3FWVA

Crystal structure of a redesigned tpr protein, t-mod(vmy), in complex with meevf peptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
128
structure length
128
Chain Sequence
SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hsc70/Hsp90-organizing protein
publication title Redesign of a protein-peptide interaction: characterization and applications
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 57
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fwvA00
3ESKA 4U0SA 5M72A 3ASDA 4KYOB 2BUGA 5BW8C 3OXGA 5FTPA 3UQ3A 4ABNA 3UUXA 3CVNA 2KCLA 2IFUA 3CV0A 4F3VA 1B89A 4CDRA 2MHKA 4ME2A 4GA0A 3LY8A 3AS4A 3ASFA 3OXLA 5BNWA 3R9AB 5ARGA 4JA7A 5KJNA 2L6JA 3JYSA 3SZ7A 4I9EA 4CGWA 4B94A 1NA3A 3LKUA 3MV2B 2XPIA 3S7BA 4GYWA 4I2ZA 2FBNA 4RG9A 3NF1A 2KC7A 2FI7A 1PC2A 2LNIA 4N2QA 2VGYA 3QWPA 3LCAA 4I1AA 5FZQA 2ONDA 4AM9A 2HR2A 3QKYA 2FF4A 3ASHA 1KLXA 3CVPA 1OUVA 4Y6WA 3RU0A 4J8EA 4UI9J 4HOSA 4G26A 4HOQA 4H7XA 4WNFA 2J9QA 5A7DB 5LCWJ 3S7JA 2VGXB 5EX0A 3U3WA 3WXXA 5D0QD 2LSUA 4AIFA 4HOUA 4APOA 4G25A 4XI9A 2PQNA 4BWRA 4KXKB 4N2SA 5EKQD 3AS8A 4GZ6A 2VGXA 1HZ4A 4YVQC 3KAEA 3HYMB 4UI9C 5FZSA 5LCWC 2KCKA 2XCBA 3PDNA 2YQ8A 5EX3A 3GZ1A 5CHEE 3QWWA 3KD7A 1TJCA 2C0LA 3GYZA 3FWVA 5HI7A 3SF4A 4WNEA 4G23A 3ZPJA 5JJ7A 1IYGA 2VSNA 4U0ZA 1FCHA 1P5QA 5D0OD 5KJKA 2V5FA 3CK7A 3EDTB 3BEEA 2IF4A 3AS5A 4HORA 2Q7FA 3CKBA 3OXFA 2LSVA 1ZU2A 5G05C 3KS2A 5JJ6A 4WNDA 3CK9A 3PE3A 3O48A 2VQ2A 2XGOA 3TGOA 4W9RA 4EQFA 3Q5MA 1WAO1 3ASGA 3LY9A 3PE4A 3RO2A 4GZ3A 1NA0A 4BT9A 4GYYA 4N39A 3CVLA 3TG4A 1IHGA 2WPVA 4GCNA 4KBQA 3GW4A 3S7FA 3CEQA 4UQYA 2GW1A 4H7YA 4J0UA 1XNFA 2XGMA 1E96B 4AY5A 3Q47B 4I17A 3CKCA 4LEUA 5KJMA 3FP3A 4RG6A 4O6FA 1ZBPA 4UI9K 4WUYA 5G04J 3VTYA 2E2EA 3RKVA 3MA5A 3LPZA 2UY1B 2NC9A 5A6CA 4U07A 2HYZA 5AYWD 1HXIA 4U0UA 3Q4AB 1ELRA 3QWVA 4G2VA 3N71A 2C2LA 2WQHA 2UY1A 4YNDA 3TAXA 5CCMA 4BTAA 4G1TA 2PQRA 3ZHEB 1KT1A 3QOUA 4N3CA 5G05J 2QFCA 1Y8MA 1WM5A 4JHRA 4GA2A 5CCLA 3CK8A 3S7DA 4BT8A 4Y6CA 5FT9A 5G04C 3ZHEA 1KT0A 2FO7A 5C1DA 2R5SA 4GPKA 2KCVA 4NRHB 5FJYA 4HOTA 1YA0A 3FFLA 2DBAA 2I6HA 2Y4UA 3IEGA 1W3BA 3MEKA 1QQEA 3ZGQA 4BTBA 2VSYA 3GZ2A 3U4TA 2HO1A 3QDNA 3CVQA 3Q15A 4JL0A 2OOEA 1QZ2A 2XEVA 3E4BA 4A1SA 3MV3B 2FEZA 3VTXA 4UQZA 5HQ8A 3RJVA 2P58C 5KJLA 4JA9A 5FZRA 3ZN3A 4AY6A 2Y4TA 2PL2A 4NQ0A 3MKRA 4UQXA 4CGVA 3ZFWA 4GZ5A 4N3BA 4U04A 1A17A 4GYOA 4XIFA 5DBKA 4IN3B 1ELWA 4N3AA 1HH8A 3LY7A 4WNGA 3TG5A 4I9CA 1NZNA 5DIZA 4XI0A 4I2WA 4G24A 3RO3A 2JLBA 4YVOA 3URZA 4J8DA 3LYAA 4GCOA 2C0MA 5BT1A 2PZIA 2VYIA 2KATA 3RIBA 2XGSA 5ARFA 2XCCA 4GA1A 3K9IA 4J8FA 2YHCA 3UPVA 2AVPA 3ULQA 5JJTA 2UWJG 3Q49B 4N5CA
chains in the Genus database with same CATH superfamily
5AN8A 3DSWA 4TRQA 3C72A 2NYJA 2Y69E 3ZYMA 2VGEA 4ABNA 2GGFA 1E8WA 4KVMA 3PNTB 2WVIA 3U64A 1Z3XA 2RFAA 2IY0C 4CDRA 3JQ0A 4FLBA 4C48B 2IJGX 4HRLA 1UJKA 1UW4B 3OXLA 2CHWA 3FULA 4FJYA 4BERA 1PAQA 2LAIA 1V54E 2OVFA 4CDNA 5J90A 3ML8A 5ARGA 2VSXE 2EILE 3D9JA 2L6JA 3SZ7A 3DEOA 3ONKA 3LKUA 3S7BA 3UM0A 3CR3A 4GB9A 2BKKB 3BU8A 4RQIA 3CHSA 3EU5A 5EN5D 3DXMG 4RG9A 2KC7A 2Y1LE 1K1BA 2GRLA 4TUMA 4DI4A 4N2QA 3DSVA 2VGYA 4BX8A 3QWPA 3LCAA 4FULA 2HR2A 4GMRA 4MS6A 4Y6WA 2PM6A 3NB2A 3RU0A 4UI9J 3RK6A 4WNFA 2WXHA 3UT8A 4OVVA 5LOZA 1N0QA 4ANUA 3S7JA 4U7EB 5CEDB 3L16A 4OVUA 2KBXA 3FUHA 3L08A 3RAUA 5JHBA 4KXKB 5EKQD 3AAAC 3BG0B 2R05A 4PS3A 2R02A 3KAEA 5LP0A 5EIDA 4AVXA 2EQXA 3E32A 4BY6A 5JA4D 4UI9C 5FZSA 2XRZA 1L5JA 5FQ6A 4B93B 3CVYA 3PRZA 3TWWA 1TR4A 3CVWA 3L54A 4OYSA 4BEPA 2EINE 5CHEE 2QYUA 3HVEB 4LNGA 5FQ4A 5HI7A 4TXPA 4JD2G 4WNEA 1GW6A 3ABKE 4GTRA 3UXGA 3FTXA 2VSNA 1YMPA 2V5FA 1MYOA 3EDTB 3V2OA 3V79K 3BEEA 4TXQA 1N9AA 3LVRE 4HORA 5AQ7A 3UMVA 3EHMA 2GRQB 2P9SG 2J08A 4DLOA 3TWUA 3I5PA 5G05C 4BESA 3CQGB 4CCAA 5JJ6A 4QQIA 2H6FA 2ETBA 4DK5A 5CECB 2EIME 4Q69A 3LVQE 4AJWA 4BSXA 5G2NA 1KZPA 3RO2A 1NA0A 2DZOA 1Y6IA 5EYPF 3ML9A 4IYPA 1OWLA 4RSYA 4HI8A 1D8DA 2LXMA 5CERB 4KBQA 3GW4A 3BG1B 2ZU6B 2M63A 1ZB1A 3CEQA 4FU3A 2ILRA 4WWNA 3RRNB 4K0RA 1SW6A 2WM9A 2WXMA 3C5RA 4L2YA 4AY5A 3SFYA 3FU3A 2JABA 3LS8A 5J08A 3TWTA 3TWVA 4RG6A 3TJPA 3FTVA 1OT8A 4O6FA 4ANVA 4D10C 1ZBPA 3VTYA 3UX4A 2E2EA 3RKVA 3LPZA 4U63A 4F6RD 1MX4A 2L0IA 4HNAD 4U07A 2HYZA 4LSZE 3NQPA 1SA5A 5CBOA 3Q4AB 2X6IA 3QWVA 2C2LA 2ZISA 4YNDA 4EBAA 5CCMA 1JWGA 2BF0X 4M3OA 1Y8MA 1H0AA 4GA2A 1H6OA 3PZ4A 3PZ2A 3MX3A 1MHQA 4CT4A 1WY6A 3Q9NC 3CK8A 2P9IG 3SFZA 4GMLA 3OAWA 5FT9A 5JMND 3CGHA 3D9MA 5AAOA 4DRXE 4GTQA 3TWRA 1YA0A 2E0IA 3JCKC 4DX2A 3L82A 4G8LA 3U9WA 5D2MC 3AG3E 3PUKA 5AQBA 3SNXA 1V55E 3Q15A 1SQMA 1TN8A 2XRYA 2VJ8A 4YDEA 4APFA 2A4ZA 2WXKA 1OCRE 1H6KA 1HG2A 3L9TA 4UQXA 4XEIG 4Q94A 4HS2A 3AG4E 4EZJA 4U04A 3L13A 1A17A 2WQ7A 4GYOA 4IN3B 3EIJA 3CVVA 4GTTA 3FTSA 3FUNA 1NZNA 4XI0A 1E8XA 3ESLA 4G24A 3UKRG 2ZGGA 1UOHA 3NZSA 4AP2A 3I3NA 4J8YA 4GTPA 1LD8A 2KATA 2XS1A 1H2TC 3L22A 4GA1A 4A55A 4J8FA 3VLEA 2YHCA 5HRYA 2CHZA 1TN6A 1S0PA 3IHVA 3QARA 5A23A 3ESKA 3ASDA 2JEKA 3OXGA 3CVNA 5BXOA 4FADA 3CSTA 4JEHA 1E8YA 2WXFA 3J5QB 2KCLA 3KEZA 3UT7A 5T4YA 1DC2A 2WXRA 3Q79A 4ME2A 4A63B 2A5UA 4FP7A 3V30A 4JA7A 4IULA 3PREA 2J49A 4CGWA 3G2WA 3MV2B 2XPIA 2WQ6A 2KM4A 3FTUA 4GYWA 4I2ZA 5CEAA 2DYSE 2FBNA 1TJFA 5KNGA 2FI7A 4BX9A 1PC2A 2LNIA 1EPUA 4RVBA 4I1AA 4PS7A 2ONDA 1OY3D 4F53A 1K1AA 3BQOA 1KLXA 3CVPA 1OUVA 3HXDA 5E75A 1N11A 2ZGDA 2VTBB 3S2AA 5A7DB 3D9HA 3MKQB 4PUCA 4UUCA 1O5MA 3CHQA 4X8QA 2VGXB 4UWLA 4C0EA 3WXXA 2IOSA 4A1GA 3FEYA 2FULA 4HOUA 2KXPC 4APOA 1SVXA 4G25A 3KEAA 2PQNA 4BWRA 3G2UA 4L7TA 4N2SA 4GZ6A 2PM7A 3UIOC 5ENQD 1H6PA 2H6IA 3D9KA 4EPZA 1EF1C 1U3CA 3DEPA 3V31A 5ENSD 4ATZD 2AW6A 4PH4B 2A5EA 1D9SA 5EX3A 3GZ1A 4WWOA 1N4QA 3TXNA 2C0LA 3BUAA 4EBAG 3FWVA 1E90A 3D9IA 3DSTA 4R7LA 4WWPA 1IYGA 5FQ7A 4TV3A 2ETCA 1BI8B 3HVEA 4FLHA 1FCHA 1P5QA 5D0OD 5D66A 5KJKA 3CK7A 4E6HA 3PZ1A 2WXLA 2ZXWE 3E30A 4I1OB 2CHXA 2IF4A 3AS5A 4GAAA 1BPOA 3CKBA 3OXFA 3ZIMA 1N52A 1FVFA 2LSVA 1MQSA 4YDYA 3KS2A 4JPSA 4WNDA 5HS0A 1OWOA 3B7SA 3O48A 2P9LG 2VQ2A 2XGOA 4BETA 5T8IA 5B3SE 3B7UX 3DXKG 4W9RA 4GTSA 4EQFA 3Q5MA 3PZDA 3LY9A 2GRPB 4RLYA 2WB2A 3W9FA 3HHMA 1TNUA 1QNFA 2CFZA 4O1OA 3AG2E 2WPVA 4ATGA 4J7WA 3APFA 2I1KA 4UQYA 1H2VC 5FWQA 4ZHBA 4I6EA 3IXEA 4U8HA 2PNNA 5B1AE 4J0UA 2XGMA 1E96B 2B6CA 3Q47B 4I17A 3F6QA 3Q75A 3ONLA 2YINA 2EIKE 1S64A 5KJMA 3D3MA 2H6HA 2IU1A 4GU5A 4JEUA 3B7BA 3MYVA 4UI9K 3MA5A 1DVPA 1OCOE 1OWPA 3NBNB 3FU5A 4U0UA 2DYRE 3PEVB 2WQHA 2DCPA 4K03A 3KSLA 3G2TA 2MRIA 4M7CA 5KCMA 5ITZF 3QOUA 5G05J 4GZDA 3B95A 3FU0A 4LG6A 1TNBA 2OEWA 4A3VA 1MX2A 2CG2A 3S7DA 4BT8A 2WXJA 4K5BA 3DSUA 1NI1A 3LXUX 3UTMA 4B8AA 4GPKA 4HOTA 4ZFHA 1ELKA 5CMYA 5B1BE 1BI7B 2LXLA 1S70B 2OV8A 3UKUG 3MEKA 3CVXA 4JHJA 3ZGQA 2NSZA 3PEUB 4MRUA 1TEZA 2VSYA 4PS8A 3DPYA 3O4ZA 3QDNA 1Z6TA 3CVQA 4ILHB 2DIWA 2OOEA 2XEVA 3JXJA 4ACKA 1YYHA 4ANXA 4YDWA 3SFXA 3EHRA 1YCSB 2R59A 3AG1E 2GROB 4G11A 3B7TA 1VDYA 3HG0D 4AY6A 3QNKA 2MOWA 4NQ0A 4GZCA 2XZTG 4GTVA 4GPMA 1JUQA 1NP7A 1XGWA 4GZ5A 4UWKA 2RG8A 4KMOA 3SO8A 4XIFA 2GRMA 5ANLA 1Z3YA 4N3AA 2L6BA 3SY2A 3ZVVA 3TG5A 5DIZA 4DX5D 2F37A 3UM3A 4C0MA 3SQVA 3AJIA 4I2WA 3CHRA 2AXZA 3ZU7B 4BFRA 2JLBA 3NOGD 4JC8A 2C0MA 2XPYA 3CQCB 3ISMC 1E7UA 3RIBA 2XGSA 5AARA 5ARFA 2XCCA 3UPVA 3ULQA 2XEEA 4P29A 3RSEG 3Q78A 1JWFA 2GRNB 2P9PG 4HVBA 2BUGA 1FT1A 5BW8C 4O1PA 4L2LA 2QZAA 4WAFA 2J09A 2IFUA 4F3VA 4Q96A 1B89A 3PNLB 1HX8A 2MHKA 3IKOB 1LD7A 5JHAA 4GA0A 3JQ1A 5HKPA 4TXRA 3R9AB 1N95A 5CRVA 3HRAA 3E33A 2R2LA 4FHJA 3EJNA 3JYSA 4I9EA 3JUEA 3C3QA 3D9LA 3HXEA 4EZLA 2WXIA 3TWQA 3ZW3A 4XKBA 2CG3A 3APCA 1HFAA 3WG7E 1U2VG 2V5QC 3VLDA 1QBQA 5LFAA 3QKYA 2FO1E 1UJJA 1DCEA 5AQAA 3DRAA 4HLLA 1JCQA 4AEZC 2J9QA 4U8VD 4K5CA 5LCWJ 2R17C 5ENPD 2XQ0A 3D9NA 2ETAA 4DX1A 2R03A 5EX0A 3U3WA 4JXTA 3NAWA 4CRWA 2VTBA 4XI9A 3MKQA 2L0TB 4N5QA 2VSOE 1UN8A 3AS8A 2VGXA 3ZXSA 4HQDA 5C2YA 2P9KG 4G8KA 4LNBA 4B89A 3HYMB 3DSSA 3C98A 1SZAA 5LCWC 2XCBA 2B0OE 2YQ8A 3PVLA 3APDA 4BSZB 3ZNGA 2X6FA 2P9NG 3KD7A 3ENEA 3FUFA 1EYHA 1IHBA 3T5VA 4HRNA 1UG3A 4FJZA 3W9GA 1OWMA 3ZPJA 4GMJA 1QYMA 3EU9A 4U0ZA 1IQUA 2HM8A 3FUJA 2V4LA 3EHQA 3CHMA 3P1UA 2QYJA 1NFIE 3Q7FA 4LCTA 4L9PA 2XPZA 5BXUA 2AXUA 1KZOA 2H6GA 2OEVA 1WDYA 2Y0BG 3CK9A 3PE3A 3TGOA 3SD5A 2X6JA 1N94A 1WAO1 2NXPA 3ASGA 1TYQG 2DWZA 2WMNA 2IONA 4E85A 3GZSA 3TG4A 5EIBE 4CT0A 3MGBA 5BV0A 5ENOD 1Z5SC 3V2XA 2IO2C 2V4HC 3QJZA 3IHYA 3B7RL 1XNFA 2WXPA 2YHEA 3CKCA 4L1BA 4DI3A 2J07A 4LEUA 3SI5A 2I2OA 3TWSA 3FUDA 4JVSA 3TL5A 4WUYA 4V3IA 2UY1B 5BUZA 5AYWD 3ULEG 1HXIA 1JCRA 3P2BA 5E76A 5LX8A 4FHKA 4B0ZA 4G2VA 3N71A 1RW2A 3ZUVB 4GTMA 2AWIA 2DZNA 3J5PA 5ENNA 4BTAA 4G1TA 1HS6A 2PQRA 1KT1A 3ZHEB 2IOLA 1N4PA 2F8YA 2QFCA 3FTYA 1WM5A 4JHRA 3HIZA 2LAHA 5CCLA 4OAVB 3JUIA 4AOFA 3CSFA 4Y6CA 4ANWA 3HDXA 5C1DA 1OCCE 4XE0A 1KPSB 4DUIA 3UM2A 4NRHB 3SGHA 3FFLA 2DBAA 2I6HA 5AENA 2Y4UA 3IEGA 1W3BA 1MZCA 4AXHA 3SBSA 3HXFA 3UM1A 3OTNA 1TNOA 3GZ2A 1IXVA 2KZTA 3EIQC 2HO1A 3X2QE 5AQ9A 4JL0A 2X6KA 4DX7D 3ZYKA 3FH8A 3ZYQA 4KZCA 3MV3B 3VTXA 2QY7A 3TWXA 5HQ8A 3RJVA 3NOCD 5KJLA 3ABLE 2QC9A 3FHEA 3ZN3A 2Y4TA 3FEXA 3MKRA 4I1MA 4UWGA 3UI2A 3I4GA 4LERA 4MLPA 3ABME 4KVOA 3CHPA 5DBKA 1JPLA 1NL4A 3LJ3A 4WNGA 3ZEFA 1X5BA 3QC1A 1LF8A 3RO3A 1E7VA 3PS6A 4YVOA 3LYAA 5AJDA 2F0YA 4GCOA 3MJWA 5BT1A 3R9MA 2PZIA 2VYIA 4DJAA 1N54A 1RZ4A 3SHFA 5KWDA 4U0SA 5M72A 4KYOB 3PH0C 4HRMB 5FTPA 4YDOA 3UQ3A 2BTDA 2RD0A 3UUXA 4EHMA 1IQRA 4OAUC 3CV0A 2DVWA 3FY4A 4GTOA 3HXCA 2EIJE 2L9BA 1JCSA 2KZTB 3HXBA 3LY8A 1DCQA 3AS4A 1BD8A 3ASFA 5FIOA 5BNWA 4IRUA 1SZ9A 2X38A 4F7AA 5KJNA 3LDZA 3Q7AA 4B94A 1INZA 1NA3A 3SBTB 2IEJA 3QB2A 4C9BB 5ENRD 2J4DA 4U8YD 3QK0A 2BKGA 3NF1A 3T8MA 3R7RA 4CEMA 4NIKA 1OCZE 3ZKJA 3T9KA 1N0RA 5FZQA 4AM9A 4JB8P 2FF4A 2V0PA 3ASHA 1OWNA 4URKA 4J8EA 2Y3AA 4HOSA 4HLEA 4G26A 4HOQA 4H7XA 3E34A 4I6GA 5KBAA 4LUNU 1FT2A 3R7QA 2J4BA 1H2UA 5D0QD 4PDXA 2LO6A 1EDUA 2LSUA 4AIFA 4DLQA 4XKCA 3I4RB 3T8KA 3DWLG 1HZ4A 4HB5A 4U96D 4YVQC 3UT4A 3LJNA 4XZ4A 3QAQA 4CZ2D 3D9OA 3FTWA 3U66A 1D8EA 2IQCA 2AXVA 2KCKA 2XHEA 5EILA 2WXGA 2YNQA 2HE0A 2ZIRA 3PDNA 2AJAA 4NURA 3FUIA 4MKTA 3QWWA 1TJCA 1TN7A 2IO3C 3GYZA 1K8KG 2WXQA 4HI9A 3ZXPA 4L23A 5CRUA 4B8CB 3SF4A 4MBGA 1H19A 1AP7A 1IKND 4AV7A 3EHNA 4KZ0A 3ASNE 4G23A 5JJ7A 4K5AB 1AWCB 3FH5A 4UWFA 4A3TA 3ZRHA 4JZYA 3VLFA 2X6HA 2RFMA 1MJ0A 2Q7FA 1ZU2A 5ANRA 4TUUA 4I43A 1X81A 4QFVA 3PE4A 4HXIA 3LEWA 2OCCE 2XENA 4GZ3A 4EZKA 5BV1A 4FA6A 3T5XA 2RKKA 2X3MA 4BT9A 4GYYA 5CMWA 1E8ZA 3C3RA 3Q73A 4N39A 5KNHD 1BLXB 3CVLA 3G2SA 1IHGA 4GCNA 4F1PA 3PUJA 3S7FA 4DPRA 2GRRB 1LTXA 2GW1A 4H7YA 3UIPC 4FC8A 1S63A 3FTZA 3B13A 3MZLB 4CDMA 1HE8A 5IY5E 2XS8A 3FP3A 3MCXA 4UWHA 1O1RA 5G04J 2XEHA 4LNUD 1HU3A 3DBSA 5EYLA 2NC9A 1N4RA 5A6CA 2BEDA 2I1JA 2F8XK 1TNYA 1ELRA 3FU6A 5CBNA 3AU4A 1TNZA 3CVUA 1WG0A 2UY1A 4J6IA 4CYMD 3TAXA 1SA4A 5BPPA 4N3CA 2V8SE 3AU5A 2CFUA 3NZUA 2WXOA 1G3NB 1OXJA 3C3OA 5H7PA 5AJLA 2J8SD 5AIJA 3CIAA 4DX6D 3DSXA 3FDHA 5G04C 3ZHEA 1A5EA 1KT0A 4XX5A 2FO7A 3FUMA 1K3ZD 2R5SA 2KCVA 2XZDG 5FJYA 4LRZA 3JXIA 3ULYA 4Z68A 1QQEA 3E37A 3CHOA 3TXMA 5FINA 2I9CA 5EDSA 4BTBA 3IV0A 3CLJA 3KSQA 1UN9A 3U4TA 1HO8A 5T3RA 2OVBA 3DPDA 4JW1A 1QZ2A 3E4BA 4HBDA 4A1SA 2WMOA 1FVHA 1MX6A 4J8SA 2FEZA 4U95D 4UQZA 3RRUA 4I6JA 2P58C 3L17A 5G55A 4JHKA 4JA9A 4ACLA 5FZRA 2PL2A 2WXNA 4ILGA 1PY1A 4CGVA 1U3DA 3ZFWA 1FPPA 4NACA 4EECA 3ASOE 4N3BA 3EUVA 5FQ8A 3L6AA 1BU9A 3UINC 1O1SA 1Q2ZA 4HFGA 1ELWA 3IBEA 3D9PA 5ENTD 4F1SA 1HH8A 3LY7A 2LUHA 4I9CA 3RRMB 1O1TA 1HF8A 3G2VA 3FH7A 2P2CP 1DNPA 3Q9UC 2MYOA 1HG5A 3URZA 4J8DA 3PZ3A 3FUKA 2P9UG 4O60A 4ILIA 3FUEA 3K9IA 2AVPA 5JJTA 2UWJG 3Q49B 4KT6B 1N4SA 3ZYLA 4N5CA
chains in the Genus database with same CATH topology
3QARA 5A23A 1JWFA 3ESKA 4U0SA 5M72A 3ASDA 4TRQA 4HVBA 4KYOB 2BUGA 3PH0C 5BW8C 2JEKA 3OXGA 5FTPA 3ZYMA 3UQ3A 2BTDA 2RD0A 3UUXA 4ABNA 1IQRA 4L2LA 3CVNA 2GGFA 1E8WA 4KVMA 4WAFA 4FADA 2J09A 2WVIA 1E8YA 3CSTA 3PNTB 2WXFA 4JEHA 3U64A 2KCLA 2IFUA 3KEZA 3CV0A 4F3VA 1Z3XA 4Q96A 3UT7A 3FY4A 5T4YA 1B89A 3PNLB 4CDRA 1HX8A 2MHKA 2WXRA 2L9BA 3IKOB 5JHAA 2KZTB 4ME2A 3JQ0A 4FLBA 2IJGX 3LY8A 3JQ1A 4GA0A 3AS4A 1UJKA 1UW4B 3ASFA 3OXLA 2A5UA 2CHWA 3FULA 4FJYA 4FP7A 5BNWA 1PAQA 2LAIA 2OVFA 3R9AB 4IRUA 1SZ9A 4CDNA 5J90A 3ML8A 2X38A 5ARGA 4F7AA 2VSXE 4JA7A 5KJNA 4IULA 4FHJA 3PREA 3LDZA 3D9JA 2J49A 3EJNA 2L6JA 3JYSA 4I9EA 3SZ7A 4CGWA 4B94A 1INZA 1NA3A 3G2WA 3ONKA 3LKUA 3MV2B 2XPIA 3SBTB 3S7BA 2WQ6A 2KM4A 3D9LA 3FTUA 3QB2A 4GYWA 4C9BB 3CR3A 4I2ZA 4GB9A 4EZLA 2FBNA 3CHSA 2J4DA 2WXIA 4BSXA 3QK0A 1TJFA 4RG9A 3ZW3A 3NF1A 2KC7A 3T8MA 2FI7A 4BX9A 3R7RA 4XKBA 2CG3A 3APCA 4CEMA 1HFAA 2GRLA 1PC2A 3VLDA 2LNIA 1EPUA 4DI4A 4N2QA 2VGYA 4BX8A 3QWPA 3LCAA 4RVBA 4FULA 4I1AA 4PS7A 5FZQA 2ONDA 4AM9A 5LFAA 4F53A 2HR2A 3QKYA 2FF4A 4MS6A 2V0PA 1UJJA 3ASHA 1OWNA 1KLXA 3CVPA 4URKA 1OUVA 4Y6WA 2PM6A 4J8EA 2Y3AA 4UI9J 3RU0A 4HOSA 4HLEA 4G26A 5E75A 4HOQA 3RK6A 4H7XA 4WNFA 2WXHA 4AEZC 3UT8A 2VTBB 2J9QA 4I6GA 3S2AA 5A7DB 3MKQB 4OVVA 4LUNU 4PUCA 5LCWJ 2R17C 3R7QA 5LOZA 2XQ0A 4ANUA 3CHQA 3D9NA 3S7JA 2VGXB 4UWLA 2J4BA 5EX0A 4C0EA 3U3WA 1H2UA 3WXXA 2IOSA 4JXTA 5D0QD 3FEYA 4A1GA 3L16A 4OVUA 4PDXA 2FULA 1EDUA 2LO6A 2LSUA 3FUHA 3L08A 4AIFA 4CRWA 4HOUA 4APOA 4G25A 2VTBA 4XI9A 4DLQA 3MKQA 4XKCA 3I4RB 2PQNA 5JHBA 2L0TB 4BWRA 3G2UA 4L7TA 2VSOE 4KXKB 4N2SA 5EKQD 1UN8A 3AS8A 4GZ6A 2PM7A 2VGXA 3ZXSA 1HZ4A 3BG0B 4PS3A 4YVQC 3KAEA 5C2YA 5LP0A 3UT4A 4AVXA 2EQXA 4BY6A 4B89A 3D9KA 4EPZA 4XZ4A 3HYMB 4UI9C 3QAQA 5FZSA 1EF1C 2XRZA 1U3CA 3D9OA 1L5JA 5FQ6A 3FTWA 3U66A 2IQCA 3C98A 3CVYA 3PRZA 1SZAA 2AXVA 5LCWC 2KCKA 3CVWA 2XHEA 3L54A 2XCBA 2WXGA 2YNQA 3PDNA 2YQ8A 2AW6A 3PVLA 4PH4B 3APDA 4OYSA 5EX3A 4NURA 3FUIA 2X6FA 4MKTA 3GZ1A 5CHEE 3QWWA 3KD7A 1TJCA 4WWOA 3TXNA 3ENEA 2C0LA 3HVEB 3GYZA 4EBAG 5FQ4A 2WXQA 3FUFA 1EYHA 3FWVA 5HI7A 1E90A 4L23A 4B8CB 3D9IA 3SF4A 3T5VA 1H19A 4R7LA 4WWPA 1UG3A 4FJZA 4WNEA 4AV7A 3EHNA 4KZ0A 1OWMA 1GW6A 4G23A 4GMJA 5FQ7A 3ZPJA 5JJ7A 1IYGA 3FH5A 4TV3A 3FTXA 4UWFA 3HVEA 4FLHA 2VSNA 4U0ZA 1FCHA 1P5QA 5D0OD 5KJKA 2V5FA 3CK7A 1IQUA 4A3TA 3ZRHA 4E6HA 4JZYA 2HM8A 2WXLA 3FUJA 2V4LA 3EDTB 4I1OB 3VLFA 2CHXA 3BEEA 2X6HA 2IF4A 3AS5A 3CHMA 3P1UA 3LVRE 4HORA 3EHMA 4GAAA 3UMVA 4LCTA 1BPOA 2J08A 2Q7FA 4DLOA 3CKBA 3OXFA 3ZIMA 1N52A 2XPZA 1FVFA 2LSVA 1ZU2A 5ANRA 2AXUA 1MQSA 3I5PA 4TUUA 3CQGB 5G05C 4CCAA 3KS2A 4JPSA 5JJ6A 4WNDA 4I43A 1OWOA 3B7SA 3CK9A 3PE3A 3O48A 2VQ2A 2XGOA 3TGOA 5T8IA 4DK5A 3B7UX 4W9RA 3SD5A 2X6JA 4Q69A 4EQFA 3LVQE 3Q5MA 4AJWA 1WAO1 2NXPA 4QFVA 3ASGA 3LY9A 3PE4A 3PZDA 4HXIA 3LEWA 5G2NA 3RO2A 2WB2A 4GZ3A 4EZKA 1NA0A 5BV1A 4FA6A 3T5XA 3HHMA 2WMNA 2IONA 2X3MA 4GYYA 4BT9A 1QNFA 1Y6IA 4E85A 5CMWA 1E8ZA 2CFZA 3GZSA 3ML9A 4IYPA 4N39A 1OWLA 4RSYA 3CVLA 3TG4A 3G2SA 1IHGA 4CT0A 2WPVA 3MGBA 5BV0A 4GCNA 4KBQA 3GW4A 3PUJA 3BG1B 2ZU6B 2M63A 3S7FA 4ATGA 4DPRA 3APFA 2I1KA 3CEQA 4FU3A 4UQYA 3QJZA 1H2VC 2ILRA 4WWNA 3RRNB 4K0RA 5FWQA 2GW1A 3IHYA 4H7YA 4I6EA 4U8HA 3B7RL 4J0UA 1XNFA 2WM9A 2WXMA 2XGMA 1E96B 2WXPA 4L2YA 4AY5A 2YHEA 3Q47B 4FC8A 4I17A 3ONLA 3FU3A 3CKCA 4L1BA 2YINA 3FTZA 4DI3A 2J07A 3B13A 3LS8A 3MZLB 4LEUA 4CDMA 5J08A 5KJMA 1HE8A 3D3MA 3SI5A 2I2OA 3FP3A 2IU1A 4RG6A 3MCXA 3FTVA 4GU5A 4JEUA 4UWHA 3TJPA 4O6FA 3FUDA 4JVSA 3TL5A 3MYVA 4ANVA 4D10C 1ZBPA 4UI9K 4WUYA 5G04J 3VTYA 3UX4A 2E2EA 4V3IA 3RKVA 1HU3A 3MA5A 3DBSA 3LPZA 2UY1B 1DVPA 4U63A 1OWPA 2NC9A 5BUZA 2L0IA 5A6CA 3FU5A 4U07A 2HYZA 5AYWD 1HXIA 3NQPA 3P2BA 2I1JA 4U0UA 5E76A 5LX8A 3Q4AB 4FHKA 1ELRA 4B0ZA 2X6IA 3QWVA 4G2VA 3N71A 3PEVB 2C2LA 2WQHA 2DCPA 3FU6A 3AU4A 3CVUA 4K03A 2UY1A 4J6IA 3G2TA 4YNDA 4EBAA 2AWIA 3TAXA 5CCMA 2MRIA 5KCMA 1JWGA 5ENNA 2BF0X 4M3OA 4G1TA 1HS6A 2PQRA 4BTAA 1KT1A 3QOUA 3ZHEB 2IOLA 5BPPA 4N3CA 2QFCA 2V8SE 3AU5A 1Y8MA 1WM5A 3FTYA 4GZDA 2CFUA 5G05J 3NZUA 1H0AA 2WXOA 3HIZA 4JHRA 3FU0A 4GA2A 2LAHA 3MX3A 1MHQA 5CCLA 4A3VA 1WY6A 4CT4A 2CG2A 3CK8A 5AJLA 3JUIA 3SFZA 4GMLA 3OAWA 3S7DA 4AOFA 3CIAA 4BT8A 5AIJA 2WXJA 3FDHA 3CSFA 4Y6CA 5FT9A 4ANWA 5G04C 3ZHEA 1KT0A 3HDXA 4XX5A 3CGHA 2FO7A 3FUMA 3LXUX 5C1DA 3D9MA 2R5SA 4XE0A 4B8AA 4GPKA 2KCVA 4NRHB 5FJYA 3SGHA 4HOTA 1YA0A 4LRZA 3FFLA 2E0IA 2DBAA 1ELKA 2I6HA 5AENA 2Y4UA 3IEGA 5CMYA 2OV8A 1W3BA 3JCKC 1QQEA 3MEKA 4AXHA 3CVXA 3SBSA 3CHOA 4JHJA 3TXMA 3ZGQA 2NSZA 2I9CA 3PEUB 5EDSA 4MRUA 4BTBA 3IV0A 3OTNA 2VSYA 3U9WA 1TEZA 3GZ2A 4PS8A 3O4ZA 3CLJA 1UN9A 2KZTA 3PUKA 1HO8A 3U4TA 3EIQC 2HO1A 3QDNA 5T3RA 1Z6TA 3SNXA 3CVQA 3Q15A 2OVBA 2X6KA 4ILHB 4JL0A 3DPDA 4JW1A 2DIWA 1SQMA 3ZYKA 2OOEA 2XRYA 1QZ2A 2VJ8A 2XEVA 3E4BA 3FH8A 4A1SA 4ACKA 3ZYQA 4ANXA 2WMOA 4KZCA 4APFA 1FVHA 3MV3B 4J8SA 2FEZA 3VTXA 2A4ZA 4UQZA 2R59A 2QY7A 3RRUA 4I6JA 5HQ8A 3RJVA 2WXKA 2P58C 5KJLA 3L17A 5G55A 4JHKA 4JA9A 1H6KA 3FHEA 5FZRA 4ACLA 3ZN3A 4G11A 3B7TA 1VDYA 1HG2A 4AY6A 3QNKA 2Y4TA 3FEXA 2PL2A 2MOWA 4NQ0A 3MKRA 4UQXA 2WXNA 4ILGA 4GZCA 4I1MA 1PY1A 4Q94A 4UWGA 4CGVA 1U3DA 1JUQA 3ZFWA 4HS2A 1NP7A 4EZJA 1XGWA 3I4GA 4LERA 4NACA 4GZ5A 4UWKA 4EECA 4MLPA 2RG8A 4N3BA 4KVOA 3L13A 4U04A 3CHPA 4KMOA 5FQ8A 1A17A 2WQ7A 3L6AA 4GYOA 4XIFA 2GRMA 5DBKA 4IN3B 3EIJA 3CVVA 1JPLA 4HFGA 5ANLA 3FTSA 1ELWA 1Z3YA 3D9PA 3IBEA 3LJ3A 4N3AA 3FUNA 1HH8A 4F1SA 3LY7A 4WNGA 3ZVVA 3TG5A 4I9CA 1NZNA 5DIZA 4XI0A 3RRMB 3ZEFA 1HF8A 4C0MA 3G2VA 1X5BA 3FH7A 3QC1A 1E8XA 4I2WA 1LF8A 3ESLA 4G24A 3RO3A 3CHRA 1DNPA 1E7VA 2AXZA 4BFRA 2JLBA 3NZSA 1HG5A 4AP2A 3PS6A 4YVOA 3URZA 4J8DA 3I3NA 3LYAA 5AJDA 4GCOA 4JC8A 3FUKA 2C0MA 3MJWA 2XPYA 3CQCB 5BT1A 2PZIA 1E7UA 2VYIA 2KATA 3RIBA 2XGSA 1H2TC 3L22A 2XCCA 4GA1A 4ILIA 5ARFA 3FUEA 4A55A 4DJAA 3K9IA 4J8FA 2YHCA 3VLEA 3UPVA 2AVPA 3ULQA 1N54A 5JJTA 2CHZA 4P29A 2UWJG 3SHFA 3Q49B 1S0PA 4KT6B 3IHVA 3ZYLA 4N5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESK A;  4U0S A;  5M72 A;  3ASD A;  4KYO B;  2BUG A;  5BW8 C;  3OXG A;  5FTP A;  3UQ3 A;  4ABN A;  3UUX A;  3CVN A;  2KCL A;  2IFU A;  3CV0 A;  4F3V A;  1B89 A;  4CDR A;  2MHK A;  4ME2 A;  4GA0 A;  3LY8 A;  3AS4 A;  3ASF A;  3OXL A;  5BNW A;  3R9A B;  5ARG A;  4JA7 A;  5KJN A;  2L6J A;  3JYS A;  3SZ7 A;  4I9E A;  4CGW A;  4B94 A;  1NA3 A;  3LKU A;  3MV2 B;  2XPI A;  3S7B A;  4GYW A;  4I2Z A;  2FBN A;  4RG9 A;  3NF1 A;  2KC7 A;  2FI7 A;  1PC2 A;  2LNI A;  4N2Q A;  2VGY A;  3QWP A;  3LCA A;  4I1A A;  5FZQ A;  2OND A;  4AM9 A;  2HR2 A;  3QKY A;  2FF4 A;  3ASH A;  1KLX A;  3CVP A;  1OUV A;  4Y6W A;  3RU0 A;  4J8E A;  4UI9 J;  4HOS A;  4G26 A;  4HOQ A;  4H7X A;  4WNF A;  2J9Q A;  5A7D B;  5LCW J;  3S7J A;  2VGX B;  5EX0 A;  3U3W A;  3WXX A;  5D0Q D;  2LSU A;  4AIF A;  4HOU A;  4APO A;  4G25 A;  4XI9 A;  2PQN A;  4BWR A;  4KXK B;  4N2S A;  5EKQ D;  3AS8 A;  4GZ6 A;  2VGX A;  1HZ4 A;  4YVQ C;  3KAE A;  3HYM B;  4UI9 C;  5FZS A;  5LCW C;  2KCK A;  2XCB A;  3PDN A;  2YQ8 A;  5EX3 A;  3GZ1 A;  5CHE E;  3QWW A;  3KD7 A;  1TJC A;  2C0L A;  3GYZ A;  3FWV A;  5HI7 A;  3SF4 A;  4WNE A;  4G23 A;  3ZPJ A;  5JJ7 A;  1IYG A;  2VSN A;  4U0Z A;  1FCH A;  1P5Q A;  5D0O D;  5KJK A;  2V5F A;  3CK7 A;  3EDT B;  3BEE A;  2IF4 A;  3AS5 A;  4HOR A;  2Q7F A;  3CKB A;  3OXF A;  2LSV A;  1ZU2 A;  5G05 C;  3KS2 A;  5JJ6 A;  4WND A;  3CK9 A;  3PE3 A;  3O48 A;  2VQ2 A;  2XGO A;  3TGO A;  4W9R A;  4EQF A;  3Q5M A;  1WAO 1;  3ASG A;  3LY9 A;  3PE4 A;  3RO2 A;  4GZ3 A;  1NA0 A;  4BT9 A;  4GYY A;  4N39 A;  3CVL A;  3TG4 A;  1IHG A;  2WPV A;  4GCN A;  4KBQ A;  3GW4 A;  3S7F A;  3CEQ A;  4UQY A;  2GW1 A;  4H7Y A;  4J0U A;  1XNF A;  2XGM A;  1E96 B;  4AY5 A;  3Q47 B;  4I17 A;  3CKC A;  4LEU A;  5KJM A;  3FP3 A;  4RG6 A;  4O6F A;  1ZBP A;  4UI9 K;  4WUY A;  5G04 J;  3VTY A;  2E2E A;  3RKV A;  3MA5 A;  3LPZ A;  2UY1 B;  2NC9 A;  5A6C A;  4U07 A;  2HYZ A;  5AYW D;  1HXI A;  4U0U A;  3Q4A B;  1ELR A;  3QWV A;  4G2V A;  3N71 A;  2C2L A;  2WQH A;  2UY1 A;  4YND A;  3TAX A;  5CCM A;  4BTA A;  4G1T A;  2PQR A;  3ZHE B;  1KT1 A;  3QOU A;  4N3C A;  5G05 J;  2QFC A;  1Y8M A;  1WM5 A;  4JHR A;  4GA2 A;  5CCL A;  3CK8 A;  3S7D A;  4BT8 A;  4Y6C A;  5FT9 A;  5G04 C;  3ZHE A;  1KT0 A;  2FO7 A;  5C1D A;  2R5S A;  4GPK A;  2KCV A;  4NRH B;  5FJY A;  4HOT A;  1YA0 A;  3FFL A;  2DBA A;  2I6H A;  2Y4U A;  3IEG A;  1W3B A;  3MEK A;  1QQE A;  3ZGQ A;  4BTB A;  2VSY A;  3GZ2 A;  3U4T A;  2HO1 A;  3QDN A;  3CVQ A;  3Q15 A;  4JL0 A;  2OOE A;  1QZ2 A;  2XEV A;  3E4B A;  4A1S A;  3MV3 B;  2FEZ A;  3VTX A;  4UQZ A;  5HQ8 A;  3RJV A;  2P58 C;  5KJL A;  4JA9 A;  5FZR A;  3ZN3 A;  4AY6 A;  2Y4T A;  2PL2 A;  4NQ0 A;  3MKR A;  4UQX A;  4CGV A;  3ZFW A;  4GZ5 A;  4N3B A;  4U04 A;  1A17 A;  4GYO A;  4XIF A;  5DBK A;  4IN3 B;  1ELW A;  4N3A A;  1HH8 A;  3LY7 A;  4WNG A;  3TG5 A;  4I9C A;  1NZN A;  5DIZ A;  4XI0 A;  4I2W A;  4G24 A;  3RO3 A;  2JLB A;  4YVO A;  3URZ A;  4J8D A;  3LYA A;  4GCO A;  2C0M A;  5BT1 A;  2PZI A;  2VYI A;  2KAT A;  3RIB A;  2XGS A;  5ARF A;  2XCC A;  4GA1 A;  3K9I A;  4J8F A;  2YHC A;  3UPV A;  2AVP A;  3ULQ A;  5JJT A;  2UWJ G;  3Q49 B;  4N5C A; 
#chains in the Genus database with same CATH topology
 5AN8 A;  3DSW A;  4TRQ A;  3C72 A;  2NYJ A;  2Y69 E;  3ZYM A;  2VGE A;  4ABN A;  2GGF A;  1E8W A;  4KVM A;  3PNT B;  2WVI A;  3U64 A;  1Z3X A;  2RFA A;  2IY0 C;  4CDR A;  3JQ0 A;  4FLB A;  4C48 B;  2IJG X;  4HRL A;  1UJK A;  1UW4 B;  3OXL A;  2CHW A;  3FUL A;  4FJY A;  4BER A;  1PAQ A;  2LAI A;  1V54 E;  2OVF A;  4CDN A;  5J90 A;  3ML8 A;  5ARG A;  2VSX E;  2EIL E;  3D9J A;  2L6J A;  3SZ7 A;  3DEO A;  3ONK A;  3LKU A;  3S7B A;  3UM0 A;  3CR3 A;  4GB9 A;  2BKK B;  3BU8 A;  4RQI A;  3CHS A;  3EU5 A;  5EN5 D;  3DXM G;  4RG9 A;  2KC7 A;  2Y1L E;  1K1B A;  2GRL A;  4TUM A;  4DI4 A;  4N2Q A;  3DSV A;  2VGY A;  4BX8 A;  3QWP A;  3LCA A;  4FUL A;  2HR2 A;  4GMR A;  4MS6 A;  4Y6W A;  2PM6 A;  3NB2 A;  3RU0 A;  4UI9 J;  3RK6 A;  4WNF A;  2WXH A;  3UT8 A;  4OVV A;  5LOZ A;  1N0Q A;  4ANU A;  3S7J A;  4U7E B;  5CED B;  3L16 A;  4OVU A;  2KBX A;  3FUH A;  3L08 A;  3RAU A;  5JHB A;  4KXK B;  5EKQ D;  3AAA C;  3BG0 B;  2R05 A;  4PS3 A;  2R02 A;  3KAE A;  5LP0 A;  5EID A;  4AVX A;  2EQX A;  3E32 A;  4BY6 A;  5JA4 D;  4UI9 C;  5FZS A;  2XRZ A;  1L5J A;  5FQ6 A;  4B93 B;  3CVY A;  3PRZ A;  3TWW A;  1TR4 A;  3CVW A;  3L54 A;  4OYS A;  4BEP A;  2EIN E;  5CHE E;  2QYU A;  3HVE B;  4LNG A;  5FQ4 A;  5HI7 A;  4TXP A;  4JD2 G;  4WNE A;  1GW6 A;  3ABK E;  4GTR A;  3UXG A;  3FTX A;  2VSN A;  1YMP A;  2V5F A;  1MYO A;  3EDT B;  3V2O A;  3V79 K;  3BEE A;  4TXQ A;  1N9A A;  3LVR E;  4HOR A;  5AQ7 A;  3UMV A;  3EHM A;  2GRQ B;  2P9S G;  2J08 A;  4DLO A;  3TWU A;  3I5P A;  5G05 C;  4BES A;  3CQG B;  4CCA A;  5JJ6 A;  4QQI A;  2H6F A;  2ETB A;  4DK5 A;  5CEC B;  2EIM E;  4Q69 A;  3LVQ E;  4AJW A;  4BSX A;  5G2N A;  1KZP A;  3RO2 A;  1NA0 A;  2DZO A;  1Y6I A;  5EYP F;  3ML9 A;  4IYP A;  1OWL A;  4RSY A;  4HI8 A;  1D8D A;  2LXM A;  5CER B;  4KBQ A;  3GW4 A;  3BG1 B;  2ZU6 B;  2M63 A;  1ZB1 A;  3CEQ A;  4FU3 A;  2ILR A;  4WWN A;  3RRN B;  4K0R A;  1SW6 A;  2WM9 A;  2WXM A;  3C5R A;  4L2Y A;  4AY5 A;  3SFY A;  3FU3 A;  2JAB A;  3LS8 A;  5J08 A;  3TWT A;  3TWV A;  4RG6 A;  3TJP A;  3FTV A;  1OT8 A;  4O6F A;  4ANV A;  4D10 C;  1ZBP A;  3VTY A;  3UX4 A;  2E2E A;  3RKV A;  3LPZ A;  4U63 A;  4F6R D;  1MX4 A;  2L0I A;  4HNA D;  4U07 A;  2HYZ A;  4LSZ E;  3NQP A;  1SA5 A;  5CBO A;  3Q4A B;  2X6I A;  3QWV A;  2C2L A;  2ZIS A;  4YND A;  4EBA A;  5CCM A;  1JWG A;  2BF0 X;  4M3O A;  1Y8M A;  1H0A A;  4GA2 A;  1H6O A;  3PZ4 A;  3PZ2 A;  3MX3 A;  1MHQ A;  4CT4 A;  1WY6 A;  3Q9N C;  3CK8 A;  2P9I G;  3SFZ A;  4GML A;  3OAW A;  5FT9 A;  5JMN D;  3CGH A;  3D9M A;  5AAO A;  4DRX E;  4GTQ A;  3TWR A;  1YA0 A;  2E0I A;  3JCK C;  4DX2 A;  3L82 A;  4G8L A;  3U9W A;  5D2M C;  3AG3 E;  3PUK A;  5AQB A;  3SNX A;  1V55 E;  3Q15 A;  1SQM A;  1TN8 A;  2XRY A;  2VJ8 A;  4YDE A;  4APF A;  2A4Z A;  2WXK A;  1OCR E;  1H6K A;  1HG2 A;  3L9T A;  4UQX A;  4XEI G;  4Q94 A;  4HS2 A;  3AG4 E;  4EZJ A;  4U04 A;  3L13 A;  1A17 A;  2WQ7 A;  4GYO A;  4IN3 B;  3EIJ A;  3CVV A;  4GTT A;  3FTS A;  3FUN A;  1NZN A;  4XI0 A;  1E8X A;  3ESL A;  4G24 A;  3UKR G;  2ZGG A;  1UOH A;  3NZS A;  4AP2 A;  3I3N A;  4J8Y A;  4GTP A;  1LD8 A;  2KAT A;  2XS1 A;  1H2T C;  3L22 A;  4GA1 A;  4A55 A;  4J8F A;  3VLE A;  2YHC A;  5HRY A;  2CHZ A;  1TN6 A;  1S0P A;  3IHV A;  3QAR A;  5A23 A;  3ESK A;  3ASD A;  2JEK A;  3OXG A;  3CVN A;  5BXO A;  4FAD A;  3CST A;  4JEH A;  1E8Y A;  2WXF A;  3J5Q B;  2KCL A;  3KEZ A;  3UT7 A;  5T4Y A;  1DC2 A;  2WXR A;  3Q79 A;  4ME2 A;  4A63 B;  2A5U A;  4FP7 A;  3V30 A;  4JA7 A;  4IUL A;  3PRE A;  2J49 A;  4CGW A;  3G2W A;  3MV2 B;  2XPI A;  2WQ6 A;  2KM4 A;  3FTU A;  4GYW A;  4I2Z A;  5CEA A;  2DYS E;  2FBN A;  1TJF A;  5KNG A;  2FI7 A;  4BX9 A;  1PC2 A;  2LNI A;  1EPU A;  4RVB A;  4I1A A;  4PS7 A;  2OND A;  1OY3 D;  4F53 A;  1K1A A;  3BQO A;  1KLX A;  3CVP A;  1OUV A;  3HXD A;  5E75 A;  1N11 A;  2ZGD A;  2VTB B;  3S2A A;  5A7D B;  3D9H A;  3MKQ B;  4PUC A;  4UUC A;  1O5M A;  3CHQ A;  4X8Q A;  2VGX B;  4UWL A;  4C0E A;  3WXX A;  2IOS A;  4A1G A;  3FEY A;  2FUL A;  4HOU A;  2KXP C;  4APO A;  1SVX A;  4G25 A;  3KEA A;  2PQN A;  4BWR A;  3G2U A;  4L7T A;  4N2S A;  4GZ6 A;  2PM7 A;  3UIO C;  5ENQ D;  1H6P A;  2H6I A;  3D9K A;  4EPZ A;  1EF1 C;  1U3C A;  3DEP A;  3V31 A;  5ENS D;  4ATZ D;  2AW6 A;  4PH4 B;  2A5E A;  1D9S A;  5EX3 A;  3GZ1 A;  4WWO A;  1N4Q A;  3TXN A;  2C0L A;  3BUA A;  4EBA G;  3FWV A;  1E90 A;  3D9I A;  3DST A;  4R7L A;  4WWP A;  1IYG A;  5FQ7 A;  4TV3 A;  2ETC A;  1BI8 B;  3HVE A;  4FLH A;  1FCH A;  1P5Q A;  5D0O D;  5D66 A;  5KJK A;  3CK7 A;  4E6H A;  3PZ1 A;  2WXL A;  2ZXW E;  3E30 A;  4I1O B;  2CHX A;  2IF4 A;  3AS5 A;  4GAA A;  1BPO A;  3CKB A;  3OXF A;  3ZIM A;  1N52 A;  1FVF A;  2LSV A;  1MQS A;  4YDY A;  3KS2 A;  4JPS A;  4WND A;  5HS0 A;  1OWO A;  3B7S A;  3O48 A;  2P9L G;  2VQ2 A;  2XGO A;  4BET A;  5T8I A;  5B3S E;  3B7U X;  3DXK G;  4W9R A;  4GTS A;  4EQF A;  3Q5M A;  3PZD A;  3LY9 A;  2GRP B;  4RLY A;  2WB2 A;  3W9F A;  3HHM A;  1TNU A;  1QNF A;  2CFZ A;  4O1O A;  3AG2 E;  2WPV A;  4ATG A;  4J7W A;  3APF A;  2I1K A;  4UQY A;  1H2V C;  5FWQ A;  4ZHB A;  4I6E A;  3IXE A;  4U8H A;  2PNN A;  5B1A E;  4J0U A;  2XGM A;  1E96 B;  2B6C A;  3Q47 B;  4I17 A;  3F6Q A;  3Q75 A;  3ONL A;  2YIN A;  2EIK E;  1S64 A;  5KJM A;  3D3M A;  2H6H A;  2IU1 A;  4GU5 A;  4JEU A;  3B7B A;  3MYV A;  4UI9 K;  3MA5 A;  1DVP A;  1OCO E;  1OWP A;  3NBN B;  3FU5 A;  4U0U A;  2DYR E;  3PEV B;  2WQH A;  2DCP A;  4K03 A;  3KSL A;  3G2T A;  2MRI A;  4M7C A;  5KCM A;  5ITZ F;  3QOU A;  5G05 J;  4GZD A;  3B95 A;  3FU0 A;  4LG6 A;  1TNB A;  2OEW A;  4A3V A;  1MX2 A;  2CG2 A;  3S7D A;  4BT8 A;  2WXJ A;  4K5B A;  3DSU A;  1NI1 A;  3LXU X;  3UTM A;  4B8A A;  4GPK A;  4HOT A;  4ZFH A;  1ELK A;  5CMY A;  5B1B E;  1BI7 B;  2LXL A;  1S70 B;  2OV8 A;  3UKU G;  3MEK A;  3CVX A;  4JHJ A;  3ZGQ A;  2NSZ A;  3PEU B;  4MRU A;  1TEZ A;  2VSY A;  4PS8 A;  3DPY A;  3O4Z A;  3QDN A;  1Z6T A;  3CVQ A;  4ILH B;  2DIW A;  2OOE A;  2XEV A;  3JXJ A;  4ACK A;  1YYH A;  4ANX A;  4YDW A;  3SFX A;  3EHR A;  1YCS B;  2R59 A;  3AG1 E;  2GRO B;  4G11 A;  3B7T A;  1VDY A;  3HG0 D;  4AY6 A;  3QNK A;  2MOW A;  4NQ0 A;  4GZC A;  2XZT G;  4GTV A;  4GPM A;  1JUQ A;  1NP7 A;  1XGW A;  4GZ5 A;  4UWK A;  2RG8 A;  4KMO A;  3SO8 A;  4XIF A;  2GRM A;  5ANL A;  1Z3Y A;  4N3A A;  2L6B A;  3SY2 A;  3ZVV A;  3TG5 A;  5DIZ A;  4DX5 D;  2F37 A;  3UM3 A;  4C0M A;  3SQV A;  3AJI A;  4I2W A;  3CHR A;  2AXZ A;  3ZU7 B;  4BFR A;  2JLB A;  3NOG D;  4JC8 A;  2C0M A;  2XPY A;  3CQC B;  3ISM C;  1E7U A;  3RIB A;  2XGS A;  5AAR A;  5ARF A;  2XCC A;  3UPV A;  3ULQ A;  2XEE A;  4P29 A;  3RSE G;  3Q78 A;  1JWF A;  2GRN B;  2P9P G;  4HVB A;  2BUG A;  1FT1 A;  5BW8 C;  4O1P A;  4L2L A;  2QZA A;  4WAF A;  2J09 A;  2IFU A;  4F3V A;  4Q96 A;  1B89 A;  3PNL B;  1HX8 A;  2MHK A;  3IKO B;  1LD7 A;  5JHA A;  4GA0 A;  3JQ1 A;  5HKP A;  4TXR A;  3R9A B;  1N95 A;  5CRV A;  3HRA A;  3E33 A;  2R2L A;  4FHJ A;  3EJN A;  3JYS A;  4I9E A;  3JUE A;  3C3Q A;  3D9L A;  3HXE A;  4EZL A;  2WXI A;  3TWQ A;  3ZW3 A;  4XKB A;  2CG3 A;  3APC A;  1HFA A;  3WG7 E;  1U2V G;  2V5Q C;  3VLD A;  1QBQ A;  5LFA A;  3QKY A;  2FO1 E;  1UJJ A;  1DCE A;  5AQA A;  3DRA A;  4HLL A;  1JCQ A;  4AEZ C;  2J9Q A;  4U8V D;  4K5C A;  5LCW J;  2R17 C;  5ENP D;  2XQ0 A;  3D9N A;  2ETA A;  4DX1 A;  2R03 A;  5EX0 A;  3U3W A;  4JXT A;  3NAW A;  4CRW A;  2VTB A;  4XI9 A;  3MKQ A;  2L0T B;  4N5Q A;  2VSO E;  1UN8 A;  3AS8 A;  2VGX A;  3ZXS A;  4HQD A;  5C2Y A;  2P9K G;  4G8K A;  4LNB A;  4B89 A;  3HYM B;  3DSS A;  3C98 A;  1SZA A;  5LCW C;  2XCB A;  2B0O E;  2YQ8 A;  3PVL A;  3APD A;  4BSZ B;  3ZNG A;  2X6F A;  2P9N G;  3KD7 A;  3ENE A;  3FUF A;  1EYH A;  1IHB A;  3T5V A;  4HRN A;  1UG3 A;  4FJZ A;  3W9G A;  1OWM A;  3ZPJ A;  4GMJ A;  1QYM A;  3EU9 A;  4U0Z A;  1IQU A;  2HM8 A;  3FUJ A;  2V4L A;  3EHQ A;  3CHM A;  3P1U A;  2QYJ A;  1NFI E;  3Q7F A;  4LCT A;  4L9P A;  2XPZ A;  5BXU A;  2AXU A;  1KZO A;  2H6G A;  2OEV A;  1WDY A;  2Y0B G;  3CK9 A;  3PE3 A;  3TGO A;  3SD5 A;  2X6J A;  1N94 A;  1WAO 1;  2NXP A;  3ASG A;  1TYQ G;  2DWZ A;  2WMN A;  2ION A;  4E85 A;  3GZS A;  3TG4 A;  5EIB E;  4CT0 A;  3MGB A;  5BV0 A;  5ENO D;  1Z5S C;  3V2X A;  2IO2 C;  2V4H C;  3QJZ A;  3IHY A;  3B7R L;  1XNF A;  2WXP A;  2YHE A;  3CKC A;  4L1B A;  4DI3 A;  2J07 A;  4LEU A;  3SI5 A;  2I2O A;  3TWS A;  3FUD A;  4JVS A;  3TL5 A;  4WUY A;  4V3I A;  2UY1 B;  5BUZ A;  5AYW D;  3ULE G;  1HXI A;  1JCR A;  3P2B A;  5E76 A;  5LX8 A;  4FHK A;  4B0Z A;  4G2V A;  3N71 A;  1RW2 A;  3ZUV B;  4GTM A;  2AWI A;  2DZN A;  3J5P A;  5ENN A;  4BTA A;  4G1T A;  1HS6 A;  2PQR A;  1KT1 A;  3ZHE B;  2IOL A;  1N4P A;  2F8Y A;  2QFC A;  3FTY A;  1WM5 A;  4JHR A;  3HIZ A;  2LAH A;  5CCL A;  4OAV B;  3JUI A;  4AOF A;  3CSF A;  4Y6C A;  4ANW A;  3HDX A;  5C1D A;  1OCC E;  4XE0 A;  1KPS B;  4DUI A;  3UM2 A;  4NRH B;  3SGH A;  3FFL A;  2DBA A;  2I6H A;  5AEN A;  2Y4U A;  3IEG A;  1W3B A;  1MZC A;  4AXH A;  3SBS A;  3HXF A;  3UM1 A;  3OTN A;  1TNO A;  3GZ2 A;  1IXV A;  2KZT A;  3EIQ C;  2HO1 A;  3X2Q E;  5AQ9 A;  4JL0 A;  2X6K A;  4DX7 D;  3ZYK A;  3FH8 A;  3ZYQ A;  4KZC A;  3MV3 B;  3VTX A;  2QY7 A;  3TWX A;  5HQ8 A;  3RJV A;  3NOC D;  5KJL A;  3ABL E;  2QC9 A;  3FHE A;  3ZN3 A;  2Y4T A;  3FEX A;  3MKR A;  4I1M A;  4UWG A;  3UI2 A;  3I4G A;  4LER A;  4MLP A;  3ABM E;  4KVO A;  3CHP A;  5DBK A;  1JPL A;  1NL4 A;  3LJ3 A;  4WNG A;  3ZEF A;  1X5B A;  3QC1 A;  1LF8 A;  3RO3 A;  1E7V A;  3PS6 A;  4YVO A;  3LYA A;  5AJD A;  2F0Y A;  4GCO A;  3MJW A;  5BT1 A;  3R9M A;  2PZI A;  2VYI A;  4DJA A;  1N54 A;  1RZ4 A;  3SHF A;  5KWD A;  4U0S A;  5M72 A;  4KYO B;  3PH0 C;  4HRM B;  5FTP A;  4YDO A;  3UQ3 A;  2BTD A;  2RD0 A;  3UUX A;  4EHM A;  1IQR A;  4OAU C;  3CV0 A;  2DVW A;  3FY4 A;  4GTO A;  3HXC A;  2EIJ E;  2L9B A;  1JCS A;  2KZT B;  3HXB A;  3LY8 A;  1DCQ A;  3AS4 A;  1BD8 A;  3ASF A;  5FIO A;  5BNW A;  4IRU A;  1SZ9 A;  2X38 A;  4F7A A;  5KJN A;  3LDZ A;  3Q7A A;  4B94 A;  1INZ A;  1NA3 A;  3SBT B;  2IEJ A;  3QB2 A;  4C9B B;  5ENR D;  2J4D A;  4U8Y D;  3QK0 A;  2BKG A;  3NF1 A;  3T8M A;  3R7R A;  4CEM A;  4NIK A;  1OCZ E;  3ZKJ A;  3T9K A;  1N0R A;  5FZQ A;  4AM9 A;  4JB8 P;  2FF4 A;  2V0P A;  3ASH A;  1OWN A;  4URK A;  4J8E A;  2Y3A A;  4HOS A;  4HLE A;  4G26 A;  4HOQ A;  4H7X A;  3E34 A;  4I6G A;  5KBA A;  4LUN U;  1FT2 A;  3R7Q A;  2J4B A;  1H2U A;  5D0Q D;  4PDX A;  2LO6 A;  1EDU A;  2LSU A;  4AIF A;  4DLQ A;  4XKC A;  3I4R B;  3T8K A;  3DWL G;  1HZ4 A;  4HB5 A;  4U96 D;  4YVQ C;  3UT4 A;  3LJN A;  4XZ4 A;  3QAQ A;  4CZ2 D;  3D9O A;  3FTW A;  3U66 A;  1D8E A;  2IQC A;  2AXV A;  2KCK A;  2XHE A;  5EIL A;  2WXG A;  2YNQ A;  2HE0 A;  2ZIR A;  3PDN A;  2AJA A;  4NUR A;  3FUI A;  4MKT A;  3QWW A;  1TJC A;  1TN7 A;  2IO3 C;  3GYZ A;  1K8K G;  2WXQ A;  4HI9 A;  3ZXP A;  4L23 A;  5CRU A;  4B8C B;  3SF4 A;  4MBG A;  1H19 A;  1AP7 A;  1IKN D;  4AV7 A;  3EHN A;  4KZ0 A;  3ASN E;  4G23 A;  5JJ7 A;  4K5A B;  1AWC B;  3FH5 A;  4UWF A;  4A3T A;  3ZRH A;  4JZY A;  3VLF A;  2X6H A;  2RFM A;  1MJ0 A;  2Q7F A;  1ZU2 A;  5ANR A;  4TUU A;  4I43 A;  1X81 A;  4QFV A;  3PE4 A;  4HXI A;  3LEW A;  2OCC E;  2XEN A;  4GZ3 A;  4EZK A;  5BV1 A;  4FA6 A;  3T5X A;  2RKK A;  2X3M A;  4BT9 A;  4GYY A;  5CMW A;  1E8Z A;  3C3R A;  3Q73 A;  4N39 A;  5KNH D;  1BLX B;  3CVL A;  3G2S A;  1IHG A;  4GCN A;  4F1P A;  3PUJ A;  3S7F A;  4DPR A;  2GRR B;  1LTX A;  2GW1 A;  4H7Y A;  3UIP C;  4FC8 A;  1S63 A;  3FTZ A;  3B13 A;  3MZL B;  4CDM A;  1HE8 A;  5IY5 E;  2XS8 A;  3FP3 A;  3MCX A;  4UWH A;  1O1R A;  5G04 J;  2XEH A;  4LNU D;  1HU3 A;  3DBS A;  5EYL A;  2NC9 A;  1N4R A;  5A6C A;  2BED A;  2I1J A;  2F8X K;  1TNY A;  1ELR A;  3FU6 A;  5CBN A;  3AU4 A;  1TNZ A;  3CVU A;  1WG0 A;  2UY1 A;  4J6I A;  4CYM D;  3TAX A;  1SA4 A;  5BPP A;  4N3C A;  2V8S E;  3AU5 A;  2CFU A;  3NZU A;  2WXO A;  1G3N B;  1OXJ A;  3C3O A;  5H7P A;  5AJL A;  2J8S D;  5AIJ A;  3CIA A;  4DX6 D;  3DSX A;  3FDH A;  5G04 C;  3ZHE A;  1A5E A;  1KT0 A;  4XX5 A;  2FO7 A;  3FUM A;  1K3Z D;  2R5S A;  2KCV A;  2XZD G;  5FJY A;  4LRZ A;  3JXI A;  3ULY A;  4Z68 A;  1QQE A;  3E37 A;  3CHO A;  3TXM A;  5FIN A;  2I9C A;  5EDS A;  4BTB A;  3IV0 A;  3CLJ A;  3KSQ A;  1UN9 A;  3U4T A;  1HO8 A;  5T3R A;  2OVB A;  3DPD A;  4JW1 A;  1QZ2 A;  3E4B A;  4HBD A;  4A1S A;  2WMO A;  1FVH A;  1MX6 A;  4J8S A;  2FEZ A;  4U95 D;  4UQZ A;  3RRU A;  4I6J A;  2P58 C;  3L17 A;  5G55 A;  4JHK A;  4JA9 A;  4ACL A;  5FZR A;  2PL2 A;  2WXN A;  4ILG A;  1PY1 A;  4CGV A;  1U3D A;  3ZFW A;  1FPP A;  4NAC A;  4EEC A;  3ASO E;  4N3B A;  3EUV A;  5FQ8 A;  3L6A A;  1BU9 A;  3UIN C;  1O1S A;  1Q2Z A;  4HFG A;  1ELW A;  3IBE A;  3D9P A;  5ENT D;  4F1S A;  1HH8 A;  3LY7 A;  2LUH A;  4I9C A;  3RRM B;  1O1T A;  1HF8 A;  3G2V A;  3FH7 A;  2P2C P;  1DNP A;  3Q9U C;  2MYO A;  1HG5 A;  3URZ A;  4J8D A;  3PZ3 A;  3FUK A;  2P9U G;  4O60 A;  4ILI A;  3FUE A;  3K9I A;  2AVP A;  5JJT A;  2UWJ G;  3Q49 B;  4KT6 B;  1N4S A;  3ZYL A;  4N5C A; 
#chains in the Genus database with same CATH homology
 3QAR A;  5A23 A;  1JWF A;  3ESK A;  4U0S A;  5M72 A;  3ASD A;  4TRQ A;  4HVB A;  4KYO B;  2BUG A;  3PH0 C;  5BW8 C;  2JEK A;  3OXG A;  5FTP A;  3ZYM A;  3UQ3 A;  2BTD A;  2RD0 A;  3UUX A;  4ABN A;  1IQR A;  4L2L A;  3CVN A;  2GGF A;  1E8W A;  4KVM A;  4WAF A;  4FAD A;  2J09 A;  2WVI A;  1E8Y A;  3CST A;  3PNT B;  2WXF A;  4JEH A;  3U64 A;  2KCL A;  2IFU A;  3KEZ A;  3CV0 A;  4F3V A;  1Z3X A;  4Q96 A;  3UT7 A;  3FY4 A;  5T4Y A;  1B89 A;  3PNL B;  4CDR A;  1HX8 A;  2MHK A;  2WXR A;  2L9B A;  3IKO B;  5JHA A;  2KZT B;  4ME2 A;  3JQ0 A;  4FLB A;  2IJG X;  3LY8 A;  3JQ1 A;  4GA0 A;  3AS4 A;  1UJK A;  1UW4 B;  3ASF A;  3OXL A;  2A5U A;  2CHW A;  3FUL A;  4FJY A;  4FP7 A;  5BNW A;  1PAQ A;  2LAI A;  2OVF A;  3R9A B;  4IRU A;  1SZ9 A;  4CDN A;  5J90 A;  3ML8 A;  2X38 A;  5ARG A;  4F7A A;  2VSX E;  4JA7 A;  5KJN A;  4IUL A;  4FHJ A;  3PRE A;  3LDZ A;  3D9J A;  2J49 A;  3EJN A;  2L6J A;  3JYS A;  4I9E A;  3SZ7 A;  4CGW A;  4B94 A;  1INZ A;  1NA3 A;  3G2W A;  3ONK A;  3LKU A;  3MV2 B;  2XPI A;  3SBT B;  3S7B A;  2WQ6 A;  2KM4 A;  3D9L A;  3FTU A;  3QB2 A;  4GYW A;  4C9B B;  3CR3 A;  4I2Z A;  4GB9 A;  4EZL A;  2FBN A;  3CHS A;  2J4D A;  2WXI A;  4BSX A;  3QK0 A;  1TJF A;  4RG9 A;  3ZW3 A;  3NF1 A;  2KC7 A;  3T8M A;  2FI7 A;  4BX9 A;  3R7R A;  4XKB A;  2CG3 A;  3APC A;  4CEM A;  1HFA A;  2GRL A;  1PC2 A;  3VLD A;  2LNI A;  1EPU A;  4DI4 A;  4N2Q A;  2VGY A;  4BX8 A;  3QWP A;  3LCA A;  4RVB A;  4FUL A;  4I1A A;  4PS7 A;  5FZQ A;  2OND A;  4AM9 A;  5LFA A;  4F53 A;  2HR2 A;  3QKY A;  2FF4 A;  4MS6 A;  2V0P A;  1UJJ A;  3ASH A;  1OWN A;  1KLX A;  3CVP A;  4URK A;  1OUV A;  4Y6W A;  2PM6 A;  4J8E A;  2Y3A A;  4UI9 J;  3RU0 A;  4HOS A;  4HLE A;  4G26 A;  5E75 A;  4HOQ A;  3RK6 A;  4H7X A;  4WNF A;  2WXH A;  4AEZ C;  3UT8 A;  2VTB B;  2J9Q A;  4I6G A;  3S2A A;  5A7D B;  3MKQ B;  4OVV A;  4LUN U;  4PUC A;  5LCW J;  2R17 C;  3R7Q A;  5LOZ A;  2XQ0 A;  4ANU A;  3CHQ A;  3D9N A;  3S7J A;  2VGX B;  4UWL A;  2J4B A;  5EX0 A;  4C0E A;  3U3W A;  1H2U A;  3WXX A;  2IOS A;  4JXT A;  5D0Q D;  3FEY A;  4A1G A;  3L16 A;  4OVU A;  4PDX A;  2FUL A;  1EDU A;  2LO6 A;  2LSU A;  3FUH A;  3L08 A;  4AIF A;  4CRW A;  4HOU A;  4APO A;  4G25 A;  2VTB A;  4XI9 A;  4DLQ A;  3MKQ A;  4XKC A;  3I4R B;  2PQN A;  5JHB A;  2L0T B;  4BWR A;  3G2U A;  4L7T A;  2VSO E;  4KXK B;  4N2S A;  5EKQ D;  1UN8 A;  3AS8 A;  4GZ6 A;  2PM7 A;  2VGX A;  3ZXS A;  1HZ4 A;  3BG0 B;  4PS3 A;  4YVQ C;  3KAE A;  5C2Y A;  5LP0 A;  3UT4 A;  4AVX A;  2EQX A;  4BY6 A;  4B89 A;  3D9K A;  4EPZ A;  4XZ4 A;  3HYM B;  4UI9 C;  3QAQ A;  5FZS A;  1EF1 C;  2XRZ A;  1U3C A;  3D9O A;  1L5J A;  5FQ6 A;  3FTW A;  3U66 A;  2IQC A;  3C98 A;  3CVY A;  3PRZ A;  1SZA A;  2AXV A;  5LCW C;  2KCK A;  3CVW A;  2XHE A;  3L54 A;  2XCB A;  2WXG A;  2YNQ A;  3PDN A;  2YQ8 A;  2AW6 A;  3PVL A;  4PH4 B;  3APD A;  4OYS A;  5EX3 A;  4NUR A;  3FUI A;  2X6F A;  4MKT A;  3GZ1 A;  5CHE E;  3QWW A;  3KD7 A;  1TJC A;  4WWO A;  3TXN A;  3ENE A;  2C0L A;  3HVE B;  3GYZ A;  4EBA G;  5FQ4 A;  2WXQ A;  3FUF A;  1EYH A;  3FWV A;  5HI7 A;  1E90 A;  4L23 A;  4B8C B;  3D9I A;  3SF4 A;  3T5V A;  1H19 A;  4R7L A;  4WWP A;  1UG3 A;  4FJZ A;  4WNE A;  4AV7 A;  3EHN A;  4KZ0 A;  1OWM A;  1GW6 A;  4G23 A;  4GMJ A;  5FQ7 A;  3ZPJ A;  5JJ7 A;  1IYG A;  3FH5 A;  4TV3 A;  3FTX A;  4UWF A;  3HVE A;  4FLH A;  2VSN A;  4U0Z A;  1FCH A;  1P5Q A;  5D0O D;  5KJK A;  2V5F A;  3CK7 A;  1IQU A;  4A3T A;  3ZRH A;  4E6H A;  4JZY A;  2HM8 A;  2WXL A;  3FUJ A;  2V4L A;  3EDT B;  4I1O B;  3VLF A;  2CHX A;  3BEE A;  2X6H A;  2IF4 A;  3AS5 A;  3CHM A;  3P1U A;  3LVR E;  4HOR A;  3EHM A;  4GAA A;  3UMV A;  4LCT A;  1BPO A;  2J08 A;  2Q7F A;  4DLO A;  3CKB A;  3OXF A;  3ZIM A;  1N52 A;  2XPZ A;  1FVF A;  2LSV A;  1ZU2 A;  5ANR A;  2AXU A;  1MQS A;  3I5P A;  4TUU A;  3CQG B;  5G05 C;  4CCA A;  3KS2 A;  4JPS A;  5JJ6 A;  4WND A;  4I43 A;  1OWO A;  3B7S A;  3CK9 A;  3PE3 A;  3O48 A;  2VQ2 A;  2XGO A;  3TGO A;  5T8I A;  4DK5 A;  3B7U X;  4W9R A;  3SD5 A;  2X6J A;  4Q69 A;  4EQF A;  3LVQ E;  3Q5M A;  4AJW A;  1WAO 1;  2NXP A;  4QFV A;  3ASG A;  3LY9 A;  3PE4 A;  3PZD A;  4HXI A;  3LEW A;  5G2N A;  3RO2 A;  2WB2 A;  4GZ3 A;  4EZK A;  1NA0 A;  5BV1 A;  4FA6 A;  3T5X A;  3HHM A;  2WMN A;  2ION A;  2X3M A;  4GYY A;  4BT9 A;  1QNF A;  1Y6I A;  4E85 A;  5CMW A;  1E8Z A;  2CFZ A;  3GZS A;  3ML9 A;  4IYP A;  4N39 A;  1OWL A;  4RSY A;  3CVL A;  3TG4 A;  3G2S A;  1IHG A;  4CT0 A;  2WPV A;  3MGB A;  5BV0 A;  4GCN A;  4KBQ A;  3GW4 A;  3PUJ A;  3BG1 B;  2ZU6 B;  2M63 A;  3S7F A;  4ATG A;  4DPR A;  3APF A;  2I1K A;  3CEQ A;  4FU3 A;  4UQY A;  3QJZ A;  1H2V C;  2ILR A;  4WWN A;  3RRN B;  4K0R A;  5FWQ A;  2GW1 A;  3IHY A;  4H7Y A;  4I6E A;  4U8H A;  3B7R L;  4J0U A;  1XNF A;  2WM9 A;  2WXM A;  2XGM A;  1E96 B;  2WXP A;  4L2Y A;  4AY5 A;  2YHE A;  3Q47 B;  4FC8 A;  4I17 A;  3ONL A;  3FU3 A;  3CKC A;  4L1B A;  2YIN A;  3FTZ A;  4DI3 A;  2J07 A;  3B13 A;  3LS8 A;  3MZL B;  4LEU A;  4CDM A;  5J08 A;  5KJM A;  1HE8 A;  3D3M A;  3SI5 A;  2I2O A;  3FP3 A;  2IU1 A;  4RG6 A;  3MCX A;  3FTV A;  4GU5 A;  4JEU A;  4UWH A;  3TJP A;  4O6F A;  3FUD A;  4JVS A;  3TL5 A;  3MYV A;  4ANV A;  4D10 C;  1ZBP A;  4UI9 K;  4WUY A;  5G04 J;  3VTY A;  3UX4 A;  2E2E A;  4V3I A;  3RKV A;  1HU3 A;  3MA5 A;  3DBS A;  3LPZ A;  2UY1 B;  1DVP A;  4U63 A;  1OWP A;  2NC9 A;  5BUZ A;  2L0I A;  5A6C A;  3FU5 A;  4U07 A;  2HYZ A;  5AYW D;  1HXI A;  3NQP A;  3P2B A;  2I1J A;  4U0U A;  5E76 A;  5LX8 A;  3Q4A B;  4FHK A;  1ELR A;  4B0Z A;  2X6I A;  3QWV A;  4G2V A;  3N71 A;  3PEV B;  2C2L A;  2WQH A;  2DCP A;  3FU6 A;  3AU4 A;  3CVU A;  4K03 A;  2UY1 A;  4J6I A;  3G2T A;  4YND A;  4EBA A;  2AWI A;  3TAX A;  5CCM A;  2MRI A;  5KCM A;  1JWG A;  5ENN A;  2BF0 X;  4M3O A;  4G1T A;  1HS6 A;  2PQR A;  4BTA A;  1KT1 A;  3QOU A;  3ZHE B;  2IOL A;  5BPP A;  4N3C A;  2QFC A;  2V8S E;  3AU5 A;  1Y8M A;  1WM5 A;  3FTY A;  4GZD A;  2CFU A;  5G05 J;  3NZU A;  1H0A A;  2WXO A;  3HIZ A;  4JHR A;  3FU0 A;  4GA2 A;  2LAH A;  3MX3 A;  1MHQ A;  5CCL A;  4A3V A;  1WY6 A;  4CT4 A;  2CG2 A;  3CK8 A;  5AJL A;  3JUI A;  3SFZ A;  4GML A;  3OAW A;  3S7D A;  4AOF A;  3CIA A;  4BT8 A;  5AIJ A;  2WXJ A;  3FDH A;  3CSF A;  4Y6C A;  5FT9 A;  4ANW A;  5G04 C;  3ZHE A;  1KT0 A;  3HDX A;  4XX5 A;  3CGH A;  2FO7 A;  3FUM A;  3LXU X;  5C1D A;  3D9M A;  2R5S A;  4XE0 A;  4B8A A;  4GPK A;  2KCV A;  4NRH B;  5FJY A;  3SGH A;  4HOT A;  1YA0 A;  4LRZ A;  3FFL A;  2E0I A;  2DBA A;  1ELK A;  2I6H A;  5AEN A;  2Y4U A;  3IEG A;  5CMY A;  2OV8 A;  1W3B A;  3JCK C;  1QQE A;  3MEK A;  4AXH A;  3CVX A;  3SBS A;  3CHO A;  4JHJ A;  3TXM A;  3ZGQ A;  2NSZ A;  2I9C A;  3PEU B;  5EDS A;  4MRU A;  4BTB A;  3IV0 A;  3OTN A;  2VSY A;  3U9W A;  1TEZ A;  3GZ2 A;  4PS8 A;  3O4Z A;  3CLJ A;  1UN9 A;  2KZT A;  3PUK A;  1HO8 A;  3U4T A;  3EIQ C;  2HO1 A;  3QDN A;  5T3R A;  1Z6T A;  3SNX A;  3CVQ A;  3Q15 A;  2OVB A;  2X6K A;  4ILH B;  4JL0 A;  3DPD A;  4JW1 A;  2DIW A;  1SQM A;  3ZYK A;  2OOE A;  2XRY A;  1QZ2 A;  2VJ8 A;  2XEV A;  3E4B A;  3FH8 A;  4A1S A;  4ACK A;  3ZYQ A;  4ANX A;  2WMO A;  4KZC A;  4APF A;  1FVH A;  3MV3 B;  4J8S A;  2FEZ A;  3VTX A;  2A4Z A;  4UQZ A;  2R59 A;  2QY7 A;  3RRU A;  4I6J A;  5HQ8 A;  3RJV A;  2WXK A;  2P58 C;  5KJL A;  3L17 A;  5G55 A;  4JHK A;  4JA9 A;  1H6K A;  3FHE A;  5FZR A;  4ACL A;  3ZN3 A;  4G11 A;  3B7T A;  1VDY A;  1HG2 A;  4AY6 A;  3QNK A;  2Y4T A;  3FEX A;  2PL2 A;  2MOW A;  4NQ0 A;  3MKR A;  4UQX A;  2WXN A;  4ILG A;  4GZC A;  4I1M A;  1PY1 A;  4Q94 A;  4UWG A;  4CGV A;  1U3D A;  1JUQ A;  3ZFW A;  4HS2 A;  1NP7 A;  4EZJ A;  1XGW A;  3I4G A;  4LER A;  4NAC A;  4GZ5 A;  4UWK A;  4EEC A;  4MLP A;  2RG8 A;  4N3B A;  4KVO A;  3L13 A;  4U04 A;  3CHP A;  4KMO A;  5FQ8 A;  1A17 A;  2WQ7 A;  3L6A A;  4GYO A;  4XIF A;  2GRM A;  5DBK A;  4IN3 B;  3EIJ A;  3CVV A;  1JPL A;  4HFG A;  5ANL A;  3FTS A;  1ELW A;  1Z3Y A;  3D9P A;  3IBE A;  3LJ3 A;  4N3A A;  3FUN A;  1HH8 A;  4F1S A;  3LY7 A;  4WNG A;  3ZVV A;  3TG5 A;  4I9C A;  1NZN A;  5DIZ A;  4XI0 A;  3RRM B;  3ZEF A;  1HF8 A;  4C0M A;  3G2V A;  1X5B A;  3FH7 A;  3QC1 A;  1E8X A;  4I2W A;  1LF8 A;  3ESL A;  4G24 A;  3RO3 A;  3CHR A;  1DNP A;  1E7V A;  2AXZ A;  4BFR A;  2JLB A;  3NZS A;  1HG5 A;  4AP2 A;  3PS6 A;  4YVO A;  3URZ A;  4J8D A;  3I3N A;  3LYA A;  5AJD A;  4GCO A;  4JC8 A;  3FUK A;  2C0M A;  3MJW A;  2XPY A;  3CQC B;  5BT1 A;  2PZI A;  1E7U A;  2VYI A;  2KAT A;  3RIB A;  2XGS A;  1H2T C;  3L22 A;  2XCC A;  4GA1 A;  4ILI A;  5ARF A;  3FUE A;  4A55 A;  4DJA A;  3K9I A;  4J8F A;  2YHC A;  3VLE A;  3UPV A;  2AVP A;  3ULQ A;  1N54 A;  5JJT A;  2CHZ A;  4P29 A;  2UWJ G;  3SHF A;  3Q49 B;  1S0P A;  4KT6 B;  3IHV A;  3ZYL A;  4N5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...