1MX6A

Structure of p18ink4c (f92n)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
WGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLENQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle inhibitor
molecule keywords Cyclin-dependent kinase 6 inhibitor
publication title Structure-based design of p18INK4c proteins with increased thermodynamic stability and cell cycle inhibitory activity
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1mx6A00
4HLLA 4U95D 4CZ2D 5EIBE 3NBNB 5AQBA 2B0OE 3SO8A 5BXUA 1K3ZD 3TWQA 2QYJA 4YDYA 3V31A 2XZTG 5JMND 1OT8A 3V2OA 3T8KA 1S70B 3TWWA 1MX6A 4N5QA 2F8XK 2J8SD 3V2XA 4OAUC 2F37A 4ZFHA 2XENA 4HNAD 4BERA 2ETAA 3ZNGA 2DVWA 1DCQA 1MJ0A 4J8YA 1IKND 2QC9A 4UUCA 4YDWA 4DX6D 5HRYA 1IXVA 3HRAA 4GMRA 5D66A 5ENTD 3V79K 5BXOA 5AAOA 3JXIA 5EYPF 4C48B 3DEPA 4F1PA 1BLXB 2XEHA 4DUIA 5CBOA 1A5EA 1YCSB 5CEAA 3UTMA 3TWRA 3UI2A 1N0QA 3KEAA 2XEEA 3ZKJA 3TWXA 4DX5D 5ENOD 4U8YD 1G3NB 5CECB 5KNGA 3IXEA 5FINA 3ZUVB 4G8LA 5JA4D 1TR4A 3J5PA 4HQDA 2A5EA 1OY3D 2P2CP 4U8VD 1NFIE 5ITZF 4HI8A 4RLYA 1YYHA 5FIOA 3B95A 1K1AA 4LG6A 4OAVB 5CERB 2ETCA 4K5AB 4ATZD 2Y1LE 2ZGGA 3AAAC 4JB8P 2DZNA 2KXPC 1BI8B 1N11A 1BD8A 3TWVA 2KBXA 3W9GA 4O60A 3D9HA 2MYOA 2F8YA 4GPMA 4HRLA 4DX1A 1MX4A 4F6RD 3T9KA 5AQAA 2RFMA 3UXGA 4K5BA 2VGEA 5HS0A 5KNHD 4BESA 2RFAA 2PNNA 4J7WA 1SW6A 4HB5A 5ENSD 5HKPA 2DWZA 5AQ7A 3TWSA 1QYMA 4LSZE 5CBNA 5KWDA 1WDYA 4BSZB 1UOHA 1WG0A 2NYJA 3NOCD 1IHBA 4HRMB 3EU9A 3TWTA 4CYMD 3HG0D 4LNUD 3B7BA 3Q9NC 4HBDA 4A63B 3Q9UC 1MX2A 1D9SA 4BEPA 2Y0BG 5CEDB 3F6QA 4DX2A 5EILA 2BKKB 5ENQD 4B93B 3W9FA 5ENRD 3J5QB 2ETBA 5ENPD 3TWUA 1K1BA 2DZOA 4HI9A 4K5CA 4TUMA 4DX7D 1MYOA 4QFVA 3AJIA 2FO1E 1YMPA 4O1PA 5EN5D 1AWCB 2ZGDA 2BKGA 2V5QC 3EHRA 3JXJA 4QQIA 4G8KA 4Z68A 3ZU7B 2XZDG 3JUEA 3V30A 2L6BA 4HRNA 5AQ9A 4ZHBA 1SVXA 4NIKA 1DC2A 5KBAA 5EYLA 3DEOA 1BI7B 2JABA 2AJAA 4BETA 1AP7A 1BU9A 5AARA 3LJNA 3EHQA 3NOGD 5AN8A 2V4HC 5EIDA 4DRXE 3C5RA 4O1OA 2HE0A 4U96D 1N0RA
chains in the Genus database with same CATH superfamily
3U64A 3I5PA 3ZIMA 3RIBA 5FTPA 3UM1A 3C3OA 2X6KA 5ARGA 3I4RB 4GYOA 3VLDA 2A4ZA 4L2YA 2BF0X 2R59A 4NQ0A 3OTNA 3ZN3A 4L9PA 4I9EA 1HXIA 5AYWD 2AXZA 4EHMA 3ENEA 1H0AA 3LY9A 1QZ2A 3Q75A 4HI8A 3R7RA 3CQGB 5EDSA 1LD7A 3G2UA 4K5AB 4W9RA 1KZPA 5LX8A 1OWPA 1HX8A 2J9QA 2I1JA 4TV3A 2VGEA 3RRNB 2J4BA 3D9LA 4CDNA 1SW6A 1TNYA 4HB5A 2UWJG 3PDNA 1PAQA 1WG0A 1H6PA 4HBDA 2WXNA 3PZ3A 4UQYA 3HXCA 5D0OD 4EZKA 5JHAA 3BEEA 3AJIA 3UKUG 4N5CA 5EN5D 3CVLA 1SVXA 2XS1A 4KXKB 4X8QA 3DEOA 3FTVA 4CEMA 4DJAA 4H7YA 4EECA 2ILRA 5EIDA 4RG6A 4DRXE 4GB9A 3SBSA 4AV7A 5LCWC 3ZYQA 1DVPA 1HO8A 5EIBE 4GYYA 4LNGA 1ZU2A 1K3ZD 4LNBA 4JZYA 2GRRB 3KD7A 2QYJA 2M63A 2CHXA 3T8KA 4ANVA 3DSWA 2WXLA 3ZHEA 3HRAA 3PNLB 5D66A 2WXHA 4N3BA 4J6IA 5CBOA 2WXFA 3PUKA 4WNEA 3QARA 2WQ7A 2L0IA 1DCEA 4TXPA 3ZYKA 1TR4A 4JHKA 2VGXB 3QWPA 4HQDA 4LRZA 4BT8A 1YYHA 3G2WA 3D9JA 3VTXA 3APCA 2H6GA 1LD8A 4JL0A 3LPZA 4YDOA 2YHCA 4O60A 3D9HA 4N2SA 5KNHD 3GYZA 3S7BA 1VDYA 2DWZA 3OXGA 4BSZB 3SI5A 4PS3A 3ABKE 3FUFA 3EIJA 5CMYA 3SF4A 2LO6A 1H2VC 2MRIA 1YMPA 1A5EA 3EHRA 5G04J 3JUEA 4ATGA 4N3AA 1O1SA 5H7PA 3R9MA 2I6HA 5ANRA 2VTBA 2VSNA 3NOGD 4XEIG 2RG8A 2DCPA 3UIOC 3APDA 3MGBA 2P58C 1FT1A 3MV2B 4BTBA 2WXKA 1EYHA 4TXRA 4HNAD 3C98A 1IKND 4YNDA 5G2NA 3D9NA 4WNDA 1TNUA 1S0PA 4ILHB 3RK6A 5FZQA 3UI2A 4GTTA 3SGHA 4G8LA 3J5PA 4U8VD 4BX9A 5JJ7A 3PE4A 2PM6A 3E34A 4A3TA 3RU0A 3T9KA 4I1OB 4A1SA 4U0ZA 4AP2A 5KWDA 1GW6A 5BW8C 3HG0D 1UN8A 2WXQA 3Q9UC 3FTZA 2KCVA 4DX2A 4B93B 3ZYLA 1O1RA 2LSUA 3Q5MA 3EDTB 4C0EA 2F0YA 3FH7A 1E8ZA 3ZU7B 1L5JA 4OVVA 3C3QA 2R17C 1A17A 4G11A 1E8WA 4KZ0A 2IJGX 3AG2E 2WMNA 4G24A 1KPSB 2QFCA 4G2VA 3E30A 5C1DA 5JMND 3BG1B 5E75A 1MX6A 2VYIA 2F8XK 3FU6A 2BTDA 3AG4E 3ZNGA 2LAIA 4U63A 2P9SG 2IEJA 3R7QA 4C48B 3DXMG 3ZGQA 1ZBPA 3KEAA 3OXFA 4MRUA 2QYUA 3ASGA 1N95A 5JA4D 3FULA 1WAO1 4R7LA 3NQPA 2P9UG 4HOQA 2WXJA 4ACKA 1N54A 4HORA 3B7UX 3ESKA 1SA4A 3EUVA 2DZNA 3UUXA 3U3WA 3B13A 4U04A 1HE8A 3PNTB 3W9GA 3TAXA 3UT4A 3VLEA 5HKPA 2R03A 3MJWA 2NYJA 1FVHA 4M3OA 4EZJA 2XRZA 3FU5A 3J5QB 1H6OA 3UM2A 1OCOE 2C0LA 4FHKA 4WAFA 2XZDG 4ZHBA 1KLXA 1SQMA 1Z3YA 4CDRA 3LCAA 4OVUA 4GTOA 5AARA 3R9AB 3EHQA 2YQ8A 4AM9A 2ZISA 2MHKA 4EBAA 3MEKA 5G55A 3KEZA 2XCCA 5BXUA 4TUUA 1OWNA 2Y3AA 3SBTB 4UI9K 5JHBA 3Q4AB 2J49A 3RRUA 1FCHA 1BLXB 2XEHA 2I9CA 5LFAA 2LNIA 4UI9J 4HOUA 3UM3A 2EIME 3CVXA 3B95A 4IYPA 1O1TA 2Y1LE 1X5BA 1HG5A 2XRYA 2HR2A 3ML9A 3ISMC 1HS6A 2F8YA 2ONDA 4F6RD 5AQAA 2WB2A 3FY4A 2PNNA 3APFA 5LOZA 1OWOA 3AS5A 3EIQC 3D3MA 2WQ6A 3FUKA 3TWTA 2GRPB 4J8FA 3Q9NC 1V55E 2R2LA 3HDXA 2IY0C 3F6QA 3SQVA 4PDXA 3W9FA 4WUYA 2DZOA 1TNZA 4EPZA 3QJZA 1N94A 3JXJA 4G8KA 5CRVA 4JEHA 2NSZA 4J0UA 1V54E 3BQOA 3ABME 4NACA 1QQEA 4GTRA 2C2LA 5ENSD 4CT0A 3HXDA 3UQ3A 3E33A 3CHQA 4JHJA 5T3RA 4BERA 2DVWA 4J8DA 1E90A 2RD0A 1W3BA 3MYVA 3CHRA 1LTXA 3CK8A 4JC8A 1OY3D 1QBQA 2CG2A 3Q47B 5A7DB 4J8EA 2IO2C 3RKVA 4U8HA 3JCKC 5FWQA 4HOTA 3CEQA 2DBAA 2VQ2A 5AIJA 4XE0A 4F53A 1H6KA 1Z5SC 3DPYA 2I1KA 1BPOA 4CRWA 1X81A 4J7WA 2XCBA 1JWGA 3RO2A 3FHEA 5FZSA 2KCKA 2ZIRA 5DIZA 2A5UA 4ABNA 4HRMB 3FP3A 2XGOA 2Y0BG 3QK0A 4K5CA 3U4TA 3QNKA 3Q78A 3SFZA 5D0QD 5BNWA 1TNBA 4M7CA 4CGVA 2JABA 3TGOA 2J07A 3NB2A 4BTAA 2KZTB 4GZ5A 2V4HC 5BPPA 4FLHA 2HM8A 3T5VA 5KJKA 1SZAA 5EX3A 3X2QE 3ZPJA 2F37A 2VGYA 4L23A 1SZ9A 1TN6A 4FULA 1U3CA 1HFAA 1DNPA 4U0UA 2EQXA 3UTMA 1TN8A 2LXMA 5B3SE 1OCRE 1PC2A 3C72A 1G3NB 4G26A 4PUCA 3IXEA 3OXLA 3CHPA 1TJFA 4JD2G 1H2TC 4MLPA 2PZIA 4ATZD 3DSUA 2H6HA 2UY1A 4Y6CA 1UG3A 1H19A 3FEYA 2XS8A 2RFAA 3GZ1A 3LYAA 3MV3B 5M72A 4KT6B 3SD5A 1N4SA 4FJZA 1TEZA 2JLBA 4HVBA 1E7VA 4GCOA 4URKA 5BUZA 4K0RA 1MHQA 1QNFA 4A3VA 3S7FA 1AWCB 5ITZF 4TXQA 1JCRA 1BI7B 3RO3A 2CHWA 5CCMA 4K03A 1OXJA 4GTQA 3C3RA 1Z6TA 4L2LA 2X6JA 3UT8A 1Q2ZA 4FP7A 2X6FA 4BT9A 4FA6A 3PEVB 4KYOB 3LVQE 1B89A 3L22A 2GRLA 5HRYA 5ENTD 4GMLA 4O6FA 2LAHA 3ULYA 1JCSA 4F1PA 2I2OA 3HYMB 4BFRA 5EX0A 4LEUA 3HVEB 4GA2A 2AVPA 3U9WA 3L6AA 3NAWA 3UMVA 5ENNA 1OUVA 4LERA 1E96B 1OCZE 2OEWA 3ZEFA 2WXRA 3NZSA 2WMOA 2ZU6B 2P2CP 3AU4A 3CKBA 4JXTA 3FUDA 3EU5A 2EIJE 4XKCA 2V5FA 2AXUA 2KBXA 3FH5A 4BESA 4J8SA 5AQ7A 4KVOA 1IQUA 3ABLE 3NOCD 4CYMD 4HS2A 4RG9A 5EILA 2ETBA 2BEDA 2PQRA 3FUMA 4FHJA 2H6FA 2FO1E 1H2UA 3CSFA 4GA0A 4BY6A 3RAUA 2IOSA 4CT4A 4HRNA 2FEZA 3CIAA 2LXLA 4KVMA 2GW1A 2XQ0A 3QOUA 5AJLA 1BU9A 2R5SA 2XEVA 4I9CA 1TJCA 2KM4A 4KBQA 2KATA 3DSXA 2WVIA 3CV0A 3LXUX 3RSEG 2X6HA 1HU3A 4KZCA 3HXEA 2QY7A 3KAEA 3BU8A 1RZ4A 4XI0A 2H6IA 3OAWA 4GYWA 4AIFA 4I43A 2HO1A 4GTPA 4HLEA 1SA5A 2XPIA 4JA9A 3Q79A 3FEXA 2XHEA 4DLOA 4C9BB 1NFIE 1N9AA 5JJTA 4F1SA 4UWKA 2ZGGA 1FVFA 3JQ0A 4LCTA 1BI8B 3AS4A 3ASNE 3TWVA 4IRUA 4I2ZA 2L9BA 1U2VG 4DI3A 2OVBA 3UXGA 3RRMB 2FF4A 4U0SA 2IOLA 3DSVA 3CHSA 5J08A 4LNUD 3ZRHA 1JCQA 2OCCE 2BKKB 4ANUA 4ME2A 5ENQD 3QKYA 1S64A 5ENPD 3URZA 1NL4A 2WQHA 1N4RA 4AEZC 2ZGDA 4BX8A 3V30A 4WNGA 1JPLA 4YVOA 3AS8A 4RVBA 5JJ6A 2VJ8A 3GZSA 4U96D 1WY6A 4U95D 4NRHB 3CQCB 3TWQA 1P5QA 2DIWA 4E85A 1WM5A 3ZHEB 1KT0A 3SY2A 3ONKA 1TN7A 4J8YA 4DX6D 2J4DA 3V79K 3U66A 3D9OA 5CEAA 3L82A 3ZKJA 3I3NA 5CECB 3JYSA 2WXIA 2ZXWE 4FJYA 4GZCA 3QDNA 2FULA 1E8YA 4CCAA 4B89A 2VGXA 3MKRA 3ASOE 2YHEA 4I17A 2ETCA 3T5XA 3PH0C 1K8KG 2OOEA 3FU3A 4JVSA 2RKKA 2OVFA 4G25A 3CVYA 3UINC 3D9MA 2WXGA 1NP7A 2XPYA 4FADA 2C0MA 4I2WA 1IHBA 3EU9A 1LF8A 3B7BA 1EPUA 1D9SA 3E32A 3SFXA 1XNFA 2VSYA 1HF8A 4HI9A 4AOFA 3DBSA 3L08A 4O1PA 3CGHA 3CK7A 4AVXA 2VTBB 2WPVA 3HXBA 4BETA 3JQ1A 4H7XA 1Z3XA 3IV0A 5AN8A 3L17A 3TG4A 4XZ4A 2HE0A 3TWUA 1MQSA 3SO8A 3S7JA 2V4LA 3S7DA 1TYQG 5CMWA 3LEWA 4N5QA 4LUNU 3WXXA 4G23A 4YDWA 4UUCA 2QC9A 3FTUA 3CVPA 3MKQA 3LY8A 3JXIA 5EYPF 4JW1A 1N0QA 4Q94A 2P9KG 5FJYA 4N3CA 3Q7FA 5AJDA 1EF1C 5FINA 3T8MA 4DPRA 4MKTA 3L9TA 4IULA 4A1GA 3CKCA 5FQ7A 4OAVB 5G05C 3PUJA 1ELWA 5KJLA 4UWGA 4JB8P 2KXPC 3D9KA 4GZDA 3HIZA 1BD8A 4I6EA 1MX4A 2JEKA 1OWMA 3S2AA 1IYGA 3IEGA 4G1TA 2WXMA 1FT2A 3QAQA 3L13A 4A63B 1NI1A 5CEDB 4UWFA 4E6HA 4QFVA 2FI7A 3ASDA 3BG0B 5HI7A 5LCWJ 5KJMA 3IHVA 1RW2A 3L16A 5BT1A 3CVVA 3SZ7A 3E37A 3LDZA 1JUQA 4BWRA 3C5RA 4PS7A 3I4GA 4O1OA 1ELKA 2P9NG 5AQBA 1UJKA 4P29A 3AG3E 3ONLA 4GTMA 3RJVA 3GZ2A 3PREA 3PE3A 3CVQA 3PS6A 4ANXA 4B8AA 5A6CA 4DUIA 1YCSB 5FQ8A 2PQNA 3BUAA 3FH8A 4APOA 1FPPA 4JHRA 2EIKE 3UIPC 1EDUA 3E4BA 4BSXA 5BV1A 4FC8A 2PM7A 1KT1A 3LJ3A 2CFZA 2XGSA 3VTYA 3ZW3A 4U07A 4YDEA 4XX5A 4GMJA 1HG2A 2MYOA 4GPMA 2GROB 3LKUA 4K5BA 5HS0A 4U7EB 4ACLA 5KCMA 3NZUA 2VSOE 3Q15A 3FUIA 3SHFA 3KS2A 1S63A 3NF1A 4XKBA 2IFUA 2WXOA 4DX7D 4EQFA 4JEUA 2R05A 3FDHA 5FT9A 2L0TB 5T8IA 5IY5E 4CGWA 4I1MA 4F7AA 3LY7A 3PZDA 4CZ2D 5B1BE 3UPVA 3NBNB 2NXPA 2P9LG 4YDYA 2DYSE 2V8SE 3TWWA 4ANWA 3MZLB 3VLFA 4I6GA 4MBGA 2ETAA 2KC7A 1TNOA 1NA0A 3TG5A 1IXVA 2FBNA 3CSTA 3DSTA 4ILIA 4IN3B 3DEPA 3PZ2A 3AG1E 2CHZA 4B94A 5ENOD 4U8YD 3B7TA 2Y69E 2WM9A 1JWFA 4JA7A 4HRLA 4B8CB 4DX1A 2RFMA 2QZAA 2E0IA 3GW4A 5AENA 3TWSA 2B6CA 2XPZA 3PZ4A 4N2QA 3WG7E 5J90A 2P9IG 1MX2A 4GTSA 3MX3A 4EZLA 4TRQA 1MYOA 2R02A 4NURA 4Z68A 2L6BA 3MKQB 4NIKA 3CVWA 1DC2A 2LUHA 3K9IA 2L6JA 4OYSA 3MCXA 4GU5A 3LVRE 3IKOB 3QB2A 3FFLA 2XGMA 3UKRG 1YA0A 2XZTG 4A55A 1S70B 3Q7AA 2X3MA 3FUEA 3L54A 5A23A 3G2TA 3N71A 3O4ZA 3CLJA 4HOSA 4I6JA 3Q49B 3ESLA 4ILGA 5HQ8A 1ELRA 2AXVA 5G04C 4UQZA 3QC1A 5CRUA 2Y4UA 5KNGA 3UT7A 4FLBA 2X6IA 4CDMA 5LP0A 3ASFA 1K1AA 5CERB 5DBKA 4GZ6A 4V3IA 5BV0A 3FTSA 3CHOA 2Q7FA 3KSLA 3ULQA 4UWHA 4L7TA 1E8XA 4PS8A 4WWNA 1UOHA 4I1AA 5CCLA 2P9PG 1E7UA 5ENRD 3B7RL 2YINA 4MS6A 3DWLG 2GRNB 2BKGA 2V5QC 3UX4A 4QQIA 3P2BA 5AQ9A 1N4PA 4HFGA 3Q73A 3MA5A 2Y4TA 4WWPA 3ZXPA 5B1AE 4DK5A 1UJJA 1IHGA 2FO7A 2EILE 2KZTA 3ML8A 2LSVA 3FUJA 2GGFA 3V31A 4RQIA 1OWLA 1OT8A 2J8SD 3SNXA 4KMOA 4ZFHA 2AW6A 2XENA 5ARFA 2X38A 3G2SA 1INZA 3CVUA 3FUNA 5T4YA 3TL5A 3IHYA 4GPKA 2BUGA 5AAOA 2HYZA 2IONA 3G2VA 5EKQD 4APFA 1MZCA 3TWRA 5FQ4A 2OV8A 2XEEA 3HXFA 4DX5D 3DXKG 5C2YA 2OEVA 2IQCA 3EJNA 2YNQA 4RLYA 3B7SA 1NA3A 3DPDA 4UQXA 5FZRA 2UY1B 4WNFA 3AAAC 1KZOA 4C0MA 1Y6IA 2KCLA 1N11A 4F3VA 3QWWA 2VSXE 4GZ3A 4XI9A 4WWOA 2WXPA 5CBNA 2CG3A 1WDYA 4GA1A 2E2EA 2IU1A 4L1BA 2J09A 4HXIA 4DLQA 4BEPA 1N52A 1UW4B 4TUMA 4XIFA 3O48A 4Q96A 3PRZA 3TJPA 5KBAA 5EYLA 4Q69A 3ZVVA 2EINE 2J08A 2DYRE 1AP7A 1D8EA 4EBAG 3ASHA 3P1UA 1D8DA 1Y8MA 3DRAA 4JPSA 1N0RA 4HLLA 4N39A 4YVQC 5D2MC 2B0OE 5G05J 1ZB1A 4UWLA 3ZXSA 3FTXA 3HHMA 4AXHA 3V2OA 3FU0A 3V2XA 4OAUC 3FUHA 4GAAA 5E76A 3AU5A 1DCQA 1MJ0A 1NZNA 2PL2A 4B0ZA 4AY6A 4GMRA 5FQ6A 1HH8A 5BXOA 1XGWA 3FTYA 3D9PA 3CK9A 3CHMA 2V0PA 3FWVA 3TWXA 3HVEA 2CFUA 3ZUVB 5ANLA 4Y6WA 3PVLA 2A5EA 3FTWA 4GCNA 3ZFWA 5FIOA 3D9IA 1N4QA 3PZ1A 4LG6A 3ULEG 5CHEE 3KSQA 3LS8A 2NC9A 2IO3C 3TXNA 1O5MA 2GRMA 1OCCE 1U3DA 3DSSA 1UN9A 1QYMA 3JUIA 4LSZE 2GRQB 4AJWA 3QWVA 4FU3A 3TXMA 4RSYA 4UI9C 3CR3A 3IBEA 3SFYA 1IQRA 1K1BA 1HZ4A 1PY1A 4AY5A 4D10C 3EHNA 4PH4B 3ZYMA 3PEUB 4DI4A 2AJAA 3UM0A 2AWIA 3CVNA 3LJNA 3EHMA 5KJNA 4GTVA 2IF4A 2MOWA
chains in the Genus database with same CATH topology
4HLLA 4U95D 4CZ2D 5EIBE 3NBNB 5AQBA 2B0OE 3SO8A 5BXUA 1K3ZD 3TWQA 2QYJA 4YDYA 3V31A 2XZTG 5JMND 1OT8A 3V2OA 3T8KA 1S70B 3TWWA 1MX6A 4N5QA 2F8XK 2J8SD 3V2XA 4OAUC 2F37A 4ZFHA 2XENA 4HNAD 4BERA 2ETAA 3ZNGA 2DVWA 1DCQA 1MJ0A 4J8YA 1IKND 2QC9A 4UUCA 4YDWA 4DX6D 5HRYA 1IXVA 3HRAA 4GMRA 5D66A 5ENTD 3V79K 5BXOA 5AAOA 3JXIA 5EYPF 4C48B 3DEPA 4F1PA 1BLXB 2XEHA 4DUIA 5CBOA 1A5EA 1YCSB 5CEAA 3UTMA 3TWRA 3UI2A 1N0QA 3KEAA 2XEEA 3ZKJA 3TWXA 4DX5D 5ENOD 4U8YD 1G3NB 5CECB 5KNGA 3IXEA 5FINA 3ZUVB 4G8LA 5JA4D 1TR4A 3J5PA 4HQDA 2A5EA 1OY3D 2P2CP 4U8VD 1NFIE 5ITZF 4HI8A 4RLYA 1YYHA 5FIOA 3B95A 1K1AA 4LG6A 4OAVB 5CERB 2ETCA 4K5AB 4ATZD 2Y1LE 2ZGGA 3AAAC 4JB8P 2DZNA 2KXPC 1BI8B 1N11A 1BD8A 3TWVA 2KBXA 3W9GA 4O60A 3D9HA 2MYOA 2F8YA 4GPMA 4HRLA 4DX1A 1MX4A 4F6RD 3T9KA 5AQAA 2RFMA 3UXGA 4K5BA 2VGEA 5HS0A 5KNHD 4BESA 2RFAA 2PNNA 4J7WA 1SW6A 4HB5A 5ENSD 5HKPA 2DWZA 5AQ7A 3TWSA 1QYMA 4LSZE 5CBNA 5KWDA 1WDYA 4BSZB 1UOHA 1WG0A 2NYJA 3NOCD 1IHBA 4HRMB 3EU9A 3TWTA 4CYMD 3HG0D 4LNUD 3B7BA 3Q9NC 4HBDA 4A63B 3Q9UC 1MX2A 1D9SA 4BEPA 2Y0BG 5CEDB 3F6QA 4DX2A 5EILA 2BKKB 5ENQD 4B93B 3W9FA 5ENRD 3J5QB 2ETBA 5ENPD 3TWUA 1K1BA 2DZOA 4HI9A 4K5CA 4TUMA 4DX7D 1MYOA 4QFVA 3AJIA 2FO1E 1YMPA 4O1PA 5EN5D 1AWCB 2ZGDA 2BKGA 2V5QC 3EHRA 3JXJA 4QQIA 4G8KA 4Z68A 3ZU7B 2XZDG 3JUEA 3V30A 2L6BA 4HRNA 5AQ9A 4ZHBA 1SVXA 4NIKA 1DC2A 5KBAA 5EYLA 3DEOA 1BI7B 2JABA 2AJAA 4BETA 1AP7A 1BU9A 5AARA 3LJNA 3EHQA 3NOGD 5AN8A 2V4HC 5EIDA 4DRXE 3C5RA 4O1OA 2HE0A 4U96D 1N0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HLL A;  4U95 D;  4CZ2 D;  5EIB E;  3NBN B;  5AQB A;  2B0O E;  3SO8 A;  5BXU A;  1K3Z D;  3TWQ A;  2QYJ A;  4YDY A;  3V31 A;  2XZT G;  5JMN D;  1OT8 A;  3V2O A;  3T8K A;  1S70 B;  3TWW A;  1MX6 A;  4N5Q A;  2F8X K;  2J8S D;  3V2X A;  4OAU C;  2F37 A;  4ZFH A;  2XEN A;  4HNA D;  4BER A;  2ETA A;  3ZNG A;  2DVW A;  1DCQ A;  1MJ0 A;  4J8Y A;  1IKN D;  2QC9 A;  4UUC A;  4YDW A;  4DX6 D;  5HRY A;  1IXV A;  3HRA A;  4GMR A;  5D66 A;  5ENT D;  3V79 K;  5BXO A;  5AAO A;  3JXI A;  5EYP F;  4C48 B;  3DEP A;  4F1P A;  1BLX B;  2XEH A;  4DUI A;  5CBO A;  1A5E A;  1YCS B;  5CEA A;  3UTM A;  3TWR A;  3UI2 A;  1N0Q A;  3KEA A;  2XEE A;  3ZKJ A;  3TWX A;  4DX5 D;  5ENO D;  4U8Y D;  1G3N B;  5CEC B;  5KNG A;  3IXE A;  5FIN A;  3ZUV B;  4G8L A;  5JA4 D;  1TR4 A;  3J5P A;  4HQD A;  2A5E A;  1OY3 D;  2P2C P;  4U8V D;  1NFI E;  5ITZ F;  4HI8 A;  4RLY A;  1YYH A;  5FIO A;  3B95 A;  1K1A A;  4LG6 A;  4OAV B;  5CER B;  2ETC A;  4K5A B;  4ATZ D;  2Y1L E;  2ZGG A;  3AAA C;  4JB8 P;  2DZN A;  2KXP C;  1BI8 B;  1N11 A;  1BD8 A;  3TWV A;  2KBX A;  3W9G A;  4O60 A;  3D9H A;  2MYO A;  2F8Y A;  4GPM A;  4HRL A;  4DX1 A;  1MX4 A;  4F6R D;  3T9K A;  5AQA A;  2RFM A;  3UXG A;  4K5B A;  2VGE A;  5HS0 A;  5KNH D;  4BES A;  2RFA A;  2PNN A;  4J7W A;  1SW6 A;  4HB5 A;  5ENS D;  5HKP A;  2DWZ A;  5AQ7 A;  3TWS A;  1QYM A;  4LSZ E;  5CBN A;  5KWD A;  1WDY A;  4BSZ B;  1UOH A;  1WG0 A;  2NYJ A;  3NOC D;  1IHB A;  4HRM B;  3EU9 A;  3TWT A;  4CYM D;  3HG0 D;  4LNU D;  3B7B A;  3Q9N C;  4HBD A;  4A63 B;  3Q9U C;  1MX2 A;  1D9S A;  4BEP A;  2Y0B G;  5CED B;  3F6Q A;  4DX2 A;  5EIL A;  2BKK B;  5ENQ D;  4B93 B;  3W9F A;  5ENR D;  3J5Q B;  2ETB A;  5ENP D;  3TWU A;  1K1B A;  2DZO A;  4HI9 A;  4K5C A;  4TUM A;  4DX7 D;  1MYO A;  4QFV A;  3AJI A;  2FO1 E;  1YMP A;  4O1P A;  5EN5 D;  1AWC B;  2ZGD A;  2BKG A;  2V5Q C;  3EHR A;  3JXJ A;  4QQI A;  4G8K A;  4Z68 A;  3ZU7 B;  2XZD G;  3JUE A;  3V30 A;  2L6B A;  4HRN A;  5AQ9 A;  4ZHB A;  1SVX A;  4NIK A;  1DC2 A;  5KBA A;  5EYL A;  3DEO A;  1BI7 B;  2JAB A;  2AJA A;  4BET A;  1AP7 A;  1BU9 A;  5AAR A;  3LJN A;  3EHQ A;  3NOG D;  5AN8 A;  2V4H C;  5EID A;  4DRX E;  3C5R A;  4O1O A;  2HE0 A;  4U96 D;  1N0R A; 
#chains in the Genus database with same CATH topology
 3U64 A;  3I5P A;  3ZIM A;  3RIB A;  5FTP A;  3UM1 A;  3C3O A;  2X6K A;  5ARG A;  3I4R B;  4GYO A;  3VLD A;  2A4Z A;  4L2Y A;  2BF0 X;  2R59 A;  4NQ0 A;  3OTN A;  3ZN3 A;  4L9P A;  4I9E A;  1HXI A;  5AYW D;  2AXZ A;  4EHM A;  3ENE A;  1H0A A;  3LY9 A;  1QZ2 A;  3Q75 A;  4HI8 A;  3R7R A;  3CQG B;  5EDS A;  1LD7 A;  3G2U A;  4K5A B;  4W9R A;  1KZP A;  5LX8 A;  1OWP A;  1HX8 A;  2J9Q A;  2I1J A;  4TV3 A;  2VGE A;  3RRN B;  2J4B A;  3D9L A;  4CDN A;  1SW6 A;  1TNY A;  4HB5 A;  2UWJ G;  3PDN A;  1PAQ A;  1WG0 A;  1H6P A;  4HBD A;  2WXN A;  3PZ3 A;  4UQY A;  3HXC A;  5D0O D;  4EZK A;  5JHA A;  3BEE A;  3AJI A;  3UKU G;  4N5C A;  5EN5 D;  3CVL A;  1SVX A;  2XS1 A;  4KXK B;  4X8Q A;  3DEO A;  3FTV A;  4CEM A;  4DJA A;  4H7Y A;  4EEC A;  2ILR A;  5EID A;  4RG6 A;  4DRX E;  4GB9 A;  3SBS A;  4AV7 A;  5LCW C;  3ZYQ A;  1DVP A;  1HO8 A;  5EIB E;  4GYY A;  4LNG A;  1ZU2 A;  1K3Z D;  4LNB A;  4JZY A;  2GRR B;  3KD7 A;  2QYJ A;  2M63 A;  2CHX A;  3T8K A;  4ANV A;  3DSW A;  2WXL A;  3ZHE A;  3HRA A;  3PNL B;  5D66 A;  2WXH A;  4N3B A;  4J6I A;  5CBO A;  2WXF A;  3PUK A;  4WNE A;  3QAR A;  2WQ7 A;  2L0I A;  1DCE A;  4TXP A;  3ZYK A;  1TR4 A;  4JHK A;  2VGX B;  3QWP A;  4HQD A;  4LRZ A;  4BT8 A;  1YYH A;  3G2W A;  3D9J A;  3VTX A;  3APC A;  2H6G A;  1LD8 A;  4JL0 A;  3LPZ A;  4YDO A;  2YHC A;  4O60 A;  3D9H A;  4N2S A;  5KNH D;  3GYZ A;  3S7B A;  1VDY A;  2DWZ A;  3OXG A;  4BSZ B;  3SI5 A;  4PS3 A;  3ABK E;  3FUF A;  3EIJ A;  5CMY A;  3SF4 A;  2LO6 A;  1H2V C;  2MRI A;  1YMP A;  1A5E A;  3EHR A;  5G04 J;  3JUE A;  4ATG A;  4N3A A;  1O1S A;  5H7P A;  3R9M A;  2I6H A;  5ANR A;  2VTB A;  2VSN A;  3NOG D;  4XEI G;  2RG8 A;  2DCP A;  3UIO C;  3APD A;  3MGB A;  2P58 C;  1FT1 A;  3MV2 B;  4BTB A;  2WXK A;  1EYH A;  4TXR A;  4HNA D;  3C98 A;  1IKN D;  4YND A;  5G2N A;  3D9N A;  4WND A;  1TNU A;  1S0P A;  4ILH B;  3RK6 A;  5FZQ A;  3UI2 A;  4GTT A;  3SGH A;  4G8L A;  3J5P A;  4U8V D;  4BX9 A;  5JJ7 A;  3PE4 A;  2PM6 A;  3E34 A;  4A3T A;  3RU0 A;  3T9K A;  4I1O B;  4A1S A;  4U0Z A;  4AP2 A;  5KWD A;  1GW6 A;  5BW8 C;  3HG0 D;  1UN8 A;  2WXQ A;  3Q9U C;  3FTZ A;  2KCV A;  4DX2 A;  4B93 B;  3ZYL A;  1O1R A;  2LSU A;  3Q5M A;  3EDT B;  4C0E A;  2F0Y A;  3FH7 A;  1E8Z A;  3ZU7 B;  1L5J A;  4OVV A;  3C3Q A;  2R17 C;  1A17 A;  4G11 A;  1E8W A;  4KZ0 A;  2IJG X;  3AG2 E;  2WMN A;  4G24 A;  1KPS B;  2QFC A;  4G2V A;  3E30 A;  5C1D A;  5JMN D;  3BG1 B;  5E75 A;  1MX6 A;  2VYI A;  2F8X K;  3FU6 A;  2BTD A;  3AG4 E;  3ZNG A;  2LAI A;  4U63 A;  2P9S G;  2IEJ A;  3R7Q A;  4C48 B;  3DXM G;  3ZGQ A;  1ZBP A;  3KEA A;  3OXF A;  4MRU A;  2QYU A;  3ASG A;  1N95 A;  5JA4 D;  3FUL A;  1WAO 1;  4R7L A;  3NQP A;  2P9U G;  4HOQ A;  2WXJ A;  4ACK A;  1N54 A;  4HOR A;  3B7U X;  3ESK A;  1SA4 A;  3EUV A;  2DZN A;  3UUX A;  3U3W A;  3B13 A;  4U04 A;  1HE8 A;  3PNT B;  3W9G A;  3TAX A;  3UT4 A;  3VLE A;  5HKP A;  2R03 A;  3MJW A;  2NYJ A;  1FVH A;  4M3O A;  4EZJ A;  2XRZ A;  3FU5 A;  3J5Q B;  1H6O A;  3UM2 A;  1OCO E;  2C0L A;  4FHK A;  4WAF A;  2XZD G;  4ZHB A;  1KLX A;  1SQM A;  1Z3Y A;  4CDR A;  3LCA A;  4OVU A;  4GTO A;  5AAR A;  3R9A B;  3EHQ A;  2YQ8 A;  4AM9 A;  2ZIS A;  2MHK A;  4EBA A;  3MEK A;  5G55 A;  3KEZ A;  2XCC A;  5BXU A;  4TUU A;  1OWN A;  2Y3A A;  3SBT B;  4UI9 K;  5JHB A;  3Q4A B;  2J49 A;  3RRU A;  1FCH A;  1BLX B;  2XEH A;  2I9C A;  5LFA A;  2LNI A;  4UI9 J;  4HOU A;  3UM3 A;  2EIM E;  3CVX A;  3B95 A;  4IYP A;  1O1T A;  2Y1L E;  1X5B A;  1HG5 A;  2XRY A;  2HR2 A;  3ML9 A;  3ISM C;  1HS6 A;  2F8Y A;  2OND A;  4F6R D;  5AQA A;  2WB2 A;  3FY4 A;  2PNN A;  3APF A;  5LOZ A;  1OWO A;  3AS5 A;  3EIQ C;  3D3M A;  2WQ6 A;  3FUK A;  3TWT A;  2GRP B;  4J8F A;  3Q9N C;  1V55 E;  2R2L A;  3HDX A;  2IY0 C;  3F6Q A;  3SQV A;  4PDX A;  3W9F A;  4WUY A;  2DZO A;  1TNZ A;  4EPZ A;  3QJZ A;  1N94 A;  3JXJ A;  4G8K A;  5CRV A;  4JEH A;  2NSZ A;  4J0U A;  1V54 E;  3BQO A;  3ABM E;  4NAC A;  1QQE A;  4GTR A;  2C2L A;  5ENS D;  4CT0 A;  3HXD A;  3UQ3 A;  3E33 A;  3CHQ A;  4JHJ A;  5T3R A;  4BER A;  2DVW A;  4J8D A;  1E90 A;  2RD0 A;  1W3B A;  3MYV A;  3CHR A;  1LTX A;  3CK8 A;  4JC8 A;  1OY3 D;  1QBQ A;  2CG2 A;  3Q47 B;  5A7D B;  4J8E A;  2IO2 C;  3RKV A;  4U8H A;  3JCK C;  5FWQ A;  4HOT A;  3CEQ A;  2DBA A;  2VQ2 A;  5AIJ A;  4XE0 A;  4F53 A;  1H6K A;  1Z5S C;  3DPY A;  2I1K A;  1BPO A;  4CRW A;  1X81 A;  4J7W A;  2XCB A;  1JWG A;  3RO2 A;  3FHE A;  5FZS A;  2KCK A;  2ZIR A;  5DIZ A;  2A5U A;  4ABN A;  4HRM B;  3FP3 A;  2XGO A;  2Y0B G;  3QK0 A;  4K5C A;  3U4T A;  3QNK A;  3Q78 A;  3SFZ A;  5D0Q D;  5BNW A;  1TNB A;  4M7C A;  4CGV A;  2JAB A;  3TGO A;  2J07 A;  3NB2 A;  4BTA A;  2KZT B;  4GZ5 A;  2V4H C;  5BPP A;  4FLH A;  2HM8 A;  3T5V A;  5KJK A;  1SZA A;  5EX3 A;  3X2Q E;  3ZPJ A;  2F37 A;  2VGY A;  4L23 A;  1SZ9 A;  1TN6 A;  4FUL A;  1U3C A;  1HFA A;  1DNP A;  4U0U A;  2EQX A;  3UTM A;  1TN8 A;  2LXM A;  5B3S E;  1OCR E;  1PC2 A;  3C72 A;  1G3N B;  4G26 A;  4PUC A;  3IXE A;  3OXL A;  3CHP A;  1TJF A;  4JD2 G;  1H2T C;  4MLP A;  2PZI A;  4ATZ D;  3DSU A;  2H6H A;  2UY1 A;  4Y6C A;  1UG3 A;  1H19 A;  3FEY A;  2XS8 A;  2RFA A;  3GZ1 A;  3LYA A;  3MV3 B;  5M72 A;  4KT6 B;  3SD5 A;  1N4S A;  4FJZ A;  1TEZ A;  2JLB A;  4HVB A;  1E7V A;  4GCO A;  4URK A;  5BUZ A;  4K0R A;  1MHQ A;  1QNF A;  4A3V A;  3S7F A;  1AWC B;  5ITZ F;  4TXQ A;  1JCR A;  1BI7 B;  3RO3 A;  2CHW A;  5CCM A;  4K03 A;  1OXJ A;  4GTQ A;  3C3R A;  1Z6T A;  4L2L A;  2X6J A;  3UT8 A;  1Q2Z A;  4FP7 A;  2X6F A;  4BT9 A;  4FA6 A;  3PEV B;  4KYO B;  3LVQ E;  1B89 A;  3L22 A;  2GRL A;  5HRY A;  5ENT D;  4GML A;  4O6F A;  2LAH A;  3ULY A;  1JCS A;  4F1P A;  2I2O A;  3HYM B;  4BFR A;  5EX0 A;  4LEU A;  3HVE B;  4GA2 A;  2AVP A;  3U9W A;  3L6A A;  3NAW A;  3UMV A;  5ENN A;  1OUV A;  4LER A;  1E96 B;  1OCZ E;  2OEW A;  3ZEF A;  2WXR A;  3NZS A;  2WMO A;  2ZU6 B;  2P2C P;  3AU4 A;  3CKB A;  4JXT A;  3FUD A;  3EU5 A;  2EIJ E;  4XKC A;  2V5F A;  2AXU A;  2KBX A;  3FH5 A;  4BES A;  4J8S A;  5AQ7 A;  4KVO A;  1IQU A;  3ABL E;  3NOC D;  4CYM D;  4HS2 A;  4RG9 A;  5EIL A;  2ETB A;  2BED A;  2PQR A;  3FUM A;  4FHJ A;  2H6F A;  2FO1 E;  1H2U A;  3CSF A;  4GA0 A;  4BY6 A;  3RAU A;  2IOS A;  4CT4 A;  4HRN A;  2FEZ A;  3CIA A;  2LXL A;  4KVM A;  2GW1 A;  2XQ0 A;  3QOU A;  5AJL A;  1BU9 A;  2R5S A;  2XEV A;  4I9C A;  1TJC A;  2KM4 A;  4KBQ A;  2KAT A;  3DSX A;  2WVI A;  3CV0 A;  3LXU X;  3RSE G;  2X6H A;  1HU3 A;  4KZC A;  3HXE A;  2QY7 A;  3KAE A;  3BU8 A;  1RZ4 A;  4XI0 A;  2H6I A;  3OAW A;  4GYW A;  4AIF A;  4I43 A;  2HO1 A;  4GTP A;  4HLE A;  1SA5 A;  2XPI A;  4JA9 A;  3Q79 A;  3FEX A;  2XHE A;  4DLO A;  4C9B B;  1NFI E;  1N9A A;  5JJT A;  4F1S A;  4UWK A;  2ZGG A;  1FVF A;  3JQ0 A;  4LCT A;  1BI8 B;  3AS4 A;  3ASN E;  3TWV A;  4IRU A;  4I2Z A;  2L9B A;  1U2V G;  4DI3 A;  2OVB A;  3UXG A;  3RRM B;  2FF4 A;  4U0S A;  2IOL A;  3DSV A;  3CHS A;  5J08 A;  4LNU D;  3ZRH A;  1JCQ A;  2OCC E;  2BKK B;  4ANU A;  4ME2 A;  5ENQ D;  3QKY A;  1S64 A;  5ENP D;  3URZ A;  1NL4 A;  2WQH A;  1N4R A;  4AEZ C;  2ZGD A;  4BX8 A;  3V30 A;  4WNG A;  1JPL A;  4YVO A;  3AS8 A;  4RVB A;  5JJ6 A;  2VJ8 A;  3GZS A;  4U96 D;  1WY6 A;  4U95 D;  4NRH B;  3CQC B;  3TWQ A;  1P5Q A;  2DIW A;  4E85 A;  1WM5 A;  3ZHE B;  1KT0 A;  3SY2 A;  3ONK A;  1TN7 A;  4J8Y A;  4DX6 D;  2J4D A;  3V79 K;  3U66 A;  3D9O A;  5CEA A;  3L82 A;  3ZKJ A;  3I3N A;  5CEC B;  3JYS A;  2WXI A;  2ZXW E;  4FJY A;  4GZC A;  3QDN A;  2FUL A;  1E8Y A;  4CCA A;  4B89 A;  2VGX A;  3MKR A;  3ASO E;  2YHE A;  4I17 A;  2ETC A;  3T5X A;  3PH0 C;  1K8K G;  2OOE A;  3FU3 A;  4JVS A;  2RKK A;  2OVF A;  4G25 A;  3CVY A;  3UIN C;  3D9M A;  2WXG A;  1NP7 A;  2XPY A;  4FAD A;  2C0M A;  4I2W A;  1IHB A;  3EU9 A;  1LF8 A;  3B7B A;  1EPU A;  1D9S A;  3E32 A;  3SFX A;  1XNF A;  2VSY A;  1HF8 A;  4HI9 A;  4AOF A;  3DBS A;  3L08 A;  4O1P A;  3CGH A;  3CK7 A;  4AVX A;  2VTB B;  2WPV A;  3HXB A;  4BET A;  3JQ1 A;  4H7X A;  1Z3X A;  3IV0 A;  5AN8 A;  3L17 A;  3TG4 A;  4XZ4 A;  2HE0 A;  3TWU A;  1MQS A;  3SO8 A;  3S7J A;  2V4L A;  3S7D A;  1TYQ G;  5CMW A;  3LEW A;  4N5Q A;  4LUN U;  3WXX A;  4G23 A;  4YDW A;  4UUC A;  2QC9 A;  3FTU A;  3CVP A;  3MKQ A;  3LY8 A;  3JXI A;  5EYP F;  4JW1 A;  1N0Q A;  4Q94 A;  2P9K G;  5FJY A;  4N3C A;  3Q7F A;  5AJD A;  1EF1 C;  5FIN A;  3T8M A;  4DPR A;  4MKT A;  3L9T A;  4IUL A;  4A1G A;  3CKC A;  5FQ7 A;  4OAV B;  5G05 C;  3PUJ A;  1ELW A;  5KJL A;  4UWG A;  4JB8 P;  2KXP C;  3D9K A;  4GZD A;  3HIZ A;  1BD8 A;  4I6E A;  1MX4 A;  2JEK A;  1OWM A;  3S2A A;  1IYG A;  3IEG A;  4G1T A;  2WXM A;  1FT2 A;  3QAQ A;  3L13 A;  4A63 B;  1NI1 A;  5CED B;  4UWF A;  4E6H A;  4QFV A;  2FI7 A;  3ASD A;  3BG0 B;  5HI7 A;  5LCW J;  5KJM A;  3IHV A;  1RW2 A;  3L16 A;  5BT1 A;  3CVV A;  3SZ7 A;  3E37 A;  3LDZ A;  1JUQ A;  4BWR A;  3C5R A;  4PS7 A;  3I4G A;  4O1O A;  1ELK A;  2P9N G;  5AQB A;  1UJK A;  4P29 A;  3AG3 E;  3ONL A;  4GTM A;  3RJV A;  3GZ2 A;  3PRE A;  3PE3 A;  3CVQ A;  3PS6 A;  4ANX A;  4B8A A;  5A6C A;  4DUI A;  1YCS B;  5FQ8 A;  2PQN A;  3BUA A;  3FH8 A;  4APO A;  1FPP A;  4JHR A;  2EIK E;  3UIP C;  1EDU A;  3E4B A;  4BSX A;  5BV1 A;  4FC8 A;  2PM7 A;  1KT1 A;  3LJ3 A;  2CFZ A;  2XGS A;  3VTY A;  3ZW3 A;  4U07 A;  4YDE A;  4XX5 A;  4GMJ A;  1HG2 A;  2MYO A;  4GPM A;  2GRO B;  3LKU A;  4K5B A;  5HS0 A;  4U7E B;  4ACL A;  5KCM A;  3NZU A;  2VSO E;  3Q15 A;  3FUI A;  3SHF A;  3KS2 A;  1S63 A;  3NF1 A;  4XKB A;  2IFU A;  2WXO A;  4DX7 D;  4EQF A;  4JEU A;  2R05 A;  3FDH A;  5FT9 A;  2L0T B;  5T8I A;  5IY5 E;  4CGW A;  4I1M A;  4F7A A;  3LY7 A;  3PZD A;  4CZ2 D;  5B1B E;  3UPV A;  3NBN B;  2NXP A;  2P9L G;  4YDY A;  2DYS E;  2V8S E;  3TWW A;  4ANW A;  3MZL B;  3VLF A;  4I6G A;  4MBG A;  2ETA A;  2KC7 A;  1TNO A;  1NA0 A;  3TG5 A;  1IXV A;  2FBN A;  3CST A;  3DST A;  4ILI A;  4IN3 B;  3DEP A;  3PZ2 A;  3AG1 E;  2CHZ A;  4B94 A;  5ENO D;  4U8Y D;  3B7T A;  2Y69 E;  2WM9 A;  1JWF A;  4JA7 A;  4HRL A;  4B8C B;  4DX1 A;  2RFM A;  2QZA A;  2E0I A;  3GW4 A;  5AEN A;  3TWS A;  2B6C A;  2XPZ A;  3PZ4 A;  4N2Q A;  3WG7 E;  5J90 A;  2P9I G;  1MX2 A;  4GTS A;  3MX3 A;  4EZL A;  4TRQ A;  1MYO A;  2R02 A;  4NUR A;  4Z68 A;  2L6B A;  3MKQ B;  4NIK A;  3CVW A;  1DC2 A;  2LUH A;  3K9I A;  2L6J A;  4OYS A;  3MCX A;  4GU5 A;  3LVR E;  3IKO B;  3QB2 A;  3FFL A;  2XGM A;  3UKR G;  1YA0 A;  2XZT G;  4A55 A;  1S70 B;  3Q7A A;  2X3M A;  3FUE A;  3L54 A;  5A23 A;  3G2T A;  3N71 A;  3O4Z A;  3CLJ A;  4HOS A;  4I6J A;  3Q49 B;  3ESL A;  4ILG A;  5HQ8 A;  1ELR A;  2AXV A;  5G04 C;  4UQZ A;  3QC1 A;  5CRU A;  2Y4U A;  5KNG A;  3UT7 A;  4FLB A;  2X6I A;  4CDM A;  5LP0 A;  3ASF A;  1K1A A;  5CER B;  5DBK A;  4GZ6 A;  4V3I A;  5BV0 A;  3FTS A;  3CHO A;  2Q7F A;  3KSL A;  3ULQ A;  4UWH A;  4L7T A;  1E8X A;  4PS8 A;  4WWN A;  1UOH A;  4I1A A;  5CCL A;  2P9P G;  1E7U A;  5ENR D;  3B7R L;  2YIN A;  4MS6 A;  3DWL G;  2GRN B;  2BKG A;  2V5Q C;  3UX4 A;  4QQI A;  3P2B A;  5AQ9 A;  1N4P A;  4HFG A;  3Q73 A;  3MA5 A;  2Y4T A;  4WWP A;  3ZXP A;  5B1A E;  4DK5 A;  1UJJ A;  1IHG A;  2FO7 A;  2EIL E;  2KZT A;  3ML8 A;  2LSV A;  3FUJ A;  2GGF A;  3V31 A;  4RQI A;  1OWL A;  1OT8 A;  2J8S D;  3SNX A;  4KMO A;  4ZFH A;  2AW6 A;  2XEN A;  5ARF A;  2X38 A;  3G2S A;  1INZ A;  3CVU A;  3FUN A;  5T4Y A;  3TL5 A;  3IHY A;  4GPK A;  2BUG A;  5AAO A;  2HYZ A;  2ION A;  3G2V A;  5EKQ D;  4APF A;  1MZC A;  3TWR A;  5FQ4 A;  2OV8 A;  2XEE A;  3HXF A;  4DX5 D;  3DXK G;  5C2Y A;  2OEV A;  2IQC A;  3EJN A;  2YNQ A;  4RLY A;  3B7S A;  1NA3 A;  3DPD A;  4UQX A;  5FZR A;  2UY1 B;  4WNF A;  3AAA C;  1KZO A;  4C0M A;  1Y6I A;  2KCL A;  1N11 A;  4F3V A;  3QWW A;  2VSX E;  4GZ3 A;  4XI9 A;  4WWO A;  2WXP A;  5CBN A;  2CG3 A;  1WDY A;  4GA1 A;  2E2E A;  2IU1 A;  4L1B A;  2J09 A;  4HXI A;  4DLQ A;  4BEP A;  1N52 A;  1UW4 B;  4TUM A;  4XIF A;  3O48 A;  4Q96 A;  3PRZ A;  3TJP A;  5KBA A;  5EYL A;  4Q69 A;  3ZVV A;  2EIN E;  2J08 A;  2DYR E;  1AP7 A;  1D8E A;  4EBA G;  3ASH A;  3P1U A;  1D8D A;  1Y8M A;  3DRA A;  4JPS A;  1N0R A;  4HLL A;  4N39 A;  4YVQ C;  5D2M C;  2B0O E;  5G05 J;  1ZB1 A;  4UWL A;  3ZXS A;  3FTX A;  3HHM A;  4AXH A;  3V2O A;  3FU0 A;  3V2X A;  4OAU C;  3FUH A;  4GAA A;  5E76 A;  3AU5 A;  1DCQ A;  1MJ0 A;  1NZN A;  2PL2 A;  4B0Z A;  4AY6 A;  4GMR A;  5FQ6 A;  1HH8 A;  5BXO A;  1XGW A;  3FTY A;  3D9P A;  3CK9 A;  3CHM A;  2V0P A;  3FWV A;  3TWX A;  3HVE A;  2CFU A;  3ZUV B;  5ANL A;  4Y6W A;  3PVL A;  2A5E A;  3FTW A;  4GCN A;  3ZFW A;  5FIO A;  3D9I A;  1N4Q A;  3PZ1 A;  4LG6 A;  3ULE G;  5CHE E;  3KSQ A;  3LS8 A;  2NC9 A;  2IO3 C;  3TXN A;  1O5M A;  2GRM A;  1OCC E;  1U3D A;  3DSS A;  1UN9 A;  1QYM A;  3JUI A;  4LSZ E;  2GRQ B;  4AJW A;  3QWV A;  4FU3 A;  3TXM A;  4RSY A;  4UI9 C;  3CR3 A;  3IBE A;  3SFY A;  1IQR A;  1K1B A;  1HZ4 A;  1PY1 A;  4AY5 A;  4D10 C;  3EHN A;  4PH4 B;  3ZYM A;  3PEU B;  4DI4 A;  2AJA A;  3UM0 A;  2AWI A;  3CVN A;  3LJN A;  3EHM A;  5KJN A;  4GTV A;  2IF4 A;  2MOW A; 
#chains in the Genus database with same CATH homology
 4HLL A;  4U95 D;  4CZ2 D;  5EIB E;  3NBN B;  5AQB A;  2B0O E;  3SO8 A;  5BXU A;  1K3Z D;  3TWQ A;  2QYJ A;  4YDY A;  3V31 A;  2XZT G;  5JMN D;  1OT8 A;  3V2O A;  3T8K A;  1S70 B;  3TWW A;  1MX6 A;  4N5Q A;  2F8X K;  2J8S D;  3V2X A;  4OAU C;  2F37 A;  4ZFH A;  2XEN A;  4HNA D;  4BER A;  2ETA A;  3ZNG A;  2DVW A;  1DCQ A;  1MJ0 A;  4J8Y A;  1IKN D;  2QC9 A;  4UUC A;  4YDW A;  4DX6 D;  5HRY A;  1IXV A;  3HRA A;  4GMR A;  5D66 A;  5ENT D;  3V79 K;  5BXO A;  5AAO A;  3JXI A;  5EYP F;  4C48 B;  3DEP A;  4F1P A;  1BLX B;  2XEH A;  4DUI A;  5CBO A;  1A5E A;  1YCS B;  5CEA A;  3UTM A;  3TWR A;  3UI2 A;  1N0Q A;  3KEA A;  2XEE A;  3ZKJ A;  3TWX A;  4DX5 D;  5ENO D;  4U8Y D;  1G3N B;  5CEC B;  5KNG A;  3IXE A;  5FIN A;  3ZUV B;  4G8L A;  5JA4 D;  1TR4 A;  3J5P A;  4HQD A;  2A5E A;  1OY3 D;  2P2C P;  4U8V D;  1NFI E;  5ITZ F;  4HI8 A;  4RLY A;  1YYH A;  5FIO A;  3B95 A;  1K1A A;  4LG6 A;  4OAV B;  5CER B;  2ETC A;  4K5A B;  4ATZ D;  2Y1L E;  2ZGG A;  3AAA C;  4JB8 P;  2DZN A;  2KXP C;  1BI8 B;  1N11 A;  1BD8 A;  3TWV A;  2KBX A;  3W9G A;  4O60 A;  3D9H A;  2MYO A;  2F8Y A;  4GPM A;  4HRL A;  4DX1 A;  1MX4 A;  4F6R D;  3T9K A;  5AQA A;  2RFM A;  3UXG A;  4K5B A;  2VGE A;  5HS0 A;  5KNH D;  4BES A;  2RFA A;  2PNN A;  4J7W A;  1SW6 A;  4HB5 A;  5ENS D;  5HKP A;  2DWZ A;  5AQ7 A;  3TWS A;  1QYM A;  4LSZ E;  5CBN A;  5KWD A;  1WDY A;  4BSZ B;  1UOH A;  1WG0 A;  2NYJ A;  3NOC D;  1IHB A;  4HRM B;  3EU9 A;  3TWT A;  4CYM D;  3HG0 D;  4LNU D;  3B7B A;  3Q9N C;  4HBD A;  4A63 B;  3Q9U C;  1MX2 A;  1D9S A;  4BEP A;  2Y0B G;  5CED B;  3F6Q A;  4DX2 A;  5EIL A;  2BKK B;  5ENQ D;  4B93 B;  3W9F A;  5ENR D;  3J5Q B;  2ETB A;  5ENP D;  3TWU A;  1K1B A;  2DZO A;  4HI9 A;  4K5C A;  4TUM A;  4DX7 D;  1MYO A;  4QFV A;  3AJI A;  2FO1 E;  1YMP A;  4O1P A;  5EN5 D;  1AWC B;  2ZGD A;  2BKG A;  2V5Q C;  3EHR A;  3JXJ A;  4QQI A;  4G8K A;  4Z68 A;  3ZU7 B;  2XZD G;  3JUE A;  3V30 A;  2L6B A;  4HRN A;  5AQ9 A;  4ZHB A;  1SVX A;  4NIK A;  1DC2 A;  5KBA A;  5EYL A;  3DEO A;  1BI7 B;  2JAB A;  2AJA A;  4BET A;  1AP7 A;  1BU9 A;  5AAR A;  3LJN A;  3EHQ A;  3NOG D;  5AN8 A;  2V4H C;  5EID A;  4DRX E;  3C5R A;  4O1O A;  2HE0 A;  4U96 D;  1N0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...