1K8KG

Crystal structure of arp2/3 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
139
Chain Sequence
ARFRKVDVDEYDENKFVDEDDGAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN-LIKE PROTEIN 3
publication title Crystal Structure of Arp2/3 Complex
pubmed doi rcsb
molecule tags Structural protein
total genus 42
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 1k8kG00
3DXKG 4JD2G 4XEIG 2P9IG 3DXMG 1TYQG 2P9PG 3DWLG 1K8KG 3ULEG 2P9SG 3UKUG 2P9UG 1U2VG 3RSEG 3UKRG 2P9LG 2P9NG 2P9KG
chains in the Genus database with same CATH superfamily
3T8KA 3CLJA 5ENTD 3HDXA 5BUZA 3LJ3A 2BUGA 3FUIA 2XQ0A 3CHOA 2P2CP 5ENQD 1NP7A 5E75A 4UWLA 4GAAA 3L54A 3KEZA 1NZNA 2R59A 4G26A 3Q7FA 3AS5A 3PEVB 2YHCA 2J07A 1FVHA 3BG0B 4PS8A 4JPSA 2RKKA 4L1BA 4CGWA 1FT1A 1Z3XA 3FFLA 3AJIA 1SZ9A 4GTTA 4BX9A 2WXKA 1LD7A 3FEYA 3PZ3A 5AN8A 2KC7A 4NURA 1JWGA 1H2TC 2WXOA 1KT1A 5EN5D 4E85A 1K1AA 3EHRA 4NACA 4NQ0A 4JHRA 3WG7E 2KATA 2GGFA 4HOUA 3D3MA 4Y6CA 3T9KA 3J5PA 2DBAA 4TUUA 5D0QD 3V31A 5JHAA 2P9PG 4J8EA 3KAEA 4CT0A 5JJTA 2LAIA 3ZKJA 1KT0A 2ZU6B 2RFAA 3V2OA 4YDWA 1OCOE 4U0ZA 4I9EA 4XZ4A 2FO1E 5FZRA 1PAQA 2E2EA 4MBGA 3FEXA 1Z5SC 5CEAA 1OWLA 2KBXA 3DSWA 3L08A 3U64A 3DPYA 1XGWA 2IJGX 5LOZA 3MEKA 1E96B 4U07A 3PS6A 1QNFA 1XNFA 1HF8A 2WXFA 2JABA 3KSLA 3UIOC 1BI7B 4I2ZA 3TGOA 5AJLA 4U0UA 2VSYA 3KSQA 4N2QA 3TAXA 4JEUA 4GB9A 3DPDA 2FO7A 3MX3A 5AQ7A 3AG4E 3DSUA 3TWRA 3RK6A 3NQPA 5ENOD 4W9RA 4EECA 3TWXA 2NSZA 2V5QC 3W9GA 3JCKC 4ACLA 1K8KG 3NOCD 1MYOA 3CVWA 3DRAA 1IHGA 3UKUG 2XGMA 3FWVA 3UT4A 4XX5A 5LP0A 3JXIA 4HRMB 4HNAD 4JL0A 4LCTA 2A4ZA 3CGHA 2IO2C 4ME2A 1N52A 2XPZA 4AXHA 3FUKA 2WM9A 3BG1B 4EQFA 1H2UA 1IXVA 3PNTB 5CRVA 3UM3A 3ONLA 4G23A 1H6PA 4I1OB 5AQBA 3G2VA 4GA1A 5G05J 3GZ2A 1K1BA 3VLEA 3R7RA 4L23A 4J8SA 3CEQA 3RJVA 2PL2A 2LSUA 2PNNA 4M3OA 4BSXA 4OAVB 4FHKA 5ANLA 4FC8A 5KCMA 1D8EA 4K5AB 5H7PA 1TNUA 3PH0C 5JHBA 4GZ3A 4UI9K 3QARA 1W3BA 3T5XA 4L7TA 2RFMA 4MRUA 1N4PA 4E6HA 3E32A 2QYUA 3OXLA 4I6GA 1KLXA 3AU4A 3L22A 3JQ1A 2J08A 2OV8A 3CSFA 4KBQA 4N3BA 1MX6A 2NXPA 5EYPF 3J5QB 3FU5A 4LSZE 1DC2A 3ESLA 1H19A 4FA6A 4BY6A 1TR4A 4GA2A 4JB8P 4HORA 2Q7FA 2ZISA 1GW6A 2J49A 3FTWA 2GRRB 3TWUA 4I2WA 5CECB 4A3VA 3FU3A 4JA7A 3FH5A 4EZLA 5KNHD 3IBEA 3ZPJA 4LRZA 2XEEA 4WNFA 2JLBA 3HIZA 3E37A 3FY4A 4G1TA 4DX2A 3FP3A 4F3VA 2BF0X 2LXMA 1TJFA 4GTRA 4GYWA 2H6FA 4Y6WA 2LXLA 4HLEA 3D9MA 3MYVA 1E8ZA 1HU3A 3Q49B 3SGHA 3L9TA 4Q96A 4ANWA 3TXNA 3S7FA 2F0YA 3G2WA 2GW1A 3UKRG 4LUNU 4BTAA 2XENA 3DXKG 2WVIA 4UQXA 1DVPA 4GYYA 3ZXSA 4A63B 5FZSA 3UTMA 1TN7A 2ETCA 3BU8A 4JXTA 1X5BA 4APFA 1KPSB 3S7JA 2P9LG 3ABLE 2ZGDA 4N3CA 3V2XA 4ILHB 4U95D 4ANUA 2VYIA 4KMOA 1S70B 3B13A 5LCWC 1SA4A 1E8YA 1OWPA 4URKA 4XKCA 4C0MA 3G2UA 2C0LA 3JUIA 1MJ0A 1OWOA 2RD0A 5BPPA 3FUDA 3UT8A 2J9QA 5CCMA 5T8IA 3ASFA 4DX6D 4AVXA 1FCHA 4GYOA 4N2SA 3NB2A 5G05C 5B1BE 3TG4A 3DSVA 3N71A 2PQNA 5T3RA 4UUCA 1HX8A 3CQGB 3LVQE 4F7AA 3PE4A 1MX2A 1OXJA 4XI9A 3ZGQA 3ASGA 3FU6A 3HXBA 4GA0A 2OVFA 2IY0C 2A5UA 1PY1A 2P9NG 4BWRA 1TNBA 3LY8A 3MZLB 2WQ6A 3FH7A 1IHBA 2UWJG 2H6HA 4ILIA 3F6QA 2L6JA 5ARGA 3CHSA 4TXRA 2CG3A 2PM6A 2EILE 5D0OD 1VDYA 4CEMA 3I4GA 3QAQA 3KS2A 4PS3A 4L2LA 1D8DA 4TV3A 1SZAA 2CFUA 2GROB 4FLHA 5CBOA 1IYGA 3ZYMA 2ZIRA 3OXFA 4YDYA 3FUJA 2HYZA 4BESA 2QYJA 1ELWA 2V8SE 1JCRA 2WXRA 1RW2A 4MLPA 1OCRE 3DXMG 4KVMA 1FPPA 3HXCA 3ULEG 3FULA 2XPIA 4GMRA 4GZDA 1P5QA 4MS6A 3V79K 2WXGA 1UJJA 4DUIA 3MKQA 5G55A 1WY6A 4K5CA 1KZOA 4DRXE 3QJZA 5BV0A 3MV3B 2XEHA 5C1DA 4J8FA 3QOUA 3HXFA 4IRUA 4YNDA 1HS6A 1H6OA 1MHQA 4AY6A 1BPOA 4AY5A 3GYZA 2I1JA 3Q4AB 4WNDA 4B8CB 4WWPA 2CFZA 2H6GA 3CHQA 3PZDA 1ZB1A 5JJ7A 1DNPA 3FDHA 3I5PA 2P9UG 4GTMA 4I1AA 5CMWA 1HO8A 4J8DA 2IONA 3CVYA 4WAFA 3ZW3A 3TWSA 2PM7A 4C48B 3OTNA 3AG1E 5C2YA 4TXQA 2P9IG 3PZ2A 4JHJA 2OCCE 4HRLA 1SW6A 2Y69E 4F1PA 4M7CA 1ELRA 4J0UA 3SZ7A 1E8WA 5FWQA 4GPMA 3LKUA 1NFIE 4FJYA 4DI3A 1NI1A 2AW6A 4OAUC 5FTPA 3EJNA 4RQIA 2ZXWE 3CIAA 3FH8A 3LEWA 3MKQB 2L6BA 3BEEA 1MZCA 5FQ8A 3RAUA 3ZHEA 2VSXE 2QC9A 1KZPA 4QQIA 2IO3C 3E34A 1RZ4A 4HVBA 3CVXA 1SVXA 2GRMA 2QY7A 3KD7A 2BTDA 3CHMA 2PZIA 3FTXA 3L6AA 1B89A 4HLLA 5IY5E 1HXIA 4GCOA 3EHQA 4X8QA 1TN6A 2AXUA 5G04C 2X6KA 4UWGA 4I43A 1DCEA 1H6KA 5FQ7A 3D9HA 4OYSA 5CMYA 4APOA 3ESKA 2WQHA 4DLOA 2AWIA 1U2VG 3FTUA 3SBSA 3C98A 3BQOA 4YDEA 3DBSA 3SY2A 1ZU2A 3PUKA 4JHKA 5HS0A 3ZUVB 1TN8A 3IV0A 4BERA 4UQZA 3CR3A 3PREA 1TNYA 5A6CA 1NL4A 4AEZC 2XCBA 5ENSD 5KWDA 5D2MC 2GRLA 1HE8A 4ATZD 3LCAA 4UWFA 4ZFHA 4KYOB 4B8AA 2M63A 2XHEA 1AP7A 1UN8A 5AJDA 1Q2ZA 3ZRHA 3QKYA 2VGYA 3ZHEB 3L16A 2OVBA 5LCWJ 5FT9A 4HOSA 3PE3A 5JMND 4XIFA 3LY7A 2MOWA 3SBTB 3I4RB 3HG0D 3C3OA 1H2VC 2MYOA 4I6JA 3RIBA 4A1GA 3EIJA 4CDNA 5BXUA 2VGXA 4JA9A 3UM2A 3D9LA 4GMJA 2ZGGA 1JCSA 4N3AA 2WMOA 4CDMA 4UWKA 4KVOA 3FTVA 5A7DB 3B7SA 4N39A 4WNGA 5JA4D 4GTQA 2IOLA 1TYQG 1WG0A 1N54A 3APCA 1QYMA 3LXUX 1QQEA 4EBAG 5AARA 4F53A 5FINA 4O1OA 4CRWA 4GTPA 1LTXA 4GZ5A 5ENPD 2X6HA 3FHEA 5FQ6A 3ISMC 3O4ZA 4K5BA 3JUEA 3S7DA 3MGBA 3X2QE 2C0MA 3QK0A 2Y0BG 3QDNA 4U63A 3CQCB 3RU0A 4U0SA 4YDOA 2CHZA 3GW4A 1HG5A 1YMPA 3VTYA 1TNZA 3APDA 4BTBA 2FEZA 4AP2A 4H7YA 4KXKB 4CT4A 5CRUA 3JXJA 4L2YA 2OOEA 2HE0A 3NF1A 5M72A 1U3CA 2AXVA 2NC9A 2VGXB 4HBDA 3ZEFA 3FUHA 3NZSA 3RO3A 4CZ2D 3TWTA 3PUJA 1AWCB 3GZ1A 1LF8A 4I6EA 4I9CA 2EIME 3RRUA 1OWNA 3SD5A 3CK7A 3DEOA 4DLQA 4FHJA 4I17A 3Q79A 1N94A 2OEWA 3TL5A 4AOFA 3QB2A 3MCXA 1TEZA 3ZYLA 1WDYA 3ABME 3B7UX 2MRIA 3IHYA 1UW4B 4A55A 5EILA 4DPRA 1V54E 5KNGA 2WB2A 4HRNA 3Q47B 5G2NA 3CVLA 4HOQA 3Q78A 3P1UA 3R7QA 3BUAA 3ZU7B 2VSOE 5KJNA 1JPLA 2EINE 4WWNA 4FJZA 1E7UA 3QWPA 2XCCA 3SO8A 3UUXA 4G2VA 3HXDA 3B95A 5D66A 4CGVA 4HB5A 4GMLA 5DIZA 3C3RA 4UI9C 2V4LA 3LS8A 3ZXPA 3FU0A 2R17C 5EKQD 2ONDA 4RSYA 5KJKA 2V0PA 5B1AE 5ARFA 2DVWA 2X3MA 3DWLG 1N11A 4UQYA 4GTVA 2P9SG 1UG3A 1IQRA 4DX7D 2EQXA 1N95A 2R2LA 2F37A 2GRPB 3EDTB 3S7BA 1IKND 1S64A 3MJWA 4LERA 3CVPA 3NOGD 3PZ4A 3DEPA 2FBNA 3Q73A 3DSTA 3D9KA 2HR2A 3Q15A 3UT7A 5G04J 1EYHA 4LG6A 5ANRA 2Y4UA 4U7EB 4G8LA 2P58C 1DCQA 1NA3A 2E0IA 3R9AB 1PC2A 2H6IA 4FU3A 4JEHA 3IHVA 3RRMB 5FZQA 1S0PA 2LUHA 4N5QA 3B7BA 3UXGA 3OXGA 3K9IA 5FJYA 3SFXA 2F8YA 3RSEG 1YA0A 3EU9A 3PVLA 3QC1A 1HG2A 4HI8A 5ENNA 4BX8A 2J4DA 4DI4A 1OY3D 4I1MA 1BU9A 3PRZA 2VQ2A 2ILRA 2I2OA 4HI9A 4AM9A 4GZ6A 4R7LA 4FP7A 3FTYA 3ASDA 2IEJA 1U3DA 3ZN3A 1BLXB 1HFAA 2FULA 3CHPA 1OCCE 2AVPA 4YVQC 3TJPA 2XEVA 4F1SA 4D10C 5EIBE 2L0TB 2DYRE 1Y8MA 3FUMA 4G25A 5DBKA 3CV0A 5FIOA 4G24A 2V4HC 4BSZB 1MX4A 1G3NB 4J8YA 4TRQA 3WXXA 4RLYA 4A3TA 1Z3YA 1FT2A 3SNXA 3HHMA 1EPUA 3AS8A 3DSXA 3RO2A 3KEAA 3VTXA 4B0ZA 1SA5A 4TXPA 1O1TA 4CCAA 3ULQA 5AIJA 3UIPC 4BT8A 3NBNB 4GPKA 4B89A 3UPVA 2WXIA 4G8KA 3AU5A 5EIDA 3U66A 3C3QA 2AXZA 4EPZA 4ABNA 2KM4A 1O1SA 5LFAA 1LD8A 2KXPC 2WMNA 2XZTG 3GZSA 2BKGA 2EIKE 2YHEA 3D9JA 3Q75A 2XS1A 4RVBA 2BKKB 2LSVA 3AG2E 2WXNA 2XGSA 3E33A 4XEIG 1OUVA 2X6FA 1D9SA 3B7TA 4GU5A 5CHEE 4EZKA 2Y3AA 3LDZA 3HXEA 1N9AA 5EDSA 1Y6IA 2F8XK 3RRNB 2B6CA 5B3SE 4J6IA 1SQMA 4FLBA 1N4QA 3EHNA 4Q69A 4K0RA 4B94A 1OCZE 1Z6TA 4ACKA 2UY1A 3Q7AA 2LO6A 3PDNA 4LNGA 1N0RA 5A23A 4IYPA 2DCPA 3Q9UC 3TWVA 4ATGA 2A5EA 4NIKA 3D9OA 4HOTA 4JVSA 4GCNA 2DWZA 3TG5A 2CG2A 3ML9A 5HQ8A 3CKCA 3UX4A 3AG3E 3JYSA 5BXOA 1E90A 4P29A 5LX8A 1K3ZD 3APFA 4XI0A 3ZYQA 4CDRA 3ML8A 3UQ3A 1X81A 5AQ9A 1UJKA 1OWMA 1WM5A 5CBNA 1JUQA 4KZCA 2WXHA 2KCKA 2VJ8A 2X6IA 2QZAA 3O48A 2WQ7A 2V5FA 2DZOA 3CKBA 4LEUA 2XZDG 4XE0A 4WWOA 4AJWA 4HFGA 3FTZA 4KZ0A 2DIWA 3LVRE 3AS4A 3SFZA 2B0OE 4U8HA 4FULA 4PDXA 2WXPA 3HVEA 4XKBA 4UI9J 2J4BA 3ABKE 2GRNB 1ELKA 2UY1B 2YINA 2KCVA 5AQAA 2WXMA 4C9BB 3E30A 4NRHB 3C72A 3QWWA 5CCLA 3SI5A 2XRZA 2IFUA 1N4RA 4IULA 4HXIA 3TWWA 1L5JA 2J09A 1OT8A 3OAWA 4JC8A 4LNBA 5FQ4A 4FADA 5BV1A 1EF1C 3EUVA 2VTBA 4K03A 1ZBPA 1INZA 1H0AA 3G2TA 2R02A 4WNEA 3CK9A 3CSTA 3EIQC 3SF4A 2WXLA 2RG8A 1E8XA 4CYMD 3PZ1A 3QNKA 4RG9A 3LPZA 2ETBA 4Z68A 4Q94A 1O1RA 4O60A 2R05A 1UN9A 4GTSA 4LNUD 5KJMA 3HVEB 3FUEA 3UI2A 4U96D 1MQSA 4B93B 2NYJA 3D9IA 3R9MA 5KBAA 1BI8B 4ILGA 1BD8A 4AV7A 5EYLA 5KJLA 4GZCA 3LYAA 1E7VA 5AENA 2CHXA 2KZTA 5CERB 2I9CA 3ZFWA 3U3WA 2FF4A 4HS2A 3ENEA 3L82A 5BW8C 1UOHA 4DK5A 1A17A 3S2AA 2IOSA 3D9NA 5JJ6A 2VTBB 4QFVA 5T4YA 1HZ4A 4EZJA 3W9FA 4DJAA 3EU5A 1QBQA 4PS7A 1FVFA 3ASHA 3EHMA 2JEKA 2AJAA 3CHRA 2IQCA 2VSNA 4U04A 3NZUA 2IU1A 3FUFA 1NA0A 2L9BA 3ULYA 1A5EA 3UMVA 3QWVA 4TUMA 4C0EA 2X6JA 1S63A 3JQ0A 2HM8A 2HO1A 4KT6B 3RKVA 3CVQA 3U4TA 4WUYA 1JWFA 4DX5D 3ZYKA 5J90A 2WXQA 3E4BA 4U8YD 2EIJE 3UM0A 5ITZF 3U9WA 5EX0A 4OVVA 4JZYA 4ANVA 2QFCA 2Y4TA 2KZTB 4A1SA 4EHMA 3ZIMA 3UINC 4H7XA 3V30A 1WAO1 4PUCA 4OVUA 3B7RL 3L17A 2GRQB 4DX1A 3VLFA 2DYSE 5CEDB 4F6RD 2YNQA 3T5VA 3MV2B 1HH8A 2OEVA 4JW1A 4PH4B 2ETAA 3G2SA 3CVVA 3HYMB 2C2LA 4AIFA 3TXMA 3C5RA 3Q5MA 1EDUA 2R5SA 4N5CA 4O1PA 1JCQA 1IQUA 2WPVA 4J7WA 1N4SA 1O5MA 2BEDA 2XRYA 2YQ8A 3MKRA 1YCSB 2XS8A 3DSSA 5E76A 2P9KG 1TNOA 4G11A 4YVOA 3URZA 2PQRA 3Q9NC 2L0IA 2R03A 3ZVVA 2I6HA 4BFRA 3FUNA 1QZ2A 4BETA 3SHFA 2LNIA 4RG6A 3SQVA 2XPYA 5J08A 4JD2G 4UWHA 3IXEA 2X38A 4GTOA 3L13A 2J8SD 3ZNGA 4HQDA 2MHKA 3HRAA 3ONKA 4V3IA 3MA5A 3P2BA 3LY9A 3PEUB 2CHWA 5HRYA 3CVNA 3UM1A 5HKPA 5BT1A 4IN3B 4MKTA 3LJNA 4O6FA 5HI7A 2WXJA 4L9PA 1YYHA 4ZHBA 5EX3A 3T8MA 2I1KA 3AAAC 3NAWA 3ASOE 3IEGA 3D9PA 5AYWD 3SFYA 4EBAA 1V55E 3FTSA 3CVUA 3ASNE 5BNWA 1TJCA 2DZNA 3I3NA 3PNLB 5ENRD 2VGEA 5AAOA 4BT9A 4BEPA 2XGOA 3VLDA 3IKOB 2KCLA 1N0QA 2IF4A 2Y1LE 2FI7A 4ANXA 3TWQA 3CK8A 2LAHA 4U8VD
chains in the Genus database with same CATH topology
3DXKG 4JD2G 4XEIG 2P9IG 3DXMG 1TYQG 2P9PG 3DWLG 1K8KG 3ULEG 2P9SG 3UKUG 2P9UG 1U2VG 3RSEG 3UKRG 2P9LG 2P9NG 2P9KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXK G;  4JD2 G;  4XEI G;  2P9I G;  3DXM G;  1TYQ G;  2P9P G;  3DWL G;  1K8K G;  3ULE G;  2P9S G;  3UKU G;  2P9U G;  1U2V G;  3RSE G;  3UKR G;  2P9L G;  2P9N G;  2P9K G; 
#chains in the Genus database with same CATH topology
 3T8K A;  3CLJ A;  5ENT D;  3HDX A;  5BUZ A;  3LJ3 A;  2BUG A;  3FUI A;  2XQ0 A;  3CHO A;  2P2C P;  5ENQ D;  1NP7 A;  5E75 A;  4UWL A;  4GAA A;  3L54 A;  3KEZ A;  1NZN A;  2R59 A;  4G26 A;  3Q7F A;  3AS5 A;  3PEV B;  2YHC A;  2J07 A;  1FVH A;  3BG0 B;  4PS8 A;  4JPS A;  2RKK A;  4L1B A;  4CGW A;  1FT1 A;  1Z3X A;  3FFL A;  3AJI A;  1SZ9 A;  4GTT A;  4BX9 A;  2WXK A;  1LD7 A;  3FEY A;  3PZ3 A;  5AN8 A;  2KC7 A;  4NUR A;  1JWG A;  1H2T C;  2WXO A;  1KT1 A;  5EN5 D;  4E85 A;  1K1A A;  3EHR A;  4NAC A;  4NQ0 A;  4JHR A;  3WG7 E;  2KAT A;  2GGF A;  4HOU A;  3D3M A;  4Y6C A;  3T9K A;  3J5P A;  2DBA A;  4TUU A;  5D0Q D;  3V31 A;  5JHA A;  2P9P G;  4J8E A;  3KAE A;  4CT0 A;  5JJT A;  2LAI A;  3ZKJ A;  1KT0 A;  2ZU6 B;  2RFA A;  3V2O A;  4YDW A;  1OCO E;  4U0Z A;  4I9E A;  4XZ4 A;  2FO1 E;  5FZR A;  1PAQ A;  2E2E A;  4MBG A;  3FEX A;  1Z5S C;  5CEA A;  1OWL A;  2KBX A;  3DSW A;  3L08 A;  3U64 A;  3DPY A;  1XGW A;  2IJG X;  5LOZ A;  3MEK A;  1E96 B;  4U07 A;  3PS6 A;  1QNF A;  1XNF A;  1HF8 A;  2WXF A;  2JAB A;  3KSL A;  3UIO C;  1BI7 B;  4I2Z A;  3TGO A;  5AJL A;  4U0U A;  2VSY A;  3KSQ A;  4N2Q A;  3TAX A;  4JEU A;  4GB9 A;  3DPD A;  2FO7 A;  3MX3 A;  5AQ7 A;  3AG4 E;  3DSU A;  3TWR A;  3RK6 A;  3NQP A;  5ENO D;  4W9R A;  4EEC A;  3TWX A;  2NSZ A;  2V5Q C;  3W9G A;  3JCK C;  4ACL A;  1K8K G;  3NOC D;  1MYO A;  3CVW A;  3DRA A;  1IHG A;  3UKU G;  2XGM A;  3FWV A;  3UT4 A;  4XX5 A;  5LP0 A;  3JXI A;  4HRM B;  4HNA D;  4JL0 A;  4LCT A;  2A4Z A;  3CGH A;  2IO2 C;  4ME2 A;  1N52 A;  2XPZ A;  4AXH A;  3FUK A;  2WM9 A;  3BG1 B;  4EQF A;  1H2U A;  1IXV A;  3PNT B;  5CRV A;  3UM3 A;  3ONL A;  4G23 A;  1H6P A;  4I1O B;  5AQB A;  3G2V A;  4GA1 A;  5G05 J;  3GZ2 A;  1K1B A;  3VLE A;  3R7R A;  4L23 A;  4J8S A;  3CEQ A;  3RJV A;  2PL2 A;  2LSU A;  2PNN A;  4M3O A;  4BSX A;  4OAV B;  4FHK A;  5ANL A;  4FC8 A;  5KCM A;  1D8E A;  4K5A B;  5H7P A;  1TNU A;  3PH0 C;  5JHB A;  4GZ3 A;  4UI9 K;  3QAR A;  1W3B A;  3T5X A;  4L7T A;  2RFM A;  4MRU A;  1N4P A;  4E6H A;  3E32 A;  2QYU A;  3OXL A;  4I6G A;  1KLX A;  3AU4 A;  3L22 A;  3JQ1 A;  2J08 A;  2OV8 A;  3CSF A;  4KBQ A;  4N3B A;  1MX6 A;  2NXP A;  5EYP F;  3J5Q B;  3FU5 A;  4LSZ E;  1DC2 A;  3ESL A;  1H19 A;  4FA6 A;  4BY6 A;  1TR4 A;  4GA2 A;  4JB8 P;  4HOR A;  2Q7F A;  2ZIS A;  1GW6 A;  2J49 A;  3FTW A;  2GRR B;  3TWU A;  4I2W A;  5CEC B;  4A3V A;  3FU3 A;  4JA7 A;  3FH5 A;  4EZL A;  5KNH D;  3IBE A;  3ZPJ A;  4LRZ A;  2XEE A;  4WNF A;  2JLB A;  3HIZ A;  3E37 A;  3FY4 A;  4G1T A;  4DX2 A;  3FP3 A;  4F3V A;  2BF0 X;  2LXM A;  1TJF A;  4GTR A;  4GYW A;  2H6F A;  4Y6W A;  2LXL A;  4HLE A;  3D9M A;  3MYV A;  1E8Z A;  1HU3 A;  3Q49 B;  3SGH A;  3L9T A;  4Q96 A;  4ANW A;  3TXN A;  3S7F A;  2F0Y A;  3G2W A;  2GW1 A;  3UKR G;  4LUN U;  4BTA A;  2XEN A;  3DXK G;  2WVI A;  4UQX A;  1DVP A;  4GYY A;  3ZXS A;  4A63 B;  5FZS A;  3UTM A;  1TN7 A;  2ETC A;  3BU8 A;  4JXT A;  1X5B A;  4APF A;  1KPS B;  3S7J A;  2P9L G;  3ABL E;  2ZGD A;  4N3C A;  3V2X A;  4ILH B;  4U95 D;  4ANU A;  2VYI A;  4KMO A;  1S70 B;  3B13 A;  5LCW C;  1SA4 A;  1E8Y A;  1OWP A;  4URK A;  4XKC A;  4C0M A;  3G2U A;  2C0L A;  3JUI A;  1MJ0 A;  1OWO A;  2RD0 A;  5BPP A;  3FUD A;  3UT8 A;  2J9Q A;  5CCM A;  5T8I A;  3ASF A;  4DX6 D;  4AVX A;  1FCH A;  4GYO A;  4N2S A;  3NB2 A;  5G05 C;  5B1B E;  3TG4 A;  3DSV A;  3N71 A;  2PQN A;  5T3R A;  4UUC A;  1HX8 A;  3CQG B;  3LVQ E;  4F7A A;  3PE4 A;  1MX2 A;  1OXJ A;  4XI9 A;  3ZGQ A;  3ASG A;  3FU6 A;  3HXB A;  4GA0 A;  2OVF A;  2IY0 C;  2A5U A;  1PY1 A;  2P9N G;  4BWR A;  1TNB A;  3LY8 A;  3MZL B;  2WQ6 A;  3FH7 A;  1IHB A;  2UWJ G;  2H6H A;  4ILI A;  3F6Q A;  2L6J A;  5ARG A;  3CHS A;  4TXR A;  2CG3 A;  2PM6 A;  2EIL E;  5D0O D;  1VDY A;  4CEM A;  3I4G A;  3QAQ A;  3KS2 A;  4PS3 A;  4L2L A;  1D8D A;  4TV3 A;  1SZA A;  2CFU A;  2GRO B;  4FLH A;  5CBO A;  1IYG A;  3ZYM A;  2ZIR A;  3OXF A;  4YDY A;  3FUJ A;  2HYZ A;  4BES A;  2QYJ A;  1ELW A;  2V8S E;  1JCR A;  2WXR A;  1RW2 A;  4MLP A;  1OCR E;  3DXM G;  4KVM A;  1FPP A;  3HXC A;  3ULE G;  3FUL A;  2XPI A;  4GMR A;  4GZD A;  1P5Q A;  4MS6 A;  3V79 K;  2WXG A;  1UJJ A;  4DUI A;  3MKQ A;  5G55 A;  1WY6 A;  4K5C A;  1KZO A;  4DRX E;  3QJZ A;  5BV0 A;  3MV3 B;  2XEH A;  5C1D A;  4J8F A;  3QOU A;  3HXF A;  4IRU A;  4YND A;  1HS6 A;  1H6O A;  1MHQ A;  4AY6 A;  1BPO A;  4AY5 A;  3GYZ A;  2I1J A;  3Q4A B;  4WND A;  4B8C B;  4WWP A;  2CFZ A;  2H6G A;  3CHQ A;  3PZD A;  1ZB1 A;  5JJ7 A;  1DNP A;  3FDH A;  3I5P A;  2P9U G;  4GTM A;  4I1A A;  5CMW A;  1HO8 A;  4J8D A;  2ION A;  3CVY A;  4WAF A;  3ZW3 A;  3TWS A;  2PM7 A;  4C48 B;  3OTN A;  3AG1 E;  5C2Y A;  4TXQ A;  2P9I G;  3PZ2 A;  4JHJ A;  2OCC E;  4HRL A;  1SW6 A;  2Y69 E;  4F1P A;  4M7C A;  1ELR A;  4J0U A;  3SZ7 A;  1E8W A;  5FWQ A;  4GPM A;  3LKU A;  1NFI E;  4FJY A;  4DI3 A;  1NI1 A;  2AW6 A;  4OAU C;  5FTP A;  3EJN A;  4RQI A;  2ZXW E;  3CIA A;  3FH8 A;  3LEW A;  3MKQ B;  2L6B A;  3BEE A;  1MZC A;  5FQ8 A;  3RAU A;  3ZHE A;  2VSX E;  2QC9 A;  1KZP A;  4QQI A;  2IO3 C;  3E34 A;  1RZ4 A;  4HVB A;  3CVX A;  1SVX A;  2GRM A;  2QY7 A;  3KD7 A;  2BTD A;  3CHM A;  2PZI A;  3FTX A;  3L6A A;  1B89 A;  4HLL A;  5IY5 E;  1HXI A;  4GCO A;  3EHQ A;  4X8Q A;  1TN6 A;  2AXU A;  5G04 C;  2X6K A;  4UWG A;  4I43 A;  1DCE A;  1H6K A;  5FQ7 A;  3D9H A;  4OYS A;  5CMY A;  4APO A;  3ESK A;  2WQH A;  4DLO A;  2AWI A;  1U2V G;  3FTU A;  3SBS A;  3C98 A;  3BQO A;  4YDE A;  3DBS A;  3SY2 A;  1ZU2 A;  3PUK A;  4JHK A;  5HS0 A;  3ZUV B;  1TN8 A;  3IV0 A;  4BER A;  4UQZ A;  3CR3 A;  3PRE A;  1TNY A;  5A6C A;  1NL4 A;  4AEZ C;  2XCB A;  5ENS D;  5KWD A;  5D2M C;  2GRL A;  1HE8 A;  4ATZ D;  3LCA A;  4UWF A;  4ZFH A;  4KYO B;  4B8A A;  2M63 A;  2XHE A;  1AP7 A;  1UN8 A;  5AJD A;  1Q2Z A;  3ZRH A;  3QKY A;  2VGY A;  3ZHE B;  3L16 A;  2OVB A;  5LCW J;  5FT9 A;  4HOS A;  3PE3 A;  5JMN D;  4XIF A;  3LY7 A;  2MOW A;  3SBT B;  3I4R B;  3HG0 D;  3C3O A;  1H2V C;  2MYO A;  4I6J A;  3RIB A;  4A1G A;  3EIJ A;  4CDN A;  5BXU A;  2VGX A;  4JA9 A;  3UM2 A;  3D9L A;  4GMJ A;  2ZGG A;  1JCS A;  4N3A A;  2WMO A;  4CDM A;  4UWK A;  4KVO A;  3FTV A;  5A7D B;  3B7S A;  4N39 A;  4WNG A;  5JA4 D;  4GTQ A;  2IOL A;  1TYQ G;  1WG0 A;  1N54 A;  3APC A;  1QYM A;  3LXU X;  1QQE A;  4EBA G;  5AAR A;  4F53 A;  5FIN A;  4O1O A;  4CRW A;  4GTP A;  1LTX A;  4GZ5 A;  5ENP D;  2X6H A;  3FHE A;  5FQ6 A;  3ISM C;  3O4Z A;  4K5B A;  3JUE A;  3S7D A;  3MGB A;  3X2Q E;  2C0M A;  3QK0 A;  2Y0B G;  3QDN A;  4U63 A;  3CQC B;  3RU0 A;  4U0S A;  4YDO A;  2CHZ A;  3GW4 A;  1HG5 A;  1YMP A;  3VTY A;  1TNZ A;  3APD A;  4BTB A;  2FEZ A;  4AP2 A;  4H7Y A;  4KXK B;  4CT4 A;  5CRU A;  3JXJ A;  4L2Y A;  2OOE A;  2HE0 A;  3NF1 A;  5M72 A;  1U3C A;  2AXV A;  2NC9 A;  2VGX B;  4HBD A;  3ZEF A;  3FUH A;  3NZS A;  3RO3 A;  4CZ2 D;  3TWT A;  3PUJ A;  1AWC B;  3GZ1 A;  1LF8 A;  4I6E A;  4I9C A;  2EIM E;  3RRU A;  1OWN A;  3SD5 A;  3CK7 A;  3DEO A;  4DLQ A;  4FHJ A;  4I17 A;  3Q79 A;  1N94 A;  2OEW A;  3TL5 A;  4AOF A;  3QB2 A;  3MCX A;  1TEZ A;  3ZYL A;  1WDY A;  3ABM E;  3B7U X;  2MRI A;  3IHY A;  1UW4 B;  4A55 A;  5EIL A;  4DPR A;  1V54 E;  5KNG A;  2WB2 A;  4HRN A;  3Q47 B;  5G2N A;  3CVL A;  4HOQ A;  3Q78 A;  3P1U A;  3R7Q A;  3BUA A;  3ZU7 B;  2VSO E;  5KJN A;  1JPL A;  2EIN E;  4WWN A;  4FJZ A;  1E7U A;  3QWP A;  2XCC A;  3SO8 A;  3UUX A;  4G2V A;  3HXD A;  3B95 A;  5D66 A;  4CGV A;  4HB5 A;  4GML A;  5DIZ A;  3C3R A;  4UI9 C;  2V4L A;  3LS8 A;  3ZXP A;  3FU0 A;  2R17 C;  5EKQ D;  2OND A;  4RSY A;  5KJK A;  2V0P A;  5B1A E;  5ARF A;  2DVW A;  2X3M A;  3DWL G;  1N11 A;  4UQY A;  4GTV A;  2P9S G;  1UG3 A;  1IQR A;  4DX7 D;  2EQX A;  1N95 A;  2R2L A;  2F37 A;  2GRP B;  3EDT B;  3S7B A;  1IKN D;  1S64 A;  3MJW A;  4LER A;  3CVP A;  3NOG D;  3PZ4 A;  3DEP A;  2FBN A;  3Q73 A;  3DST A;  3D9K A;  2HR2 A;  3Q15 A;  3UT7 A;  5G04 J;  1EYH A;  4LG6 A;  5ANR A;  2Y4U A;  4U7E B;  4G8L A;  2P58 C;  1DCQ A;  1NA3 A;  2E0I A;  3R9A B;  1PC2 A;  2H6I A;  4FU3 A;  4JEH A;  3IHV A;  3RRM B;  5FZQ A;  1S0P A;  2LUH A;  4N5Q A;  3B7B A;  3UXG A;  3OXG A;  3K9I A;  5FJY A;  3SFX A;  2F8Y A;  3RSE G;  1YA0 A;  3EU9 A;  3PVL A;  3QC1 A;  1HG2 A;  4HI8 A;  5ENN A;  4BX8 A;  2J4D A;  4DI4 A;  1OY3 D;  4I1M A;  1BU9 A;  3PRZ A;  2VQ2 A;  2ILR A;  2I2O A;  4HI9 A;  4AM9 A;  4GZ6 A;  4R7L A;  4FP7 A;  3FTY A;  3ASD A;  2IEJ A;  1U3D A;  3ZN3 A;  1BLX B;  1HFA A;  2FUL A;  3CHP A;  1OCC E;  2AVP A;  4YVQ C;  3TJP A;  2XEV A;  4F1S A;  4D10 C;  5EIB E;  2L0T B;  2DYR E;  1Y8M A;  3FUM A;  4G25 A;  5DBK A;  3CV0 A;  5FIO A;  4G24 A;  2V4H C;  4BSZ B;  1MX4 A;  1G3N B;  4J8Y A;  4TRQ A;  3WXX A;  4RLY A;  4A3T A;  1Z3Y A;  1FT2 A;  3SNX A;  3HHM A;  1EPU A;  3AS8 A;  3DSX A;  3RO2 A;  3KEA A;  3VTX A;  4B0Z A;  1SA5 A;  4TXP A;  1O1T A;  4CCA A;  3ULQ A;  5AIJ A;  3UIP C;  4BT8 A;  3NBN B;  4GPK A;  4B89 A;  3UPV A;  2WXI A;  4G8K A;  3AU5 A;  5EID A;  3U66 A;  3C3Q A;  2AXZ A;  4EPZ A;  4ABN A;  2KM4 A;  1O1S A;  5LFA A;  1LD8 A;  2KXP C;  2WMN A;  2XZT G;  3GZS A;  2BKG A;  2EIK E;  2YHE A;  3D9J A;  3Q75 A;  2XS1 A;  4RVB A;  2BKK B;  2LSV A;  3AG2 E;  2WXN A;  2XGS A;  3E33 A;  4XEI G;  1OUV A;  2X6F A;  1D9S A;  3B7T A;  4GU5 A;  5CHE E;  4EZK A;  2Y3A A;  3LDZ A;  3HXE A;  1N9A A;  5EDS A;  1Y6I A;  2F8X K;  3RRN B;  2B6C A;  5B3S E;  4J6I A;  1SQM A;  4FLB A;  1N4Q A;  3EHN A;  4Q69 A;  4K0R A;  4B94 A;  1OCZ E;  1Z6T A;  4ACK A;  2UY1 A;  3Q7A A;  2LO6 A;  3PDN A;  4LNG A;  1N0R A;  5A23 A;  4IYP A;  2DCP A;  3Q9U C;  3TWV A;  4ATG A;  2A5E A;  4NIK A;  3D9O A;  4HOT A;  4JVS A;  4GCN A;  2DWZ A;  3TG5 A;  2CG2 A;  3ML9 A;  5HQ8 A;  3CKC A;  3UX4 A;  3AG3 E;  3JYS A;  5BXO A;  1E90 A;  4P29 A;  5LX8 A;  1K3Z D;  3APF A;  4XI0 A;  3ZYQ A;  4CDR A;  3ML8 A;  3UQ3 A;  1X81 A;  5AQ9 A;  1UJK A;  1OWM A;  1WM5 A;  5CBN A;  1JUQ A;  4KZC A;  2WXH A;  2KCK A;  2VJ8 A;  2X6I A;  2QZA A;  3O48 A;  2WQ7 A;  2V5F A;  2DZO A;  3CKB A;  4LEU A;  2XZD G;  4XE0 A;  4WWO A;  4AJW A;  4HFG A;  3FTZ A;  4KZ0 A;  2DIW A;  3LVR E;  3AS4 A;  3SFZ A;  2B0O E;  4U8H A;  4FUL A;  4PDX A;  2WXP A;  3HVE A;  4XKB A;  4UI9 J;  2J4B A;  3ABK E;  2GRN B;  1ELK A;  2UY1 B;  2YIN A;  2KCV A;  5AQA A;  2WXM A;  4C9B B;  3E30 A;  4NRH B;  3C72 A;  3QWW A;  5CCL A;  3SI5 A;  2XRZ A;  2IFU A;  1N4R A;  4IUL A;  4HXI A;  3TWW A;  1L5J A;  2J09 A;  1OT8 A;  3OAW A;  4JC8 A;  4LNB A;  5FQ4 A;  4FAD A;  5BV1 A;  1EF1 C;  3EUV A;  2VTB A;  4K03 A;  1ZBP A;  1INZ A;  1H0A A;  3G2T A;  2R02 A;  4WNE A;  3CK9 A;  3CST A;  3EIQ C;  3SF4 A;  2WXL A;  2RG8 A;  1E8X A;  4CYM D;  3PZ1 A;  3QNK A;  4RG9 A;  3LPZ A;  2ETB A;  4Z68 A;  4Q94 A;  1O1R A;  4O60 A;  2R05 A;  1UN9 A;  4GTS A;  4LNU D;  5KJM A;  3HVE B;  3FUE A;  3UI2 A;  4U96 D;  1MQS A;  4B93 B;  2NYJ A;  3D9I A;  3R9M A;  5KBA A;  1BI8 B;  4ILG A;  1BD8 A;  4AV7 A;  5EYL A;  5KJL A;  4GZC A;  3LYA A;  1E7V A;  5AEN A;  2CHX A;  2KZT A;  5CER B;  2I9C A;  3ZFW A;  3U3W A;  2FF4 A;  4HS2 A;  3ENE A;  3L82 A;  5BW8 C;  1UOH A;  4DK5 A;  1A17 A;  3S2A A;  2IOS A;  3D9N A;  5JJ6 A;  2VTB B;  4QFV A;  5T4Y A;  1HZ4 A;  4EZJ A;  3W9F A;  4DJA A;  3EU5 A;  1QBQ A;  4PS7 A;  1FVF A;  3ASH A;  3EHM A;  2JEK A;  2AJA A;  3CHR A;  2IQC A;  2VSN A;  4U04 A;  3NZU A;  2IU1 A;  3FUF A;  1NA0 A;  2L9B A;  3ULY A;  1A5E A;  3UMV A;  3QWV A;  4TUM A;  4C0E A;  2X6J A;  1S63 A;  3JQ0 A;  2HM8 A;  2HO1 A;  4KT6 B;  3RKV A;  3CVQ A;  3U4T A;  4WUY A;  1JWF A;  4DX5 D;  3ZYK A;  5J90 A;  2WXQ A;  3E4B A;  4U8Y D;  2EIJ E;  3UM0 A;  5ITZ F;  3U9W A;  5EX0 A;  4OVV A;  4JZY A;  4ANV A;  2QFC A;  2Y4T A;  2KZT B;  4A1S A;  4EHM A;  3ZIM A;  3UIN C;  4H7X A;  3V30 A;  1WAO 1;  4PUC A;  4OVU A;  3B7R L;  3L17 A;  2GRQ B;  4DX1 A;  3VLF A;  2DYS E;  5CED B;  4F6R D;  2YNQ A;  3T5V A;  3MV2 B;  1HH8 A;  2OEV A;  4JW1 A;  4PH4 B;  2ETA A;  3G2S A;  3CVV A;  3HYM B;  2C2L A;  4AIF A;  3TXM A;  3C5R A;  3Q5M A;  1EDU A;  2R5S A;  4N5C A;  4O1P A;  1JCQ A;  1IQU A;  2WPV A;  4J7W A;  1N4S A;  1O5M A;  2BED A;  2XRY A;  2YQ8 A;  3MKR A;  1YCS B;  2XS8 A;  3DSS A;  5E76 A;  2P9K G;  1TNO A;  4G11 A;  4YVO A;  3URZ A;  2PQR A;  3Q9N C;  2L0I A;  2R03 A;  3ZVV A;  2I6H A;  4BFR A;  3FUN A;  1QZ2 A;  4BET A;  3SHF A;  2LNI A;  4RG6 A;  3SQV A;  2XPY A;  5J08 A;  4JD2 G;  4UWH A;  3IXE A;  2X38 A;  4GTO A;  3L13 A;  2J8S D;  3ZNG A;  4HQD A;  2MHK A;  3HRA A;  3ONK A;  4V3I A;  3MA5 A;  3P2B A;  3LY9 A;  3PEU B;  2CHW A;  5HRY A;  3CVN A;  3UM1 A;  5HKP A;  5BT1 A;  4IN3 B;  4MKT A;  3LJN A;  4O6F A;  5HI7 A;  2WXJ A;  4L9P A;  1YYH A;  4ZHB A;  5EX3 A;  3T8M A;  2I1K A;  3AAA C;  3NAW A;  3ASO E;  3IEG A;  3D9P A;  5AYW D;  3SFY A;  4EBA A;  1V55 E;  3FTS A;  3CVU A;  3ASN E;  5BNW A;  1TJC A;  2DZN A;  3I3N A;  3PNL B;  5ENR D;  2VGE A;  5AAO A;  4BT9 A;  4BEP A;  2XGO A;  3VLD A;  3IKO B;  2KCL A;  1N0Q A;  2IF4 A;  2Y1L E;  2FI7 A;  4ANX A;  3TWQ A;  3CK8 A;  2LAH A;  4U8V D; 
#chains in the Genus database with same CATH homology
 3DXK G;  4JD2 G;  4XEI G;  2P9I G;  3DXM G;  1TYQ G;  2P9P G;  3DWL G;  1K8K G;  3ULE G;  2P9S G;  3UKU G;  2P9U G;  1U2V G;  3RSE G;  3UKR G;  2P9L G;  2P9N G;  2P9K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...