4KXKB

Alanine-glyoxylate aminotransferase variant k390a/k391a in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
288
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transport protein
molecule keywords Serine--pyruvate aminotransferase
publication title Ligand-Induced Compaction of the PEX5 Receptor-Binding Cavity Impacts Protein Import Efficiency into Peroxisomes.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 288
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kxkB00
2VGXA 4NRHB 3ESKA 3MA5A 4KXKB 3PE4A 4U04A 4BWRA 2Y4TA 2C0LA 3U4TA 5BNWA 5KJNA 1ZU2A 4UI9J 4JL0A 4YNDA 5EX0A 3RKVA 5DBKA 5CCLA 5M72A 4UI9C 2R5SA 4WUYA 3GZ2A 3MV3B 3O48A 2ONDA 2VSYA 1KT1A 2E2EA 3AS8A 3S7DA 3NF1A 3ASGA 4F3VA 2PL2A 3OXGA 4G26A 3QDNA 3ULQA 3FP3A 4BTBA 1W3BA 3ZGQA 5JJ6A 4CGWA 5HI7A 2C0MA 1WAO1 1KLXA 4I1AA 4N3AA 3RU0A 4N2SA 4I9EA 3ZPJA 3QKYA 2FO7A 1XNFA 3Q5MA 3CK8A 4RG6A 3TGOA 3ZFWA 5ARGA 2LNIA 4W9RA 4HORA 1B89A 2V5FA 1HXIA 2KCVA 4G1TA 4JA7A 2LSUA 3JYSA 2FI7A 2KCKA 3CVQA 3QWPA 4YVOA 1HZ4A 4CGVA 5CHEE 3TG4A 2C2LA 2MHKA 2OOEA 2P58C 5FZQA 4N2QA 3LY7A 5LCWJ 4RG9A 3SZ7A 2IF4A 1HH8A 2UY1B 5LCWC 3CKCA 1WM5A 3FWVA 2UWJG 2XEVA 5EX3A 3RO3A 1PC2A 4HOQA 4I9CA 4U07A 5A6CA 4EQFA 3CVPA 4UI9K 4WNGA 5AYWD 3U3WA 4N5CA 4ABNA 4N3CA 4H7XA 3CKBA 4I2WA 3ASDA 5FZSA 4Y6WA 3Q47B 3UPVA 3Q49B 4KYOB 3OXFA 3GZ1A 1QZ2A 4AM9A 4O6FA 3ASFA 2L6JA 3S7FA 3CVLA 3TG5A 1A17A 3CK9A 2GW1A 3MV2B 1IHGA 3K9IA 2XGOA 3ZN3A 3MEKA 1KT0A 4GYOA 5KJMA 2WQHA 5BW8C 5G04J 2J9QA 4AY5A 2JLBA 4XIFA 4GCNA 2QFCA 2PQNA 3RO2A 4GPKA 2KC7A 3PE3A 5G04C 5BT1A 4BT8A 3GW4A 4GCOA 1NZNA 1IYGA 3QWWA 4I17A 4UQZA 4A1SA 2XGSA 3VTYA 3EDTB 5JJ7A 1Y8MA 2FF4A 5KJKA 4G2VA 5CCMA 4APOA 4U0SA 4NQ0A 4I2ZA 1QQEA 3KAEA 4UQXA 3SF4A 4J8FA 5FZRA 3KS2A 3LY8A 4HOSA 2YHCA 1YA0A 2XCCA 5ARFA 2UY1A 2VSNA 2XPIA 5EKQD 5FT9A 4XI9A 2KATA 3KD7A 3LCAA 3QOUA 4J8DA 5DIZA 4GYYA 3TAXA 3CVNA 2IFUA 2VYIA 2FEZA 5D0OD 1NA0A 4U0UA 4GA2A 3ZHEA 1NA3A 1TJCA 3WXXA 2VQ2A 4WNEA 3CK7A 4KBQA 5KJLA 3AS5A 2YQ8A 4AIFA 5G05J 3ZHEB 4GYWA 4YVQC 2HR2A 4N3BA 3HYMB 3LYAA 5G05C 4IN3B 3URZA 4LEUA 2VGXB 4GZ3A 2BUGA 4XI0A 3CV0A 3AS4A 2XGMA 2FBNA 5D0QD 1E96B 5FTPA 4GZ6A 4ME2A 4J0UA 4BTAA 4HOUA 1OUVA 5FJYA 2HYZA 2Q7FA 4UQYA 1ELRA 3UUXA 3LKUA 2I6HA 2PZIA 4G23A 4G24A 1P5QA 3UQ3A 2AVPA 4H7YA 4U0ZA 2WPVA 3Q15A 2Y4UA 4JHRA 3QWVA 3E4BA 2KCLA 2HO1A 1ELWA 2PQRA 4GA0A 2LSVA 3R9AB 4JA9A 3RIBA 4CDRA 2NC9A 4GZ5A 3BEEA 3PDNA 4WNFA 3S7JA 3VTXA 3MKRA 4Y6CA 5C1DA 4B94A 3OXLA 4N39A 3N71A 4AY6A 4BT9A 1ZBPA 3ASHA 2XCBA 5HQ8A 3FFLA 2DBAA 1FCHA 4G25A 3LPZA 2VGYA 3LY9A 4J8EA 3IEGA 5JJTA 5A7DB 3CEQA 4HOTA 4GA1A 3S7BA 3RJVA 3Q4AB 4WNDA 3GYZA
chains in the Genus database with same CATH superfamily
3PEVB 4WWOA 3D9PA 3PE4A 5T8IA 4UWLA 2Y4TA 3U4TA 4XEIG 4YDYA 3ZRHA 4GTTA 1ZU2A 3FEYA 3TJPA 4BSXA 3Q9UC 2IU1A 4KVMA 5EX0A 4ILGA 5DBKA 4HNAD 5CRUA 3JQ1A 2AWIA 5CCLA 4UI9C 1HG5A 2E2EA 3QB2A 3AG4E 4LNBA 5EYLA 1H2TC 3SFYA 2ILRA 2VTBB 3SGHA 4J7WA 3CVVA 2PL2A 4C48B 2A5UA 2KXPC 3B7UX 3FTUA 5FWQA 1VDYA 4ATGA 1W3BA 2WB2A 3IBEA 5ANLA 3CSFA 3E30A 2XPZA 3DSWA 2P9PG 5HI7A 4JEUA 3D9NA 4L2LA 4I9EA 3ZPJA 5BXOA 2WXJA 2FO7A 3OAWA 3PVLA 4GTVA 4HBDA 3LEWA 4JHKA 3ZFWA 5ARGA 2LNIA 1OCZE 2H6IA 1B89A 3Q7AA 2GRPB 1HXIA 3KEZA 2DVWA 4U8VD 4JA7A 4GTPA 3JXIA 2AXUA 4OAUC 3E34A 3PZ3A 3CVQA 4JXTA 1G3NB 3PZ1A 3I3NA 4FU3A 4CGVA 3UM2A 2AXZA 3LS8A 3TG4A 2C2LA 2EIKE 3RAUA 3D9HA 4GMRA 2RKKA 2LUHA 4GZCA 2YINA 4N2QA 5LCWJ 1N4SA 3RRUA 3BU8A 1JUQA 3ZU7B 1Z6TA 1ELKA 1YCSB 2UWJG 4LRZA 4I9CA 5A6CA 4FHKA 4EQFA 3O4ZA 1X5BA 2BKGA 2XEEA 3TWXA 3CVYA 2DWZA 3EJNA 3APFA 4EBAA 1S0PA 2BF0X 3HVEB 4I2WA 3UT7A 4GZDA 3MGBA 3T5XA 4EZKA 2GROB 5FZSA 3Q49B 3J5PA 1HG2A 3FULA 3OXFA 3GZ1A 4AM9A 1UJKA 4JC8A 4CEMA 1N52A 3CK9A 3OTNA 5EYPF 1IHGA 3K9IA 2XGOA 3ZW3A 4TV3A 5KJMA 4C0EA 5G04J 2J9QA 4HB5A 4XIFA 4MRUA 3B13A 2KC7A 3PE3A 1SZAA 4J8SA 4U8HA 4AEZC 3QK0A 3GW4A 4GCOA 1QBQA 4U95D 4I17A 4UQZA 4I6EA 4AP2A 3EHMA 3TWSA 2CG3A 2ZU6B 3VTYA 5JJ7A 5D2MC 4AJWA 3RRNB 3ML8A 4G2VA 2VSXE 4LSZE 3ASNE 4U0SA 3J5QB 4NQ0A 1KZOA 4L1BA 4GAAA 5KBAA 3T5VA 3LVRE 2L0IA 3RSEG 1D9SA 3L54A 3APCA 2BEDA 5ENTD 3BG1B 3UXGA 2XPIA 1FT2A 4ZHBA 3UIPC 1SW6A 4GYYA 3G2WA 3QARA 4GTOA 2FEZA 3FTXA 4YDWA 2J07A 3FU3A 4GA2A 4BX8A 1RW2A 5FIOA 4LNGA 1TJCA 3WXXA 5KNHD 5LP0A 3HVEA 4C9BB 3CK7A 4F1PA 3TWTA 4Q69A 2EIJE 2HR2A 3HYMB 4KVOA 3FDHA 5JHBA 4DPRA 1WY6A 3URZA 1IXVA 4LEUA 2P9NG 3FU0A 3E33A 2MYOA 3ENEA 3WG7E 4OAVB 2XGMA 1IQUA 5D0QD 2J09A 3JXJA 3C3RA 2RFAA 4J0UA 2H6GA 1HX8A 5J08A 1OUVA 3HG0D 1TNUA 1Z3XA 5FJYA 5A23A 5G2NA 3UUXA 4OVUA 2PZIA 1E8XA 4ANUA 4DI4A 5BV1A 1P5QA 2ETAA 2A5EA 1OCRE 2FO1E 3SBSA 3ZXPA 1N0RA 2Y69E 4OVVA 4EPZA 3QWVA 3DSXA 4TXPA 2GRQB 2AXVA 4AOFA 3MCXA 3TWRA 2WXLA 4G11A 1UG3A 1ELWA 3FTSA 1OXJA 1OWLA 1OT8A 2GRMA 4AXHA 4GA0A 1K1BA 2LSVA 3FUHA 4PH4B 2IOSA 3B95A 2IONA 2R2LA 3QNKA 4BX9A 4XE0A 3FU6A 4DUIA 4GZ5A 3LJNA 5CRVA 3BEEA 3PDNA 2VJ8A 1HF8A 4Y6CA 3SO8A 5C1DA 4B94A 1N95A 3C3OA 5FINA 4AY6A 4BT9A 4ZFHA 2P9LG 2YHEA 3FTWA 3ASHA 3SY2A 2XCBA 3D9LA 3SD5A 2WXFA 2DBAA 2XQ0A 3NZUA 3LPZA 1K3ZD 3AG1E 5ENSD 5B1BE 1K1AA 5JJTA 3HRAA 4HI8A 4MKTA 3W9GA 4DK5A 1IKND 4A3TA 4GA1A 3Q4AB 4DX1A 1D8DA 3GYZA 3Q75A 1DVPA 4HVBA 4KXKB 4F1SA 4U04A 3DBSA 4BWRA 3R7RA 3EIQC 5FQ4A 5AN8A 4CDNA 1LD7A 5BXUA 3PEUB 3DRAA 2HE0A 2R5SA 3GZ2A 3PUJA 2VSYA 1KT1A 3S2AA 3PUKA 3DSTA 3D9OA 4HI9A 2ETCA 5AAOA 3D9JA 3V30A 3IHYA 2AW6A 3AU5A 4JEHA 3DEOA 2NXPA 5JJ6A 4CGWA 3HDXA 2C0MA 1WAO1 3HXEA 2XRZA 4I1AA 5EILA 3ZYLA 1NL4A 3RU0A 2ETBA 2EINE 1BI8B 1AWCB 4TXQA 1XNFA 3Q5MA 4EECA 4U8YD 3CK8A 4RG6A 3TGOA 4UUCA 3CHMA 1ZB1A 4HORA 4JHJA 4FJZA 4ANVA 1O5MA 1MYOA 3UMVA 3JYSA 3FUJA 3TWQA 1V55E 3QWPA 3U9WA 1H0AA 3G2UA 2IO2C 4B8AA 2PM6A 4MS6A 5CHEE 3SFXA 4K0RA 3FTVA 2OOEA 3E32A 3SI5A 2L0TB 4RG9A 4ILHB 5AQAA 3UKRG 5CMWA 3SZ7A 1EPUA 4CDMA 2UY1B 1FT1A 5J90A 2OEWA 5AIJA 3ZEFA 2PNNA 3BQOA 4HOQA 4U07A 3ULEG 3EU5A 4ACKA 2B0OE 2V0PA 4EBAG 4UI9K 4WNGA 2P9SG 3I5PA 2IJGX 2CFUA 4E6HA 1YMPA 3D9KA 1EDUA 3UX4A 1H6OA 1MX4A 2QZAA 3CKBA 1E8ZA 3ASDA 1LTXA 4Y6WA 4EHMA 3Q47B 3T9KA 2ZXWE 3ZYQA 3PNLB 3T8KA 3ASFA 3FH8A 1L5JA 3DPDA 5FQ8A 3DSSA 3PREA 3TG5A 3MKQA 4I1MA 4PS3A 4KMOA 2GW1A 3MV2B 1IHBA 3MEKA 1KT0A 4UWKA 2WQHA 2F0YA 5CBOA 3R9MA 5E75A 4GCNA 3C98A 4GPKA 1Z5SC 4I1OB 5G55A 4GU5A 4LNUD 3UM0A 1NZNA 4HRLA 1IYGA 1N11A 1S63A 4A1SA 3AG3E 2X6KA 5KJKA 4Z68A 1HFAA 1NI1A 4PDXA 5LX8A 4I2ZA 3D9IA 2V4HC 3KAEA 3W9FA 3PNTB 5HS0A 2WVIA 2OEVA 3KS2A 3LY8A 1XGWA 4RVBA 3TL5A 4CYMD 1MHQA 3CGHA 5FQ6A 2XCCA 1UN8A 5ARFA 2UY1A 4G8LA 3KSLA 4JVSA 5FT9A 5KCMA 1DCEA 5HRYA 3FH5A 4BETA 4XI9A 3C3QA 3SQVA 3QOUA 5DIZA 2M63A 2VYIA 3FUMA 5D0OD 3ZHEA 2Y1LE 2XRYA 5ENPD 1LF8A 2VQ2A 4FJYA 3AS5A 5CECB 3T8MA 3DSVA 5ENNA 3EHRA 5AJLA 3LYAA 5G05C 1SA5A 2VGXB 4K5BA 4GZ3A 3SNXA 3CVWA 3CHRA 4TRQA 4XI0A 3AS4A 3HHMA 3Q78A 2FBNA 5HKPA 3G2TA 3F6QA 3HXBA 1E96B 3U66A 5FTPA 4GZ6A 4ME2A 1OWNA 4BTAA 4E85A 4OYSA 2J49A 3EHQA 4X8QA 2Q7FA 1ELRA 3UQ3A 2AVPA 2L9BA 2J08A 1HU3A 4U0ZA 4Q94A 2GRNB 3CVXA 4JHRA 3JUIA 4O1PA 5EIDA 3ONLA 3Q79A 2X6FA 2HO1A 4MLPA 3HXFA 1DCQA 3CQCB 5BV0A 2LXMA 3R9AB 5KNGA 5IY5E 4IULA 3NBNB 2WQ6A 4AVXA 4B8CB 2EIME 2WM9A 4WNFA 3MKRA 1JPLA 4L23A 4CZ2D 3OXLA 2MRIA 3L08A 3L17A 5HQ8A 3NOGD 3FFLA 1N4QA 4G25A 4FLHA 1N94A 4J8EA 3FEXA 2OV8A 3UIOC 3CHQA 2IOLA 3B7TA 1FPPA 3I4RB 5BPPA 4C0MA 3HXDA 1Z3YA 2WXHA 3QJZA 3UT8A 2FF4A 3QAQA 2XHEA 2VGXA 1N0QA 2WXMA 2WXPA 3VLEA 4BSZB 5BNWA 5KJNA 1HO8A 4HRMB 4XZ4A 4UI9J 4JL0A 1JCSA 4Q96A 5B3SE 3RKVA 2ZISA 4FA6A 5M72A 2PM7A 4WUYA 4GB9A 2ONDA 1BLXB 4FHJA 3ZVVA 3TXNA 5EIBE 3S7DA 3NF1A 1MZCA 4F3VA 2I1JA 1Y6IA 4G26A 3ULQA 1DNPA 3B7RL 3ONKA 2I1KA 3ZGQA 4LG6A 1KLXA 1HE8A 4N3AA 4I43A 4DX5D 1EF1C 2OCCE 1OCOE 3FTYA 3GZSA 2EQXA 1E7UA 3IV0A 1TYQG 2KCVA 4U63A 4FLBA 1GW6A 1UJJA 4ANXA 4URKA 3V2XA 4G1TA 3DSUA 3LDZA 5B1AE 1TN6A 4JPSA 3X2QE 1K8KG 2A4ZA 3UTMA 3ABKE 4V3IA 3EIJA 4UWGA 4YVOA 1HZ4A 2XZDG 3PRZA 1MX6A 2R03A 2MHKA 3PH0C 2P58C 3SHFA 4D10C 5CBNA 3EUVA 2KZTB 4P29A 3LY7A 3ULYA 4L7TA 1KZPA 2RG8A 3UM1A 5EDSA 2IF4A 1HH8A 3ZYKA 5LCWC 4IYPA 4B93B 3ZYMA 3FWVA 2DIWA 4KZCA 5E76A 1PC2A 4JW1A 1UN9A 2LO6A 4G8KA 4U96D 4DX7D 3BG0B 2ZIRA 2CFZA 5CEAA 3RK6A 1TJFA 5AYWD 3L16A 4N5CA 3Q7FA 4N3CA 3EU9A 3ISMC 4H7XA 1JCQA 5AQBA 2WXOA 1MX2A 4BEPA 3MZLB 3UPVA 4KYOB 1SVXA 2BTDA 3FUKA 1QZ2A 4O6FA 2YNQA 3SBTB 4DRXE 2WMOA 2F37A 5JHAA 3DXKG 1A17A 3ZN3A 1E8YA 3ASOE 2XEHA 2L6BA 3MKQB 4GYOA 5JA4D 3P2BA 4AY5A 2JLBA 5ENQD 2QY7A 3Q9NC 3RO2A 3FH7A 3G2VA 1H2VC 5G04C 1O1TA 4BT8A 3ZXSA 4B89A 3ESLA 2Y0BG 3QWWA 2XGSA 4BERA 1BU9A 3EDTB 1U3DA 4CT4A 4CT0A 1NP7A 2MOWA 3D9MA 2EILE 4A55A 4UQXA 2KZTA 3SF4A 4J8FA 5FZRA 3QC1A 1YA0A 2RFMA 5ANRA 4FULA 4GPMA 2VSNA 3V31A 1QNFA 3TXMA 3CIAA 3C5RA 2AJAA 3CHOA 2KATA 3KD7A 3LCAA 1LD8A 4A1GA 4DLOA 4FADA 4XX5A 1NA0A 2P9UG 4U0UA 1NA3A 4F53A 1MQSA 2GGFA 4WNEA 2XS1A 4AV7A 4KBQA 5KJLA 4AIFA 2CG2A 3ZHEB 4GYWA 4YVQC 3NB2A 2X38A 2VSOE 1INZA 4HS2A 2IO3C 3CLJA 1BD8A 2NYJA 1TN7A 2RD0A 2BUGA 1N4PA 2CHWA 3CV0A 1KPSB 4A3VA 4K5CA 5CMYA 2GRLA 4L9PA 3IHVA 5ENOD 4HOUA 3KSQA 2HYZA 4GTRA 3LKUA 2I6HA 2DYRE 4J6IA 4G24A 3UM3A 3Q73A 5CERB 4HFGA 4HLLA 2WPVA 2WXQA 3Q15A 4R7LA 4LERA 3V2OA 3E4BA 4B0ZA 3ABME 1MJ0A 2KCLA 4K5AB 4BFRA 2WXIA 3CSTA 4KZ0A 1OWMA 3ABLE 2PQRA 3B7SA 4HLEA 5CEDB 3FUIA 2JABA 3L13A 4GMJA 1JWGA 4BY6A 3RIBA 4CDRA 4HQDA 1A5EA 3VTXA 4RLYA 3U64A 3B7BA 5KWDA 4TUMA 2KM4A 4O1OA 1JWFA 3L9TA 2KBXA 4QFVA 5C2YA 1UW4B 1N9AA 4RSYA 4ATZD 4FC8A 3FUFA 2DYSE 3NQPA 3MYVA 5A7DB 4ANWA 5ITZF 2CHXA 3CQGB 3ML9A 3CEQA 4HOTA 3S7BA 3RJVA 1H6KA 4WNDA 2GRRB 2V4LA 3BUAA 4NRHB 3ESKA 2IY0C 2LAHA 2QYJA 3MA5A 2F8XK 3PZ2A 3ZUVB 1TNOA 2BKKB 2R17C 2C0LA 1OWPA 3TWVA 1S70B 1BPOA 4L2YA 4DX2A 2WMNA 4UWFA 1DC2A 4YNDA 3LJ3A 1N4RA 4HRNA 3ZNGA 2H6HA 3NZSA 3DWLG 1WG0A 2VTBA 3MV3B 3O48A 2X6IA 3AS8A 3CVUA 3ASGA 5AARA 3MX3A 1WDYA 2LAIA 3OXGA 3QDNA 4BESA 3D3MA 3FP3A 4BTBA 1U3CA 4A63B 4RQIA 3FUEA 5AQ9A 4M7CA 3TWUA 2DCPA 2VGEA 4N2SA 3RRMB 3UI2A 3QKYA 1TNBA 2XENA 3VLDA 1TN8A 4W9RA 3FHEA 4LCTA 4QQIA 4O60A 2V5FA 1O1SA 5ENRD 1JCRA 3IXEA 5AENA 2LSUA 5T3RA 1UOHA 2X6HA 1BI7B 2FI7A 2KCKA 2E0IA 3PZDA 4JB8P 1OCCE 1EYHA 3NAWA 1V54E 2JEKA 3L22A 3APDA 2QC9A 2B6CA 1E90A 1OY3D 3AJIA 5FZQA 2OVBA 2J4BA 5BUZA 3LXUX 2P9IG 4GTQA 2I2OA 3CKCA 2QYUA 1WM5A 3PZ4A 4IRUA 2XEVA 2V5QC 5EX3A 1H19A 4PUCA 3RO3A 2R05A 3PS6A 3CR3A 3CVPA 1E8WA 1S64A 2X6JA 3U3WA 4ABNA 4PS8A 4M3OA 1TNZA 1QYMA 2X3MA 3DXMG 3NOCD 3L6AA 5H7PA 1SA4A 4JZYA 4YDOA 1PY1A 3JQ0A 3C72A 4GTSA 1TEZA 2L6JA 3S7FA 3V79K 4DJAA 4TUUA 4I6GA 3CVLA 1U2VG 3IKOB 2LXLA 2ZGGA 4LUNU 1YYHA 5BW8C 4EZJA 4YDEA 2XPYA 3FUDA 2PQNA 2QFCA 5JMND 1HS6A 4TXRA 4J8YA 5BT1A 3UINC 1NFIE 3DPYA 3ZIMA 4ILIA 3I4GA 4CRWA 3SFZA 1Y8MA 2IQCA 5CCMA 4APOA 2NSZA 5LFAA 1QQEA 3TWWA 4HOSA 3HIZA 4NACA 2YHCA 2V8SE 4CCAA 1FVHA 1X81A 1Q2ZA 4I6JA 3MJWA 5EKQD 2WQ7A 4WWPA 3AAAC 4DI3A 2H6FA 3FY4A 4J8DA 4DX6D 3TAXA 5AJDA 3CVNA 4PS7A 2IFUA 5T4YA 3JCKC 1TNYA 2ZGDA 4KT6B 4MBGA 3R7QA 2YQ8A 5G05J 2WXNA 3L82A 4N3BA 2R59A 1SQMA 4DLQA 4F7AA 2HM8A 4IN3B 3CHSA 3ZKJA 4WWNA 5LOZA 4XKBA 2Y3AA 1D8EA 5AQ7A 1TR4A 5D66A 1OWOA 3FTZA 2I9CA 3AG2E 5EN5D 3KEAA 2P9KG 2P2CP 4XKCA 1N54A 4K03A 5FQ7A 4UQYA 1E7VA 2XZTG 4NIKA 3VLFA 3UT4A 2WXRA 4G23A 3DEPA 1PAQA 4WAFA 4H7YA 1O1RA 2WXGA 4GTMA 2Y4UA 4F6RD 4NURA 1SZ9A 2DZNA 3UKUG 1IQRA 4ACLA 3FU5A 4N5QA 4U7EB 2CHZA 3LVQE 2OVFA 2WXKA 4JA9A 4UWHA 1H6PA 3JUEA 1H2UA 2NC9A 4GMLA 3S7JA 4EZLA 4N39A 3N71A 1AP7A 4HXIA 2J8SD 1FVFA 1ZBPA 4JD2G 2DZOA 3E37A 3AU4A 3FUNA 2XS8A 1FCHA 1RZ4A 4APFA 2VGYA 3EHNA 2R02A 3LY9A 3P1UA 3CHPA 3IEGA 3HXCA 2J4DA 2IEJA 3G2SA 4FP7A 2FULA 2F8YA
chains in the Genus database with same CATH topology
3PEVB 3QAQA 1DVPA 4HVBA 2V4LA 2XHEA 2VGXA 4NRHB 4WWOA 3ESKA 3MA5A 2LAHA 3D9PA 2WXMA 4KXKB 4F1SA 2WXPA 3PE4A 3VLEA 4U04A 3DBSA 4BWRA 5T8IA 3R7RA 4UWLA 2R17C 2Y4TA 2C0LA 3U4TA 5BNWA 5KJNA 3EIQC 1OWPA 1HO8A 3ZRHA 1ZU2A 3FEYA 3TJPA 1BPOA 4L2YA 4XZ4A 5FQ4A 3UT8A 4UI9J 4JL0A 4BSXA 2WMNA 2IU1A 4UWFA 4YNDA 3LJ3A 4KVMA 5EX0A 4Q96A 4CDNA 3RKVA 4ILGA 5DBKA 4FA6A 3JQ1A 2AWIA 5CCLA 5M72A 3PEUB 1HG5A 3NZSA 2PM7A 4UI9C 2R5SA 2VTBA 4WUYA 3GZ2A 3PUJA 3MV3B 4GB9A 3O48A 2ONDA 2VSYA 2X6IA 1KT1A 2E2EA 4FHJA 3ZVVA 3S2AA 3AS8A 3QB2A 3TXNA 3PUKA 3D9OA 3S7DA 3CVUA 3NF1A 1H2TC 3ASGA 2ILRA 2VTBB 3SGHA 3CVVA 4F3VA 2PL2A 3MX3A 2I1JA 2LAIA 3OXGA 2A5UA 3B7UX 1Y6IA 3D9JA 3FTUA 3QDNA 4G26A 5FWQA 3ULQA 3IHYA 2AW6A 1VDYA 3D3MA 3FP3A 3AU5A 4ATGA 1DNPA 4BTBA 3B7RL 1U3CA 1W3BA 3ONKA 2I1KA 4JEHA 2WB2A 3IBEA 5ANLA 3GYZA 3CSFA 2NXPA 3ZGQA 2XPZA 5JJ6A 4CGWA 5HI7A 3HDXA 4JEUA 2C0MA 3FUEA 1WAO1 1KLXA 2XRZA 3D9NA 1HE8A 2DCPA 4I1AA 4L2LA 3ZYLA 4N3AA 3RU0A 4N2SA 4I43A 4I9EA 3RRMB 3ZPJA 3QKYA 2WXJA 2FO7A 1XNFA 3Q5MA 4EECA 3OAWA 3VLDA 3CK8A 4RG6A 1EF1C 3TGOA 3PVLA 3LEWA 4JHKA 3ZFWA 5ARGA 2LNIA 3FTYA 4W9RA 3CHMA 3GZSA 3FHEA 4HORA 4JHJA 1B89A 4LCTA 4FJZA 2EQXA 1E7UA 3IV0A 2V5FA 1HXIA 4ANVA 2KCVA 4U63A 4FLBA 1GW6A 1UJJA 3KEZA 4ANXA 4URKA 4G1TA 4JA7A 5AENA 2LSUA 3LDZA 5T3RA 3UMVA 4JPSA 2X6HA 3JYSA 2A4ZA 3FUJA 4V3IA 2FI7A 2AXUA 2KCKA 2E0IA 3PZDA 3EIJA 3CVQA 4JXTA 4UWGA 3QWPA 3U9WA 4YVOA 1H0AA 3G2UA 1HZ4A 3I3NA 4FU3A 4B8AA 1EYHA 4CGVA 2PM6A 2AXZA 3PRZA 3L22A 2JEKA 3LS8A 4MS6A 3APDA 5CHEE 3TG4A 2C2LA 2MHKA 4K0RA 3PH0C 3FTVA 2OOEA 2P58C 1E90A 3SHFA 4GZCA 4D10C 2YINA 5FZQA 2L0TB 3SI5A 2KZTB 4P29A 3LY7A 5LCWJ 4RG9A 4N2QA 4ILHB 4L7TA 2OVBA 2J4BA 3RRUA 5CMWA 2RG8A 5BUZA 5EDSA 3LXUX 3SZ7A 1JUQA 2IF4A 1EPUA 4CDMA 1HH8A 2I2OA 1Z6TA 2UY1B 3ZYKA 5J90A 5LCWC 4IYPA 1ELKA 3ZYMA 3CKCA 1WM5A 4IRUA 3FWVA 2UWJG 2DIWA 2XEVA 5EX3A 1H19A 4PUCA 4KZCA 5E76A 1PC2A 3RO3A 3ZEFA 5AIJA 4JW1A 1UN9A 2LO6A 4HOQA 4LRZA 4I9CA 4U07A 5A6CA 4ACKA 4FHKA 3PS6A 2V0PA 4EBAG 3O4ZA 3CR3A 4EQFA 3CVPA 1E8WA 1X5BA 4UI9K 4WNGA 3BG0B 3I5PA 3CVYA 2IJGX 2CFUA 2CFZA 3RK6A 1TJFA 3EJNA 4E6HA 3APFA 5AYWD 3L16A 2X6JA 4EBAA 3D9KA 1S0PA 4N5CA 1EDUA 2BF0X 4ABNA 3UX4A 4PS8A 3U3WA 4N3CA 3HVEB 4H7XA 3CKBA 4I2WA 1E8ZA 4M3OA 3UT7A 4GZDA 3MGBA 2WXOA 3T5XA 3ASDA 5FZSA 4EZKA 4Y6WA 3MZLB 3Q47B 2X3MA 3UPVA 3Q49B 4KYOB 1HG2A 3FULA 3ZYQA 3OXFA 3PNLB 3GZ1A 3L6AA 2BTDA 3FUKA 1QZ2A 4AM9A 4JZYA 1UJKA 1PY1A 3JQ0A 4JC8A 4O6FA 2YNQA 4CEMA 3ASFA 1N52A 3FH8A 1L5JA 3SBTB 2L6JA 1TEZA 2WMOA 3DPDA 3S7FA 5FQ8A 4DJAA 5JHAA 4TUUA 4I6GA 3CVLA 3PREA 3IKOB 3TG5A 1A17A 3CK9A 3MKQA 4I1MA 4PS3A 4KMOA 3OTNA 2GW1A 3MV2B 1IHGA 3K9IA 2XGOA 3ZW3A 3ZN3A 1E8YA 4TV3A 3MEKA 1KT0A 4LUNU 4UWKA 3MKQB 4GYOA 5KJMA 2WQHA 5BW8C 4C0EA 5G04J 2J9QA 3P2BA 4EZJA 4AY5A 2JLBA 2QY7A 4XIFA 2XPYA 5E75A 4GCNA 3FUDA 4MRUA 2QFCA 2PQNA 3C98A 3B13A 3RO2A 4GPKA 2KC7A 3PE3A 1SZAA 3FH7A 3G2VA 1H2VC 5G04C 1HS6A 4I1OB 4J8SA 4U8HA 5BT1A 5G55A 4AEZC 4BT8A 3QK0A 3GW4A 4GCOA 4GU5A 3ZXSA 1NZNA 3ESLA 3ZIMA 4B89A 1IYGA 3QWWA 4I17A 4UQZA 4A1SA 4I6EA 4ILIA 4AP2A 3EHMA 3I4GA 2XGSA 2CG3A 2ZU6B 3VTYA 4CRWA 3EDTB 2X6KA 3SFZA 1Y8MA 1U3DA 4AJWA 5JJ7A 5KJKA 4CT4A 1HFAA 4CT0A 3RRNB 2IQCA 3ML8A 4G2VA 4PDXA 2VSXE 4APOA 1NP7A 5CCMA 4U0SA 5LX8A 2MOWA 4NQ0A 4L1BA 4I2ZA 2NSZA 3D9IA 5LFAA 3D9MA 4GAAA 1QQEA 4A55A 3T5VA 3LVRE 3KAEA 3PNTB 4UQXA 2KZTA 3SF4A 2WVIA 2L0IA 4J8FA 3KS2A 5FZRA 3LY8A 3QC1A 4HOSA 1XGWA 4RVBA 3HIZA 4NACA 2YHCA 3L54A 2V8SE 4CCAA 1YA0A 3TL5A 1FVHA 1MHQA 3CGHA 5ANRA 3APCA 5FQ6A 2XCCA 1UN8A 4FULA 5ARFA 2UY1A 2VSNA 3BG1B 4I6JA 2XPIA 4JVSA 3MJWA 5EKQD 5FT9A 2WQ7A 4WWPA 4DI3A 1QNFA 5KCMA 3TXMA 3FY4A 3CIAA 3FH5A 3CHOA 4XI9A 2KATA 3KD7A 3LCAA 3QOUA 4J8DA 5DIZA 2M63A 4GYYA 3G2WA 3TAXA 5AJDA 3CVNA 3QARA 4PS7A 2IFUA 2VYIA 2FEZA 3FUMA 4A1GA 4DLOA 4XX5A 5D0OD 4FADA 1NA0A 4U0UA 3FTXA 3JCKC 5T4YA 2J07A 3FU3A 4GA2A 3ZHEA 4BX8A 4KT6B 1NA3A 4F53A 1MQSA 2GGFA 2XRYA 1TJCA 3WXXA 1LF8A 5LP0A 2VQ2A 4WNEA 3HVEA 4C9BB 3R7QA 4AV7A 3CK7A 4KBQA 4FJYA 5KJLA 3AS5A 2YQ8A 4AIFA 5G05J 2WXNA 2CG2A 3ZHEB 4GYWA 4YVQC 4Q69A 3T8MA 2HR2A 4N3BA 2R59A 1SQMA 5ENNA 3HYMB 4KVOA 3FDHA 5JHBA 2X38A 2VSOE 4DPRA 5AJLA 1WY6A 3LYAA 4DLQA 4HS2A 4F7AA 2HM8A 5G05C 4IN3B 3URZA 1INZA 4LEUA 3CLJA 2VGXB 4GZ3A 3CHSA 3SNXA 4WWNA 3FU0A 3CVWA 5LOZA 2RD0A 3CHRA 3ENEA 2BUGA 2Y3AA 4TRQA 2CHWA 4XKBA 4XI0A 3CV0A 3AS4A 3HHMA 2XGMA 4A3VA 2FBNA 3G2TA 1OWOA 1IQUA 5D0QD 2J09A 3FTZA 2I9CA 1E96B 3U66A 5FTPA 5CMYA 2GRLA 4GZ6A 4ME2A 3IHVA 4J0UA 1OWNA 4BTAA 4E85A 4OYSA 1HX8A 4HOUA 5J08A 2J49A 1OUVA 4XKCA 1Z3XA 5FJYA 1N54A 2HYZA 4K03A 5FQ7A 2Q7FA 4UQYA 1E7VA 5A23A 5G2NA 1ELRA 3UUXA 3LKUA 4OVUA 2I6HA 2PZIA 1E8XA 4ANUA 4J6IA 3VLFA 3UT4A 2WXRA 4DI4A 4G23A 4G24A 5BV1A 1P5QA 3UQ3A 2AVPA 1PAQA 4WAFA 2L9BA 4H7YA 2J08A 4HFGA 1HU3A 4U0ZA 3SBSA 2WPVA 2WXQA 3Q15A 2WXGA 4R7LA 2Y4UA 4LERA 4Q94A 4NURA 3CVXA 4JHRA 1SZ9A 4OVVA 3QWVA 4EPZA 3JUIA 3E4BA 4B0ZA 2KCLA 3ONLA 1IQRA 4ACLA 2AXVA 4AOFA 3MCXA 4BFRA 2WXIA 2WXLA 3CSTA 4KZ0A 2X6FA 1OWMA 2HO1A 4G11A 1UG3A 3FU5A 4MLPA 1ELWA 2PQRA 3FTSA 3B7SA 4HLEA 1OWLA 2GRMA 4AXHA 4GA0A 2LSVA 2CHZA 3CQCB 3FUIA 3FUHA 4PH4B 5BV0A 3LVQE 3L13A 3R9AB 2IOSA 2IONA 2OVFA 3QNKA 2WXKA 4GMJA 1JWGA 4IULA 4JA9A 4UWHA 4XE0A 4BX9A 4BY6A 2WQ6A 3RIBA 4CDRA 1H2UA 2NC9A 3FU6A 4AVXA 4GZ5A 4B8CB 3BEEA 2WM9A 2VJ8A 3PDNA 1HF8A 4GMLA 4WNFA 3S7JA 3MKRA 3VTXA 4EZLA 4Y6CA 1JPLA 5C1DA 4L23A 4B94A 3OXLA 4N39A 3U64A 3N71A 4AY6A 2MRIA 4HXIA 1FVFA 4BT9A 2YHEA 2KM4A 3L08A 1JWFA 1ZBPA 3ASHA 3FTWA 3L17A 4QFVA 5C2YA 2XCBA 3AU4A 3FUNA 5HQ8A 3D9LA 1UW4B 3FFLA 3SD5A 4RSYA 2WXFA 2DBAA 1FCHA 2XQ0A 4G25A 3NZUA 4FLHA 3FUFA 3LPZA 2VGYA 3EHNA 4FC8A 3LY9A 4APFA 3P1UA 3CHPA 3FEXA 4J8EA 3IEGA 2OV8A 3NQPA 5JJTA 3CHQA 3MYVA 2IOLA 5A7DB 2J4DA 4MKTA 3B7TA 4ANWA 4DK5A 2CHXA 3I4RB 5BPPA 3CQGB 4A3TA 4C0MA 3ML9A 3CEQA 4HOTA 1Z3YA 2WXHA 3G2SA 4FP7A 4GA1A 3S7BA 2FULA 3QJZA 3RJVA 1H6KA 3Q4AB 4WNDA 2FF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGX A;  4NRH B;  3ESK A;  3MA5 A;  4KXK B;  3PE4 A;  4U04 A;  4BWR A;  2Y4T A;  2C0L A;  3U4T A;  5BNW A;  5KJN A;  1ZU2 A;  4UI9 J;  4JL0 A;  4YND A;  5EX0 A;  3RKV A;  5DBK A;  5CCL A;  5M72 A;  4UI9 C;  2R5S A;  4WUY A;  3GZ2 A;  3MV3 B;  3O48 A;  2OND A;  2VSY A;  1KT1 A;  2E2E A;  3AS8 A;  3S7D A;  3NF1 A;  3ASG A;  4F3V A;  2PL2 A;  3OXG A;  4G26 A;  3QDN A;  3ULQ A;  3FP3 A;  4BTB A;  1W3B A;  3ZGQ A;  5JJ6 A;  4CGW A;  5HI7 A;  2C0M A;  1WAO 1;  1KLX A;  4I1A A;  4N3A A;  3RU0 A;  4N2S A;  4I9E A;  3ZPJ A;  3QKY A;  2FO7 A;  1XNF A;  3Q5M A;  3CK8 A;  4RG6 A;  3TGO A;  3ZFW A;  5ARG A;  2LNI A;  4W9R A;  4HOR A;  1B89 A;  2V5F A;  1HXI A;  2KCV A;  4G1T A;  4JA7 A;  2LSU A;  3JYS A;  2FI7 A;  2KCK A;  3CVQ A;  3QWP A;  4YVO A;  1HZ4 A;  4CGV A;  5CHE E;  3TG4 A;  2C2L A;  2MHK A;  2OOE A;  2P58 C;  5FZQ A;  4N2Q A;  3LY7 A;  5LCW J;  4RG9 A;  3SZ7 A;  2IF4 A;  1HH8 A;  2UY1 B;  5LCW C;  3CKC A;  1WM5 A;  3FWV A;  2UWJ G;  2XEV A;  5EX3 A;  3RO3 A;  1PC2 A;  4HOQ A;  4I9C A;  4U07 A;  5A6C A;  4EQF A;  3CVP A;  4UI9 K;  4WNG A;  5AYW D;  3U3W A;  4N5C A;  4ABN A;  4N3C A;  4H7X A;  3CKB A;  4I2W A;  3ASD A;  5FZS A;  4Y6W A;  3Q47 B;  3UPV A;  3Q49 B;  4KYO B;  3OXF A;  3GZ1 A;  1QZ2 A;  4AM9 A;  4O6F A;  3ASF A;  2L6J A;  3S7F A;  3CVL A;  3TG5 A;  1A17 A;  3CK9 A;  2GW1 A;  3MV2 B;  1IHG A;  3K9I A;  2XGO A;  3ZN3 A;  3MEK A;  1KT0 A;  4GYO A;  5KJM A;  2WQH A;  5BW8 C;  5G04 J;  2J9Q A;  4AY5 A;  2JLB A;  4XIF A;  4GCN A;  2QFC A;  2PQN A;  3RO2 A;  4GPK A;  2KC7 A;  3PE3 A;  5G04 C;  5BT1 A;  4BT8 A;  3GW4 A;  4GCO A;  1NZN A;  1IYG A;  3QWW A;  4I17 A;  4UQZ A;  4A1S A;  2XGS A;  3VTY A;  3EDT B;  5JJ7 A;  1Y8M A;  2FF4 A;  5KJK A;  4G2V A;  5CCM A;  4APO A;  4U0S A;  4NQ0 A;  4I2Z A;  1QQE A;  3KAE A;  4UQX A;  3SF4 A;  4J8F A;  5FZR A;  3KS2 A;  3LY8 A;  4HOS A;  2YHC A;  1YA0 A;  2XCC A;  5ARF A;  2UY1 A;  2VSN A;  2XPI A;  5EKQ D;  5FT9 A;  4XI9 A;  2KAT A;  3KD7 A;  3LCA A;  3QOU A;  4J8D A;  5DIZ A;  4GYY A;  3TAX A;  3CVN A;  2IFU A;  2VYI A;  2FEZ A;  5D0O D;  1NA0 A;  4U0U A;  4GA2 A;  3ZHE A;  1NA3 A;  1TJC A;  3WXX A;  2VQ2 A;  4WNE A;  3CK7 A;  4KBQ A;  5KJL A;  3AS5 A;  2YQ8 A;  4AIF A;  5G05 J;  3ZHE B;  4GYW A;  4YVQ C;  2HR2 A;  4N3B A;  3HYM B;  3LYA A;  5G05 C;  4IN3 B;  3URZ A;  4LEU A;  2VGX B;  4GZ3 A;  2BUG A;  4XI0 A;  3CV0 A;  3AS4 A;  2XGM A;  2FBN A;  5D0Q D;  1E96 B;  5FTP A;  4GZ6 A;  4ME2 A;  4J0U A;  4BTA A;  4HOU A;  1OUV A;  5FJY A;  2HYZ A;  2Q7F A;  4UQY A;  1ELR A;  3UUX A;  3LKU A;  2I6H A;  2PZI A;  4G23 A;  4G24 A;  1P5Q A;  3UQ3 A;  2AVP A;  4H7Y A;  4U0Z A;  2WPV A;  3Q15 A;  2Y4U A;  4JHR A;  3QWV A;  3E4B A;  2KCL A;  2HO1 A;  1ELW A;  2PQR A;  4GA0 A;  2LSV A;  3R9A B;  4JA9 A;  3RIB A;  4CDR A;  2NC9 A;  4GZ5 A;  3BEE A;  3PDN A;  4WNF A;  3S7J A;  3VTX A;  3MKR A;  4Y6C A;  5C1D A;  4B94 A;  3OXL A;  4N39 A;  3N71 A;  4AY6 A;  4BT9 A;  1ZBP A;  3ASH A;  2XCB A;  5HQ8 A;  3FFL A;  2DBA A;  1FCH A;  4G25 A;  3LPZ A;  2VGY A;  3LY9 A;  4J8E A;  3IEG A;  5JJT A;  5A7D B;  3CEQ A;  4HOT A;  4GA1 A;  3S7B A;  3RJV A;  3Q4A B;  4WND A;  3GYZ A; 
#chains in the Genus database with same CATH topology
 3PEV B;  4WWO A;  3D9P A;  3PE4 A;  5T8I A;  4UWL A;  2Y4T A;  3U4T A;  4XEI G;  4YDY A;  3ZRH A;  4GTT A;  1ZU2 A;  3FEY A;  3TJP A;  4BSX A;  3Q9U C;  2IU1 A;  4KVM A;  5EX0 A;  4ILG A;  5DBK A;  4HNA D;  5CRU A;  3JQ1 A;  2AWI A;  5CCL A;  4UI9 C;  1HG5 A;  2E2E A;  3QB2 A;  3AG4 E;  4LNB A;  5EYL A;  1H2T C;  3SFY A;  2ILR A;  2VTB B;  3SGH A;  4J7W A;  3CVV A;  2PL2 A;  4C48 B;  2A5U A;  2KXP C;  3B7U X;  3FTU A;  5FWQ A;  1VDY A;  4ATG A;  1W3B A;  2WB2 A;  3IBE A;  5ANL A;  3CSF A;  3E30 A;  2XPZ A;  3DSW A;  2P9P G;  5HI7 A;  4JEU A;  3D9N A;  4L2L A;  4I9E A;  3ZPJ A;  5BXO A;  2WXJ A;  2FO7 A;  3OAW A;  3PVL A;  4GTV A;  4HBD A;  3LEW A;  4JHK A;  3ZFW A;  5ARG A;  2LNI A;  1OCZ E;  2H6I A;  1B89 A;  3Q7A A;  2GRP B;  1HXI A;  3KEZ A;  2DVW A;  4U8V D;  4JA7 A;  4GTP A;  3JXI A;  2AXU A;  4OAU C;  3E34 A;  3PZ3 A;  3CVQ A;  4JXT A;  1G3N B;  3PZ1 A;  3I3N A;  4FU3 A;  4CGV A;  3UM2 A;  2AXZ A;  3LS8 A;  3TG4 A;  2C2L A;  2EIK E;  3RAU A;  3D9H A;  4GMR A;  2RKK A;  2LUH A;  4GZC A;  2YIN A;  4N2Q A;  5LCW J;  1N4S A;  3RRU A;  3BU8 A;  1JUQ A;  3ZU7 B;  1Z6T A;  1ELK A;  1YCS B;  2UWJ G;  4LRZ A;  4I9C A;  5A6C A;  4FHK A;  4EQF A;  3O4Z A;  1X5B A;  2BKG A;  2XEE A;  3TWX A;  3CVY A;  2DWZ A;  3EJN A;  3APF A;  4EBA A;  1S0P A;  2BF0 X;  3HVE B;  4I2W A;  3UT7 A;  4GZD A;  3MGB A;  3T5X A;  4EZK A;  2GRO B;  5FZS A;  3Q49 B;  3J5P A;  1HG2 A;  3FUL A;  3OXF A;  3GZ1 A;  4AM9 A;  1UJK A;  4JC8 A;  4CEM A;  1N52 A;  3CK9 A;  3OTN A;  5EYP F;  1IHG A;  3K9I A;  2XGO A;  3ZW3 A;  4TV3 A;  5KJM A;  4C0E A;  5G04 J;  2J9Q A;  4HB5 A;  4XIF A;  4MRU A;  3B13 A;  2KC7 A;  3PE3 A;  1SZA A;  4J8S A;  4U8H A;  4AEZ C;  3QK0 A;  3GW4 A;  4GCO A;  1QBQ A;  4U95 D;  4I17 A;  4UQZ A;  4I6E A;  4AP2 A;  3EHM A;  3TWS A;  2CG3 A;  2ZU6 B;  3VTY A;  5JJ7 A;  5D2M C;  4AJW A;  3RRN B;  3ML8 A;  4G2V A;  2VSX E;  4LSZ E;  3ASN E;  4U0S A;  3J5Q B;  4NQ0 A;  1KZO A;  4L1B A;  4GAA A;  5KBA A;  3T5V A;  3LVR E;  2L0I A;  3RSE G;  1D9S A;  3L54 A;  3APC A;  2BED A;  5ENT D;  3BG1 B;  3UXG A;  2XPI A;  1FT2 A;  4ZHB A;  3UIP C;  1SW6 A;  4GYY A;  3G2W A;  3QAR A;  4GTO A;  2FEZ A;  3FTX A;  4YDW A;  2J07 A;  3FU3 A;  4GA2 A;  4BX8 A;  1RW2 A;  5FIO A;  4LNG A;  1TJC A;  3WXX A;  5KNH D;  5LP0 A;  3HVE A;  4C9B B;  3CK7 A;  4F1P A;  3TWT A;  4Q69 A;  2EIJ E;  2HR2 A;  3HYM B;  4KVO A;  3FDH A;  5JHB A;  4DPR A;  1WY6 A;  3URZ A;  1IXV A;  4LEU A;  2P9N G;  3FU0 A;  3E33 A;  2MYO A;  3ENE A;  3WG7 E;  4OAV B;  2XGM A;  1IQU A;  5D0Q D;  2J09 A;  3JXJ A;  3C3R A;  2RFA A;  4J0U A;  2H6G A;  1HX8 A;  5J08 A;  1OUV A;  3HG0 D;  1TNU A;  1Z3X A;  5FJY A;  5A23 A;  5G2N A;  3UUX A;  4OVU A;  2PZI A;  1E8X A;  4ANU A;  4DI4 A;  5BV1 A;  1P5Q A;  2ETA A;  2A5E A;  1OCR E;  2FO1 E;  3SBS A;  3ZXP A;  1N0R A;  2Y69 E;  4OVV A;  4EPZ A;  3QWV A;  3DSX A;  4TXP A;  2GRQ B;  2AXV A;  4AOF A;  3MCX A;  3TWR A;  2WXL A;  4G11 A;  1UG3 A;  1ELW A;  3FTS A;  1OXJ A;  1OWL A;  1OT8 A;  2GRM A;  4AXH A;  4GA0 A;  1K1B A;  2LSV A;  3FUH A;  4PH4 B;  2IOS A;  3B95 A;  2ION A;  2R2L A;  3QNK A;  4BX9 A;  4XE0 A;  3FU6 A;  4DUI A;  4GZ5 A;  3LJN A;  5CRV A;  3BEE A;  3PDN A;  2VJ8 A;  1HF8 A;  4Y6C A;  3SO8 A;  5C1D A;  4B94 A;  1N95 A;  3C3O A;  5FIN A;  4AY6 A;  4BT9 A;  4ZFH A;  2P9L G;  2YHE A;  3FTW A;  3ASH A;  3SY2 A;  2XCB A;  3D9L A;  3SD5 A;  2WXF A;  2DBA A;  2XQ0 A;  3NZU A;  3LPZ A;  1K3Z D;  3AG1 E;  5ENS D;  5B1B E;  1K1A A;  5JJT A;  3HRA A;  4HI8 A;  4MKT A;  3W9G A;  4DK5 A;  1IKN D;  4A3T A;  4GA1 A;  3Q4A B;  4DX1 A;  1D8D A;  3GYZ A;  3Q75 A;  1DVP A;  4HVB A;  4KXK B;  4F1S A;  4U04 A;  3DBS A;  4BWR A;  3R7R A;  3EIQ C;  5FQ4 A;  5AN8 A;  4CDN A;  1LD7 A;  5BXU A;  3PEU B;  3DRA A;  2HE0 A;  2R5S A;  3GZ2 A;  3PUJ A;  2VSY A;  1KT1 A;  3S2A A;  3PUK A;  3DST A;  3D9O A;  4HI9 A;  2ETC A;  5AAO A;  3D9J A;  3V30 A;  3IHY A;  2AW6 A;  3AU5 A;  4JEH A;  3DEO A;  2NXP A;  5JJ6 A;  4CGW A;  3HDX A;  2C0M A;  1WAO 1;  3HXE A;  2XRZ A;  4I1A A;  5EIL A;  3ZYL A;  1NL4 A;  3RU0 A;  2ETB A;  2EIN E;  1BI8 B;  1AWC B;  4TXQ A;  1XNF A;  3Q5M A;  4EEC A;  4U8Y D;  3CK8 A;  4RG6 A;  3TGO A;  4UUC A;  3CHM A;  1ZB1 A;  4HOR A;  4JHJ A;  4FJZ A;  4ANV A;  1O5M A;  1MYO A;  3UMV A;  3JYS A;  3FUJ A;  3TWQ A;  1V55 E;  3QWP A;  3U9W A;  1H0A A;  3G2U A;  2IO2 C;  4B8A A;  2PM6 A;  4MS6 A;  5CHE E;  3SFX A;  4K0R A;  3FTV A;  2OOE A;  3E32 A;  3SI5 A;  2L0T B;  4RG9 A;  4ILH B;  5AQA A;  3UKR G;  5CMW A;  3SZ7 A;  1EPU A;  4CDM A;  2UY1 B;  1FT1 A;  5J90 A;  2OEW A;  5AIJ A;  3ZEF A;  2PNN A;  3BQO A;  4HOQ A;  4U07 A;  3ULE G;  3EU5 A;  4ACK A;  2B0O E;  2V0P A;  4EBA G;  4UI9 K;  4WNG A;  2P9S G;  3I5P A;  2IJG X;  2CFU A;  4E6H A;  1YMP A;  3D9K A;  1EDU A;  3UX4 A;  1H6O A;  1MX4 A;  2QZA A;  3CKB A;  1E8Z A;  3ASD A;  1LTX A;  4Y6W A;  4EHM A;  3Q47 B;  3T9K A;  2ZXW E;  3ZYQ A;  3PNL B;  3T8K A;  3ASF A;  3FH8 A;  1L5J A;  3DPD A;  5FQ8 A;  3DSS A;  3PRE A;  3TG5 A;  3MKQ A;  4I1M A;  4PS3 A;  4KMO A;  2GW1 A;  3MV2 B;  1IHB A;  3MEK A;  1KT0 A;  4UWK A;  2WQH A;  2F0Y A;  5CBO A;  3R9M A;  5E75 A;  4GCN A;  3C98 A;  4GPK A;  1Z5S C;  4I1O B;  5G55 A;  4GU5 A;  4LNU D;  3UM0 A;  1NZN A;  4HRL A;  1IYG A;  1N11 A;  1S63 A;  4A1S A;  3AG3 E;  2X6K A;  5KJK A;  4Z68 A;  1HFA A;  1NI1 A;  4PDX A;  5LX8 A;  4I2Z A;  3D9I A;  2V4H C;  3KAE A;  3W9F A;  3PNT B;  5HS0 A;  2WVI A;  2OEV A;  3KS2 A;  3LY8 A;  1XGW A;  4RVB A;  3TL5 A;  4CYM D;  1MHQ A;  3CGH A;  5FQ6 A;  2XCC A;  1UN8 A;  5ARF A;  2UY1 A;  4G8L A;  3KSL A;  4JVS A;  5FT9 A;  5KCM A;  1DCE A;  5HRY A;  3FH5 A;  4BET A;  4XI9 A;  3C3Q A;  3SQV A;  3QOU A;  5DIZ A;  2M63 A;  2VYI A;  3FUM A;  5D0O D;  3ZHE A;  2Y1L E;  2XRY A;  5ENP D;  1LF8 A;  2VQ2 A;  4FJY A;  3AS5 A;  5CEC B;  3T8M A;  3DSV A;  5ENN A;  3EHR A;  5AJL A;  3LYA A;  5G05 C;  1SA5 A;  2VGX B;  4K5B A;  4GZ3 A;  3SNX A;  3CVW A;  3CHR A;  4TRQ A;  4XI0 A;  3AS4 A;  3HHM A;  3Q78 A;  2FBN A;  5HKP A;  3G2T A;  3F6Q A;  3HXB A;  1E96 B;  3U66 A;  5FTP A;  4GZ6 A;  4ME2 A;  1OWN A;  4BTA A;  4E85 A;  4OYS A;  2J49 A;  3EHQ A;  4X8Q A;  2Q7F A;  1ELR A;  3UQ3 A;  2AVP A;  2L9B A;  2J08 A;  1HU3 A;  4U0Z A;  4Q94 A;  2GRN B;  3CVX A;  4JHR A;  3JUI A;  4O1P A;  5EID A;  3ONL A;  3Q79 A;  2X6F A;  2HO1 A;  4MLP A;  3HXF A;  1DCQ A;  3CQC B;  5BV0 A;  2LXM A;  3R9A B;  5KNG A;  5IY5 E;  4IUL A;  3NBN B;  2WQ6 A;  4AVX A;  4B8C B;  2EIM E;  2WM9 A;  4WNF A;  3MKR A;  1JPL A;  4L23 A;  4CZ2 D;  3OXL A;  2MRI A;  3L08 A;  3L17 A;  5HQ8 A;  3NOG D;  3FFL A;  1N4Q A;  4G25 A;  4FLH A;  1N94 A;  4J8E A;  3FEX A;  2OV8 A;  3UIO C;  3CHQ A;  2IOL A;  3B7T A;  1FPP A;  3I4R B;  5BPP A;  4C0M A;  3HXD A;  1Z3Y A;  2WXH A;  3QJZ A;  3UT8 A;  2FF4 A;  3QAQ A;  2XHE A;  2VGX A;  1N0Q A;  2WXM A;  2WXP A;  3VLE A;  4BSZ B;  5BNW A;  5KJN A;  1HO8 A;  4HRM B;  4XZ4 A;  4UI9 J;  4JL0 A;  1JCS A;  4Q96 A;  5B3S E;  3RKV A;  2ZIS A;  4FA6 A;  5M72 A;  2PM7 A;  4WUY A;  4GB9 A;  2OND A;  1BLX B;  4FHJ A;  3ZVV A;  3TXN A;  5EIB E;  3S7D A;  3NF1 A;  1MZC A;  4F3V A;  2I1J A;  1Y6I A;  4G26 A;  3ULQ A;  1DNP A;  3B7R L;  3ONK A;  2I1K A;  3ZGQ A;  4LG6 A;  1KLX A;  1HE8 A;  4N3A A;  4I43 A;  4DX5 D;  1EF1 C;  2OCC E;  1OCO E;  3FTY A;  3GZS A;  2EQX A;  1E7U A;  3IV0 A;  1TYQ G;  2KCV A;  4U63 A;  4FLB A;  1GW6 A;  1UJJ A;  4ANX A;  4URK A;  3V2X A;  4G1T A;  3DSU A;  3LDZ A;  5B1A E;  1TN6 A;  4JPS A;  3X2Q E;  1K8K G;  2A4Z A;  3UTM A;  3ABK E;  4V3I A;  3EIJ A;  4UWG A;  4YVO A;  1HZ4 A;  2XZD G;  3PRZ A;  1MX6 A;  2R03 A;  2MHK A;  3PH0 C;  2P58 C;  3SHF A;  4D10 C;  5CBN A;  3EUV A;  2KZT B;  4P29 A;  3LY7 A;  3ULY A;  4L7T A;  1KZP A;  2RG8 A;  3UM1 A;  5EDS A;  2IF4 A;  1HH8 A;  3ZYK A;  5LCW C;  4IYP A;  4B93 B;  3ZYM A;  3FWV A;  2DIW A;  4KZC A;  5E76 A;  1PC2 A;  4JW1 A;  1UN9 A;  2LO6 A;  4G8K A;  4U96 D;  4DX7 D;  3BG0 B;  2ZIR A;  2CFZ A;  5CEA A;  3RK6 A;  1TJF A;  5AYW D;  3L16 A;  4N5C A;  3Q7F A;  4N3C A;  3EU9 A;  3ISM C;  4H7X A;  1JCQ A;  5AQB A;  2WXO A;  1MX2 A;  4BEP A;  3MZL B;  3UPV A;  4KYO B;  1SVX A;  2BTD A;  3FUK A;  1QZ2 A;  4O6F A;  2YNQ A;  3SBT B;  4DRX E;  2WMO A;  2F37 A;  5JHA A;  3DXK G;  1A17 A;  3ZN3 A;  1E8Y A;  3ASO E;  2XEH A;  2L6B A;  3MKQ B;  4GYO A;  5JA4 D;  3P2B A;  4AY5 A;  2JLB A;  5ENQ D;  2QY7 A;  3Q9N C;  3RO2 A;  3FH7 A;  3G2V A;  1H2V C;  5G04 C;  1O1T A;  4BT8 A;  3ZXS A;  4B89 A;  3ESL A;  2Y0B G;  3QWW A;  2XGS A;  4BER A;  1BU9 A;  3EDT B;  1U3D A;  4CT4 A;  4CT0 A;  1NP7 A;  2MOW A;  3D9M A;  2EIL E;  4A55 A;  4UQX A;  2KZT A;  3SF4 A;  4J8F A;  5FZR A;  3QC1 A;  1YA0 A;  2RFM A;  5ANR A;  4FUL A;  4GPM A;  2VSN A;  3V31 A;  1QNF A;  3TXM A;  3CIA A;  3C5R A;  2AJA A;  3CHO A;  2KAT A;  3KD7 A;  3LCA A;  1LD8 A;  4A1G A;  4DLO A;  4FAD A;  4XX5 A;  1NA0 A;  2P9U G;  4U0U A;  1NA3 A;  4F53 A;  1MQS A;  2GGF A;  4WNE A;  2XS1 A;  4AV7 A;  4KBQ A;  5KJL A;  4AIF A;  2CG2 A;  3ZHE B;  4GYW A;  4YVQ C;  3NB2 A;  2X38 A;  2VSO E;  1INZ A;  4HS2 A;  2IO3 C;  3CLJ A;  1BD8 A;  2NYJ A;  1TN7 A;  2RD0 A;  2BUG A;  1N4P A;  2CHW A;  3CV0 A;  1KPS B;  4A3V A;  4K5C A;  5CMY A;  2GRL A;  4L9P A;  3IHV A;  5ENO D;  4HOU A;  3KSQ A;  2HYZ A;  4GTR A;  3LKU A;  2I6H A;  2DYR E;  4J6I A;  4G24 A;  3UM3 A;  3Q73 A;  5CER B;  4HFG A;  4HLL A;  2WPV A;  2WXQ A;  3Q15 A;  4R7L A;  4LER A;  3V2O A;  3E4B A;  4B0Z A;  3ABM E;  1MJ0 A;  2KCL A;  4K5A B;  4BFR A;  2WXI A;  3CST A;  4KZ0 A;  1OWM A;  3ABL E;  2PQR A;  3B7S A;  4HLE A;  5CED B;  3FUI A;  2JAB A;  3L13 A;  4GMJ A;  1JWG A;  4BY6 A;  3RIB A;  4CDR A;  4HQD A;  1A5E A;  3VTX A;  4RLY A;  3U64 A;  3B7B A;  5KWD A;  4TUM A;  2KM4 A;  4O1O A;  1JWF A;  3L9T A;  2KBX A;  4QFV A;  5C2Y A;  1UW4 B;  1N9A A;  4RSY A;  4ATZ D;  4FC8 A;  3FUF A;  2DYS E;  3NQP A;  3MYV A;  5A7D B;  4ANW A;  5ITZ F;  2CHX A;  3CQG B;  3ML9 A;  3CEQ A;  4HOT A;  3S7B A;  3RJV A;  1H6K A;  4WND A;  2GRR B;  2V4L A;  3BUA A;  4NRH B;  3ESK A;  2IY0 C;  2LAH A;  2QYJ A;  3MA5 A;  2F8X K;  3PZ2 A;  3ZUV B;  1TNO A;  2BKK B;  2R17 C;  2C0L A;  1OWP A;  3TWV A;  1S70 B;  1BPO A;  4L2Y A;  4DX2 A;  2WMN A;  4UWF A;  1DC2 A;  4YND A;  3LJ3 A;  1N4R A;  4HRN A;  3ZNG A;  2H6H A;  3NZS A;  3DWL G;  1WG0 A;  2VTB A;  3MV3 B;  3O48 A;  2X6I A;  3AS8 A;  3CVU A;  3ASG A;  5AAR A;  3MX3 A;  1WDY A;  2LAI A;  3OXG A;  3QDN A;  4BES A;  3D3M A;  3FP3 A;  4BTB A;  1U3C A;  4A63 B;  4RQI A;  3FUE A;  5AQ9 A;  4M7C A;  3TWU A;  2DCP A;  2VGE A;  4N2S A;  3RRM B;  3UI2 A;  3QKY A;  1TNB A;  2XEN A;  3VLD A;  1TN8 A;  4W9R A;  3FHE A;  4LCT A;  4QQI A;  4O60 A;  2V5F A;  1O1S A;  5ENR D;  1JCR A;  3IXE A;  5AEN A;  2LSU A;  5T3R A;  1UOH A;  2X6H A;  1BI7 B;  2FI7 A;  2KCK A;  2E0I A;  3PZD A;  4JB8 P;  1OCC E;  1EYH A;  3NAW A;  1V54 E;  2JEK A;  3L22 A;  3APD A;  2QC9 A;  2B6C A;  1E90 A;  1OY3 D;  3AJI A;  5FZQ A;  2OVB A;  2J4B A;  5BUZ A;  3LXU X;  2P9I G;  4GTQ A;  2I2O A;  3CKC A;  2QYU A;  1WM5 A;  3PZ4 A;  4IRU A;  2XEV A;  2V5Q C;  5EX3 A;  1H19 A;  4PUC A;  3RO3 A;  2R05 A;  3PS6 A;  3CR3 A;  3CVP A;  1E8W A;  1S64 A;  2X6J A;  3U3W A;  4ABN A;  4PS8 A;  4M3O A;  1TNZ A;  1QYM A;  2X3M A;  3DXM G;  3NOC D;  3L6A A;  5H7P A;  1SA4 A;  4JZY A;  4YDO A;  1PY1 A;  3JQ0 A;  3C72 A;  4GTS A;  1TEZ A;  2L6J A;  3S7F A;  3V79 K;  4DJA A;  4TUU A;  4I6G A;  3CVL A;  1U2V G;  3IKO B;  2LXL A;  2ZGG A;  4LUN U;  1YYH A;  5BW8 C;  4EZJ A;  4YDE A;  2XPY A;  3FUD A;  2PQN A;  2QFC A;  5JMN D;  1HS6 A;  4TXR A;  4J8Y A;  5BT1 A;  3UIN C;  1NFI E;  3DPY A;  3ZIM A;  4ILI A;  3I4G A;  4CRW A;  3SFZ A;  1Y8M A;  2IQC A;  5CCM A;  4APO A;  2NSZ A;  5LFA A;  1QQE A;  3TWW A;  4HOS A;  3HIZ A;  4NAC A;  2YHC A;  2V8S E;  4CCA A;  1FVH A;  1X81 A;  1Q2Z A;  4I6J A;  3MJW A;  5EKQ D;  2WQ7 A;  4WWP A;  3AAA C;  4DI3 A;  2H6F A;  3FY4 A;  4J8D A;  4DX6 D;  3TAX A;  5AJD A;  3CVN A;  4PS7 A;  2IFU A;  5T4Y A;  3JCK C;  1TNY A;  2ZGD A;  4KT6 B;  4MBG A;  3R7Q A;  2YQ8 A;  5G05 J;  2WXN A;  3L82 A;  4N3B A;  2R59 A;  1SQM A;  4DLQ A;  4F7A A;  2HM8 A;  4IN3 B;  3CHS A;  3ZKJ A;  4WWN A;  5LOZ A;  4XKB A;  2Y3A A;  1D8E A;  5AQ7 A;  1TR4 A;  5D66 A;  1OWO A;  3FTZ A;  2I9C A;  3AG2 E;  5EN5 D;  3KEA A;  2P9K G;  2P2C P;  4XKC A;  1N54 A;  4K03 A;  5FQ7 A;  4UQY A;  1E7V A;  2XZT G;  4NIK A;  3VLF A;  3UT4 A;  2WXR A;  4G23 A;  3DEP A;  1PAQ A;  4WAF A;  4H7Y A;  1O1R A;  2WXG A;  4GTM A;  2Y4U A;  4F6R D;  4NUR A;  1SZ9 A;  2DZN A;  3UKU G;  1IQR A;  4ACL A;  3FU5 A;  4N5Q A;  4U7E B;  2CHZ A;  3LVQ E;  2OVF A;  2WXK A;  4JA9 A;  4UWH A;  1H6P A;  3JUE A;  1H2U A;  2NC9 A;  4GML A;  3S7J A;  4EZL A;  4N39 A;  3N71 A;  1AP7 A;  4HXI A;  2J8S D;  1FVF A;  1ZBP A;  4JD2 G;  2DZO A;  3E37 A;  3AU4 A;  3FUN A;  2XS8 A;  1FCH A;  1RZ4 A;  4APF A;  2VGY A;  3EHN A;  2R02 A;  3LY9 A;  3P1U A;  3CHP A;  3IEG A;  3HXC A;  2J4D A;  2IEJ A;  3G2S A;  4FP7 A;  2FUL A;  2F8Y A; 
#chains in the Genus database with same CATH homology
 3PEV B;  3QAQ A;  1DVP A;  4HVB A;  2V4L A;  2XHE A;  2VGX A;  4NRH B;  4WWO A;  3ESK A;  3MA5 A;  2LAH A;  3D9P A;  2WXM A;  4KXK B;  4F1S A;  2WXP A;  3PE4 A;  3VLE A;  4U04 A;  3DBS A;  4BWR A;  5T8I A;  3R7R A;  4UWL A;  2R17 C;  2Y4T A;  2C0L A;  3U4T A;  5BNW A;  5KJN A;  3EIQ C;  1OWP A;  1HO8 A;  3ZRH A;  1ZU2 A;  3FEY A;  3TJP A;  1BPO A;  4L2Y A;  4XZ4 A;  5FQ4 A;  3UT8 A;  4UI9 J;  4JL0 A;  4BSX A;  2WMN A;  2IU1 A;  4UWF A;  4YND A;  3LJ3 A;  4KVM A;  5EX0 A;  4Q96 A;  4CDN A;  3RKV A;  4ILG A;  5DBK A;  4FA6 A;  3JQ1 A;  2AWI A;  5CCL A;  5M72 A;  3PEU B;  1HG5 A;  3NZS A;  2PM7 A;  4UI9 C;  2R5S A;  2VTB A;  4WUY A;  3GZ2 A;  3PUJ A;  3MV3 B;  4GB9 A;  3O48 A;  2OND A;  2VSY A;  2X6I A;  1KT1 A;  2E2E A;  4FHJ A;  3ZVV A;  3S2A A;  3AS8 A;  3QB2 A;  3TXN A;  3PUK A;  3D9O A;  3S7D A;  3CVU A;  3NF1 A;  1H2T C;  3ASG A;  2ILR A;  2VTB B;  3SGH A;  3CVV A;  4F3V A;  2PL2 A;  3MX3 A;  2I1J A;  2LAI A;  3OXG A;  2A5U A;  3B7U X;  1Y6I A;  3D9J A;  3FTU A;  3QDN A;  4G26 A;  5FWQ A;  3ULQ A;  3IHY A;  2AW6 A;  1VDY A;  3D3M A;  3FP3 A;  3AU5 A;  4ATG A;  1DNP A;  4BTB A;  3B7R L;  1U3C A;  1W3B A;  3ONK A;  2I1K A;  4JEH A;  2WB2 A;  3IBE A;  5ANL A;  3GYZ A;  3CSF A;  2NXP A;  3ZGQ A;  2XPZ A;  5JJ6 A;  4CGW A;  5HI7 A;  3HDX A;  4JEU A;  2C0M A;  3FUE A;  1WAO 1;  1KLX A;  2XRZ A;  3D9N A;  1HE8 A;  2DCP A;  4I1A A;  4L2L A;  3ZYL A;  4N3A A;  3RU0 A;  4N2S A;  4I43 A;  4I9E A;  3RRM B;  3ZPJ A;  3QKY A;  2WXJ A;  2FO7 A;  1XNF A;  3Q5M A;  4EEC A;  3OAW A;  3VLD A;  3CK8 A;  4RG6 A;  1EF1 C;  3TGO A;  3PVL A;  3LEW A;  4JHK A;  3ZFW A;  5ARG A;  2LNI A;  3FTY A;  4W9R A;  3CHM A;  3GZS A;  3FHE A;  4HOR A;  4JHJ A;  1B89 A;  4LCT A;  4FJZ A;  2EQX A;  1E7U A;  3IV0 A;  2V5F A;  1HXI A;  4ANV A;  2KCV A;  4U63 A;  4FLB A;  1GW6 A;  1UJJ A;  3KEZ A;  4ANX A;  4URK A;  4G1T A;  4JA7 A;  5AEN A;  2LSU A;  3LDZ A;  5T3R A;  3UMV A;  4JPS A;  2X6H A;  3JYS A;  2A4Z A;  3FUJ A;  4V3I A;  2FI7 A;  2AXU A;  2KCK A;  2E0I A;  3PZD A;  3EIJ A;  3CVQ A;  4JXT A;  4UWG A;  3QWP A;  3U9W A;  4YVO A;  1H0A A;  3G2U A;  1HZ4 A;  3I3N A;  4FU3 A;  4B8A A;  1EYH A;  4CGV A;  2PM6 A;  2AXZ A;  3PRZ A;  3L22 A;  2JEK A;  3LS8 A;  4MS6 A;  3APD A;  5CHE E;  3TG4 A;  2C2L A;  2MHK A;  4K0R A;  3PH0 C;  3FTV A;  2OOE A;  2P58 C;  1E90 A;  3SHF A;  4GZC A;  4D10 C;  2YIN A;  5FZQ A;  2L0T B;  3SI5 A;  2KZT B;  4P29 A;  3LY7 A;  5LCW J;  4RG9 A;  4N2Q A;  4ILH B;  4L7T A;  2OVB A;  2J4B A;  3RRU A;  5CMW A;  2RG8 A;  5BUZ A;  5EDS A;  3LXU X;  3SZ7 A;  1JUQ A;  2IF4 A;  1EPU A;  4CDM A;  1HH8 A;  2I2O A;  1Z6T A;  2UY1 B;  3ZYK A;  5J90 A;  5LCW C;  4IYP A;  1ELK A;  3ZYM A;  3CKC A;  1WM5 A;  4IRU A;  3FWV A;  2UWJ G;  2DIW A;  2XEV A;  5EX3 A;  1H19 A;  4PUC A;  4KZC A;  5E76 A;  1PC2 A;  3RO3 A;  3ZEF A;  5AIJ A;  4JW1 A;  1UN9 A;  2LO6 A;  4HOQ A;  4LRZ A;  4I9C A;  4U07 A;  5A6C A;  4ACK A;  4FHK A;  3PS6 A;  2V0P A;  4EBA G;  3O4Z A;  3CR3 A;  4EQF A;  3CVP A;  1E8W A;  1X5B A;  4UI9 K;  4WNG A;  3BG0 B;  3I5P A;  3CVY A;  2IJG X;  2CFU A;  2CFZ A;  3RK6 A;  1TJF A;  3EJN A;  4E6H A;  3APF A;  5AYW D;  3L16 A;  2X6J A;  4EBA A;  3D9K A;  1S0P A;  4N5C A;  1EDU A;  2BF0 X;  4ABN A;  3UX4 A;  4PS8 A;  3U3W A;  4N3C A;  3HVE B;  4H7X A;  3CKB A;  4I2W A;  1E8Z A;  4M3O A;  3UT7 A;  4GZD A;  3MGB A;  2WXO A;  3T5X A;  3ASD A;  5FZS A;  4EZK A;  4Y6W A;  3MZL B;  3Q47 B;  2X3M A;  3UPV A;  3Q49 B;  4KYO B;  1HG2 A;  3FUL A;  3ZYQ A;  3OXF A;  3PNL B;  3GZ1 A;  3L6A A;  2BTD A;  3FUK A;  1QZ2 A;  4AM9 A;  4JZY A;  1UJK A;  1PY1 A;  3JQ0 A;  4JC8 A;  4O6F A;  2YNQ A;  4CEM A;  3ASF A;  1N52 A;  3FH8 A;  1L5J A;  3SBT B;  2L6J A;  1TEZ A;  2WMO A;  3DPD A;  3S7F A;  5FQ8 A;  4DJA A;  5JHA A;  4TUU A;  4I6G A;  3CVL A;  3PRE A;  3IKO B;  3TG5 A;  1A17 A;  3CK9 A;  3MKQ A;  4I1M A;  4PS3 A;  4KMO A;  3OTN A;  2GW1 A;  3MV2 B;  1IHG A;  3K9I A;  2XGO A;  3ZW3 A;  3ZN3 A;  1E8Y A;  4TV3 A;  3MEK A;  1KT0 A;  4LUN U;  4UWK A;  3MKQ B;  4GYO A;  5KJM A;  2WQH A;  5BW8 C;  4C0E A;  5G04 J;  2J9Q A;  3P2B A;  4EZJ A;  4AY5 A;  2JLB A;  2QY7 A;  4XIF A;  2XPY A;  5E75 A;  4GCN A;  3FUD A;  4MRU A;  2QFC A;  2PQN A;  3C98 A;  3B13 A;  3RO2 A;  4GPK A;  2KC7 A;  3PE3 A;  1SZA A;  3FH7 A;  3G2V A;  1H2V C;  5G04 C;  1HS6 A;  4I1O B;  4J8S A;  4U8H A;  5BT1 A;  5G55 A;  4AEZ C;  4BT8 A;  3QK0 A;  3GW4 A;  4GCO A;  4GU5 A;  3ZXS A;  1NZN A;  3ESL A;  3ZIM A;  4B89 A;  1IYG A;  3QWW A;  4I17 A;  4UQZ A;  4A1S A;  4I6E A;  4ILI A;  4AP2 A;  3EHM A;  3I4G A;  2XGS A;  2CG3 A;  2ZU6 B;  3VTY A;  4CRW A;  3EDT B;  2X6K A;  3SFZ A;  1Y8M A;  1U3D A;  4AJW A;  5JJ7 A;  5KJK A;  4CT4 A;  1HFA A;  4CT0 A;  3RRN B;  2IQC A;  3ML8 A;  4G2V A;  4PDX A;  2VSX E;  4APO A;  1NP7 A;  5CCM A;  4U0S A;  5LX8 A;  2MOW A;  4NQ0 A;  4L1B A;  4I2Z A;  2NSZ A;  3D9I A;  5LFA A;  3D9M A;  4GAA A;  1QQE A;  4A55 A;  3T5V A;  3LVR E;  3KAE A;  3PNT B;  4UQX A;  2KZT A;  3SF4 A;  2WVI A;  2L0I A;  4J8F A;  3KS2 A;  5FZR A;  3LY8 A;  3QC1 A;  4HOS A;  1XGW A;  4RVB A;  3HIZ A;  4NAC A;  2YHC A;  3L54 A;  2V8S E;  4CCA A;  1YA0 A;  3TL5 A;  1FVH A;  1MHQ A;  3CGH A;  5ANR A;  3APC A;  5FQ6 A;  2XCC A;  1UN8 A;  4FUL A;  5ARF A;  2UY1 A;  2VSN A;  3BG1 B;  4I6J A;  2XPI A;  4JVS A;  3MJW A;  5EKQ D;  5FT9 A;  2WQ7 A;  4WWP A;  4DI3 A;  1QNF A;  5KCM A;  3TXM A;  3FY4 A;  3CIA A;  3FH5 A;  3CHO A;  4XI9 A;  2KAT A;  3KD7 A;  3LCA A;  3QOU A;  4J8D A;  5DIZ A;  2M63 A;  4GYY A;  3G2W A;  3TAX A;  5AJD A;  3CVN A;  3QAR A;  4PS7 A;  2IFU A;  2VYI A;  2FEZ A;  3FUM A;  4A1G A;  4DLO A;  4XX5 A;  5D0O D;  4FAD A;  1NA0 A;  4U0U A;  3FTX A;  3JCK C;  5T4Y A;  2J07 A;  3FU3 A;  4GA2 A;  3ZHE A;  4BX8 A;  4KT6 B;  1NA3 A;  4F53 A;  1MQS A;  2GGF A;  2XRY A;  1TJC A;  3WXX A;  1LF8 A;  5LP0 A;  2VQ2 A;  4WNE A;  3HVE A;  4C9B B;  3R7Q A;  4AV7 A;  3CK7 A;  4KBQ A;  4FJY A;  5KJL A;  3AS5 A;  2YQ8 A;  4AIF A;  5G05 J;  2WXN A;  2CG2 A;  3ZHE B;  4GYW A;  4YVQ C;  4Q69 A;  3T8M A;  2HR2 A;  4N3B A;  2R59 A;  1SQM A;  5ENN A;  3HYM B;  4KVO A;  3FDH A;  5JHB A;  2X38 A;  2VSO E;  4DPR A;  5AJL A;  1WY6 A;  3LYA A;  4DLQ A;  4HS2 A;  4F7A A;  2HM8 A;  5G05 C;  4IN3 B;  3URZ A;  1INZ A;  4LEU A;  3CLJ A;  2VGX B;  4GZ3 A;  3CHS A;  3SNX A;  4WWN A;  3FU0 A;  3CVW A;  5LOZ A;  2RD0 A;  3CHR A;  3ENE A;  2BUG A;  2Y3A A;  4TRQ A;  2CHW A;  4XKB A;  4XI0 A;  3CV0 A;  3AS4 A;  3HHM A;  2XGM A;  4A3V A;  2FBN A;  3G2T A;  1OWO A;  1IQU A;  5D0Q D;  2J09 A;  3FTZ A;  2I9C A;  1E96 B;  3U66 A;  5FTP A;  5CMY A;  2GRL A;  4GZ6 A;  4ME2 A;  3IHV A;  4J0U A;  1OWN A;  4BTA A;  4E85 A;  4OYS A;  1HX8 A;  4HOU A;  5J08 A;  2J49 A;  1OUV A;  4XKC A;  1Z3X A;  5FJY A;  1N54 A;  2HYZ A;  4K03 A;  5FQ7 A;  2Q7F A;  4UQY A;  1E7V A;  5A23 A;  5G2N A;  1ELR A;  3UUX A;  3LKU A;  4OVU A;  2I6H A;  2PZI A;  1E8X A;  4ANU A;  4J6I A;  3VLF A;  3UT4 A;  2WXR A;  4DI4 A;  4G23 A;  4G24 A;  5BV1 A;  1P5Q A;  3UQ3 A;  2AVP A;  1PAQ A;  4WAF A;  2L9B A;  4H7Y A;  2J08 A;  4HFG A;  1HU3 A;  4U0Z A;  3SBS A;  2WPV A;  2WXQ A;  3Q15 A;  2WXG A;  4R7L A;  2Y4U A;  4LER A;  4Q94 A;  4NUR A;  3CVX A;  4JHR A;  1SZ9 A;  4OVV A;  3QWV A;  4EPZ A;  3JUI A;  3E4B A;  4B0Z A;  2KCL A;  3ONL A;  1IQR A;  4ACL A;  2AXV A;  4AOF A;  3MCX A;  4BFR A;  2WXI A;  2WXL A;  3CST A;  4KZ0 A;  2X6F A;  1OWM A;  2HO1 A;  4G11 A;  1UG3 A;  3FU5 A;  4MLP A;  1ELW A;  2PQR A;  3FTS A;  3B7S A;  4HLE A;  1OWL A;  2GRM A;  4AXH A;  4GA0 A;  2LSV A;  2CHZ A;  3CQC B;  3FUI A;  3FUH A;  4PH4 B;  5BV0 A;  3LVQ E;  3L13 A;  3R9A B;  2IOS A;  2ION A;  2OVF A;  3QNK A;  2WXK A;  4GMJ A;  1JWG A;  4IUL A;  4JA9 A;  4UWH A;  4XE0 A;  4BX9 A;  4BY6 A;  2WQ6 A;  3RIB A;  4CDR A;  1H2U A;  2NC9 A;  3FU6 A;  4AVX A;  4GZ5 A;  4B8C B;  3BEE A;  2WM9 A;  2VJ8 A;  3PDN A;  1HF8 A;  4GML A;  4WNF A;  3S7J A;  3MKR A;  3VTX A;  4EZL A;  4Y6C A;  1JPL A;  5C1D A;  4L23 A;  4B94 A;  3OXL A;  4N39 A;  3U64 A;  3N71 A;  4AY6 A;  2MRI A;  4HXI A;  1FVF A;  4BT9 A;  2YHE A;  2KM4 A;  3L08 A;  1JWF A;  1ZBP A;  3ASH A;  3FTW A;  3L17 A;  4QFV A;  5C2Y A;  2XCB A;  3AU4 A;  3FUN A;  5HQ8 A;  3D9L A;  1UW4 B;  3FFL A;  3SD5 A;  4RSY A;  2WXF A;  2DBA A;  1FCH A;  2XQ0 A;  4G25 A;  3NZU A;  4FLH A;  3FUF A;  3LPZ A;  2VGY A;  3EHN A;  4FC8 A;  3LY9 A;  4APF A;  3P1U A;  3CHP A;  3FEX A;  4J8E A;  3IEG A;  2OV8 A;  3NQP A;  5JJT A;  3CHQ A;  3MYV A;  2IOL A;  5A7D B;  2J4D A;  4MKT A;  3B7T A;  4ANW A;  4DK5 A;  2CHX A;  3I4R B;  5BPP A;  3CQG B;  4A3T A;  4C0M A;  3ML9 A;  3CEQ A;  4HOT A;  1Z3Y A;  2WXH A;  3G2S A;  4FP7 A;  4GA1 A;  3S7B A;  2FUL A;  3QJZ A;  3RJV A;  1H6K A;  3Q4A B;  4WND A;  2FF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...