4KXKB

Alanine-glyoxylate aminotransferase variant k390a/k391a in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
288
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine--pyruvate aminotransferase
publication title Ligand-Induced Compaction of the PEX5 Receptor-Binding Cavity Impacts Protein Import Efficiency into Peroxisomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
total genus 116
structure length 288
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kxkB00
5D0QD 2HYZA 4J8FA 3CK7A 3RO3A 2WQHA 4XIFA 1E96B 4N3AA 2FF4A 3ZFWA 1ZU2A 3MV3B 4Y6CA 5FZRA 4I9EA 3RKVA 3S7FA 3ULQA 2LNIA 3S7DA 2JLBA 4N3CA 4WNEA 2VSYA 2J9QA 5BW8C 3LY9A 3GZ2A 2GW1A 1NA0A 4WUYA 2C0LA 4G23A 2E2EA 1TJCA 4CGVA 5G05J 1FCHA 2I6HA 3UQ3A 2ONDA 3RU0A 1NA3A 1W3BA 4I2WA 2C0MA 4NQ0A 4HOQA 3WXXA 2XEVA 3UPVA 2Q7FA 4N5CA 3O48A 3S7BA 3TG4A 3IEGA 2QFCA 2VGXB 4JL0A 2R5SA 2LSUA 3RJVA 3AS5A 4ABNA 4GYOA 5HQ8A 2V5FA 4JA7A 4Y6WA 3HYMB 2KCKA 4UQXA 1XNFA 5KJKA 4G1TA 5LCWJ 2VYIA 3ZPJA 2WPVA 2L6JA 5KJMA 3RIBA 3FWVA 1IYGA 4GZ6A 5FZQA 1HXIA 2HR2A 2YQ8A 4YNDA 3GW4A 4APOA 3VTXA 4HORA 3FP3A 2UWJG 3CEQA 1KT1A 4N3BA 2XGSA 4U0SA 4AIFA 4GPKA 5CCMA 4GZ3A 2DBAA 3CK9A 4GYWA 3QWWA 5FJYA 2P58C 4JA9A 3FFLA 3PE3A 4G24A 5AYWD 5CCLA 3URZA 4KBQA 3QOUA 2KCVA 4H7YA 5D0OD 5EX0A 4JHRA 3K9IA 3QWPA 3GYZA 3ESKA 4J8DA 4GA0A 4BTAA 4F3VA 4LEUA 2VSNA 4EQFA 3OXLA 3LYAA 3Q49B 4CGWA 2NC9A 2MHKA 4I17A 3NF1A 3ZHEB 1QZ2A 3CK8A 5KJNA 4NRHB 3MEKA 4XI9A 2AVPA 3U3WA 2FBNA 3CVPA 4WNDA 4HOSA 4BTBA 3LY7A 5BT1A 3RO2A 4U04A 2VGYA 5FZSA 4GCOA 3LY8A 5G05C 3CKCA 3PDNA 3MA5A 4WNGA 2XPIA 4HOUA 1HZ4A 2UY1A 3U4TA 5JJ7A 2Y4TA 1P5QA 3ASHA 2PL2A 2FI7A 4UI9J 3KS2A 4J8EA 3ZN3A 5DBKA 4O6FA 3TG5A 3BEEA 2PQNA 1QQEA 5HI7A 3QWVA 4BWRA 4BT9A 5LCWC 2KCLA 3ASFA 1Y8MA 5ARGA 1KT0A 5DIZA 3EDTB 3TGOA 4AM9A 2XGMA 3OXFA 4UI9K 2FEZA 5G04J 5BNWA 1B89A 5A7DB 3TAXA 3LCAA 3UUXA 1ELRA 4AY6A 5M72A 4U07A 1OUVA 3QDNA 2XCCA 3N71A 5JJTA 4G26A 4KXKB 2VGXA 4N2SA 5ARFA 4BT8A 2BUGA 4H7XA 4GA1A 3KAEA 3Q47B 4A1SA 5CHEE 3E4BA 4RG6A 4GCNA 3SF4A 2HO1A 3S7JA 4YVQC 2PQRA 3AS4A 4AY5A 3LPZA 2PZIA 2XGOA 4IN3B 2KATA 5JJ6A 3ZGQA 3CKBA 2OOEA 4GA2A 3OXGA 3AS8A 4I2ZA 4N2QA 5KJLA 1ZBPA 1YA0A 4J0UA 4U0UA 3MV2B 4YVOA 2IF4A 2XCBA 4B94A 3PE4A 3QKYA 4UQYA 3LKUA 4G25A 3ASGA 4GZ5A 5EKQD 3MKRA 1WM5A 3GZ1A 1ELWA 3CVQA 4I1AA 2C2LA 3Q5MA 3KD7A 4I9CA 4CDRA 5EX3A 4RG9A 2VQ2A 3R9AB 1KLXA 1NZNA 4GYYA 4UI9C 4WNFA 2IFUA 2YHCA 3Q4AB 3SZ7A 2KC7A 4U0ZA 1IHGA 4KYOB 3ZHEA 1A17A 3CV0A 5FTPA 3ASDA 5C1DA 1HH8A 3Q15A 5A6CA 2Y4UA 5FT9A 4UQZA 4ME2A 2LSVA 4N39A 4W9RA 3JYSA 1PC2A 3CVNA 2UY1B 4XI0A 3VTYA 4HOTA 2FO7A 1WAO1 3CVLA 4G2VA 5G04C
chains in the Genus database with same CATH superfamily
3V31A 2IEJA 5D0QD 3D9JA 3QJZA 3R9MA 2HYZA 1OWOA 2DCPA 1UJKA 2WQHA 5E76A 2J09A 2WXHA 2AXVA 3TWQA 2FF4A 3ZKJA 1ZU2A 2YHEA 3MV3B 4BX8A 5FZRA 3S7FA 2LNIA 3Q7FA 1JWGA 3V79K 3W9GA 3D9MA 2VSYA 1E7UA 5BW8C 3LY9A 4JD2G 4QFVA 2PM6A 1Y6IA 4MRUA 4G23A 3CR3A 3G2UA 2DWZA 4MKTA 4YDYA 1HS6A 1X81A 2WXJA 2ONDA 1NA3A 2J8SD 3O4ZA 1RW2A 1KZOA 3WXXA 5B1BE 2XQ0A 1SZAA 5ENSD 3F6QA 4I1MA 2EQXA 4I6JA 2LSUA 3T8MA 1DVPA 2AJAA 4GYOA 5KNHD 4A63B 2OEVA 4UQXA 1XNFA 2J08A 2X3MA 3CHQA 3NOCD 2BTDA 5AQ7A 4HRNA 1D9SA 2VYIA 3ZPJA 4GMRA 4GZ6A 1E7VA 1YCSB 4OVUA 4U63A 3HXEA 5D66A 1KT1A 4N3BA 3C98A 3I5PA 2XGSA 4GPKA 1BI7B 4GZ3A 2OVFA 4K03A 2DBAA 2ETBA 3QWWA 2AWIA 3CHRA 3PE3A 5AYWD 3DPDA 5CCLA 3URZA 2AXUA 4H7YA 5EX0A 4JHRA 2IU1A 2J07A 3ESKA 3FH8A 2CFUA 1N4RA 4DX7D 4BTAA 4JEUA 3VLFA 2QZAA 3L17A 4LEUA 4A3TA 4EQFA 3SBSA 3LYAA 3Q49B 2DVWA 3Q75A 4CGWA 2NC9A 2QY7A 3FTXA 3SFYA 2V4LA 3L9TA 3ML9A 4J8YA 5ENPD 3B7RL 3CIAA 3IBEA 4NRHB 4XI9A 1JCQA 2ZGDA 3Q79A 4HLEA 4PH4B 4A55A 3C72A 3LY7A 3I4RB 5BT1A 3RO2A 1LF8A 4B93B 2X6JA 5FZSA 3APDA 2WXNA 3FTYA 3LY8A 2WB2A 1Z3XA 3PDNA 3FUFA 3PZ3A 4HOUA 1VDYA 2KZTA 2GRRB 2BKKB 2LXMA 4C0MA 1WDYA 4G8LA 3V2OA 2FI7A 3G2VA 1IXVA 5FINA 1QQEA 1BLXB 4XKCA 3L22A 3MZLB 3QWVA 1K3ZD 4BWRA 4EECA 5KBAA 2XHEA 2X38A 4BT9A 2BKGA 3AG4E 3ASFA 1TYQG 2IJGX 2MRIA 2XGMA 3L08A 3OXFA 4BESA 2FEZA 3ONLA 1A5EA 2IO2C 1NL4A 4U8YD 1ELRA 4P29A 3TWSA 3D9OA 1OUVA 2ZXWE 3QDNA 2VGXA 5EYPF 4A1SA 5CHEE 3FEYA 1N4SA 2WXFA 1O1TA 3LJ3A 2WXKA 3RK6A 3HHMA 1DCQA 3HVEB 1MYOA 3AS4A 1N54A 4PS3A 3HRAA 2DZNA 3FTUA 2YNQA 3Q9NC 1AP7A 4FHKA 4IN3B 2KBXA 3LVQE 4GMJA 3CKBA 2OOEA 2CG3A 2IO3C 4HS2A 3AS8A 4I2ZA 1EYHA 4N2QA 4AOFA 3HIZA 4GTVA 4U0UA 2IF4A 4HVBA 1H19A 4ANWA 4B89A 5CBNA 3FH7A 3LS8A 3QKYA 3LKUA 3ZXPA 4U95D 2L0IA 1WM5A 2IONA 4G8KA 3QARA 4KZ0A 1TN6A 4U8HA 3Q5MA 4A3VA 5HRYA 3SD5A 3KD7A 4CT0A 2LAIA 4DK5A 2HE0A 3MJWA 3ZUVB 4CDRA 5AAOA 3FULA 5EX3A 4RG9A 4UUCA 2J4BA 4NIKA 2R2LA 2MOWA 3QK0A 5ENOD 4LCTA 4U7EB 3SZ7A 3HXBA 1LTXA 2GGFA 3KSLA 1A17A 2VTBB 2V5QC 3CV0A 3EHQA 2QC9A 5HS0A 2GRLA 5C1DA 3DBSA 4OAVB 4ME2A 4N39A 4W9RA 4TXPA 3JYSA 3ASNE 2KXPC 4G2VA 1LD7A 2J49A 2XPZA 3LVRE 4UWLA 4LERA 2I9CA 4I6GA 2V4HC 3S7DA 3V2XA 4RLYA 3FU6A 3RRMB 1BI8B 2XS8A 4WNEA 4KZCA 5AQ9A 3LDZA 3D9KA 4NURA 2GW1A 1NA0A 5LX8A 1TN8A 2C0LA 3U9WA 2P9LG 2CHXA 3DEPA 4DPRA 2E2EA 3L82A 4CEMA 3ZEFA 1E8ZA 2L0TB 5BPPA 4CGVA 4HRLA 3PS6A 5FQ7A 3CVVA 1E8WA 4B8AA 3PEVB 4I2WA 4V3IA 3FTWA 4NQ0A 4HOQA 3X2QE 3TWUA 1HG2A 3FHEA 2LO6A 4KVMA 2P2CP 3FUDA 4CYMD 1H6PA 1H2UA 2B6CA 4GU5A 3RAUA 2R5SA 4IYPA 2XPYA 4JHJA 4UWKA 3DWLG 3SNXA 3EHRA 2J4DA 4CCAA 3ABLE 4ABNA 4AV7A 3EU5A 2IOLA 1IQUA 3LEWA 2CFZA 3UI2A 4Y6WA 5G2NA 1QYMA 2WPVA 3MGBA 3RIBA 1YYHA 4TUUA 5AQBA 1TNBA 4BX9A 3ABKE 3BG1B 4EBAG 4JPSA 2JEKA 4APOA 1U3DA 4AJWA 3B95A 2L9BA 3PNTB 4M3OA 1SA5A 3IKOB 4OYSA 3L16A 5EYLA 1YMPA 4EZKA 2P9NG 5CRVA 3Q78A 1U2VG 4GYWA 1E8YA 1TNOA 3UKUG 4G24A 4Q96A 3TWRA 1K1BA 1DCEA 3FUMA 3I4GA 3NZUA 3K9IA 4JC8A 4L7TA 3UM1A 2P9UG 2WXPA 3UMVA 3NAWA 2EIKE 4BFRA 2CHWA 2Y0BG 5CECB 3PVLA 2ZU6B 3NF1A 3ZHEB 4L1BA 4GMLA 2ZISA 5ENRD 4ZHBA 3SY2A 4FC8A 5CMYA 2FBNA 4HOSA 4DX6D 1OWLA 5G55A 4ILIA 2IQCA 3ZXSA 4M7CA 1V55E 1BU9A 5LFAA 3DPYA 2R59A 4EBAA 2DZOA 2P9IG 3SO8A 3CKCA 5AJDA 5KNGA 3I3NA 2P9SG 2EINE 1OCCE 3DXMG 1JCRA 3FUKA 3U4TA 5JJ7A 1JUQA 2Y4TA 3LXUX 3ASHA 1H0AA 2PL2A 4MBGA 4UI9J 5AIJA 3KS2A 4J8EA 4BEPA 4RQIA 4O6FA 2PQNA 3GZSA 3UM0A 2XRYA 1O5MA 3FUHA 2KCLA 1Y8MA 1KT0A 3FU0A 4E85A 3EDTB 4BERA 3RSEG 5J90A 3TGOA 3ZW3A 2RG8A 3ZVVA 1OCRE 3EUVA 5G04J 3LCAA 3EIJA 5EILA 3PZ4A 2WXMA 4AY6A 3RRNB 3D9NA 3ONKA 5CEDB 3FTVA 3Q9UC 4HFGA 3CVXA 3MYVA 3ULYA 3ULEG 2OEWA 4FULA 4G26A 4LNBA 3TXNA 4JVSA 2BUGA 4O1OA 4H7XA 3KAEA 1K1AA 1SZ9A 2DYRE 4RG6A 3W9FA 4TRQA 4C9BB 4JZYA 3DSUA 2HO1A 3UIOC 1H6KA 5KWDA 3MCXA 5ITZF 4AY5A 2PZIA 5JJ6A 4UWGA 1JCSA 5KJLA 1YA0A 3NQPA 4J0UA 3DSWA 4QQIA 4LNGA 1G3NB 4YVOA 1MJ0A 4PS7A 4FP7A 4APFA 2H6FA 2GRPB 3PE4A 3BG0B 2NXPA 3NB2A 4UQYA 4IRUA 1KPSB 1K8KG 1AWCB 1JWFA 3FU5A 1N0RA 1HE8A 3VLDA 3PH0C 4ANUA 3EIQC 2WXRA 4C48B 3RRUA 5FQ4A 3UX4A 5JHBA 2I1JA 4I9CA 2AXZA 1OWPA 5JA4D 4JB8P 3HXDA 3CHPA 5LOZA 3R9AB 1KLXA 4UWFA 4GB9A 4UI9C 1JPLA 2YHCA 2KC7A 1UN8A 2ZGGA 4GTMA 1QBQA 3NBNB 3JUIA 5FIOA 1IQRA 1Z3YA 3Q15A 5T8IA 2Y4UA 3E37A 2FO1E 2R02A 3B7SA 4HLLA 3CVNA 2UY1B 4XI0A 3VTYA 4HOTA 4DI4A 4F1SA 5G04C 4U96D 1Q2ZA 2I1KA 3MX3A 4J8FA 1FPPA 2H6IA 3UT4A 1EDUA 5KCMA 5T3RA 3CLJA 4N3AA 3ZFWA 4I9EA 5BUZA 1TEZA 3JXJA 2WMOA 5JHAA 4N3CA 4KVOA 4N5QA 3GZ2A 3FU3A 1FVFA 3SFZA 3D9HA 3IXEA 2NYJA 3UT7A 3SHFA 4L9PA 4DX1A 2F8XK 3ZRHA 1HX8A 5G05J 1FCHA 2I6HA 3RU0A 4NACA 2KM4A 3C3RA 4Z68A 3ZIMA 5D2MC 3E34A 4OAUC 3UPVA 2Q7FA 4X8QA 3ASOE 4HBDA 3DRAA 3O48A 3S7BA 2GROB 3TG4A 4PS8A 2QFCA 1NFIE 4ATZD 3V30A 3B7BA 4JEHA 1TR4A 4JA7A 3HYMB 2KCKA 2IY0C 2R17C 3CHSA 4G1TA 3Q73A 5AJLA 4K5BA 2XEHA 1H6OA 5AQAA 1N52A 4GTOA 5KJMA 1IYGA 5A23A 5HKPA 3MKQB 1TNUA 5FZQA 2HR2A 1E8XA 2YQ8A 5E75A 2IOSA 3GW4A 4I1OB 1MX2A 2P9KG 3HVEA 2UWJG 3T5VA 1TNZA 4ACLA 4LUNU 1FT2A 4U0SA 3PZDA 4IULA 3SBTB 5CCMA 1WY6A 4EZLA 3APCA 3CK9A 1HU3A 2P58C 4JA9A 1XGWA 2WXOA 2B0OE 3FUJA 4GAAA 3PZ2A 3QOUA 3TJPA 1N4QA 5D0OD 1FVHA 3QWPA 2R05A 2P9PG 1N0QA 3CSFA 3B13A 4F3VA 3ABME 1UG3A 2VSNA 3D3MA 4B8CB 3OXLA 3NZSA 3PREA 4FU3A 5FWQA 3HXFA 4I17A 1QZ2A 3CK8A 4AP2A 4O60A 3J5PA 4XEIG 3MEKA 2AVPA 4WNDA 3CVPA 3AU4A 2XRZA 4BTBA 4G11A 4U04A 1SW6A 1D8EA 3TWWA 4K5CA 2PNNA 1N4PA 1O1RA 2WQ6A 2RD0A 5G05C 1U3CA 1OXJA 2VTBA 1WG0A 3JQ0A 3MA5A 1PY1A 3FY4A 2NSZA 4Q69A 4DLQA 2XEEA 1OWNA 3CQGB 3UKRG 3DEOA 3P2BA 2FULA 3CHMA 4UWHA 4B0ZA 1P5QA 2A4ZA 2GRMA 1KZPA 3FUNA 2V0PA 2RFMA 4O1PA 1N11A 3TG5A 3BEEA 5HI7A 3PNLB 1EF1C 4WWOA 2WXIA 3UT8A 5DIZA 4I43A 3EU9A 4AM9A 5EDSA 1FT1A 2I2OA 4UI9K 4TV3A 5BNWA 5A7DB 4FLBA 1BPOA 3E30A 3UUXA 2XZTG 4U8VD 3AU5A 5EN5D 5H7PA 1H2VC 4U07A 4ILHB 3N71A 3PUJA 1OCZE 4ILGA 2QYUA 4L2YA 1OWMA 3BQOA 4BY6A 3Q47B 3ZYKA 4BSZB 3S2AA 3JQ1A 3NOGD 3SF4A 3S7JA 2L6BA 3CGHA 1GW6A 4A1GA 5ANLA 3D9PA 2LUHA 2X6KA 2LAHA 4DI3A 4EHMA 3JCKC 2EIJE 2ZIRA 4GA2A 3OXGA 1ZBPA 3U64A 2HM8A 3MV2B 3FTSA 4K0RA 2VJ8A 3ZYLA 4HRMB 3L6AA 1HF8A 5AARA 4LSZE 2ETCA 3P1UA 3FUEA 3KEZA 3L13A 4G25A 3EJNA 4MLPA 5EKQD 1IKND 2EILE 3GZ1A 1NI1A 1ELWA 4HI9A 3CVQA 4J8SA 4I1AA 3ESLA 3JXIA 2ILRA 1OCOE 3J5QB 3VLEA 4DX2A 4FA6A 2VQ2A 1MHQA 5FQ6A 1EPUA 3TWVA 2BF0X 4GYYA 5C2YA 1X5BA 3R7QA 2IFUA 2A5UA 2WQ7A 3DSVA 5BV0A 4GZCA 1IHGA 4KYOB 5J08A 1OT8A 3ZHEA 4ATGA 2DIWA 2Y3AA 2WMNA 4TXRA 5FTPA 4FHJA 3ASDA 1S70B 2ETAA 1HH8A 4KT6B 5FT9A 3FEXA 4UQZA 4GPMA 2KZTB 4F7AA 2GRNB 3SGHA 2FO7A 4AVXA 1S64A 3T5XA 4ANVA 1MZCA 4ACKA 3CK7A 3RO3A 3HDXA 4HB5A 4GTTA 1ELKA 4XIFA 1E96B 1IHBA 4RSYA 4Y6CA 3RKVA 3CQCB 3ULQA 2JLBA 2DYSE 2PM7A 2J9QA 4AXHA 1SVXA 5ENNA 4WUYA 4LNUD 4OVVA 3FH5A 1HFAA 3PRZA 4HXIA 2RFAA 3CSTA 1RZ4A 1TJCA 2M63A 2WXGA 2XS1A 1SQMA 4JXTA 3UQ3A 1UOHA 1W3BA 1Z6TA 2C0MA 3C3QA 1E90A 3TWTA 2XEVA 1UJJA 4N5CA 3UM2A 2MYOA 3IEGA 4FJYA 2VGXB 4JL0A 5AN8A 2WXQA 4GTRA 4XKBA 5B1AE 3DSTA 3RJVA 2WVIA 3AS5A 5HQ8A 2V5FA 2R03A 3ML8A 4ANXA 5AENA 5KJKA 5LCWJ 2F8YA 3AAAC 2V8SE 2L6JA 1MQSA 4DLOA 3FWVA 2H6HA 4CDNA 4WWNA 1TNYA 1HXIA 2Y69E 2XENA 3Q7AA 4YNDA 3FUIA 3PUKA 4FLHA 3VTXA 5EIBE 2E0IA 1NP7A 1MX6A 3OAWA 4HORA 3FP3A 4TUMA 3LJNA 3CEQA 3C3OA 1Z5SC 2VSOE 2XZDG 4FJZA 3AG1E 3C5RA 4WWPA 4AIFA 4DUIA 2X6IA 2OCCE 4TXQA 4KMOA 5T4YA 3SQVA 5FJYA 1INZA 3FFLA 5ANRA 4KBQA 2KCVA 3UIPC 4AEZC 1TJFA 3GYZA 4J8DA 1OY3D 4GA0A 4LRZA 5ENTD 5CMWA 2H6GA 4DJAA 4L2LA 3SI5A 5CRUA 3UTMA 4GTSA 5BV1A 1DC2A 2MHKA 3FDHA 4WAFA 2JABA 2AW6A 4J7WA 5KJNA 4DRXE 3U3WA 3BU8A 3OTNA 4D10C 3QAQA 3G2TA 3TL5A 2VGYA 4GCOA 3CVWA 5CEAA 3ISMC 4GTQA 3DSSA 3ZU7B 4CDMA 4EPZA 5EIDA 4PDXA 4XX5A 4WNGA 2XPIA 1HZ4A 1DNPA 3D9LA 3ENEA 2UY1A 4GTPA 1TN7A 1L5JA 3E33A 4MS6A 3WG7E 2X6HA 3EHMA 5ENQD 4C0EA 3ZN3A 5DBKA 3CHOA 3AG3E 5CERB 2WM9A 3BUAA 1S0PA 4PUCA 4LG6A 3PEUB 5LCWC 1H2TC 5ARGA 4F1PA 1N9AA 3E32A 5B3SE 3UINC 2RKKA 1ZB1A 3G2SA 3IHVA 3TXMA 2WXLA 3U66A 1B89A 1PAQA 3QC1A 3TAXA 5BXOA 1O1SA 1SA4A 3KEAA 3UM3A 5LP0A 3EHNA 5M72A 2XCCA 2OVBA 3ZNGA 5JJTA 3ZYQA 3HG0D 4KXKB 4N2SA 5ARFA 4BT8A 4F6RD 2A5EA 4GA1A 4Q94A 3E4BA 1HO8A 1V54E 3SFXA 2CHZA 3DSXA 4I6EA 4GCNA 4BSXA 5BXUA 4YVQC 2PQRA 3G2WA 3FTZA 5IY5E 3CVUA 3LPZA 2XGOA 1D8DA 3ZGQA 2KATA 4GZDA 3B7UX 2VSXE 2Y1LE 3MKQA 4JW1A 3QNKA 2EIME 4HNAD 2YINA 3HXCA 2CG2A 3B7TA 4URKA 2X6FA 3IHYA 2XCBA 4B94A 2QYJA 2OV8A 4J6IA 2F0YA 3T9KA 2F37A 3JUEA 3L54A 3ASGA 4GZ5A 3MKRA 3TWXA 5FQ8A 1LD8A 4HQDA 1QNFA 4RVBA 2C2LA 2LXLA 3QB2A 3AJIA 4JHKA 3DXKG 3UXGA 3IV0A 4L23A 3R7RA 4F53A 1HG5A 3APFA 1MX4A 1NZNA 4CRWA 5CBOA 3KSQA 4K5AB 4E6HA 4CT4A 4WNFA 2GRQB 3Q4AB 3T8KA 4YDEA 1UN9A 2VGEA 3CVYA 4YDWA 1UW4B 4R7LA 4U0ZA 3ZYMA 3AG2E 1N95A 3D9IA 1N94A 4HI8A 4ZFHA 2BEDA 4DX5D 4YDOA 5JMND 4EZJA 5A6CA 4CZ2D 1S63A 2LSVA 3PZ1A 4BETA 1BD8A 1PC2A 4XE0A 4XZ4A 3CVLA 1WAO1 4FADA
chains in the Genus database with same CATH topology
3T5XA 5D0QD 2J49A 3D9JA 2XPZA 3QJZA 3LVRE 4ANVA 2HYZA 1OWOA 2I1KA 3MX3A 4J8FA 4ACKA 3CK7A 3RO3A 2DCPA 3HDXA 1UJKA 1EDUA 2WQHA 5E76A 2J09A 4UWLA 3UT4A 1ELKA 2WXHA 2AXVA 4XIFA 5KCMA 5T3RA 1E96B 3CLJA 4N3AA 2FF4A 3ZFWA 4RSYA 1ZU2A 2YHEA 3MV3B 4BX8A 4LERA 4Y6CA 5FZRA 2I9CA 4I9EA 5BUZA 3RKVA 3CQCB 1TEZA 4I6GA 3S7FA 3ULQA 2LNIA 3S7DA 1JWGA 2JLBA 3FU6A 2WMOA 3RRMB 5JHAA 4N3CA 3D9MA 4WNEA 2PM7A 2VSYA 4KVOA 4KZCA 2J9QA 1E7UA 5BW8C 3LY9A 3LDZA 3GZ2A 4AXHA 4QFVA 3FU3A 5ENNA 3D9KA 4NURA 1FVFA 2GW1A 3SFZA 2PM6A 1NA0A 1Y6IA 4WUYA 5LX8A 4MRUA 2C0LA 3UT7A 4G23A 3SHFA 3U9WA 3CR3A 2CHXA 4DPRA 3G2UA 2E2EA 4MKTA 1HS6A 4OVVA 3FH5A 1HFAA 4CEMA 3PRZA 4HXIA 3CSTA 3ZEFA 1E8ZA 1TJCA 2L0TB 2M63A 5BPPA 2WXJA 2WXGA 3ZRHA 1HX8A 4CGVA 5G05J 1FCHA 2I6HA 1SQMA 3PS6A 4JXTA 3UQ3A 2ONDA 3RU0A 4NACA 1NA3A 5FQ7A 3CVVA 1E8WA 2KM4A 3O4ZA 3PEVB 1W3BA 1Z6TA 2C0MA 3FTWA 4I2WA 4V3IA 3ZIMA 4B8AA 4NQ0A 4HOQA 1E90A 3WXXA 1HG2A 2XEVA 3FHEA 3UPVA 2LO6A 4KVMA 2Q7FA 2XQ0A 1SZAA 1UJJA 3FUDA 4N5CA 3O48A 3S7BA 4I1MA 3TG4A 4PS8A 3IEGA 1H2UA 4FJYA 2QFCA 2EQXA 2VGXB 4GU5A 4JL0A 2R5SA 4IYPA 2XPYA 4I6JA 2WXQA 4JHJA 4UWKA 4JEHA 4XKBA 3SNXA 2J4DA 2LSUA 3T8MA 3RJVA 2WVIA 4CCAA 3AS5A 1DVPA 4ABNA 4GYOA 4AV7A 2IOLA 1IQUA 5HQ8A 3LEWA 2CFZA 2V5FA 4JA7A 3ML8A 4ANXA 4Y6WA 3HYMB 2KCKA 4UQXA 5AENA 1XNFA 2R17C 5KJKA 2J08A 2X3MA 3CHQA 3CHSA 4G1TA 5AJLA 2BTDA 5G2NA 5LCWJ 2VYIA 3ZPJA 2V8SE 2WPVA 1N52A 2L6JA 3MGBA 5KJMA 1MQSA 3RIBA 4DLOA 3FWVA 1IYGA 4TUUA 5A23A 4GZ6A 4BX9A 3MKQB 3BG1B 4CDNA 4WWNA 4EBAG 5FZQA 2HR2A 1HXIA 4JPSA 1E8XA 2YQ8A 5E75A 4YNDA 1E7VA 2IOSA 2JEKA 3FUIA 3GW4A 3PUKA 4FLHA 4I1OB 4APOA 3VTXA 2E0IA 1NP7A 4OVUA 3HVEA 1U3DA 4AJWA 4U63A 3OAWA 4HORA 3FP3A 2UWJG 2L9BA 3CEQA 3PNTB 1KT1A 3T5VA 4ACLA 4N3BA 2VSOE 4M3OA 3C98A 4LUNU 3IKOB 4FJZA 3I5PA 2XGSA 4OYSA 3L16A 4WWPA 4U0SA 4AIFA 3PZDA 4GPKA 2X6IA 4IULA 4EZKA 3SBTB 5CCMA 5T4YA 1WY6A 4KMOA 4GZ3A 2OVFA 4EZLA 3APCA 4K03A 2DBAA 3CK9A 4GYWA 1HU3A 3QWWA 1E8YA 5FJYA 2P58C 4JA9A 1INZA 1XGWA 2AWIA 2WXOA 3FFLA 5ANRA 3CHRA 3PE3A 3FUJA 4G24A 3DPDA 5AYWD 4Q96A 4GAAA 4KBQA 2AXUA 3QOUA 3URZA 5CCLA 2KCVA 3FUMA 3TJPA 3I4GA 4H7YA 5D0OD 5EX0A 3NZUA 2IU1A 3K9IA 1FVHA 3QWPA 4JHRA 4AEZC 1TJFA 2J07A 3GYZA 3ESKA 4J8DA 3FH8A 2CFUA 4JC8A 4GA0A 4BTAA 4JEUA 4L7TA 4LRZA 3VLFA 5CMWA 3CSFA 3L17A 3B13A 2WXPA 4F3VA 3UMVA 1UG3A 4LEUA 4DJAA 4A3TA 2VSNA 4EQFA 3D3MA 4L2LA 3SI5A 4B8CB 3OXLA 3SBSA 4BFRA 2CHWA 3LYAA 3Q49B 4CGWA 2NC9A 3NZSA 5BV1A 2QY7A 3FTXA 2MHKA 3FDHA 3PREA 4FU3A 3PVLA 5FWQA 4WAFA 2V4LA 4I17A 2ZU6B 3NF1A 3ZHEB 4L1BA 2AW6A 3ML9A 1QZ2A 4GMLA 3CK8A 3B7RL 4AP2A 5KJNA 3CIAA 3IBEA 4FC8A 4NRHB 3MEKA 4XI9A 5CMYA 2AVPA 3U3WA 2FBNA 3CVPA 4WNDA 4HOSA 3AU4A 4HLEA 1OWLA 3OTNA 5G55A 4PH4B 4A55A 2XRZA 4D10C 4ILIA 4BTBA 3LY7A 2IQCA 3G2TA 3I4RB 3QAQA 3RO2A 5BT1A 3ZXSA 1LF8A 4G11A 4U04A 2X6JA 3TL5A 2VGYA 5FZSA 4GCOA 5LFAA 2R59A 3CVWA 4EBAA 3APDA 2WXNA 2WQ6A 3FTYA 3LY8A 2RD0A 4CDMA 2WB2A 5G05C 1U3CA 4EPZA 2VTBA 3CKCA 1Z3XA 3PDNA 3JQ0A 3MA5A 4PDXA 5AJDA 4XX5A 1PY1A 3FY4A 2NSZA 4WNGA 3I3NA 4Q69A 3FUFA 2XPIA 4DLQA 4HOUA 1HZ4A 1DNPA 1OWNA 1VDYA 3CQGB 2KZTA 3P2BA 2FULA 3D9LA 3ENEA 2UY1A 3FUKA 3U4TA 5JJ7A 1JUQA 3CHMA 4UWHA 1L5JA 2Y4TA 4C0MA 3LXUX 4MS6A 4B0ZA 1P5QA 3ASHA 2X6HA 2A4ZA 2GRMA 3EHMA 1H0AA 3FUNA 2PL2A 2FI7A 4UI9J 3G2VA 5AIJA 4C0EA 3KS2A 4J8EA 3ZN3A 5DBKA 2V0PA 3CHOA 4O6FA 3TG5A 3BEEA 2PQNA 3GZSA 2WM9A 1QQEA 4XKCA 1S0PA 5HI7A 3L22A 3MZLB 3QWVA 2XRYA 4PUCA 4BWRA 4EECA 2XHEA 2X38A 3PEUB 4BT9A 3PNLB 3FUHA 5LCWC 2KCLA 1EF1C 3ASFA 1Y8MA 1H2TC 4WWOA 5ARGA 1KT0A 2IJGX 2WXIA 3FU0A 4E85A 3UT8A 5DIZA 3EDTB 2MRIA 4I43A 5J90A 3TGOA 3ZW3A 4AM9A 2XGMA 3L08A 5EDSA 2I2OA 2RG8A 3G2SA 3IHVA 3OXFA 4UI9K 3TXMA 3ZVVA 4TV3A 2FEZA 2WXLA 5G04J 5BNWA 1B89A 1PAQA 3U66A 5A7DB 3QC1A 4FLBA 3ONLA 3TAXA 3LCAA 1BPOA 3UUXA 3EIJA 3AU5A 1ELRA 5LP0A 2WXMA 3EHNA 4AY6A 1H2VC 3RRNB 5M72A 3D9NA 3ONKA 4P29A 4U07A 3D9OA 3FTVA 1OUVA 4HFGA 3QDNA 4ILHB 3CVXA 2XCCA 2OVBA 3MYVA 3N71A 5JJTA 3PUJA 4ILGA 3ZYQA 4FULA 4G26A 4KXKB 3TXNA 2VGXA 4L2YA 5ARFA 4N2SA 4BT8A 4JVSA 1OWMA 2BUGA 4H7XA 4BY6A 4GA1A 3KAEA 3Q47B 4Q94A 5CHEE 3ZYKA 4A1SA 3E4BA 1HO8A 3FEYA 1SZ9A 2WXFA 2CHZA 4RG6A 3LJ3A 2WXKA 4TRQA 4I6EA 4GCNA 4C9BB 3S2AA 3JQ1A 4JZYA 3SF4A 2HO1A 3S7JA 3RK6A 4BSXA 3CGHA 3HHMA 3HVEB 4YVQC 1GW6A 2PQRA 1H6KA 5ANLA 3AS4A 1N54A 3G2WA 4PS3A 4A1GA 3D9PA 3MCXA 3FTZA 3CVUA 4AY5A 3LPZA 3FTUA 2YNQA 2PZIA 2XGOA 2X6KA 2KATA 4FHKA 2LAHA 4IN3B 4UWGA 5JJ6A 3ZGQA 3JCKC 3LVQE 4GMJA 4GZDA 4DI3A 3B7UX 3CKBA 2OOEA 2CG3A 2VSXE 4GA2A 3MKQA 4HS2A 3OXGA 3AS8A 3QNKA 1EYHA 4JW1A 4I2ZA 5KJLA 1ZBPA 3U64A 1YA0A 4N2QA 2YINA 3NQPA 3HIZA 4J0UA 4AOFA 2CG2A 4U0UA 3B7TA 2HM8A 3MV2B 4YVOA 3FTSA 4K0RA 4PS7A 4FP7A 2VJ8A 4URKA 2IF4A 2X6FA 3IHYA 4APFA 3ZYLA 2XCBA 4B94A 4HVBA 2OV8A 3PE4A 1H19A 4ANWA 3L6AA 4B89A 1HF8A 3FH7A 3BG0B 4J6IA 3LS8A 2NXPA 3QKYA 4UQYA 3LKUA 3P1UA 4IRUA 3FUEA 3KEZA 3L13A 4G25A 3EJNA 3L54A 3ASGA 4MLPA 2L0IA 4GZ5A 5EKQD 3MKRA 1WM5A 3GZ1A 1JWFA 2IONA 3FU5A 5FQ8A 1ELWA 1HE8A 3QARA 4KZ0A 3VLDA 3PH0C 3CVQA 4ANUA 4J8SA 1QNFA 3EIQC 4FADA 4RVBA 4I1AA 2C2LA 4U8HA 3ESLA 2WXRA 3Q5MA 3RRUA 5FQ4A 3QB2A 2ILRA 3UX4A 4A3VA 5JHBA 3SD5A 2I1JA 3KD7A 4I9CA 4CT0A 2AXZA 1OWPA 4JHKA 2LAIA 4DK5A 3VLEA 3IV0A 3MJWA 4CDRA 4L23A 3FULA 3R7RA 5EX3A 4RG9A 3CHPA 4F53A 1HG5A 3APFA 4FA6A 2VQ2A 1MHQA 5FQ6A 1EPUA 1KLXA 5LOZA 2BF0X 3R9AB 2J4BA 4UWFA 1NZNA 4CRWA 4GB9A 4GYYA 5C2YA 4E6HA 4CT4A 1X5BA 2MOWA 3QK0A 4UI9C 4WNFA 4LCTA 3R7QA 2IFUA 1JPLA 2YHCA 3Q4AB 3SZ7A 1UN9A 2KC7A 2A5UA 2WQ7A 2GGFA 3CVYA 1UW4B 1UN8A 4R7LA 5BV0A 4U0ZA 4GZCA 1IHGA 4KYOB 5J08A 3ZYMA 3ZHEA 3JUIA 4ATGA 1A17A 3D9IA 2DIWA 1IQRA 1Z3YA 2WMNA 2Y3AA 3CV0A 2VTBB 5FTPA 4FHJA 3ASDA 2GRLA 5C1DA 1HH8A 3Q15A 4EZJA 5A6CA 4KT6B 2Y4UA 5FT9A 3FEXA 4UQZA 5T8IA 3DBSA 3B7SA 4ME2A 2KZTB 2LSVA 4N39A 4W9RA 4F7AA 3JYSA 1PC2A 3CVNA 2UY1B 4XI0A 4XE0A 3VTYA 3SGHA 4XZ4A 4DI4A 4HOTA 2FO7A 1WAO1 3CVLA 4G2VA 4AVXA 4F1SA 5G04C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D0Q D;  2HYZ A;  4J8F A;  3CK7 A;  3RO3 A;  2WQH A;  4XIF A;  1E96 B;  4N3A A;  2FF4 A;  3ZFW A;  1ZU2 A;  3MV3 B;  4Y6C A;  5FZR A;  4I9E A;  3RKV A;  3S7F A;  3ULQ A;  2LNI A;  3S7D A;  2JLB A;  4N3C A;  4WNE A;  2VSY A;  2J9Q A;  5BW8 C;  3LY9 A;  3GZ2 A;  2GW1 A;  1NA0 A;  4WUY A;  2C0L A;  4G23 A;  2E2E A;  1TJC A;  4CGV A;  5G05 J;  1FCH A;  2I6H A;  3UQ3 A;  2OND A;  3RU0 A;  1NA3 A;  1W3B A;  4I2W A;  2C0M A;  4NQ0 A;  4HOQ A;  3WXX A;  2XEV A;  3UPV A;  2Q7F A;  4N5C A;  3O48 A;  3S7B A;  3TG4 A;  3IEG A;  2QFC A;  2VGX B;  4JL0 A;  2R5S A;  2LSU A;  3RJV A;  3AS5 A;  4ABN A;  4GYO A;  5HQ8 A;  2V5F A;  4JA7 A;  4Y6W A;  3HYM B;  2KCK A;  4UQX A;  1XNF A;  5KJK A;  4G1T A;  5LCW J;  2VYI A;  3ZPJ A;  2WPV A;  2L6J A;  5KJM A;  3RIB A;  3FWV A;  1IYG A;  4GZ6 A;  5FZQ A;  1HXI A;  2HR2 A;  2YQ8 A;  4YND A;  3GW4 A;  4APO A;  3VTX A;  4HOR A;  3FP3 A;  2UWJ G;  3CEQ A;  1KT1 A;  4N3B A;  2XGS A;  4U0S A;  4AIF A;  4GPK A;  5CCM A;  4GZ3 A;  2DBA A;  3CK9 A;  4GYW A;  3QWW A;  5FJY A;  2P58 C;  4JA9 A;  3FFL A;  3PE3 A;  4G24 A;  5AYW D;  5CCL A;  3URZ A;  4KBQ A;  3QOU A;  2KCV A;  4H7Y A;  5D0O D;  5EX0 A;  4JHR A;  3K9I A;  3QWP A;  3GYZ A;  3ESK A;  4J8D A;  4GA0 A;  4BTA A;  4F3V A;  4LEU A;  2VSN A;  4EQF A;  3OXL A;  3LYA A;  3Q49 B;  4CGW A;  2NC9 A;  2MHK A;  4I17 A;  3NF1 A;  3ZHE B;  1QZ2 A;  3CK8 A;  5KJN A;  4NRH B;  3MEK A;  4XI9 A;  2AVP A;  3U3W A;  2FBN A;  3CVP A;  4WND A;  4HOS A;  4BTB A;  3LY7 A;  5BT1 A;  3RO2 A;  4U04 A;  2VGY A;  5FZS A;  4GCO A;  3LY8 A;  5G05 C;  3CKC A;  3PDN A;  3MA5 A;  4WNG A;  2XPI A;  4HOU A;  1HZ4 A;  2UY1 A;  3U4T A;  5JJ7 A;  2Y4T A;  1P5Q A;  3ASH A;  2PL2 A;  2FI7 A;  4UI9 J;  3KS2 A;  4J8E A;  3ZN3 A;  5DBK A;  4O6F A;  3TG5 A;  3BEE A;  2PQN A;  1QQE A;  5HI7 A;  3QWV A;  4BWR A;  4BT9 A;  5LCW C;  2KCL A;  3ASF A;  1Y8M A;  5ARG A;  1KT0 A;  5DIZ A;  3EDT B;  3TGO A;  4AM9 A;  2XGM A;  3OXF A;  4UI9 K;  2FEZ A;  5G04 J;  5BNW A;  1B89 A;  5A7D B;  3TAX A;  3LCA A;  3UUX A;  1ELR A;  4AY6 A;  5M72 A;  4U07 A;  1OUV A;  3QDN A;  2XCC A;  3N71 A;  5JJT A;  4G26 A;  4KXK B;  2VGX A;  4N2S A;  5ARF A;  4BT8 A;  2BUG A;  4H7X A;  4GA1 A;  3KAE A;  3Q47 B;  4A1S A;  5CHE E;  3E4B A;  4RG6 A;  4GCN A;  3SF4 A;  2HO1 A;  3S7J A;  4YVQ C;  2PQR A;  3AS4 A;  4AY5 A;  3LPZ A;  2PZI A;  2XGO A;  4IN3 B;  2KAT A;  5JJ6 A;  3ZGQ A;  3CKB A;  2OOE A;  4GA2 A;  3OXG A;  3AS8 A;  4I2Z A;  4N2Q A;  5KJL A;  1ZBP A;  1YA0 A;  4J0U A;  4U0U A;  3MV2 B;  4YVO A;  2IF4 A;  2XCB A;  4B94 A;  3PE4 A;  3QKY A;  4UQY A;  3LKU A;  4G25 A;  3ASG A;  4GZ5 A;  5EKQ D;  3MKR A;  1WM5 A;  3GZ1 A;  1ELW A;  3CVQ A;  4I1A A;  2C2L A;  3Q5M A;  3KD7 A;  4I9C A;  4CDR A;  5EX3 A;  4RG9 A;  2VQ2 A;  3R9A B;  1KLX A;  1NZN A;  4GYY A;  4UI9 C;  4WNF A;  2IFU A;  2YHC A;  3Q4A B;  3SZ7 A;  2KC7 A;  4U0Z A;  1IHG A;  4KYO B;  3ZHE A;  1A17 A;  3CV0 A;  5FTP A;  3ASD A;  5C1D A;  1HH8 A;  3Q15 A;  5A6C A;  2Y4U A;  5FT9 A;  4UQZ A;  4ME2 A;  2LSV A;  4N39 A;  4W9R A;  3JYS A;  1PC2 A;  3CVN A;  2UY1 B;  4XI0 A;  3VTY A;  4HOT A;  2FO7 A;  1WAO 1;  3CVL A;  4G2V A;  5G04 C; 
#chains in the Genus database with same CATH topology
 3V31 A;  2IEJ A;  5D0Q D;  3D9J A;  3QJZ A;  3R9M A;  2HYZ A;  1OWO A;  2DCP A;  1UJK A;  2WQH A;  5E76 A;  2J09 A;  2WXH A;  2AXV A;  3TWQ A;  2FF4 A;  3ZKJ A;  1ZU2 A;  2YHE A;  3MV3 B;  4BX8 A;  5FZR A;  3S7F A;  2LNI A;  3Q7F A;  1JWG A;  3V79 K;  3W9G A;  3D9M A;  2VSY A;  1E7U A;  5BW8 C;  3LY9 A;  4JD2 G;  4QFV A;  2PM6 A;  1Y6I A;  4MRU A;  4G23 A;  3CR3 A;  3G2U A;  2DWZ A;  4MKT A;  4YDY A;  1HS6 A;  1X81 A;  2WXJ A;  2OND A;  1NA3 A;  2J8S D;  3O4Z A;  1RW2 A;  1KZO A;  3WXX A;  5B1B E;  2XQ0 A;  1SZA A;  5ENS D;  3F6Q A;  4I1M A;  2EQX A;  4I6J A;  2LSU A;  3T8M A;  1DVP A;  2AJA A;  4GYO A;  5KNH D;  4A63 B;  2OEV A;  4UQX A;  1XNF A;  2J08 A;  2X3M A;  3CHQ A;  3NOC D;  2BTD A;  5AQ7 A;  4HRN A;  1D9S A;  2VYI A;  3ZPJ A;  4GMR A;  4GZ6 A;  1E7V A;  1YCS B;  4OVU A;  4U63 A;  3HXE A;  5D66 A;  1KT1 A;  4N3B A;  3C98 A;  3I5P A;  2XGS A;  4GPK A;  1BI7 B;  4GZ3 A;  2OVF A;  4K03 A;  2DBA A;  2ETB A;  3QWW A;  2AWI A;  3CHR A;  3PE3 A;  5AYW D;  3DPD A;  5CCL A;  3URZ A;  2AXU A;  4H7Y A;  5EX0 A;  4JHR A;  2IU1 A;  2J07 A;  3ESK A;  3FH8 A;  2CFU A;  1N4R A;  4DX7 D;  4BTA A;  4JEU A;  3VLF A;  2QZA A;  3L17 A;  4LEU A;  4A3T A;  4EQF A;  3SBS A;  3LYA A;  3Q49 B;  2DVW A;  3Q75 A;  4CGW A;  2NC9 A;  2QY7 A;  3FTX A;  3SFY A;  2V4L A;  3L9T A;  3ML9 A;  4J8Y A;  5ENP D;  3B7R L;  3CIA A;  3IBE A;  4NRH B;  4XI9 A;  1JCQ A;  2ZGD A;  3Q79 A;  4HLE A;  4PH4 B;  4A55 A;  3C72 A;  3LY7 A;  3I4R B;  5BT1 A;  3RO2 A;  1LF8 A;  4B93 B;  2X6J A;  5FZS A;  3APD A;  2WXN A;  3FTY A;  3LY8 A;  2WB2 A;  1Z3X A;  3PDN A;  3FUF A;  3PZ3 A;  4HOU A;  1VDY A;  2KZT A;  2GRR B;  2BKK B;  2LXM A;  4C0M A;  1WDY A;  4G8L A;  3V2O A;  2FI7 A;  3G2V A;  1IXV A;  5FIN A;  1QQE A;  1BLX B;  4XKC A;  3L22 A;  3MZL B;  3QWV A;  1K3Z D;  4BWR A;  4EEC A;  5KBA A;  2XHE A;  2X38 A;  4BT9 A;  2BKG A;  3AG4 E;  3ASF A;  1TYQ G;  2IJG X;  2MRI A;  2XGM A;  3L08 A;  3OXF A;  4BES A;  2FEZ A;  3ONL A;  1A5E A;  2IO2 C;  1NL4 A;  4U8Y D;  1ELR A;  4P29 A;  3TWS A;  3D9O A;  1OUV A;  2ZXW E;  3QDN A;  2VGX A;  5EYP F;  4A1S A;  5CHE E;  3FEY A;  1N4S A;  2WXF A;  1O1T A;  3LJ3 A;  2WXK A;  3RK6 A;  3HHM A;  1DCQ A;  3HVE B;  1MYO A;  3AS4 A;  1N54 A;  4PS3 A;  3HRA A;  2DZN A;  3FTU A;  2YNQ A;  3Q9N C;  1AP7 A;  4FHK A;  4IN3 B;  2KBX A;  3LVQ E;  4GMJ A;  3CKB A;  2OOE A;  2CG3 A;  2IO3 C;  4HS2 A;  3AS8 A;  4I2Z A;  1EYH A;  4N2Q A;  4AOF A;  3HIZ A;  4GTV A;  4U0U A;  2IF4 A;  4HVB A;  1H19 A;  4ANW A;  4B89 A;  5CBN A;  3FH7 A;  3LS8 A;  3QKY A;  3LKU A;  3ZXP A;  4U95 D;  2L0I A;  1WM5 A;  2ION A;  4G8K A;  3QAR A;  4KZ0 A;  1TN6 A;  4U8H A;  3Q5M A;  4A3V A;  5HRY A;  3SD5 A;  3KD7 A;  4CT0 A;  2LAI A;  4DK5 A;  2HE0 A;  3MJW A;  3ZUV B;  4CDR A;  5AAO A;  3FUL A;  5EX3 A;  4RG9 A;  4UUC A;  2J4B A;  4NIK A;  2R2L A;  2MOW A;  3QK0 A;  5ENO D;  4LCT A;  4U7E B;  3SZ7 A;  3HXB A;  1LTX A;  2GGF A;  3KSL A;  1A17 A;  2VTB B;  2V5Q C;  3CV0 A;  3EHQ A;  2QC9 A;  5HS0 A;  2GRL A;  5C1D A;  3DBS A;  4OAV B;  4ME2 A;  4N39 A;  4W9R A;  4TXP A;  3JYS A;  3ASN E;  2KXP C;  4G2V A;  1LD7 A;  2J49 A;  2XPZ A;  3LVR E;  4UWL A;  4LER A;  2I9C A;  4I6G A;  2V4H C;  3S7D A;  3V2X A;  4RLY A;  3FU6 A;  3RRM B;  1BI8 B;  2XS8 A;  4WNE A;  4KZC A;  5AQ9 A;  3LDZ A;  3D9K A;  4NUR A;  2GW1 A;  1NA0 A;  5LX8 A;  1TN8 A;  2C0L A;  3U9W A;  2P9L G;  2CHX A;  3DEP A;  4DPR A;  2E2E A;  3L82 A;  4CEM A;  3ZEF A;  1E8Z A;  2L0T B;  5BPP A;  4CGV A;  4HRL A;  3PS6 A;  5FQ7 A;  3CVV A;  1E8W A;  4B8A A;  3PEV B;  4I2W A;  4V3I A;  3FTW A;  4NQ0 A;  4HOQ A;  3X2Q E;  3TWU A;  1HG2 A;  3FHE A;  2LO6 A;  4KVM A;  2P2C P;  3FUD A;  4CYM D;  1H6P A;  1H2U A;  2B6C A;  4GU5 A;  3RAU A;  2R5S A;  4IYP A;  2XPY A;  4JHJ A;  4UWK A;  3DWL G;  3SNX A;  3EHR A;  2J4D A;  4CCA A;  3ABL E;  4ABN A;  4AV7 A;  3EU5 A;  2IOL A;  1IQU A;  3LEW A;  2CFZ A;  3UI2 A;  4Y6W A;  5G2N A;  1QYM A;  2WPV A;  3MGB A;  3RIB A;  1YYH A;  4TUU A;  5AQB A;  1TNB A;  4BX9 A;  3ABK E;  3BG1 B;  4EBA G;  4JPS A;  2JEK A;  4APO A;  1U3D A;  4AJW A;  3B95 A;  2L9B A;  3PNT B;  4M3O A;  1SA5 A;  3IKO B;  4OYS A;  3L16 A;  5EYL A;  1YMP A;  4EZK A;  2P9N G;  5CRV A;  3Q78 A;  1U2V G;  4GYW A;  1E8Y A;  1TNO A;  3UKU G;  4G24 A;  4Q96 A;  3TWR A;  1K1B A;  1DCE A;  3FUM A;  3I4G A;  3NZU A;  3K9I A;  4JC8 A;  4L7T A;  3UM1 A;  2P9U G;  2WXP A;  3UMV A;  3NAW A;  2EIK E;  4BFR A;  2CHW A;  2Y0B G;  5CEC B;  3PVL A;  2ZU6 B;  3NF1 A;  3ZHE B;  4L1B A;  4GML A;  2ZIS A;  5ENR D;  4ZHB A;  3SY2 A;  4FC8 A;  5CMY A;  2FBN A;  4HOS A;  4DX6 D;  1OWL A;  5G55 A;  4ILI A;  2IQC A;  3ZXS A;  4M7C A;  1V55 E;  1BU9 A;  5LFA A;  3DPY A;  2R59 A;  4EBA A;  2DZO A;  2P9I G;  3SO8 A;  3CKC A;  5AJD A;  5KNG A;  3I3N A;  2P9S G;  2EIN E;  1OCC E;  3DXM G;  1JCR A;  3FUK A;  3U4T A;  5JJ7 A;  1JUQ A;  2Y4T A;  3LXU X;  3ASH A;  1H0A A;  2PL2 A;  4MBG A;  4UI9 J;  5AIJ A;  3KS2 A;  4J8E A;  4BEP A;  4RQI A;  4O6F A;  2PQN A;  3GZS A;  3UM0 A;  2XRY A;  1O5M A;  3FUH A;  2KCL A;  1Y8M A;  1KT0 A;  3FU0 A;  4E85 A;  3EDT B;  4BER A;  3RSE G;  5J90 A;  3TGO A;  3ZW3 A;  2RG8 A;  3ZVV A;  1OCR E;  3EUV A;  5G04 J;  3LCA A;  3EIJ A;  5EIL A;  3PZ4 A;  2WXM A;  4AY6 A;  3RRN B;  3D9N A;  3ONK A;  5CED B;  3FTV A;  3Q9U C;  4HFG A;  3CVX A;  3MYV A;  3ULY A;  3ULE G;  2OEW A;  4FUL A;  4G26 A;  4LNB A;  3TXN A;  4JVS A;  2BUG A;  4O1O A;  4H7X A;  3KAE A;  1K1A A;  1SZ9 A;  2DYR E;  4RG6 A;  3W9F A;  4TRQ A;  4C9B B;  4JZY A;  3DSU A;  2HO1 A;  3UIO C;  1H6K A;  5KWD A;  3MCX A;  5ITZ F;  4AY5 A;  2PZI A;  5JJ6 A;  4UWG A;  1JCS A;  5KJL A;  1YA0 A;  3NQP A;  4J0U A;  3DSW A;  4QQI A;  4LNG A;  1G3N B;  4YVO A;  1MJ0 A;  4PS7 A;  4FP7 A;  4APF A;  2H6F A;  2GRP B;  3PE4 A;  3BG0 B;  2NXP A;  3NB2 A;  4UQY A;  4IRU A;  1KPS B;  1K8K G;  1AWC B;  1JWF A;  3FU5 A;  1N0R A;  1HE8 A;  3VLD A;  3PH0 C;  4ANU A;  3EIQ C;  2WXR A;  4C48 B;  3RRU A;  5FQ4 A;  3UX4 A;  5JHB A;  2I1J A;  4I9C A;  2AXZ A;  1OWP A;  5JA4 D;  4JB8 P;  3HXD A;  3CHP A;  5LOZ A;  3R9A B;  1KLX A;  4UWF A;  4GB9 A;  4UI9 C;  1JPL A;  2YHC A;  2KC7 A;  1UN8 A;  2ZGG A;  4GTM A;  1QBQ A;  3NBN B;  3JUI A;  5FIO A;  1IQR A;  1Z3Y A;  3Q15 A;  5T8I A;  2Y4U A;  3E37 A;  2FO1 E;  2R02 A;  3B7S A;  4HLL A;  3CVN A;  2UY1 B;  4XI0 A;  3VTY A;  4HOT A;  4DI4 A;  4F1S A;  5G04 C;  4U96 D;  1Q2Z A;  2I1K A;  3MX3 A;  4J8F A;  1FPP A;  2H6I A;  3UT4 A;  1EDU A;  5KCM A;  5T3R A;  3CLJ A;  4N3A A;  3ZFW A;  4I9E A;  5BUZ A;  1TEZ A;  3JXJ A;  2WMO A;  5JHA A;  4N3C A;  4KVO A;  4N5Q A;  3GZ2 A;  3FU3 A;  1FVF A;  3SFZ A;  3D9H A;  3IXE A;  2NYJ A;  3UT7 A;  3SHF A;  4L9P A;  4DX1 A;  2F8X K;  3ZRH A;  1HX8 A;  5G05 J;  1FCH A;  2I6H A;  3RU0 A;  4NAC A;  2KM4 A;  3C3R A;  4Z68 A;  3ZIM A;  5D2M C;  3E34 A;  4OAU C;  3UPV A;  2Q7F A;  4X8Q A;  3ASO E;  4HBD A;  3DRA A;  3O48 A;  3S7B A;  2GRO B;  3TG4 A;  4PS8 A;  2QFC A;  1NFI E;  4ATZ D;  3V30 A;  3B7B A;  4JEH A;  1TR4 A;  4JA7 A;  3HYM B;  2KCK A;  2IY0 C;  2R17 C;  3CHS A;  4G1T A;  3Q73 A;  5AJL A;  4K5B A;  2XEH A;  1H6O A;  5AQA A;  1N52 A;  4GTO A;  5KJM A;  1IYG A;  5A23 A;  5HKP A;  3MKQ B;  1TNU A;  5FZQ A;  2HR2 A;  1E8X A;  2YQ8 A;  5E75 A;  2IOS A;  3GW4 A;  4I1O B;  1MX2 A;  2P9K G;  3HVE A;  2UWJ G;  3T5V A;  1TNZ A;  4ACL A;  4LUN U;  1FT2 A;  4U0S A;  3PZD A;  4IUL A;  3SBT B;  5CCM A;  1WY6 A;  4EZL A;  3APC A;  3CK9 A;  1HU3 A;  2P58 C;  4JA9 A;  1XGW A;  2WXO A;  2B0O E;  3FUJ A;  4GAA A;  3PZ2 A;  3QOU A;  3TJP A;  1N4Q A;  5D0O D;  1FVH A;  3QWP A;  2R05 A;  2P9P G;  1N0Q A;  3CSF A;  3B13 A;  4F3V A;  3ABM E;  1UG3 A;  2VSN A;  3D3M A;  4B8C B;  3OXL A;  3NZS A;  3PRE A;  4FU3 A;  5FWQ A;  3HXF A;  4I17 A;  1QZ2 A;  3CK8 A;  4AP2 A;  4O60 A;  3J5P A;  4XEI G;  3MEK A;  2AVP A;  4WND A;  3CVP A;  3AU4 A;  2XRZ A;  4BTB A;  4G11 A;  4U04 A;  1SW6 A;  1D8E A;  3TWW A;  4K5C A;  2PNN A;  1N4P A;  1O1R A;  2WQ6 A;  2RD0 A;  5G05 C;  1U3C A;  1OXJ A;  2VTB A;  1WG0 A;  3JQ0 A;  3MA5 A;  1PY1 A;  3FY4 A;  2NSZ A;  4Q69 A;  4DLQ A;  2XEE A;  1OWN A;  3CQG B;  3UKR G;  3DEO A;  3P2B A;  2FUL A;  3CHM A;  4UWH A;  4B0Z A;  1P5Q A;  2A4Z A;  2GRM A;  1KZP A;  3FUN A;  2V0P A;  2RFM A;  4O1P A;  1N11 A;  3TG5 A;  3BEE A;  5HI7 A;  3PNL B;  1EF1 C;  4WWO A;  2WXI A;  3UT8 A;  5DIZ A;  4I43 A;  3EU9 A;  4AM9 A;  5EDS A;  1FT1 A;  2I2O A;  4UI9 K;  4TV3 A;  5BNW A;  5A7D B;  4FLB A;  1BPO A;  3E30 A;  3UUX A;  2XZT G;  4U8V D;  3AU5 A;  5EN5 D;  5H7P A;  1H2V C;  4U07 A;  4ILH B;  3N71 A;  3PUJ A;  1OCZ E;  4ILG A;  2QYU A;  4L2Y A;  1OWM A;  3BQO A;  4BY6 A;  3Q47 B;  3ZYK A;  4BSZ B;  3S2A A;  3JQ1 A;  3NOG D;  3SF4 A;  3S7J A;  2L6B A;  3CGH A;  1GW6 A;  4A1G A;  5ANL A;  3D9P A;  2LUH A;  2X6K A;  2LAH A;  4DI3 A;  4EHM A;  3JCK C;  2EIJ E;  2ZIR A;  4GA2 A;  3OXG A;  1ZBP A;  3U64 A;  2HM8 A;  3MV2 B;  3FTS A;  4K0R A;  2VJ8 A;  3ZYL A;  4HRM B;  3L6A A;  1HF8 A;  5AAR A;  4LSZ E;  2ETC A;  3P1U A;  3FUE A;  3KEZ A;  3L13 A;  4G25 A;  3EJN A;  4MLP A;  5EKQ D;  1IKN D;  2EIL E;  3GZ1 A;  1NI1 A;  1ELW A;  4HI9 A;  3CVQ A;  4J8S A;  4I1A A;  3ESL A;  3JXI A;  2ILR A;  1OCO E;  3J5Q B;  3VLE A;  4DX2 A;  4FA6 A;  2VQ2 A;  1MHQ A;  5FQ6 A;  1EPU A;  3TWV A;  2BF0 X;  4GYY A;  5C2Y A;  1X5B A;  3R7Q A;  2IFU A;  2A5U A;  2WQ7 A;  3DSV A;  5BV0 A;  4GZC A;  1IHG A;  4KYO B;  5J08 A;  1OT8 A;  3ZHE A;  4ATG A;  2DIW A;  2Y3A A;  2WMN A;  4TXR A;  5FTP A;  4FHJ A;  3ASD A;  1S70 B;  2ETA A;  1HH8 A;  4KT6 B;  5FT9 A;  3FEX A;  4UQZ A;  4GPM A;  2KZT B;  4F7A A;  2GRN B;  3SGH A;  2FO7 A;  4AVX A;  1S64 A;  3T5X A;  4ANV A;  1MZC A;  4ACK A;  3CK7 A;  3RO3 A;  3HDX A;  4HB5 A;  4GTT A;  1ELK A;  4XIF A;  1E96 B;  1IHB A;  4RSY A;  4Y6C A;  3RKV A;  3CQC B;  3ULQ A;  2JLB A;  2DYS E;  2PM7 A;  2J9Q A;  4AXH A;  1SVX A;  5ENN A;  4WUY A;  4LNU D;  4OVV A;  3FH5 A;  1HFA A;  3PRZ A;  4HXI A;  2RFA A;  3CST A;  1RZ4 A;  1TJC A;  2M63 A;  2WXG A;  2XS1 A;  1SQM A;  4JXT A;  3UQ3 A;  1UOH A;  1W3B A;  1Z6T A;  2C0M A;  3C3Q A;  1E90 A;  3TWT A;  2XEV A;  1UJJ A;  4N5C A;  3UM2 A;  2MYO A;  3IEG A;  4FJY A;  2VGX B;  4JL0 A;  5AN8 A;  2WXQ A;  4GTR A;  4XKB A;  5B1A E;  3DST A;  3RJV A;  2WVI A;  3AS5 A;  5HQ8 A;  2V5F A;  2R03 A;  3ML8 A;  4ANX A;  5AEN A;  5KJK A;  5LCW J;  2F8Y A;  3AAA C;  2V8S E;  2L6J A;  1MQS A;  4DLO A;  3FWV A;  2H6H A;  4CDN A;  4WWN A;  1TNY A;  1HXI A;  2Y69 E;  2XEN A;  3Q7A A;  4YND A;  3FUI A;  3PUK A;  4FLH A;  3VTX A;  5EIB E;  2E0I A;  1NP7 A;  1MX6 A;  3OAW A;  4HOR A;  3FP3 A;  4TUM A;  3LJN A;  3CEQ A;  3C3O A;  1Z5S C;  2VSO E;  2XZD G;  4FJZ A;  3AG1 E;  3C5R A;  4WWP A;  4AIF A;  4DUI A;  2X6I A;  2OCC E;  4TXQ A;  4KMO A;  5T4Y A;  3SQV A;  5FJY A;  1INZ A;  3FFL A;  5ANR A;  4KBQ A;  2KCV A;  3UIP C;  4AEZ C;  1TJF A;  3GYZ A;  4J8D A;  1OY3 D;  4GA0 A;  4LRZ A;  5ENT D;  5CMW A;  2H6G A;  4DJA A;  4L2L A;  3SI5 A;  5CRU A;  3UTM A;  4GTS A;  5BV1 A;  1DC2 A;  2MHK A;  3FDH A;  4WAF A;  2JAB A;  2AW6 A;  4J7W A;  5KJN A;  4DRX E;  3U3W A;  3BU8 A;  3OTN A;  4D10 C;  3QAQ A;  3G2T A;  3TL5 A;  2VGY A;  4GCO A;  3CVW A;  5CEA A;  3ISM C;  4GTQ A;  3DSS A;  3ZU7 B;  4CDM A;  4EPZ A;  5EID A;  4PDX A;  4XX5 A;  4WNG A;  2XPI A;  1HZ4 A;  1DNP A;  3D9L A;  3ENE A;  2UY1 A;  4GTP A;  1TN7 A;  1L5J A;  3E33 A;  4MS6 A;  3WG7 E;  2X6H A;  3EHM A;  5ENQ D;  4C0E A;  3ZN3 A;  5DBK A;  3CHO A;  3AG3 E;  5CER B;  2WM9 A;  3BUA A;  1S0P A;  4PUC A;  4LG6 A;  3PEU B;  5LCW C;  1H2T C;  5ARG A;  4F1P A;  1N9A A;  3E32 A;  5B3S E;  3UIN C;  2RKK A;  1ZB1 A;  3G2S A;  3IHV A;  3TXM A;  2WXL A;  3U66 A;  1B89 A;  1PAQ A;  3QC1 A;  3TAX A;  5BXO A;  1O1S A;  1SA4 A;  3KEA A;  3UM3 A;  5LP0 A;  3EHN A;  5M72 A;  2XCC A;  2OVB A;  3ZNG A;  5JJT A;  3ZYQ A;  3HG0 D;  4KXK B;  4N2S A;  5ARF A;  4BT8 A;  4F6R D;  2A5E A;  4GA1 A;  4Q94 A;  3E4B A;  1HO8 A;  1V54 E;  3SFX A;  2CHZ A;  3DSX A;  4I6E A;  4GCN A;  4BSX A;  5BXU A;  4YVQ C;  2PQR A;  3G2W A;  3FTZ A;  5IY5 E;  3CVU A;  3LPZ A;  2XGO A;  1D8D A;  3ZGQ A;  2KAT A;  4GZD A;  3B7U X;  2VSX E;  2Y1L E;  3MKQ A;  4JW1 A;  3QNK A;  2EIM E;  4HNA D;  2YIN A;  3HXC A;  2CG2 A;  3B7T A;  4URK A;  2X6F A;  3IHY A;  2XCB A;  4B94 A;  2QYJ A;  2OV8 A;  4J6I A;  2F0Y A;  3T9K A;  2F37 A;  3JUE A;  3L54 A;  3ASG A;  4GZ5 A;  3MKR A;  3TWX A;  5FQ8 A;  1LD8 A;  4HQD A;  1QNF A;  4RVB A;  2C2L A;  2LXL A;  3QB2 A;  3AJI A;  4JHK A;  3DXK G;  3UXG A;  3IV0 A;  4L23 A;  3R7R A;  4F53 A;  1HG5 A;  3APF A;  1MX4 A;  1NZN A;  4CRW A;  5CBO A;  3KSQ A;  4K5A B;  4E6H A;  4CT4 A;  4WNF A;  2GRQ B;  3Q4A B;  3T8K A;  4YDE A;  1UN9 A;  2VGE A;  3CVY A;  4YDW A;  1UW4 B;  4R7L A;  4U0Z A;  3ZYM A;  3AG2 E;  1N95 A;  3D9I A;  1N94 A;  4HI8 A;  4ZFH A;  2BED A;  4DX5 D;  4YDO A;  5JMN D;  4EZJ A;  5A6C A;  4CZ2 D;  1S63 A;  2LSV A;  3PZ1 A;  4BET A;  1BD8 A;  1PC2 A;  4XE0 A;  4XZ4 A;  3CVL A;  1WAO 1;  4FAD A; 
#chains in the Genus database with same CATH homology
 3T5X A;  5D0Q D;  2J49 A;  3D9J A;  2XPZ A;  3QJZ A;  3LVR E;  4ANV A;  2HYZ A;  1OWO A;  2I1K A;  3MX3 A;  4J8F A;  4ACK A;  3CK7 A;  3RO3 A;  2DCP A;  3HDX A;  1UJK A;  1EDU A;  2WQH A;  5E76 A;  2J09 A;  4UWL A;  3UT4 A;  1ELK A;  2WXH A;  2AXV A;  4XIF A;  5KCM A;  5T3R A;  1E96 B;  3CLJ A;  4N3A A;  2FF4 A;  3ZFW A;  4RSY A;  1ZU2 A;  2YHE A;  3MV3 B;  4BX8 A;  4LER A;  4Y6C A;  5FZR A;  2I9C A;  4I9E A;  5BUZ A;  3RKV A;  3CQC B;  1TEZ A;  4I6G A;  3S7F A;  3ULQ A;  2LNI A;  3S7D A;  1JWG A;  2JLB A;  3FU6 A;  2WMO A;  3RRM B;  5JHA A;  4N3C A;  3D9M A;  4WNE A;  2PM7 A;  2VSY A;  4KVO A;  4KZC A;  2J9Q A;  1E7U A;  5BW8 C;  3LY9 A;  3LDZ A;  3GZ2 A;  4AXH A;  4QFV A;  3FU3 A;  5ENN A;  3D9K A;  4NUR A;  1FVF A;  2GW1 A;  3SFZ A;  2PM6 A;  1NA0 A;  1Y6I A;  4WUY A;  5LX8 A;  4MRU A;  2C0L A;  3UT7 A;  4G23 A;  3SHF A;  3U9W A;  3CR3 A;  2CHX A;  4DPR A;  3G2U A;  2E2E A;  4MKT A;  1HS6 A;  4OVV A;  3FH5 A;  1HFA A;  4CEM A;  3PRZ A;  4HXI A;  3CST A;  3ZEF A;  1E8Z A;  1TJC A;  2L0T B;  2M63 A;  5BPP A;  2WXJ A;  2WXG A;  3ZRH A;  1HX8 A;  4CGV A;  5G05 J;  1FCH A;  2I6H A;  1SQM A;  3PS6 A;  4JXT A;  3UQ3 A;  2OND A;  3RU0 A;  4NAC A;  1NA3 A;  5FQ7 A;  3CVV A;  1E8W A;  2KM4 A;  3O4Z A;  3PEV B;  1W3B A;  1Z6T A;  2C0M A;  3FTW A;  4I2W A;  4V3I A;  3ZIM A;  4B8A A;  4NQ0 A;  4HOQ A;  1E90 A;  3WXX A;  1HG2 A;  2XEV A;  3FHE A;  3UPV A;  2LO6 A;  4KVM A;  2Q7F A;  2XQ0 A;  1SZA A;  1UJJ A;  3FUD A;  4N5C A;  3O48 A;  3S7B A;  4I1M A;  3TG4 A;  4PS8 A;  3IEG A;  1H2U A;  4FJY A;  2QFC A;  2EQX A;  2VGX B;  4GU5 A;  4JL0 A;  2R5S A;  4IYP A;  2XPY A;  4I6J A;  2WXQ A;  4JHJ A;  4UWK A;  4JEH A;  4XKB A;  3SNX A;  2J4D A;  2LSU A;  3T8M A;  3RJV A;  2WVI A;  4CCA A;  3AS5 A;  1DVP A;  4ABN A;  4GYO A;  4AV7 A;  2IOL A;  1IQU A;  5HQ8 A;  3LEW A;  2CFZ A;  2V5F A;  4JA7 A;  3ML8 A;  4ANX A;  4Y6W A;  3HYM B;  2KCK A;  4UQX A;  5AEN A;  1XNF A;  2R17 C;  5KJK A;  2J08 A;  2X3M A;  3CHQ A;  3CHS A;  4G1T A;  5AJL A;  2BTD A;  5G2N A;  5LCW J;  2VYI A;  3ZPJ A;  2V8S E;  2WPV A;  1N52 A;  2L6J A;  3MGB A;  5KJM A;  1MQS A;  3RIB A;  4DLO A;  3FWV A;  1IYG A;  4TUU A;  5A23 A;  4GZ6 A;  4BX9 A;  3MKQ B;  3BG1 B;  4CDN A;  4WWN A;  4EBA G;  5FZQ A;  2HR2 A;  1HXI A;  4JPS A;  1E8X A;  2YQ8 A;  5E75 A;  4YND A;  1E7V A;  2IOS A;  2JEK A;  3FUI A;  3GW4 A;  3PUK A;  4FLH A;  4I1O B;  4APO A;  3VTX A;  2E0I A;  1NP7 A;  4OVU A;  3HVE A;  1U3D A;  4AJW A;  4U63 A;  3OAW A;  4HOR A;  3FP3 A;  2UWJ G;  2L9B A;  3CEQ A;  3PNT B;  1KT1 A;  3T5V A;  4ACL A;  4N3B A;  2VSO E;  4M3O A;  3C98 A;  4LUN U;  3IKO B;  4FJZ A;  3I5P A;  2XGS A;  4OYS A;  3L16 A;  4WWP A;  4U0S A;  4AIF A;  3PZD A;  4GPK A;  2X6I A;  4IUL A;  4EZK A;  3SBT B;  5CCM A;  5T4Y A;  1WY6 A;  4KMO A;  4GZ3 A;  2OVF A;  4EZL A;  3APC A;  4K03 A;  2DBA A;  3CK9 A;  4GYW A;  1HU3 A;  3QWW A;  1E8Y A;  5FJY A;  2P58 C;  4JA9 A;  1INZ A;  1XGW A;  2AWI A;  2WXO A;  3FFL A;  5ANR A;  3CHR A;  3PE3 A;  3FUJ A;  4G24 A;  3DPD A;  5AYW D;  4Q96 A;  4GAA A;  4KBQ A;  2AXU A;  3QOU A;  3URZ A;  5CCL A;  2KCV A;  3FUM A;  3TJP A;  3I4G A;  4H7Y A;  5D0O D;  5EX0 A;  3NZU A;  2IU1 A;  3K9I A;  1FVH A;  3QWP A;  4JHR A;  4AEZ C;  1TJF A;  2J07 A;  3GYZ A;  3ESK A;  4J8D A;  3FH8 A;  2CFU A;  4JC8 A;  4GA0 A;  4BTA A;  4JEU A;  4L7T A;  4LRZ A;  3VLF A;  5CMW A;  3CSF A;  3L17 A;  3B13 A;  2WXP A;  4F3V A;  3UMV A;  1UG3 A;  4LEU A;  4DJA A;  4A3T A;  2VSN A;  4EQF A;  3D3M A;  4L2L A;  3SI5 A;  4B8C B;  3OXL A;  3SBS A;  4BFR A;  2CHW A;  3LYA A;  3Q49 B;  4CGW A;  2NC9 A;  3NZS A;  5BV1 A;  2QY7 A;  3FTX A;  2MHK A;  3FDH A;  3PRE A;  4FU3 A;  3PVL A;  5FWQ A;  4WAF A;  2V4L A;  4I17 A;  2ZU6 B;  3NF1 A;  3ZHE B;  4L1B A;  2AW6 A;  3ML9 A;  1QZ2 A;  4GML A;  3CK8 A;  3B7R L;  4AP2 A;  5KJN A;  3CIA A;  3IBE A;  4FC8 A;  4NRH B;  3MEK A;  4XI9 A;  5CMY A;  2AVP A;  3U3W A;  2FBN A;  3CVP A;  4WND A;  4HOS A;  3AU4 A;  4HLE A;  1OWL A;  3OTN A;  5G55 A;  4PH4 B;  4A55 A;  2XRZ A;  4D10 C;  4ILI A;  4BTB A;  3LY7 A;  2IQC A;  3G2T A;  3I4R B;  3QAQ A;  3RO2 A;  5BT1 A;  3ZXS A;  1LF8 A;  4G11 A;  4U04 A;  2X6J A;  3TL5 A;  2VGY A;  5FZS A;  4GCO A;  5LFA A;  2R59 A;  3CVW A;  4EBA A;  3APD A;  2WXN A;  2WQ6 A;  3FTY A;  3LY8 A;  2RD0 A;  4CDM A;  2WB2 A;  5G05 C;  1U3C A;  4EPZ A;  2VTB A;  3CKC A;  1Z3X A;  3PDN A;  3JQ0 A;  3MA5 A;  4PDX A;  5AJD A;  4XX5 A;  1PY1 A;  3FY4 A;  2NSZ A;  4WNG A;  3I3N A;  4Q69 A;  3FUF A;  2XPI A;  4DLQ A;  4HOU A;  1HZ4 A;  1DNP A;  1OWN A;  1VDY A;  3CQG B;  2KZT A;  3P2B A;  2FUL A;  3D9L A;  3ENE A;  2UY1 A;  3FUK A;  3U4T A;  5JJ7 A;  1JUQ A;  3CHM A;  4UWH A;  1L5J A;  2Y4T A;  4C0M A;  3LXU X;  4MS6 A;  4B0Z A;  1P5Q A;  3ASH A;  2X6H A;  2A4Z A;  2GRM A;  3EHM A;  1H0A A;  3FUN A;  2PL2 A;  2FI7 A;  4UI9 J;  3G2V A;  5AIJ A;  4C0E A;  3KS2 A;  4J8E A;  3ZN3 A;  5DBK A;  2V0P A;  3CHO A;  4O6F A;  3TG5 A;  3BEE A;  2PQN A;  3GZS A;  2WM9 A;  1QQE A;  4XKC A;  1S0P A;  5HI7 A;  3L22 A;  3MZL B;  3QWV A;  2XRY A;  4PUC A;  4BWR A;  4EEC A;  2XHE A;  2X38 A;  3PEU B;  4BT9 A;  3PNL B;  3FUH A;  5LCW C;  2KCL A;  1EF1 C;  3ASF A;  1Y8M A;  1H2T C;  4WWO A;  5ARG A;  1KT0 A;  2IJG X;  2WXI A;  3FU0 A;  4E85 A;  3UT8 A;  5DIZ A;  3EDT B;  2MRI A;  4I43 A;  5J90 A;  3TGO A;  3ZW3 A;  4AM9 A;  2XGM A;  3L08 A;  5EDS A;  2I2O A;  2RG8 A;  3G2S A;  3IHV A;  3OXF A;  4UI9 K;  3TXM A;  3ZVV A;  4TV3 A;  2FEZ A;  2WXL A;  5G04 J;  5BNW A;  1B89 A;  1PAQ A;  3U66 A;  5A7D B;  3QC1 A;  4FLB A;  3ONL A;  3TAX A;  3LCA A;  1BPO A;  3UUX A;  3EIJ A;  3AU5 A;  1ELR A;  5LP0 A;  2WXM A;  3EHN A;  4AY6 A;  1H2V C;  3RRN B;  5M72 A;  3D9N A;  3ONK A;  4P29 A;  4U07 A;  3D9O A;  3FTV A;  1OUV A;  4HFG A;  3QDN A;  4ILH B;  3CVX A;  2XCC A;  2OVB A;  3MYV A;  3N71 A;  5JJT A;  3PUJ A;  4ILG A;  3ZYQ A;  4FUL A;  4G26 A;  4KXK B;  3TXN A;  2VGX A;  4L2Y A;  5ARF A;  4N2S A;  4BT8 A;  4JVS A;  1OWM A;  2BUG A;  4H7X A;  4BY6 A;  4GA1 A;  3KAE A;  3Q47 B;  4Q94 A;  5CHE E;  3ZYK A;  4A1S A;  3E4B A;  1HO8 A;  3FEY A;  1SZ9 A;  2WXF A;  2CHZ A;  4RG6 A;  3LJ3 A;  2WXK A;  4TRQ A;  4I6E A;  4GCN A;  4C9B B;  3S2A A;  3JQ1 A;  4JZY A;  3SF4 A;  2HO1 A;  3S7J A;  3RK6 A;  4BSX A;  3CGH A;  3HHM A;  3HVE B;  4YVQ C;  1GW6 A;  2PQR A;  1H6K A;  5ANL A;  3AS4 A;  1N54 A;  3G2W A;  4PS3 A;  4A1G A;  3D9P A;  3MCX A;  3FTZ A;  3CVU A;  4AY5 A;  3LPZ A;  3FTU A;  2YNQ A;  2PZI A;  2XGO A;  2X6K A;  2KAT A;  4FHK A;  2LAH A;  4IN3 B;  4UWG A;  5JJ6 A;  3ZGQ A;  3JCK C;  3LVQ E;  4GMJ A;  4GZD A;  4DI3 A;  3B7U X;  3CKB A;  2OOE A;  2CG3 A;  2VSX E;  4GA2 A;  3MKQ A;  4HS2 A;  3OXG A;  3AS8 A;  3QNK A;  1EYH A;  4JW1 A;  4I2Z A;  5KJL A;  1ZBP A;  3U64 A;  1YA0 A;  4N2Q A;  2YIN A;  3NQP A;  3HIZ A;  4J0U A;  4AOF A;  2CG2 A;  4U0U A;  3B7T A;  2HM8 A;  3MV2 B;  4YVO A;  3FTS A;  4K0R A;  4PS7 A;  4FP7 A;  2VJ8 A;  4URK A;  2IF4 A;  2X6F A;  3IHY A;  4APF A;  3ZYL A;  2XCB A;  4B94 A;  4HVB A;  2OV8 A;  3PE4 A;  1H19 A;  4ANW A;  3L6A A;  4B89 A;  1HF8 A;  3FH7 A;  3BG0 B;  4J6I A;  3LS8 A;  2NXP A;  3QKY A;  4UQY A;  3LKU A;  3P1U A;  4IRU A;  3FUE A;  3KEZ A;  3L13 A;  4G25 A;  3EJN A;  3L54 A;  3ASG A;  4MLP A;  2L0I A;  4GZ5 A;  5EKQ D;  3MKR A;  1WM5 A;  3GZ1 A;  1JWF A;  2ION A;  3FU5 A;  5FQ8 A;  1ELW A;  1HE8 A;  3QAR A;  4KZ0 A;  3VLD A;  3PH0 C;  3CVQ A;  4ANU A;  4J8S A;  1QNF A;  3EIQ C;  4FAD A;  4RVB A;  4I1A A;  2C2L A;  4U8H A;  3ESL A;  2WXR A;  3Q5M A;  3RRU A;  5FQ4 A;  3QB2 A;  2ILR A;  3UX4 A;  4A3V A;  5JHB A;  3SD5 A;  2I1J A;  3KD7 A;  4I9C A;  4CT0 A;  2AXZ A;  1OWP A;  4JHK A;  2LAI A;  4DK5 A;  3VLE A;  3IV0 A;  3MJW A;  4CDR A;  4L23 A;  3FUL A;  3R7R A;  5EX3 A;  4RG9 A;  3CHP A;  4F53 A;  1HG5 A;  3APF A;  4FA6 A;  2VQ2 A;  1MHQ A;  5FQ6 A;  1EPU A;  1KLX A;  5LOZ A;  2BF0 X;  3R9A B;  2J4B A;  4UWF A;  1NZN A;  4CRW A;  4GB9 A;  4GYY A;  5C2Y A;  4E6H A;  4CT4 A;  1X5B A;  2MOW A;  3QK0 A;  4UI9 C;  4WNF A;  4LCT A;  3R7Q A;  2IFU A;  1JPL A;  2YHC A;  3Q4A B;  3SZ7 A;  1UN9 A;  2KC7 A;  2A5U A;  2WQ7 A;  2GGF A;  3CVY A;  1UW4 B;  1UN8 A;  4R7L A;  5BV0 A;  4U0Z A;  4GZC A;  1IHG A;  4KYO B;  5J08 A;  3ZYM A;  3ZHE A;  3JUI A;  4ATG A;  1A17 A;  3D9I A;  2DIW A;  1IQR A;  1Z3Y A;  2WMN A;  2Y3A A;  3CV0 A;  2VTB B;  5FTP A;  4FHJ A;  3ASD A;  2GRL A;  5C1D A;  1HH8 A;  3Q15 A;  4EZJ A;  5A6C A;  4KT6 B;  2Y4U A;  5FT9 A;  3FEX A;  4UQZ A;  5T8I A;  3DBS A;  3B7S A;  4ME2 A;  2KZT B;  2LSV A;  4N39 A;  4W9R A;  4F7A A;  3JYS A;  1PC2 A;  3CVN A;  2UY1 B;  4XI0 A;  4XE0 A;  3VTY A;  3SGH A;  4XZ4 A;  4DI4 A;  4HOT A;  2FO7 A;  1WAO 1;  3CVL A;  4G2V A;  4AVX A;  4F1S A;  5G04 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...