4KXKB

Alanine-glyoxylate aminotransferase variant k390a/k391a in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
288
Chain Sequence
b'QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine--pyruvate aminotransferase
publication title Ligand-Induced Compaction of the PEX5 Receptor-Binding Cavity Impacts Protein Import Efficiency into Peroxisomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
total genus 116
structure length 288
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kxkB00
3CV0A 4N2QA 4B94A 3RO2A 1IYGA 2LSUA 2KCLA 3RU0A 4N39A 3LY9A 5FZRA 1QZ2A 4UQZA 3GYZA 4GZ6A 3ESKA 2FO7A 4I9CA 4BT9A 3MA5A 5FTPA 5KJMA 4JHRA 4N2SA 1ZU2A 1HH8A 4J8DA 3AS8A 3RIBA 3HYMB 1FCHA 5G05J 2JLBA 2OOEA 4WNFA 3S7BA 5CCLA 4BWRA 4I2WA 4GCOA 4I9EA 5A7DB 3KS2A 4HORA 3Q15A 3ZN3A 2IF4A 4GPKA 4XIFA 2NC9A 4A1SA 3S7FA 3VTXA 3CK8A 2ONDA 4G23A 3QKYA 2KCKA 3WXXA 2L6JA 2HO1A 2FF4A 5D0QD 2P58C 1B89A 4N3BA 3ASHA 5CCMA 5C1DA 3SZ7A 4H7YA 4UI9C 2C0LA 4KXKB 4NQ0A 5JJTA 4N5CA 4U0UA 4I2ZA 3ZHEA 1HXIA 1NA3A 3U4TA 4G2VA 4GA0A 3PE3A 2Y4UA 5EKQD 1E96B 5KJLA 2YQ8A 5DBKA 3ASGA 3CEQA 4U04A 2E2EA 2UY1A 4ABNA 3CVLA 3GZ1A 3URZA 2KCVA 4U0SA 2QFCA 3ASFA 5A6CA 5D0OD 3U3WA 3GZ2A 3TG4A 5FZSA 1PC2A 4G25A 3MV3B 5G04J 5EX3A 4J0UA 1ELRA 3CK7A 2FEZA 4KYOB 4AY6A 3TGOA 3CVPA 2XGMA 2UWJG 4JA7A 5KJKA 1IHGA 5LCWJ 4GYYA 3RKVA 3ZHEB 2BUGA 4AY5A 4G26A 3OXFA 2XGSA 3LYAA 4J8FA 5JJ7A 3N71A 3QWPA 4Y6WA 4HOTA 4U0ZA 4G1TA 2FI7A 4U07A 4EQFA 4F3VA 4CDRA 2UY1B 4XI9A 2XGOA 3TG5A 3UUXA 3QOUA 4NRHB 2HR2A 4YVQC 1HZ4A 2WQHA 3ZGQA 2XEVA 3FWVA 4N3CA 4BT8A 2VSNA 4UQYA 5HQ8A 3IEGA 3LY7A 2YHCA 3E4BA 3SF4A 5AYWD 3ZFWA 1KT0A 2FBNA 5CHEE 4HOSA 3QDNA 2AVPA 3VTYA 5HI7A 3Q47B 2J9QA 4O6FA 3ZPJA 5BW8C 3RO3A 4RG6A 3OXGA 5ARGA 3LKUA 3TAXA 1TJCA 4WUYA 2VGXA 3JYSA 4H7XA 3ULQA 2LNIA 3CK9A 1XNFA 1QQEA 4JA9A 2VQ2A 1KT1A 4BTAA 4ME2A 3FP3A 3BEEA 4UI9K 2XCCA 4RG9A 4CGVA 3O48A 4GA1A 2IFUA 3CVQA 3UQ3A 4GZ5A 2DBAA 2PZIA 3Q5MA 4W9RA 4Y6CA 3GW4A 4BTBA 1YA0A 2XPIA 5LCWC 3EDTB 3LCAA 5M72A 2C2LA 3S7JA 3S7DA 2PQRA 4HOUA 5ARFA 2MHKA 3ASDA 1A17A 2PQNA 5G05C 3RJVA 2LSVA 3Q4AB 5KJNA 2VSYA 2Q7FA 2VGXB 4GA2A 3KD7A 3LPZA 3PDNA 4I1AA 4GZ3A 3UPVA 1NZNA 5JJ6A 4J8EA 3MKRA 1OUVA 3MEKA 4KBQA 2VGYA 3MV2B 4JL0A 3K9IA 3QWWA 2PL2A 4HOQA 2WPVA 4WNEA 3QWVA 1ZBPA 4LEUA 1WAO1 5FT9A 2GW1A 3Q49B 5EX0A 5FJYA 4CGWA 4AIFA 4UI9J 2XCBA 4GCNA 1P5QA 1ELWA 1W3BA 4YVOA 4GYWA 5FZQA 3PE4A 4UQXA 2KC7A 2KATA 2V5FA 3FFLA 3OXLA 1WM5A 3R9AB 4G24A 4APOA 5DIZA 4AM9A 4I17A 3AS4A 1KLXA 3KAEA 2VYIA 5BT1A 2R5SA 4GYOA 5G04C 1NA0A 3LY8A 1Y8MA 3CVNA 2C0MA 4WNGA 4XI0A 3NF1A 4IN3B 5BNWA 3CKCA 4YNDA 2I6HA 3CKBA 2Y4TA 4WNDA 3AS5A 2HYZA 4N3AA
chains in the Genus database with same CATH superfamily
1HO8A 3SBSA 4B94A 3SD5A 4ILGA 2KBXA 2X6KA 2I9CA 1Y6IA 5FZRA 1QZ2A 3J5QB 4UQZA 4LNBA 4GZ6A 3ESKA 4HNAD 2QYUA 4PS3A 1H6OA 3L6AA 4JHRA 2XS1A 3GZSA 3UXGA 1NP7A 3CGHA 3FHEA 1Z3YA 3UI2A 1FCHA 2JLBA 5ENPD 2OOEA 1X5BA 4G8LA 2CG3A 4BWRA 2R59A 1IKND 1HG2A 2J08A 2J8SD 3Q15A 3L9TA 3T5VA 4A1SA 4GTMA 5CBOA 1MX2A 3WXXA 2VSXE 3P1UA 2GGFA 2GRNB 4JXTA 2H6FA 1N9AA 3LJNA 2BEDA 1OWOA 1K8KG 3AG4E 3WG7E 1E90A 3PNTB 3MX3A 2C0LA 2XHEA 2WXQA 2AXZA 4B8CB 2WB2A 3D9HA 4NQ0A 5JJTA 4M3OA 4I2ZA 2QYJA 1IQUA 1NA3A 3ZXPA 1EDUA 4BX8A 3U4TA 3UT4A 3D3MA 2RFAA 4BESA 1WDYA 3DBSA 5D66A 3ASGA 3CEQA 5JMND 2UY1A 4ABNA 5AQAA 1SA4A 3VLDA 4BFRA 3FUDA 3GZ1A 3CQCB 1TNOA 1NFIE 1EYHA 3FUJA 3T8KA 2HE0A 3EUVA 3TG4A 2J49A 4FHKA 4KVOA 5FZSA 1PC2A 3B7SA 3CHRA 3DEPA 1WG0A 4JHJA 3DSSA 4G8KA 1A5EA 4XKCA 2LXMA 2ILRA 2J09A 4FLBA 4HB5A 4AY5A 2L6BA 4CT4A 4JD2G 1FT1A 5JJ7A 4U0ZA 4G1TA 5IY5E 5AENA 4LG6A 3R9MA 3SQVA 4OAVB 1ZB1A 2UY1B 1JCQA 1YCSB 4ACKA 3ASNE 4GMJA 1V54E 5AQ7A 2H6IA 2WXRA 3B7UX 1DC2A 4J7WA 2JEKA 3UIOC 2DWZA 2AWIA 3T9KA 3IEGA 2XQ0A 2A4ZA 2HM8A 2YHCA 3OAWA 4DI4A 4HI9A 4L23A 2GRRB 2CHZA 3PZ3A 3ZFWA 1OWLA 2QZAA 2FBNA 5CHEE 3B13A 4YDOA 1FT2A 3U66A 3UM0A 4ANXA 4WWPA 3ZPJA 4O60A 3EIQC 2ETCA 3RO3A 4A55A 1TNUA 4EZJA 3D9NA 3OXGA 3VLFA 2XEHA 3BG0B 2VGXA 2ZU6B 3Q73A 3HXBA 1E7VA 4JA9A 4MKTA 3AG1E 1KPSB 2OV8A 4J8SA 5AJDA 3LJ3A 2XCCA 1BLXB 3O48A 2VGEA 2WXIA 3BG1B 3C5RA 1E8XA 3HG0D 3CVQA 3V30A 4JHKA 3PZ1A 4BTBA 1H2VC 5ENTD 4C0EA 5AIJA 3EDTB 2V4LA 3S7JA 4F1SA 2EIKE 4D10C 3TWVA 3AU4A 5ARFA 4YDWA 2R05A 2MHKA 3HHMA 3FU5A 3FTSA 2XRYA 3Q4AB 5KJNA 2Q7FA 4KZCA 2VGXB 3HXEA 3FH5A 3Q9UC 3DSVA 4TRQA 2I2OA 3LPZA 3ZRHA 4GZ3A 4QFVA 5CMYA 1N4SA 3MEKA 1K1AA 4I1MA 3C3QA 4FC8A 1HX8A 2AJAA 3QB2A 5CRUA 3K9IA 3QWWA 3I3NA 3ABME 1SVXA 3ENEA 3SY2A 3QWVA 1OCOE 5FJYA 3ML9A 4AIFA 4UI9J 1ELWA 5B1AE 4U63A 3PH0C 4N5QA 3G2SA 3DSTA 3SO8A 5FQ7A 3CIAA 2JABA 2KC7A 3L16A 3KEZA 2Y0BG 2EILE 3TWUA 4AM9A 1BD8A 5D2MC 3OTNA 3AS4A 3KAEA 4K5AB 3FTVA 5BT1A 1Q2ZA 5BUZA 3LY8A 5ITZF 3C3RA 4XI0A 3NF1A 5BNWA 5JA4D 1E8ZA 3ZKJA 3NB2A 3CV0A 2IU1A 3SFXA 5CERB 2IY0C 5CECB 2LSUA 3RU0A 4KZ0A 3EHNA 4FJZA 1N4QA 3LVQE 1LTXA 1KZPA 2WMNA 4CRWA 4GTSA 4XZ4A 3APDA 3IBEA 3MJWA 3RK6A 4UWHA 5E75A 1OCRE 4I9CA 1IHBA 3MA5A 5KJMA 1O1TA 4UWLA 3EIJA 4FU3A 1ZU2A 1HS6A 2XENA 3PZ4A 4L7TA 3UKRG 1N52A 4RSYA 2OVBA 5G05J 3IV0A 4RVBA 4WNFA 3PUKA 3S7BA 3SBTB 3L08A 3UKUG 3ZN3A 2NSZA 3S7FA 3UMVA 2WXMA 4G23A 4B93B 2KCKA 4OYSA 4WWNA 2L6JA 2HO1A 3TWTA 1L5JA 4TUMA 1X81A 3ASHA 3D9OA 5C1DA 3SZ7A 4H7YA 4UI9C 5EN5D 5G55A 1HG5A 2MOWA 4V3IA 3FEXA 2H6HA 4XE0A 4G2VA 3CHOA 3AG3E 5FINA 2IO3C 4E85A 4OVVA 5KJLA 2YQ8A 4U04A 2E2EA 1TNZA 5KNGA 3JXIA 4HRMB 4U0SA 3UM2A 3FULA 2X38A 4FADA 4PUCA 3B7TA 4DI3A 1EPUA 3MKQA 2CG2A 1D8EA 4I6JA 4JEHA 5AQBA 5G04J 5EX3A 1JUQA 5EIBE 4J0UA 4OAUC 1ELRA 4DX1A 3CK7A 3TJPA 3T8MA 5EYLA 1PAQA 3CVPA 2XGMA 3P2BA 2FULA 4F1PA 3FTUA 1JCSA 3LEWA 5LCWJ 4XX5A 3NOCD 3HXCA 2BUGA 3LXUX 1EF1C 4GTTA 3OXFA 2XEEA 3F6QA 3L13A 3SI5A 3QARA 1RW2A 3UT7A 1OCCE 4Y6WA 4ACLA 3ZNGA 3FUEA 3X2QE 1TN8A 2HR2A 4NURA 4CEMA 2P2CP 2WQHA 3FWVA 1S70B 3MKQB 1OY3D 4FHJA 4N3CA 4BT8A 3R7RA 3ZW3A 3EU5A 3SHFA 5HQ8A 4HXIA 1FVFA 2DVWA 2DYRE 4ZHBA 4BERA 4CYMD 3QC1A 3V2XA 4AVXA 1H2UA 2CFUA 5E76A 1DNPA 1N0QA 2V8SE 3VTYA 1TNBA 1TEZA 2J9QA 3TXNA 4UWFA 4JZYA 4JPSA 4BSZB 3DSWA 4EECA 1LF8A 3TAXA 4HLEA 3ULQA 1HF8A 2LNIA 1GW6A 4HRNA 5AJLA 3FU6A 2VQ2A 1UN8A 3BU8A 4BTAA 3FP3A 4MS6A 4RG9A 2WXNA 3EU9A 4U8YD 4CGVA 3D9MA 2GRMA 4OVUA 3UX4A 5H7PA 2P9IG 2CFZA 4A1GA 3UQ3A 2DBAA 4U96D 2WXKA 3Q5MA 3ZEFA 2BKGA 1OT8A 2R2LA 2XPIA 2EIJE 3CR3A 5LCWC 4K5BA 2C2LA 2RFMA 4R7LA 3Q9NC 3ABLE 1H0AA 5ENRD 1S64A 4AOFA 5LP0A 3C72A 1Z6TA 3ASOE 4WAFA 3C3OA 3ASDA 1O1RA 5ANRA 1A17A 2PQNA 3HDXA 4FLHA 3RSEG 2QC9A 1IXVA 1BI7B 4BY6A 4GA2A 1SQMA 3I5PA 4A3TA 4I1AA 4EZLA 2WXFA 1NZNA 5T8IA 4J8EA 5J08A 3MKRA 4TXRA 3JUIA 2FO1E 4GTOA 1OUVA 2ZXWE 4HVBA 4UWKA 1INZA 3UT8A 2WXHA 1U3DA 4GTRA 2I1KA 2PL2A 3FTZA 3L82A 2X6IA 4FA6A 3FUFA 3CHPA 4K0RA 4LUNU 3KSQA 4XEIG 4IYPA 3SFZA 5FT9A 4JB8P 2GW1A 3QJZA 3CSTA 2A5UA 2XCBA 5LFAA 5CEAA 4CCAA 1P5QA 3E30A 4YVOA 5ENSD 3TWWA 1O5MA 2F0YA 2J4DA 3EHQA 1AWCB 4UQXA 3T5XA 2WXLA 2BF0X 3OXLA 4DX2A 1N94A 3HVEA 3JXJA 5ENNA 2VSOE 4I17A 2CHXA 2IQCA 3UM3A 4U8VD 2GRQB 2R5SA 2YNQA 4JW1A 2CHWA 5FQ6A 3JQ0A 2VTBA 2R17C 3CVVA 4WNGA 4GPMA 4MRUA 2IJGX 4ANUA 1QBQA 2HYZA 2DIWA 3NAWA 3HIZA 4YDYA 4N2QA 3RO2A 3MGBA 5BV0A 4A3VA 2KCLA 4DRXE 1Z3XA 2Y69E 3GYZA 2FO7A 1N0RA 4K03A 2XPYA 4J8YA 1N95A 5FTPA 3FUMA 3ONKA 4WWOA 4C9BB 1HH8A 4J8DA 1BU9A 2OCCE 3AS8A 3HYMB 3HVEB 3EJNA 5CCLA 4I2WA 5AARA 4GCOA 4CDMA 2VTBB 4HORA 1JCRA 3FUIA 2IF4A 2NC9A 2ZIRA 2ONDA 3QKYA 5HS0A 4GZCA 4U8HA 4YDEA 2DZOA 1N4RA 2FF4A 2XZTG 2KM4A 3FEYA 3CLJA 3I4RB 5ENQD 4LERA 1UJJA 2Y1LE 4BSXA 3L54A 2WVIA 4ATZD 4A63B 4GTPA 4N5CA 4U0UA 3ZYMA 1S63A 4HBDA 1HXIA 2DCPA 2X6HA 3ZVVA 2L0IA 2IO2C 4CT0A 4RLYA 4LCTA 2NXPA 2OEWA 1DVPA 3PE3A 1K3ZD 2VJ8A 3HXFA 5EKQD 1E96B 1U3CA 2RG8A 5DBKA 5FIOA 4B89A 3QK0A 1V55E 3DPDA 3I4GA 3URZA 2KCVA 5EDSA 3R7QA 5D0OD 3IXEA 2WXPA 1HE8A 5KBAA 2WXJA 3GZ2A 4RQIA 3CSFA 3PS6A 4G25A 4DLOA 3CVYA 4ATGA 2P9PG 4CDNA 1H2TC 2F8XK 2FEZA 4KYOB 2AXVA 2AW6A 4AY6A 3TGOA 2UWJG 3Q7AA 4JA7A 3IHYA 1IHGA 4GYYA 4ANVA 3RAUA 3CVWA 3U64A 5AN8A 3DSXA 3ZUVB 4G26A 2M63A 2XGSA 4J8FA 3DSUA 3N71A 2PM7A 5KNHD 2FI7A 3ULYA 1UJKA 1TJFA 3NZUA 3TL5A 4CDRA 3O4ZA 1FPPA 4I43A 2AXUA 2J4BA 2XGOA 2WM9A 3UUXA 4YVQC 4F7AA 5BXOA 3JUEA 3KEAA 1PY1A 1H19A 2GRPB 2VSNA 4O1OA 1JPLA 4UQYA 3FH8A 3C98A 5T3RA 4AXHA 1JWGA 3LY7A 2P9SG 3FTWA 3SF4A 5AYWD 4UUCA 3SGHA 3U9WA 2R02A 2V0PA 2WMOA 4TUUA 3TWRA 4GU5A 4F6RD 4HOSA 1D9SA 5HI7A 1FVHA 3Q47B 4O6FA 5B1BE 5BW8C 1UOHA 3UIPC 5ARGA 2P9NG 4EPZA 4H7XA 3CK9A 1XNFA 3RRNB 3ZYKA 4JC8A 3CVUA 3TXMA 5JHBA 3FU3A 1KT1A 3DWLG 4FULA 2WXGA 1TN7A 4UI9K 1VDYA 1RZ4A 3PVLA 4GZ5A 4AEZC 2PZIA 4L2YA 3MYVA 4X8QA 3ISMC 2KXPC 1YA0A 3NZSA 3QNKA 4XKBA 3LCAA 3PZ2A 4APFA 4Q96A 1BI8B 4PDXA 3MCXA 2BKKB 4FP7A 3ML8A 4HOUA 3ONLA 1N54A 2EIME 5G05C 3RJVA 3TWSA 1UG3A 3HXDA 5ENOD 4ANWA 3G2WA 4HLLA 3PDNA 1LD7A 3B7RL 1YMPA 1E8WA 3FU0A 3DRAA 5FQ8A 5KCMA 3PEVB 5CBNA 4KBQA 4ILIA 5LOZA 2VGYA 3G2TA 3MV2B 3Q79A 5T4YA 5FWQA 4KVMA 2WPVA 3J5PA 1G3NB 1D8DA 1K1BA 2XS8A 4LEUA 4LSZE 1S0PA 2PNNA 1WAO1 5EX0A 3FY4A 2R03A 2LXLA 4EZKA 5FZQA 3KSLA 3PE4A 5AAOA 3V31A 4MLPA 2V5FA 2KATA 3FFLA 3FUHA 5HKPA 4GAAA 3TWXA 4APOA 5DIZA 2MRIA 4K5CA 4HI8A 4I6GA 4U95D 4P29A 1BPOA 4I1OB 1KLXA 2VYIA 3W9GA 5G04C 1H6PA 3AAAC 3CVNA 5EILA 4UWGA 4Q94A 4IN3B 5BPPA 3CKCA 4YNDA 3AJIA 4DJAA 5BXUA 4F53A 2OVFA 3CHSA 2E0IA 3LDZA 4L1BA 3ZYLA 2IOLA 3AS5A 2DZNA 3B95A 4B8AA 1SZAA 3MZLB 1IYGA 2WXOA 4M7CA 5G2NA 4N39A 1YYHA 3LY9A 2LUHA 3VLEA 2X6FA 2F8YA 4G11A 5J90A 4PS7A 4EBAG 4BT9A 5BV1A 4N2SA 4GTQA 1HU3A 3SFYA 4MBGA 5C2YA 4GB9A 1AP7A 4HS2A 3RIBA 4EHMA 4HRLA 3PZDA 1DCQA 4LNUD 4DX5D 3L22A 4I9EA 4TXQA 5A7DB 3DPYA 3KS2A 4GPKA 2B0OE 5LX8A 3CVXA 2A5EA 1OWPA 4XIFA 1MX6A 4HFGA 3VTXA 3CK8A 1OXJA 1ELKA 4IRUA 1MZCA 3NOGD 2GROB 3ESLA 4NACA 3ZU7B 5D0QD 2P58C 1B89A 1IQRA 4U7EB 1MYOA 2L0TB 4N3BA 5KWDA 3NBNB 5CCMA 3D9PA 2XRZA 4KXKB 4JVSA 1E8YA 3ZHEA 3CQGB 2EINE 3AG2E 4GA0A 4GTVA 3S2AA 3ZIMA 2Y4UA 2GRLA 2MYOA 1SW6A 4GZDA 4ZFHA 4DPRA 4KT6B 3V79K 3CHMA 3CVLA 3PUJA 2L9BA 1UN9A 2QFCA 1QNFA 4CZ2D 4AJWA 2LAIA 3ASFA 5A6CA 4L2LA 4C48B 2V4HC 3U3WA 1MHQA 1MQSA 3MV3B 2ZGGA 3FTYA 2RD0A 2XZDG 3Q78A 4C0MA 5CMWA 1WY6A 2J07A 5AQ9A 5KJKA 1MX4A 1TR4A 1TYQG 3RKVA 3ZHEB 3RRMB 2YHEA 3CHQA 5FQ4A 3PEUB 2B6CA 3LYAA 5ANLA 3E37A 3QWPA 3Q75A 4HOTA 1NI1A 4EQFA 4U07A 2IONA 4F3VA 2F37A 3D9LA 4XI9A 2X3MA 3TG5A 4EBAA 4L9PA 3QOUA 4NRHB 3FTXA 3HRAA 1HZ4A 4DX7D 3ZGQA 2XEVA 2LO6A 3RRUA 3ZYQA 3FH7A 4BETA 3Q7FA 3UTMA 4GMLA 3L17A 2KZTA 2P9UG 2Y3AA 1O1SA 1NL4A 3E4BA 4J6IA 4QQIA 5B3SE 5HRYA 4BEPA 1LD8A 1KT0A 5EYPF 3NQPA 1N11A 1XGWA 3IHVA 3QDNA 2AVPA 2EQXA 2ZGDA 3LS8A 4AV7A 1TN6A 2P9LG 3DEOA 3JQ1A 3PNLB 4RG6A 3LKUA 3ULEG 2RKKA 4E6HA 1TJCA 4WUYA 2IEJA 2OEVA 3DXMG 3JYSA 4ILHB 1QQEA 3G2UA 3LVRE 2ETAA 4Q69A 3EHMA 1N4PA 2XPZA 3UM1A 3FDHA 2P9KG 4ME2A 2PM6A 1Z5SC 3BEEA 1KZOA 1OWNA 4AP2A 2QY7A 2ZISA 3FUNA 3D9JA 4GA1A 3B7BA 2IFUA 1JWFA 4IULA 2KZTB 4LRZA 1E7UA 2DYSE 3D9IA 4NIKA 3APCA 4W9RA 2H6GA 4Y6CA 3GW4A 4TXPA 3W9FA 3G2VA 2IOSA 5M72A 3E34A 3S7DA 2PQRA 4PH4B 3UINC 5A23A 4HQDA 5CRVA 3PREA 2WQ6A 2LSVA 1SZ9A 4PS8A 2VSYA 2BTDA 1OWMA 4URKA 3KD7A 4JEUA 2ETBA 1SA5A 4KMOA 3UPVA 5JJ6A 3TWQA 4I6EA 3JCKC 3BQOA 4DK5A 3IKOB 4DUIA 4JL0A 3EHRA 3ABKE 5CEDB 2X6JA 4HOQA 5EIDA 2NYJA 4WNEA 1UW4B 3DXKG 4B0ZA 2V5QC 1ZBPA 3E32A 3D9KA 4Z68A 1DCEA 1QYMA 3V2OA 1TNYA 2WQ7A 1U2VG 3Q49B 4CGWA 4TV3A 1MJ0A 4BX9A 4GCNA 4LNGA 4FJYA 3SNXA 1W3BA 2YINA 4GYWA 3APFA 3QAQA 1OCZE 4O1PA 3BUAA 4DX6D 1WM5A 4GMRA 3R9AB 4G24A 4DLQA 1HFAA 3E33A 3AU5A 3PRZA 4GYOA 1NA0A 1Y8MA 2C0MA 3ZXSA 5JHAA 2I1JA 2LAHA 2I6HA 3CKBA 2Y4TA 3FUKA 4WNDA 1H6KA 4N3AA
chains in the Genus database with same CATH topology
3CV0A 4N2QA 1HO8A 3SBSA 2IU1A 4B94A 3SD5A 4B8AA 1SZAA 3MZLB 4ILGA 3MGBA 3RO2A 1IYGA 2WXOA 5BV0A 4A3VA 2LSUA 2KCLA 2X6KA 4KZ0A 2I9CA 3EHNA 4FJZA 5G2NA 4N39A 3RU0A 3LY9A 3LVQE 1Y6IA 5FZRA 1QZ2A 1Z3XA 4UQZA 3VLEA 2X6FA 2WMNA 3GYZA 4GZ6A 4CRWA 3ESKA 4XZ4A 2FO7A 3APDA 3IBEA 3MJWA 4G11A 3RK6A 4UWHA 4PS3A 5E75A 4I9CA 5J90A 4PS7A 4K03A 2XPYA 4EBAG 4BT9A 3MA5A 5FTPA 5BV1A 3L6AA 4JHRA 1HU3A 4UWLA 3FUMA 5KJMA 3EIJA 4FU3A 1ZU2A 3ONKA 4WWOA 5C2YA 1HS6A 3GZSA 4C9BB 4GB9A 4L7TA 1HH8A 1NP7A 3CGHA 3FHEA 4J8DA 3AS8A 4HS2A 3RIBA 1Z3YA 1N52A 3HVEB 3HYMB 2OVBA 4RSYA 1FCHA 5G05J 2JLBA 3IV0A 3PZDA 4RVBA 2OOEA 4WNFA 1X5BA 3PUKA 3EJNA 3S7BA 2CG3A 5CCLA 4BWRA 4I2WA 4GCOA 2R59A 3L22A 4I9EA 4CDMA 3SBTB 5A7DB 3KS2A 3L08A 2VTBB 4HORA 1HG2A 2J08A 3FUIA 3Q15A 3ZN3A 2IF4A 5LX8A 3T5VA 4GPKA 3CVXA 4XIFA 1OWPA 2NC9A 4A1SA 2NSZA 3S7FA 4HFGA 3UMVA 2WXMA 3VTXA 3CK8A 1ELKA 2ONDA 4G23A 3QKYA 2KCKA 3WXXA 4IRUA 4GZCA 4OYSA 4WWNA 4U8HA 2L6JA 2VSXE 3P1UA 2GGFA 2HO1A 3ESLA 2FF4A 4NACA 4JXTA 2KM4A 3FEYA 5D0QD 2P58C 3CLJA 1B89A 1IQRA 1L5JA 2L0TB 3I4RB 4N3BA 1OWOA 4LERA 1UJJA 3ASHA 5CCMA 3D9OA 4BSXA 5C1DA 3L54A 1E90A 3SZ7A 3D9PA 2WVIA 3PNTB 4H7YA 4UI9C 3MX3A 2C0LA 2XHEA 2WXQA 2AXZA 5G55A 2XRZA 4B8CB 2WB2A 1HG5A 4KXKB 4NQ0A 4JVSA 5JJTA 4N5CA 4U0UA 2MOWA 3ZYMA 4V3IA 4M3OA 1E8YA 4I2ZA 3CQGB 3ZHEA 1IQUA 1HXIA 3FEXA 1NA3A 2DCPA 2X6HA 3ZVVA 2L0IA 1EDUA 4BX8A 4CT0A 4LCTA 2NXPA 4XE0A 4G2VA 3U4TA 3UT4A 1DVPA 3CHOA 4GA0A 5HQ8A 3S2AA 3PE3A 3D3MA 2VJ8A 3ZIMA 4E85A 2Y4UA 4OVVA 5EKQD 1E96B 1U3CA 2RG8A 2GRLA 3DBSA 5KJLA 2YQ8A 5DBKA 3ASGA 3CEQA 4GZDA 4U04A 4DPRA 4KT6B 2E2EA 4B89A 3QK0A 2UY1A 4ABNA 3CHMA 3CVLA 3VLDA 4BFRA 3FUDA 3GZ1A 3CQCB 3DPDA 3I4GA 3PUJA 2L9BA 3URZA 1UN9A 2KCVA 4U0SA 2QFCA 3FULA 1QNFA 2X38A 4AJWA 4FADA 1EYHA 2LAIA 5EDSA 3FUJA 4PUCA 3ASFA 3B7TA 5A6CA 3R7QA 4DI3A 5D0OD 1EPUA 3MKQA 4L2LA 2WXPA 1HE8A 2CG2A 3U3WA 2WXJA 3GZ2A 3TG4A 2J49A 1MHQA 3CSFA 4FHKA 4I6JA 4KVOA 1PC2A 3PS6A 4JEHA 1MQSA 3B7SA 4G25A 5FZSA 4DLOA 3MV3B 5G04J 4ATGA 3CVYA 3CHRA 3FTYA 1JUQA 5EX3A 2RD0A 4J0UA 1ELRA 3CK7A 3TJPA 3T8MA 1H2TC 4CDNA 2FEZA 4JHJA 4KYOB 2AXVA 2AW6A 1PAQA 4C0MA 5CMWA 4AY6A 3TGOA 3CVPA 1WY6A 2J07A 2XGMA 3P2BA 2UWJG 2FULA 4JA7A 5KJKA 4XKCA 3FTUA 3IHYA 1IHGA 3LEWA 5LCWJ 4XX5A 4GYYA 2ILRA 3RKVA 4ANVA 2J09A 3ZHEB 4FLBA 3CVWA 3U64A 2BUGA 3RRMB 2YHEA 3LXUX 4AY5A 4G26A 3CHQA 5FQ4A 1EF1C 2M63A 4CT4A 3OXFA 3PEUB 2XGSA 3LYAA 5ANLA 3L13A 4J8FA 3N71A 3SI5A 3QARA 2PM7A 3QWPA 5JJ7A 3UT7A 4Y6WA 4HOTA 4U0ZA 4G1TA 2FI7A 4U07A 4EQFA 1UJKA 4ACLA 5AENA 1TJFA 3NZUA 2IONA 4F3VA 3TL5A 4CDRA 3O4ZA 3D9LA 3FUEA 2AXUA 2UY1B 4I43A 2J4BA 4XI9A 4ACKA 4GMJA 2XGOA 2X3MA 2WM9A 3TG5A 4EBAA 3UUXA 3QOUA 4NRHB 2HR2A 2WXRA 3FTXA 4NURA 4YVQC 4CEMA 1HZ4A 3B7UX 2WQHA 3ZGQA 2XEVA 2LO6A 3FWVA 3MKQB 4FHJA 3RRUA 4F7AA 4N3CA 3ZYQA 2JEKA 3FH7A 4BT8A 1PY1A 3R7RA 1H19A 2VSNA 4GMLA 3L17A 1JPLA 4UQYA 2AWIA 3ZW3A 3FH8A 3C98A 3IEGA 3SHFA 2XQ0A 4HXIA 2KZTA 1FVFA 5T3RA 2A4ZA 1JWGA 2HM8A 2YHCA 2Y3AA 3LY7A 4AXHA 3E4BA 3OAWA 4DI4A 4J6IA 3FTWA 3SF4A 5AYWD 4L23A 3QC1A 4AVXA 2CHZA 1H2UA 3SGHA 2CFUA 3U9WA 3ZFWA 1KT0A 1DNPA 1OWLA 2V0PA 2WMOA 2V8SE 5E76A 2FBNA 3NQPA 4TUUA 5CHEE 3B13A 4GU5A 1XGWA 4HOSA 3IHVA 3U66A 3QDNA 4ANXA 2AVPA 3VTYA 2EQXA 5HI7A 1FVHA 3Q47B 1TEZA 2J9QA 3TXNA 4O6FA 4WWPA 3ZPJA 3LS8A 4UWFA 4JZYA 5BW8C 3EIQC 4AV7A 4JPSA 3RO3A 4A55A 4EZJA 3PNLB 3JQ1A 3D9NA 4RG6A 3OXGA 3VLFA 5ARGA 4EECA 3LKUA 1LF8A 3TAXA 4HLEA 4E6HA 1TJCA 3BG0B 2VGXA 2ZU6B 4WUYA 4EPZA 3JYSA 4H7XA 3ULQA 1HF8A 2LNIA 1GW6A 1XNFA 3CK9A 4ILHB 1QQEA 5AJLA 3RRNB 1E7VA 3FU6A 3ZYKA 4JA9A 4JC8A 3CVUA 3G2UA 3LVRE 3TXMA 4Q69A 3EHMA 3FU3A 5JHBA 2VQ2A 1UN8A 1KT1A 2XPZA 3FDHA 4FULA 4MKTA 4BTAA 4ME2A 2WXGA 2OV8A 2PM6A 3BEEA 3FP3A 4J8SA 4MS6A 5AJDA 1OWNA 4AP2A 2QY7A 4UI9K 3LJ3A 2XCCA 4RG9A 2WXNA 3FUNA 4CGVA 3D9MA 3O48A 2GRMA 4OVUA 3D9JA 2WXIA 3UX4A 3BG1B 1VDYA 4GA1A 1E8XA 2CFZA 2IFUA 4A1GA 1JWFA 4IULA 3CVQA 3PVLA 2KZTB 4LRZA 1E7UA 3UQ3A 4GZ5A 2DBAA 2WXKA 3D9IA 4AEZC 2PZIA 3Q5MA 4L2YA 3APCA 4JHKA 3MYVA 4W9RA 3ZEFA 4Y6CA 3GW4A 4BTBA 1H2VC 1YA0A 3G2VA 2XPIA 4C0EA 3CR3A 3NZSA 3QNKA 5AIJA 2IOSA 4XKBA 3EDTB 3LCAA 5LCWC 4APFA 5M72A 2C2LA 2V4LA 3S7JA 4Q96A 4R7LA 4F1SA 4PDXA 3S7DA 2PQRA 4PH4B 5A23A 1H0AA 4D10C 3MCXA 3AU4A 4FP7A 3ML8A 4AOFA 5LP0A 4HOUA 1Z6TA 4WAFA 5ARFA 3ONLA 1N54A 2MHKA 3ASDA 3PREA 3HHMA 5ANRA 2WQ6A 1A17A 2PQNA 5G05C 3RJVA 2LSVA 3FU5A 1SZ9A 3FTSA 2XRYA 3Q4AB 2VSYA 3HDXA 1UG3A 4FLHA 2BTDA 4PS8A 5KJNA 2Q7FA 4KZCA 4N3AA 4BY6A 2VGXB 4GA2A 3FH5A 1OWMA 4ANWA 4URKA 3G2WA 1SQMA 2I2OA 3KD7A 4TRQA 3LPZA 4JEUA 3ZRHA 3I5PA 3PDNA 4A3TA 3B7RL 4I1AA 4EZLA 4KMOA 4GZ3A 2WXFA 3UPVA 1NZNA 5JJ6A 5T8IA 4J8EA 5J08A 3MKRA 4QFVA 3JUIA 1E8WA 3FU0A 4N2SA 5FQ8A 5KCMA 1OUVA 5CMYA 3PEVB 3MEKA 3JCKC 4I6EA 4ILIA 4KBQA 4I1MA 5LOZA 2VGYA 3G2TA 4HVBA 4FC8A 4UWKA 1HX8A 1INZA 4DK5A 3IKOB 3MV2B 3UT8A 2WXHA 1U3DA 4JL0A 3QB2A 5T4YA 5FWQA 4KVMA 3K9IA 3QWWA 2X6JA 2I1KA 2PL2A 3FTZA 3I3NA 2WPVA 4HOQA 2X6IA 4WNEA 1UW4B 4FA6A 4B0ZA 3ENEA 3FUFA 3CHPA 3QWVA 4K0RA 4LUNU 1ZBPA 3D9KA 4IYPA 3SFZA 4LEUA 1S0PA 1WAO1 5FT9A 2WQ7A 2GW1A 3Q49B 5EX0A 5FJYA 4CGWA 3QJZA 3CSTA 4TV3A 3ML9A 3FY4A 4AIFA 4UI9J 4BX9A 2A5UA 2XCBA 5LFAA 4CCAA 4GCNA 1P5QA 1ELWA 4FJYA 3SNXA 1W3BA 4YVOA 2YINA 4GYWA 3APFA 3QAQA 4U63A 3PH0C 2J4DA 4EZKA 5FZQA 3G2SA 3PE4A 4UQXA 4MLPA 5FQ7A 3CIAA 3T5XA 2WXLA 2KC7A 2KATA 2V5FA 3FFLA 3L16A 2BF0X 3KEZA 3OXLA 3FUHA 1WM5A 4GAAA 3R9AB 4G24A 4APOA 5DIZA 4DLQA 2MRIA 1HFAA 4AM9A 3HVEA 4I6GA 4P29A 1BPOA 5ENNA 2VSOE 3OTNA 3AS4A 2CHXA 4I17A 4I1OB 3AU5A 2IQCA 1KLXA 3KAEA 2VYIA 3FTVA 3PRZA 5BT1A 2R5SA 2YNQA 4GYOA 4JW1A 2CHWA 5FQ6A 5G04C 3JQ0A 2VTBA 1NA0A 5BUZA 3LY8A 1Y8MA 2R17C 3CVNA 3CVVA 2C0MA 3ZXSA 4UWGA 4WNGA 4XI0A 4Q94A 3NF1A 4IN3B 5JHAA 5BNWA 5BPPA 2I1JA 2LAHA 3CKCA 4YNDA 2I6HA 3CKBA 2OVFA 4MRUA 4DJAA 4F53A 3CHSA 2E0IA 2Y4TA 2IJGX 3LDZA 3FUKA 4L1BA 3ZYLA 4WNDA 4ANUA 2IOLA 3AS5A 1E8ZA 2HYZA 2DIWA 1H6KA 3HIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CV0 A;  4N2Q A;  4B94 A;  3RO2 A;  1IYG A;  2LSU A;  2KCL A;  3RU0 A;  4N39 A;  3LY9 A;  5FZR A;  1QZ2 A;  4UQZ A;  3GYZ A;  4GZ6 A;  3ESK A;  2FO7 A;  4I9C A;  4BT9 A;  3MA5 A;  5FTP A;  5KJM A;  4JHR A;  4N2S A;  1ZU2 A;  1HH8 A;  4J8D A;  3AS8 A;  3RIB A;  3HYM B;  1FCH A;  5G05 J;  2JLB A;  2OOE A;  4WNF A;  3S7B A;  5CCL A;  4BWR A;  4I2W A;  4GCO A;  4I9E A;  5A7D B;  3KS2 A;  4HOR A;  3Q15 A;  3ZN3 A;  2IF4 A;  4GPK A;  4XIF A;  2NC9 A;  4A1S A;  3S7F A;  3VTX A;  3CK8 A;  2OND A;  4G23 A;  3QKY A;  2KCK A;  3WXX A;  2L6J A;  2HO1 A;  2FF4 A;  5D0Q D;  2P58 C;  1B89 A;  4N3B A;  3ASH A;  5CCM A;  5C1D A;  3SZ7 A;  4H7Y A;  4UI9 C;  2C0L A;  4KXK B;  4NQ0 A;  5JJT A;  4N5C A;  4U0U A;  4I2Z A;  3ZHE A;  1HXI A;  1NA3 A;  3U4T A;  4G2V A;  4GA0 A;  3PE3 A;  2Y4U A;  5EKQ D;  1E96 B;  5KJL A;  2YQ8 A;  5DBK A;  3ASG A;  3CEQ A;  4U04 A;  2E2E A;  2UY1 A;  4ABN A;  3CVL A;  3GZ1 A;  3URZ A;  2KCV A;  4U0S A;  2QFC A;  3ASF A;  5A6C A;  5D0O D;  3U3W A;  3GZ2 A;  3TG4 A;  5FZS A;  1PC2 A;  4G25 A;  3MV3 B;  5G04 J;  5EX3 A;  4J0U A;  1ELR A;  3CK7 A;  2FEZ A;  4KYO B;  4AY6 A;  3TGO A;  3CVP A;  2XGM A;  2UWJ G;  4JA7 A;  5KJK A;  1IHG A;  5LCW J;  4GYY A;  3RKV A;  3ZHE B;  2BUG A;  4AY5 A;  4G26 A;  3OXF A;  2XGS A;  3LYA A;  4J8F A;  5JJ7 A;  3N71 A;  3QWP A;  4Y6W A;  4HOT A;  4U0Z A;  4G1T A;  2FI7 A;  4U07 A;  4EQF A;  4F3V A;  4CDR A;  2UY1 B;  4XI9 A;  2XGO A;  3TG5 A;  3UUX A;  3QOU A;  4NRH B;  2HR2 A;  4YVQ C;  1HZ4 A;  2WQH A;  3ZGQ A;  2XEV A;  3FWV A;  4N3C A;  4BT8 A;  2VSN A;  4UQY A;  5HQ8 A;  3IEG A;  3LY7 A;  2YHC A;  3E4B A;  3SF4 A;  5AYW D;  3ZFW A;  1KT0 A;  2FBN A;  5CHE E;  4HOS A;  3QDN A;  2AVP A;  3VTY A;  5HI7 A;  3Q47 B;  2J9Q A;  4O6F A;  3ZPJ A;  5BW8 C;  3RO3 A;  4RG6 A;  3OXG A;  5ARG A;  3LKU A;  3TAX A;  1TJC A;  4WUY A;  2VGX A;  3JYS A;  4H7X A;  3ULQ A;  2LNI A;  3CK9 A;  1XNF A;  1QQE A;  4JA9 A;  2VQ2 A;  1KT1 A;  4BTA A;  4ME2 A;  3FP3 A;  3BEE A;  4UI9 K;  2XCC A;  4RG9 A;  4CGV A;  3O48 A;  4GA1 A;  2IFU A;  3CVQ A;  3UQ3 A;  4GZ5 A;  2DBA A;  2PZI A;  3Q5M A;  4W9R A;  4Y6C A;  3GW4 A;  4BTB A;  1YA0 A;  2XPI A;  5LCW C;  3EDT B;  3LCA A;  5M72 A;  2C2L A;  3S7J A;  3S7D A;  2PQR A;  4HOU A;  5ARF A;  2MHK A;  3ASD A;  1A17 A;  2PQN A;  5G05 C;  3RJV A;  2LSV A;  3Q4A B;  5KJN A;  2VSY A;  2Q7F A;  2VGX B;  4GA2 A;  3KD7 A;  3LPZ A;  3PDN A;  4I1A A;  4GZ3 A;  3UPV A;  1NZN A;  5JJ6 A;  4J8E A;  3MKR A;  1OUV A;  3MEK A;  4KBQ A;  2VGY A;  3MV2 B;  4JL0 A;  3K9I A;  3QWW A;  2PL2 A;  4HOQ A;  2WPV A;  4WNE A;  3QWV A;  1ZBP A;  4LEU A;  1WAO 1;  5FT9 A;  2GW1 A;  3Q49 B;  5EX0 A;  5FJY A;  4CGW A;  4AIF A;  4UI9 J;  2XCB A;  4GCN A;  1P5Q A;  1ELW A;  1W3B A;  4YVO A;  4GYW A;  5FZQ A;  3PE4 A;  4UQX A;  2KC7 A;  2KAT A;  2V5F A;  3FFL A;  3OXL A;  1WM5 A;  3R9A B;  4G24 A;  4APO A;  5DIZ A;  4AM9 A;  4I17 A;  3AS4 A;  1KLX A;  3KAE A;  2VYI A;  5BT1 A;  2R5S A;  4GYO A;  5G04 C;  1NA0 A;  3LY8 A;  1Y8M A;  3CVN A;  2C0M A;  4WNG A;  4XI0 A;  3NF1 A;  4IN3 B;  5BNW A;  3CKC A;  4YND A;  2I6H A;  3CKB A;  2Y4T A;  4WND A;  3AS5 A;  2HYZ A;  4N3A A; 
#chains in the Genus database with same CATH topology
 1HO8 A;  3SBS A;  4B94 A;  3SD5 A;  4ILG A;  2KBX A;  2X6K A;  2I9C A;  1Y6I A;  5FZR A;  1QZ2 A;  3J5Q B;  4UQZ A;  4LNB A;  4GZ6 A;  3ESK A;  4HNA D;  2QYU A;  4PS3 A;  1H6O A;  3L6A A;  4JHR A;  2XS1 A;  3GZS A;  3UXG A;  1NP7 A;  3CGH A;  3FHE A;  1Z3Y A;  3UI2 A;  1FCH A;  2JLB A;  5ENP D;  2OOE A;  1X5B A;  4G8L A;  2CG3 A;  4BWR A;  2R59 A;  1IKN D;  1HG2 A;  2J08 A;  2J8S D;  3Q15 A;  3L9T A;  3T5V A;  4A1S A;  4GTM A;  5CBO A;  1MX2 A;  3WXX A;  2VSX E;  3P1U A;  2GGF A;  2GRN B;  4JXT A;  2H6F A;  1N9A A;  3LJN A;  2BED A;  1OWO A;  1K8K G;  3AG4 E;  3WG7 E;  1E90 A;  3PNT B;  3MX3 A;  2C0L A;  2XHE A;  2WXQ A;  2AXZ A;  4B8C B;  2WB2 A;  3D9H A;  4NQ0 A;  5JJT A;  4M3O A;  4I2Z A;  2QYJ A;  1IQU A;  1NA3 A;  3ZXP A;  1EDU A;  4BX8 A;  3U4T A;  3UT4 A;  3D3M A;  2RFA A;  4BES A;  1WDY A;  3DBS A;  5D66 A;  3ASG A;  3CEQ A;  5JMN D;  2UY1 A;  4ABN A;  5AQA A;  1SA4 A;  3VLD A;  4BFR A;  3FUD A;  3GZ1 A;  3CQC B;  1TNO A;  1NFI E;  1EYH A;  3FUJ A;  3T8K A;  2HE0 A;  3EUV A;  3TG4 A;  2J49 A;  4FHK A;  4KVO A;  5FZS A;  1PC2 A;  3B7S A;  3CHR A;  3DEP A;  1WG0 A;  4JHJ A;  3DSS A;  4G8K A;  1A5E A;  4XKC A;  2LXM A;  2ILR A;  2J09 A;  4FLB A;  4HB5 A;  4AY5 A;  2L6B A;  4CT4 A;  4JD2 G;  1FT1 A;  5JJ7 A;  4U0Z A;  4G1T A;  5IY5 E;  5AEN A;  4LG6 A;  3R9M A;  3SQV A;  4OAV B;  1ZB1 A;  2UY1 B;  1JCQ A;  1YCS B;  4ACK A;  3ASN E;  4GMJ A;  1V54 E;  5AQ7 A;  2H6I A;  2WXR A;  3B7U X;  1DC2 A;  4J7W A;  2JEK A;  3UIO C;  2DWZ A;  2AWI A;  3T9K A;  3IEG A;  2XQ0 A;  2A4Z A;  2HM8 A;  2YHC A;  3OAW A;  4DI4 A;  4HI9 A;  4L23 A;  2GRR B;  2CHZ A;  3PZ3 A;  3ZFW A;  1OWL A;  2QZA A;  2FBN A;  5CHE E;  3B13 A;  4YDO A;  1FT2 A;  3U66 A;  3UM0 A;  4ANX A;  4WWP A;  3ZPJ A;  4O60 A;  3EIQ C;  2ETC A;  3RO3 A;  4A55 A;  1TNU A;  4EZJ A;  3D9N A;  3OXG A;  3VLF A;  2XEH A;  3BG0 B;  2VGX A;  2ZU6 B;  3Q73 A;  3HXB A;  1E7V A;  4JA9 A;  4MKT A;  3AG1 E;  1KPS B;  2OV8 A;  4J8S A;  5AJD A;  3LJ3 A;  2XCC A;  1BLX B;  3O48 A;  2VGE A;  2WXI A;  3BG1 B;  3C5R A;  1E8X A;  3HG0 D;  3CVQ A;  3V30 A;  4JHK A;  3PZ1 A;  4BTB A;  1H2V C;  5ENT D;  4C0E A;  5AIJ A;  3EDT B;  2V4L A;  3S7J A;  4F1S A;  2EIK E;  4D10 C;  3TWV A;  3AU4 A;  5ARF A;  4YDW A;  2R05 A;  2MHK A;  3HHM A;  3FU5 A;  3FTS A;  2XRY A;  3Q4A B;  5KJN A;  2Q7F A;  4KZC A;  2VGX B;  3HXE A;  3FH5 A;  3Q9U C;  3DSV A;  4TRQ A;  2I2O A;  3LPZ A;  3ZRH A;  4GZ3 A;  4QFV A;  5CMY A;  1N4S A;  3MEK A;  1K1A A;  4I1M A;  3C3Q A;  4FC8 A;  1HX8 A;  2AJA A;  3QB2 A;  5CRU A;  3K9I A;  3QWW A;  3I3N A;  3ABM E;  1SVX A;  3ENE A;  3SY2 A;  3QWV A;  1OCO E;  5FJY A;  3ML9 A;  4AIF A;  4UI9 J;  1ELW A;  5B1A E;  4U63 A;  3PH0 C;  4N5Q A;  3G2S A;  3DST A;  3SO8 A;  5FQ7 A;  3CIA A;  2JAB A;  2KC7 A;  3L16 A;  3KEZ A;  2Y0B G;  2EIL E;  3TWU A;  4AM9 A;  1BD8 A;  5D2M C;  3OTN A;  3AS4 A;  3KAE A;  4K5A B;  3FTV A;  5BT1 A;  1Q2Z A;  5BUZ A;  3LY8 A;  5ITZ F;  3C3R A;  4XI0 A;  3NF1 A;  5BNW A;  5JA4 D;  1E8Z A;  3ZKJ A;  3NB2 A;  3CV0 A;  2IU1 A;  3SFX A;  5CER B;  2IY0 C;  5CEC B;  2LSU A;  3RU0 A;  4KZ0 A;  3EHN A;  4FJZ A;  1N4Q A;  3LVQ E;  1LTX A;  1KZP A;  2WMN A;  4CRW A;  4GTS A;  4XZ4 A;  3APD A;  3IBE A;  3MJW A;  3RK6 A;  4UWH A;  5E75 A;  1OCR E;  4I9C A;  1IHB A;  3MA5 A;  5KJM A;  1O1T A;  4UWL A;  3EIJ A;  4FU3 A;  1ZU2 A;  1HS6 A;  2XEN A;  3PZ4 A;  4L7T A;  3UKR G;  1N52 A;  4RSY A;  2OVB A;  5G05 J;  3IV0 A;  4RVB A;  4WNF A;  3PUK A;  3S7B A;  3SBT B;  3L08 A;  3UKU G;  3ZN3 A;  2NSZ A;  3S7F A;  3UMV A;  2WXM A;  4G23 A;  4B93 B;  2KCK A;  4OYS A;  4WWN A;  2L6J A;  2HO1 A;  3TWT A;  1L5J A;  4TUM A;  1X81 A;  3ASH A;  3D9O A;  5C1D A;  3SZ7 A;  4H7Y A;  4UI9 C;  5EN5 D;  5G55 A;  1HG5 A;  2MOW A;  4V3I A;  3FEX A;  2H6H A;  4XE0 A;  4G2V A;  3CHO A;  3AG3 E;  5FIN A;  2IO3 C;  4E85 A;  4OVV A;  5KJL A;  2YQ8 A;  4U04 A;  2E2E A;  1TNZ A;  5KNG A;  3JXI A;  4HRM B;  4U0S A;  3UM2 A;  3FUL A;  2X38 A;  4FAD A;  4PUC A;  3B7T A;  4DI3 A;  1EPU A;  3MKQ A;  2CG2 A;  1D8E A;  4I6J A;  4JEH A;  5AQB A;  5G04 J;  5EX3 A;  1JUQ A;  5EIB E;  4J0U A;  4OAU C;  1ELR A;  4DX1 A;  3CK7 A;  3TJP A;  3T8M A;  5EYL A;  1PAQ A;  3CVP A;  2XGM A;  3P2B A;  2FUL A;  4F1P A;  3FTU A;  1JCS A;  3LEW A;  5LCW J;  4XX5 A;  3NOC D;  3HXC A;  2BUG A;  3LXU X;  1EF1 C;  4GTT A;  3OXF A;  2XEE A;  3F6Q A;  3L13 A;  3SI5 A;  3QAR A;  1RW2 A;  3UT7 A;  1OCC E;  4Y6W A;  4ACL A;  3ZNG A;  3FUE A;  3X2Q E;  1TN8 A;  2HR2 A;  4NUR A;  4CEM A;  2P2C P;  2WQH A;  3FWV A;  1S70 B;  3MKQ B;  1OY3 D;  4FHJ A;  4N3C A;  4BT8 A;  3R7R A;  3ZW3 A;  3EU5 A;  3SHF A;  5HQ8 A;  4HXI A;  1FVF A;  2DVW A;  2DYR E;  4ZHB A;  4BER A;  4CYM D;  3QC1 A;  3V2X A;  4AVX A;  1H2U A;  2CFU A;  5E76 A;  1DNP A;  1N0Q A;  2V8S E;  3VTY A;  1TNB A;  1TEZ A;  2J9Q A;  3TXN A;  4UWF A;  4JZY A;  4JPS A;  4BSZ B;  3DSW A;  4EEC A;  1LF8 A;  3TAX A;  4HLE A;  3ULQ A;  1HF8 A;  2LNI A;  1GW6 A;  4HRN A;  5AJL A;  3FU6 A;  2VQ2 A;  1UN8 A;  3BU8 A;  4BTA A;  3FP3 A;  4MS6 A;  4RG9 A;  2WXN A;  3EU9 A;  4U8Y D;  4CGV A;  3D9M A;  2GRM A;  4OVU A;  3UX4 A;  5H7P A;  2P9I G;  2CFZ A;  4A1G A;  3UQ3 A;  2DBA A;  4U96 D;  2WXK A;  3Q5M A;  3ZEF A;  2BKG A;  1OT8 A;  2R2L A;  2XPI A;  2EIJ E;  3CR3 A;  5LCW C;  4K5B A;  2C2L A;  2RFM A;  4R7L A;  3Q9N C;  3ABL E;  1H0A A;  5ENR D;  1S64 A;  4AOF A;  5LP0 A;  3C72 A;  1Z6T A;  3ASO E;  4WAF A;  3C3O A;  3ASD A;  1O1R A;  5ANR A;  1A17 A;  2PQN A;  3HDX A;  4FLH A;  3RSE G;  2QC9 A;  1IXV A;  1BI7 B;  4BY6 A;  4GA2 A;  1SQM A;  3I5P A;  4A3T A;  4I1A A;  4EZL A;  2WXF A;  1NZN A;  5T8I A;  4J8E A;  5J08 A;  3MKR A;  4TXR A;  3JUI A;  2FO1 E;  4GTO A;  1OUV A;  2ZXW E;  4HVB A;  4UWK A;  1INZ A;  3UT8 A;  2WXH A;  1U3D A;  4GTR A;  2I1K A;  2PL2 A;  3FTZ A;  3L82 A;  2X6I A;  4FA6 A;  3FUF A;  3CHP A;  4K0R A;  4LUN U;  3KSQ A;  4XEI G;  4IYP A;  3SFZ A;  5FT9 A;  4JB8 P;  2GW1 A;  3QJZ A;  3CST A;  2A5U A;  2XCB A;  5LFA A;  5CEA A;  4CCA A;  1P5Q A;  3E30 A;  4YVO A;  5ENS D;  3TWW A;  1O5M A;  2F0Y A;  2J4D A;  3EHQ A;  1AWC B;  4UQX A;  3T5X A;  2WXL A;  2BF0 X;  3OXL A;  4DX2 A;  1N94 A;  3HVE A;  3JXJ A;  5ENN A;  2VSO E;  4I17 A;  2CHX A;  2IQC A;  3UM3 A;  4U8V D;  2GRQ B;  2R5S A;  2YNQ A;  4JW1 A;  2CHW A;  5FQ6 A;  3JQ0 A;  2VTB A;  2R17 C;  3CVV A;  4WNG A;  4GPM A;  4MRU A;  2IJG X;  4ANU A;  1QBQ A;  2HYZ A;  2DIW A;  3NAW A;  3HIZ A;  4YDY A;  4N2Q A;  3RO2 A;  3MGB A;  5BV0 A;  4A3V A;  2KCL A;  4DRX E;  1Z3X A;  2Y69 E;  3GYZ A;  2FO7 A;  1N0R A;  4K03 A;  2XPY A;  4J8Y A;  1N95 A;  5FTP A;  3FUM A;  3ONK A;  4WWO A;  4C9B B;  1HH8 A;  4J8D A;  1BU9 A;  2OCC E;  3AS8 A;  3HYM B;  3HVE B;  3EJN A;  5CCL A;  4I2W A;  5AAR A;  4GCO A;  4CDM A;  2VTB B;  4HOR A;  1JCR A;  3FUI A;  2IF4 A;  2NC9 A;  2ZIR A;  2OND A;  3QKY A;  5HS0 A;  4GZC A;  4U8H A;  4YDE A;  2DZO A;  1N4R A;  2FF4 A;  2XZT G;  2KM4 A;  3FEY A;  3CLJ A;  3I4R B;  5ENQ D;  4LER A;  1UJJ A;  2Y1L E;  4BSX A;  3L54 A;  2WVI A;  4ATZ D;  4A63 B;  4GTP A;  4N5C A;  4U0U A;  3ZYM A;  1S63 A;  4HBD A;  1HXI A;  2DCP A;  2X6H A;  3ZVV A;  2L0I A;  2IO2 C;  4CT0 A;  4RLY A;  4LCT A;  2NXP A;  2OEW A;  1DVP A;  3PE3 A;  1K3Z D;  2VJ8 A;  3HXF A;  5EKQ D;  1E96 B;  1U3C A;  2RG8 A;  5DBK A;  5FIO A;  4B89 A;  3QK0 A;  1V55 E;  3DPD A;  3I4G A;  3URZ A;  2KCV A;  5EDS A;  3R7Q A;  5D0O D;  3IXE A;  2WXP A;  1HE8 A;  5KBA A;  2WXJ A;  3GZ2 A;  4RQI A;  3CSF A;  3PS6 A;  4G25 A;  4DLO A;  3CVY A;  4ATG A;  2P9P G;  4CDN A;  1H2T C;  2F8X K;  2FEZ A;  4KYO B;  2AXV A;  2AW6 A;  4AY6 A;  3TGO A;  2UWJ G;  3Q7A A;  4JA7 A;  3IHY A;  1IHG A;  4GYY A;  4ANV A;  3RAU A;  3CVW A;  3U64 A;  5AN8 A;  3DSX A;  3ZUV B;  4G26 A;  2M63 A;  2XGS A;  4J8F A;  3DSU A;  3N71 A;  2PM7 A;  5KNH D;  2FI7 A;  3ULY A;  1UJK A;  1TJF A;  3NZU A;  3TL5 A;  4CDR A;  3O4Z A;  1FPP A;  4I43 A;  2AXU A;  2J4B A;  2XGO A;  2WM9 A;  3UUX A;  4YVQ C;  4F7A A;  5BXO A;  3JUE A;  3KEA A;  1PY1 A;  1H19 A;  2GRP B;  2VSN A;  4O1O A;  1JPL A;  4UQY A;  3FH8 A;  3C98 A;  5T3R A;  4AXH A;  1JWG A;  3LY7 A;  2P9S G;  3FTW A;  3SF4 A;  5AYW D;  4UUC A;  3SGH A;  3U9W A;  2R02 A;  2V0P A;  2WMO A;  4TUU A;  3TWR A;  4GU5 A;  4F6R D;  4HOS A;  1D9S A;  5HI7 A;  1FVH A;  3Q47 B;  4O6F A;  5B1B E;  5BW8 C;  1UOH A;  3UIP C;  5ARG A;  2P9N G;  4EPZ A;  4H7X A;  3CK9 A;  1XNF A;  3RRN B;  3ZYK A;  4JC8 A;  3CVU A;  3TXM A;  5JHB A;  3FU3 A;  1KT1 A;  3DWL G;  4FUL A;  2WXG A;  1TN7 A;  4UI9 K;  1VDY A;  1RZ4 A;  3PVL A;  4GZ5 A;  4AEZ C;  2PZI A;  4L2Y A;  3MYV A;  4X8Q A;  3ISM C;  2KXP C;  1YA0 A;  3NZS A;  3QNK A;  4XKB A;  3LCA A;  3PZ2 A;  4APF A;  4Q96 A;  1BI8 B;  4PDX A;  3MCX A;  2BKK B;  4FP7 A;  3ML8 A;  4HOU A;  3ONL A;  1N54 A;  2EIM E;  5G05 C;  3RJV A;  3TWS A;  1UG3 A;  3HXD A;  5ENO D;  4ANW A;  3G2W A;  4HLL A;  3PDN A;  1LD7 A;  3B7R L;  1YMP A;  1E8W A;  3FU0 A;  3DRA A;  5FQ8 A;  5KCM A;  3PEV B;  5CBN A;  4KBQ A;  4ILI A;  5LOZ A;  2VGY A;  3G2T A;  3MV2 B;  3Q79 A;  5T4Y A;  5FWQ A;  4KVM A;  2WPV A;  3J5P A;  1G3N B;  1D8D A;  1K1B A;  2XS8 A;  4LEU A;  4LSZ E;  1S0P A;  2PNN A;  1WAO 1;  5EX0 A;  3FY4 A;  2R03 A;  2LXL A;  4EZK A;  5FZQ A;  3KSL A;  3PE4 A;  5AAO A;  3V31 A;  4MLP A;  2V5F A;  2KAT A;  3FFL A;  3FUH A;  5HKP A;  4GAA A;  3TWX A;  4APO A;  5DIZ A;  2MRI A;  4K5C A;  4HI8 A;  4I6G A;  4U95 D;  4P29 A;  1BPO A;  4I1O B;  1KLX A;  2VYI A;  3W9G A;  5G04 C;  1H6P A;  3AAA C;  3CVN A;  5EIL A;  4UWG A;  4Q94 A;  4IN3 B;  5BPP A;  3CKC A;  4YND A;  3AJI A;  4DJA A;  5BXU A;  4F53 A;  2OVF A;  3CHS A;  2E0I A;  3LDZ A;  4L1B A;  3ZYL A;  2IOL A;  3AS5 A;  2DZN A;  3B95 A;  4B8A A;  1SZA A;  3MZL B;  1IYG A;  2WXO A;  4M7C A;  5G2N A;  4N39 A;  1YYH A;  3LY9 A;  2LUH A;  3VLE A;  2X6F A;  2F8Y A;  4G11 A;  5J90 A;  4PS7 A;  4EBA G;  4BT9 A;  5BV1 A;  4N2S A;  4GTQ A;  1HU3 A;  3SFY A;  4MBG A;  5C2Y A;  4GB9 A;  1AP7 A;  4HS2 A;  3RIB A;  4EHM A;  4HRL A;  3PZD A;  1DCQ A;  4LNU D;  4DX5 D;  3L22 A;  4I9E A;  4TXQ A;  5A7D B;  3DPY A;  3KS2 A;  4GPK A;  2B0O E;  5LX8 A;  3CVX A;  2A5E A;  1OWP A;  4XIF A;  1MX6 A;  4HFG A;  3VTX A;  3CK8 A;  1OXJ A;  1ELK A;  4IRU A;  1MZC A;  3NOG D;  2GRO B;  3ESL A;  4NAC A;  3ZU7 B;  5D0Q D;  2P58 C;  1B89 A;  1IQR A;  4U7E B;  1MYO A;  2L0T B;  4N3B A;  5KWD A;  3NBN B;  5CCM A;  3D9P A;  2XRZ A;  4KXK B;  4JVS A;  1E8Y A;  3ZHE A;  3CQG B;  2EIN E;  3AG2 E;  4GA0 A;  4GTV A;  3S2A A;  3ZIM A;  2Y4U A;  2GRL A;  2MYO A;  1SW6 A;  4GZD A;  4ZFH A;  4DPR A;  4KT6 B;  3V79 K;  3CHM A;  3CVL A;  3PUJ A;  2L9B A;  1UN9 A;  2QFC A;  1QNF A;  4CZ2 D;  4AJW A;  2LAI A;  3ASF A;  5A6C A;  4L2L A;  4C48 B;  2V4H C;  3U3W A;  1MHQ A;  1MQS A;  3MV3 B;  2ZGG A;  3FTY A;  2RD0 A;  2XZD G;  3Q78 A;  4C0M A;  5CMW A;  1WY6 A;  2J07 A;  5AQ9 A;  5KJK A;  1MX4 A;  1TR4 A;  1TYQ G;  3RKV A;  3ZHE B;  3RRM B;  2YHE A;  3CHQ A;  5FQ4 A;  3PEU B;  2B6C A;  3LYA A;  5ANL A;  3E37 A;  3QWP A;  3Q75 A;  4HOT A;  1NI1 A;  4EQF A;  4U07 A;  2ION A;  4F3V A;  2F37 A;  3D9L A;  4XI9 A;  2X3M A;  3TG5 A;  4EBA A;  4L9P A;  3QOU A;  4NRH B;  3FTX A;  3HRA A;  1HZ4 A;  4DX7 D;  3ZGQ A;  2XEV A;  2LO6 A;  3RRU A;  3ZYQ A;  3FH7 A;  4BET A;  3Q7F A;  3UTM A;  4GML A;  3L17 A;  2KZT A;  2P9U G;  2Y3A A;  1O1S A;  1NL4 A;  3E4B A;  4J6I A;  4QQI A;  5B3S E;  5HRY A;  4BEP A;  1LD8 A;  1KT0 A;  5EYP F;  3NQP A;  1N11 A;  1XGW A;  3IHV A;  3QDN A;  2AVP A;  2EQX A;  2ZGD A;  3LS8 A;  4AV7 A;  1TN6 A;  2P9L G;  3DEO A;  3JQ1 A;  3PNL B;  4RG6 A;  3LKU A;  3ULE G;  2RKK A;  4E6H A;  1TJC A;  4WUY A;  2IEJ A;  2OEV A;  3DXM G;  3JYS A;  4ILH B;  1QQE A;  3G2U A;  3LVR E;  2ETA A;  4Q69 A;  3EHM A;  1N4P A;  2XPZ A;  3UM1 A;  3FDH A;  2P9K G;  4ME2 A;  2PM6 A;  1Z5S C;  3BEE A;  1KZO A;  1OWN A;  4AP2 A;  2QY7 A;  2ZIS A;  3FUN A;  3D9J A;  4GA1 A;  3B7B A;  2IFU A;  1JWF A;  4IUL A;  2KZT B;  4LRZ A;  1E7U A;  2DYS E;  3D9I A;  4NIK A;  3APC A;  4W9R A;  2H6G A;  4Y6C A;  3GW4 A;  4TXP A;  3W9F A;  3G2V A;  2IOS A;  5M72 A;  3E34 A;  3S7D A;  2PQR A;  4PH4 B;  3UIN C;  5A23 A;  4HQD A;  5CRV A;  3PRE A;  2WQ6 A;  2LSV A;  1SZ9 A;  4PS8 A;  2VSY A;  2BTD A;  1OWM A;  4URK A;  3KD7 A;  4JEU A;  2ETB A;  1SA5 A;  4KMO A;  3UPV A;  5JJ6 A;  3TWQ A;  4I6E A;  3JCK C;  3BQO A;  4DK5 A;  3IKO B;  4DUI A;  4JL0 A;  3EHR A;  3ABK E;  5CED B;  2X6J A;  4HOQ A;  5EID A;  2NYJ A;  4WNE A;  1UW4 B;  3DXK G;  4B0Z A;  2V5Q C;  1ZBP A;  3E32 A;  3D9K A;  4Z68 A;  1DCE A;  1QYM A;  3V2O A;  1TNY A;  2WQ7 A;  1U2V G;  3Q49 B;  4CGW A;  4TV3 A;  1MJ0 A;  4BX9 A;  4GCN A;  4LNG A;  4FJY A;  3SNX A;  1W3B A;  2YIN A;  4GYW A;  3APF A;  3QAQ A;  1OCZ E;  4O1P A;  3BUA A;  4DX6 D;  1WM5 A;  4GMR A;  3R9A B;  4G24 A;  4DLQ A;  1HFA A;  3E33 A;  3AU5 A;  3PRZ A;  4GYO A;  1NA0 A;  1Y8M A;  2C0M A;  3ZXS A;  5JHA A;  2I1J A;  2LAH A;  2I6H A;  3CKB A;  2Y4T A;  3FUK A;  4WND A;  1H6K A;  4N3A A; 
#chains in the Genus database with same CATH homology
 3CV0 A;  4N2Q A;  1HO8 A;  3SBS A;  2IU1 A;  4B94 A;  3SD5 A;  4B8A A;  1SZA A;  3MZL B;  4ILG A;  3MGB A;  3RO2 A;  1IYG A;  2WXO A;  5BV0 A;  4A3V A;  2LSU A;  2KCL A;  2X6K A;  4KZ0 A;  2I9C A;  3EHN A;  4FJZ A;  5G2N A;  4N39 A;  3RU0 A;  3LY9 A;  3LVQ E;  1Y6I A;  5FZR A;  1QZ2 A;  1Z3X A;  4UQZ A;  3VLE A;  2X6F A;  2WMN A;  3GYZ A;  4GZ6 A;  4CRW A;  3ESK A;  4XZ4 A;  2FO7 A;  3APD A;  3IBE A;  3MJW A;  4G11 A;  3RK6 A;  4UWH A;  4PS3 A;  5E75 A;  4I9C A;  5J90 A;  4PS7 A;  4K03 A;  2XPY A;  4EBA G;  4BT9 A;  3MA5 A;  5FTP A;  5BV1 A;  3L6A A;  4JHR A;  1HU3 A;  4UWL A;  3FUM A;  5KJM A;  3EIJ A;  4FU3 A;  1ZU2 A;  3ONK A;  4WWO A;  5C2Y A;  1HS6 A;  3GZS A;  4C9B B;  4GB9 A;  4L7T A;  1HH8 A;  1NP7 A;  3CGH A;  3FHE A;  4J8D A;  3AS8 A;  4HS2 A;  3RIB A;  1Z3Y A;  1N52 A;  3HVE B;  3HYM B;  2OVB A;  4RSY A;  1FCH A;  5G05 J;  2JLB A;  3IV0 A;  3PZD A;  4RVB A;  2OOE A;  4WNF A;  1X5B A;  3PUK A;  3EJN A;  3S7B A;  2CG3 A;  5CCL A;  4BWR A;  4I2W A;  4GCO A;  2R59 A;  3L22 A;  4I9E A;  4CDM A;  3SBT B;  5A7D B;  3KS2 A;  3L08 A;  2VTB B;  4HOR A;  1HG2 A;  2J08 A;  3FUI A;  3Q15 A;  3ZN3 A;  2IF4 A;  5LX8 A;  3T5V A;  4GPK A;  3CVX A;  4XIF A;  1OWP A;  2NC9 A;  4A1S A;  2NSZ A;  3S7F A;  4HFG A;  3UMV A;  2WXM A;  3VTX A;  3CK8 A;  1ELK A;  2OND A;  4G23 A;  3QKY A;  2KCK A;  3WXX A;  4IRU A;  4GZC A;  4OYS A;  4WWN A;  4U8H A;  2L6J A;  2VSX E;  3P1U A;  2GGF A;  2HO1 A;  3ESL A;  2FF4 A;  4NAC A;  4JXT A;  2KM4 A;  3FEY A;  5D0Q D;  2P58 C;  3CLJ A;  1B89 A;  1IQR A;  1L5J A;  2L0T B;  3I4R B;  4N3B A;  1OWO A;  4LER A;  1UJJ A;  3ASH A;  5CCM A;  3D9O A;  4BSX A;  5C1D A;  3L54 A;  1E90 A;  3SZ7 A;  3D9P A;  2WVI A;  3PNT B;  4H7Y A;  4UI9 C;  3MX3 A;  2C0L A;  2XHE A;  2WXQ A;  2AXZ A;  5G55 A;  2XRZ A;  4B8C B;  2WB2 A;  1HG5 A;  4KXK B;  4NQ0 A;  4JVS A;  5JJT A;  4N5C A;  4U0U A;  2MOW A;  3ZYM A;  4V3I A;  4M3O A;  1E8Y A;  4I2Z A;  3CQG B;  3ZHE A;  1IQU A;  1HXI A;  3FEX A;  1NA3 A;  2DCP A;  2X6H A;  3ZVV A;  2L0I A;  1EDU A;  4BX8 A;  4CT0 A;  4LCT A;  2NXP A;  4XE0 A;  4G2V A;  3U4T A;  3UT4 A;  1DVP A;  3CHO A;  4GA0 A;  5HQ8 A;  3S2A A;  3PE3 A;  3D3M A;  2VJ8 A;  3ZIM A;  4E85 A;  2Y4U A;  4OVV A;  5EKQ D;  1E96 B;  1U3C A;  2RG8 A;  2GRL A;  3DBS A;  5KJL A;  2YQ8 A;  5DBK A;  3ASG A;  3CEQ A;  4GZD A;  4U04 A;  4DPR A;  4KT6 B;  2E2E A;  4B89 A;  3QK0 A;  2UY1 A;  4ABN A;  3CHM A;  3CVL A;  3VLD A;  4BFR A;  3FUD A;  3GZ1 A;  3CQC B;  3DPD A;  3I4G A;  3PUJ A;  2L9B A;  3URZ A;  1UN9 A;  2KCV A;  4U0S A;  2QFC A;  3FUL A;  1QNF A;  2X38 A;  4AJW A;  4FAD A;  1EYH A;  2LAI A;  5EDS A;  3FUJ A;  4PUC A;  3ASF A;  3B7T A;  5A6C A;  3R7Q A;  4DI3 A;  5D0O D;  1EPU A;  3MKQ A;  4L2L A;  2WXP A;  1HE8 A;  2CG2 A;  3U3W A;  2WXJ A;  3GZ2 A;  3TG4 A;  2J49 A;  1MHQ A;  3CSF A;  4FHK A;  4I6J A;  4KVO A;  1PC2 A;  3PS6 A;  4JEH A;  1MQS A;  3B7S A;  4G25 A;  5FZS A;  4DLO A;  3MV3 B;  5G04 J;  4ATG A;  3CVY A;  3CHR A;  3FTY A;  1JUQ A;  5EX3 A;  2RD0 A;  4J0U A;  1ELR A;  3CK7 A;  3TJP A;  3T8M A;  1H2T C;  4CDN A;  2FEZ A;  4JHJ A;  4KYO B;  2AXV A;  2AW6 A;  1PAQ A;  4C0M A;  5CMW A;  4AY6 A;  3TGO A;  3CVP A;  1WY6 A;  2J07 A;  2XGM A;  3P2B A;  2UWJ G;  2FUL A;  4JA7 A;  5KJK A;  4XKC A;  3FTU A;  3IHY A;  1IHG A;  3LEW A;  5LCW J;  4XX5 A;  4GYY A;  2ILR A;  3RKV A;  4ANV A;  2J09 A;  3ZHE B;  4FLB A;  3CVW A;  3U64 A;  2BUG A;  3RRM B;  2YHE A;  3LXU X;  4AY5 A;  4G26 A;  3CHQ A;  5FQ4 A;  1EF1 C;  2M63 A;  4CT4 A;  3OXF A;  3PEU B;  2XGS A;  3LYA A;  5ANL A;  3L13 A;  4J8F A;  3N71 A;  3SI5 A;  3QAR A;  2PM7 A;  3QWP A;  5JJ7 A;  3UT7 A;  4Y6W A;  4HOT A;  4U0Z A;  4G1T A;  2FI7 A;  4U07 A;  4EQF A;  1UJK A;  4ACL A;  5AEN A;  1TJF A;  3NZU A;  2ION A;  4F3V A;  3TL5 A;  4CDR A;  3O4Z A;  3D9L A;  3FUE A;  2AXU A;  2UY1 B;  4I43 A;  2J4B A;  4XI9 A;  4ACK A;  4GMJ A;  2XGO A;  2X3M A;  2WM9 A;  3TG5 A;  4EBA A;  3UUX A;  3QOU A;  4NRH B;  2HR2 A;  2WXR A;  3FTX A;  4NUR A;  4YVQ C;  4CEM A;  1HZ4 A;  3B7U X;  2WQH A;  3ZGQ A;  2XEV A;  2LO6 A;  3FWV A;  3MKQ B;  4FHJ A;  3RRU A;  4F7A A;  4N3C A;  3ZYQ A;  2JEK A;  3FH7 A;  4BT8 A;  1PY1 A;  3R7R A;  1H19 A;  2VSN A;  4GML A;  3L17 A;  1JPL A;  4UQY A;  2AWI A;  3ZW3 A;  3FH8 A;  3C98 A;  3IEG A;  3SHF A;  2XQ0 A;  4HXI A;  2KZT A;  1FVF A;  5T3R A;  2A4Z A;  1JWG A;  2HM8 A;  2YHC A;  2Y3A A;  3LY7 A;  4AXH A;  3E4B A;  3OAW A;  4DI4 A;  4J6I A;  3FTW A;  3SF4 A;  5AYW D;  4L23 A;  3QC1 A;  4AVX A;  2CHZ A;  1H2U A;  3SGH A;  2CFU A;  3U9W A;  3ZFW A;  1KT0 A;  1DNP A;  1OWL A;  2V0P A;  2WMO A;  2V8S E;  5E76 A;  2FBN A;  3NQP A;  4TUU A;  5CHE E;  3B13 A;  4GU5 A;  1XGW A;  4HOS A;  3IHV A;  3U66 A;  3QDN A;  4ANX A;  2AVP A;  3VTY A;  2EQX A;  5HI7 A;  1FVH A;  3Q47 B;  1TEZ A;  2J9Q A;  3TXN A;  4O6F A;  4WWP A;  3ZPJ A;  3LS8 A;  4UWF A;  4JZY A;  5BW8 C;  3EIQ C;  4AV7 A;  4JPS A;  3RO3 A;  4A55 A;  4EZJ A;  3PNL B;  3JQ1 A;  3D9N A;  4RG6 A;  3OXG A;  3VLF A;  5ARG A;  4EEC A;  3LKU A;  1LF8 A;  3TAX A;  4HLE A;  4E6H A;  1TJC A;  3BG0 B;  2VGX A;  2ZU6 B;  4WUY A;  4EPZ A;  3JYS A;  4H7X A;  3ULQ A;  1HF8 A;  2LNI A;  1GW6 A;  1XNF A;  3CK9 A;  4ILH B;  1QQE A;  5AJL A;  3RRN B;  1E7V A;  3FU6 A;  3ZYK A;  4JA9 A;  4JC8 A;  3CVU A;  3G2U A;  3LVR E;  3TXM A;  4Q69 A;  3EHM A;  3FU3 A;  5JHB A;  2VQ2 A;  1UN8 A;  1KT1 A;  2XPZ A;  3FDH A;  4FUL A;  4MKT A;  4BTA A;  4ME2 A;  2WXG A;  2OV8 A;  2PM6 A;  3BEE A;  3FP3 A;  4J8S A;  4MS6 A;  5AJD A;  1OWN A;  4AP2 A;  2QY7 A;  4UI9 K;  3LJ3 A;  2XCC A;  4RG9 A;  2WXN A;  3FUN A;  4CGV A;  3D9M A;  3O48 A;  2GRM A;  4OVU A;  3D9J A;  2WXI A;  3UX4 A;  3BG1 B;  1VDY A;  4GA1 A;  1E8X A;  2CFZ A;  2IFU A;  4A1G A;  1JWF A;  4IUL A;  3CVQ A;  3PVL A;  2KZT B;  4LRZ A;  1E7U A;  3UQ3 A;  4GZ5 A;  2DBA A;  2WXK A;  3D9I A;  4AEZ C;  2PZI A;  3Q5M A;  4L2Y A;  3APC A;  4JHK A;  3MYV A;  4W9R A;  3ZEF A;  4Y6C A;  3GW4 A;  4BTB A;  1H2V C;  1YA0 A;  3G2V A;  2XPI A;  4C0E A;  3CR3 A;  3NZS A;  3QNK A;  5AIJ A;  2IOS A;  4XKB A;  3EDT B;  3LCA A;  5LCW C;  4APF A;  5M72 A;  2C2L A;  2V4L A;  3S7J A;  4Q96 A;  4R7L A;  4F1S A;  4PDX A;  3S7D A;  2PQR A;  4PH4 B;  5A23 A;  1H0A A;  4D10 C;  3MCX A;  3AU4 A;  4FP7 A;  3ML8 A;  4AOF A;  5LP0 A;  4HOU A;  1Z6T A;  4WAF A;  5ARF A;  3ONL A;  1N54 A;  2MHK A;  3ASD A;  3PRE A;  3HHM A;  5ANR A;  2WQ6 A;  1A17 A;  2PQN A;  5G05 C;  3RJV A;  2LSV A;  3FU5 A;  1SZ9 A;  3FTS A;  2XRY A;  3Q4A B;  2VSY A;  3HDX A;  1UG3 A;  4FLH A;  2BTD A;  4PS8 A;  5KJN A;  2Q7F A;  4KZC A;  4N3A A;  4BY6 A;  2VGX B;  4GA2 A;  3FH5 A;  1OWM A;  4ANW A;  4URK A;  3G2W A;  1SQM A;  2I2O A;  3KD7 A;  4TRQ A;  3LPZ A;  4JEU A;  3ZRH A;  3I5P A;  3PDN A;  4A3T A;  3B7R L;  4I1A A;  4EZL A;  4KMO A;  4GZ3 A;  2WXF A;  3UPV A;  1NZN A;  5JJ6 A;  5T8I A;  4J8E A;  5J08 A;  3MKR A;  4QFV A;  3JUI A;  1E8W A;  3FU0 A;  4N2S A;  5FQ8 A;  5KCM A;  1OUV A;  5CMY A;  3PEV B;  3MEK A;  3JCK C;  4I6E A;  4ILI A;  4KBQ A;  4I1M A;  5LOZ A;  2VGY A;  3G2T A;  4HVB A;  4FC8 A;  4UWK A;  1HX8 A;  1INZ A;  4DK5 A;  3IKO B;  3MV2 B;  3UT8 A;  2WXH A;  1U3D A;  4JL0 A;  3QB2 A;  5T4Y A;  5FWQ A;  4KVM A;  3K9I A;  3QWW A;  2X6J A;  2I1K A;  2PL2 A;  3FTZ A;  3I3N A;  2WPV A;  4HOQ A;  2X6I A;  4WNE A;  1UW4 B;  4FA6 A;  4B0Z A;  3ENE A;  3FUF A;  3CHP A;  3QWV A;  4K0R A;  4LUN U;  1ZBP A;  3D9K A;  4IYP A;  3SFZ A;  4LEU A;  1S0P A;  1WAO 1;  5FT9 A;  2WQ7 A;  2GW1 A;  3Q49 B;  5EX0 A;  5FJY A;  4CGW A;  3QJZ A;  3CST A;  4TV3 A;  3ML9 A;  3FY4 A;  4AIF A;  4UI9 J;  4BX9 A;  2A5U A;  2XCB A;  5LFA A;  4CCA A;  4GCN A;  1P5Q A;  1ELW A;  4FJY A;  3SNX A;  1W3B A;  4YVO A;  2YIN A;  4GYW A;  3APF A;  3QAQ A;  4U63 A;  3PH0 C;  2J4D A;  4EZK A;  5FZQ A;  3G2S A;  3PE4 A;  4UQX A;  4MLP A;  5FQ7 A;  3CIA A;  3T5X A;  2WXL A;  2KC7 A;  2KAT A;  2V5F A;  3FFL A;  3L16 A;  2BF0 X;  3KEZ A;  3OXL A;  3FUH A;  1WM5 A;  4GAA A;  3R9A B;  4G24 A;  4APO A;  5DIZ A;  4DLQ A;  2MRI A;  1HFA A;  4AM9 A;  3HVE A;  4I6G A;  4P29 A;  1BPO A;  5ENN A;  2VSO E;  3OTN A;  3AS4 A;  2CHX A;  4I17 A;  4I1O B;  3AU5 A;  2IQC A;  1KLX A;  3KAE A;  2VYI A;  3FTV A;  3PRZ A;  5BT1 A;  2R5S A;  2YNQ A;  4GYO A;  4JW1 A;  2CHW A;  5FQ6 A;  5G04 C;  3JQ0 A;  2VTB A;  1NA0 A;  5BUZ A;  3LY8 A;  1Y8M A;  2R17 C;  3CVN A;  3CVV A;  2C0M A;  3ZXS A;  4UWG A;  4WNG A;  4XI0 A;  4Q94 A;  3NF1 A;  4IN3 B;  5JHA A;  5BNW A;  5BPP A;  2I1J A;  2LAH A;  3CKC A;  4YND A;  2I6H A;  3CKB A;  2OVF A;  4MRU A;  4DJA A;  4F53 A;  3CHS A;  2E0I A;  2Y4T A;  2IJG X;  3LDZ A;  3FUK A;  4L1B A;  3ZYL A;  4WND A;  4ANU A;  2IOL A;  3AS5 A;  1E8Z A;  2HYZ A;  2DIW A;  1H6K A;  3HIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...