1MX6A

Structure of p18ink4c (f92n)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
WGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLENQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 6 inhibitor
publication title Structure-based design of p18INK4c proteins with increased thermodynamic stability and cell cycle inhibitory activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle inhibitor
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1mx6A00
4DX6D 2PNNA 3W9GA 5AAOA 2XZTG 5ENPD 3UI2A 4HQDA 4LG6A 4RLYA 4A63B 5ITZF 1BI8B 1BD8A 4O1OA 4LNUD 4F6RD 2HE0A 3V30A 4DX1A 5JMND 3C5RA 4BSZB 4U96D 3DEOA 1YCSB 1K1AA 4K5AB 1MYOA 4N5QA 3TWWA 5CEAA 2KXPC 4F1PA 3TWVA 4J7WA 5EIBE 2V5QC 3TWQA 5BXUA 3JXJA 4CZ2D 4U8VD 1NFIE 2NYJA 1IKND 3AAAC 3B95A 4LSZE 1K1BA 5AQBA 2DWZA 1SW6A 3NOGD 4Z68A 2Y0BG 4CYMD 5EN5D 5HRYA 4C48B 1DC2A 1MX4A 2L6BA 3Q9UC 4K5BA 2FO1E 5D66A 4GMRA 2JABA 5AQ9A 2AJAA 1BLXB 2XEHA 5CEDB 4G8LA 1TR4A 5CECB 2BKGA 4GPMA 4HLLA 5ENTD 3T8KA 3F6QA 4JB8P 4B93B 1N0QA 4DX5D 1WDYA 2F8YA 3JXIA 2B0OE 3B7BA 4HRLA 4QQIA 4DUIA 5CERB 5FINA 1S70B 3NBNB 1MJ0A 1N0RA 3HG0D 4OAVB 1OY3D 1SVXA 3EU9A 4ATZD 1D9SA 1MX6A 3ZU7B 5KNGA 1A5EA 1YYHA 2A5EA 2V4HC 3IXEA 1IXVA 5EYPF 5FIOA 2XEEA 5AARA 4BESA 3LJNA 4HRMB 3Q9NC 4DX2A 3AJIA 4U8YD 1BI7B 3D9HA 4HRNA 4HI8A 5KNHD 3TWXA 4BERA 5JA4D 3ZNGA 4YDYA 2ZGGA 3V79K 5HKPA 1YMPA 1QYMA 4QFVA 5AN8A 3TWUA 2ETAA 1IHBA 4TUMA 1AWCB 4OAUC 4BEPA 3HRAA 2RFAA 4U95D 3SO8A 3TWTA 3V31A 2ZGDA 2ETBA 3ZKJA 1N11A 2QYJA 2VGEA 3JUEA 5KBAA 1AP7A 4DX7D 3UXGA 2BKKB 4G8KA 4NIKA 1UOHA 3ZUVB 4UUCA 4HNAD 3KEAA 3UTMA 2DZNA 4YDWA 4HB5A 3V2OA 4K5CA 5ENSD 5ENOD 3NOCD 3TWSA 2RFMA 3TWRA 1OT8A 3J5QB 5AQ7A 4BETA 4ZHBA 2KBXA 4J8YA 5CBNA 2MYOA 1MX2A 4O60A 4O1PA 2XZDG 2DZOA 5ENQD 2ETCA 1DCQA 5EYLA 4ZFHA 5BXOA 1BU9A 4DRXE 2P2CP 3DEPA 2J8SD 1G3NB 1WG0A 5AQAA 4HI9A 1K3ZD 5EILA 3V2XA 5CBOA 2F8XK 3T9KA 3W9FA 3EHQA 5KWDA 3J5PA 5EIDA 5ENRD 3EHRA 2QC9A 2Y1LE 4HBDA 2XENA 5HS0A 2F37A 2DVWA
chains in the Genus database with same CATH superfamily
1PY1A 5ENPD 4FJYA 3CKCA 1HH8A 4BX9A 5C2YA 1H19A 4F3VA 1Z5SC 4K5AB 3SFZA 3G2SA 5T8IA 1TNBA 3PS6A 4CGVA 2UWJG 5AQBA 2AXVA 3B7SA 4U04A 5CRUA 4WUYA 5LFAA 3ZHEA 4UWLA 3BU8A 5CEDB 3PUJA 4HLLA 1KT1A 4BTAA 2WVIA 4DX5D 2B0OE 5CCMA 2R2LA 3QK0A 1MJ0A 5EKQD 3FY4A 4ATZD 4GZ5A 3ZU7B 3HIZA 3IXEA 1H2VC 1ZU2A 2L0TB 3ONKA 2LXMA 4L2YA 3FHEA 4G25A 4HRNA 4GZ6A 2ZU6B 3SQVA 4PDXA 4GYYA 1JCSA 2OCCE 4LUNU 3ULYA 4HLEA 3CHSA 4AXHA 2IF4A 4AIFA 4EHMA 3E30A 5AJDA 3CGHA 2QYJA 4TRQA 1NZNA 3FU5A 4EPZA 2MRIA 3AU4A 1VDYA 5LCWC 4DLQA 4BETA 3UX4A 1N94A 2MYOA 3Q78A 2DZOA 3GZ1A 1DVPA 3EDTB 3C98A 4G24A 5EILA 5CBOA 4DK5A 2Y4UA 3D9MA 4HBDA 3PNLB 4CT0A 3FTVA 2H6FA 4DX6D 4N2QA 2WXMA 3DSXA 2GRPB 3ML9A 4HQDA 3RO2A 4C0MA 5C1DA 2P9UG 3FTYA 4JXTA 1SA5A 1WAO1 2RG8A 3DSWA 4EZKA 3LXUX 4CZ2D 4U8VD 3CVWA 4NQ0A 1NFIE 2VSXE 1IKND 4LNBA 3VTYA 5B3SE 2GRMA 1MHQA 3QWVA 2WQHA 4GMRA 4PH4B 4L2LA 1TR4A 3PRZA 1LD7A 4KYOB 3UUXA 3ASDA 4EZLA 3HXFA 2YHCA 5BNWA 5JJ7A 4HORA 4GA1A 5FJYA 3UQ3A 2BEDA 3C3QA 1OCCE 4GZCA 5G05J 2XPIA 3FUMA 3DBSA 4HRMB 1KZPA 1JUQA 4EBAG 1PC2A 4BERA 5KNHD 4HI8A 4QFVA 3AG3E 1ZB1A 4OAUC 3PH0C 3C72A 3PZ3A 1Z3YA 4YDEA 4HVBA 4GCOA 4U0UA 3RIBA 3ZYKA 3R9AB 4GPKA 4N3CA 5KJMA 1E7VA 4L23A 2WXFA 3ZPJA 3HYMB 4GTRA 4K5CA 4U7EB 5ENSD 4B0ZA 5ENOD 2OEVA 1N52A 3PDNA 2HM8A 2XZDG 4J8SA 3FEXA 3ESLA 1XGWA 5EX3A 2X6JA 4UI9K 4APFA 2XZTG 3RSEG 3CHMA 3TL5A 1E90A 3UT8A 2IOLA 3LKUA 2LAIA 4GTPA 1K1BA 1NL4A 2EQXA 2JEKA 1H2UA 4CYMD 1V54E 5EN5D 1DC2A 1MX4A 2WXJA 4J6IA 1EF1C 4AV7A 2WXNA 3QARA 2HR2A 4B8CB 3FTSA 4XE0A 4C9BB 3JQ1A 2P9SG 3DPDA 1A17A 4J8EA 1JWGA 4KBQA 1WM5A 3ZVVA 1ELWA 4I9CA 4B89A 2QY7A 5M72A 4IN3B 1TEZA 2P9LG 3CVPA 4FHJA 4AY5A 4WNGA 2FO7A 4UWGA 1YA0A 1OCOE 4BY6A 1N4SA 2GRNB 2Q7FA 2ZXWE 2WXGA 3NZUA 1FT2A 5D2MC 4O1PA 2CHXA 1BU9A 4DRXE 3UM1A 3Q75A 4FC8A 3OXGA 3LEWA 2PNNA 2P9IG 2IY0C 5D0OD 2QFCA 3CVNA 3G2UA 3CVLA 3HXCA 4GCNA 4U0ZA 4M3OA 3ASOE 4G23A 2KXPC 3TWVA 3U4TA 3ZHEB 3TWQA 3FTXA 5EX0A 1H6PA 3FUFA 3R7QA 2DWZA 3L9TA 4JW1A 1LD8A 5FQ8A 5CCLA 3HXBA 1S0PA 1W3BA 2AJAA 2VGXA 3SFYA 3T8KA 2PL2A 1UJKA 3LY8A 4UWFA 4MBGA 3L22A 2KCKA 4UI9C 5EYPF 3LJNA 2C0LA 4LNGA 5HKPA 4ILGA 3OAWA 4LCTA 2ZGDA 3ISMC 4IULA 5AJLA 1OCRE 4P29A 3D9PA 1RW2A 2EINE 4UQZA 2CFZA 3NOCD 1OT8A 3ONLA 4ANXA 3AG2E 5A7DB 1MX2A 5KJKA 1LTXA 4JA9A 2GGFA 4FLBA 2I6HA 1UW4B 4JZYA 2DCPA 4U96D 3E33A 2WXOA 3FU3A 2WQ6A 4J7WA 3KS2A 5BV1A 5HRYA 4K5BA 5FZRA 2HYZA 3MA5A 3D3MA 2VTBB 1O1SA 2BKGA 2PZIA 1IHGA 4GTMA 2EIME 3QNKA 1X5BA 1IQUA 3I3NA 5H7PA 1OWLA 4HXIA 4I6JA 5AARA 3SD5A 3TG5A 3AJIA 2ILRA 2WXLA 3FULA 3RKVA 2MHKA 1Q2ZA 2WXKA 4GZ3A 4UWHA 4ATGA 2QZAA 3P1UA 2DBAA 3Q7AA 5E76A 5FT9A 5LCWJ 2XQ0A 4L7TA 2ETBA 3ZKJA 1H0AA 5ANRA 2I1KA 5JJ6A 2GW1A 4HB5A 3B7TA 3QWWA 4ZHBA 4O6FA 3IV0A 1EYHA 4O60A 5B1AE 5BXOA 2J8SD 1G3NB 3PZ1A 2OV8A 3FUJA 3TAXA 2Y1LE 5HS0A 4GU5A 3EHMA 1OUVA 2XCBA 1MZCA 1JCRA 3ZXPA 3W9GA 3HVEA 5AAOA 4A63B 4RLYA 2X6IA 5HI7A 3ZRHA 4K03A 4GZDA 1TN8A 5CEAA 5EIBE 3UKRG 5D0QD 2I9CA 5BV0A 3AU5A 4G1TA 2WXHA 2Y0BG 4WWOA 2L6BA 2OVFA 1HE8A 2H6HA 2H6GA 5D66A 4GB9A 2LXLA 3CVVA 1HF8A 3QB2A 3F6QA 4B93B 2UY1A 3B7UX 3NBNB 2J9QA 4OVUA 3CK8A 1IXVA 4KVOA 1INZA 2LSUA 2X6HA 3N71A 1OCZE 2RFAA 4GTVA 4M7CA 4ILHB 1O1TA 3UT4A 3E37A 4HNAD 2DYSE 2KATA 2VGYA 5ARFA 3OXFA 3OTNA 3PVLA 3TWSA 1FCHA 4J8YA 4CDNA 3FUNA 2ONDA 4I1OB 4DJAA 4HI9A 3V2XA 5JHBA 2F8XK 1JPLA 5EIDA 3U66A 4FP7A 1Y8MA 3UI2A 2H6IA 2KCVA 3E4BA 3ZGQA 2IO2C 4U8HA 4F6RD 4N2SA 3NQPA 5KJNA 2QYUA 3SI5A 5JHAA 5JJTA 1UN9A 3RRUA 2VGXB 3NOGD 5LOZA 4ANVA 2JABA 2XEHA 3EU5A 2PQNA 3B7RL 3MKQA 5HQ8A 4E6HA 3NF1A 4PS3A 4KMOA 2VSOE 1S70B 3LY9A 3QJZA 4IYPA 5KNGA 1A5EA 4MKTA 1K8KG 2V4HC 3SBTB 4F1SA 4FHKA 3G2TA 2AWIA 4MS6A 4AP2A 4N5CA 3JUIA 5G55A 5BW8C 3EJNA 1N4PA 2V4LA 3CHQA 4DX7D 4RSYA 3O4ZA 2BKKB 2WQ7A 2VTBA 3D9IA 3FH5A 4OYSA 3T8MA 2DZNA 4YDWA 3V2OA 2XGMA 3MJWA 4I43A 2LAHA 4HOTA 2KBXA 3MV2B 4D10C 5AIJA 2FF4A 5EYLA 3C3RA 1KPSB 3S2AA 3D9LA 3DXKG 3FUIA 2F37A 2R02A 1MQSA 2FBNA 2HE0A 4AOFA 2CG2A 2XGOA 1MYOA 2FEZA 4N5QA 4MLPA 3IHYA 4LEUA 3SY2A 2KZTB 3AAAC 2A5UA 3MKRA 3FH8A 2ZISA 4FULA 4JVSA 1E8YA 3IKOB 4I6GA 3UM0A 3UM2A 3T5VA 4U0SA 3SBSA 4GA0A 4DUIA 3CV0A 2Y69E 1U3CA 3FUKA 2BUGA 1OWPA 3O48A 3PEVB 2IU1A 4GTOA 3KD7A 3PEUB 3Q9NC 4U63A 4U8YD 1BI7B 2B6CA 2XS8A 3UT7A 3ZNGA 3LVRE 3TWUA 2IONA 3D9OA 3DWLG 2IJGX 4KZCA 3V31A 4DLOA 5G04C 3JYSA 4L9PA 4G2VA 3CVUA 3FTUA 3KSLA 1QNFA 2L6JA 3TXNA 4I1AA 1TN6A 5AQ7A 2IEJA 3HDXA 1NA3A 2LUHA 4JHJA 4RG6A 3HVEB 5LX8A 3L08A 1OWOA 2QC9A 2NSZA 2VSNA 4F53A 3CR3A 1FPPA 1E8XA 2ZIRA 1RZ4A 4O1OA 3SFXA 3ZYLA 3UPVA 1N4RA 3NZSA 4ANUA 1K1AA 2C0MA 3Q15A 2X6FA 3VLDA 4FA6A 4JHRA 2YHEA 2LSVA 3BG1B 5FQ7A 2IO3C 3CHPA 3ZN3A 2UY1B 5AQ9A 1JCQA 3ASFA 2EIJE 3RAUA 2J4DA 4G8LA 3Q79A 1O5MA 1OWMA 3RRNB 3RO3A 2WXQA 2V0PA 4B94A 1OWNA 2L9BA 3SGHA 3D9JA 3U3WA 2XEEA 3IBEA 3S7JA 1EPUA 4PUCA 1YMPA 1QYMA 1LF8A 4HFGA 3FTWA 4XEIG 1FVFA 4U95D 2PM6A 3I4RB 3CQCB 3U9WA 3TWTA 4HS2A 3FEYA 1N11A 1KZOA 3DSTA 4ANWA 4WNFA 1UOHA 1FT1A 3KEAA 3TXMA 3PZDA 4A1SA 4LRZA 3NAWA 3PREA 3UKUG 1OXJA 2KCLA 4G11A 3L54A 2XPZA 3T9KA 4AEZC 2XENA 3CEQA 2DVWA 3VLEA 4B8AA 1XNFA 1KLXA 4KXKB 2A4ZA 3CVQA 3VLFA 3ABKE 4Q96A 3C5RA 2VQ2A 4YVOA 3NB2A 2AXZA 4LERA 1HG2A 2XGSA 3GZSA 4H7XA 4OVVA 3MKQB 1BLXB 1HXIA 4JPSA 5FINA 3AG1E 2J49A 1L5JA 1SZAA 4BESA 2P9NG 4KT6B 3ZFWA 1FVHA 4GYWA 2KZTA 1TNUA 1IHBA 3CVXA 2R5SA 3SO8A 1PAQA 3S7BA 4WWNA 4UQXA 5KBAA 2OEWA 2Y4TA 3LDZA 3B13A 3KAEA 3UMVA 4TXRA 1HO8A 1BPOA 1WY6A 2R05A 4ZFHA 4GAAA 2V8SE 1SQMA 4XX5A 3GW4A 4J8DA 5ITZF 4J0UA 3U64A 3MYVA 3V30A 3JCKC 4DX1A 1HG5A 1UG3A 4TUUA 1U3DA 2V5QC 5EDSA 2R17C 2MOWA 4A1GA 2CHWA 2GRQB 1SW6A 4C48B 3DRAA 5BPPA 3APCA 2IFUA 3Q4AB 2C2LA 4XI9A 5BUZA 1TJCA 3ZYQA 4JEUA 3CQGB 4JB8P 2F8YA 4JC8A 4F7AA 3EU9A 5DIZA 5J08A 2XRYA 1YYHA 4N3BA 3FFLA 4NRHB 4EECA 3ASHA 4HOSA 5JA4D 2ZGGA 1UJJA 3TGOA 3RJVA 1X81A 1V55E 2WB2A 3KSQA 2VGEA 4N39A 2HO1A 4FLHA 4G8KA 4NACA 3WG7E 3IHVA 4YNDA 3UTMA 4KZ0A 2IQCA 2WXIA 4DPRA 5FZQA 4X8QA 3APFA 1QZ2A 4APOA 4BSXA 3K9IA 3PE3A 1DCQA 2P2CP 1WG0A 3I5PA 1K3ZD 4W9RA 1S64A 1TNOA 2VJ8A 4PS8A 3PZ4A 2GRRB 5B1BE 4YVQC 2P9KG 3QDNA 3ABME 2J4BA 3ASNE 2KC7A 4TXQA 5J90A 3PNTB 3RU0A 2V5FA 4FADA 3CHOA 4WNEA 3CK7A 1GW6A 4UQYA 1Z6TA 3FP3A 5T4YA 4QQIA 3CKBA 1E8WA 2WXPA 5FQ4A 4EBAA 4PS7A 3BG0B 3MX3A 4YDOA 3PE4A 5A23A 4FU3A 5G04J 1ZBPA 4URKA 5AYWD 4AM9A 3HRAA 2WMNA 3I4GA 3PZ2A 3DSUA 3QWPA 4G26A 2VYIA 3T5XA 3RK6A 3Q5MA 3EIJA 3LPZA 2DIWA 4Y6CA 3FU6A 4ACLA 4XZ4A 4CRWA 4ACKA 3TWRA 3J5QB 3GZ2A 2GROB 2CFUA 2X6KA 3CVYA 5ENQD 3DEPA 5AQAA 3D9KA 3RRMB 1Y6IA 5KWDA 3J5PA 3EHRA 1SZ9A 4GMJA 1HU3A 4AY6A 2M63A 1IQRA 1O1RA 4I2ZA 4LG6A 4WAFA 1BD8A 2IOSA 3Q73A 1NA0A 4CT4A 1P5QA 3MGBA 1ELRA 2YQ8A 5JMND 3URZA 3R7RA 4ILIA 3LY7A 4TV3A 4GTQA 3SHFA 4Q69A 3B95A 3HXDA 4Z68A 3AS5A 3ZYMA 3HXEA 4R7LA 1Z3XA 3R9MA 5ARGA 4TXPA 3CSTA 4FJZA 3MV3B 4N3AA 3G2VA 3FH7A 3AS4A 2A5EA 3Q49B 3LVQE 3BQOA 5CMWA 4DX2A 3TWXA 4YDYA 2PM7A 3EHNA 5AN8A 2YNQA 3DSSA 3Q7FA 3ZEFA 4UI9J 2CHZA 4RQIA 1H2TC 1E7UA 4UWKA 2XCCA 4XKCA 1DCEA 2WXRA 3E32A 4NIKA 4RVBA 3FU0A 3L6AA 3AG4E 4RG9A 4V3IA 2R59A 4BWRA 3ULQA 1QBQA 1HS6A 1N9AA 3ZW3A 2P58C 1TN7A 3AS8A 5ANLA 5KJLA 3SNXA 5CMYA 3VTXA 4K0RA 4WNDA 1U2VG 2EIKE 2X3MA 4LNUD 2AXUA 3CLJA 4CEMA 5CRVA 1JWFA 1TJFA 3EUVA 3FUHA 2J07A 4I9EA 4DI4A 2NYJA 2E0IA 2FI7A 3ZXSA 1NP7A 2I1JA 1D8DA 2AVPA 2P9PG 1H6OA 3WXXA 5LP0A 3D9NA 5CECB 4GPMA 4BT8A 4GA2A 1N0QA 5ENNA 5CERB 4BFRA 3ABLE 3HG0D 3QAQA 3ESKA 1TYQG 1D9SA 4GMLA 3EIQC 2XHEA 4CDRA 2DYRE 3PUKA 3D9HA 1E96B 4A3TA 1AWCB 2R03A 5G05C 2OOEA 4Y6WA 1KT0A 3QKYA 1B89A 4GTSA 3OXLA 3ML8A 3UXGA 3UINC 3ZUVB 1IYGA 4UUCA 1EDUA 4H7YA 3L17A 2WMOA 2RFMA 4XI0A 1NI1A 5CBNA 2RD0A 3G2WA 4JA7A 1SA4A 4J8FA 4I6EA 3EHQA 2XEVA 3DSVA 3ZIMA 4XKBA 1N54A 2GRLA 5A6CA 1N4QA 1BI8B 1QQEA 4CGWA 1S63A 3S7FA 4ME2A 4BSZB 2CG3A 3TWWA 3Q47B 1DNPA 4BT9A 3CHRA 3C3OA 4LSZE 4L1BA 4XIFA 3LJ3A 3Q9UC 3X2QE 2FO1E 4E85A 1UN8A 4IRUA 4BTBA 4CDMA 4Q94A 3SZ7A 1HFAA 4JD2G 4A55A 2LNIA 3B7BA 5DBKA 1D8EA 1N0RA 2J08A 1OY3D 4OAVB 4ABNA 5T3RA 1E8ZA 3QC1A 2NC9A 3FUDA 4JEHA 3LS8A 1H6KA 3KEZA 1TNZA 2J09A 2I2OA 5FQ6A 2WM9A 4GTTA 4C0EA 4WWPA 4BX8A 3LYAA 1HX8A 2KM4A 4NURA 4A3VA 3DPYA 4GYOA 2LO6A 4CCAA 3FDHA 2WPVA 1TNYA 2PQRA 3UIPC 3TJPA 3UIOC 4HOQA 3CSFA 5ENRD 2JLBA 4JL0A 2XRZA 2BF0X 3QOUA 4MRUA 3BUAA 5IY5E 2FULA 2OVBA 3GYZA 5CHEE 4I1MA 2NXPA 2F0YA 3FWVA 4I2WA 3DXMG 3DEOA 1YCSB 5E75A 2L0IA 4KVMA 4F1PA 2EILE 5BXUA 2XPYA 3JXJA 4EQFA 2AW6A 4AVXA 3MEKA 2RKKA 3L13A 3CIAA 3JQ0A 2VSYA 3SF4A 1N95A 5ENTD 1WDYA 3L82A 3JXIA 4HRLA 3BEEA 1ELKA 3ENEA 4HOUA 3TG4A 1SVXA 5FWQA 1MX6A 3S7DA 2E2EA 5FIOA 4U07A 3V79K 5AENA 4EZJA 2ETAA 2BTDA 4TUMA 3L16A 3E34A 5FZSA 4BEPA 3P2BA 3CK9A 4I17A 3MCXA 3ULEG 3FTZA 3FUEA 3UM3A 3ASGA 3JUEA 1AP7A 3LCAA 4DI3A 2YINA 3HHMA 1HZ4A 3MZLB 5BT1A 5FTPA 3IEGA 2XS1A 2Y3AA 5KCMA 5G2NA 4JHKA 2ETCA 3W9FA 3APDA 2X38A 4AJWA
chains in the Genus database with same CATH topology
4DX6D 2PNNA 3W9GA 5AAOA 2XZTG 5ENPD 3UI2A 4HQDA 4LG6A 4RLYA 4A63B 5ITZF 1BI8B 1BD8A 4O1OA 4LNUD 4F6RD 2HE0A 3V30A 4DX1A 5JMND 3C5RA 4BSZB 4U96D 3DEOA 1YCSB 1K1AA 4K5AB 1MYOA 4N5QA 3TWWA 5CEAA 2KXPC 4F1PA 3TWVA 4J7WA 5EIBE 2V5QC 3TWQA 5BXUA 3JXJA 4CZ2D 4U8VD 1NFIE 2NYJA 1IKND 3AAAC 3B95A 4LSZE 1K1BA 5AQBA 2DWZA 1SW6A 3NOGD 4Z68A 2Y0BG 4CYMD 5EN5D 5HRYA 4C48B 1DC2A 1MX4A 2L6BA 3Q9UC 4K5BA 2FO1E 5D66A 4GMRA 2JABA 5AQ9A 2AJAA 1BLXB 2XEHA 5CEDB 4G8LA 1TR4A 5CECB 2BKGA 4GPMA 4HLLA 5ENTD 3T8KA 3F6QA 4JB8P 4B93B 1N0QA 4DX5D 1WDYA 2F8YA 3JXIA 2B0OE 3B7BA 4HRLA 4QQIA 4DUIA 5CERB 5FINA 1S70B 3NBNB 1MJ0A 1N0RA 3HG0D 4OAVB 1OY3D 1SVXA 3EU9A 4ATZD 1D9SA 1MX6A 3ZU7B 5KNGA 1A5EA 1YYHA 2A5EA 2V4HC 3IXEA 1IXVA 5EYPF 5FIOA 2XEEA 5AARA 4BESA 3LJNA 4HRMB 3Q9NC 4DX2A 3AJIA 4U8YD 1BI7B 3D9HA 4HRNA 4HI8A 5KNHD 3TWXA 4BERA 5JA4D 3ZNGA 4YDYA 2ZGGA 3V79K 5HKPA 1YMPA 1QYMA 4QFVA 5AN8A 3TWUA 2ETAA 1IHBA 4TUMA 1AWCB 4OAUC 4BEPA 3HRAA 2RFAA 4U95D 3SO8A 3TWTA 3V31A 2ZGDA 2ETBA 3ZKJA 1N11A 2QYJA 2VGEA 3JUEA 5KBAA 1AP7A 4DX7D 3UXGA 2BKKB 4G8KA 4NIKA 1UOHA 3ZUVB 4UUCA 4HNAD 3KEAA 3UTMA 2DZNA 4YDWA 4HB5A 3V2OA 4K5CA 5ENSD 5ENOD 3NOCD 3TWSA 2RFMA 3TWRA 1OT8A 3J5QB 5AQ7A 4BETA 4ZHBA 2KBXA 4J8YA 5CBNA 2MYOA 1MX2A 4O60A 4O1PA 2XZDG 2DZOA 5ENQD 2ETCA 1DCQA 5EYLA 4ZFHA 5BXOA 1BU9A 4DRXE 2P2CP 3DEPA 2J8SD 1G3NB 1WG0A 5AQAA 4HI9A 1K3ZD 5EILA 3V2XA 5CBOA 2F8XK 3T9KA 3W9FA 3EHQA 5KWDA 3J5PA 5EIDA 5ENRD 3EHRA 2QC9A 2Y1LE 4HBDA 2XENA 5HS0A 2F37A 2DVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DX6 D;  2PNN A;  3W9G A;  5AAO A;  2XZT G;  5ENP D;  3UI2 A;  4HQD A;  4LG6 A;  4RLY A;  4A63 B;  5ITZ F;  1BI8 B;  1BD8 A;  4O1O A;  4LNU D;  4F6R D;  2HE0 A;  3V30 A;  4DX1 A;  5JMN D;  3C5R A;  4BSZ B;  4U96 D;  3DEO A;  1YCS B;  1K1A A;  4K5A B;  1MYO A;  4N5Q A;  3TWW A;  5CEA A;  2KXP C;  4F1P A;  3TWV A;  4J7W A;  5EIB E;  2V5Q C;  3TWQ A;  5BXU A;  3JXJ A;  4CZ2 D;  4U8V D;  1NFI E;  2NYJ A;  1IKN D;  3AAA C;  3B95 A;  4LSZ E;  1K1B A;  5AQB A;  2DWZ A;  1SW6 A;  3NOG D;  4Z68 A;  2Y0B G;  4CYM D;  5EN5 D;  5HRY A;  4C48 B;  1DC2 A;  1MX4 A;  2L6B A;  3Q9U C;  4K5B A;  2FO1 E;  5D66 A;  4GMR A;  2JAB A;  5AQ9 A;  2AJA A;  1BLX B;  2XEH A;  5CED B;  4G8L A;  1TR4 A;  5CEC B;  2BKG A;  4GPM A;  4HLL A;  5ENT D;  3T8K A;  3F6Q A;  4JB8 P;  4B93 B;  1N0Q A;  4DX5 D;  1WDY A;  2F8Y A;  3JXI A;  2B0O E;  3B7B A;  4HRL A;  4QQI A;  4DUI A;  5CER B;  5FIN A;  1S70 B;  3NBN B;  1MJ0 A;  1N0R A;  3HG0 D;  4OAV B;  1OY3 D;  1SVX A;  3EU9 A;  4ATZ D;  1D9S A;  1MX6 A;  3ZU7 B;  5KNG A;  1A5E A;  1YYH A;  2A5E A;  2V4H C;  3IXE A;  1IXV A;  5EYP F;  5FIO A;  2XEE A;  5AAR A;  4BES A;  3LJN A;  4HRM B;  3Q9N C;  4DX2 A;  3AJI A;  4U8Y D;  1BI7 B;  3D9H A;  4HRN A;  4HI8 A;  5KNH D;  3TWX A;  4BER A;  5JA4 D;  3ZNG A;  4YDY A;  2ZGG A;  3V79 K;  5HKP A;  1YMP A;  1QYM A;  4QFV A;  5AN8 A;  3TWU A;  2ETA A;  1IHB A;  4TUM A;  1AWC B;  4OAU C;  4BEP A;  3HRA A;  2RFA A;  4U95 D;  3SO8 A;  3TWT A;  3V31 A;  2ZGD A;  2ETB A;  3ZKJ A;  1N11 A;  2QYJ A;  2VGE A;  3JUE A;  5KBA A;  1AP7 A;  4DX7 D;  3UXG A;  2BKK B;  4G8K A;  4NIK A;  1UOH A;  3ZUV B;  4UUC A;  4HNA D;  3KEA A;  3UTM A;  2DZN A;  4YDW A;  4HB5 A;  3V2O A;  4K5C A;  5ENS D;  5ENO D;  3NOC D;  3TWS A;  2RFM A;  3TWR A;  1OT8 A;  3J5Q B;  5AQ7 A;  4BET A;  4ZHB A;  2KBX A;  4J8Y A;  5CBN A;  2MYO A;  1MX2 A;  4O60 A;  4O1P A;  2XZD G;  2DZO A;  5ENQ D;  2ETC A;  1DCQ A;  5EYL A;  4ZFH A;  5BXO A;  1BU9 A;  4DRX E;  2P2C P;  3DEP A;  2J8S D;  1G3N B;  1WG0 A;  5AQA A;  4HI9 A;  1K3Z D;  5EIL A;  3V2X A;  5CBO A;  2F8X K;  3T9K A;  3W9F A;  3EHQ A;  5KWD A;  3J5P A;  5EID A;  5ENR D;  3EHR A;  2QC9 A;  2Y1L E;  4HBD A;  2XEN A;  5HS0 A;  2F37 A;  2DVW A; 
#chains in the Genus database with same CATH topology
 1PY1 A;  5ENP D;  4FJY A;  3CKC A;  1HH8 A;  4BX9 A;  5C2Y A;  1H19 A;  4F3V A;  1Z5S C;  4K5A B;  3SFZ A;  3G2S A;  5T8I A;  1TNB A;  3PS6 A;  4CGV A;  2UWJ G;  5AQB A;  2AXV A;  3B7S A;  4U04 A;  5CRU A;  4WUY A;  5LFA A;  3ZHE A;  4UWL A;  3BU8 A;  5CED B;  3PUJ A;  4HLL A;  1KT1 A;  4BTA A;  2WVI A;  4DX5 D;  2B0O E;  5CCM A;  2R2L A;  3QK0 A;  1MJ0 A;  5EKQ D;  3FY4 A;  4ATZ D;  4GZ5 A;  3ZU7 B;  3HIZ A;  3IXE A;  1H2V C;  1ZU2 A;  2L0T B;  3ONK A;  2LXM A;  4L2Y A;  3FHE A;  4G25 A;  4HRN A;  4GZ6 A;  2ZU6 B;  3SQV A;  4PDX A;  4GYY A;  1JCS A;  2OCC E;  4LUN U;  3ULY A;  4HLE A;  3CHS A;  4AXH A;  2IF4 A;  4AIF A;  4EHM A;  3E30 A;  5AJD A;  3CGH A;  2QYJ A;  4TRQ A;  1NZN A;  3FU5 A;  4EPZ A;  2MRI A;  3AU4 A;  1VDY A;  5LCW C;  4DLQ A;  4BET A;  3UX4 A;  1N94 A;  2MYO A;  3Q78 A;  2DZO A;  3GZ1 A;  1DVP A;  3EDT B;  3C98 A;  4G24 A;  5EIL A;  5CBO A;  4DK5 A;  2Y4U A;  3D9M A;  4HBD A;  3PNL B;  4CT0 A;  3FTV A;  2H6F A;  4DX6 D;  4N2Q A;  2WXM A;  3DSX A;  2GRP B;  3ML9 A;  4HQD A;  3RO2 A;  4C0M A;  5C1D A;  2P9U G;  3FTY A;  4JXT A;  1SA5 A;  1WAO 1;  2RG8 A;  3DSW A;  4EZK A;  3LXU X;  4CZ2 D;  4U8V D;  3CVW A;  4NQ0 A;  1NFI E;  2VSX E;  1IKN D;  4LNB A;  3VTY A;  5B3S E;  2GRM A;  1MHQ A;  3QWV A;  2WQH A;  4GMR A;  4PH4 B;  4L2L A;  1TR4 A;  3PRZ A;  1LD7 A;  4KYO B;  3UUX A;  3ASD A;  4EZL A;  3HXF A;  2YHC A;  5BNW A;  5JJ7 A;  4HOR A;  4GA1 A;  5FJY A;  3UQ3 A;  2BED A;  3C3Q A;  1OCC E;  4GZC A;  5G05 J;  2XPI A;  3FUM A;  3DBS A;  4HRM B;  1KZP A;  1JUQ A;  4EBA G;  1PC2 A;  4BER A;  5KNH D;  4HI8 A;  4QFV A;  3AG3 E;  1ZB1 A;  4OAU C;  3PH0 C;  3C72 A;  3PZ3 A;  1Z3Y A;  4YDE A;  4HVB A;  4GCO A;  4U0U A;  3RIB A;  3ZYK A;  3R9A B;  4GPK A;  4N3C A;  5KJM A;  1E7V A;  4L23 A;  2WXF A;  3ZPJ A;  3HYM B;  4GTR A;  4K5C A;  4U7E B;  5ENS D;  4B0Z A;  5ENO D;  2OEV A;  1N52 A;  3PDN A;  2HM8 A;  2XZD G;  4J8S A;  3FEX A;  3ESL A;  1XGW A;  5EX3 A;  2X6J A;  4UI9 K;  4APF A;  2XZT G;  3RSE G;  3CHM A;  3TL5 A;  1E90 A;  3UT8 A;  2IOL A;  3LKU A;  2LAI A;  4GTP A;  1K1B A;  1NL4 A;  2EQX A;  2JEK A;  1H2U A;  4CYM D;  1V54 E;  5EN5 D;  1DC2 A;  1MX4 A;  2WXJ A;  4J6I A;  1EF1 C;  4AV7 A;  2WXN A;  3QAR A;  2HR2 A;  4B8C B;  3FTS A;  4XE0 A;  4C9B B;  3JQ1 A;  2P9S G;  3DPD A;  1A17 A;  4J8E A;  1JWG A;  4KBQ A;  1WM5 A;  3ZVV A;  1ELW A;  4I9C A;  4B89 A;  2QY7 A;  5M72 A;  4IN3 B;  1TEZ A;  2P9L G;  3CVP A;  4FHJ A;  4AY5 A;  4WNG A;  2FO7 A;  4UWG A;  1YA0 A;  1OCO E;  4BY6 A;  1N4S A;  2GRN B;  2Q7F A;  2ZXW E;  2WXG A;  3NZU A;  1FT2 A;  5D2M C;  4O1P A;  2CHX A;  1BU9 A;  4DRX E;  3UM1 A;  3Q75 A;  4FC8 A;  3OXG A;  3LEW A;  2PNN A;  2P9I G;  2IY0 C;  5D0O D;  2QFC A;  3CVN A;  3G2U A;  3CVL A;  3HXC A;  4GCN A;  4U0Z A;  4M3O A;  3ASO E;  4G23 A;  2KXP C;  3TWV A;  3U4T A;  3ZHE B;  3TWQ A;  3FTX A;  5EX0 A;  1H6P A;  3FUF A;  3R7Q A;  2DWZ A;  3L9T A;  4JW1 A;  1LD8 A;  5FQ8 A;  5CCL A;  3HXB A;  1S0P A;  1W3B A;  2AJA A;  2VGX A;  3SFY A;  3T8K A;  2PL2 A;  1UJK A;  3LY8 A;  4UWF A;  4MBG A;  3L22 A;  2KCK A;  4UI9 C;  5EYP F;  3LJN A;  2C0L A;  4LNG A;  5HKP A;  4ILG A;  3OAW A;  4LCT A;  2ZGD A;  3ISM C;  4IUL A;  5AJL A;  1OCR E;  4P29 A;  3D9P A;  1RW2 A;  2EIN E;  4UQZ A;  2CFZ A;  3NOC D;  1OT8 A;  3ONL A;  4ANX A;  3AG2 E;  5A7D B;  1MX2 A;  5KJK A;  1LTX A;  4JA9 A;  2GGF A;  4FLB A;  2I6H A;  1UW4 B;  4JZY A;  2DCP A;  4U96 D;  3E33 A;  2WXO A;  3FU3 A;  2WQ6 A;  4J7W A;  3KS2 A;  5BV1 A;  5HRY A;  4K5B A;  5FZR A;  2HYZ A;  3MA5 A;  3D3M A;  2VTB B;  1O1S A;  2BKG A;  2PZI A;  1IHG A;  4GTM A;  2EIM E;  3QNK A;  1X5B A;  1IQU A;  3I3N A;  5H7P A;  1OWL A;  4HXI A;  4I6J A;  5AAR A;  3SD5 A;  3TG5 A;  3AJI A;  2ILR A;  2WXL A;  3FUL A;  3RKV A;  2MHK A;  1Q2Z A;  2WXK A;  4GZ3 A;  4UWH A;  4ATG A;  2QZA A;  3P1U A;  2DBA A;  3Q7A A;  5E76 A;  5FT9 A;  5LCW J;  2XQ0 A;  4L7T A;  2ETB A;  3ZKJ A;  1H0A A;  5ANR A;  2I1K A;  5JJ6 A;  2GW1 A;  4HB5 A;  3B7T A;  3QWW A;  4ZHB A;  4O6F A;  3IV0 A;  1EYH A;  4O60 A;  5B1A E;  5BXO A;  2J8S D;  1G3N B;  3PZ1 A;  2OV8 A;  3FUJ A;  3TAX A;  2Y1L E;  5HS0 A;  4GU5 A;  3EHM A;  1OUV A;  2XCB A;  1MZC A;  1JCR A;  3ZXP A;  3W9G A;  3HVE A;  5AAO A;  4A63 B;  4RLY A;  2X6I A;  5HI7 A;  3ZRH A;  4K03 A;  4GZD A;  1TN8 A;  5CEA A;  5EIB E;  3UKR G;  5D0Q D;  2I9C A;  5BV0 A;  3AU5 A;  4G1T A;  2WXH A;  2Y0B G;  4WWO A;  2L6B A;  2OVF A;  1HE8 A;  2H6H A;  2H6G A;  5D66 A;  4GB9 A;  2LXL A;  3CVV A;  1HF8 A;  3QB2 A;  3F6Q A;  4B93 B;  2UY1 A;  3B7U X;  3NBN B;  2J9Q A;  4OVU A;  3CK8 A;  1IXV A;  4KVO A;  1INZ A;  2LSU A;  2X6H A;  3N71 A;  1OCZ E;  2RFA A;  4GTV A;  4M7C A;  4ILH B;  1O1T A;  3UT4 A;  3E37 A;  4HNA D;  2DYS E;  2KAT A;  2VGY A;  5ARF A;  3OXF A;  3OTN A;  3PVL A;  3TWS A;  1FCH A;  4J8Y A;  4CDN A;  3FUN A;  2OND A;  4I1O B;  4DJA A;  4HI9 A;  3V2X A;  5JHB A;  2F8X K;  1JPL A;  5EID A;  3U66 A;  4FP7 A;  1Y8M A;  3UI2 A;  2H6I A;  2KCV A;  3E4B A;  3ZGQ A;  2IO2 C;  4U8H A;  4F6R D;  4N2S A;  3NQP A;  5KJN A;  2QYU A;  3SI5 A;  5JHA A;  5JJT A;  1UN9 A;  3RRU A;  2VGX B;  3NOG D;  5LOZ A;  4ANV A;  2JAB A;  2XEH A;  3EU5 A;  2PQN A;  3B7R L;  3MKQ A;  5HQ8 A;  4E6H A;  3NF1 A;  4PS3 A;  4KMO A;  2VSO E;  1S70 B;  3LY9 A;  3QJZ A;  4IYP A;  5KNG A;  1A5E A;  4MKT A;  1K8K G;  2V4H C;  3SBT B;  4F1S A;  4FHK A;  3G2T A;  2AWI A;  4MS6 A;  4AP2 A;  4N5C A;  3JUI A;  5G55 A;  5BW8 C;  3EJN A;  1N4P A;  2V4L A;  3CHQ A;  4DX7 D;  4RSY A;  3O4Z A;  2BKK B;  2WQ7 A;  2VTB A;  3D9I A;  3FH5 A;  4OYS A;  3T8M A;  2DZN A;  4YDW A;  3V2O A;  2XGM A;  3MJW A;  4I43 A;  2LAH A;  4HOT A;  2KBX A;  3MV2 B;  4D10 C;  5AIJ A;  2FF4 A;  5EYL A;  3C3R A;  1KPS B;  3S2A A;  3D9L A;  3DXK G;  3FUI A;  2F37 A;  2R02 A;  1MQS A;  2FBN A;  2HE0 A;  4AOF A;  2CG2 A;  2XGO A;  1MYO A;  2FEZ A;  4N5Q A;  4MLP A;  3IHY A;  4LEU A;  3SY2 A;  2KZT B;  3AAA C;  2A5U A;  3MKR A;  3FH8 A;  2ZIS A;  4FUL A;  4JVS A;  1E8Y A;  3IKO B;  4I6G A;  3UM0 A;  3UM2 A;  3T5V A;  4U0S A;  3SBS A;  4GA0 A;  4DUI A;  3CV0 A;  2Y69 E;  1U3C A;  3FUK A;  2BUG A;  1OWP A;  3O48 A;  3PEV B;  2IU1 A;  4GTO A;  3KD7 A;  3PEU B;  3Q9N C;  4U63 A;  4U8Y D;  1BI7 B;  2B6C A;  2XS8 A;  3UT7 A;  3ZNG A;  3LVR E;  3TWU A;  2ION A;  3D9O A;  3DWL G;  2IJG X;  4KZC A;  3V31 A;  4DLO A;  5G04 C;  3JYS A;  4L9P A;  4G2V A;  3CVU A;  3FTU A;  3KSL A;  1QNF A;  2L6J A;  3TXN A;  4I1A A;  1TN6 A;  5AQ7 A;  2IEJ A;  3HDX A;  1NA3 A;  2LUH A;  4JHJ A;  4RG6 A;  3HVE B;  5LX8 A;  3L08 A;  1OWO A;  2QC9 A;  2NSZ A;  2VSN A;  4F53 A;  3CR3 A;  1FPP A;  1E8X A;  2ZIR A;  1RZ4 A;  4O1O A;  3SFX A;  3ZYL A;  3UPV A;  1N4R A;  3NZS A;  4ANU A;  1K1A A;  2C0M A;  3Q15 A;  2X6F A;  3VLD A;  4FA6 A;  4JHR A;  2YHE A;  2LSV A;  3BG1 B;  5FQ7 A;  2IO3 C;  3CHP A;  3ZN3 A;  2UY1 B;  5AQ9 A;  1JCQ A;  3ASF A;  2EIJ E;  3RAU A;  2J4D A;  4G8L A;  3Q79 A;  1O5M A;  1OWM A;  3RRN B;  3RO3 A;  2WXQ A;  2V0P A;  4B94 A;  1OWN A;  2L9B A;  3SGH A;  3D9J A;  3U3W A;  2XEE A;  3IBE A;  3S7J A;  1EPU A;  4PUC A;  1YMP A;  1QYM A;  1LF8 A;  4HFG A;  3FTW A;  4XEI G;  1FVF A;  4U95 D;  2PM6 A;  3I4R B;  3CQC B;  3U9W A;  3TWT A;  4HS2 A;  3FEY A;  1N11 A;  1KZO A;  3DST A;  4ANW A;  4WNF A;  1UOH A;  1FT1 A;  3KEA A;  3TXM A;  3PZD A;  4A1S A;  4LRZ A;  3NAW A;  3PRE A;  3UKU G;  1OXJ A;  2KCL A;  4G11 A;  3L54 A;  2XPZ A;  3T9K A;  4AEZ C;  2XEN A;  3CEQ A;  2DVW A;  3VLE A;  4B8A A;  1XNF A;  1KLX A;  4KXK B;  2A4Z A;  3CVQ A;  3VLF A;  3ABK E;  4Q96 A;  3C5R A;  2VQ2 A;  4YVO A;  3NB2 A;  2AXZ A;  4LER A;  1HG2 A;  2XGS A;  3GZS A;  4H7X A;  4OVV A;  3MKQ B;  1BLX B;  1HXI A;  4JPS A;  5FIN A;  3AG1 E;  2J49 A;  1L5J A;  1SZA A;  4BES A;  2P9N G;  4KT6 B;  3ZFW A;  1FVH A;  4GYW A;  2KZT A;  1TNU A;  1IHB A;  3CVX A;  2R5S A;  3SO8 A;  1PAQ A;  3S7B A;  4WWN A;  4UQX A;  5KBA A;  2OEW A;  2Y4T A;  3LDZ A;  3B13 A;  3KAE A;  3UMV A;  4TXR A;  1HO8 A;  1BPO A;  1WY6 A;  2R05 A;  4ZFH A;  4GAA A;  2V8S E;  1SQM A;  4XX5 A;  3GW4 A;  4J8D A;  5ITZ F;  4J0U A;  3U64 A;  3MYV A;  3V30 A;  3JCK C;  4DX1 A;  1HG5 A;  1UG3 A;  4TUU A;  1U3D A;  2V5Q C;  5EDS A;  2R17 C;  2MOW A;  4A1G A;  2CHW A;  2GRQ B;  1SW6 A;  4C48 B;  3DRA A;  5BPP A;  3APC A;  2IFU A;  3Q4A B;  2C2L A;  4XI9 A;  5BUZ A;  1TJC A;  3ZYQ A;  4JEU A;  3CQG B;  4JB8 P;  2F8Y A;  4JC8 A;  4F7A A;  3EU9 A;  5DIZ A;  5J08 A;  2XRY A;  1YYH A;  4N3B A;  3FFL A;  4NRH B;  4EEC A;  3ASH A;  4HOS A;  5JA4 D;  2ZGG A;  1UJJ A;  3TGO A;  3RJV A;  1X81 A;  1V55 E;  2WB2 A;  3KSQ A;  2VGE A;  4N39 A;  2HO1 A;  4FLH A;  4G8K A;  4NAC A;  3WG7 E;  3IHV A;  4YND A;  3UTM A;  4KZ0 A;  2IQC A;  2WXI A;  4DPR A;  5FZQ A;  4X8Q A;  3APF A;  1QZ2 A;  4APO A;  4BSX A;  3K9I A;  3PE3 A;  1DCQ A;  2P2C P;  1WG0 A;  3I5P A;  1K3Z D;  4W9R A;  1S64 A;  1TNO A;  2VJ8 A;  4PS8 A;  3PZ4 A;  2GRR B;  5B1B E;  4YVQ C;  2P9K G;  3QDN A;  3ABM E;  2J4B A;  3ASN E;  2KC7 A;  4TXQ A;  5J90 A;  3PNT B;  3RU0 A;  2V5F A;  4FAD A;  3CHO A;  4WNE A;  3CK7 A;  1GW6 A;  4UQY A;  1Z6T A;  3FP3 A;  5T4Y A;  4QQI A;  3CKB A;  1E8W A;  2WXP A;  5FQ4 A;  4EBA A;  4PS7 A;  3BG0 B;  3MX3 A;  4YDO A;  3PE4 A;  5A23 A;  4FU3 A;  5G04 J;  1ZBP A;  4URK A;  5AYW D;  4AM9 A;  3HRA A;  2WMN A;  3I4G A;  3PZ2 A;  3DSU A;  3QWP A;  4G26 A;  2VYI A;  3T5X A;  3RK6 A;  3Q5M A;  3EIJ A;  3LPZ A;  2DIW A;  4Y6C A;  3FU6 A;  4ACL A;  4XZ4 A;  4CRW A;  4ACK A;  3TWR A;  3J5Q B;  3GZ2 A;  2GRO B;  2CFU A;  2X6K A;  3CVY A;  5ENQ D;  3DEP A;  5AQA A;  3D9K A;  3RRM B;  1Y6I A;  5KWD A;  3J5P A;  3EHR A;  1SZ9 A;  4GMJ A;  1HU3 A;  4AY6 A;  2M63 A;  1IQR A;  1O1R A;  4I2Z A;  4LG6 A;  4WAF A;  1BD8 A;  2IOS A;  3Q73 A;  1NA0 A;  4CT4 A;  1P5Q A;  3MGB A;  1ELR A;  2YQ8 A;  5JMN D;  3URZ A;  3R7R A;  4ILI A;  3LY7 A;  4TV3 A;  4GTQ A;  3SHF A;  4Q69 A;  3B95 A;  3HXD A;  4Z68 A;  3AS5 A;  3ZYM A;  3HXE A;  4R7L A;  1Z3X A;  3R9M A;  5ARG A;  4TXP A;  3CST A;  4FJZ A;  3MV3 B;  4N3A A;  3G2V A;  3FH7 A;  3AS4 A;  2A5E A;  3Q49 B;  3LVQ E;  3BQO A;  5CMW A;  4DX2 A;  3TWX A;  4YDY A;  2PM7 A;  3EHN A;  5AN8 A;  2YNQ A;  3DSS A;  3Q7F A;  3ZEF A;  4UI9 J;  2CHZ A;  4RQI A;  1H2T C;  1E7U A;  4UWK A;  2XCC A;  4XKC A;  1DCE A;  2WXR A;  3E32 A;  4NIK A;  4RVB A;  3FU0 A;  3L6A A;  3AG4 E;  4RG9 A;  4V3I A;  2R59 A;  4BWR A;  3ULQ A;  1QBQ A;  1HS6 A;  1N9A A;  3ZW3 A;  2P58 C;  1TN7 A;  3AS8 A;  5ANL A;  5KJL A;  3SNX A;  5CMY A;  3VTX A;  4K0R A;  4WND A;  1U2V G;  2EIK E;  2X3M A;  4LNU D;  2AXU A;  3CLJ A;  4CEM A;  5CRV A;  1JWF A;  1TJF A;  3EUV A;  3FUH A;  2J07 A;  4I9E A;  4DI4 A;  2NYJ A;  2E0I A;  2FI7 A;  3ZXS A;  1NP7 A;  2I1J A;  1D8D A;  2AVP A;  2P9P G;  1H6O A;  3WXX A;  5LP0 A;  3D9N A;  5CEC B;  4GPM A;  4BT8 A;  4GA2 A;  1N0Q A;  5ENN A;  5CER B;  4BFR A;  3ABL E;  3HG0 D;  3QAQ A;  3ESK A;  1TYQ G;  1D9S A;  4GML A;  3EIQ C;  2XHE A;  4CDR A;  2DYR E;  3PUK A;  3D9H A;  1E96 B;  4A3T A;  1AWC B;  2R03 A;  5G05 C;  2OOE A;  4Y6W A;  1KT0 A;  3QKY A;  1B89 A;  4GTS A;  3OXL A;  3ML8 A;  3UXG A;  3UIN C;  3ZUV B;  1IYG A;  4UUC A;  1EDU A;  4H7Y A;  3L17 A;  2WMO A;  2RFM A;  4XI0 A;  1NI1 A;  5CBN A;  2RD0 A;  3G2W A;  4JA7 A;  1SA4 A;  4J8F A;  4I6E A;  3EHQ A;  2XEV A;  3DSV A;  3ZIM A;  4XKB A;  1N54 A;  2GRL A;  5A6C A;  1N4Q A;  1BI8 B;  1QQE A;  4CGW A;  1S63 A;  3S7F A;  4ME2 A;  4BSZ B;  2CG3 A;  3TWW A;  3Q47 B;  1DNP A;  4BT9 A;  3CHR A;  3C3O A;  4LSZ E;  4L1B A;  4XIF A;  3LJ3 A;  3Q9U C;  3X2Q E;  2FO1 E;  4E85 A;  1UN8 A;  4IRU A;  4BTB A;  4CDM A;  4Q94 A;  3SZ7 A;  1HFA A;  4JD2 G;  4A55 A;  2LNI A;  3B7B A;  5DBK A;  1D8E A;  1N0R A;  2J08 A;  1OY3 D;  4OAV B;  4ABN A;  5T3R A;  1E8Z A;  3QC1 A;  2NC9 A;  3FUD A;  4JEH A;  3LS8 A;  1H6K A;  3KEZ A;  1TNZ A;  2J09 A;  2I2O A;  5FQ6 A;  2WM9 A;  4GTT A;  4C0E A;  4WWP A;  4BX8 A;  3LYA A;  1HX8 A;  2KM4 A;  4NUR A;  4A3V A;  3DPY A;  4GYO A;  2LO6 A;  4CCA A;  3FDH A;  2WPV A;  1TNY A;  2PQR A;  3UIP C;  3TJP A;  3UIO C;  4HOQ A;  3CSF A;  5ENR D;  2JLB A;  4JL0 A;  2XRZ A;  2BF0 X;  3QOU A;  4MRU A;  3BUA A;  5IY5 E;  2FUL A;  2OVB A;  3GYZ A;  5CHE E;  4I1M A;  2NXP A;  2F0Y A;  3FWV A;  4I2W A;  3DXM G;  3DEO A;  1YCS B;  5E75 A;  2L0I A;  4KVM A;  4F1P A;  2EIL E;  5BXU A;  2XPY A;  3JXJ A;  4EQF A;  2AW6 A;  4AVX A;  3MEK A;  2RKK A;  3L13 A;  3CIA A;  3JQ0 A;  2VSY A;  3SF4 A;  1N95 A;  5ENT D;  1WDY A;  3L82 A;  3JXI A;  4HRL A;  3BEE A;  1ELK A;  3ENE A;  4HOU A;  3TG4 A;  1SVX A;  5FWQ A;  1MX6 A;  3S7D A;  2E2E A;  5FIO A;  4U07 A;  3V79 K;  5AEN A;  4EZJ A;  2ETA A;  2BTD A;  4TUM A;  3L16 A;  3E34 A;  5FZS A;  4BEP A;  3P2B A;  3CK9 A;  4I17 A;  3MCX A;  3ULE G;  3FTZ A;  3FUE A;  3UM3 A;  3ASG A;  3JUE A;  1AP7 A;  3LCA A;  4DI3 A;  2YIN A;  3HHM A;  1HZ4 A;  3MZL B;  5BT1 A;  5FTP A;  3IEG A;  2XS1 A;  2Y3A A;  5KCM A;  5G2N A;  4JHK A;  2ETC A;  3W9F A;  3APD A;  2X38 A;  4AJW A; 
#chains in the Genus database with same CATH homology
 4DX6 D;  2PNN A;  3W9G A;  5AAO A;  2XZT G;  5ENP D;  3UI2 A;  4HQD A;  4LG6 A;  4RLY A;  4A63 B;  5ITZ F;  1BI8 B;  1BD8 A;  4O1O A;  4LNU D;  4F6R D;  2HE0 A;  3V30 A;  4DX1 A;  5JMN D;  3C5R A;  4BSZ B;  4U96 D;  3DEO A;  1YCS B;  1K1A A;  4K5A B;  1MYO A;  4N5Q A;  3TWW A;  5CEA A;  2KXP C;  4F1P A;  3TWV A;  4J7W A;  5EIB E;  2V5Q C;  3TWQ A;  5BXU A;  3JXJ A;  4CZ2 D;  4U8V D;  1NFI E;  2NYJ A;  1IKN D;  3AAA C;  3B95 A;  4LSZ E;  1K1B A;  5AQB A;  2DWZ A;  1SW6 A;  3NOG D;  4Z68 A;  2Y0B G;  4CYM D;  5EN5 D;  5HRY A;  4C48 B;  1DC2 A;  1MX4 A;  2L6B A;  3Q9U C;  4K5B A;  2FO1 E;  5D66 A;  4GMR A;  2JAB A;  5AQ9 A;  2AJA A;  1BLX B;  2XEH A;  5CED B;  4G8L A;  1TR4 A;  5CEC B;  2BKG A;  4GPM A;  4HLL A;  5ENT D;  3T8K A;  3F6Q A;  4JB8 P;  4B93 B;  1N0Q A;  4DX5 D;  1WDY A;  2F8Y A;  3JXI A;  2B0O E;  3B7B A;  4HRL A;  4QQI A;  4DUI A;  5CER B;  5FIN A;  1S70 B;  3NBN B;  1MJ0 A;  1N0R A;  3HG0 D;  4OAV B;  1OY3 D;  1SVX A;  3EU9 A;  4ATZ D;  1D9S A;  1MX6 A;  3ZU7 B;  5KNG A;  1A5E A;  1YYH A;  2A5E A;  2V4H C;  3IXE A;  1IXV A;  5EYP F;  5FIO A;  2XEE A;  5AAR A;  4BES A;  3LJN A;  4HRM B;  3Q9N C;  4DX2 A;  3AJI A;  4U8Y D;  1BI7 B;  3D9H A;  4HRN A;  4HI8 A;  5KNH D;  3TWX A;  4BER A;  5JA4 D;  3ZNG A;  4YDY A;  2ZGG A;  3V79 K;  5HKP A;  1YMP A;  1QYM A;  4QFV A;  5AN8 A;  3TWU A;  2ETA A;  1IHB A;  4TUM A;  1AWC B;  4OAU C;  4BEP A;  3HRA A;  2RFA A;  4U95 D;  3SO8 A;  3TWT A;  3V31 A;  2ZGD A;  2ETB A;  3ZKJ A;  1N11 A;  2QYJ A;  2VGE A;  3JUE A;  5KBA A;  1AP7 A;  4DX7 D;  3UXG A;  2BKK B;  4G8K A;  4NIK A;  1UOH A;  3ZUV B;  4UUC A;  4HNA D;  3KEA A;  3UTM A;  2DZN A;  4YDW A;  4HB5 A;  3V2O A;  4K5C A;  5ENS D;  5ENO D;  3NOC D;  3TWS A;  2RFM A;  3TWR A;  1OT8 A;  3J5Q B;  5AQ7 A;  4BET A;  4ZHB A;  2KBX A;  4J8Y A;  5CBN A;  2MYO A;  1MX2 A;  4O60 A;  4O1P A;  2XZD G;  2DZO A;  5ENQ D;  2ETC A;  1DCQ A;  5EYL A;  4ZFH A;  5BXO A;  1BU9 A;  4DRX E;  2P2C P;  3DEP A;  2J8S D;  1G3N B;  1WG0 A;  5AQA A;  4HI9 A;  1K3Z D;  5EIL A;  3V2X A;  5CBO A;  2F8X K;  3T9K A;  3W9F A;  3EHQ A;  5KWD A;  3J5P A;  5EID A;  5ENR D;  3EHR A;  2QC9 A;  2Y1L E;  4HBD A;  2XEN A;  5HS0 A;  2F37 A;  2DVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...