3FWVA

Crystal structure of a redesigned tpr protein, t-mod(vmy), in complex with meevf peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
128
structure length
128
Chain Sequence
b'SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hsc70/Hsp90-organizing protein
publication title Redesign of a protein-peptide interaction: characterization and applications
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 57
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fwvA00
2XGSA 3GZ1A 2KC7A 4UI9C 5KJKA 2XEVA 2BUGA 4Y6CA 3TG4A 5EX0A 3FWVA 2UY1B 1PC2A 5JJ7A 2KCVA 2KATA 1TJCA 3FFLA 5KJNA 1NA0A 2QFCA 2JLBA 1KT1A 3ZHEB 5LCWC 3LY7A 4GYWA 4HOUA 4J8EA 1OUVA 1IHGA 5BW8C 4N3AA 3LY9A 5KJMA 1ELWA 2XCBA 3QWPA 3SZ7A 2UY1A 4J8FA 3QWWA 4RG9A 5DIZA 4LEUA 4HOTA 3SF4A 2ONDA 2VGYA 2Y4TA 1NA3A 4U04A 3IEGA 2FEZA 5ARGA 3ZHEA 2PQNA 2V5FA 2NC9A 3RKVA 3ZPJA 2FO7A 4I2ZA 3JYSA 4JA7A 2L6JA 2AVPA 4U0ZA 3U4TA 4GCOA 4G25A 4GZ3A 4CGVA 5CCLA 3E4BA 3R9AB 4JHRA 3S7BA 5JJTA 1HH8A 4U07A 3VTYA 2PQRA 3ASHA 4XIFA 3UQ3A 4GYYA 4AIFA 5FZQA 4J0UA 3CVQA 4N2QA 4BT8A 1ZBPA 3GYZA 3CK7A 2VYIA 4XI9A 4N3CA 3CKCA 2WQHA 2R5SA 3KS2A 3CK8A 5M72A 2HYZA 1NZNA 3QOUA 4HOQA 3CK9A 4G2VA 3LY8A 4G26A 4CDRA 4A1SA 3AS8A 4BWRA 4UI9J 4HORA 2FI7A 4U0UA 4CGWA 4UQYA 4AY5A 3URZA 5HQ8A 3S7JA 4KYOB 3LPZA 4H7YA 1Y8MA 2LSUA 3CEQA 3ZGQA 5FZRA 3EDTB 3GZ2A 3OXLA 5G05C 5HI7A 2VSYA 2PL2A 3GW4A 5LCWJ 3Q15A 5DBKA 1E96B 4WUYA 3Q49B 2YHCA 5A6CA 3MA5A 5C1DA 2VGXB 4O6FA 5D0QD 3CVPA 4GA1A 4ABNA 3S7DA 4I9EA 4Y6WA 3ZFWA 4BTAA 3MEKA 4GA2A 5JJ6A 3TAXA 3KAEA 3FP3A 3Q5MA 2IFUA 2IF4A 4YVOA 5FTPA 1KT0A 3RU0A 4GCNA 2Q7FA 4YNDA 3ZN3A 5KJLA 1HZ4A 5G04C 3ESKA 4WNDA 3HYMB 3MV2B 4ME2A 4WNEA 5FT9A 2LNIA 4N3BA 3QDNA 2DBAA 5BT1A 3KD7A 5A7DB 3TG5A 2I6HA 3RO3A 1QZ2A 1XNFA 4I17A 2C2LA 5EX3A 4N2SA 4N39A 2KCKA 4H7XA 5ARFA 4EQFA 2YQ8A 3LYAA 5CCMA 3TGOA 4NQ0A 3CKBA 2OOEA 4BTBA 3PE4A 2XCCA 3RO2A 4I1AA 1QQEA 3OXGA 4UQXA 3K9IA 4NRHB 1A17A 2XPIA 3AS5A 3PE3A 2VSNA 3UUXA 1P5QA 1WM5A 5BNWA 2FF4A 3O48A 3ASDA 4U0SA 4BT9A 4G24A 5G05J 1W3BA 4YVQC 4JL0A 1ZU2A 2Y4UA 3CVNA 2UWJG 2LSVA 4XI0A 1B89A 5CHEE 4B94A 3MKRA 3Q4AB 4WNGA 2WPVA 4GYOA 3UPVA 2HO1A 1FCHA 3LCAA 3QKYA 4N5CA 5D0OD 4I9CA 4AM9A 4G1TA 2C0LA 3ASFA 4AY6A 3MV3B 3S7FA 2PZIA 5FZSA 4J8DA 2MHKA 1WAO1 5EKQD 4GPKA 1IYGA 2FBNA 4W9RA 2XGMA 3WXXA 5G04J 3CVLA 4GZ6A 4HOSA 2VGXA 4UQZA 4F3VA 4I2WA 4UI9K 3NF1A 3RJVA 4RG6A 4GZ5A 1YA0A 4WNFA 4IN3B 5FJYA 3VTXA 2KCLA 1KLXA 3U3WA 3AS4A 2J9QA 1ELRA 1HXIA 3OXFA 5AYWD 3ULQA 2HR2A 4G23A 3CV0A 4APOA 4KXKB 2P58C 4GA0A 2E2EA 2VQ2A 3ASGA 2XGOA 4JA9A 3LKUA 3Q47B 3QWVA 2C0MA 3BEEA 2GW1A 3PDNA 3RIBA 3N71A 4KBQA
chains in the Genus database with same CATH superfamily
2BF0X 3W9GA 4UWGA 2BUGA 3ULYA 3NAWA 4PS8A 1JWFA 5BUZA 3HXDA 4J8SA 4HI9A 3FWVA 1PC2A 2DYSE 3FTWA 5ENRD 1XGWA 5KJNA 3JQ1A 2A5EA 2QFCA 1KT1A 4JC8A 3FUHA 1OY3D 3DSUA 1H2TC 4WAFA 1Z6TA 2WXHA 5FQ8A 1V55E 1FT1A 3LEWA 2CFUA 1HF8A 1WG0A 4F7AA 4J8EA 3TWWA 1OCOE 2VGEA 4HVBA 1ELWA 5KNGA 2WXPA 1Y6IA 4GB9A 3FH8A 3KSLA 1AP7A 2AW6A 5KWDA 4J8FA 4CT0A 1UW4B 4HOTA 4UWHA 3SF4A 4URKA 1D9SA 1LD7A 4U04A 3IEGA 2PQNA 2IU1A 4OVVA 3TWSA 3RKVA 1DCQA 5AQ9A 3RRNB 4I2ZA 4LNUD 2QC9A 3FU6A 3U4TA 4G25A 4HQDA 4AXHA 3E34A 2IOSA 4CGVA 1HH8A 3I3NA 1O1RA 4DUIA 3JXJA 3ASHA 3QB2A 4GYYA 3UINC 1H2UA 4BT8A 3BG0B 1ZBPA 3DPYA 3GYZA 1FT2A 4B89A 4B93B 5C2YA 1N4SA 3DSXA 2P9IG 3UT7A 1NZNA 2WVIA 4HOQA 1JCSA 1MJ0A 4A1SA 4BETA 1K1AA 2FI7A 3ABME 3HDXA 3SGHA 3G2UA 3KEZA 3AU4A 3R9MA 4TXRA 1UG3A 3LPZA 5D2MC 3DSSA 4HS2A 3U66A 5G05C 2AWIA 1SW6A 4DLQA 2WXRA 4O1PA 1SA5A 4LERA 3UKUG 1TNUA 4CT4A 5HS0A 4BX9A 1H0AA 2XRYA 1IQUA 4ABNA 2X6JA 2WXKA 3C98A 3FUFA 4ILGA 3ZYLA 2GRLA 5ANRA 3IV0A 4XE0A 3FP3A 3RSEG 3BG1B 4YVOA 1DVPA 3RU0A 1HU3A 4A1GA 4GCNA 5KJLA 2AXZA 1HZ4A 5BV0A 4J6IA 3PVLA 3QK0A 2F0YA 3DPDA 5T8IA 3FH7A 3B7UX 4L7TA 1MX2A 2Y0BG 2JABA 3PZDA 1HO8A 1LD8A 3CHOA 3HYMB 4DX6D 1QNFA 4O60A 2DIWA 2ZGDA 3B13A 3ZEFA 4J7WA 4KZCA 1NL4A 2R02A 4GTSA 1TNYA 4GZCA 2Y3AA 2XHEA 3HVEB 4N2SA 1H6PA 1BLXB 2KCKA 3HHMA 5ARFA 4DRXE 1IKND 4JD2G 3C3QA 5B1AE 4UQXA 1Z3YA 1Q2ZA 4NRHB 2XPIA 3KEAA 3MCXA 3Q9NC 1N0QA 4FU3A 1WM5A 5B3SE 2IONA 3UTMA 5CEDB 1TNBA 3PZ3A 2IJGX 3DXKG 3FUNA 1OCCE 2GROB 5G05J 2GRPB 2WXQA 2R05A 4JL0A 2UWJG 2LSVA 3B7SA 3QARA 5D66A 1B89A 2GRNB 2WXIA 5CMYA 1GW6A 3MJWA 4WNGA 2WPVA 3UPVA 2HO1A 1FCHA 4LNGA 4IULA 4FLBA 3RRUA 4AM9A 4CYMD 3T9KA 4K5BA 3U64A 4G1TA 2C0LA 2WXMA 3ASFA 4APFA 3LS8A 3J5PA 4YDYA 5ITZF 4DX1A 2P2CP 3S2AA 2X38A 2MHKA 1KZOA 5EKQD 2I1KA 4HRLA 5JA4D 1JPLA 2FBNA 2XGMA 1YCSB 3RAUA 3CSTA 4B8AA 2WXGA 4Q94A 2BKGA 2V4HC 1MX4A 4F3VA 3NF1A 2PNNA 3L54A 4GTRA 3ZRHA 2BKKB 1QYMA 5EIDA 1NFIE 3C3RA 3VTXA 5EIBE 2V4LA 2RFMA 4TRQA 3U3WA 3HRAA 4FA6A 2J8SD 5AYWD 2L9BA 1NI1A 4UWLA 3SD5A 3HXCA 3L08A 4ZFHA 3V30A 5ANLA 4F6RD 1N4QA 4G8LA 3FEYA 4JHJA 3APCA 4F1SA 2WXJA 2KC7A 4UI9C 4JVSA 1OWMA 2XEVA 4Y6CA 4DX2A 1TEZA 3FH5A 1EPUA 2R03A 1UN8A 2RD0A 5EX0A 3LJ3A 2AXUA 2UY1B 5JJ7A 2KCVA 1DCEA 2KATA 3UX4A 3FFLA 3I4GA 3CR3A 4CDMA 5CRUA 1NA0A 3AG4E 2JLBA 4HNAD 2J09A 3ZHEB 2WXLA 2V5QC 3AG2E 3EHRA 2H6HA 1K1BA 4GYWA 4XKBA 4HOUA 5BW8C 3UM3A 3CHQA 4CZ2D 3Q75A 1N9AA 1FVHA 3ESLA 3SBTB 2LXMA 4OYSA 2DZOA 3JXIA 2UY1A 1TR4A 1HS6A 1UJKA 4CDNA 3D9JA 4UWKA 2ONDA 4L9PA 1NA3A 1N52A 4U96D 1N94A 3EIQC 3OAWA 5HRYA 2DYRE 3ZHEA 1VDYA 2V5FA 3ULEG 1ELKA 2NC9A 4EZJA 2XEEA 3V2XA 2I1JA 3QC1A 4TXQA 4EZLA 4JA7A 1E90A 2WMNA 4GCOA 2EQXA 1HE8A 3IHYA 2EIKE 2KXPC 4M7CA 5CCLA 1KZPA 5J08A 1BI7B 2ETCA 2HM8A 4XIFA 4GTMA 1HG5A 1INZA 2YINA 2KBXA 3CK7A 2R2LA 4BEPA 4DPRA 3HXBA 3CVVA 3CKCA 3FUDA 3UMVA 3TWTA 1X81A 5ENNA 3G2SA 4IYPA 2R5SA 1NP7A 5M72A 3PNTB 2HYZA 4MS6A 2CHZA 4N5QA 4YDOA 1OWOA 4G2VA 4CDRA 4BWRA 4HLLA 4UI9J 2IOLA 4U0UA 4ANWA 1PY1A 4AY5A 2ZIRA 5LP0A 3S7JA 3TWQA 4KYOB 2IY0C 2NSZA 1N4RA 4KT6B 3QJZA 3U9WA 4H7YA 2LSUA 3G2TA 3CEQA 3SY2A 3GZ2A 3PEVB 3BQOA 4DX7D 3DWLG 4B0ZA 2B0OE 3ZYQA 4EPZA 2VGXB 4O6FA 3AJIA 3CVPA 2V8SE 3S7DA 5EYPF 4FHJA 1MYOA 4GU5A 4BTAA 4PH4B 3PUJA 3PRZA 2VSXE 3FUJA 3E32A 3TAXA 1O1SA 3KAEA 3TXMA 2OVBA 3APDA 3RK6A 2IF4A 5EDSA 3UT8A 1FVFA 4J8YA 3B95A 4DI3A 5AARA 2RFAA 2MRIA 2VJ8A 2F8YA 3ZXSA 2XEHA 4WNDA 3WG7E 3MV2B 1A5EA 4ATZD 4WWPA 4X8QA 5T4YA 2WMOA 5FT9A 4GZDA 3BUAA 4C0EA 3NOGD 3RRMB 3V31A 3DBSA 3LJNA 4ANUA 4I6EA 2ZISA 4I17A 3HG0D 2WB2A 4H7XA 4EQFA 4FP7A 3TGOA 5B1BE 3ZW3A 4NQ0A 3CKBA 3EHMA 2OOEA 3JUIA 4DJAA 3E33A 2XCCA 4I1AA 1OWLA 4U95D 3OXGA 4KMOA 4KVOA 5JMND 5T3RA 3AS5A 3FULA 4JB8P 3PUKA 3PE3A 2VSNA 5BXUA 3UI2A 2XS1A 2CG3A 2AJAA 5BNWA 3O48A 1N4PA 3G2VA 4G24A 3CHPA 3DSVA 4G11A 1TN8A 2EINE 5FQ4A 3JUEA 4P29A 4YVQC 5E75A 4IRUA 5AQAA 3UM1A 4ILHB 4XI0A 3MKRA 3ABLE 5G2NA 2A4ZA 4DK5A 1H19A 4N5CA 4LNBA 4I9CA 3UKRG 5FWQA 3CVXA 2WM9A 3JCKC 4GTQA 4E85A 2P9PG 4M3OA 1E7UA 3APFA 3O4ZA 3W9FA 4AY6A 4HI8A 4K5AB 2I2OA 2DWZA 1S63A 3SI5A 3FUKA 3DEOA 4W9RA 3WXXA 4U7EB 2WXOA 3EHQA 3FU0A 4K0RA 3CVLA 4HOSA 4Q96A 3I5PA 1MQSA 5AJLA 3R7QA 2LXLA 5AQBA 4I1MA 1OWPA 2L0TB 3ONLA 4DLOA 1HX8A 3PH0C 3ML8A 4IN3B 3ABKE 2KCLA 4XEIG 4E6HA 2J9QA 1ELRA 1BPOA 1HXIA 3TXNA 2I9CA 3ULQA 1BI8B 4G23A 3CV0A 4APOA 2P58C 3BU8A 2WQ6A 3C72A 1PAQA 4AJWA 2ZGGA 3IKOB 3X2QE 3Q47B 1E8ZA 2C0MA 5AQ7A 2ILRA 4HRMB 3BEEA 2PM7A 5FIOA 3N71A 2XGSA 2LAIA 3GZ1A 4AVXA 1MZCA 3L16A 3CGHA 1N0RA 3SFZA 1JWGA 4PS7A 4C0MA 5IY5E 2CG2A 3HVEA 3AAAC 1TJCA 3NZSA 3FU5A 1OWNA 2XS8A 4FULA 2R17C 3L13A 3FEXA 1N54A 3UXGA 3QAQA 4KZ0A 2WQ7A 3V2OA 4KVMA 1Z3XA 4GTVA 3LVRE 3LY7A 2IEJA 5EN5D 1OUVA 1IHGA 1UJJA 4N3AA 1U2VG 2XCBA 3QWPA 1E8YA 3SZ7A 2YNQA 3QWWA 4RG9A 3EHNA 4LEUA 4K5CA 3ENEA 3R7RA 2XPZA 2VGYA 3SBSA 3G2WA 3TWVA 3P2BA 2FEZA 5ARGA 4ILIA 3L9TA 4MRUA 5KCMA 4GMLA 1S70B 3F6QA 3ZPJA 3Q7AA 4HLEA 1WY6A 5BV1A 2DCPA 4BERA 1OT8A 2L6JA 2AVPA 1OCZE 3EU9A 4GZ3A 4JHKA 3E4BA 3R9AB 3S7BA 5JJTA 2FULA 2XENA 4BX8A 4PS3A 2FO1E 3FHEA 1MHQA 3UQ3A 4LCTA 5FQ7A 2LO6A 4I6GA 2VYIA 4XI9A 3DRAA 4V3IA 2H6GA 4NACA 2WQHA 3L82A 4ATGA 3PZ1A 3HXFA 3KS2A 3CK8A 1V54E 4ZHBA 4PUCA 1YYHA 2J08A 3LY8A 3ZYMA 4F1PA 4HORA 2OVFA 4UQYA 3NB2A 3URZA 1MX6A 4A55A 4OAVB 4DX5D 4LRZA 1Y8MA 1UN9A 3ZGQA 4BESA 2RKKA 3ZNGA 3FTZA 1N11A 3PREA 2R59A 3PNLB 2VSYA 1FPPA 5BXOA 1IQRA 3GW4A 3Q15A 5DBKA 1E96B 1H6KA 2YHCA 3L17A 3Q49B 3OTNA 4ACKA 2ETBA 4AP2A 5C1DA 1BD8A 5D0QD 4ANVA 4TUMA 4GA1A 2CHWA 3ZVVA 4Y6WA 2WXFA 3ZFWA 5ENQD 1Z5SC 4L23A 2XRZA 3I4RB 1U3DA 3C3OA 3Q5MA 3D9LA 5AN8A 2IFUA 4FLHA 3T5XA 5FTPA 1KT0A 3ZU7B 3CHSA 3DSTA 4FJZA 2Q7FA 3TJPA 2IQCA 4L2LA 5G04C 4LUNU 1EDUA 4LSZE 4JEUA 1JUQA 3CIAA 2J4DA 4I1OB 2HE0A 2LAHA 3PEUB 2JEKA 4C9BB 4ME2A 4WNEA 2B6CA 2LNIA 2J49A 2J4BA 1JCQA 1YMPA 2L0IA 3TG5A 2I6HA 1QZ2A 2P9NG 2C2LA 1S0PA 3FTVA 2YQ8A 3LYAA 5CCMA 1OCRE 3FUIA 3PE4A 1QQEA 4FC8A 1KPSB 2F37A 4LG6A 3K9IA 4L2YA 1TJFA 2A5UA 3ZXPA 3D9IA 1A17A 3KSQA 1TNZA 1BU9A 2X3MA 3UM0A 1TN7A 3DXMG 4JW1A 3UUXA 2VSOE 2J07A 2FF4A 3DSWA 4HBDA 4U0SA 4BT9A 3TWRA 2CHXA 3PZ4A 1H6OA 1QBQA 2H6FA 1W3BA 1SQMA 3CVUA 4U8VD 1N95A 1ZU2A 2Y4UA 1HG2A 2EIJE 5CHEE 4B94A 2AXVA 4RSYA 1TNOA 4GYOA 3LCAA 3QKYA 3PS6A 4U63A 1HFAA 1K8KG 5FINA 2OEWA 4CRWA 3DEPA 3FUMA 3D9KA 3S7FA 3Q78A 4QQIA 4U8YD 2XZTG 4RQIA 4YDEA 2ZXWE 4OVUA 2KZTB 5G04J 3ONKA 4EBAA 5LOZA 3HIZA 3FTXA 3FTYA 4GZ6A 2VGXA 4UQZA 1K3ZD 5AAOA 4I2WA 4UI9K 2LUHA 3RJVA 4RG6A 4GZ5A 1YA0A 1IHBA 5G55A 5AJDA 4A63B 2ZU6B 1O5MA 3AS4A 4MBGA 3Q79A 4Z68A 4XZ4A 4UUCA 1AWCB 2HR2A 2P9SG 4KXKB 3CVWA 1TN6A 2EIME 4GA0A 2E2EA 2KZTA 2VQ2A 3EU5A 4EECA 2XPYA 4BSZB 4R7LA 2XGOA 3Q9UC 5A23A 1DC2A 4EBAG 4YDWA 1TYQG 2GW1A 3PDNA 3P1UA 4WWNA 3GZSA 5ENTD 4KBQA 3ASNE 2ETAA 5KJKA 4RLYA 3D9OA 1E8WA 5KNHD 1H2VC 4I43A 3TG4A 4B8CB 4I6JA 3TL5A 3T5VA 1L5JA 4QFVA 4D10C 5CBOA 3QNKA 2GRQB 4G8KA 5ENOD 1SZAA 4BFRA 3SFXA 5LCWC 5CMWA 3FDHA 3UIOC 3SO8A 2EILE 4L1BA 1RW2A 3LDZA 3LY9A 5KJMA 4GTOA 4DI4A 1D8DA 4FADA 3C5RA 4HRNA 4WWOA 4FJYA 5DIZA 2Y4TA 2OEVA 4NIKA 4HB5A 2X6KA 1SA4A 2XZDG 2FO7A 4GAAA 3JYSA 5HKPA 3FTSA 4U0ZA 3CQGB 4MKTA 4A3TA 2Y69E 4JHRA 3LXUX 3E30A 4U07A 3VTYA 2PQRA 3B7RL 4ANXA 4GTPA 2V0PA 4TUUA 4AIFA 5FZQA 4JZYA 4J0UA 3CVQA 4N2QA 3CQCB 4BY6A 4N3CA 5CBNA 2H6IA 3AG3E 2NYJA 4TXPA 2BTDA 5CECB 3VLFA 3ZKJA 3LVQE 3NQPA 3QOUA 3FU3A 2OV8A 2OCCE 3J5QB 3CK9A 4G26A 1JCRA 3ZYKA 3AS8A 4GTTA 5E76A 4CGWA 3D9PA 3VLEA 5HQ8A 4AEZC 2P9LG 5AIJA 4MLPA 4Q69A 2KM4A 5FZRA 3EDTB 4A3VA 3UIPC 5JHBA 3EIJA 3OXLA 5HI7A 3L22A 3MYVA 2PL2A 1G3NB 2BEDA 5LCWJ 3CSFA 4WUYA 5A6CA 2YHEA 1LTXA 2WXNA 3MA5A 4JPSA 4JXTA 1E7VA 4CEMA 4PDXA 5JHAA 3Q73A 4I9EA 4K03A 3CHMA 4TV3A 1EF1C 2GGFA 3SNXA 2MYOA 3MEKA 4GA2A 4FHKA 3E37A 1EYHA 2P9KG 4GPMA 5JJ6A 2QY7A 5CRVA 4BSXA 4EHMA 1LF8A 1IXVA 4YNDA 3ZN3A 4EZKA 4CCAA 3T8KA 2E0IA 2M63A 3ESKA 2F8XK 1D8EA 3CVYA 3B7TA 4U8HA 3ZUVB 3NBNB 2X6IA 4F53A 3MKQB 3TWUA 2QYJA 3FUEA 3EJNA 1OXJA 3ZIMA 4N3BA 3QDNA 2DBAA 2MOWA 5BT1A 3IXEA 3IHVA 3KD7A 1X5BA 5A7DB 3RO3A 5CERB 1XNFA 2IO2C 5EX3A 3CLJA 4N39A 2PM6A 2IO3C 3AU5A 5ENPD 3FTUA 3D9NA 3Q7FA 3ML9A 1O1TA 4BTBA 3RO2A 2QZAA 3MX3A 3D9HA 3MKQA 3SFYA 2CFZA 3IBEA 5CEAA 5LFAA 1ZB1A 2L6BA 3UT4A 1P5QA 1UOHA 3ASDA 3ISMC 4UWFA 5KBAA 2DZNA 2Y1LE 2NXPA 3ASOE 4GMRA 4C48B 3CVNA 3D3MA 2GRRB 1SVXA 5J90A 5BPPA 3Q4AB 2RG8A 2P9UG 1E8XA 5H7PA 3VLDA 5D0OD 3V79K 4NURA 3TWXA 4O1OA 3MV3B 4GMJA 3FY4A 2PZIA 4RVBA 3L6AA 5FZSA 4J8DA 1RZ4A 1WAO1 4GPKA 1IYGA 3T8MA 4AOFA 3MGBA 5EILA 3UM2A 1U3CA 5EYLA 3NZUA 3SHFA 4XKCA 5AENA 2VTBB 3NOCD 2X6FA 4WNFA 3PZ2A 3JQ0A 2DVWA 1S64A 5FJYA 4AV7A 3CHRA 3MZLB 1KLXA 3EUVA 4XX5A 3AG1E 2QYUA 4ACLA 4OAUC 3OXFA 5LX8A 1SZ9A 2X6HA 3D9MA 4JEHA 3B7BA 2XQ0A 2GRMA 5ENSD 4HXIA 3ASGA 4JA9A 3LKUA 3HXEA 3QWVA 3SQVA 5FQ6A 3RIBA 1DNPA 1WDYA 2VTBA 4HFGA
chains in the Genus database with same CATH topology
2XGSA 4JHJA 3APCA 4F1SA 2WXJA 2LAIA 2BF0X 3GZ1A 4AVXA 2KC7A 4UI9C 4JVSA 5KJKA 1OWMA 2XEVA 3D9OA 1E8WA 4UWGA 1H2VC 3L16A 2BUGA 3CGHA 4Y6CA 3SFZA 4I43A 3TG4A 1TEZA 3FH5A 4B8CB 1JWGA 1EPUA 4I6JA 4PS7A 4PS8A 3TL5A 1JWFA 4C0MA 1UN8A 2RD0A 5BUZA 3T5VA 5EX0A 2CG2A 4J8SA 3HVEA 3LJ3A 2AXUA 3FWVA 2UY1B 1L5JA 1PC2A 4QFVA 5JJ7A 4D10C 3FTWA 2KCVA 2KATA 1TJCA 3UX4A 3NZSA 3FFLA 3I4GA 1XGWA 3FU5A 1OWNA 3CR3A 5KJNA 4CDMA 4FULA 1NA0A 3JQ1A 3QNKA 2R17C 2QFCA 3L13A 2JLBA 3FEXA 1KT1A 1N54A 2J09A 3ZHEB 2WXLA 3QAQA 4JC8A 3FUHA 1SZAA 4BFRA 5LCWC 4KZ0A 2WQ7A 4KVMA 1H2TC 4WAFA 5CMWA 1Z6TA 1Z3XA 2WXHA 5FQ8A 3LVRE 3FDHA 3LY7A 3LEWA 4GYWA 2CFUA 1HF8A 4XKBA 4L1BA 4HOUA 4F7AA 4J8EA 1OUVA 1IHGA 3LDZA 5BW8C 1UJJA 4N3AA 3LY9A 4HVBA 5KJMA 1ELWA 3CHQA 2WXPA 4DI4A 4FADA 1FVHA 1Y6IA 2XCBA 3FH8A 4GB9A 3ESLA 3SBTB 4OYSA 3QWPA 1E8YA 3SZ7A 2AW6A 2UY1A 4WWOA 4J8FA 2YNQA 3QWWA 4RG9A 1HS6A 1UJKA 4CT0A 4FJYA 1UW4B 3EHNA 4LEUA 5DIZA 4CDNA 3D9JA 4UWHA 3SF4A 4HOTA 4URKA 3ENEA 4UWKA 3R7RA 2ONDA 2XPZA 2VGYA 3SBSA 2Y4TA 3G2WA 1NA3A 1N52A 4U04A 3IEGA 3P2BA 2FEZA 5ARGA 3EIQC 3OAWA 4ILIA 3ZHEA 2PQNA 2X6KA 2IU1A 1VDYA 2V5FA 4GMLA 4MRUA 5KCMA 1ELKA 2NC9A 4OVVA 4EZJA 3RKVA 3ZPJA 2FO7A 4HLEA 2I1JA 4GAAA 1WY6A 3RRNB 5BV1A 4I2ZA 2DCPA 3JYSA 3QC1A 4EZLA 4JA7A 2L6JA 2AVPA 3FTSA 4U0ZA 3CQGB 1E90A 2WMNA 3FU6A 3U4TA 4GCOA 4G25A 2EQXA 4MKTA 1HE8A 4A3TA 3IHYA 4GZ3A 4AXHA 4JHKA 2IOSA 4CGVA 5CCLA 3E4BA 3R9AB 4JHRA 3LXUX 3S7BA 5JJTA 5J08A 2FULA 1HH8A 3I3NA 4U07A 3VTYA 4BX8A 2PQRA 2HM8A 3B7RL 4PS3A 3FHEA 4ANXA 1MHQA 3ASHA 2V0PA 3QB2A 4TUUA 4LCTA 4GYYA 4XIFA 5FQ7A 1HG5A 2LO6A 5FZQA 3UQ3A 4AIFA 1INZA 4JZYA 4J0UA 2YINA 3CVQA 1H2UA 4I6GA 4BT8A 3BG0B 1ZBPA 3CQCB 4N2QA 3GYZA 3CK7A 2VYIA 4BY6A 4DPRA 4XI9A 4N3CA 3CVVA 3N71A 3CKCA 4V3IA 4B89A 3FUDA 3UMVA 5C2YA 5ENNA 3G2SA 4NACA 2WQHA 4IYPA 4ATGA 2BTDA 2R5SA 3KS2A 3CK8A 1NP7A 3LVQE 3VLFA 3PNTB 3NQPA 5M72A 3UT7A 2HYZA 1NZNA 3QOUA 2WVIA 3FU3A 4HOQA 4MS6A 2CHZA 2OV8A 4PUCA 2J08A 1OWOA 3CK9A 4G2VA 3LY8A 4G26A 4CDRA 3ZYMA 4A1SA 3ZYKA 3AS8A 4BWRA 4UI9J 4HORA 2OVFA 2FI7A 2IOLA 4U0UA 5E76A 4ANWA 4CGWA 3HDXA 3D9PA 4UQYA 3SGHA 1PY1A 4AY5A 3G2UA 3URZA 3VLEA 5HQ8A 3KEZA 3AU4A 4AEZC 5LP0A 5AIJA 4A55A 3S7JA 4KYOB 1UG3A 3LPZA 4MLPA 2NSZA 4Q69A 4LRZA 2KM4A 4KT6B 3QJZA 3U9WA 4H7YA 1Y8MA 2LSUA 3G2TA 3CEQA 1UN9A 3ZGQA 4HS2A 3U66A 5FZRA 3EDTB 4A3VA 3GZ2A 3PEVB 3FTZA 5JHBA 3EIJA 3OXLA 2R59A 3PREA 5G05C 5HI7A 2AWIA 3PNLB 3L22A 3MYVA 2VSYA 2PL2A 4DLQA 1IQRA 2WXRA 3GW4A 5LCWJ 3CSFA 4LERA 3Q15A 5DBKA 1E96B 4WUYA 1H6KA 2YHCA 3L17A 3Q49B 4B0ZA 2YHEA 4CT4A 5A6CA 3OTNA 4ACKA 3ZYQA 4AP2A 4BX9A 1H0AA 2WXNA 2XRYA 3MA5A 5C1DA 4EPZA 2VGXB 4JPSA 4O6FA 5D0QD 1IQUA 4JXTA 1E7VA 4ANVA 4CEMA 4PDXA 3CVPA 4GA1A 5JHAA 2CHWA 4ABNA 3ZVVA 2V8SE 3S7DA 4I9EA 2X6JA 2WXKA 3CHMA 3C98A 4FHJA 4K03A 4TV3A 4Y6WA 1EF1C 4GU5A 2WXFA 3FUFA 2GGFA 3SNXA 3ZFWA 4ILGA 4BTAA 3ZYLA 3MEKA 4GA2A 4PH4B 4FHKA 4L23A 3PUJA 1EYHA 3PRZA 2VSXE 5JJ6A 2XRZA 2GRLA 3FUJA 3I4RB 3TAXA 5ANRA 1U3DA 3KAEA 2QY7A 3IV0A 3TXMA 4XE0A 2OVBA 3FP3A 3APDA 3Q5MA 3D9LA 3RK6A 2IFUA 3BG1B 4FLHA 2IF4A 3T5XA 4YVOA 5FTPA 1DVPA 1KT0A 4BSXA 5EDSA 1LF8A 3RU0A 1HU3A 3CHSA 1FVFA 3UT8A 4FJZA 4A1GA 4GCNA 2Q7FA 4YNDA 3ZN3A 3TJPA 4EZKA 4DI3A 5KJLA 2AXZA 2IQCA 4CCAA 4L2LA 1HZ4A 5G04C 5BV0A 2E0IA 2M63A 2MRIA 3PVLA 4J6IA 3QK0A 3ESKA 3DPDA 1EDUA 2VJ8A 3FH7A 3B7UX 4L7TA 4LUNU 5T8IA 4JEUA 3PZDA 3ZXSA 1HO8A 1JUQA 3CIAA 2J4DA 4I1OB 4WNDA 3CVYA 3B7TA 4U8HA 2LAHA 2X6IA 3CHOA 3HYMB 3PEUB 2JEKA 4C9BB 3MV2B 3MKQB 1QNFA 4F53A 4ME2A 2DIWA 4WWPA 4WNEA 5T4YA 2WMOA 3B13A 3FUEA 3ZEFA 3EJNA 5FT9A 4GZDA 3ZIMA 2LNIA 4C0EA 2J49A 4KZCA 4N3BA 3QDNA 2DBAA 2J4BA 2MOWA 3RRMB 5BT1A 3DBSA 3IHVA 3KD7A 4ANUA 1X5BA 2L0IA 5A7DB 3TG5A 2I6HA 4GZCA 3RO3A 2Y3AA 4I6EA 1QZ2A 2XHEA 1XNFA 4I17A 2C2LA 3HVEB 5EX3A 2WB2A 4N2SA 3CLJA 4N39A 2PM6A 1S0PA 3FTVA 2KCKA 4H7XA 3AU5A 3HHMA 5ARFA 4EQFA 2YQ8A 4FP7A 3LYAA 3FTUA 5CCMA 3TGOA 3D9NA 4NQ0A 3CKBA 3ZW3A 3EHMA 2OOEA 3JUIA 4DJAA 3ML9A 4BTBA 3FUIA 3PE4A 2XCCA 3RO2A 4I1AA 1OWLA 1QQEA 4FC8A 3OXGA 4KMOA 4UQXA 1Z3YA 3K9IA 4L2YA 1TJFA 3MX3A 2A5UA 4KVOA 3D9IA 3MKQA 4NRHB 2CFZA 3IBEA 1A17A 2XPIA 5T3RA 3AS5A 2X3MA 3FULA 5LFAA 3MCXA 3PUKA 3PE3A 2VSNA 4JW1A 3UUXA 3UT4A 1P5QA 2VSOE 2CG3A 2J07A 4FU3A 1WM5A 5BNWA 2FF4A 3O48A 2IONA 3G2VA 3ASDA 4U0SA 4UWFA 4BT9A 4G24A 3CHPA 2CHXA 4G11A 2IJGX 3FUNA 5FQ4A 5G05J 1W3BA 2NXPA 4P29A 2WXQA 4YVQC 1SQMA 4JL0A 5E75A 4IRUA 3CVUA 1ZU2A 2Y4UA 3CVNA 2UWJG 1HG2A 2LSVA 3B7SA 3D3MA 3QARA 4ILHB 1B89A 2WXIA 4XI0A 5CHEE 3MKRA 5CMYA 4B94A 5J90A 1GW6A 5BPPA 2AXVA 3Q4AB 3MJWA 2RG8A 4RSYA 4WNGA 5G2NA 2WPVA 1E8XA 4GYOA 3UPVA 2HO1A 1FCHA 2A4ZA 4DK5A 3LCAA 3VLDA 1H19A 3QKYA 4N5CA 3PS6A 5D0OD 4IULA 1HFAA 4I9CA 4U63A 4FLBA 5FWQA 3RRUA 4AM9A 3CVXA 2WM9A 3JCKC 4CRWA 4NURA 3U64A 4E85A 4G1TA 4M3OA 2C0LA 2WXMA 1E7UA 3APFA 3ASFA 3O4ZA 4AY6A 4APFA 3MV3B 3LS8A 3FUMA 3D9KA 4GMJA 3S7FA 3FY4A 2PZIA 3S2AA 4RVBA 3L6AA 2X38A 5FZSA 4J8DA 4OVUA 2MHKA 2I2OA 1WAO1 5EKQD 4GPKA 2I1KA 3T8MA 4AOFA 1IYGA 2KZTB 3SI5A 1JPLA 3FUKA 3MGBA 2FBNA 4W9RA 2XGMA 3WXXA 5G04J 3ONKA 4EBAA 5LOZA 2WXOA 3HIZA 3FTXA 3FU0A 3FTYA 3CSTA 1U3CA 2WXGA 4K0RA 4Q94A 3CVLA 4GZ6A 4B8AA 4HOSA 2VGXA 4UQZA 3NZUA 4Q96A 4F3VA 3SHFA 4I2WA 3I5PA 4UI9K 4XKCA 3NF1A 5AENA 1MQSA 5AJLA 3L54A 3RJVA 3R7QA 2VTBB 4RG6A 3ZRHA 4GZ5A 1YA0A 2X6FA 4I1MA 4WNFA 1OWPA 2L0TB 3ONLA 3JQ0A 4DLOA 1HX8A 3PH0C 5G55A 3ML8A 4IN3B 5AJDA 5FJYA 3VTXA 4AV7A 3CHRA 2V4LA 2ZU6B 2KCLA 3MZLB 1KLXA 4TRQA 4XX5A 4E6HA 3U3WA 3AS4A 2J9QA 1ELRA 1BPOA 4XZ4A 1HXIA 4FA6A 3TXNA 4ACLA 3OXFA 2I9CA 5AYWD 2L9BA 3ULQA 2HR2A 4G23A 3CV0A 5LX8A 4APOA 4KXKB 3CVWA 1SZ9A 2X6HA 2P58C 3D9MA 4GA0A 4UWLA 4JEHA 2E2EA 2KZTA 3SD5A 2VQ2A 2XQ0A 2WQ6A 4EECA 1PAQA 2GRMA 4AJWA 2XPYA 4HXIA 3ASGA 4R7LA 2XGOA 3L08A 4JA9A 3LKUA 5A23A 3IKOB 4EBAG 3Q47B 3QWVA 5ANLA 1E8ZA 2C0MA 2ILRA 3BEEA 2GW1A 5FQ6A 3PDNA 3RIBA 1DNPA 2PM7A 3P1UA 4WWNA 3GZSA 2VTBA 4HFGA 3FEYA 4KBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGS A;  3GZ1 A;  2KC7 A;  4UI9 C;  5KJK A;  2XEV A;  2BUG A;  4Y6C A;  3TG4 A;  5EX0 A;  3FWV A;  2UY1 B;  1PC2 A;  5JJ7 A;  2KCV A;  2KAT A;  1TJC A;  3FFL A;  5KJN A;  1NA0 A;  2QFC A;  2JLB A;  1KT1 A;  3ZHE B;  5LCW C;  3LY7 A;  4GYW A;  4HOU A;  4J8E A;  1OUV A;  1IHG A;  5BW8 C;  4N3A A;  3LY9 A;  5KJM A;  1ELW A;  2XCB A;  3QWP A;  3SZ7 A;  2UY1 A;  4J8F A;  3QWW A;  4RG9 A;  5DIZ A;  4LEU A;  4HOT A;  3SF4 A;  2OND A;  2VGY A;  2Y4T A;  1NA3 A;  4U04 A;  3IEG A;  2FEZ A;  5ARG A;  3ZHE A;  2PQN A;  2V5F A;  2NC9 A;  3RKV A;  3ZPJ A;  2FO7 A;  4I2Z A;  3JYS A;  4JA7 A;  2L6J A;  2AVP A;  4U0Z A;  3U4T A;  4GCO A;  4G25 A;  4GZ3 A;  4CGV A;  5CCL A;  3E4B A;  3R9A B;  4JHR A;  3S7B A;  5JJT A;  1HH8 A;  4U07 A;  3VTY A;  2PQR A;  3ASH A;  4XIF A;  3UQ3 A;  4GYY A;  4AIF A;  5FZQ A;  4J0U A;  3CVQ A;  4N2Q A;  4BT8 A;  1ZBP A;  3GYZ A;  3CK7 A;  2VYI A;  4XI9 A;  4N3C A;  3CKC A;  2WQH A;  2R5S A;  3KS2 A;  3CK8 A;  5M72 A;  2HYZ A;  1NZN A;  3QOU A;  4HOQ A;  3CK9 A;  4G2V A;  3LY8 A;  4G26 A;  4CDR A;  4A1S A;  3AS8 A;  4BWR A;  4UI9 J;  4HOR A;  2FI7 A;  4U0U A;  4CGW A;  4UQY A;  4AY5 A;  3URZ A;  5HQ8 A;  3S7J A;  4KYO B;  3LPZ A;  4H7Y A;  1Y8M A;  2LSU A;  3CEQ A;  3ZGQ A;  5FZR A;  3EDT B;  3GZ2 A;  3OXL A;  5G05 C;  5HI7 A;  2VSY A;  2PL2 A;  3GW4 A;  5LCW J;  3Q15 A;  5DBK A;  1E96 B;  4WUY A;  3Q49 B;  2YHC A;  5A6C A;  3MA5 A;  5C1D A;  2VGX B;  4O6F A;  5D0Q D;  3CVP A;  4GA1 A;  4ABN A;  3S7D A;  4I9E A;  4Y6W A;  3ZFW A;  4BTA A;  3MEK A;  4GA2 A;  5JJ6 A;  3TAX A;  3KAE A;  3FP3 A;  3Q5M A;  2IFU A;  2IF4 A;  4YVO A;  5FTP A;  1KT0 A;  3RU0 A;  4GCN A;  2Q7F A;  4YND A;  3ZN3 A;  5KJL A;  1HZ4 A;  5G04 C;  3ESK A;  4WND A;  3HYM B;  3MV2 B;  4ME2 A;  4WNE A;  5FT9 A;  2LNI A;  4N3B A;  3QDN A;  2DBA A;  5BT1 A;  3KD7 A;  5A7D B;  3TG5 A;  2I6H A;  3RO3 A;  1QZ2 A;  1XNF A;  4I17 A;  2C2L A;  5EX3 A;  4N2S A;  4N39 A;  2KCK A;  4H7X A;  5ARF A;  4EQF A;  2YQ8 A;  3LYA A;  5CCM A;  3TGO A;  4NQ0 A;  3CKB A;  2OOE A;  4BTB A;  3PE4 A;  2XCC A;  3RO2 A;  4I1A A;  1QQE A;  3OXG A;  4UQX A;  3K9I A;  4NRH B;  1A17 A;  2XPI A;  3AS5 A;  3PE3 A;  2VSN A;  3UUX A;  1P5Q A;  1WM5 A;  5BNW A;  2FF4 A;  3O48 A;  3ASD A;  4U0S A;  4BT9 A;  4G24 A;  5G05 J;  1W3B A;  4YVQ C;  4JL0 A;  1ZU2 A;  2Y4U A;  3CVN A;  2UWJ G;  2LSV A;  4XI0 A;  1B89 A;  5CHE E;  4B94 A;  3MKR A;  3Q4A B;  4WNG A;  2WPV A;  4GYO A;  3UPV A;  2HO1 A;  1FCH A;  3LCA A;  3QKY A;  4N5C A;  5D0O D;  4I9C A;  4AM9 A;  4G1T A;  2C0L A;  3ASF A;  4AY6 A;  3MV3 B;  3S7F A;  2PZI A;  5FZS A;  4J8D A;  2MHK A;  1WAO 1;  5EKQ D;  4GPK A;  1IYG A;  2FBN A;  4W9R A;  2XGM A;  3WXX A;  5G04 J;  3CVL A;  4GZ6 A;  4HOS A;  2VGX A;  4UQZ A;  4F3V A;  4I2W A;  4UI9 K;  3NF1 A;  3RJV A;  4RG6 A;  4GZ5 A;  1YA0 A;  4WNF A;  4IN3 B;  5FJY A;  3VTX A;  2KCL A;  1KLX A;  3U3W A;  3AS4 A;  2J9Q A;  1ELR A;  1HXI A;  3OXF A;  5AYW D;  3ULQ A;  2HR2 A;  4G23 A;  3CV0 A;  4APO A;  4KXK B;  2P58 C;  4GA0 A;  2E2E A;  2VQ2 A;  3ASG A;  2XGO A;  4JA9 A;  3LKU A;  3Q47 B;  3QWV A;  2C0M A;  3BEE A;  2GW1 A;  3PDN A;  3RIB A;  3N71 A;  4KBQ A; 
#chains in the Genus database with same CATH topology
 2BF0 X;  3W9G A;  4UWG A;  2BUG A;  3ULY A;  3NAW A;  4PS8 A;  1JWF A;  5BUZ A;  3HXD A;  4J8S A;  4HI9 A;  3FWV A;  1PC2 A;  2DYS E;  3FTW A;  5ENR D;  1XGW A;  5KJN A;  3JQ1 A;  2A5E A;  2QFC A;  1KT1 A;  4JC8 A;  3FUH A;  1OY3 D;  3DSU A;  1H2T C;  4WAF A;  1Z6T A;  2WXH A;  5FQ8 A;  1V55 E;  1FT1 A;  3LEW A;  2CFU A;  1HF8 A;  1WG0 A;  4F7A A;  4J8E A;  3TWW A;  1OCO E;  2VGE A;  4HVB A;  1ELW A;  5KNG A;  2WXP A;  1Y6I A;  4GB9 A;  3FH8 A;  3KSL A;  1AP7 A;  2AW6 A;  5KWD A;  4J8F A;  4CT0 A;  1UW4 B;  4HOT A;  4UWH A;  3SF4 A;  4URK A;  1D9S A;  1LD7 A;  4U04 A;  3IEG A;  2PQN A;  2IU1 A;  4OVV A;  3TWS A;  3RKV A;  1DCQ A;  5AQ9 A;  3RRN B;  4I2Z A;  4LNU D;  2QC9 A;  3FU6 A;  3U4T A;  4G25 A;  4HQD A;  4AXH A;  3E34 A;  2IOS A;  4CGV A;  1HH8 A;  3I3N A;  1O1R A;  4DUI A;  3JXJ A;  3ASH A;  3QB2 A;  4GYY A;  3UIN C;  1H2U A;  4BT8 A;  3BG0 B;  1ZBP A;  3DPY A;  3GYZ A;  1FT2 A;  4B89 A;  4B93 B;  5C2Y A;  1N4S A;  3DSX A;  2P9I G;  3UT7 A;  1NZN A;  2WVI A;  4HOQ A;  1JCS A;  1MJ0 A;  4A1S A;  4BET A;  1K1A A;  2FI7 A;  3ABM E;  3HDX A;  3SGH A;  3G2U A;  3KEZ A;  3AU4 A;  3R9M A;  4TXR A;  1UG3 A;  3LPZ A;  5D2M C;  3DSS A;  4HS2 A;  3U66 A;  5G05 C;  2AWI A;  1SW6 A;  4DLQ A;  2WXR A;  4O1P A;  1SA5 A;  4LER A;  3UKU G;  1TNU A;  4CT4 A;  5HS0 A;  4BX9 A;  1H0A A;  2XRY A;  1IQU A;  4ABN A;  2X6J A;  2WXK A;  3C98 A;  3FUF A;  4ILG A;  3ZYL A;  2GRL A;  5ANR A;  3IV0 A;  4XE0 A;  3FP3 A;  3RSE G;  3BG1 B;  4YVO A;  1DVP A;  3RU0 A;  1HU3 A;  4A1G A;  4GCN A;  5KJL A;  2AXZ A;  1HZ4 A;  5BV0 A;  4J6I A;  3PVL A;  3QK0 A;  2F0Y A;  3DPD A;  5T8I A;  3FH7 A;  3B7U X;  4L7T A;  1MX2 A;  2Y0B G;  2JAB A;  3PZD A;  1HO8 A;  1LD8 A;  3CHO A;  3HYM B;  4DX6 D;  1QNF A;  4O60 A;  2DIW A;  2ZGD A;  3B13 A;  3ZEF A;  4J7W A;  4KZC A;  1NL4 A;  2R02 A;  4GTS A;  1TNY A;  4GZC A;  2Y3A A;  2XHE A;  3HVE B;  4N2S A;  1H6P A;  1BLX B;  2KCK A;  3HHM A;  5ARF A;  4DRX E;  1IKN D;  4JD2 G;  3C3Q A;  5B1A E;  4UQX A;  1Z3Y A;  1Q2Z A;  4NRH B;  2XPI A;  3KEA A;  3MCX A;  3Q9N C;  1N0Q A;  4FU3 A;  1WM5 A;  5B3S E;  2ION A;  3UTM A;  5CED B;  1TNB A;  3PZ3 A;  2IJG X;  3DXK G;  3FUN A;  1OCC E;  2GRO B;  5G05 J;  2GRP B;  2WXQ A;  2R05 A;  4JL0 A;  2UWJ G;  2LSV A;  3B7S A;  3QAR A;  5D66 A;  1B89 A;  2GRN B;  2WXI A;  5CMY A;  1GW6 A;  3MJW A;  4WNG A;  2WPV A;  3UPV A;  2HO1 A;  1FCH A;  4LNG A;  4IUL A;  4FLB A;  3RRU A;  4AM9 A;  4CYM D;  3T9K A;  4K5B A;  3U64 A;  4G1T A;  2C0L A;  2WXM A;  3ASF A;  4APF A;  3LS8 A;  3J5P A;  4YDY A;  5ITZ F;  4DX1 A;  2P2C P;  3S2A A;  2X38 A;  2MHK A;  1KZO A;  5EKQ D;  2I1K A;  4HRL A;  5JA4 D;  1JPL A;  2FBN A;  2XGM A;  1YCS B;  3RAU A;  3CST A;  4B8A A;  2WXG A;  4Q94 A;  2BKG A;  2V4H C;  1MX4 A;  4F3V A;  3NF1 A;  2PNN A;  3L54 A;  4GTR A;  3ZRH A;  2BKK B;  1QYM A;  5EID A;  1NFI E;  3C3R A;  3VTX A;  5EIB E;  2V4L A;  2RFM A;  4TRQ A;  3U3W A;  3HRA A;  4FA6 A;  2J8S D;  5AYW D;  2L9B A;  1NI1 A;  4UWL A;  3SD5 A;  3HXC A;  3L08 A;  4ZFH A;  3V30 A;  5ANL A;  4F6R D;  1N4Q A;  4G8L A;  3FEY A;  4JHJ A;  3APC A;  4F1S A;  2WXJ A;  2KC7 A;  4UI9 C;  4JVS A;  1OWM A;  2XEV A;  4Y6C A;  4DX2 A;  1TEZ A;  3FH5 A;  1EPU A;  2R03 A;  1UN8 A;  2RD0 A;  5EX0 A;  3LJ3 A;  2AXU A;  2UY1 B;  5JJ7 A;  2KCV A;  1DCE A;  2KAT A;  3UX4 A;  3FFL A;  3I4G A;  3CR3 A;  4CDM A;  5CRU A;  1NA0 A;  3AG4 E;  2JLB A;  4HNA D;  2J09 A;  3ZHE B;  2WXL A;  2V5Q C;  3AG2 E;  3EHR A;  2H6H A;  1K1B A;  4GYW A;  4XKB A;  4HOU A;  5BW8 C;  3UM3 A;  3CHQ A;  4CZ2 D;  3Q75 A;  1N9A A;  1FVH A;  3ESL A;  3SBT B;  2LXM A;  4OYS A;  2DZO A;  3JXI A;  2UY1 A;  1TR4 A;  1HS6 A;  1UJK A;  4CDN A;  3D9J A;  4UWK A;  2OND A;  4L9P A;  1NA3 A;  1N52 A;  4U96 D;  1N94 A;  3EIQ C;  3OAW A;  5HRY A;  2DYR E;  3ZHE A;  1VDY A;  2V5F A;  3ULE G;  1ELK A;  2NC9 A;  4EZJ A;  2XEE A;  3V2X A;  2I1J A;  3QC1 A;  4TXQ A;  4EZL A;  4JA7 A;  1E90 A;  2WMN A;  4GCO A;  2EQX A;  1HE8 A;  3IHY A;  2EIK E;  2KXP C;  4M7C A;  5CCL A;  1KZP A;  5J08 A;  1BI7 B;  2ETC A;  2HM8 A;  4XIF A;  4GTM A;  1HG5 A;  1INZ A;  2YIN A;  2KBX A;  3CK7 A;  2R2L A;  4BEP A;  4DPR A;  3HXB A;  3CVV A;  3CKC A;  3FUD A;  3UMV A;  3TWT A;  1X81 A;  5ENN A;  3G2S A;  4IYP A;  2R5S A;  1NP7 A;  5M72 A;  3PNT B;  2HYZ A;  4MS6 A;  2CHZ A;  4N5Q A;  4YDO A;  1OWO A;  4G2V A;  4CDR A;  4BWR A;  4HLL A;  4UI9 J;  2IOL A;  4U0U A;  4ANW A;  1PY1 A;  4AY5 A;  2ZIR A;  5LP0 A;  3S7J A;  3TWQ A;  4KYO B;  2IY0 C;  2NSZ A;  1N4R A;  4KT6 B;  3QJZ A;  3U9W A;  4H7Y A;  2LSU A;  3G2T A;  3CEQ A;  3SY2 A;  3GZ2 A;  3PEV B;  3BQO A;  4DX7 D;  3DWL G;  4B0Z A;  2B0O E;  3ZYQ A;  4EPZ A;  2VGX B;  4O6F A;  3AJI A;  3CVP A;  2V8S E;  3S7D A;  5EYP F;  4FHJ A;  1MYO A;  4GU5 A;  4BTA A;  4PH4 B;  3PUJ A;  3PRZ A;  2VSX E;  3FUJ A;  3E32 A;  3TAX A;  1O1S A;  3KAE A;  3TXM A;  2OVB A;  3APD A;  3RK6 A;  2IF4 A;  5EDS A;  3UT8 A;  1FVF A;  4J8Y A;  3B95 A;  4DI3 A;  5AAR A;  2RFA A;  2MRI A;  2VJ8 A;  2F8Y A;  3ZXS A;  2XEH A;  4WND A;  3WG7 E;  3MV2 B;  1A5E A;  4ATZ D;  4WWP A;  4X8Q A;  5T4Y A;  2WMO A;  5FT9 A;  4GZD A;  3BUA A;  4C0E A;  3NOG D;  3RRM B;  3V31 A;  3DBS A;  3LJN A;  4ANU A;  4I6E A;  2ZIS A;  4I17 A;  3HG0 D;  2WB2 A;  4H7X A;  4EQF A;  4FP7 A;  3TGO A;  5B1B E;  3ZW3 A;  4NQ0 A;  3CKB A;  3EHM A;  2OOE A;  3JUI A;  4DJA A;  3E33 A;  2XCC A;  4I1A A;  1OWL A;  4U95 D;  3OXG A;  4KMO A;  4KVO A;  5JMN D;  5T3R A;  3AS5 A;  3FUL A;  4JB8 P;  3PUK A;  3PE3 A;  2VSN A;  5BXU A;  3UI2 A;  2XS1 A;  2CG3 A;  2AJA A;  5BNW A;  3O48 A;  1N4P A;  3G2V A;  4G24 A;  3CHP A;  3DSV A;  4G11 A;  1TN8 A;  2EIN E;  5FQ4 A;  3JUE A;  4P29 A;  4YVQ C;  5E75 A;  4IRU A;  5AQA A;  3UM1 A;  4ILH B;  4XI0 A;  3MKR A;  3ABL E;  5G2N A;  2A4Z A;  4DK5 A;  1H19 A;  4N5C A;  4LNB A;  4I9C A;  3UKR G;  5FWQ A;  3CVX A;  2WM9 A;  3JCK C;  4GTQ A;  4E85 A;  2P9P G;  4M3O A;  1E7U A;  3APF A;  3O4Z A;  3W9F A;  4AY6 A;  4HI8 A;  4K5A B;  2I2O A;  2DWZ A;  1S63 A;  3SI5 A;  3FUK A;  3DEO A;  4W9R A;  3WXX A;  4U7E B;  2WXO A;  3EHQ A;  3FU0 A;  4K0R A;  3CVL A;  4HOS A;  4Q96 A;  3I5P A;  1MQS A;  5AJL A;  3R7Q A;  2LXL A;  5AQB A;  4I1M A;  1OWP A;  2L0T B;  3ONL A;  4DLO A;  1HX8 A;  3PH0 C;  3ML8 A;  4IN3 B;  3ABK E;  2KCL A;  4XEI G;  4E6H A;  2J9Q A;  1ELR A;  1BPO A;  1HXI A;  3TXN A;  2I9C A;  3ULQ A;  1BI8 B;  4G23 A;  3CV0 A;  4APO A;  2P58 C;  3BU8 A;  2WQ6 A;  3C72 A;  1PAQ A;  4AJW A;  2ZGG A;  3IKO B;  3X2Q E;  3Q47 B;  1E8Z A;  2C0M A;  5AQ7 A;  2ILR A;  4HRM B;  3BEE A;  2PM7 A;  5FIO A;  3N71 A;  2XGS A;  2LAI A;  3GZ1 A;  4AVX A;  1MZC A;  3L16 A;  3CGH A;  1N0R A;  3SFZ A;  1JWG A;  4PS7 A;  4C0M A;  5IY5 E;  2CG2 A;  3HVE A;  3AAA C;  1TJC A;  3NZS A;  3FU5 A;  1OWN A;  2XS8 A;  4FUL A;  2R17 C;  3L13 A;  3FEX A;  1N54 A;  3UXG A;  3QAQ A;  4KZ0 A;  2WQ7 A;  3V2O A;  4KVM A;  1Z3X A;  4GTV A;  3LVR E;  3LY7 A;  2IEJ A;  5EN5 D;  1OUV A;  1IHG A;  1UJJ A;  4N3A A;  1U2V G;  2XCB A;  3QWP A;  1E8Y A;  3SZ7 A;  2YNQ A;  3QWW A;  4RG9 A;  3EHN A;  4LEU A;  4K5C A;  3ENE A;  3R7R A;  2XPZ A;  2VGY A;  3SBS A;  3G2W A;  3TWV A;  3P2B A;  2FEZ A;  5ARG A;  4ILI A;  3L9T A;  4MRU A;  5KCM A;  4GML A;  1S70 B;  3F6Q A;  3ZPJ A;  3Q7A A;  4HLE A;  1WY6 A;  5BV1 A;  2DCP A;  4BER A;  1OT8 A;  2L6J A;  2AVP A;  1OCZ E;  3EU9 A;  4GZ3 A;  4JHK A;  3E4B A;  3R9A B;  3S7B A;  5JJT A;  2FUL A;  2XEN A;  4BX8 A;  4PS3 A;  2FO1 E;  3FHE A;  1MHQ A;  3UQ3 A;  4LCT A;  5FQ7 A;  2LO6 A;  4I6G A;  2VYI A;  4XI9 A;  3DRA A;  4V3I A;  2H6G A;  4NAC A;  2WQH A;  3L82 A;  4ATG A;  3PZ1 A;  3HXF A;  3KS2 A;  3CK8 A;  1V54 E;  4ZHB A;  4PUC A;  1YYH A;  2J08 A;  3LY8 A;  3ZYM A;  4F1P A;  4HOR A;  2OVF A;  4UQY A;  3NB2 A;  3URZ A;  1MX6 A;  4A55 A;  4OAV B;  4DX5 D;  4LRZ A;  1Y8M A;  1UN9 A;  3ZGQ A;  4BES A;  2RKK A;  3ZNG A;  3FTZ A;  1N11 A;  3PRE A;  2R59 A;  3PNL B;  2VSY A;  1FPP A;  5BXO A;  1IQR A;  3GW4 A;  3Q15 A;  5DBK A;  1E96 B;  1H6K A;  2YHC A;  3L17 A;  3Q49 B;  3OTN A;  4ACK A;  2ETB A;  4AP2 A;  5C1D A;  1BD8 A;  5D0Q D;  4ANV A;  4TUM A;  4GA1 A;  2CHW A;  3ZVV A;  4Y6W A;  2WXF A;  3ZFW A;  5ENQ D;  1Z5S C;  4L23 A;  2XRZ A;  3I4R B;  1U3D A;  3C3O A;  3Q5M A;  3D9L A;  5AN8 A;  2IFU A;  4FLH A;  3T5X A;  5FTP A;  1KT0 A;  3ZU7 B;  3CHS A;  3DST A;  4FJZ A;  2Q7F A;  3TJP A;  2IQC A;  4L2L A;  5G04 C;  4LUN U;  1EDU A;  4LSZ E;  4JEU A;  1JUQ A;  3CIA A;  2J4D A;  4I1O B;  2HE0 A;  2LAH A;  3PEU B;  2JEK A;  4C9B B;  4ME2 A;  4WNE A;  2B6C A;  2LNI A;  2J49 A;  2J4B A;  1JCQ A;  1YMP A;  2L0I A;  3TG5 A;  2I6H A;  1QZ2 A;  2P9N G;  2C2L A;  1S0P A;  3FTV A;  2YQ8 A;  3LYA A;  5CCM A;  1OCR E;  3FUI A;  3PE4 A;  1QQE A;  4FC8 A;  1KPS B;  2F37 A;  4LG6 A;  3K9I A;  4L2Y A;  1TJF A;  2A5U A;  3ZXP A;  3D9I A;  1A17 A;  3KSQ A;  1TNZ A;  1BU9 A;  2X3M A;  3UM0 A;  1TN7 A;  3DXM G;  4JW1 A;  3UUX A;  2VSO E;  2J07 A;  2FF4 A;  3DSW A;  4HBD A;  4U0S A;  4BT9 A;  3TWR A;  2CHX A;  3PZ4 A;  1H6O A;  1QBQ A;  2H6F A;  1W3B A;  1SQM A;  3CVU A;  4U8V D;  1N95 A;  1ZU2 A;  2Y4U A;  1HG2 A;  2EIJ E;  5CHE E;  4B94 A;  2AXV A;  4RSY A;  1TNO A;  4GYO A;  3LCA A;  3QKY A;  3PS6 A;  4U63 A;  1HFA A;  1K8K G;  5FIN A;  2OEW A;  4CRW A;  3DEP A;  3FUM A;  3D9K A;  3S7F A;  3Q78 A;  4QQI A;  4U8Y D;  2XZT G;  4RQI A;  4YDE A;  2ZXW E;  4OVU A;  2KZT B;  5G04 J;  3ONK A;  4EBA A;  5LOZ A;  3HIZ A;  3FTX A;  3FTY A;  4GZ6 A;  2VGX A;  4UQZ A;  1K3Z D;  5AAO A;  4I2W A;  4UI9 K;  2LUH A;  3RJV A;  4RG6 A;  4GZ5 A;  1YA0 A;  1IHB A;  5G55 A;  5AJD A;  4A63 B;  2ZU6 B;  1O5M A;  3AS4 A;  4MBG A;  3Q79 A;  4Z68 A;  4XZ4 A;  4UUC A;  1AWC B;  2HR2 A;  2P9S G;  4KXK B;  3CVW A;  1TN6 A;  2EIM E;  4GA0 A;  2E2E A;  2KZT A;  2VQ2 A;  3EU5 A;  4EEC A;  2XPY A;  4BSZ B;  4R7L A;  2XGO A;  3Q9U C;  5A23 A;  1DC2 A;  4EBA G;  4YDW A;  1TYQ G;  2GW1 A;  3PDN A;  3P1U A;  4WWN A;  3GZS A;  5ENT D;  4KBQ A;  3ASN E;  2ETA A;  5KJK A;  4RLY A;  3D9O A;  1E8W A;  5KNH D;  1H2V C;  4I43 A;  3TG4 A;  4B8C B;  4I6J A;  3TL5 A;  3T5V A;  1L5J A;  4QFV A;  4D10 C;  5CBO A;  3QNK A;  2GRQ B;  4G8K A;  5ENO D;  1SZA A;  4BFR A;  3SFX A;  5LCW C;  5CMW A;  3FDH A;  3UIO C;  3SO8 A;  2EIL E;  4L1B A;  1RW2 A;  3LDZ A;  3LY9 A;  5KJM A;  4GTO A;  4DI4 A;  1D8D A;  4FAD A;  3C5R A;  4HRN A;  4WWO A;  4FJY A;  5DIZ A;  2Y4T A;  2OEV A;  4NIK A;  4HB5 A;  2X6K A;  1SA4 A;  2XZD G;  2FO7 A;  4GAA A;  3JYS A;  5HKP A;  3FTS A;  4U0Z A;  3CQG B;  4MKT A;  4A3T A;  2Y69 E;  4JHR A;  3LXU X;  3E30 A;  4U07 A;  3VTY A;  2PQR A;  3B7R L;  4ANX A;  4GTP A;  2V0P A;  4TUU A;  4AIF A;  5FZQ A;  4JZY A;  4J0U A;  3CVQ A;  4N2Q A;  3CQC B;  4BY6 A;  4N3C A;  5CBN A;  2H6I A;  3AG3 E;  2NYJ A;  4TXP A;  2BTD A;  5CEC B;  3VLF A;  3ZKJ A;  3LVQ E;  3NQP A;  3QOU A;  3FU3 A;  2OV8 A;  2OCC E;  3J5Q B;  3CK9 A;  4G26 A;  1JCR A;  3ZYK A;  3AS8 A;  4GTT A;  5E76 A;  4CGW A;  3D9P A;  3VLE A;  5HQ8 A;  4AEZ C;  2P9L G;  5AIJ A;  4MLP A;  4Q69 A;  2KM4 A;  5FZR A;  3EDT B;  4A3V A;  3UIP C;  5JHB A;  3EIJ A;  3OXL A;  5HI7 A;  3L22 A;  3MYV A;  2PL2 A;  1G3N B;  2BED A;  5LCW J;  3CSF A;  4WUY A;  5A6C A;  2YHE A;  1LTX A;  2WXN A;  3MA5 A;  4JPS A;  4JXT A;  1E7V A;  4CEM A;  4PDX A;  5JHA A;  3Q73 A;  4I9E A;  4K03 A;  3CHM A;  4TV3 A;  1EF1 C;  2GGF A;  3SNX A;  2MYO A;  3MEK A;  4GA2 A;  4FHK A;  3E37 A;  1EYH A;  2P9K G;  4GPM A;  5JJ6 A;  2QY7 A;  5CRV A;  4BSX A;  4EHM A;  1LF8 A;  1IXV A;  4YND A;  3ZN3 A;  4EZK A;  4CCA A;  3T8K A;  2E0I A;  2M63 A;  3ESK A;  2F8X K;  1D8E A;  3CVY A;  3B7T A;  4U8H A;  3ZUV B;  3NBN B;  2X6I A;  4F53 A;  3MKQ B;  3TWU A;  2QYJ A;  3FUE A;  3EJN A;  1OXJ A;  3ZIM A;  4N3B A;  3QDN A;  2DBA A;  2MOW A;  5BT1 A;  3IXE A;  3IHV A;  3KD7 A;  1X5B A;  5A7D B;  3RO3 A;  5CER B;  1XNF A;  2IO2 C;  5EX3 A;  3CLJ A;  4N39 A;  2PM6 A;  2IO3 C;  3AU5 A;  5ENP D;  3FTU A;  3D9N A;  3Q7F A;  3ML9 A;  1O1T A;  4BTB A;  3RO2 A;  2QZA A;  3MX3 A;  3D9H A;  3MKQ A;  3SFY A;  2CFZ A;  3IBE A;  5CEA A;  5LFA A;  1ZB1 A;  2L6B A;  3UT4 A;  1P5Q A;  1UOH A;  3ASD A;  3ISM C;  4UWF A;  5KBA A;  2DZN A;  2Y1L E;  2NXP A;  3ASO E;  4GMR A;  4C48 B;  3CVN A;  3D3M A;  2GRR B;  1SVX A;  5J90 A;  5BPP A;  3Q4A B;  2RG8 A;  2P9U G;  1E8X A;  5H7P A;  3VLD A;  5D0O D;  3V79 K;  4NUR A;  3TWX A;  4O1O A;  3MV3 B;  4GMJ A;  3FY4 A;  2PZI A;  4RVB A;  3L6A A;  5FZS A;  4J8D A;  1RZ4 A;  1WAO 1;  4GPK A;  1IYG A;  3T8M A;  4AOF A;  3MGB A;  5EIL A;  3UM2 A;  1U3C A;  5EYL A;  3NZU A;  3SHF A;  4XKC A;  5AEN A;  2VTB B;  3NOC D;  2X6F A;  4WNF A;  3PZ2 A;  3JQ0 A;  2DVW A;  1S64 A;  5FJY A;  4AV7 A;  3CHR A;  3MZL B;  1KLX A;  3EUV A;  4XX5 A;  3AG1 E;  2QYU A;  4ACL A;  4OAU C;  3OXF A;  5LX8 A;  1SZ9 A;  2X6H A;  3D9M A;  4JEH A;  3B7B A;  2XQ0 A;  2GRM A;  5ENS D;  4HXI A;  3ASG A;  4JA9 A;  3LKU A;  3HXE A;  3QWV A;  3SQV A;  5FQ6 A;  3RIB A;  1DNP A;  1WDY A;  2VTB A;  4HFG A; 
#chains in the Genus database with same CATH homology
 2XGS A;  4JHJ A;  3APC A;  4F1S A;  2WXJ A;  2LAI A;  2BF0 X;  3GZ1 A;  4AVX A;  2KC7 A;  4UI9 C;  4JVS A;  5KJK A;  1OWM A;  2XEV A;  3D9O A;  1E8W A;  4UWG A;  1H2V C;  3L16 A;  2BUG A;  3CGH A;  4Y6C A;  3SFZ A;  4I43 A;  3TG4 A;  1TEZ A;  3FH5 A;  4B8C B;  1JWG A;  1EPU A;  4I6J A;  4PS7 A;  4PS8 A;  3TL5 A;  1JWF A;  4C0M A;  1UN8 A;  2RD0 A;  5BUZ A;  3T5V A;  5EX0 A;  2CG2 A;  4J8S A;  3HVE A;  3LJ3 A;  2AXU A;  3FWV A;  2UY1 B;  1L5J A;  1PC2 A;  4QFV A;  5JJ7 A;  4D10 C;  3FTW A;  2KCV A;  2KAT A;  1TJC A;  3UX4 A;  3NZS A;  3FFL A;  3I4G A;  1XGW A;  3FU5 A;  1OWN A;  3CR3 A;  5KJN A;  4CDM A;  4FUL A;  1NA0 A;  3JQ1 A;  3QNK A;  2R17 C;  2QFC A;  3L13 A;  2JLB A;  3FEX A;  1KT1 A;  1N54 A;  2J09 A;  3ZHE B;  2WXL A;  3QAQ A;  4JC8 A;  3FUH A;  1SZA A;  4BFR A;  5LCW C;  4KZ0 A;  2WQ7 A;  4KVM A;  1H2T C;  4WAF A;  5CMW A;  1Z6T A;  1Z3X A;  2WXH A;  5FQ8 A;  3LVR E;  3FDH A;  3LY7 A;  3LEW A;  4GYW A;  2CFU A;  1HF8 A;  4XKB A;  4L1B A;  4HOU A;  4F7A A;  4J8E A;  1OUV A;  1IHG A;  3LDZ A;  5BW8 C;  1UJJ A;  4N3A A;  3LY9 A;  4HVB A;  5KJM A;  1ELW A;  3CHQ A;  2WXP A;  4DI4 A;  4FAD A;  1FVH A;  1Y6I A;  2XCB A;  3FH8 A;  4GB9 A;  3ESL A;  3SBT B;  4OYS A;  3QWP A;  1E8Y A;  3SZ7 A;  2AW6 A;  2UY1 A;  4WWO A;  4J8F A;  2YNQ A;  3QWW A;  4RG9 A;  1HS6 A;  1UJK A;  4CT0 A;  4FJY A;  1UW4 B;  3EHN A;  4LEU A;  5DIZ A;  4CDN A;  3D9J A;  4UWH A;  3SF4 A;  4HOT A;  4URK A;  3ENE A;  4UWK A;  3R7R A;  2OND A;  2XPZ A;  2VGY A;  3SBS A;  2Y4T A;  3G2W A;  1NA3 A;  1N52 A;  4U04 A;  3IEG A;  3P2B A;  2FEZ A;  5ARG A;  3EIQ C;  3OAW A;  4ILI A;  3ZHE A;  2PQN A;  2X6K A;  2IU1 A;  1VDY A;  2V5F A;  4GML A;  4MRU A;  5KCM A;  1ELK A;  2NC9 A;  4OVV A;  4EZJ A;  3RKV A;  3ZPJ A;  2FO7 A;  4HLE A;  2I1J A;  4GAA A;  1WY6 A;  3RRN B;  5BV1 A;  4I2Z A;  2DCP A;  3JYS A;  3QC1 A;  4EZL A;  4JA7 A;  2L6J A;  2AVP A;  3FTS A;  4U0Z A;  3CQG B;  1E90 A;  2WMN A;  3FU6 A;  3U4T A;  4GCO A;  4G25 A;  2EQX A;  4MKT A;  1HE8 A;  4A3T A;  3IHY A;  4GZ3 A;  4AXH A;  4JHK A;  2IOS A;  4CGV A;  5CCL A;  3E4B A;  3R9A B;  4JHR A;  3LXU X;  3S7B A;  5JJT A;  5J08 A;  2FUL A;  1HH8 A;  3I3N A;  4U07 A;  3VTY A;  4BX8 A;  2PQR A;  2HM8 A;  3B7R L;  4PS3 A;  3FHE A;  4ANX A;  1MHQ A;  3ASH A;  2V0P A;  3QB2 A;  4TUU A;  4LCT A;  4GYY A;  4XIF A;  5FQ7 A;  1HG5 A;  2LO6 A;  5FZQ A;  3UQ3 A;  4AIF A;  1INZ A;  4JZY A;  4J0U A;  2YIN A;  3CVQ A;  1H2U A;  4I6G A;  4BT8 A;  3BG0 B;  1ZBP A;  3CQC B;  4N2Q A;  3GYZ A;  3CK7 A;  2VYI A;  4BY6 A;  4DPR A;  4XI9 A;  4N3C A;  3CVV A;  3N71 A;  3CKC A;  4V3I A;  4B89 A;  3FUD A;  3UMV A;  5C2Y A;  5ENN A;  3G2S A;  4NAC A;  2WQH A;  4IYP A;  4ATG A;  2BTD A;  2R5S A;  3KS2 A;  3CK8 A;  1NP7 A;  3LVQ E;  3VLF A;  3PNT B;  3NQP A;  5M72 A;  3UT7 A;  2HYZ A;  1NZN A;  3QOU A;  2WVI A;  3FU3 A;  4HOQ A;  4MS6 A;  2CHZ A;  2OV8 A;  4PUC A;  2J08 A;  1OWO A;  3CK9 A;  4G2V A;  3LY8 A;  4G26 A;  4CDR A;  3ZYM A;  4A1S A;  3ZYK A;  3AS8 A;  4BWR A;  4UI9 J;  4HOR A;  2OVF A;  2FI7 A;  2IOL A;  4U0U A;  5E76 A;  4ANW A;  4CGW A;  3HDX A;  3D9P A;  4UQY A;  3SGH A;  1PY1 A;  4AY5 A;  3G2U A;  3URZ A;  3VLE A;  5HQ8 A;  3KEZ A;  3AU4 A;  4AEZ C;  5LP0 A;  5AIJ A;  4A55 A;  3S7J A;  4KYO B;  1UG3 A;  3LPZ A;  4MLP A;  2NSZ A;  4Q69 A;  4LRZ A;  2KM4 A;  4KT6 B;  3QJZ A;  3U9W A;  4H7Y A;  1Y8M A;  2LSU A;  3G2T A;  3CEQ A;  1UN9 A;  3ZGQ A;  4HS2 A;  3U66 A;  5FZR A;  3EDT B;  4A3V A;  3GZ2 A;  3PEV B;  3FTZ A;  5JHB A;  3EIJ A;  3OXL A;  2R59 A;  3PRE A;  5G05 C;  5HI7 A;  2AWI A;  3PNL B;  3L22 A;  3MYV A;  2VSY A;  2PL2 A;  4DLQ A;  1IQR A;  2WXR A;  3GW4 A;  5LCW J;  3CSF A;  4LER A;  3Q15 A;  5DBK A;  1E96 B;  4WUY A;  1H6K A;  2YHC A;  3L17 A;  3Q49 B;  4B0Z A;  2YHE A;  4CT4 A;  5A6C A;  3OTN A;  4ACK A;  3ZYQ A;  4AP2 A;  4BX9 A;  1H0A A;  2WXN A;  2XRY A;  3MA5 A;  5C1D A;  4EPZ A;  2VGX B;  4JPS A;  4O6F A;  5D0Q D;  1IQU A;  4JXT A;  1E7V A;  4ANV A;  4CEM A;  4PDX A;  3CVP A;  4GA1 A;  5JHA A;  2CHW A;  4ABN A;  3ZVV A;  2V8S E;  3S7D A;  4I9E A;  2X6J A;  2WXK A;  3CHM A;  3C98 A;  4FHJ A;  4K03 A;  4TV3 A;  4Y6W A;  1EF1 C;  4GU5 A;  2WXF A;  3FUF A;  2GGF A;  3SNX A;  3ZFW A;  4ILG A;  4BTA A;  3ZYL A;  3MEK A;  4GA2 A;  4PH4 B;  4FHK A;  4L23 A;  3PUJ A;  1EYH A;  3PRZ A;  2VSX E;  5JJ6 A;  2XRZ A;  2GRL A;  3FUJ A;  3I4R B;  3TAX A;  5ANR A;  1U3D A;  3KAE A;  2QY7 A;  3IV0 A;  3TXM A;  4XE0 A;  2OVB A;  3FP3 A;  3APD A;  3Q5M A;  3D9L A;  3RK6 A;  2IFU A;  3BG1 B;  4FLH A;  2IF4 A;  3T5X A;  4YVO A;  5FTP A;  1DVP A;  1KT0 A;  4BSX A;  5EDS A;  1LF8 A;  3RU0 A;  1HU3 A;  3CHS A;  1FVF A;  3UT8 A;  4FJZ A;  4A1G A;  4GCN A;  2Q7F A;  4YND A;  3ZN3 A;  3TJP A;  4EZK A;  4DI3 A;  5KJL A;  2AXZ A;  2IQC A;  4CCA A;  4L2L A;  1HZ4 A;  5G04 C;  5BV0 A;  2E0I A;  2M63 A;  2MRI A;  3PVL A;  4J6I A;  3QK0 A;  3ESK A;  3DPD A;  1EDU A;  2VJ8 A;  3FH7 A;  3B7U X;  4L7T A;  4LUN U;  5T8I A;  4JEU A;  3PZD A;  3ZXS A;  1HO8 A;  1JUQ A;  3CIA A;  2J4D A;  4I1O B;  4WND A;  3CVY A;  3B7T A;  4U8H A;  2LAH A;  2X6I A;  3CHO A;  3HYM B;  3PEU B;  2JEK A;  4C9B B;  3MV2 B;  3MKQ B;  1QNF A;  4F53 A;  4ME2 A;  2DIW A;  4WWP A;  4WNE A;  5T4Y A;  2WMO A;  3B13 A;  3FUE A;  3ZEF A;  3EJN A;  5FT9 A;  4GZD A;  3ZIM A;  2LNI A;  4C0E A;  2J49 A;  4KZC A;  4N3B A;  3QDN A;  2DBA A;  2J4B A;  2MOW A;  3RRM B;  5BT1 A;  3DBS A;  3IHV A;  3KD7 A;  4ANU A;  1X5B A;  2L0I A;  5A7D B;  3TG5 A;  2I6H A;  4GZC A;  3RO3 A;  2Y3A A;  4I6E A;  1QZ2 A;  2XHE A;  1XNF A;  4I17 A;  2C2L A;  3HVE B;  5EX3 A;  2WB2 A;  4N2S A;  3CLJ A;  4N39 A;  2PM6 A;  1S0P A;  3FTV A;  2KCK A;  4H7X A;  3AU5 A;  3HHM A;  5ARF A;  4EQF A;  2YQ8 A;  4FP7 A;  3LYA A;  3FTU A;  5CCM A;  3TGO A;  3D9N A;  4NQ0 A;  3CKB A;  3ZW3 A;  3EHM A;  2OOE A;  3JUI A;  4DJA A;  3ML9 A;  4BTB A;  3FUI A;  3PE4 A;  2XCC A;  3RO2 A;  4I1A A;  1OWL A;  1QQE A;  4FC8 A;  3OXG A;  4KMO A;  4UQX A;  1Z3Y A;  3K9I A;  4L2Y A;  1TJF A;  3MX3 A;  2A5U A;  4KVO A;  3D9I A;  3MKQ A;  4NRH B;  2CFZ A;  3IBE A;  1A17 A;  2XPI A;  5T3R A;  3AS5 A;  2X3M A;  3FUL A;  5LFA A;  3MCX A;  3PUK A;  3PE3 A;  2VSN A;  4JW1 A;  3UUX A;  3UT4 A;  1P5Q A;  2VSO E;  2CG3 A;  2J07 A;  4FU3 A;  1WM5 A;  5BNW A;  2FF4 A;  3O48 A;  2ION A;  3G2V A;  3ASD A;  4U0S A;  4UWF A;  4BT9 A;  4G24 A;  3CHP A;  2CHX A;  4G11 A;  2IJG X;  3FUN A;  5FQ4 A;  5G05 J;  1W3B A;  2NXP A;  4P29 A;  2WXQ A;  4YVQ C;  1SQM A;  4JL0 A;  5E75 A;  4IRU A;  3CVU A;  1ZU2 A;  2Y4U A;  3CVN A;  2UWJ G;  1HG2 A;  2LSV A;  3B7S A;  3D3M A;  3QAR A;  4ILH B;  1B89 A;  2WXI A;  4XI0 A;  5CHE E;  3MKR A;  5CMY A;  4B94 A;  5J90 A;  1GW6 A;  5BPP A;  2AXV A;  3Q4A B;  3MJW A;  2RG8 A;  4RSY A;  4WNG A;  5G2N A;  2WPV A;  1E8X A;  4GYO A;  3UPV A;  2HO1 A;  1FCH A;  2A4Z A;  4DK5 A;  3LCA A;  3VLD A;  1H19 A;  3QKY A;  4N5C A;  3PS6 A;  5D0O D;  4IUL A;  1HFA A;  4I9C A;  4U63 A;  4FLB A;  5FWQ A;  3RRU A;  4AM9 A;  3CVX A;  2WM9 A;  3JCK C;  4CRW A;  4NUR A;  3U64 A;  4E85 A;  4G1T A;  4M3O A;  2C0L A;  2WXM A;  1E7U A;  3APF A;  3ASF A;  3O4Z A;  4AY6 A;  4APF A;  3MV3 B;  3LS8 A;  3FUM A;  3D9K A;  4GMJ A;  3S7F A;  3FY4 A;  2PZI A;  3S2A A;  4RVB A;  3L6A A;  2X38 A;  5FZS A;  4J8D A;  4OVU A;  2MHK A;  2I2O A;  1WAO 1;  5EKQ D;  4GPK A;  2I1K A;  3T8M A;  4AOF A;  1IYG A;  2KZT B;  3SI5 A;  1JPL A;  3FUK A;  3MGB A;  2FBN A;  4W9R A;  2XGM A;  3WXX A;  5G04 J;  3ONK A;  4EBA A;  5LOZ A;  2WXO A;  3HIZ A;  3FTX A;  3FU0 A;  3FTY A;  3CST A;  1U3C A;  2WXG A;  4K0R A;  4Q94 A;  3CVL A;  4GZ6 A;  4B8A A;  4HOS A;  2VGX A;  4UQZ A;  3NZU A;  4Q96 A;  4F3V A;  3SHF A;  4I2W A;  3I5P A;  4UI9 K;  4XKC A;  3NF1 A;  5AEN A;  1MQS A;  5AJL A;  3L54 A;  3RJV A;  3R7Q A;  2VTB B;  4RG6 A;  3ZRH A;  4GZ5 A;  1YA0 A;  2X6F A;  4I1M A;  4WNF A;  1OWP A;  2L0T B;  3ONL A;  3JQ0 A;  4DLO A;  1HX8 A;  3PH0 C;  5G55 A;  3ML8 A;  4IN3 B;  5AJD A;  5FJY A;  3VTX A;  4AV7 A;  3CHR A;  2V4L A;  2ZU6 B;  2KCL A;  3MZL B;  1KLX A;  4TRQ A;  4XX5 A;  4E6H A;  3U3W A;  3AS4 A;  2J9Q A;  1ELR A;  1BPO A;  4XZ4 A;  1HXI A;  4FA6 A;  3TXN A;  4ACL A;  3OXF A;  2I9C A;  5AYW D;  2L9B A;  3ULQ A;  2HR2 A;  4G23 A;  3CV0 A;  5LX8 A;  4APO A;  4KXK B;  3CVW A;  1SZ9 A;  2X6H A;  2P58 C;  3D9M A;  4GA0 A;  4UWL A;  4JEH A;  2E2E A;  2KZT A;  3SD5 A;  2VQ2 A;  2XQ0 A;  2WQ6 A;  4EEC A;  1PAQ A;  2GRM A;  4AJW A;  2XPY A;  4HXI A;  3ASG A;  4R7L A;  2XGO A;  3L08 A;  4JA9 A;  3LKU A;  5A23 A;  3IKO B;  4EBA G;  3Q47 B;  3QWV A;  5ANL A;  1E8Z A;  2C0M A;  2ILR A;  3BEE A;  2GW1 A;  5FQ6 A;  3PDN A;  3RIB A;  1DNP A;  2PM7 A;  3P1U A;  4WWN A;  3GZS A;  2VTB A;  4HFG A;  3FEY A;  4KBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...