3FWVA

Crystal structure of a redesigned tpr protein, t-mod(vmy), in complex with meevf peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
128
structure length
128
Chain Sequence
SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Hsc70/Hsp90-organizing protein
publication title Redesign of a protein-peptide interaction: characterization and applications
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fwvA00
2JLBA 2ONDA 2VGXA 4J8FA 3ZFWA 1FCHA 4H7YA 4YVQC 4F3VA 3TGOA 5EKQD 2Y4TA 4N3CA 4KXKB 2VSNA 4AY6A 5FZRA 4G23A 4KYOB 1B89A 4XIFA 3ZGQA 5HQ8A 1IHGA 2XPIA 3GZ2A 5D0QD 2QFCA 5FTPA 4RG9A 2IFUA 4H7XA 3CKBA 3VTYA 2VGYA 4HOQA 1OUVA 2PQNA 1TJCA 4WUYA 4BTAA 2C0MA 4EQFA 4N3AA 4AY5A 4NRHB 3CEQA 4U07A 1WM5A 2HYZA 2LSVA 5FZQA 1IYGA 1XNFA 4GZ5A 2PQRA 4BWRA 3URZA 4YNDA 5BT1A 4I9CA 4GCNA 5CHEE 3CKCA 1ZU2A 3U3WA 4CDRA 2XGMA 4GZ3A 2E2EA 5KJMA 2UWJG 4WNDA 4U0UA 3U4TA 3JYSA 4G24A 4JHRA 5KJKA 2LSUA 3CVLA 3CK8A 3LCAA 3UPVA 3RO2A 1HXIA 3LY9A 1A17A 4GPKA 5JJTA 2PL2A 4GA0A 5D0OD 2BUGA 2AVPA 2WQHA 1QQEA 3CVPA 4I2ZA 1Y8MA 2XGOA 2FF4A 3N71A 4N5CA 4APOA 2VYIA 4IN3B 3FP3A 4Y6CA 4N3BA 5ARGA 2KC7A 3HYMB 4G26A 3QKYA 2XEVA 3CVQA 5M72A 3S7DA 3CK9A 4XI9A 4YVOA 4GZ6A 1HZ4A 2FO7A 4UI9J 2PZIA 4UQYA 4I1AA 4KBQA 3KD7A 3VTXA 5FT9A 2FBNA 3O48A 3FWVA 4U0SA 2YHCA 3E4BA 4XI0A 4WNEA 5ARFA 4G1TA 4GYOA 4N2SA 2J9QA 3ASGA 1KLXA 2V5FA 3QWPA 2VSYA 4RG6A 3MA5A 2KATA 3IEGA 3ULQA 3UQ3A 4N2QA 3ZHEB 4UQXA 3KS2A 5G05J 5G04J 2LNIA 5EX0A 5AYWD 3ASDA 2NC9A 4GA1A 4J0UA 3ASFA 3SZ7A 4JA7A 3PE4A 4CGWA 3TG4A 4J8DA 1ZBPA 4G25A 3ESKA 2HO1A 5JJ6A 3CV0A 2P58C 5LCWJ 1NZNA 3KAEA 2HR2A 3LKUA 3K9IA 3MV2B 4I9EA 5KJNA 3PDNA 2R5SA 3NF1A 4UI9K 3OXGA 3RIBA 3ZN3A 5HI7A 4NQ0A 5A6CA 4CGVA 3QOUA 1NA0A 3CK7A 1WAO1 3Q49B 2C0LA 2VQ2A 3OXFA 3ASHA 4I17A 3LY7A 3RKVA 3LYAA 3QDNA 3Q15A 4G2VA 2Q7FA 1ELWA 4HOTA 4GYYA 2C2LA 4AM9A 3BEEA 4U04A 3CVNA 5G05C 4BT9A 3ZHEA 5JJ7A 3PE3A 2YQ8A 4A1SA 4BTBA 3TAXA 4HORA 1W3BA 3ZPJA 4O6FA 2MHKA 3S7BA 4BT8A 3FFLA 3RU0A 5C1DA 2L6JA 2KCKA 2UY1B 3R9AB 4AIFA 5LCWC 3Q4AB 3UUXA 1QZ2A 2XGSA 1YA0A 5FZSA 2XCCA 3LPZA 4JA9A 2OOEA 3RJVA 1HH8A 2KCLA 3EDTB 3MV3B 5DIZA 3LY8A 1ELRA 3Q47B 5KJLA 2VGXB 2KCVA 3MKRA 1P5QA 3GW4A 2XCBA 3MEKA 4HOSA 3GZ1A 4GA2A 5BNWA 4LEUA 5EX3A 5CCLA 2Y4UA 3TG5A 1KT1A 3S7JA 3Q5MA 4ME2A 3WXXA 4GYWA 4UI9C 4J8EA 4HOUA 4N39A 3AS4A 3AS5A 4I2WA 4GCOA 4JL0A 4U0ZA 2UY1A 3S7FA 3QWVA 4Y6WA 5A7DB 2FI7A 1PC2A 1NA3A 3GYZA 1KT0A 2FEZA 4WNFA 5FJYA 2IF4A 4WNGA 4ABNA 3RO3A 3OXLA 5BW8C 5DBKA 4UQZA 4B94A 2WPVA 3SF4A 5G04C 2GW1A 2DBAA 3QWWA 3AS8A 4W9RA 1E96B 5CCMA 2I6HA
chains in the Genus database with same CATH superfamily
2OVBA 4I1OB 2LUHA 3CSTA 3LVRE 2AWIA 5EILA 1AP7A 2VGXA 3TWTA 4OVVA 4H7YA 4YVQC 2RG8A 4KVMA 2YNQA 3ZYMA 3FUEA 2WXOA 3UM1A 2V4LA 4MLPA 4KXKB 4AY6A 1BI7B 2GGFA 3DWLG 2WVIA 2WXGA 1TYQG 2XPIA 1S64A 1V54E 2IONA 3J5PA 3QB2A 5EN5D 3B7SA 4OAVB 2IFUA 2NSZA 4H7XA 4XKBA 3VLEA 3L17A 4WUYA 3UKUG 4EQFA 1OCCE 5B1BE 2MRIA 2VGEA 3BUAA 1MHQA 3T8MA 5E75A 3CHSA 1WM5A 2HYZA 1H2VC 5FZQA 2HM8A 4HI9A 1IYGA 4GZ5A 3L9TA 4CEMA 3V30A 2V4HC 2IOSA 3FU3A 1N94A 2R17C 3U3WA 1N11A 2GRRB 4JD2G 5KNGA 4G11A 5KJMA 2UWJG 4WNDA 3HVEA 4PDXA 5BUZA 3Q75A 4JHKA 1WY6A 4HFGA 2XZDG 3CK8A 3C3QA 3CVLA 4GTOA 4FJZA 4YDWA 1HXIA 5JJTA 3BQOA 4GA0A 3U64A 2BUGA 3IBEA 2EIJE 3PS6A 3EU5A 4O1OA 4BEPA 4JB8P 4PH4B 4LNUD 4APOA 4K5BA 4AEZC 3FP3A 3WG7E 4ANVA 4EZJA 4N3BA 1FVFA 4A3TA 2MOWA 3S7DA 4XI9A 4YVOA 4GZ6A 2FO7A 1L5JA 3CR3A 2ETAA 3D3MA 3KD7A 3DPDA 5CMYA 4C0MA 2WM9A 1INZA 4EZLA 5ARFA 2X6KA 2H6IA 4Q94A 1EF1C 4L1BA 1SVXA 5CERB 2VSYA 2RKKA 4RG6A 3MA5A 4EHMA 5ENRD 4N2QA 3ZHEB 4RSYA 1KPSB 1N4SA 4EPZA 3FUHA 3ASDA 5JA4D 3FULA 3PE4A 2BKKB 3TG4A 3AAAC 4J8DA 2J4DA 1O5MA 4WWPA 4FLBA 3IHVA 1UN9A 1HFAA 2DZNA 1NI1A 3UX4A 3D9LA 4HRLA 3KAEA 3U9WA 3MJWA 3LKUA 3HXFA 2VTBB 5ENQD 3OAWA 4J8YA 3G2TA 3D9IA 4HRNA 4J7WA 1TNYA 1UW4B 2F0YA 1D8EA 4DRXE 1UN8A 3C5RA 5JMND 3APCA 4NQ0A 3CK7A 2R59A 4JXTA 5J90A 3OXFA 3ASHA 3LY7A 3RKVA 2RFAA 3UKRG 2Q7FA 2Y69E 4HOTA 4KVOA 4GYYA 3TWWA 3V31A 3W9GA 4ZFHA 2KZTA 1LD7A 4U04A 2AXUA 3QJZA 3PE3A 3TAXA 4HORA 3ZPJA 4O6FA 5KNHD 2MHKA 4BT8A 3DXKG 4JC8A 4Z68A 1DCEA 2CG2A 1FT2A 5LCWC 3UUXA 1QZ2A 2XGSA 3GZSA 3CVXA 5FQ6A 1HF8A 2XHEA 3LVQE 4FJYA 3G2WA 3LPZA 4JA9A 3G2UA 4MKTA 1HS6A 3FU5A 2WXNA 1N0QA 3P2BA 3MV3B 4D10C 5DIZA 4APFA 2R03A 4G8LA 1ZB1A 2VGXB 2KCVA 4GTSA 1E8XA 3FTUA 4GTTA 3L16A 3ZXSA 2WXRA 3GW4A 5BV1A 3QAQA 4HOSA 3GZ1A 3PEVB 4LEUA 3PUJA 5EX3A 2KXPC 4AP2A 2ILRA 1Z5SC 1U3CA 4EBAG 2ETCA 2H6GA 3EIQC 4ME2A 3UIPC 2DWZA 4GYWA 4J8EA 1N4RA 1H6KA 3QNKA 4U8VD 1TN7A 3L22A 3DEOA 2GROB 3TWRA 4WWOA 3HXDA 2WXMA 2Y1LE 3DRAA 4TXQA 4Y6WA 4DX1A 4QFVA 3B95A 1NA3A 3Q9UC 2WXKA 4ABNA 1U2VG 3OXLA 3E37A 3D9PA 1OWNA 4U95D 2XEHA 5BW8C 3ZUVB 5ENTD 3C72A 4UQZA 2WQ7A 3DSXA 3QWWA 1SZAA 3SGHA 1UG3A 3AS8A 1Y6IA 1E96B 4JPSA 2R2LA 5CCMA 5CRVA 3DSUA 1HU3A 5ENSD 4J8FA 3Q9NC 4I6JA 3HDXA 1FCHA 2R05A 4X8QA 5HKPA 5AAOA 3JXIA 5HS0A 2A5UA 2LXLA 4BERA 2XPZA 5G2NA 2Y4TA 4QQIA 5FZRA 3D9HA 1BI8B 3CHMA 4KYOB 4XIFA 5FIOA 4HI8A 4XKCA 3EUVA 1IHGA 3FH7A 4N5QA 4B8AA 4HOQA 4BETA 5CRUA 3ABKE 1N4QA 3TWSA 2C0MA 1NP7A 4E6HA 5EIDA 1PY1A 1H6OA 2QY7A 3FU0A 2LSVA 3TWVA 1XNFA 2IO3C 4DJAA 2OV8A 3LEWA 1YMPA 4YNDA 3FTYA 5BT1A 4I9CA 4IRUA 3CIAA 2MYOA 3CQGB 3FUMA 5BPPA 3FUFA 3FTSA 4CDRA 4FP7A 4I43A 5AQ7A 3T5XA 3PEUB 4TXRA 2XGMA 4GTPA 4GZ3A 4JEHA 5FQ4A 2Y3AA 3U4TA 3ENEA 4L7TA 4JHRA 2LSUA 3UPVA 2DZOA 1IQRA 3ULEG 3DSTA 4DX6D 5EYPF 3C3OA 3NBNB 2WQHA 1QQEA 3CVPA 3HIZA 4I2ZA 1H6PA 3TWQA 2DYRE 1OXJA 4Y6CA 3HXBA 4HLEA 5ARGA 2KC7A 3PVLA 4G26A 3QKYA 1RW2A 3TXMA 1HZ4A 3RAUA 1U3DA 3MYVA 1SA5A 5FT9A 2I1JA 2WXPA 3Q7AA 2YHCA 4IYPA 4G1TA 4HVBA 4GZCA 2QYJA 3AG1E 3HRAA 2WXIA 3RSEG 1DNPA 1YYHA 5ENOD 3NB2A 4F1PA 2X6IA 3JUIA 2KZTB 4DI4A 4CT0A 1JWFA 3L6AA 1JCRA 3PRZA 3SFYA 2RFMA 1UOHA 4DX2A 1X5BA 4GPMA 4YDYA 3IKOB 3DPYA 2LNIA 1E8WA 1QYMA 5EDSA 3ONLA 2V8SE 4A55A 4WWNA 1ELKA 2V5QC 3SBTB 4MRUA 3HXEA 3ISMC 4P29A 2CFZA 4F1SA 1TNOA 4EECA 1DC2A 5LCWJ 4ACKA 1KZPA 2DCPA 3PZ1A 3K9IA 3B7BA 4I9EA 3MX3A 4A63B 3PDNA 1MQSA 1EYHA 2IU1A 3RIBA 3FTWA 3ZN3A 5ANLA 2ETBA 5T4YA 3TL5A 4L2YA 4G8KA 3VLDA 2IEJA 4CGVA 5J08A 5AARA 3Q49B 3CVYA 3IV0A 4KZCA 1NFIE 3UM3A 4I6GA 3QDNA 4F53A 1TNBA 2C2LA 4LUNU 2B0OE 4XZ4A 3BEEA 1LTXA 4FADA 1RZ4A 3I3NA 2OVFA 4BTBA 4IULA 4PS8A 1SW6A 4GMLA 2IY0C 3FFLA 2H6HA 4L23A 1KZOA 2ZGGA 5LOZA 2RD0A 1TJFA 3S2AA 3BG1B 2AXVA 4FHKA 2LAIA 3PH0C 1JWGA 3JQ1A 3UTMA 3EDTB 3NZUA 3SBSA 1OCOE 4MBGA 5AIJA 3DSSA 4B8CB 5KJLA 3MKRA 5FWQA 1P5QA 4DUIA 3L08A 1OY3D 3MEKA 5BNWA 4J6IA 3T5VA 4NURA 2V0PA 3UM0A 5CCLA 3MGBA 5CECB 3S7JA 3Q78A 1JUQA 1H2UA 3FH8A 2WXQA 4ATZD 1A5EA 4N39A 3AS4A 3LXUX 3F6QA 1LF8A 3Q7FA 3MCXA 4I2WA 4GCOA 3R9MA 4ANXA 2UY1A 1QNFA 2QC9A 4F6RD 5A7DB 2FI7A 2XRZA 3GYZA 1E90A 1MZCA 2WB2A 1E7VA 3LS8A 2XS8A 4RQIA 3SFXA 3OTNA 2YINA 4GTRA 3FUJA 3DXMG 4B94A 4HB5A 2F8XK 2WPVA 3JCKC 4LRZA 2GW1A 4YDOA 1YCSB 1DVPA 1DCQA 3CQCB 4ILIA 3HXCA 4GZDA 2WXFA 5JHBA 2JLBA 2XEEA 3FUDA 3D9JA 5FINA 4JW1A 4R7LA 3W9FA 2GRPB 4MS6A 2I2OA 4DLQA 2VSXE 2Y0BG 4V3IA 3EHMA 1S63A 4F3VA 3L13A 2PM7A 3V79K 4BX8A 4TXPA 4N3CA 2VSNA 3JQ0A 3ABLE 2J07A 5CMWA 3ML9A 4G23A 3EHQA 2P9PG 4U63A 4AOFA 3IXEA 1Q2ZA 3GZ2A 5FTPA 1OWLA 4B0ZA 4RG9A 2NXPA 1K3ZD 4CCAA 3VTYA 3UINC 2VGYA 2PQNA 3PZ4A 1TJCA 4HLLA 4BTAA 1TNUA 1IQUA 4N3AA 2X6FA 4Q96A 4FA6A 3SO8A 3ZW3A 4U07A 4A3VA 1SA4A 3BU8A 2IOLA 4ATGA 2E0IA 1G3NB 2WXHA 4BESA 4K5AB 4BWRA 3R7RA 3SD5A 3RRMB 3TWXA 4ZHBA 2EINE 4AJWA 3CSFA 4HBDA 3CKCA 3FUNA 2GRQB 4NIKA 1WG0A 1UJKA 3Q79A 1TN8A 2FO1E 2IO2C 3UT4A 2E2EA 1D9SA 2L6BA 2IQCA 2X6JA 5T3RA 3LCAA 4KT6B 3RO2A 1EPUA 1H2TC 3LY9A 2PL2A 2AVPA 3FU6A 3CHRA 1S0PA 2FF4A 3N71A 3ZVVA 4ANUA 4HNAD 2JABA 2I9CA 4E85A 1TR4A 4C9BB 4UWHA 3Q73A 3CK9A 3UI2A 3ASNE 4UI9J 3C3RA 1H0AA 2PZIA 3V2XA 5D66A 4UQYA 3PZ2A 3KSQA 4I1AA 4KBQA 4TUUA 5CEAA 5D2MC 3EIJA 2ZIRA 2XS1A 3VTXA 5ITZF 2FBNA 3O48A 4A1GA 2WMNA 1BU9A 3CVVA 4U0SA 5ANRA 4XI0A 4WNEA 4GYOA 4DX7D 3FHEA 4N2SA 3ASGA 1KLXA 2V5FA 2P9SG 3EHNA 2GRMA 3FEXA 3QC1A 3IEGA 1BPOA 3UQ3A 5JHAA 3KS2A 5G04J 1IXVA 1O1SA 2IJGX 3CHOA 3TJPA 4LSZE 5EX0A 2H6FA 5AYWD 4U7EB 4JA7A 4KZ0A 4UUCA 5A23A 1FVHA 4G25A 3CLJA 3ESKA 3NQPA 1JCQA 5JJ6A 3CV0A 4UWGA 3D9KA 2CHZA 1NZNA 4CZ2D 3FUIA 4M7CA 4YDEA 1Z3YA 3MV2B 3PREA 4JZYA 1PAQA 4GAAA 2P9UG 2R5SA 3UXGA 3OXGA 4CDMA 4FULA 4NACA 2BKGA 1HG5A 3UT8A 1H19A 5HI7A 4PS3A 3ML8A 3ESLA 5A6CA 3QOUA 4CT4A 2VQ2A 1VDYA 4BFRA 2WXLA 2OEVA 2LAHA 3LYAA 1SZ9A 3AU4A 3Q15A 4G2VA 1ELWA 4DPRA 1E7UA 3APDA 2OEWA 4TV3A 3FUKA 3PZDA 4U96D 1TEZA 4AM9A 5KWDA 5AENA 2X3MA 5G05C 5B3SE 4BT9A 4GTQA 5JJ7A 2YQ8A 2J8SD 4K03A 3D9NA 3L82A 1HO8A 4LERA 2BF0X 2XQ0A 2J08A 3EU9A 1V55E 5CBNA 1AWCB 2UY1B 4AIFA 2BEDA 5IY5E 3Q4AB 3C98A 1YA0A 2XCCA 3ZRHA 4PS7A 3HG0D 3T9KA 2OOEA 3D9OA 4L2LA 2CFUA 2KCLA 3ZYQA 4OVUA 4GB9A 3LY8A 2BTDA 2ZISA 5KBAA 5AJLA 4URKA 1QBQA 4TUMA 2CHXA 2A4ZA 2VJ8A 4F7AA 2XCBA 2ZXWE 3EJNA 3RRUA 1WDYA 4L9PA 1E8ZA 2P9LG 2KM4A 4GA2A 5CEDB 5B1AE 2EIME 4GTVA 2Y4UA 5LP0A 2I1KA 1KT1A 3CHPA 2KBXA 3LJNA 3SQVA 1MYOA 3WXXA 4HS2A 4UI9C 1OWMA 4HOUA 2L9BA 5G55A 1UJJA 4K5CA 1N4PA 4BSZB 5FQ8A 3I4GA 2AJAA 5CBOA 3S7FA 1N0RA 2LXMA 1OWPA 1E8YA 4WAFA 1PC2A 2FEZA 5FJYA 2IF4A 3MKQA 2XENA 5DBKA 1OT8A 4BX9A 3E30A 2AW6A 3AU5A 5G04C 1JCSA 1D8DA 3BG0B 4EBAA 2L0TB 4U8YD 2J4BA 3CVUA 1FT1A 2I6HA 4CRWA 2J49A 2P9NG 2ONDA 2A5EA 3AG4E 1N54A 2L0IA 3ZFWA 2OCCE 3NAWA 3T8KA 3FTZA 3TGOA 5AN8A 1MX4A 5FQ7A 4Q69A 5EKQD 4J8SA 3HHMA 2EILE 2EIKE 3KSLA 2XPYA 1IHBA 1B89A 3ZGQA 3JUEA 3IHYA 5AQAA 5HQ8A 5D0QD 2QFCA 4AVXA 3UT7A 5E76A 3PZ3A 3CKBA 3PUKA 1OUVA 3J5QB 5EYLA 3DEPA 2PNNA 3ZIMA 5HRYA 2P9KG 3FTVA 1JPLA 4AY5A 2J09A 4NRHB 3CEQA 2NYJA 4DX5D 4FU3A 3DSWA 3RK6A 4B89A 3FTXA 1IKND 3DBSA 4BY6A 2PQRA 3V2OA 3URZA 3B7RL 1LD8A 4GCNA 5CHEE 3RRNB 3LJ3A 1ZU2A 4M3OA 3G2SA 3SY2A 2X6HA 3ZYLA 3SFZA 3ZEFA 4HXIA 5EIBE 4U0UA 3SHFA 4I6EA 3JYSA 4G24A 3QARA 4CYMD 2ZGDA 4I1MA 3KEAA 5KJKA 2AXZA 3E33A 1A17A 4GPKA 5D0OD 2DVWA 4DK5A 2R02A 2B6CA 1Y8MA 2XGOA 4U8HA 4N5CA 2VYIA 4IN3B 5H7PA 4B93B 4HQDA 2FULA 2GRNB 3PNTB 3HYMB 1N95A 2XEVA 3CVQA 5M72A 2QYUA 3JXJA 1BLXB 1O1RA 2CHWA 2P2CP 3FDHA 3NOGD 2M63A 3FWVA 2YHEA 4BSXA 3E4BA 2J9QA 1NL4A 3QWPA 3E32A 4ILGA 2KATA 3ULQA 3TWUA 4RLYA 1TNZA 4UQXA 5G05J 4RVBA 3L54A 3P1UA 1EDUA 4GMJA 4GA1A 2NC9A 4FHJA 1MX2A 4J0UA 2LO6A 4XE0A 1K8KG 3ASFA 3SZ7A 3R7QA 5C2YA 3CHQA 4CGWA 4JEUA 4O60A 3CGHA 3QK0A 3ZXPA 1ZBPA 2EQXA 2HO1A 2F8YA 2P58C 4FC8A 3KEZA 4K0RA 3O4ZA 1O1TA 1GW6A 3FH5A 3ZU7B 3APFA 3ASOE 2HR2A 1K1AA 3B7TA 2GRLA 1HE8A 5KJNA 3UM2A 4GTMA 1OCRE 5BXUA 1N9AA 3B13A 3NF1A 4KMOA 4UI9K 3ZNGA 3D9MA 1OCZE 2XZTG 2F37A 3DSVA 4LNGA 1NA0A 5AJDA 1WAO1 3PNLB 2C0LA 1TN6A 4I17A 3G2VA 3B7UX 1OWOA 3AJIA 1SQMA 1MJ0A 2ZU6B 1HX8A 3I5PA 5AQ9A 3ZYKA 4JVSA 2WMOA 4C48B 3I4RB 3CVNA 4XEIG 2PM6A 2XRYA 3ZHEA 4EZKA 4A1SA 3ABME 3NOCD 1W3BA 3FEYA 5AQBA 3CVWA 1HG2A 4CDNA 1BD8A 3S7BA 3UMVA 3NZSA 4OYSA 3AG3E 3RU0A 5C1DA 1X81A 2KCKA 2L6JA 2X38A 2WQ6A 3R9AB 1MX6A 5FZSA 2P9IG 4PUCA 3MKQB 4UWLA 4ILHB 4AV7A 5ENNA 3HVEB 3E34A 2VSOE 4UWKA 3ZKJA 2VTBA 5LX8A 4C0EA 3RJVA 4DLOA 1HH8A 4TRQA 5ENPD 3MZLB 4JHJA 1ELRA 3Q47B 4UWFA 2DIWA 5T8IA 3ONKA 3U66A 5KCMA 4LCTA 4AXHA 4ANWA 3EHRA 1Z6TA 2WXJA 3TG5A 3Q5MA 3SI5A 3VLFA 5BXOA 4LG6A 4OAUC 2JEKA 4DI3A 3TXNA 4HRMB 3FY4A 1N52A 1K1BA 4FLHA 3AS5A 3AG2E 1S70B 4LNBA 4ACLA 4JL0A 4U0ZA 3SNXA 3QWVA 4O1PA 4GU5A 3UIOC 4XX5A 1KT0A 4WNFA 5BV0A 1XGWA 4WNGA 5LFAA 3RO3A 3LDZA 1Z3XA 2HE0A 2QZAA 1FPPA 3X2QE 3SF4A 2DBAA 4GMRA 4W9RA 3ULYA 2CG3A 2DYSE
chains in the Genus database with same CATH topology
2J49A 2OVBA 4GZDA 4I1OB 2WXFA 5JHBA 2JLBA 3CSTA 2ONDA 3LVRE 2AWIA 1N54A 1HU3A 2L0IA 3FUDA 2VGXA 3D9JA 4J8FA 4I6JA 3HDXA 4JW1A 3ZFWA 4R7LA 1FCHA 4OVVA 4H7YA 4MS6A 2I2OA 4YVQC 2VSXE 4DLQA 2RG8A 4KVMA 2YNQA 2A5UA 4V3IA 3EHMA 3ZYMA 4F3VA 3FTZA 3TGOA 3FUEA 3L13A 2PM7A 2WXOA 5FQ7A 2XPZA 4Q69A 2V4LA 4BX8A 5EKQD 4MLPA 5G2NA 4J8SA 2Y4TA 4N3CA 4KXKB 2VSNA 3JQ0A 4AY6A 2GGFA 5FZRA 3HHMA 2J07A 2WVIA 5CMWA 2WXGA 3ML9A 2XPYA 4G23A 3CHMA 4KYOB 1B89A 4XIFA 3ZGQA 4U63A 4AOFA 3IHYA 4XKCA 5HQ8A 1IHGA 2XPIA 3GZ2A 2IONA 2QFCA 5D0QD 3QB2A 5FTPA 1OWLA 4AVXA 3B7SA 4B0ZA 3FH7A 4RG9A 3UT7A 5E76A 2IFUA 2NSZA 2NXPA 3CKBA 4H7XA 4XKBA 3VTYA 4B8AA 4CCAA 3VLEA 3PUKA 2VGYA 3L17A 4HOQA 1OUVA 2PQNA 1TJCA 4WUYA 3ZIMA 4BTAA 2C0MA 1NP7A 3FTVA 4EQFA 1IQUA 1JPLA 4N3AA 4AY5A 4E6HA 2J09A 2MRIA 4NRHB 2X6FA 4Q96A 1MHQA 3CEQA 4FA6A 3T8MA 3ZW3A 1PY1A 5E75A 4FU3A 4U07A 3CHSA 2QY7A 3FU0A 1WM5A 4A3VA 2HYZA 3RK6A 1H2VC 2LSVA 5FZQA 2HM8A 1IYGA 1XNFA 2IOLA 4ATGA 2E0IA 4B89A 3FTXA 4DJAA 4GZ5A 2WXHA 3DBSA 4BY6A 2OV8A 2PQRA 4CEMA 4BWRA 3URZA 3R7RA 3B7RL 3SD5A 3RRMB 3LEWA 4YNDA 3FTYA 5BT1A 2IOSA 3FU3A 4I9CA 4IRUA 4GCNA 4AJWA 3CSFA 2R17C 5CHEE 3CIAA 3CKCA 3RRNB 3LJ3A 3CQGB 3FUMA 5BPPA 1ZU2A 3U3WA 3FUNA 3FUFA 4M3OA 3FTSA 3G2SA 4CDRA 2X6HA 4FP7A 4I43A 1UJKA 3T5XA 3SFZA 3PEUB 3ZYLA 3ZEFA 4G11A 2XGMA 3UT4A 4GZ3A 4HXIA 2E2EA 4JEHA 5KJMA 2UWJG 4WNDA 4U0UA 5FQ4A 3SHFA 2Y3AA 2IQCA 3JYSA 4I6EA 3ENEA 3HVEA 4PDXA 3U4TA 5BUZA 4G24A 3QARA 4JHKA 4L7TA 4I1MA 4JHRA 2X6JA 5KJKA 1WY6A 2LSUA 4HFGA 3CVLA 3CK8A 5T3RA 3LCAA 4KT6B 3UPVA 4FJZA 2AXZA 3RO2A 1IQRA 1HXIA 1EPUA 3CQCB 1H2TC 1A17A 3LY9A 4GPKA 5JJTA 2PL2A 4GA0A 3U64A 5D0OD 2BUGA 3IBEA 2AVPA 4DK5A 2WQHA 1QQEA 3CVPA 3HIZA 3PS6A 4I2ZA 3FU6A 3CHRA 1S0PA 1Y8MA 4PH4B 2XGOA 2FF4A 3N71A 3ZVVA 4U8HA 4N5CA 4ANUA 4APOA 2VYIA 4IN3B 4AEZC 3FP3A 2I9CA 4ANVA 4E85A 4EZJA 4Y6CA 4N3BA 4C9BB 4UWHA 2FULA 4HLEA 5ARGA 1FVFA 2KC7A 3PNTB 3PVLA 3HYMB 4A3TA 4G26A 3QKYA 2MOWA 2XEVA 3CVQA 5M72A 3TXMA 3S7DA 3CK9A 4XI9A 4YVOA 4GZ6A 1HZ4A 2FO7A 4UI9J 1L5JA 1U3DA 1H0AA 2PZIA 3CR3A 4UQYA 4TUUA 3MYVA 4I1AA 4KBQA 3D3MA 3EIJA 2CHWA 3DPDA 3KD7A 5CMYA 4C0MA 3VTXA 5FT9A 2WM9A 2I1JA 2FBNA 3O48A 1INZA 4A1GA 3FDHA 4EZLA 2M63A 2WMNA 3FWVA 3CVVA 4U0SA 2YHEA 2WXPA 4BSXA 2YHCA 3E4BA 5ANRA 4XI0A 4IYPA 4WNEA 5ARFA 4G1TA 4GYOA 2X6KA 4HVBA 3FHEA 2J9QA 4GZCA 3TG4A 4N2SA 3ASGA 4Q94A 2WXIA 1EF1C 4L1BA 1DNPA 1KLXA 2V5FA 3QWPA 3EHNA 2GRMA 2VSYA 2X6IA 3FEXA 3JUIA 3QC1A 2KZTB 3MA5A 4ILGA 4RG6A 2KATA 3IEGA 1JWFA 4CT0A 4DI4A 3L6AA 1BPOA 3PRZA 3ULQA 3UQ3A 3CVUA 4N2QA 1X5BA 3ZHEB 5JHAA 4UQXA 3KS2A 5G05J 3IKOB 5G04J 4RSYA 2LNIA 4RVBA 3L54A 3P1UA 2IJGX 1E8WA 1EDUA 3CHOA 5EDSA 3TJPA 4GMJA 4EPZA 3FUHA 5EX0A 3ASDA 2NC9A 4FHJA 4GA1A 5AYWD 3ONLA 2LO6A 4J0UA 4XE0A 3ASFA 3FULA 3SZ7A 3R7QA 4JA7A 3PE4A 2V8SE 3CHQA 5C2YA 4CGWA 4JEUA 4A55A 4WWNA 3CGHA 1ELKA 4J8DA 4KZ0A 3QK0A 3SBTB 1ZBPA 2J4DA 1FVHA 5A23A 4G25A 3CLJA 4MRUA 4P29A 2EQXA 2CFZA 3ESKA 2HO1A 4F1SA 3NQPA 5JJ6A 3CV0A 4WWPA 4FLBA 3IHVA 2P58C 1UN9A 1HFAA 3D9KA 4FC8A 4UWGA 2CHZA 4EECA 3KEZA 5LCWJ 4K0RA 3O4ZA 3UX4A 4ACKA 1NZNA 3D9LA 1GW6A 3FH5A 3FUIA 3KAEA 3U9WA 3APFA 3MJWA 2DCPA 2HR2A 3LKUA 4DLOA 3K9IA 1Z3YA 3B7TA 3MV2B 2GRLA 3PREA 2VTBB 4JZYA 1HE8A 4I9EA 5KJNA 3MX3A 3OAWA 1PAQA 3PDNA 4GAAA 2R5SA 3G2TA 1MQSA 3D9IA 3B13A 1EYHA 3NF1A 3OXGA 4KMOA 4UI9K 2IU1A 1UW4B 3RIBA 3FTWA 4CDMA 3ZN3A 4FULA 4NACA 5ANLA 1HG5A 1UN8A 3D9MA 3UT8A 5T4YA 3TL5A 1H19A 4L2YA 5HI7A 3APCA 3ML8A 4NQ0A 3ESLA 4PS3A 5A6CA 3VLDA 4CGVA 5J08A 3QOUA 1NA0A 3CK7A 5AJDA 1WAO1 3Q49B 2R59A 2C0LA 3PNLB 4CT4A 2VQ2A 4JXTA 5J90A 3IV0A 3CVYA 1VDYA 3OXFA 3ASHA 4I17A 3G2VA 4BFRA 2WXLA 3B7UX 3LY7A 4KZCA 3RKVA 2LAHA 3LYAA 3QDNA 4I6GA 1SZ9A 3AU4A 1OWOA 3Q15A 4G2VA 1SQMA 2Q7FA 4F53A 1ELWA 4DPRA 4HOTA 4KVOA 1E7UA 2C2LA 4GYYA 3APDA 2ZU6B 1HX8A 4TV3A 4LUNU 3I5PA 3FUKA 2KZTA 3ZYKA 4JVSA 3PZDA 2WMOA 4XZ4A 1TEZA 4AM9A 3BEEA 2AXUA 3I4RB 3CVNA 4U04A 2X3MA 5G05C 5AENA 2PM6A 4FADA 2XRYA 4BT9A 3ZHEA 4EZKA 5JJ7A 3I3NA 3QJZA 3PE3A 2OVFA 2YQ8A 4A1SA 3TAXA 4BTBA 4HORA 1W3BA 4IULA 3ZPJA 3FEYA 4O6FA 3CVWA 1HG2A 4CDNA 3D9NA 4K03A 4PS8A 1HO8A 2MHKA 4GMLA 4LERA 3S7BA 3FFLA 3NZSA 3UMVA 4BT8A 2BF0X 4JC8A 4OYSA 4L23A 2XQ0A 2J08A 3RU0A 5LOZA 5C1DA 2L6JA 2KCKA 2X38A 2WQ6A 2UY1B 3R9AB 4AIFA 2RD0A 2CG2A 5LCWC 3Q4AB 3C98A 3UUXA 1QZ2A 1TJFA 2XGSA 1YA0A 3GZSA 5FZSA 3S2AA 2XCCA 3CVXA 5FQ6A 3ZRHA 4PUCA 3MKQB 3BG1B 1HF8A 4UWLA 4ILHB 4AV7A 5ENNA 4PS7A 3HVEB 2XHEA 3LVQE 2VSOE 4UWKA 2AXVA 4FHKA 4FJYA 3G2WA 2VTBA 2LAIA 3LPZA 5LX8A 3PH0C 4JA9A 1JWGA 3G2UA 4MKTA 1HS6A 2OOEA 4C0EA 3D9OA 3FU5A 2WXNA 3JQ1A 2CFUA 1HH8A 4L2LA 2KCLA 4TRQA 3RJVA 3EDTB 3P2BA 3ZYQA 3MV3B 4OVUA 4D10C 3NZUA 4GB9A 5DIZA 3SBSA 3LY8A 2BTDA 3MZLB 4JHJA 1ELRA 4APFA 3Q47B 5AIJA 4B8CB 4UWFA 5KJLA 2DIWA 2VGXB 2KCVA 5AJLA 4URKA 3MKRA 5T8IA 5FWQA 1E8XA 2CHXA 2A4ZA 3FTUA 1P5QA 2VJ8A 3L16A 3L08A 3ZXSA 2WXRA 3ONKA 3U66A 3GW4A 4F7AA 2XCBA 5KCMA 5BV1A 3EJNA 3QAQA 3RRUA 3MEKA 4HOSA 3GZ1A 1E8ZA 3PEVB 2KM4A 4GA2A 4J6IA 4LEUA 4LCTA 5BNWA 3PUJA 4AXHA 5EX3A 3T5VA 4NURA 4ANWA 2V0PA 1Z6TA 5CCLA 3MGBA 4AP2A 2WXJA 2Y4UA 2ILRA 5LP0A 1U3CA 1KT1A 2I1KA 3S7JA 3CHPA 3Q5MA 3SI5A 3TG5A 4EBAG 1JUQA 1H2UA 3EIQC 3FH8A 4ME2A 3VLFA 2WXQA 3WXXA 2JEKA 4DI3A 4GYWA 4HS2A 4UI9C 3TXNA 1OWMA 4J8EA 4HOUA 3FY4A 1H6KA 4N39A 3AS4A 3QNKA 1N52A 2L9BA 3LXUX 5G55A 1UJJA 4FLHA 3L22A 1LF8A 3AS5A 3MCXA 4I2WA 4GCOA 4WWOA 5FQ8A 4JL0A 4ACLA 3I4GA 4U0ZA 3SNXA 4ANXA 2WXMA 2UY1A 3S7FA 1QNFA 3QWVA 1OWPA 4Y6WA 1E8YA 4GU5A 5A7DB 2FI7A 4QFVA 4WAFA 4XX5A 1PC2A 2XRZA 1NA3A 3GYZA 1KT0A 2FEZA 1E90A 4WNFA 5FJYA 5BV0A 2WXKA 1E7VA 1XGWA 2IF4A 2WB2A 4WNGA 4ABNA 5LFAA 3MKQA 3OXLA 3RO3A 3LS8A 3D9PA 1OWNA 3LDZA 5BW8C 1Z3XA 5DBKA 4BX9A 4UQZA 3OTNA 2YINA 2AW6A 3FUJA 3AU5A 4B94A 2WQ7A 2WPVA 3SF4A 3JCKC 4LRZA 5G04C 2GW1A 2DBAA 3QWWA 1SZAA 3SGHA 1DVPA 1UG3A 3BG0B 2L0TB 4EBAA 3AS8A 4W9RA 1Y6IA 1E96B 4JPSA 2J4BA 2CG3A 5CCMA 4ILIA 4CRWA 2I6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JLB A;  2OND A;  2VGX A;  4J8F A;  3ZFW A;  1FCH A;  4H7Y A;  4YVQ C;  4F3V A;  3TGO A;  5EKQ D;  2Y4T A;  4N3C A;  4KXK B;  2VSN A;  4AY6 A;  5FZR A;  4G23 A;  4KYO B;  1B89 A;  4XIF A;  3ZGQ A;  5HQ8 A;  1IHG A;  2XPI A;  3GZ2 A;  5D0Q D;  2QFC A;  5FTP A;  4RG9 A;  2IFU A;  4H7X A;  3CKB A;  3VTY A;  2VGY A;  4HOQ A;  1OUV A;  2PQN A;  1TJC A;  4WUY A;  4BTA A;  2C0M A;  4EQF A;  4N3A A;  4AY5 A;  4NRH B;  3CEQ A;  4U07 A;  1WM5 A;  2HYZ A;  2LSV A;  5FZQ A;  1IYG A;  1XNF A;  4GZ5 A;  2PQR A;  4BWR A;  3URZ A;  4YND A;  5BT1 A;  4I9C A;  4GCN A;  5CHE E;  3CKC A;  1ZU2 A;  3U3W A;  4CDR A;  2XGM A;  4GZ3 A;  2E2E A;  5KJM A;  2UWJ G;  4WND A;  4U0U A;  3U4T A;  3JYS A;  4G24 A;  4JHR A;  5KJK A;  2LSU A;  3CVL A;  3CK8 A;  3LCA A;  3UPV A;  3RO2 A;  1HXI A;  3LY9 A;  1A17 A;  4GPK A;  5JJT A;  2PL2 A;  4GA0 A;  5D0O D;  2BUG A;  2AVP A;  2WQH A;  1QQE A;  3CVP A;  4I2Z A;  1Y8M A;  2XGO A;  2FF4 A;  3N71 A;  4N5C A;  4APO A;  2VYI A;  4IN3 B;  3FP3 A;  4Y6C A;  4N3B A;  5ARG A;  2KC7 A;  3HYM B;  4G26 A;  3QKY A;  2XEV A;  3CVQ A;  5M72 A;  3S7D A;  3CK9 A;  4XI9 A;  4YVO A;  4GZ6 A;  1HZ4 A;  2FO7 A;  4UI9 J;  2PZI A;  4UQY A;  4I1A A;  4KBQ A;  3KD7 A;  3VTX A;  5FT9 A;  2FBN A;  3O48 A;  3FWV A;  4U0S A;  2YHC A;  3E4B A;  4XI0 A;  4WNE A;  5ARF A;  4G1T A;  4GYO A;  4N2S A;  2J9Q A;  3ASG A;  1KLX A;  2V5F A;  3QWP A;  2VSY A;  4RG6 A;  3MA5 A;  2KAT A;  3IEG A;  3ULQ A;  3UQ3 A;  4N2Q A;  3ZHE B;  4UQX A;  3KS2 A;  5G05 J;  5G04 J;  2LNI A;  5EX0 A;  5AYW D;  3ASD A;  2NC9 A;  4GA1 A;  4J0U A;  3ASF A;  3SZ7 A;  4JA7 A;  3PE4 A;  4CGW A;  3TG4 A;  4J8D A;  1ZBP A;  4G25 A;  3ESK A;  2HO1 A;  5JJ6 A;  3CV0 A;  2P58 C;  5LCW J;  1NZN A;  3KAE A;  2HR2 A;  3LKU A;  3K9I A;  3MV2 B;  4I9E A;  5KJN A;  3PDN A;  2R5S A;  3NF1 A;  4UI9 K;  3OXG A;  3RIB A;  3ZN3 A;  5HI7 A;  4NQ0 A;  5A6C A;  4CGV A;  3QOU A;  1NA0 A;  3CK7 A;  1WAO 1;  3Q49 B;  2C0L A;  2VQ2 A;  3OXF A;  3ASH A;  4I17 A;  3LY7 A;  3RKV A;  3LYA A;  3QDN A;  3Q15 A;  4G2V A;  2Q7F A;  1ELW A;  4HOT A;  4GYY A;  2C2L A;  4AM9 A;  3BEE A;  4U04 A;  3CVN A;  5G05 C;  4BT9 A;  3ZHE A;  5JJ7 A;  3PE3 A;  2YQ8 A;  4A1S A;  4BTB A;  3TAX A;  4HOR A;  1W3B A;  3ZPJ A;  4O6F A;  2MHK A;  3S7B A;  4BT8 A;  3FFL A;  3RU0 A;  5C1D A;  2L6J A;  2KCK A;  2UY1 B;  3R9A B;  4AIF A;  5LCW C;  3Q4A B;  3UUX A;  1QZ2 A;  2XGS A;  1YA0 A;  5FZS A;  2XCC A;  3LPZ A;  4JA9 A;  2OOE A;  3RJV A;  1HH8 A;  2KCL A;  3EDT B;  3MV3 B;  5DIZ A;  3LY8 A;  1ELR A;  3Q47 B;  5KJL A;  2VGX B;  2KCV A;  3MKR A;  1P5Q A;  3GW4 A;  2XCB A;  3MEK A;  4HOS A;  3GZ1 A;  4GA2 A;  5BNW A;  4LEU A;  5EX3 A;  5CCL A;  2Y4U A;  3TG5 A;  1KT1 A;  3S7J A;  3Q5M A;  4ME2 A;  3WXX A;  4GYW A;  4UI9 C;  4J8E A;  4HOU A;  4N39 A;  3AS4 A;  3AS5 A;  4I2W A;  4GCO A;  4JL0 A;  4U0Z A;  2UY1 A;  3S7F A;  3QWV A;  4Y6W A;  5A7D B;  2FI7 A;  1PC2 A;  1NA3 A;  3GYZ A;  1KT0 A;  2FEZ A;  4WNF A;  5FJY A;  2IF4 A;  4WNG A;  4ABN A;  3RO3 A;  3OXL A;  5BW8 C;  5DBK A;  4UQZ A;  4B94 A;  2WPV A;  3SF4 A;  5G04 C;  2GW1 A;  2DBA A;  3QWW A;  3AS8 A;  4W9R A;  1E96 B;  5CCM A;  2I6H A; 
#chains in the Genus database with same CATH topology
 2OVB A;  4I1O B;  2LUH A;  3CST A;  3LVR E;  2AWI A;  5EIL A;  1AP7 A;  2VGX A;  3TWT A;  4OVV A;  4H7Y A;  4YVQ C;  2RG8 A;  4KVM A;  2YNQ A;  3ZYM A;  3FUE A;  2WXO A;  3UM1 A;  2V4L A;  4MLP A;  4KXK B;  4AY6 A;  1BI7 B;  2GGF A;  3DWL G;  2WVI A;  2WXG A;  1TYQ G;  2XPI A;  1S64 A;  1V54 E;  2ION A;  3J5P A;  3QB2 A;  5EN5 D;  3B7S A;  4OAV B;  2IFU A;  2NSZ A;  4H7X A;  4XKB A;  3VLE A;  3L17 A;  4WUY A;  3UKU G;  4EQF A;  1OCC E;  5B1B E;  2MRI A;  2VGE A;  3BUA A;  1MHQ A;  3T8M A;  5E75 A;  3CHS A;  1WM5 A;  2HYZ A;  1H2V C;  5FZQ A;  2HM8 A;  4HI9 A;  1IYG A;  4GZ5 A;  3L9T A;  4CEM A;  3V30 A;  2V4H C;  2IOS A;  3FU3 A;  1N94 A;  2R17 C;  3U3W A;  1N11 A;  2GRR B;  4JD2 G;  5KNG A;  4G11 A;  5KJM A;  2UWJ G;  4WND A;  3HVE A;  4PDX A;  5BUZ A;  3Q75 A;  4JHK A;  1WY6 A;  4HFG A;  2XZD G;  3CK8 A;  3C3Q A;  3CVL A;  4GTO A;  4FJZ A;  4YDW A;  1HXI A;  5JJT A;  3BQO A;  4GA0 A;  3U64 A;  2BUG A;  3IBE A;  2EIJ E;  3PS6 A;  3EU5 A;  4O1O A;  4BEP A;  4JB8 P;  4PH4 B;  4LNU D;  4APO A;  4K5B A;  4AEZ C;  3FP3 A;  3WG7 E;  4ANV A;  4EZJ A;  4N3B A;  1FVF A;  4A3T A;  2MOW A;  3S7D A;  4XI9 A;  4YVO A;  4GZ6 A;  2FO7 A;  1L5J A;  3CR3 A;  2ETA A;  3D3M A;  3KD7 A;  3DPD A;  5CMY A;  4C0M A;  2WM9 A;  1INZ A;  4EZL A;  5ARF A;  2X6K A;  2H6I A;  4Q94 A;  1EF1 C;  4L1B A;  1SVX A;  5CER B;  2VSY A;  2RKK A;  4RG6 A;  3MA5 A;  4EHM A;  5ENR D;  4N2Q A;  3ZHE B;  4RSY A;  1KPS B;  1N4S A;  4EPZ A;  3FUH A;  3ASD A;  5JA4 D;  3FUL A;  3PE4 A;  2BKK B;  3TG4 A;  3AAA C;  4J8D A;  2J4D A;  1O5M A;  4WWP A;  4FLB A;  3IHV A;  1UN9 A;  1HFA A;  2DZN A;  1NI1 A;  3UX4 A;  3D9L A;  4HRL A;  3KAE A;  3U9W A;  3MJW A;  3LKU A;  3HXF A;  2VTB B;  5ENQ D;  3OAW A;  4J8Y A;  3G2T A;  3D9I A;  4HRN A;  4J7W A;  1TNY A;  1UW4 B;  2F0Y A;  1D8E A;  4DRX E;  1UN8 A;  3C5R A;  5JMN D;  3APC A;  4NQ0 A;  3CK7 A;  2R59 A;  4JXT A;  5J90 A;  3OXF A;  3ASH A;  3LY7 A;  3RKV A;  2RFA A;  3UKR G;  2Q7F A;  2Y69 E;  4HOT A;  4KVO A;  4GYY A;  3TWW A;  3V31 A;  3W9G A;  4ZFH A;  2KZT A;  1LD7 A;  4U04 A;  2AXU A;  3QJZ A;  3PE3 A;  3TAX A;  4HOR A;  3ZPJ A;  4O6F A;  5KNH D;  2MHK A;  4BT8 A;  3DXK G;  4JC8 A;  4Z68 A;  1DCE A;  2CG2 A;  1FT2 A;  5LCW C;  3UUX A;  1QZ2 A;  2XGS A;  3GZS A;  3CVX A;  5FQ6 A;  1HF8 A;  2XHE A;  3LVQ E;  4FJY A;  3G2W A;  3LPZ A;  4JA9 A;  3G2U A;  4MKT A;  1HS6 A;  3FU5 A;  2WXN A;  1N0Q A;  3P2B A;  3MV3 B;  4D10 C;  5DIZ A;  4APF A;  2R03 A;  4G8L A;  1ZB1 A;  2VGX B;  2KCV A;  4GTS A;  1E8X A;  3FTU A;  4GTT A;  3L16 A;  3ZXS A;  2WXR A;  3GW4 A;  5BV1 A;  3QAQ A;  4HOS A;  3GZ1 A;  3PEV B;  4LEU A;  3PUJ A;  5EX3 A;  2KXP C;  4AP2 A;  2ILR A;  1Z5S C;  1U3C A;  4EBA G;  2ETC A;  2H6G A;  3EIQ C;  4ME2 A;  3UIP C;  2DWZ A;  4GYW A;  4J8E A;  1N4R A;  1H6K A;  3QNK A;  4U8V D;  1TN7 A;  3L22 A;  3DEO A;  2GRO B;  3TWR A;  4WWO A;  3HXD A;  2WXM A;  2Y1L E;  3DRA A;  4TXQ A;  4Y6W A;  4DX1 A;  4QFV A;  3B95 A;  1NA3 A;  3Q9U C;  2WXK A;  4ABN A;  1U2V G;  3OXL A;  3E37 A;  3D9P A;  1OWN A;  4U95 D;  2XEH A;  5BW8 C;  3ZUV B;  5ENT D;  3C72 A;  4UQZ A;  2WQ7 A;  3DSX A;  3QWW A;  1SZA A;  3SGH A;  1UG3 A;  3AS8 A;  1Y6I A;  1E96 B;  4JPS A;  2R2L A;  5CCM A;  5CRV A;  3DSU A;  1HU3 A;  5ENS D;  4J8F A;  3Q9N C;  4I6J A;  3HDX A;  1FCH A;  2R05 A;  4X8Q A;  5HKP A;  5AAO A;  3JXI A;  5HS0 A;  2A5U A;  2LXL A;  4BER A;  2XPZ A;  5G2N A;  2Y4T A;  4QQI A;  5FZR A;  3D9H A;  1BI8 B;  3CHM A;  4KYO B;  4XIF A;  5FIO A;  4HI8 A;  4XKC A;  3EUV A;  1IHG A;  3FH7 A;  4N5Q A;  4B8A A;  4HOQ A;  4BET A;  5CRU A;  3ABK E;  1N4Q A;  3TWS A;  2C0M A;  1NP7 A;  4E6H A;  5EID A;  1PY1 A;  1H6O A;  2QY7 A;  3FU0 A;  2LSV A;  3TWV A;  1XNF A;  2IO3 C;  4DJA A;  2OV8 A;  3LEW A;  1YMP A;  4YND A;  3FTY A;  5BT1 A;  4I9C A;  4IRU A;  3CIA A;  2MYO A;  3CQG B;  3FUM A;  5BPP A;  3FUF A;  3FTS A;  4CDR A;  4FP7 A;  4I43 A;  5AQ7 A;  3T5X A;  3PEU B;  4TXR A;  2XGM A;  4GTP A;  4GZ3 A;  4JEH A;  5FQ4 A;  2Y3A A;  3U4T A;  3ENE A;  4L7T A;  4JHR A;  2LSU A;  3UPV A;  2DZO A;  1IQR A;  3ULE G;  3DST A;  4DX6 D;  5EYP F;  3C3O A;  3NBN B;  2WQH A;  1QQE A;  3CVP A;  3HIZ A;  4I2Z A;  1H6P A;  3TWQ A;  2DYR E;  1OXJ A;  4Y6C A;  3HXB A;  4HLE A;  5ARG A;  2KC7 A;  3PVL A;  4G26 A;  3QKY A;  1RW2 A;  3TXM A;  1HZ4 A;  3RAU A;  1U3D A;  3MYV A;  1SA5 A;  5FT9 A;  2I1J A;  2WXP A;  3Q7A A;  2YHC A;  4IYP A;  4G1T A;  4HVB A;  4GZC A;  2QYJ A;  3AG1 E;  3HRA A;  2WXI A;  3RSE G;  1DNP A;  1YYH A;  5ENO D;  3NB2 A;  4F1P A;  2X6I A;  3JUI A;  2KZT B;  4DI4 A;  4CT0 A;  1JWF A;  3L6A A;  1JCR A;  3PRZ A;  3SFY A;  2RFM A;  1UOH A;  4DX2 A;  1X5B A;  4GPM A;  4YDY A;  3IKO B;  3DPY A;  2LNI A;  1E8W A;  1QYM A;  5EDS A;  3ONL A;  2V8S E;  4A55 A;  4WWN A;  1ELK A;  2V5Q C;  3SBT B;  4MRU A;  3HXE A;  3ISM C;  4P29 A;  2CFZ A;  4F1S A;  1TNO A;  4EEC A;  1DC2 A;  5LCW J;  4ACK A;  1KZP A;  2DCP A;  3PZ1 A;  3K9I A;  3B7B A;  4I9E A;  3MX3 A;  4A63 B;  3PDN A;  1MQS A;  1EYH A;  2IU1 A;  3RIB A;  3FTW A;  3ZN3 A;  5ANL A;  2ETB A;  5T4Y A;  3TL5 A;  4L2Y A;  4G8K A;  3VLD A;  2IEJ A;  4CGV A;  5J08 A;  5AAR A;  3Q49 B;  3CVY A;  3IV0 A;  4KZC A;  1NFI E;  3UM3 A;  4I6G A;  3QDN A;  4F53 A;  1TNB A;  2C2L A;  4LUN U;  2B0O E;  4XZ4 A;  3BEE A;  1LTX A;  4FAD A;  1RZ4 A;  3I3N A;  2OVF A;  4BTB A;  4IUL A;  4PS8 A;  1SW6 A;  4GML A;  2IY0 C;  3FFL A;  2H6H A;  4L23 A;  1KZO A;  2ZGG A;  5LOZ A;  2RD0 A;  1TJF A;  3S2A A;  3BG1 B;  2AXV A;  4FHK A;  2LAI A;  3PH0 C;  1JWG A;  3JQ1 A;  3UTM A;  3EDT B;  3NZU A;  3SBS A;  1OCO E;  4MBG A;  5AIJ A;  3DSS A;  4B8C B;  5KJL A;  3MKR A;  5FWQ A;  1P5Q A;  4DUI A;  3L08 A;  1OY3 D;  3MEK A;  5BNW A;  4J6I A;  3T5V A;  4NUR A;  2V0P A;  3UM0 A;  5CCL A;  3MGB A;  5CEC B;  3S7J A;  3Q78 A;  1JUQ A;  1H2U A;  3FH8 A;  2WXQ A;  4ATZ D;  1A5E A;  4N39 A;  3AS4 A;  3LXU X;  3F6Q A;  1LF8 A;  3Q7F A;  3MCX A;  4I2W A;  4GCO A;  3R9M A;  4ANX A;  2UY1 A;  1QNF A;  2QC9 A;  4F6R D;  5A7D B;  2FI7 A;  2XRZ A;  3GYZ A;  1E90 A;  1MZC A;  2WB2 A;  1E7V A;  3LS8 A;  2XS8 A;  4RQI A;  3SFX A;  3OTN A;  2YIN A;  4GTR A;  3FUJ A;  3DXM G;  4B94 A;  4HB5 A;  2F8X K;  2WPV A;  3JCK C;  4LRZ A;  2GW1 A;  4YDO A;  1YCS B;  1DVP A;  1DCQ A;  3CQC B;  4ILI A;  3HXC A;  4GZD A;  2WXF A;  5JHB A;  2JLB A;  2XEE A;  3FUD A;  3D9J A;  5FIN A;  4JW1 A;  4R7L A;  3W9F A;  2GRP B;  4MS6 A;  2I2O A;  4DLQ A;  2VSX E;  2Y0B G;  4V3I A;  3EHM A;  1S63 A;  4F3V A;  3L13 A;  2PM7 A;  3V79 K;  4BX8 A;  4TXP A;  4N3C A;  2VSN A;  3JQ0 A;  3ABL E;  2J07 A;  5CMW A;  3ML9 A;  4G23 A;  3EHQ A;  2P9P G;  4U63 A;  4AOF A;  3IXE A;  1Q2Z A;  3GZ2 A;  5FTP A;  1OWL A;  4B0Z A;  4RG9 A;  2NXP A;  1K3Z D;  4CCA A;  3VTY A;  3UIN C;  2VGY A;  2PQN A;  3PZ4 A;  1TJC A;  4HLL A;  4BTA A;  1TNU A;  1IQU A;  4N3A A;  2X6F A;  4Q96 A;  4FA6 A;  3SO8 A;  3ZW3 A;  4U07 A;  4A3V A;  1SA4 A;  3BU8 A;  2IOL A;  4ATG A;  2E0I A;  1G3N B;  2WXH A;  4BES A;  4K5A B;  4BWR A;  3R7R A;  3SD5 A;  3RRM B;  3TWX A;  4ZHB A;  2EIN E;  4AJW A;  3CSF A;  4HBD A;  3CKC A;  3FUN A;  2GRQ B;  4NIK A;  1WG0 A;  1UJK A;  3Q79 A;  1TN8 A;  2FO1 E;  2IO2 C;  3UT4 A;  2E2E A;  1D9S A;  2L6B A;  2IQC A;  2X6J A;  5T3R A;  3LCA A;  4KT6 B;  3RO2 A;  1EPU A;  1H2T C;  3LY9 A;  2PL2 A;  2AVP A;  3FU6 A;  3CHR A;  1S0P A;  2FF4 A;  3N71 A;  3ZVV A;  4ANU A;  4HNA D;  2JAB A;  2I9C A;  4E85 A;  1TR4 A;  4C9B B;  4UWH A;  3Q73 A;  3CK9 A;  3UI2 A;  3ASN E;  4UI9 J;  3C3R A;  1H0A A;  2PZI A;  3V2X A;  5D66 A;  4UQY A;  3PZ2 A;  3KSQ A;  4I1A A;  4KBQ A;  4TUU A;  5CEA A;  5D2M C;  3EIJ A;  2ZIR A;  2XS1 A;  3VTX A;  5ITZ F;  2FBN A;  3O48 A;  4A1G A;  2WMN A;  1BU9 A;  3CVV A;  4U0S A;  5ANR A;  4XI0 A;  4WNE A;  4GYO A;  4DX7 D;  3FHE A;  4N2S A;  3ASG A;  1KLX A;  2V5F A;  2P9S G;  3EHN A;  2GRM A;  3FEX A;  3QC1 A;  3IEG A;  1BPO A;  3UQ3 A;  5JHA A;  3KS2 A;  5G04 J;  1IXV A;  1O1S A;  2IJG X;  3CHO A;  3TJP A;  4LSZ E;  5EX0 A;  2H6F A;  5AYW D;  4U7E B;  4JA7 A;  4KZ0 A;  4UUC A;  5A23 A;  1FVH A;  4G25 A;  3CLJ A;  3ESK A;  3NQP A;  1JCQ A;  5JJ6 A;  3CV0 A;  4UWG A;  3D9K A;  2CHZ A;  1NZN A;  4CZ2 D;  3FUI A;  4M7C A;  4YDE A;  1Z3Y A;  3MV2 B;  3PRE A;  4JZY A;  1PAQ A;  4GAA A;  2P9U G;  2R5S A;  3UXG A;  3OXG A;  4CDM A;  4FUL A;  4NAC A;  2BKG A;  1HG5 A;  3UT8 A;  1H19 A;  5HI7 A;  4PS3 A;  3ML8 A;  3ESL A;  5A6C A;  3QOU A;  4CT4 A;  2VQ2 A;  1VDY A;  4BFR A;  2WXL A;  2OEV A;  2LAH A;  3LYA A;  1SZ9 A;  3AU4 A;  3Q15 A;  4G2V A;  1ELW A;  4DPR A;  1E7U A;  3APD A;  2OEW A;  4TV3 A;  3FUK A;  3PZD A;  4U96 D;  1TEZ A;  4AM9 A;  5KWD A;  5AEN A;  2X3M A;  5G05 C;  5B3S E;  4BT9 A;  4GTQ A;  5JJ7 A;  2YQ8 A;  2J8S D;  4K03 A;  3D9N A;  3L82 A;  1HO8 A;  4LER A;  2BF0 X;  2XQ0 A;  2J08 A;  3EU9 A;  1V55 E;  5CBN A;  1AWC B;  2UY1 B;  4AIF A;  2BED A;  5IY5 E;  3Q4A B;  3C98 A;  1YA0 A;  2XCC A;  3ZRH A;  4PS7 A;  3HG0 D;  3T9K A;  2OOE A;  3D9O A;  4L2L A;  2CFU A;  2KCL A;  3ZYQ A;  4OVU A;  4GB9 A;  3LY8 A;  2BTD A;  2ZIS A;  5KBA A;  5AJL A;  4URK A;  1QBQ A;  4TUM A;  2CHX A;  2A4Z A;  2VJ8 A;  4F7A A;  2XCB A;  2ZXW E;  3EJN A;  3RRU A;  1WDY A;  4L9P A;  1E8Z A;  2P9L G;  2KM4 A;  4GA2 A;  5CED B;  5B1A E;  2EIM E;  4GTV A;  2Y4U A;  5LP0 A;  2I1K A;  1KT1 A;  3CHP A;  2KBX A;  3LJN A;  3SQV A;  1MYO A;  3WXX A;  4HS2 A;  4UI9 C;  1OWM A;  4HOU A;  2L9B A;  5G55 A;  1UJJ A;  4K5C A;  1N4P A;  4BSZ B;  5FQ8 A;  3I4G A;  2AJA A;  5CBO A;  3S7F A;  1N0R A;  2LXM A;  1OWP A;  1E8Y A;  4WAF A;  1PC2 A;  2FEZ A;  5FJY A;  2IF4 A;  3MKQ A;  2XEN A;  5DBK A;  1OT8 A;  4BX9 A;  3E30 A;  2AW6 A;  3AU5 A;  5G04 C;  1JCS A;  1D8D A;  3BG0 B;  4EBA A;  2L0T B;  4U8Y D;  2J4B A;  3CVU A;  1FT1 A;  2I6H A;  4CRW A;  2J49 A;  2P9N G;  2OND A;  2A5E A;  3AG4 E;  1N54 A;  2L0I A;  3ZFW A;  2OCC E;  3NAW A;  3T8K A;  3FTZ A;  3TGO A;  5AN8 A;  1MX4 A;  5FQ7 A;  4Q69 A;  5EKQ D;  4J8S A;  3HHM A;  2EIL E;  2EIK E;  3KSL A;  2XPY A;  1IHB A;  1B89 A;  3ZGQ A;  3JUE A;  3IHY A;  5AQA A;  5HQ8 A;  5D0Q D;  2QFC A;  4AVX A;  3UT7 A;  5E76 A;  3PZ3 A;  3CKB A;  3PUK A;  1OUV A;  3J5Q B;  5EYL A;  3DEP A;  2PNN A;  3ZIM A;  5HRY A;  2P9K G;  3FTV A;  1JPL A;  4AY5 A;  2J09 A;  4NRH B;  3CEQ A;  2NYJ A;  4DX5 D;  4FU3 A;  3DSW A;  3RK6 A;  4B89 A;  3FTX A;  1IKN D;  3DBS A;  4BY6 A;  2PQR A;  3V2O A;  3URZ A;  3B7R L;  1LD8 A;  4GCN A;  5CHE E;  3RRN B;  3LJ3 A;  1ZU2 A;  4M3O A;  3G2S A;  3SY2 A;  2X6H A;  3ZYL A;  3SFZ A;  3ZEF A;  4HXI A;  5EIB E;  4U0U A;  3SHF A;  4I6E A;  3JYS A;  4G24 A;  3QAR A;  4CYM D;  2ZGD A;  4I1M A;  3KEA A;  5KJK A;  2AXZ A;  3E33 A;  1A17 A;  4GPK A;  5D0O D;  2DVW A;  4DK5 A;  2R02 A;  2B6C A;  1Y8M A;  2XGO A;  4U8H A;  4N5C A;  2VYI A;  4IN3 B;  5H7P A;  4B93 B;  4HQD A;  2FUL A;  2GRN B;  3PNT B;  3HYM B;  1N95 A;  2XEV A;  3CVQ A;  5M72 A;  2QYU A;  3JXJ A;  1BLX B;  1O1R A;  2CHW A;  2P2C P;  3FDH A;  3NOG D;  2M63 A;  3FWV A;  2YHE A;  4BSX A;  3E4B A;  2J9Q A;  1NL4 A;  3QWP A;  3E32 A;  4ILG A;  2KAT A;  3ULQ A;  3TWU A;  4RLY A;  1TNZ A;  4UQX A;  5G05 J;  4RVB A;  3L54 A;  3P1U A;  1EDU A;  4GMJ A;  4GA1 A;  2NC9 A;  4FHJ A;  1MX2 A;  4J0U A;  2LO6 A;  4XE0 A;  1K8K G;  3ASF A;  3SZ7 A;  3R7Q A;  5C2Y A;  3CHQ A;  4CGW A;  4JEU A;  4O60 A;  3CGH A;  3QK0 A;  3ZXP A;  1ZBP A;  2EQX A;  2HO1 A;  2F8Y A;  2P58 C;  4FC8 A;  3KEZ A;  4K0R A;  3O4Z A;  1O1T A;  1GW6 A;  3FH5 A;  3ZU7 B;  3APF A;  3ASO E;  2HR2 A;  1K1A A;  3B7T A;  2GRL A;  1HE8 A;  5KJN A;  3UM2 A;  4GTM A;  1OCR E;  5BXU A;  1N9A A;  3B13 A;  3NF1 A;  4KMO A;  4UI9 K;  3ZNG A;  3D9M A;  1OCZ E;  2XZT G;  2F37 A;  3DSV A;  4LNG A;  1NA0 A;  5AJD A;  1WAO 1;  3PNL B;  2C0L A;  1TN6 A;  4I17 A;  3G2V A;  3B7U X;  1OWO A;  3AJI A;  1SQM A;  1MJ0 A;  2ZU6 B;  1HX8 A;  3I5P A;  5AQ9 A;  3ZYK A;  4JVS A;  2WMO A;  4C48 B;  3I4R B;  3CVN A;  4XEI G;  2PM6 A;  2XRY A;  3ZHE A;  4EZK A;  4A1S A;  3ABM E;  3NOC D;  1W3B A;  3FEY A;  5AQB A;  3CVW A;  1HG2 A;  4CDN A;  1BD8 A;  3S7B A;  3UMV A;  3NZS A;  4OYS A;  3AG3 E;  3RU0 A;  5C1D A;  1X81 A;  2KCK A;  2L6J A;  2X38 A;  2WQ6 A;  3R9A B;  1MX6 A;  5FZS A;  2P9I G;  4PUC A;  3MKQ B;  4UWL A;  4ILH B;  4AV7 A;  5ENN A;  3HVE B;  3E34 A;  2VSO E;  4UWK A;  3ZKJ A;  2VTB A;  5LX8 A;  4C0E A;  3RJV A;  4DLO A;  1HH8 A;  4TRQ A;  5ENP D;  3MZL B;  4JHJ A;  1ELR A;  3Q47 B;  4UWF A;  2DIW A;  5T8I A;  3ONK A;  3U66 A;  5KCM A;  4LCT A;  4AXH A;  4ANW A;  3EHR A;  1Z6T A;  2WXJ A;  3TG5 A;  3Q5M A;  3SI5 A;  3VLF A;  5BXO A;  4LG6 A;  4OAU C;  2JEK A;  4DI3 A;  3TXN A;  4HRM B;  3FY4 A;  1N52 A;  1K1B A;  4FLH A;  3AS5 A;  3AG2 E;  1S70 B;  4LNB A;  4ACL A;  4JL0 A;  4U0Z A;  3SNX A;  3QWV A;  4O1P A;  4GU5 A;  3UIO C;  4XX5 A;  1KT0 A;  4WNF A;  5BV0 A;  1XGW A;  4WNG A;  5LFA A;  3RO3 A;  3LDZ A;  1Z3X A;  2HE0 A;  2QZA A;  1FPP A;  3X2Q E;  3SF4 A;  2DBA A;  4GMR A;  4W9R A;  3ULY A;  2CG3 A;  2DYS E; 
#chains in the Genus database with same CATH homology
 2J49 A;  2OVB A;  4GZD A;  4I1O B;  2WXF A;  5JHB A;  2JLB A;  3CST A;  2OND A;  3LVR E;  2AWI A;  1N54 A;  1HU3 A;  2L0I A;  3FUD A;  2VGX A;  3D9J A;  4J8F A;  4I6J A;  3HDX A;  4JW1 A;  3ZFW A;  4R7L A;  1FCH A;  4OVV A;  4H7Y A;  4MS6 A;  2I2O A;  4YVQ C;  2VSX E;  4DLQ A;  2RG8 A;  4KVM A;  2YNQ A;  2A5U A;  4V3I A;  3EHM A;  3ZYM A;  4F3V A;  3FTZ A;  3TGO A;  3FUE A;  3L13 A;  2PM7 A;  2WXO A;  5FQ7 A;  2XPZ A;  4Q69 A;  2V4L A;  4BX8 A;  5EKQ D;  4MLP A;  5G2N A;  4J8S A;  2Y4T A;  4N3C A;  4KXK B;  2VSN A;  3JQ0 A;  4AY6 A;  2GGF A;  5FZR A;  3HHM A;  2J07 A;  2WVI A;  5CMW A;  2WXG A;  3ML9 A;  2XPY A;  4G23 A;  3CHM A;  4KYO B;  1B89 A;  4XIF A;  3ZGQ A;  4U63 A;  4AOF A;  3IHY A;  4XKC A;  5HQ8 A;  1IHG A;  2XPI A;  3GZ2 A;  2ION A;  2QFC A;  5D0Q D;  3QB2 A;  5FTP A;  1OWL A;  4AVX A;  3B7S A;  4B0Z A;  3FH7 A;  4RG9 A;  3UT7 A;  5E76 A;  2IFU A;  2NSZ A;  2NXP A;  3CKB A;  4H7X A;  4XKB A;  3VTY A;  4B8A A;  4CCA A;  3VLE A;  3PUK A;  2VGY A;  3L17 A;  4HOQ A;  1OUV A;  2PQN A;  1TJC A;  4WUY A;  3ZIM A;  4BTA A;  2C0M A;  1NP7 A;  3FTV A;  4EQF A;  1IQU A;  1JPL A;  4N3A A;  4AY5 A;  4E6H A;  2J09 A;  2MRI A;  4NRH B;  2X6F A;  4Q96 A;  1MHQ A;  3CEQ A;  4FA6 A;  3T8M A;  3ZW3 A;  1PY1 A;  5E75 A;  4FU3 A;  4U07 A;  3CHS A;  2QY7 A;  3FU0 A;  1WM5 A;  4A3V A;  2HYZ A;  3RK6 A;  1H2V C;  2LSV A;  5FZQ A;  2HM8 A;  1IYG A;  1XNF A;  2IOL A;  4ATG A;  2E0I A;  4B89 A;  3FTX A;  4DJA A;  4GZ5 A;  2WXH A;  3DBS A;  4BY6 A;  2OV8 A;  2PQR A;  4CEM A;  4BWR A;  3URZ A;  3R7R A;  3B7R L;  3SD5 A;  3RRM B;  3LEW A;  4YND A;  3FTY A;  5BT1 A;  2IOS A;  3FU3 A;  4I9C A;  4IRU A;  4GCN A;  4AJW A;  3CSF A;  2R17 C;  5CHE E;  3CIA A;  3CKC A;  3RRN B;  3LJ3 A;  3CQG B;  3FUM A;  5BPP A;  1ZU2 A;  3U3W A;  3FUN A;  3FUF A;  4M3O A;  3FTS A;  3G2S A;  4CDR A;  2X6H A;  4FP7 A;  4I43 A;  1UJK A;  3T5X A;  3SFZ A;  3PEU B;  3ZYL A;  3ZEF A;  4G11 A;  2XGM A;  3UT4 A;  4GZ3 A;  4HXI A;  2E2E A;  4JEH A;  5KJM A;  2UWJ G;  4WND A;  4U0U A;  5FQ4 A;  3SHF A;  2Y3A A;  2IQC A;  3JYS A;  4I6E A;  3ENE A;  3HVE A;  4PDX A;  3U4T A;  5BUZ A;  4G24 A;  3QAR A;  4JHK A;  4L7T A;  4I1M A;  4JHR A;  2X6J A;  5KJK A;  1WY6 A;  2LSU A;  4HFG A;  3CVL A;  3CK8 A;  5T3R A;  3LCA A;  4KT6 B;  3UPV A;  4FJZ A;  2AXZ A;  3RO2 A;  1IQR A;  1HXI A;  1EPU A;  3CQC B;  1H2T C;  1A17 A;  3LY9 A;  4GPK A;  5JJT A;  2PL2 A;  4GA0 A;  3U64 A;  5D0O D;  2BUG A;  3IBE A;  2AVP A;  4DK5 A;  2WQH A;  1QQE A;  3CVP A;  3HIZ A;  3PS6 A;  4I2Z A;  3FU6 A;  3CHR A;  1S0P A;  1Y8M A;  4PH4 B;  2XGO A;  2FF4 A;  3N71 A;  3ZVV A;  4U8H A;  4N5C A;  4ANU A;  4APO A;  2VYI A;  4IN3 B;  4AEZ C;  3FP3 A;  2I9C A;  4ANV A;  4E85 A;  4EZJ A;  4Y6C A;  4N3B A;  4C9B B;  4UWH A;  2FUL A;  4HLE A;  5ARG A;  1FVF A;  2KC7 A;  3PNT B;  3PVL A;  3HYM B;  4A3T A;  4G26 A;  3QKY A;  2MOW A;  2XEV A;  3CVQ A;  5M72 A;  3TXM A;  3S7D A;  3CK9 A;  4XI9 A;  4YVO A;  4GZ6 A;  1HZ4 A;  2FO7 A;  4UI9 J;  1L5J A;  1U3D A;  1H0A A;  2PZI A;  3CR3 A;  4UQY A;  4TUU A;  3MYV A;  4I1A A;  4KBQ A;  3D3M A;  3EIJ A;  2CHW A;  3DPD A;  3KD7 A;  5CMY A;  4C0M A;  3VTX A;  5FT9 A;  2WM9 A;  2I1J A;  2FBN A;  3O48 A;  1INZ A;  4A1G A;  3FDH A;  4EZL A;  2M63 A;  2WMN A;  3FWV A;  3CVV A;  4U0S A;  2YHE A;  2WXP A;  4BSX A;  2YHC A;  3E4B A;  5ANR A;  4XI0 A;  4IYP A;  4WNE A;  5ARF A;  4G1T A;  4GYO A;  2X6K A;  4HVB A;  3FHE A;  2J9Q A;  4GZC A;  3TG4 A;  4N2S A;  3ASG A;  4Q94 A;  2WXI A;  1EF1 C;  4L1B A;  1DNP A;  1KLX A;  2V5F A;  3QWP A;  3EHN A;  2GRM A;  2VSY A;  2X6I A;  3FEX A;  3JUI A;  3QC1 A;  2KZT B;  3MA5 A;  4ILG A;  4RG6 A;  2KAT A;  3IEG A;  1JWF A;  4CT0 A;  4DI4 A;  3L6A A;  1BPO A;  3PRZ A;  3ULQ A;  3UQ3 A;  3CVU A;  4N2Q A;  1X5B A;  3ZHE B;  5JHA A;  4UQX A;  3KS2 A;  5G05 J;  3IKO B;  5G04 J;  4RSY A;  2LNI A;  4RVB A;  3L54 A;  3P1U A;  2IJG X;  1E8W A;  1EDU A;  3CHO A;  5EDS A;  3TJP A;  4GMJ A;  4EPZ A;  3FUH A;  5EX0 A;  3ASD A;  2NC9 A;  4FHJ A;  4GA1 A;  5AYW D;  3ONL A;  2LO6 A;  4J0U A;  4XE0 A;  3ASF A;  3FUL A;  3SZ7 A;  3R7Q A;  4JA7 A;  3PE4 A;  2V8S E;  3CHQ A;  5C2Y A;  4CGW A;  4JEU A;  4A55 A;  4WWN A;  3CGH A;  1ELK A;  4J8D A;  4KZ0 A;  3QK0 A;  3SBT B;  1ZBP A;  2J4D A;  1FVH A;  5A23 A;  4G25 A;  3CLJ A;  4MRU A;  4P29 A;  2EQX A;  2CFZ A;  3ESK A;  2HO1 A;  4F1S A;  3NQP A;  5JJ6 A;  3CV0 A;  4WWP A;  4FLB A;  3IHV A;  2P58 C;  1UN9 A;  1HFA A;  3D9K A;  4FC8 A;  4UWG A;  2CHZ A;  4EEC A;  3KEZ A;  5LCW J;  4K0R A;  3O4Z A;  3UX4 A;  4ACK A;  1NZN A;  3D9L A;  1GW6 A;  3FH5 A;  3FUI A;  3KAE A;  3U9W A;  3APF A;  3MJW A;  2DCP A;  2HR2 A;  3LKU A;  4DLO A;  3K9I A;  1Z3Y A;  3B7T A;  3MV2 B;  2GRL A;  3PRE A;  2VTB B;  4JZY A;  1HE8 A;  4I9E A;  5KJN A;  3MX3 A;  3OAW A;  1PAQ A;  3PDN A;  4GAA A;  2R5S A;  3G2T A;  1MQS A;  3D9I A;  3B13 A;  1EYH A;  3NF1 A;  3OXG A;  4KMO A;  4UI9 K;  2IU1 A;  1UW4 B;  3RIB A;  3FTW A;  4CDM A;  3ZN3 A;  4FUL A;  4NAC A;  5ANL A;  1HG5 A;  1UN8 A;  3D9M A;  3UT8 A;  5T4Y A;  3TL5 A;  1H19 A;  4L2Y A;  5HI7 A;  3APC A;  3ML8 A;  4NQ0 A;  3ESL A;  4PS3 A;  5A6C A;  3VLD A;  4CGV A;  5J08 A;  3QOU A;  1NA0 A;  3CK7 A;  5AJD A;  1WAO 1;  3Q49 B;  2R59 A;  2C0L A;  3PNL B;  4CT4 A;  2VQ2 A;  4JXT A;  5J90 A;  3IV0 A;  3CVY A;  1VDY A;  3OXF A;  3ASH A;  4I17 A;  3G2V A;  4BFR A;  2WXL A;  3B7U X;  3LY7 A;  4KZC A;  3RKV A;  2LAH A;  3LYA A;  3QDN A;  4I6G A;  1SZ9 A;  3AU4 A;  1OWO A;  3Q15 A;  4G2V A;  1SQM A;  2Q7F A;  4F53 A;  1ELW A;  4DPR A;  4HOT A;  4KVO A;  1E7U A;  2C2L A;  4GYY A;  3APD A;  2ZU6 B;  1HX8 A;  4TV3 A;  4LUN U;  3I5P A;  3FUK A;  2KZT A;  3ZYK A;  4JVS A;  3PZD A;  2WMO A;  4XZ4 A;  1TEZ A;  4AM9 A;  3BEE A;  2AXU A;  3I4R B;  3CVN A;  4U04 A;  2X3M A;  5G05 C;  5AEN A;  2PM6 A;  4FAD A;  2XRY A;  4BT9 A;  3ZHE A;  4EZK A;  5JJ7 A;  3I3N A;  3QJZ A;  3PE3 A;  2OVF A;  2YQ8 A;  4A1S A;  3TAX A;  4BTB A;  4HOR A;  1W3B A;  4IUL A;  3ZPJ A;  3FEY A;  4O6F A;  3CVW A;  1HG2 A;  4CDN A;  3D9N A;  4K03 A;  4PS8 A;  1HO8 A;  2MHK A;  4GML A;  4LER A;  3S7B A;  3FFL A;  3NZS A;  3UMV A;  4BT8 A;  2BF0 X;  4JC8 A;  4OYS A;  4L23 A;  2XQ0 A;  2J08 A;  3RU0 A;  5LOZ A;  5C1D A;  2L6J A;  2KCK A;  2X38 A;  2WQ6 A;  2UY1 B;  3R9A B;  4AIF A;  2RD0 A;  2CG2 A;  5LCW C;  3Q4A B;  3C98 A;  3UUX A;  1QZ2 A;  1TJF A;  2XGS A;  1YA0 A;  3GZS A;  5FZS A;  3S2A A;  2XCC A;  3CVX A;  5FQ6 A;  3ZRH A;  4PUC A;  3MKQ B;  3BG1 B;  1HF8 A;  4UWL A;  4ILH B;  4AV7 A;  5ENN A;  4PS7 A;  3HVE B;  2XHE A;  3LVQ E;  2VSO E;  4UWK A;  2AXV A;  4FHK A;  4FJY A;  3G2W A;  2VTB A;  2LAI A;  3LPZ A;  5LX8 A;  3PH0 C;  4JA9 A;  1JWG A;  3G2U A;  4MKT A;  1HS6 A;  2OOE A;  4C0E A;  3D9O A;  3FU5 A;  2WXN A;  3JQ1 A;  2CFU A;  1HH8 A;  4L2L A;  2KCL A;  4TRQ A;  3RJV A;  3EDT B;  3P2B A;  3ZYQ A;  3MV3 B;  4OVU A;  4D10 C;  3NZU A;  4GB9 A;  5DIZ A;  3SBS A;  3LY8 A;  2BTD A;  3MZL B;  4JHJ A;  1ELR A;  4APF A;  3Q47 B;  5AIJ A;  4B8C B;  4UWF A;  5KJL A;  2DIW A;  2VGX B;  2KCV A;  5AJL A;  4URK A;  3MKR A;  5T8I A;  5FWQ A;  1E8X A;  2CHX A;  2A4Z A;  3FTU A;  1P5Q A;  2VJ8 A;  3L16 A;  3L08 A;  3ZXS A;  2WXR A;  3ONK A;  3U66 A;  3GW4 A;  4F7A A;  2XCB A;  5KCM A;  5BV1 A;  3EJN A;  3QAQ A;  3RRU A;  3MEK A;  4HOS A;  3GZ1 A;  1E8Z A;  3PEV B;  2KM4 A;  4GA2 A;  4J6I A;  4LEU A;  4LCT A;  5BNW A;  3PUJ A;  4AXH A;  5EX3 A;  3T5V A;  4NUR A;  4ANW A;  2V0P A;  1Z6T A;  5CCL A;  3MGB A;  4AP2 A;  2WXJ A;  2Y4U A;  2ILR A;  5LP0 A;  1U3C A;  1KT1 A;  2I1K A;  3S7J A;  3CHP A;  3Q5M A;  3SI5 A;  3TG5 A;  4EBA G;  1JUQ A;  1H2U A;  3EIQ C;  3FH8 A;  4ME2 A;  3VLF A;  2WXQ A;  3WXX A;  2JEK A;  4DI3 A;  4GYW A;  4HS2 A;  4UI9 C;  3TXN A;  1OWM A;  4J8E A;  4HOU A;  3FY4 A;  1H6K A;  4N39 A;  3AS4 A;  3QNK A;  1N52 A;  2L9B A;  3LXU X;  5G55 A;  1UJJ A;  4FLH A;  3L22 A;  1LF8 A;  3AS5 A;  3MCX A;  4I2W A;  4GCO A;  4WWO A;  5FQ8 A;  4JL0 A;  4ACL A;  3I4G A;  4U0Z A;  3SNX A;  4ANX A;  2WXM A;  2UY1 A;  3S7F A;  1QNF A;  3QWV A;  1OWP A;  4Y6W A;  1E8Y A;  4GU5 A;  5A7D B;  2FI7 A;  4QFV A;  4WAF A;  4XX5 A;  1PC2 A;  2XRZ A;  1NA3 A;  3GYZ A;  1KT0 A;  2FEZ A;  1E90 A;  4WNF A;  5FJY A;  5BV0 A;  2WXK A;  1E7V A;  1XGW A;  2IF4 A;  2WB2 A;  4WNG A;  4ABN A;  5LFA A;  3MKQ A;  3OXL A;  3RO3 A;  3LS8 A;  3D9P A;  1OWN A;  3LDZ A;  5BW8 C;  1Z3X A;  5DBK A;  4BX9 A;  4UQZ A;  3OTN A;  2YIN A;  2AW6 A;  3FUJ A;  3AU5 A;  4B94 A;  2WQ7 A;  2WPV A;  3SF4 A;  3JCK C;  4LRZ A;  5G04 C;  2GW1 A;  2DBA A;  3QWW A;  1SZA A;  3SGH A;  1DVP A;  1UG3 A;  3BG0 B;  2L0T B;  4EBA A;  3AS8 A;  4W9R A;  1Y6I A;  1E96 B;  4JPS A;  2J4B A;  2CG3 A;  5CCM A;  4ILI A;  4CRW A;  2I6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...