQ8A 3RJVA 2C0LA 3FFLA 4I9EA 3ZHEB 4J8FA 3RU0A 2MHKA 2QFCA 1IHGA 4O6FA 4UQXA 4UI9K 1W3BA 5JJ6A 5DBKA 4RG9A 3CVLA 3N71A 2XGSA 5EX3A 5BT1A 2PZIA 3LY9A 4UQYA 4GZ5A 2VSNA 1HH8A 2VGYA 4BWRA 3AS5A 4Y6WA 4CGWA 3QWVA 3S7DA 5FT9A 3TAXA 4YNDA 3ZFWA 4GZ6A 2PQRA 2E2EA 2LSUA 3URZA 5D0QD
chains in the Genus database with same CATH superfamily
2ZXWE 1X81A 2IONA 4JZYA 4PDXA 2GRMA 5G05C 2AJAA 3I5PA 1KPSB 4GZ3A 4HRLA 3GW4A 3SD5A 1TEZA 1KT1A 3SQVA 3PEUB 4I1MA 4C48B 4N3AA 4BTBA 3L13A 2J8SD 3ZIMA 2JEKA 3CV0A 2MRIA 1E96B 3T8KA 4IN3B 2WXLA 2HM8A 2QZAA 2QY7A 2Y4TA 3LJNA 4RG6A 5G55A 4N2QA 4A63B 2KCKA 4J6IA 4HXIA 1RW2A 4OAVB 4M3OA 1Q2ZA 3Q7AA 5KJLA 2IU1A 4ILHB 2BKKB 2DCPA 5ARFA 4AOFA 3L9TA 5HKPA 4FU3A 4F3VA 3D9NA 2HO1A 5B3SE 2WXOA 1Z5SC 3D9JA 2ILRA 3ULQA 4CGVA 4GPKA 3KSQA 1HFAA 3U66A 1QYMA 3TJPA 3FDHA 4ZFHA 4HOUA 2DIWA 3NQPA 3TWRA 4HOSA 2IO3C 4L2LA 4U0SA 3S7JA 5KJNA 3UKUG 3QOUA 1UW4B 2BEDA 3SFXA 1ELKA 4JA9A 3F6QA 3G2TA 3B95A 4N39A 3DXKG 1TJFA 4APOA 2F0YA 4WWNA 2QC9A 4C0MA 3IXEA 4G1TA 2R02A 3ULYA 4PS7A 5ANLA 3FUJA 3NB2A 4G23A 4DX1A 3IV0A 3LDZA 4ATGA 4ANWA 3APDA 4HLLA 3EHMA 3GZ2A 1NFIE 2XPYA 5AYWD 5FINA 4TXQA 2R5SA 1H6OA 3TXMA 3Q49B 3CSFA 4GCNA 4U8YD 2FI7A 2L0IA 3PZ1A 2DVWA 3ZYQA 3KS2A 4N5CA 5BV0A 3BEEA 4HOTA 4GTSA 3Q9UC 1HS6A 3Q4AB 4PUCA 3T5VA 2XRYA 3CR3A 2L9BA 5J90A 3MV2B 4I2ZA 4G25A 5KNGA 4DJAA 1AP7A 3UT4A 3LYAA 3MX3A 2X6IA 1UJJA 2LAHA 5AENA 2IFUA 2XPZA 5JJTA 5ENPD 5BUZA 5HQ8A 4V3IA 1HZ4A 2GW1A 2OVFA 2ZISA 2ONDA 3E37A 4IULA 5CBNA 3CVYA 5KWDA 4HI8A 4BSZB 1O1SA 3B7UX 3NZSA 4QFVA 5A7DB 5HRYA 2M63A 2WXQA 3B13A 2L0TB 2F8YA 3FTXA 4GTMA 4GTOA 1NA0A 3APCA 3C5RA 3BUAA 2WXHA 3CHOA 5AQAA 4P29A 4K5BA 3R9AB 4O60A 1N9AA 2X6KA 5CRUA 4CZ2D 3CK7A 4KZ0A 5B1AE 2GGFA 4A3VA 2OEVA 3D9MA 4AEZC 3LVRE 3ZKJA 4I43A 5LCWJ 4EBAG 2WXKA 5KJMA 3PDNA 1EF1C 1MX4A 4XI0A 4I6EA 2LXLA 1TN8A 3CEQA 2EINE 2VSXE 4JD2G 2NC9A 3MJWA 5A23A 3JUIA 4HLEA 2EIME 4JB8P 1MX2A 1YYHA 5ENOD 2FEZA 4XX5A 4I9CA 4K0RA 4Q96A 3UI2A 2X6HA 3IBEA 4U8VD 4MS6A 3V2XA 3EHQA 4CT0A 4XIFA 3TWXA 4AY5A 1E8YA 1KT0A 2WXNA 1E90A 1UN8A 5J08A 4DI4A 1HO8A 3L22A 1Y8MA 2NYJA 3BG1B 3UT8A 2YQ8A 3RJVA 3RK6A 2GROB 2XS1A 4I9EA 1O1RA 4CCAA 2EIKE 2R05A 3RU0A 4OVUA 3AJIA 4BETA 4DRXE 1Z6TA 2LAIA 2XZDG 1BPOA 5DBKA 1N94A 4B89A 4B8AA 4LNBA 3CVLA 3HXFA 2A4ZA 2P9SG 1ZB1A 1LD7A 4UWFA 4DX2A 3LY9A 1BI7B 5JMND 3TWSA 4A1GA 3UIOC 2NSZA 4Y6WA 4ILGA 5CECB 2PM7A 4CGWA 3EU9A 3FEXA 3HXEA 1HG2A 1WG0A 2H6FA 4GZ6A 3LXUX 4TUUA 1LF8A 1JCRA 2WXRA 3TWQA 4FLBA 1FVFA 3FU3A 5D0QD 3UT7A 3PZ3A 4YDWA 2WQHA 3E33A 5KJKA 1IXVA 3LY7A 2VTBA 2OOEA 2KBXA 3LPZA 1E7VA 5HS0A 2C0MA 3TG4A 3ASFA 5CEDB 3PZDA 4LNUD 3JUEA 2FBNA 2WXMA 5LCWC 3RO3A 2AXZA 4EPZA 4U0ZA 3FUIA 3Q15A 3DXMG 5AJLA 2KCVA 1OWMA 2VGEA 2I1KA 3JQ1A 4NRHB 4DI3A 3X2QE 4CT4A 2Y69E 3FUEA 4HQDA 2RFAA 4KYOB 1H0AA 3HDXA 2LNIA 3SFYA 1LD8A 3TXNA 1V55E 3HVEA 3S7BA 3DSUA 3CVUA 1D9SA 4BESA 4M7CA 3TL5A 1WY6A 2XCBA 2WM9A 2AWIA 3PE3A 3NBNB 1RZ4A 4IRUA 4GYWA 3FHEA 1S0PA 5EIBE 4EECA 3PVLA 4FLHA 3CVWA 3Q47B 4L23A 1EPUA 3G2SA 4J8YA 3ML9A 4YVOA 3SI5A 3FH7A 3B7TA 4J0UA 2MYOA 1BLXB 2J4BA 1DNPA 3WG7E 3B7BA 3CGHA 4H7XA 3OAWA 3JYSA 1GW6A 4FP7A 1O5MA 4DX7D 2L6JA 3L17A 3PNLB 4HRMB 1H2UA 1FCHA 5H7PA 3L16A 3ABLE 4XZ4A 4WNFA 3E34A 4ANXA 5EN5D 4U04A 1TNUA 3RSEG 1SVXA 3KEAA 3S7FA 4GB9A 3CVXA 4PH4B 2V0PA 3AG4E 2AW6A 3DSXA 2XEHA 4G26A 3ULEG 4NQ0A 2WQ7A 2XRZA 4J8EA 4HBDA 5HI7A 5ARGA 4ILIA 4GMRA 2IEJA 3IHVA 2IY0C 2XGMA 1Y6IA 1JCQA 3EJNA 3V2OA 3HIZA 3AAAC 1VDYA 2F37A 2CFZA 3UM3A 5AQBA 1K1BA 4LCTA 4PS8A 4Q94A 5EYPF 4BFRA 3ML8A 3ASDA 2C2LA 5T3RA 4C0EA 3RKVA 4U96D 5G2NA 5C1DA 1MJ0A 1A17A 1SZAA 3PREA 3C3OA 4MKTA 2DYRE 3MZLB 1NP7A 4K03A 4ANUA 3UKRG 4JVSA 2YNQA 4K5AB 5LP0A 3G2VA 4GTTA 3ZXSA 5LX8A 3C3RA 3L54A 5AJDA 4BY6A 4AVXA 4URKA 2IJGX 5ANRA 3CK9A 4F1SA 3U3WA 4TXRA 1TN7A 5E75A 4EZKA 1ZU2A 1UN9A 1HX8A 3GYZA 2R17C 3ABME 4HORA 1ELRA 5D66A 2LO6A 2OV8A 1S63A 3D9LA 3QNKA 5EDSA 1S70B 3TWWA 3JQ0A 2FULA 5CMYA 4GMLA 4DLOA 4NURA 1OWPA 2P9IG 4WUYA 1N4QA 4BX8A 2RFMA 2VSYA 5CCLA 2OVBA 1YA0A 2UWJG 5ENSD 4G11A 3FH5A 3SBSA 2A5EA 1YCSB 4GYOA 4J8SA 5ENQD 2V5FA 4KMOA 1EYHA 4BTAA 2BTDA 5JJ7A 1B89A 4DX5D 5BXUA 5FZSA 3PZ2A 3D9OA 2J08A 1P5QA 4J7WA 4FHJA 4JXTA 3RIBA 2DBAA 2P9NG 4DX6D 3UM1A 2MOWA 2PQNA 4FJZA 3V30A 1ZBPA 3EU5A 3D9HA 3ZVVA 2B6CA 3ONKA 3MA5A 3EDTB 2P58C 1D8DA 4F7AA 1N0QA 4WWPA 4L2YA 3ZU7B 3FFLA 5BXOA 1OWOA 2X6JA 4HI9A 4KVOA 1OCZE 3CHRA 3T5XA 4JC8A 1MQSA 3CHSA 1OWLA 3Q9NC 1N54A 2XGSA 3CLJA 5EX3A 5BT1A 1IQUA 5C2YA 3E32A 3FUFA 1TN6A 3S7DA 5FT9A 1OCOE 3CHPA 2A5UA 4GU5A 1K3ZD 4Q69A 1EDUA 2P9UG 2J07A 3URZA 1MZCA 3ZN3A 1OUVA 4U0UA 4KZCA 3ZYMA 1N95A 4ACLA 2WPVA 2R03A 3CSTA 2YINA 1QZ2A 4H7YA 3CQCB 1OXJA 4CDNA 1E7UA 4HRNA 5EYLA 3T9KA 3UIPC 2WB2A 3HHMA 1NI1A 4G2VA 3PEVB 5FIOA 3UM0A 1JCSA 3EIQC 3AG1E 3CK8A 4HVBA 3MGBA 1JPLA 1QBQA 3HXBA 5JA4D 2VYIA 2KCLA 2DZOA 5CERB 2XS8A 3RRNB 3BQOA 4BSXA 3O48A 3PH0C 4HFGA 3DSSA 2Y1LE 2WVIA 2LUHA 1NL4A 3TWVA 3L08A 3SFZA 1S64A 3IEGA 3AS8A 5AAOA 4N3CA 3E30A 4CDRA 4AY6A 4C9BB 4A1SA 3D9KA 3CVPA 4K5CA 3UTMA 2KC7A 3B7RL 2I6HA 4N5QA 4FJYA 3D3MA 5BNWA 5B1BE 1QNFA 3J5QB 4DK5A 2WQ6A 1TNBA 2R2LA 3ASHA 2EILE 3T8MA 3FU6A 2YHEA 4EHMA 3ISMC 2HR2A 5FQ7A 3DSWA 1X5BA 5CMWA 4UWKA 1A5EA 1HG5A 4NACA 4DUIA 4FC8A 4BX9A 2V8SE 3C3QA 4GA1A 3AU5A 3FUMA 3DRAA 5G05J 2XHEA 5KBAA 1HU3A 3ZNGA 3UX4A 1N4PA 1E8XA 3MKQB 3SNXA 4AP2A 3ZXPA 4WWOA 2GRQB 4JL0A 2XEEA 3ASNE 1JWFA 3LS8A 3HG0D 3WXXA 3U9WA 4J8DA 3Q78A 3EHNA 2YHCA 4L9PA 1AWCB 3FUKA 4MRUA 4TUMA 3Q73A 3QDNA 2X38A 3LKUA 2EQXA 3QWWA 5LOZA 3QC1A 1SZ9A 5CCMA 4I6JA 4RSYA 3SF4A 1MHQA 1DC2A 1L5JA 5AQ9A 1TNOA 4GZCA 2XEVA 3FWVA 2ZIRA 4KXKB 3QJZA 3NZUA 3RAUA 2VSOE 4HOQA 1IKND 1U3CA 3LEWA 4X8QA 5LFAA 4HS2A 2J4DA 3TWUA 4U63A 2ZGGA 4WAFA 4CYMD 3FY4A 2V4HC 2FO1E 4XE0A 4KBQA 2Y3AA 2WXJA 3DPYA 3FTWA 5ENTD 2V4LA 2LXMA 5ENNA 2UY1B 3U64A 4ANVA 4LEUA 3NF1A 3ZPJA 3TG5A 3NOGD 2XZTG 2DZNA 3SGHA 1YMPA 1NZNA 3D9IA 2FO7A 3KD7A 3PUKA 2ETBA 2ETCA 4D10C 4Y6CA 3MKQA 3CVNA 5M72A 3GZ1A 5BV1A 1OY3D 4ATZD 3K9IA 3FH8A 5BPPA 1HF8A 1WM5A 2F8XK 2RKKA 1H19A 1MYOA 1XGWA 4B8CB 3VTYA 4GYYA 4DPRA 5FQ6A 3SY2A 3DSVA 3CHQA 2PM6A 2FF4A 2J49A 3UXGA 4TV3A 2R59A 1PC2A 2B0OE 2GRNB 1N4RA 3DBSA 2X6FA 5D0OD 5KCMA 3ABKE 4JA7A 2HYZA 3L6AA 1DVPA 4GAAA 1U2VG 3QARA 3EHRA 4EQFA 3OTNA 1HXIA 2J09A 1U3DA 3LY8A 4GTRA 5FZRA 2J9QA 2CHZA 5CHEE 2OEWA 5EILA 2IOSA 3UUXA 5EKQD 4HB5A 3JCKC 5FQ8A 1BU9A 4CDMA 4KT6B 3FUNA 2E0IA 2PL2A 1H6KA 4G24A 3V79K 1TYQG 5JHAA 3ENEA 1D8EA 4LSZE 4UQZA 3QB2A 4TRQA 3OXGA 3RO2A 1IHBA 2UY1A 4MBGA 4I1AA 3FEYA 4QQIA 3NOCD 2IO2C 2CG3A 2JLBA 3FU5A 4I1OB 3G2WA 4U7EB 3ZHEB 2MHKA 4O6FA 4UI9K 4I6GA 3APFA 5JJ6A 5EIDA 4L7TA 1K1AA 4JHJA 1MX6A 1V54E 4GZDA 4F53A 1TR4A 1WDYA 3FULA 3UINC 2PZIA 4UQYA 1N11A 2VSNA 1HH8A 2VGYA 3G2UA 2JABA 3AS5A 4APFA 3QWVA 3TAXA 2I2OA 3ESLA 4EZLA 5AARA 3LVQE 5D2MC 2E2EA 3FUHA 4XEIG 3FTUA 4FHKA 2LSUA 5AN8A 4CRWA 3Q7FA 4JPSA 1K8KG 1OWNA 2DWZA 1TJCA 4GCOA 5FQ4A 3ZUVB 2WMNA 2Q7FA 4FADA 4F1PA 3QK0A 3PNTB 4O1PA 4YDYA 3UM2A 3QAQA 4WNDA 3VTXA 2VJ8A 1TNYA 4UUCA 1JWGA 4F6RD 2KATA 1N0RA 2WXPA 3GZSA 3UQ3A 2XQ0A 1FPPA 5IY5E 3OXFA 2NXPA 4ACKA 3SO8A 4EZJA 3ZYLA 1O1TA 5KNHD 1Z3YA 4E85A 3BU8A 3ASGA 3Q75A 5ENRD 3UPVA 1Z3XA 4CEMA 1XNFA 2DYSE 5T8IA 3O4ZA 4GA0A 2H6GA 4FULA 1SA4A 1FT1A 1OT8A 2P2CP 2KXPC 1UOHA 4IYPA 1PY1A 2IQCA 1IQRA 1FVHA 3DPDA 3ZHEA 4R7LA 1UG3A 3I4RB 1KZPA 3MYVA 3FUDA 4ZHBA 3FTZA 3SHFA 3CVVA 3KSLA 2WXGA 3BG0B 4N3BA 4UI9J 5FWQA 2WMOA 3MKRA 3CQGB 3DSTA 2IF4A 3TGOA 2AXUA 3V31A 2BUGA 3HRAA 3I4GA 1SW6A 3KEZA 2X3MA 1LTXA 1SA5A 4E6HA 2CG2A 1IYGA 3PRZA 3AG2E 4I2WA 4GTVA 2GRRB 3PE4A 3FTYA 4GA2A 4TXPA 2P9KG 5A6CA 3ZGQA 4WNGA 2WXIA 3FTSA 5CEAA 1NA3A 3HXDA 3ZEFA 4N2SA 5AQ7A 3MEKA 1BI8B 4B93B 3P2BA 4B94A 1FT2A 2EIJE 3IHYA 3Q5MA 4LUNU 4BT9A 2I1JA 4RVBA 2KM4A 3L82A 1G3NB 1QQEA 3PZ4A 3ZYKA 4GMJA 2ETAA 3ONLA 3VLEA 3CKBA 3EUVA 1BD8A 2KZTB 2XPIA 3VLDA 3IKOB 3C72A 2ZU6B 3QWPA 3R9MA 4JEUA 4XI9A 5G04J 4JHRA 4NIKA 1HE8A 4LERA 1KLXA 4AV7A 1H6PA 3FTVA 2H6IA 3D9PA 3Q79A 5JHBA 4AJWA 4JHKA 3I3NA 2PNNA 4GTQA 2VTBB 3U4TA 4AM9A 3JXIA 3PS6A 1PAQA 4BEPA 1E8WA 2VGXB 4U8HA 3E4BA 4W9RA 3W9FA 3ESKA 3ZRHA 4OVVA 2RD0A 3CVQA 2XGOA 4O1OA 3LJ3A 1OCCE 2HE0A 2XCCA 1ELWA 5CBOA 4LG6A 5BW8C 4B0ZA 1H2TC 4G8KA 4FA6A 2Y0BG 3HVEB 2VQ2A 4WNEA 3SZ7A 3LCAA 2WXFA 2L6BA 4A55A 3MV3B 4OYSA 2XENA 3EIJA 4YDOA 3PUJA 4YVQC 4UI9C 2BF0X 3NAWA 1E8ZA 3J5PA 1DCQA 4PS3A 3HYMB 4UWGA 5FZQA 3VLFA 3DEPA 2H6HA 4RQIA 2IOLA 4EBAA 1SQMA 4KVMA 4U07A 3CKCA 3UMVA 1WAO1 5DIZA 2KZTA 4GPMA 2AVPA 3MCXA 4ME2A 3DEOA 2BKGA 3FU0A 3R7RA 3KAEA 3ZW3A 5FTPA 5ITZF 2P9PG 1H2VC 3QKYA 4L1BA 3S2AA 5CRVA 3ASOE 4RLYA 3P1UA 4ABNA 3OXLA 2GRLA 4JW1A 3AS4A 4AXHA 2VGXA 5T4YA 3AU4A 4I17A 2CHXA 4LRZA 5FJYA 4UWLA 1KZOA 5G04C 4U95D 4OAUC 4BT8A 3W9GA 4MLPA 2GRPB 2Y4UA 2V5QC 2QYUA 1N4SA 2LSVA 4AIFA 4Z68A 1INZA 1DCEA 4G8LA 5AIJA 4DLQA 4BERA 1N52A 4XKBA 4YDEA 3CHMA 3FP3A 5EX0A 3HXCA 2C0LA 1UJKA 4GTPA 2AXVA 4J8FA 3RRUA 2QFCA 1IHGA 4UQXA 4UWHA 1W3BA 3RRMB 1JUQA 1OCRE 4LNGA 4RG9A 3AG3E 3B7SA 1TNZA 5E76A 2ZGDA 3N71A 4A3TA 2OCCE 3CIAA 4GZ5A 3R7QA 4BWRA 2I9CA 4HNAD 2CFUA 3C98A 3TWTA 2QYJA 2RG8A 2CHWA 4XKCA 4YNDA 3JXJA 3ZFWA 2P9LG 4JEHA 3SBTB 2PQRA 3DWLG
chains in the Genus database with same CATH topology
3ZN3A 2IONA 1OUVA 4JPSA 3UT7A 4U0UA 4JZYA 4PDXA 2GRMA 5G05C 1OWNA 4KZCA 3I5PA 3ZYMA 4GZ3A 2WQHA 1TJCA 3GW4A 3SD5A 4ACLA 5KJKA 4GCOA 2WPVA 5FQ4A 2WMNA 3LY7A 1TEZA 2Q7FA 4FADA 3CSTA 2VTBA 2YINA 3QK0A 1KT1A 3PNTB 1QZ2A 4H7YA 2OOEA 3CQCB 3QAQA 4WNDA 3VTXA 4CDNA 1E7UA 2VJ8A 3LPZA 3PEUB 1JWGA 2WB2A 1E7VA 2KATA 3HHMA 2WXPA 4I1MA 2C0MA 3GZSA 3ASFA 4N3AA 3TG4A 3UQ3A 3PZDA 4BTBA 2XQ0A 3PEVB 4G2VA 3L13A 3OXFA 2NXPA 2FBNA 2WXMA 4ACKA 5LCWC 3RO3A 3ZIMA 4EZJA 2JEKA 3CV0A 2MRIA 3ZYLA 1E96B 2AXZA 4IN3B 4U0ZA 4EPZA 3FUIA 1Z3YA 3Q15A 4E85A 5AJLA 2KCVA 1OWMA 3ASGA 3EIQC 2WXLA 3UPVA 2HM8A 2QY7A 2I1KA 3JQ1A 2Y4TA 3CK8A 4NRHB 4DI3A 4HVBA 1Z3XA 3MGBA 4CT4A 3FUEA 4RG6A 4KYOB 1XNFA 1H0AA 3HDXA 4CEMA 1JPLA 2LNIA 5G55A 4N2QA 5T8IA 2VYIA 2KCKA 3O4ZA 4J6IA 2KCLA 4HXIA 3TXNA 4GA0A 3HVEA 4FULA 3RRNB 3S7BA 3CVUA 4M3OA 4BSXA 3O48A 3PH0C 5KJLA 2IU1A 4HFGA 4ILHB 4IYPA 1PY1A 2DCPA 1IQRA 1FVHA 2IQCA 3DPDA 3ZHEA 4R7LA 1UG3A 2WVIA 3I4RB 3TL5A 1WY6A 3MYVA 5ARFA 2XCBA 2WM9A 2AWIA 3PE3A 3FUDA 4AOFA 4IRUA 3FTZA 3L08A 4GYWA 3SHFA 3FHEA 3SFZA 1S0PA 3CVVA 3IEGA 4FU3A 3AS8A 4F3VA 4EECA 2WXGA 3D9NA 3PVLA 3BG0B 4FLHA 4N3BA 4N3CA 3Q47B 4UI9J 5FWQA 3CVWA 2HO1A 2WMOA 2WXOA 4L23A 4CDRA 3MKRA 3CQGB 4AY6A 1EPUA 4C9BB 4A1SA 3D9KA 3D9JA 3CVPA 3G2SA 2IF4A 3TGOA 3ML9A 2KC7A 3B7RL 4YVOA 2AXUA 3FH7A 3B7TA 3SI5A 2ILRA 2BUGA 2I6HA 4J0UA 3ULQA 4CGVA 4GPKA 4FJYA 3D3MA 3I4GA 1HFAA 5BNWA 3KEZA 2X3MA 3U66A 4E6HA 2CG2A 2J4BA 1DNPA 1QNFA 4DK5A 2WQ6A 3TJPA 3FDHA 3ASHA 1IYGA 3PRZA 4HOUA 3CGHA 4H7XA 4I2WA 2DIWA 3T8MA 3NQPA 3FU6A 3OAWA 2YHEA 3JYSA 4HOSA 3PE4A 1GW6A 4FP7A 3FTYA 4GA2A 2L6JA 2HR2A 3L17A 5FQ7A 3PNLB 4L2LA 5A6CA 1X5BA 1H2UA 3ZGQA 1FCHA 5CMWA 4UWKA 4U0SA 1HG5A 4NACA 4FC8A 4BX9A 2V8SE 3S7JA 5KJNA 4WNGA 3QOUA 2WXIA 1UW4B 3L16A 4GA1A 3AU5A 3FUMA 3FTSA 5G05J 4XZ4A 4WNFA 1NA3A 2XHEA 3ZEFA 1ELKA 4N2SA 1HU3A 3MEKA 4ANXA 4JA9A 3G2TA 4U04A 3UX4A 4N39A 1E8XA 3MKQB 1TJFA 3SNXA 4AP2A 3P2BA 4APOA 4B94A 4WWNA 3IHYA 4C0MA 3Q5MA 4G1TA 4LUNU 4WWOA 4BT9A 2I1JA 4RVBA 2KM4A 3S7FA 1QQEA 4JL0A 3ZYKA 4GMJA 4GB9A 3CVXA 1JWFA 4PH4B 2V0PA 4PS7A 5ANLA 3ONLA 3LS8A 3FUJA 2AW6A 3CKBA 4G23A 3VLEA 4G26A 3WXXA 3IV0A 3U9WA 4J8DA 3LDZA 4NQ0A 2KZTB 3EHNA 2WQ7A 4ATGA 2XPIA 2YHCA 4ANWA 3APDA 3VLDA 3IKOB 2XRZA 2ZU6B 3QWPA 4J8EA 5HI7A 3EHMA 4JEUA 3FUKA 5ARGA 3GZ2A 4ILIA 4XI9A 4MRUA 5G04J 2XPYA 3IHVA 4JHRA 5AYWD 3QDNA 2X38A 3LKUA 2EQXA 2XGMA 3EJNA 1HE8A 1Y6IA 1KLXA 3QC1A 3QWWA 3HIZA 4LERA 5LOZA 1SZ9A 3FTVA 4AV7A 1VDYA 3D9PA 2R5SA 2CFZA 5CCMA 5JHBA 4AJWA 4JHKA 4I6JA 3I3NA 4LCTA 4PS8A 4RSYA 3TXMA 2VTBB 3U4TA 4AM9A 3SF4A 1MHQA 3PS6A 4Q94A 1L5JA 3Q49B 3CSFA 4GZCA 4GCNA 1PAQA 2XEVA 3FWVA 4BFRA 3ML8A 4KXKB 3ASDA 2C2LA 1E8WA 2FI7A 2L0IA 3QJZA 3NZUA 2VGXB 4U8HA 5T3RA 4C0EA 2VSOE 3E4BA 3KS2A 4HOQA 4N5CA 3ESKA 4W9RA 3ZYQA 5BV0A 1U3CA 3LEWA 3RKVA 5LFAA 5G2NA 4HS2A 3BEEA 2J4DA 5C1DA 3ZRHA 4HOTA 1A17A 4OVVA 2RD0A 4U63A 1SZAA 3PREA 4MKTA 1HS6A 3Q4AB 3CVQA 3MZLB 4PUCA 2XGOA 3T5VA 1NP7A 2XRYA 3CR3A 4K03A 4WAFA 4ANUA 2L9BA 3LJ3A 3FY4A 5J90A 3MV2B 2XCCA 1ELWA 4JVSA 4I2ZA 5BW8C 2YNQA 4B0ZA 4G25A 1H2TC 5LP0A 4DJAA 3G2VA 4XE0A 3UT4A 3LYAA 4KBQA 3MX3A 2X6IA 1UJJA 4FA6A 2LAHA 5AENA 3HVEB 2VQ2A 4WNEA 3SZ7A 2IFUA 3ZXSA 5LX8A 2XPZA 3LCAA 5JJTA 2Y3AA 2WXJA 3FTWA 3L54A 5AJDA 5BUZA 2WXFA 4A55A 2V4LA 3MV3B 4OYSA 5HQ8A 5ENNA 3EIJA 2UY1B 3PUJA 4V3IA 3U64A 4ANVA 4LEUA 4BY6A 1HZ4A 2GW1A 3NF1A 2OVFA 3TG5A 4YVQC 3ZPJA 2ONDA 4UI9C 3SGHA 4IULA 4AVXA 4URKA 3CVYA 2BF0X 2IJGX 1NZNA 5ANRA 3CK9A 3B7UX 3NZSA 3D9IA 4QFVA 1E8ZA 2FO7A 4F1SA 3KD7A 3PUKA 5A7DB 3U3WA 4D10C 2M63A 4Y6CA 3MKQA 2WXQA 4PS3A 3HYMB 4UWGA 5E75A 3B13A 2L0TB 3CVNA 5FZQA 5M72A 3GZ1A 4EZKA 5BV1A 3K9IA 3FH8A 1ZU2A 3FTXA 5BPPA 1HF8A 3VLFA 1WM5A 1UN9A 1HX8A 2IOLA 1NA0A 4EBAA 3GYZA 1SQMA 2R17C 3APCA 1H19A 4KVMA 4U07A 2WXHA 3CKCA 3CHOA 3UMVA 1XGWA 4P29A 4B8CB 4HORA 1WAO1 3VTYA 1ELRA 4GYYA 5DIZA 4DPRA 5FQ6A 2KZTA 2LO6A 2OV8A 3R9AB 2AVPA 3MCXA 3CHQA 4ME2A 3D9LA 3QNKA 2PM6A 2X6KA 2FF4A 5EDSA 3CK7A 4KZ0A 3FU0A 3R7RA 3JQ0A 2FULA 2J49A 3KAEA 2GGFA 3ZW3A 4TV3A 4A3VA 2R59A 3D9MA 4AEZC 3LVRE 5FTPA 4I43A 5LCWJ 1PC2A 4EBAG 5CMYA 2WXKA 3DBSA 2X6FA 4GMLA 4NURA 1OWPA 5D0OD 4JA7A 5KCMA 4DLOA 4WUYA 2HYZA 1H2VC 3PDNA 5KJMA 4BX8A 3L6AA 2VSYA 1EF1C 3QKYA 1DVPA 4XI0A 5CCLA 4L1BA 4GAAA 2OVBA 1YA0A 3S2AA 4I6EA 3QARA 4EQFA 2UWJG 3OTNA 1HXIA 4G11A 3FH5A 3SBSA 2J09A 1U3DA 3P1UA 4GYOA 3CEQA 2VSXE 4J8SA 3LY8A 3OXLA 2NC9A 2GRLA 2J9QA 5FZRA 4ABNA 2V5FA 4JW1A 3MJWA 2CHZA 5A23A 3AS4A 4KMOA 5CHEE 1EYHA 4AXHA 2BTDA 4BTAA 1B89A 2VGXA 5T4YA 5JJ7A 3JUIA 4HLEA 2IOSA 3AU4A 5FZSA 2FEZA 4XX5A 3UUXA 5EKQD 4I17A 2CHXA 3JCKC 3D9OA 4LRZA 5FJYA 2J08A 4UWLA 5FQ8A 1P5QA 4I9CA 4K0RA 4Q96A 4FHJA 4CDMA 4KT6B 4JXTA 2X6HA 5G04C 4BT8A 3RIBA 3IBEA 2DBAA 3FUNA 2E0IA 2PL2A 1H6KA 2MOWA 2PQNA 4G24A 4MLPA 2Y4UA 4MS6A 5JHAA 4FJZA 3ENEA 2LSVA 4AIFA 4CT0A 4XIFA 1ZBPA 4AY5A 1E8YA 1KT0A 4UQZA 3QB2A 4TRQA 1INZA 2WXNA 1E90A 3OXGA 3RO2A 1UN8A 2UY1A 4DLQA 5AIJA 5J08A 1N52A 3ZVVA 4I1AA 1HO8A 3FEYA 3ONKA 4XKBA 4DI4A 3L22A 3MA5A 2CG3A 2JLBA 3CHMA 1Y8MA 3EDTB 2P58C 3BG1B 3FP3A 5EX0A 4F7AA 3UT8A 2YQ8A 3RJVA 3FU5A 4L2YA 4WWPA 3RK6A 2C0LA 3FFLA 4I1OB 4I9EA 4CCAA 1UJKA 3G2WA 3ZHEB 2AXVA 4J8FA 3RRUA 3RU0A 2MHKA 2QFCA 1OWOA 4OVUA 2X6JA 1IHGA 4O6FA 4KVOA 4UQXA 4UWHA 4UI9K 1W3BA 3RRMB 1JUQA 4I6GA 1Z6TA 3APFA 5JJ6A 3CHRA 2LAIA 1BPOA 3T5XA 4JC8A 4L7TA 1MQSA 4RG9A 5DBKA 3CHSA 4B89A 3CVLA 4JHJA 4B8AA 2A4ZA 1OWLA 3B7SA 1N54A 4GZDA 4F53A 5E76A 3N71A 2XGSA 3CLJA 3FULA 5EX3A 4UWFA 5BT1A 1IQUA 2PZIA 5C2YA 3LY9A 4A3TA 3CIAA 4UQYA 4GZ5A 3R7QA 2VSNA 1HH8A 2VGYA 4BWRA 4A1GA 3G2UA 2I9CA 2NSZA 3FUFA 2CFUA 3C98A 3AS5A 4ILGA 4Y6WA 2PM7A 4CGWA 4APFA 3QWVA 3S7DA 5FT9A 3TAXA 2I2OA 3FEXA 3ESLA 2RG8A 2CHWA 1HG2A 4XKCA 4YNDA 4EZLA 3CHPA 2A5UA 4JEHA 3SBTB 3ZFWA 4GZ6A 3LXUX 4TUUA 2PQRA 1LF8A 3LVQE 2WXRA 4GU5A 4Q69A 1EDUA 2E2EA 4FLBA 3FUHA 3FTUA 1FVFA 2J07A 4FHKA 2LSUA 3FU3A 3URZA 4CRWA 5D0QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZN3 A;  1OUV A;  4U0U A;  5G05 C;  4GZ3 A;  2WQH A;  1TJC A;  3GW4 A;  5KJK A;  4GCO A;  2WPV A;  3LY7 A;  2Q7F A;  1KT1 A;  1QZ2 A;  4H7Y A;  2OOE A;  4WND A;  3VTX A;  3LPZ A;  2KAT A;  2C0M A;  3TG4 A;  3ASF A;  4N3A A;  3UQ3 A;  4BTB A;  4G2V A;  3OXF A;  2FBN A;  5LCW C;  3RO3 A;  3CV0 A;  1E96 B;  4IN3 B;  4U0Z A;  3Q15 A;  2KCV A;  3ASG A;  3UPV A;  2Y4T A;  3CK8 A;  4NRH B;  4RG6 A;  4KYO B;  1XNF A;  2LNI A;  4N2Q A;  2VYI A;  2KCK A;  2KCL A;  4GA0 A;  3S7B A;  3O48 A;  5KJL A;  3ZHE A;  5ARF A;  2XCB A;  3PE3 A;  4GYW A;  3IEG A;  3AS8 A;  4F3V A;  4N3B A;  4N3C A;  3Q47 B;  4UI9 J;  2HO1 A;  4CDR A;  3MKR A;  4AY6 A;  4A1S A;  3CVP A;  2IF4 A;  3TGO A;  2KC7 A;  4YVO A;  2BUG A;  2I6H A;  4J0U A;  3ULQ A;  4CGV A;  4GPK A;  5BNW A;  3ASH A;  1IYG A;  4HOU A;  4H7X A;  4I2W A;  3JYS A;  4HOS A;  3PE4 A;  4GA2 A;  2L6J A;  2HR2 A;  5A6C A;  3ZGQ A;  1FCH A;  4U0S A;  3S7J A;  5KJN A;  4WNG A;  3QOU A;  4GA1 A;  5G05 J;  4WNF A;  1NA3 A;  4N2S A;  3MEK A;  4JA9 A;  4U04 A;  4N39 A;  4APO A;  4B94 A;  3Q5M A;  4G1T A;  4BT9 A;  3S7F A;  1QQE A;  4JL0 A;  4G23 A;  3CKB A;  3WXX A;  4G26 A;  4J8D A;  4NQ0 A;  2XPI A;  2YHC A;  3QWP A;  4J8E A;  5HI7 A;  5ARG A;  3GZ2 A;  4XI9 A;  5G04 J;  4JHR A;  5AYW D;  3QDN A;  3LKU A;  2XGM A;  3QWW A;  1KLX A;  2R5S A;  5CCM A;  3U4T A;  4AM9 A;  3SF4 A;  3Q49 B;  4GCN A;  2XEV A;  3FWV A;  4KXK B;  3ASD A;  2C2L A;  2FI7 A;  2VGX B;  3E4B A;  3KS2 A;  4HOQ A;  4N5C A;  3ESK A;  4W9R A;  3RKV A;  3BEE A;  5C1D A;  4HOT A;  1A17 A;  3Q4A B;  3CVQ A;  2XGO A;  3MV2 B;  2XCC A;  1ELW A;  4I2Z A;  5BW8 C;  4G25 A;  3LYA A;  4KBQ A;  4WNE A;  2VQ2 A;  3SZ7 A;  2IFU A;  3LCA A;  5JJT A;  5HQ8 A;  3MV3 B;  2UY1 B;  4LEU A;  1HZ4 A;  2GW1 A;  3NF1 A;  3ZPJ A;  3TG5 A;  4YVQ C;  2OND A;  4UI9 C;  1NZN A;  3CK9 A;  2FO7 A;  3KD7 A;  5A7D B;  3U3W A;  4Y6C A;  3HYM B;  3CVN A;  5M72 A;  5FZQ A;  3GZ1 A;  3K9I A;  1ZU2 A;  1WM5 A;  1NA0 A;  3GYZ A;  4U07 A;  3CKC A;  4HOR A;  1WAO 1;  3VTY A;  1ELR A;  4GYY A;  5DIZ A;  3R9A B;  2AVP A;  4ME2 A;  2FF4 A;  3CK7 A;  3KAE A;  5FTP A;  5LCW J;  1PC2 A;  5D0O D;  4JA7 A;  5KJM A;  4WUY A;  2HYZ A;  3PDN A;  2VSY A;  3QKY A;  4XI0 A;  5CCL A;  1YA0 A;  4EQF A;  2UWJ G;  1HXI A;  4GYO A;  3CEQ A;  3LY8 A;  3OXL A;  2NC9 A;  5FZR A;  2J9Q A;  4ABN A;  2V5F A;  3AS4 A;  5CHE E;  4BTA A;  5JJ7 A;  1B89 A;  2VGX A;  5FZS A;  2FEZ A;  3UUX A;  5EKQ D;  4I17 A;  5FJY A;  1P5Q A;  4I9C A;  5G04 C;  4BT8 A;  3RIB A;  2DBA A;  2PL2 A;  2PQN A;  4G24 A;  2Y4U A;  2LSV A;  4AIF A;  4XIF A;  1ZBP A;  4AY5 A;  4UQZ A;  1KT0 A;  3OXG A;  3RO2 A;  2UY1 A;  4I1A A;  3MA5 A;  2JLB A;  1Y8M A;  3EDT B;  2P58 C;  3FP3 A;  5EX0 A;  2YQ8 A;  3RJV A;  2C0L A;  3FFL A;  4I9E A;  3ZHE B;  4J8F A;  3RU0 A;  2MHK A;  2QFC A;  1IHG A;  4O6F A;  4UQX A;  4UI9 K;  1W3B A;  5JJ6 A;  5DBK A;  4RG9 A;  3CVL A;  3N71 A;  2XGS A;  5EX3 A;  5BT1 A;  2PZI A;  3LY9 A;  4UQY A;  4GZ5 A;  2VSN A;  1HH8 A;  2VGY A;  4BWR A;  3AS5 A;  4Y6W A;  4CGW A;  3QWV A;  3S7D A;  5FT9 A;  3TAX A;  4YND A;  3ZFW A;  4GZ6 A;  2PQR A;  2E2E A;  2LSU A;  3URZ A;  5D0Q D; 
#chains in the Genus database with same CATH topology
 2ZXW E;  1X81 A;  2ION A;  4JZY A;  4PDX A;  2GRM A;  5G05 C;  2AJA A;  3I5P A;  1KPS B;  4GZ3 A;  4HRL A;  3GW4 A;  3SD5 A;  1TEZ A;  1KT1 A;  3SQV A;  3PEU B;  4I1M A;  4C48 B;  4N3A A;  4BTB A;  3L13 A;  2J8S D;  3ZIM A;  2JEK A;  3CV0 A;  2MRI A;  1E96 B;  3T8K A;  4IN3 B;  2WXL A;  2HM8 A;  2QZA A;  2QY7 A;  2Y4T A;  3LJN A;  4RG6 A;  5G55 A;  4N2Q A;  4A63 B;  2KCK A;  4J6I A;  4HXI A;  1RW2 A;  4OAV B;  4M3O A;  1Q2Z A;  3Q7A A;  5KJL A;  2IU1 A;  4ILH B;  2BKK B;  2DCP A;  5ARF A;  4AOF A;  3L9T A;  5HKP A;  4FU3 A;  4F3V A;  3D9N A;  2HO1 A;  5B3S E;  2WXO A;  1Z5S C;  3D9J A;  2ILR A;  3ULQ A;  4CGV A;  4GPK A;  3KSQ A;  1HFA A;  3U66 A;  1QYM A;  3TJP A;  3FDH A;  4ZFH A;  4HOU A;  2DIW A;  3NQP A;  3TWR A;  4HOS A;  2IO3 C;  4L2L A;  4U0S A;  3S7J A;  5KJN A;  3UKU G;  3QOU A;  1UW4 B;  2BED A;  3SFX A;  1ELK A;  4JA9 A;  3F6Q A;  3G2T A;  3B95 A;  4N39 A;  3DXK G;  1TJF A;  4APO A;  2F0Y A;  4WWN A;  2QC9 A;  4C0M A;  3IXE A;  4G1T A;  2R02 A;  3ULY A;  4PS7 A;  5ANL A;  3FUJ A;  3NB2 A;  4G23 A;  4DX1 A;  3IV0 A;  3LDZ A;  4ATG A;  4ANW A;  3APD A;  4HLL A;  3EHM A;  3GZ2 A;  1NFI E;  2XPY A;  5AYW D;  5FIN A;  4TXQ A;  2R5S A;  1H6O A;  3TXM A;  3Q49 B;  3CSF A;  4GCN A;  4U8Y D;  2FI7 A;  2L0I A;  3PZ1 A;  2DVW A;  3ZYQ A;  3KS2 A;  4N5C A;  5BV0 A;  3BEE A;  4HOT A;  4GTS A;  3Q9U C;  1HS6 A;  3Q4A B;  4PUC A;  3T5V A;  2XRY A;  3CR3 A;  2L9B A;  5J90 A;  3MV2 B;  4I2Z A;  4G25 A;  5KNG A;  4DJA A;  1AP7 A;  3UT4 A;  3LYA A;  3MX3 A;  2X6I A;  1UJJ A;  2LAH A;  5AEN A;  2IFU A;  2XPZ A;  5JJT A;  5ENP D;  5BUZ A;  5HQ8 A;  4V3I A;  1HZ4 A;  2GW1 A;  2OVF A;  2ZIS A;  2OND A;  3E37 A;  4IUL A;  5CBN A;  3CVY A;  5KWD A;  4HI8 A;  4BSZ B;  1O1S A;  3B7U X;  3NZS A;  4QFV A;  5A7D B;  5HRY A;  2M63 A;  2WXQ A;  3B13 A;  2L0T B;  2F8Y A;  3FTX A;  4GTM A;  4GTO A;  1NA0 A;  3APC A;  3C5R A;  3BUA A;  2WXH A;  3CHO A;  5AQA A;  4P29 A;  4K5B A;  3R9A B;  4O60 A;  1N9A A;  2X6K A;  5CRU A;  4CZ2 D;  3CK7 A;  4KZ0 A;  5B1A E;  2GGF A;  4A3V A;  2OEV A;  3D9M A;  4AEZ C;  3LVR E;  3ZKJ A;  4I43 A;  5LCW J;  4EBA G;  2WXK A;  5KJM A;  3PDN A;  1EF1 C;  1MX4 A;  4XI0 A;  4I6E A;  2LXL A;  1TN8 A;  3CEQ A;  2EIN E;  2VSX E;  4JD2 G;  2NC9 A;  3MJW A;  5A23 A;  3JUI A;  4HLE A;  2EIM E;  4JB8 P;  1MX2 A;  1YYH A;  5ENO D;  2FEZ A;  4XX5 A;  4I9C A;  4K0R A;  4Q96 A;  3UI2 A;  2X6H A;  3IBE A;  4U8V D;  4MS6 A;  3V2X A;  3EHQ A;  4CT0 A;  4XIF A;  3TWX A;  4AY5 A;  1E8Y A;  1KT0 A;  2WXN A;  1E90 A;  1UN8 A;  5J08 A;  4DI4 A;  1HO8 A;  3L22 A;  1Y8M A;  2NYJ A;  3BG1 B;  3UT8 A;  2YQ8 A;  3RJV A;  3RK6 A;  2GRO B;  2XS1 A;  4I9E A;  1O1R A;  4CCA A;  2EIK E;  2R05 A;  3RU0 A;  4OVU A;  3AJI A;  4BET A;  4DRX E;  1Z6T A;  2LAI A;  2XZD G;  1BPO A;  5DBK A;  1N94 A;  4B89 A;  4B8A A;  4LNB A;  3CVL A;  3HXF A;  2A4Z A;  2P9S G;  1ZB1 A;  1LD7 A;  4UWF A;  4DX2 A;  3LY9 A;  1BI7 B;  5JMN D;  3TWS A;  4A1G A;  3UIO C;  2NSZ A;  4Y6W A;  4ILG A;  5CEC B;  2PM7 A;  4CGW A;  3EU9 A;  3FEX A;  3HXE A;  1HG2 A;  1WG0 A;  2H6F A;  4GZ6 A;  3LXU X;  4TUU A;  1LF8 A;  1JCR A;  2WXR A;  3TWQ A;  4FLB A;  1FVF A;  3FU3 A;  5D0Q D;  3UT7 A;  3PZ3 A;  4YDW A;  2WQH A;  3E33 A;  5KJK A;  1IXV A;  3LY7 A;  2VTB A;  2OOE A;  2KBX A;  3LPZ A;  1E7V A;  5HS0 A;  2C0M A;  3TG4 A;  3ASF A;  5CED B;  3PZD A;  4LNU D;  3JUE A;  2FBN A;  2WXM A;  5LCW C;  3RO3 A;  2AXZ A;  4EPZ A;  4U0Z A;  3FUI A;  3Q15 A;  3DXM G;  5AJL A;  2KCV A;  1OWM A;  2VGE A;  2I1K A;  3JQ1 A;  4NRH B;  4DI3 A;  3X2Q E;  4CT4 A;  2Y69 E;  3FUE A;  4HQD A;  2RFA A;  4KYO B;  1H0A A;  3HDX A;  2LNI A;  3SFY A;  1LD8 A;  3TXN A;  1V55 E;  3HVE A;  3S7B A;  3DSU A;  3CVU A;  1D9S A;  4BES A;  4M7C A;  3TL5 A;  1WY6 A;  2XCB A;  2WM9 A;  2AWI A;  3PE3 A;  3NBN B;  1RZ4 A;  4IRU A;  4GYW A;  3FHE A;  1S0P A;  5EIB E;  4EEC A;  3PVL A;  4FLH A;  3CVW A;  3Q47 B;  4L23 A;  1EPU A;  3G2S A;  4J8Y A;  3ML9 A;  4YVO A;  3SI5 A;  3FH7 A;  3B7T A;  4J0U A;  2MYO A;  1BLX B;  2J4B A;  1DNP A;  3WG7 E;  3B7B A;  3CGH A;  4H7X A;  3OAW A;  3JYS A;  1GW6 A;  4FP7 A;  1O5M A;  4DX7 D;  2L6J A;  3L17 A;  3PNL B;  4HRM B;  1H2U A;  1FCH A;  5H7P A;  3L16 A;  3ABL E;  4XZ4 A;  4WNF A;  3E34 A;  4ANX A;  5EN5 D;  4U04 A;  1TNU A;  3RSE G;  1SVX A;  3KEA A;  3S7F A;  4GB9 A;  3CVX A;  4PH4 B;  2V0P A;  3AG4 E;  2AW6 A;  3DSX A;  2XEH A;  4G26 A;  3ULE G;  4NQ0 A;  2WQ7 A;  2XRZ A;  4J8E A;  4HBD A;  5HI7 A;  5ARG A;  4ILI A;  4GMR A;  2IEJ A;  3IHV A;  2IY0 C;  2XGM A;  1Y6I A;  1JCQ A;  3EJN A;  3V2O A;  3HIZ A;  3AAA C;  1VDY A;  2F37 A;  2CFZ A;  3UM3 A;  5AQB A;  1K1B A;  4LCT A;  4PS8 A;  4Q94 A;  5EYP F;  4BFR A;  3ML8 A;  3ASD A;  2C2L A;  5T3R A;  4C0E A;  3RKV A;  4U96 D;  5G2N A;  5C1D A;  1MJ0 A;  1A17 A;  1SZA A;  3PRE A;  3C3O A;  4MKT A;  2DYR E;  3MZL B;  1NP7 A;  4K03 A;  4ANU A;  3UKR G;  4JVS A;  2YNQ A;  4K5A B;  5LP0 A;  3G2V A;  4GTT A;  3ZXS A;  5LX8 A;  3C3R A;  3L54 A;  5AJD A;  4BY6 A;  4AVX A;  4URK A;  2IJG X;  5ANR A;  3CK9 A;  4F1S A;  3U3W A;  4TXR A;  1TN7 A;  5E75 A;  4EZK A;  1ZU2 A;  1UN9 A;  1HX8 A;  3GYZ A;  2R17 C;  3ABM E;  4HOR A;  1ELR A;  5D66 A;  2LO6 A;  2OV8 A;  1S63 A;  3D9L A;  3QNK A;  5EDS A;  1S70 B;  3TWW A;  3JQ0 A;  2FUL A;  5CMY A;  4GML A;  4DLO A;  4NUR A;  1OWP A;  2P9I G;  4WUY A;  1N4Q A;  4BX8 A;  2RFM A;  2VSY A;  5CCL A;  2OVB A;  1YA0 A;  2UWJ G;  5ENS D;  4G11 A;  3FH5 A;  3SBS A;  2A5E A;  1YCS B;  4GYO A;  4J8S A;  5ENQ D;  2V5F A;  4KMO A;  1EYH A;  4BTA A;  2BTD A;  5JJ7 A;  1B89 A;  4DX5 D;  5BXU A;  5FZS A;  3PZ2 A;  3D9O A;  2J08 A;  1P5Q A;  4J7W A;  4FHJ A;  4JXT A;  3RIB A;  2DBA A;  2P9N G;  4DX6 D;  3UM1 A;  2MOW A;  2PQN A;  4FJZ A;  3V30 A;  1ZBP A;  3EU5 A;  3D9H A;  3ZVV A;  2B6C A;  3ONK A;  3MA5 A;  3EDT B;  2P58 C;  1D8D A;  4F7A A;  1N0Q A;  4WWP A;  4L2Y A;  3ZU7 B;  3FFL A;  5BXO A;  1OWO A;  2X6J A;  4HI9 A;  4KVO A;  1OCZ E;  3CHR A;  3T5X A;  4JC8 A;  1MQS A;  3CHS A;  1OWL A;  3Q9N C;  1N54 A;  2XGS A;  3CLJ A;  5EX3 A;  5BT1 A;  1IQU A;  5C2Y A;  3E32 A;  3FUF A;  1TN6 A;  3S7D A;  5FT9 A;  1OCO E;  3CHP A;  2A5U A;  4GU5 A;  1K3Z D;  4Q69 A;  1EDU A;  2P9U G;  2J07 A;  3URZ A;  1MZC A;  3ZN3 A;  1OUV A;  4U0U A;  4KZC A;  3ZYM A;  1N95 A;  4ACL A;  2WPV A;  2R03 A;  3CST A;  2YIN A;  1QZ2 A;  4H7Y A;  3CQC B;  1OXJ A;  4CDN A;  1E7U A;  4HRN A;  5EYL A;  3T9K A;  3UIP C;  2WB2 A;  3HHM A;  1NI1 A;  4G2V A;  3PEV B;  5FIO A;  3UM0 A;  1JCS A;  3EIQ C;  3AG1 E;  3CK8 A;  4HVB A;  3MGB A;  1JPL A;  1QBQ A;  3HXB A;  5JA4 D;  2VYI A;  2KCL A;  2DZO A;  5CER B;  2XS8 A;  3RRN B;  3BQO A;  4BSX A;  3O48 A;  3PH0 C;  4HFG A;  3DSS A;  2Y1L E;  2WVI A;  2LUH A;  1NL4 A;  3TWV A;  3L08 A;  3SFZ A;  1S64 A;  3IEG A;  3AS8 A;  5AAO A;  4N3C A;  3E30 A;  4CDR A;  4AY6 A;  4C9B B;  4A1S A;  3D9K A;  3CVP A;  4K5C A;  3UTM A;  2KC7 A;  3B7R L;  2I6H A;  4N5Q A;  4FJY A;  3D3M A;  5BNW A;  5B1B E;  1QNF A;  3J5Q B;  4DK5 A;  2WQ6 A;  1TNB A;  2R2L A;  3ASH A;  2EIL E;  3T8M A;  3FU6 A;  2YHE A;  4EHM A;  3ISM C;  2HR2 A;  5FQ7 A;  3DSW A;  1X5B A;  5CMW A;  4UWK A;  1A5E A;  1HG5 A;  4NAC A;  4DUI A;  4FC8 A;  4BX9 A;  2V8S E;  3C3Q A;  4GA1 A;  3AU5 A;  3FUM A;  3DRA A;  5G05 J;  2XHE A;  5KBA A;  1HU3 A;  3ZNG A;  3UX4 A;  1N4P A;  1E8X A;  3MKQ B;  3SNX A;  4AP2 A;  3ZXP A;  4WWO A;  2GRQ B;  4JL0 A;  2XEE A;  3ASN E;  1JWF A;  3LS8 A;  3HG0 D;  3WXX A;  3U9W A;  4J8D A;  3Q78 A;  3EHN A;  2YHC A;  4L9P A;  1AWC B;  3FUK A;  4MRU A;  4TUM A;  3Q73 A;  3QDN A;  2X38 A;  3LKU A;  2EQX A;  3QWW A;  5LOZ A;  3QC1 A;  1SZ9 A;  5CCM A;  4I6J A;  4RSY A;  3SF4 A;  1MHQ A;  1DC2 A;  1L5J A;  5AQ9 A;  1TNO A;  4GZC A;  2XEV A;  3FWV A;  2ZIR A;  4KXK B;  3QJZ A;  3NZU A;  3RAU A;  2VSO E;  4HOQ A;  1IKN D;  1U3C A;  3LEW A;  4X8Q A;  5LFA A;  4HS2 A;  2J4D A;  3TWU A;  4U63 A;  2ZGG A;  4WAF A;  4CYM D;  3FY4 A;  2V4H C;  2FO1 E;  4XE0 A;  4KBQ A;  2Y3A A;  2WXJ A;  3DPY A;  3FTW A;  5ENT D;  2V4L A;  2LXM A;  5ENN A;  2UY1 B;  3U64 A;  4ANV A;  4LEU A;  3NF1 A;  3ZPJ A;  3TG5 A;  3NOG D;  2XZT G;  2DZN A;  3SGH A;  1YMP A;  1NZN A;  3D9I A;  2FO7 A;  3KD7 A;  3PUK A;  2ETB A;  2ETC A;  4D10 C;  4Y6C A;  3MKQ A;  3CVN A;  5M72 A;  3GZ1 A;  5BV1 A;  1OY3 D;  4ATZ D;  3K9I A;  3FH8 A;  5BPP A;  1HF8 A;  1WM5 A;  2F8X K;  2RKK A;  1H19 A;  1MYO A;  1XGW A;  4B8C B;  3VTY A;  4GYY A;  4DPR A;  5FQ6 A;  3SY2 A;  3DSV A;  3CHQ A;  2PM6 A;  2FF4 A;  2J49 A;  3UXG A;  4TV3 A;  2R59 A;  1PC2 A;  2B0O E;  2GRN B;  1N4R A;  3DBS A;  2X6F A;  5D0O D;  5KCM A;  3ABK E;  4JA7 A;  2HYZ A;  3L6A A;  1DVP A;  4GAA A;  1U2V G;  3QAR A;  3EHR A;  4EQF A;  3OTN A;  1HXI A;  2J09 A;  1U3D A;  3LY8 A;  4GTR A;  5FZR A;  2J9Q A;  2CHZ A;  5CHE E;  2OEW A;  5EIL A;  2IOS A;  3UUX A;  5EKQ D;  4HB5 A;  3JCK C;  5FQ8 A;  1BU9 A;  4CDM A;  4KT6 B;  3FUN A;  2E0I A;  2PL2 A;  1H6K A;  4G24 A;  3V79 K;  1TYQ G;  5JHA A;  3ENE A;  1D8E A;  4LSZ E;  4UQZ A;  3QB2 A;  4TRQ A;  3OXG A;  3RO2 A;  1IHB A;  2UY1 A;  4MBG A;  4I1A A;  3FEY A;  4QQI A;  3NOC D;  2IO2 C;  2CG3 A;  2JLB A;  3FU5 A;  4I1O B;  3G2W A;  4U7E B;  3ZHE B;  2MHK A;  4O6F A;  4UI9 K;  4I6G A;  3APF A;  5JJ6 A;  5EID A;  4L7T A;  1K1A A;  4JHJ A;  1MX6 A;  1V54 E;  4GZD A;  4F53 A;  1TR4 A;  1WDY A;  3FUL A;  3UIN C;  2PZI A;  4UQY A;  1N11 A;  2VSN A;  1HH8 A;  2VGY A;  3G2U A;  2JAB A;  3AS5 A;  4APF A;  3QWV A;  3TAX A;  2I2O A;  3ESL A;  4EZL A;  5AAR A;  3LVQ E;  5D2M C;  2E2E A;  3FUH A;  4XEI G;  3FTU A;  4FHK A;  2LSU A;  5AN8 A;  4CRW A;  3Q7F A;  4JPS A;  1K8K G;  1OWN A;  2DWZ A;  1TJC A;  4GCO A;  5FQ4 A;  3ZUV B;  2WMN A;  2Q7F A;  4FAD A;  4F1P A;  3QK0 A;  3PNT B;  4O1P A;  4YDY A;  3UM2 A;  3QAQ A;  4WND A;  3VTX A;  2VJ8 A;  1TNY A;  4UUC A;  1JWG A;  4F6R D;  2KAT A;  1N0R A;  2WXP A;  3GZS A;  3UQ3 A;  2XQ0 A;  1FPP A;  5IY5 E;  3OXF A;  2NXP A;  4ACK A;  3SO8 A;  4EZJ A;  3ZYL A;  1O1T A;  5KNH D;  1Z3Y A;  4E85 A;  3BU8 A;  3ASG A;  3Q75 A;  5ENR D;  3UPV A;  1Z3X A;  4CEM A;  1XNF A;  2DYS E;  5T8I A;  3O4Z A;  4GA0 A;  2H6G A;  4FUL A;  1SA4 A;  1FT1 A;  1OT8 A;  2P2C P;  2KXP C;  1UOH A;  4IYP A;  1PY1 A;  2IQC A;  1IQR A;  1FVH A;  3DPD A;  3ZHE A;  4R7L A;  1UG3 A;  3I4R B;  1KZP A;  3MYV A;  3FUD A;  4ZHB A;  3FTZ A;  3SHF A;  3CVV A;  3KSL A;  2WXG A;  3BG0 B;  4N3B A;  4UI9 J;  5FWQ A;  2WMO A;  3MKR A;  3CQG B;  3DST A;  2IF4 A;  3TGO A;  2AXU A;  3V31 A;  2BUG A;  3HRA A;  3I4G A;  1SW6 A;  3KEZ A;  2X3M A;  1LTX A;  1SA5 A;  4E6H A;  2CG2 A;  1IYG A;  3PRZ A;  3AG2 E;  4I2W A;  4GTV A;  2GRR B;  3PE4 A;  3FTY A;  4GA2 A;  4TXP A;  2P9K G;  5A6C A;  3ZGQ A;  4WNG A;  2WXI A;  3FTS A;  5CEA A;  1NA3 A;  3HXD A;  3ZEF A;  4N2S A;  5AQ7 A;  3MEK A;  1BI8 B;  4B93 B;  3P2B A;  4B94 A;  1FT2 A;  2EIJ E;  3IHY A;  3Q5M A;  4LUN U;  4BT9 A;  2I1J A;  4RVB A;  2KM4 A;  3L82 A;  1G3N B;  1QQE A;  3PZ4 A;  3ZYK A;  4GMJ A;  2ETA A;  3ONL A;  3VLE A;  3CKB A;  3EUV A;  1BD8 A;  2KZT B;  2XPI A;  3VLD A;  3IKO B;  3C72 A;  2ZU6 B;  3QWP A;  3R9M A;  4JEU A;  4XI9 A;  5G04 J;  4JHR A;  4NIK A;  1HE8 A;  4LER A;  1KLX A;  4AV7 A;  1H6P A;  3FTV A;  2H6I A;  3D9P A;  3Q79 A;  5JHB A;  4AJW A;  4JHK A;  3I3N A;  2PNN A;  4GTQ A;  2VTB B;  3U4T A;  4AM9 A;  3JXI A;  3PS6 A;  1PAQ A;  4BEP A;  1E8W A;  2VGX B;  4U8H A;  3E4B A;  4W9R A;  3W9F A;  3ESK A;  3ZRH A;  4OVV A;  2RD0 A;  3CVQ A;  2XGO A;  4O1O A;  3LJ3 A;  1OCC E;  2HE0 A;  2XCC A;  1ELW A;  5CBO A;  4LG6 A;  5BW8 C;  4B0Z A;  1H2T C;  4G8K A;  4FA6 A;  2Y0B G;  3HVE B;  2VQ2 A;  4WNE A;  3SZ7 A;  3LCA A;  2WXF A;  2L6B A;  4A55 A;  3MV3 B;  4OYS A;  2XEN A;  3EIJ A;  4YDO A;  3PUJ A;  4YVQ C;  4UI9 C;  2BF0 X;  3NAW A;  1E8Z A;  3J5P A;  1DCQ A;  4PS3 A;  3HYM B;  4UWG A;  5FZQ A;  3VLF A;  3DEP A;  2H6H A;  4RQI A;  2IOL A;  4EBA A;  1SQM A;  4KVM A;  4U07 A;  3CKC A;  3UMV A;  1WAO 1;  5DIZ A;  2KZT A;  4GPM A;  2AVP A;  3MCX A;  4ME2 A;  3DEO A;  2BKG A;  3FU0 A;  3R7R A;  3KAE A;  3ZW3 A;  5FTP A;  5ITZ F;  2P9P G;  1H2V C;  3QKY A;  4L1B A;  3S2A A;  5CRV A;  3ASO E;  4RLY A;  3P1U A;  4ABN A;  3OXL A;  2GRL A;  4JW1 A;  3AS4 A;  4AXH A;  2VGX A;  5T4Y A;  3AU4 A;  4I17 A;  2CHX A;  4LRZ A;  5FJY A;  4UWL A;  1KZO A;  5G04 C;  4U95 D;  4OAU C;  4BT8 A;  3W9G A;  4MLP A;  2GRP B;  2Y4U A;  2V5Q C;  2QYU A;  1N4S A;  2LSV A;  4AIF A;  4Z68 A;  1INZ A;  1DCE A;  4G8L A;  5AIJ A;  4DLQ A;  4BER A;  1N52 A;  4XKB A;  4YDE A;  3CHM A;  3FP3 A;  5EX0 A;  3HXC A;  2C0L A;  1UJK A;  4GTP A;  2AXV A;  4J8F A;  3RRU A;  2QFC A;  1IHG A;  4UQX A;  4UWH A;  1W3B A;  3RRM B;  1JUQ A;  1OCR E;  4LNG A;  4RG9 A;  3AG3 E;  3B7S A;  1TNZ A;  5E76 A;  2ZGD A;  3N71 A;  4A3T A;  2OCC E;  3CIA A;  4GZ5 A;  3R7Q A;  4BWR A;  2I9C A;  4HNA D;  2CFU A;  3C98 A;  3TWT A;  2QYJ A;  2RG8 A;  2CHW A;  4XKC A;  4YND A;  3JXJ A;  3ZFW A;  2P9L G;  4JEH A;  3SBT B;  2PQR A;  3DWL G; 
#chains in the Genus database with same CATH homology
 3ZN3 A;  2ION A;  1OUV A;  4JPS A;  3UT7 A;  4U0U A;  4JZY A;  4PDX A;  2GRM A;  5G05 C;  1OWN A;  4KZC A;  3I5P A;  3ZYM A;  4GZ3 A;  2WQH A;  1TJC A;  3GW4 A;  3SD5 A;  4ACL A;  5KJK A;  4GCO A;  2WPV A;  5FQ4 A;  2WMN A;  3LY7 A;  1TEZ A;  2Q7F A;  4FAD A;  3CST A;  2VTB A;  2YIN A;  3QK0 A;  1KT1 A;  3PNT B;  1QZ2 A;  4H7Y A;  2OOE A;  3CQC B;  3QAQ A;  4WND A;  3VTX A;  4CDN A;  1E7U A;  2VJ8 A;  3LPZ A;  3PEU B;  1JWG A;  2WB2 A;  1E7V A;  2KAT A;  3HHM A;  2WXP A;  4I1M A;  2C0M A;  3GZS A;  3ASF A;  4N3A A;  3TG4 A;  3UQ3 A;  3PZD A;  4BTB A;  2XQ0 A;  3PEV B;  4G2V A;  3L13 A;  3OXF A;  2NXP A;  2FBN A;  2WXM A;  4ACK A;  5LCW C;  3RO3 A;  3ZIM A;  4EZJ A;  2JEK A;  3CV0 A;  2MRI A;  3ZYL A;  1E96 B;  2AXZ A;  4IN3 B;  4U0Z A;  4EPZ A;  3FUI A;  1Z3Y A;  3Q15 A;  4E85 A;  5AJL A;  2KCV A;  1OWM A;  3ASG A;  3EIQ C;  2WXL A;  3UPV A;  2HM8 A;  2QY7 A;  2I1K A;  3JQ1 A;  2Y4T A;  3CK8 A;  4NRH B;  4DI3 A;  4HVB A;  1Z3X A;  3MGB A;  4CT4 A;  3FUE A;  4RG6 A;  4KYO B;  1XNF A;  1H0A A;  3HDX A;  4CEM A;  1JPL A;  2LNI A;  5G55 A;  4N2Q A;  5T8I A;  2VYI A;  2KCK A;  3O4Z A;  4J6I A;  2KCL A;  4HXI A;  3TXN A;  4GA0 A;  3HVE A;  4FUL A;  3RRN B;  3S7B A;  3CVU A;  4M3O A;  4BSX A;  3O48 A;  3PH0 C;  5KJL A;  2IU1 A;  4HFG A;  4ILH B;  4IYP A;  1PY1 A;  2DCP A;  1IQR A;  1FVH A;  2IQC A;  3DPD A;  3ZHE A;  4R7L A;  1UG3 A;  2WVI A;  3I4R B;  3TL5 A;  1WY6 A;  3MYV A;  5ARF A;  2XCB A;  2WM9 A;  2AWI A;  3PE3 A;  3FUD A;  4AOF A;  4IRU A;  3FTZ A;  3L08 A;  4GYW A;  3SHF A;  3FHE A;  3SFZ A;  1S0P A;  3CVV A;  3IEG A;  4FU3 A;  3AS8 A;  4F3V A;  4EEC A;  2WXG A;  3D9N A;  3PVL A;  3BG0 B;  4FLH A;  4N3B A;  4N3C A;  3Q47 B;  4UI9 J;  5FWQ A;  3CVW A;  2HO1 A;  2WMO A;  2WXO A;  4L23 A;  4CDR A;  3MKR A;  3CQG B;  4AY6 A;  1EPU A;  4C9B B;  4A1S A;  3D9K A;  3D9J A;  3CVP A;  3G2S A;  2IF4 A;  3TGO A;  3ML9 A;  2KC7 A;  3B7R L;  4YVO A;  2AXU A;  3FH7 A;  3B7T A;  3SI5 A;  2ILR A;  2BUG A;  2I6H A;  4J0U A;  3ULQ A;  4CGV A;  4GPK A;  4FJY A;  3D3M A;  3I4G A;  1HFA A;  5BNW A;  3KEZ A;  2X3M A;  3U66 A;  4E6H A;  2CG2 A;  2J4B A;  1DNP A;  1QNF A;  4DK5 A;  2WQ6 A;  3TJP A;  3FDH A;  3ASH A;  1IYG A;  3PRZ A;  4HOU A;  3CGH A;  4H7X A;  4I2W A;  2DIW A;  3T8M A;  3NQP A;  3FU6 A;  3OAW A;  2YHE A;  3JYS A;  4HOS A;  3PE4 A;  1GW6 A;  4FP7 A;  3FTY A;  4GA2 A;  2L6J A;  2HR2 A;  3L17 A;  5FQ7 A;  3PNL B;  4L2L A;  5A6C A;  1X5B A;  1H2U A;  3ZGQ A;  1FCH A;  5CMW A;  4UWK A;  4U0S A;  1HG5 A;  4NAC A;  4FC8 A;  4BX9 A;  2V8S E;  3S7J A;  5KJN A;  4WNG A;  3QOU A;  2WXI A;  1UW4 B;  3L16 A;  4GA1 A;  3AU5 A;  3FUM A;  3FTS A;  5G05 J;  4XZ4 A;  4WNF A;  1NA3 A;  2XHE A;  3ZEF A;  1ELK A;  4N2S A;  1HU3 A;  3MEK A;  4ANX A;  4JA9 A;  3G2T A;  4U04 A;  3UX4 A;  4N39 A;  1E8X A;  3MKQ B;  1TJF A;  3SNX A;  4AP2 A;  3P2B A;  4APO A;  4B94 A;  4WWN A;  3IHY A;  4C0M A;  3Q5M A;  4G1T A;  4LUN U;  4WWO A;  4BT9 A;  2I1J A;  4RVB A;  2KM4 A;  3S7F A;  1QQE A;  4JL0 A;  3ZYK A;  4GMJ A;  4GB9 A;  3CVX A;  1JWF A;  4PH4 B;  2V0P A;  4PS7 A;  5ANL A;  3ONL A;  3LS8 A;  3FUJ A;  2AW6 A;  3CKB A;  4G23 A;  3VLE A;  4G26 A;  3WXX A;  3IV0 A;  3U9W A;  4J8D A;  3LDZ A;  4NQ0 A;  2KZT B;  3EHN A;  2WQ7 A;  4ATG A;  2XPI A;  2YHC A;  4ANW A;  3APD A;  3VLD A;  3IKO B;  2XRZ A;  2ZU6 B;  3QWP A;  4J8E A;  5HI7 A;  3EHM A;  4JEU A;  3FUK A;  5ARG A;  3GZ2 A;  4ILI A;  4XI9 A;  4MRU A;  5G04 J;  2XPY A;  3IHV A;  4JHR A;  5AYW D;  3QDN A;  2X38 A;  3LKU A;  2EQX A;  2XGM A;  3EJN A;  1HE8 A;  1Y6I A;  1KLX A;  3QC1 A;  3QWW A;  3HIZ A;  4LER A;  5LOZ A;  1SZ9 A;  3FTV A;  4AV7 A;  1VDY A;  3D9P A;  2R5S A;  2CFZ A;  5CCM A;  5JHB A;  4AJW A;  4JHK A;  4I6J A;  3I3N A;  4LCT A;  4PS8 A;  4RSY A;  3TXM A;  2VTB B;  3U4T A;  4AM9 A;  3SF4 A;  1MHQ A;  3PS6 A;  4Q94 A;  1L5J A;  3Q49 B;  3CSF A;  4GZC A;  4GCN A;  1PAQ A;  2XEV A;  3FWV A;  4BFR A;  3ML8 A;  4KXK B;  3ASD A;  2C2L A;  1E8W A;  2FI7 A;  2L0I A;  3QJZ A;  3NZU A;  2VGX B;  4U8H A;  5T3R A;  4C0E A;  2VSO E;  3E4B A;  3KS2 A;  4HOQ A;  4N5C A;  3ESK A;  4W9R A;  3ZYQ A;  5BV0 A;  1U3C A;  3LEW A;  3RKV A;  5LFA A;  5G2N A;  4HS2 A;  3BEE A;  2J4D A;  5C1D A;  3ZRH A;  4HOT A;  1A17 A;  4OVV A;  2RD0 A;  4U63 A;  1SZA A;  3PRE A;  4MKT A;  1HS6 A;  3Q4A B;  3CVQ A;  3MZL B;  4PUC A;  2XGO A;  3T5V A;  1NP7 A;  2XRY A;  3CR3 A;  4K03 A;  4WAF A;  4ANU A;  2L9B A;  3LJ3 A;  3FY4 A;  5J90 A;  3MV2 B;  2XCC A;  1ELW A;  4JVS A;  4I2Z A;  5BW8 C;  2YNQ A;  4B0Z A;  4G25 A;  1H2T C;  5LP0 A;  4DJA A;  3G2V A;  4XE0 A;  3UT4 A;  3LYA A;  4KBQ A;  3MX3 A;  2X6I A;  1UJJ A;  4FA6 A;  2LAH A;  5AEN A;  3HVE B;  2VQ2 A;  4WNE A;  3SZ7 A;  2IFU A;  3ZXS A;  5LX8 A;  2XPZ A;  3LCA A;  5JJT A;  2Y3A A;  2WXJ A;  3FTW A;  3L54 A;  5AJD A;  5BUZ A;  2WXF A;  4A55 A;  2V4L A;  3MV3 B;  4OYS A;  5HQ8 A;  5ENN A;  3EIJ A;  2UY1 B;  3PUJ A;  4V3I A;  3U64 A;  4ANV A;  4LEU A;  4BY6 A;  1HZ4 A;  2GW1 A;  3NF1 A;  2OVF A;  3TG5 A;  4YVQ C;  3ZPJ A;  2OND A;  4UI9 C;  3SGH A;  4IUL A;  4AVX A;  4URK A;  3CVY A;  2BF0 X;  2IJG X;  1NZN A;  5ANR A;  3CK9 A;  3B7U X;  3NZS A;  3D9I A;  4QFV A;  1E8Z A;  2FO7 A;  4F1S A;  3KD7 A;  3PUK A;  5A7D B;  3U3W A;  4D10 C;  2M63 A;  4Y6C A;  3MKQ A;  2WXQ A;  4PS3 A;  3HYM B;  4UWG A;  5E75 A;  3B13 A;  2L0T B;  3CVN A;  5FZQ A;  5M72 A;  3GZ1 A;  4EZK A;  5BV1 A;  3K9I A;  3FH8 A;  1ZU2 A;  3FTX A;  5BPP A;  1HF8 A;  3VLF A;  1WM5 A;  1UN9 A;  1HX8 A;  2IOL A;  1NA0 A;  4EBA A;  3GYZ A;  1SQM A;  2R17 C;  3APC A;  1H19 A;  4KVM A;  4U07 A;  2WXH A;  3CKC A;  3CHO A;  3UMV A;  1XGW A;  4P29 A;  4B8C B;  4HOR A;  1WAO 1;  3VTY A;  1ELR A;  4GYY A;  5DIZ A;  4DPR A;  5FQ6 A;  2KZT A;  2LO6 A;  2OV8 A;  3R9A B;  2AVP A;  3MCX A;  3CHQ A;  4ME2 A;  3D9L A;  3QNK A;  2PM6 A;  2X6K A;  2FF4 A;  5EDS A;  3CK7 A;  4KZ0 A;  3FU0 A;  3R7R A;  3JQ0 A;  2FUL A;  2J49 A;  3KAE A;  2GGF A;  3ZW3 A;  4TV3 A;  4A3V A;  2R59 A;  3D9M A;  4AEZ C;  3LVR E;  5FTP A;  4I43 A;  5LCW J;  1PC2 A;  4EBA G;  5CMY A;  2WXK A;  3DBS A;  2X6F A;  4GML A;  4NUR A;  1OWP A;  5D0O D;  4JA7 A;  5KCM A;  4DLO A;  4WUY A;  2HYZ A;  1H2V C;  3PDN A;  5KJM A;  4BX8 A;  3L6A A;  2VSY A;  1EF1 C;  3QKY A;  1DVP A;  4XI0 A;  5CCL A;  4L1B A;  4GAA A;  2OVB A;  1YA0 A;  3S2A A;  4I6E A;  3QAR A;  4EQF A;  2UWJ G;  3OTN A;  1HXI A;  4G11 A;  3FH5 A;  3SBS A;  2J09 A;  1U3D A;  3P1U A;  4GYO A;  3CEQ A;  2VSX E;  4J8S A;  3LY8 A;  3OXL A;  2NC9 A;  2GRL A;  2J9Q A;  5FZR A;  4ABN A;  2V5F A;  4JW1 A;  3MJW A;  2CHZ A;  5A23 A;  3AS4 A;  4KMO A;  5CHE E;  1EYH A;  4AXH A;  2BTD A;  4BTA A;  1B89 A;  2VGX A;  5T4Y A;  5JJ7 A;  3JUI A;  4HLE A;  2IOS A;  3AU4 A;  5FZS A;  2FEZ A;  4XX5 A;  3UUX A;  5EKQ D;  4I17 A;  2CHX A;  3JCK C;  3D9O A;  4LRZ A;  5FJY A;  2J08 A;  4UWL A;  5FQ8 A;  1P5Q A;  4I9C A;  4K0R A;  4Q96 A;  4FHJ A;  4CDM A;  4KT6 B;  4JXT A;  2X6H A;  5G04 C;  4BT8 A;  3RIB A;  3IBE A;  2DBA A;  3FUN A;  2E0I A;  2PL2 A;  1H6K A;  2MOW A;  2PQN A;  4G24 A;  4MLP A;  2Y4U A;  4MS6 A;  5JHA A;  4FJZ A;  3ENE A;  2LSV A;  4AIF A;  4CT0 A;  4XIF A;  1ZBP A;  4AY5 A;  1E8Y A;  1KT0 A;  4UQZ A;  3QB2 A;  4TRQ A;  1INZ A;  2WXN A;  1E90 A;  3OXG A;  3RO2 A;  1UN8 A;  2UY1 A;  4DLQ A;  5AIJ A;  5J08 A;  1N52 A;  3ZVV A;  4I1A A;  1HO8 A;  3FEY A;  3ONK A;  4XKB A;  4DI4 A;  3L22 A;  3MA5 A;  2CG3 A;  2JLB A;  3CHM A;  1Y8M A;  3EDT B;  2P58 C;  3BG1 B;  3FP3 A;  5EX0 A;  4F7A A;  3UT8 A;  2YQ8 A;  3RJV A;  3FU5 A;  4L2Y A;  4WWP A;  3RK6 A;  2C0L A;  3FFL A;  4I1O B;  4I9E A;  4CCA A;  1UJK A;  3G2W A;  3ZHE B;  2AXV A;  4J8F A;  3RRU A;  3RU0 A;  2MHK A;  2QFC A;  1OWO A;  4OVU A;  2X6J A;  1IHG A;  4O6F A;  4KVO A;  4UQX A;  4UWH A;  4UI9 K;  1W3B A;  3RRM B;  1JUQ A;  4I6G A;  1Z6T A;  3APF A;  5JJ6 A;  3CHR A;  2LAI A;  1BPO A;  3T5X A;  4JC8 A;  4L7T A;  1MQS A;  4RG9 A;  5DBK A;  3CHS A;  4B89 A;  3CVL A;  4JHJ A;  4B8A A;  2A4Z A;  1OWL A;  3B7S A;  1N54 A;  4GZD A;  4F53 A;  5E76 A;  3N71 A;  2XGS A;  3CLJ A;  3FUL A;  5EX3 A;  4UWF A;  5BT1 A;  1IQU A;  2PZI A;  5C2Y A;  3LY9 A;  4A3T A;  3CIA A;  4UQY A;  4GZ5 A;  3R7Q A;  2VSN A;  1HH8 A;  2VGY A;  4BWR A;  4A1G A;  3G2U A;  2I9C A;  2NSZ A;  3FUF A;  2CFU A;  3C98 A;  3AS5 A;  4ILG A;  4Y6W A;  2PM7 A;  4CGW A;  4APF A;  3QWV A;  3S7D A;  5FT9 A;  3TAX A;  2I2O A;  3FEX A;  3ESL A;  2RG8 A;  2CHW A;  1HG2 A;  4XKC A;  4YND A;  4EZL A;  3CHP A;  2A5U A;  4JEH A;  3SBT B;  3ZFW A;  4GZ6 A;  3LXU X;  4TUU A;  2PQR A;  1LF8 A;  3LVQ E;  2WXR A;  4GU5 A;  4Q69 A;  1EDU A;  2E2E A;  4FLB A;  3FUH A;  3FTU A;  1FVF A;  2J07 A;  4FHK A;  2LSU A;  3FU3 A;  3URZ A;  4CRW A;  5D0Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...