3O48A

Crystal structure of fission protein fis1 from saccharomyces cerevisiae
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
129
structure length
129
Chain Sequence
DFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKEENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Mitochondria fission 1 protein
publication title The 1.75 Angstrom resolution structure of fission protein Fis1 from Saccharomyces cerevisiae reveals elusive interactions of the autoinhibitory domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3o48A01
4G25A 2QFCA 4HOTA 3CV0A 5AYWD 3TAXA 2AVPA 2KCKA 3ZN3A 3RU0A 2PZIA 2VSNA 4KBQA 2KC7A 3FP3A 5G04J 1WM5A 4BWRA 3CKCA 3ZPJA 2VGYA 1QZ2A 2XCBA 2KCVA 3QKYA 3MA5A 5KJNA 3HYMB 3QWWA 1HXIA 1WAO1 2HYZA 4XI0A 3ZHEA 2WQHA 2XGMA 4NQ0A 5FZSA 2ONDA 4J8EA 2C0LA 4G2VA 2GW1A 3S7DA 3ESKA 5C1DA 4JHRA 5BW8C 2Y4UA 3Q4AB 1W3BA 3CK8A 4WNFA 3ASHA 3MEKA 4G1TA 3CKBA 4F3VA 4HOSA 2BUGA 3SZ7A 5D0OD 3CVQA 4N5CA 4BTAA 3CVPA 4G24A 1YA0A 1KLXA 4GYWA 1FCHA 3RO3A 4UI9C 3ASFA 4H7XA 4JA7A 4CDRA 3FWVA 5M72A 5DBKA 3CK7A 1Y8MA 3Q15A 4GYYA 3PE4A 4HOQA 4N3BA 2YQ8A 3EDTB 3RJVA 2VGXB 4BT9A 3OXLA 4GZ5A 3CK9A 3MV2B 4WNEA 2WPVA 5HI7A 2FI7A 1NA3A 3S7BA 3QWPA 5FT9A 5FTPA 4BT8A 5JJ7A 3R9AB 3CEQA 3VTYA 1HZ4A 3QOUA 5HQ8A 1KT0A 3UPVA 2VYIA 5D0QD 5G05C 3ASDA 1NZNA 3E4BA 3N71A 1ZU2A 5EKQD 4N3AA 2IF4A 4ABNA 1ELRA 2FF4A 4AY6A 2XPIA 2YHCA 2V5FA 2XCCA 4APOA 1IYGA 4GA0A 4I2ZA 4U0SA 2J9QA 3S7JA 4U0UA 3TGOA 4UI9K 4GPKA 3U4TA 3LYAA 5FZQA 3CVLA 2VGXA 1B89A 4GA2A 4RG9A 3LY7A 4WUYA 3RIBA 3UUXA 5A7DB 4I17A 2LSUA 2C2LA 3GYZA 5KJLA 4GYOA 4U07A 4N39A 3LCAA 4JA9A 1XNFA 1E96B 4A1SA 3NF1A 2XGSA 2MHKA 2FEZA 3S7FA 3UQ3A 4I1AA 4CGVA 4IN3B 4J8DA 1OUVA 4N3CA 4W9RA 4LEUA 4UI9J 2LNIA 3KD7A 1KT1A 4HOUA 5ARFA 3AS8A 5BNWA 3SF4A 1QQEA 1ZBPA 2LSVA 4RG6A 4WNDA 4AIFA 3TG5A 2XEVA 4G23A 3ZGQA 2KATA 4I9CA 5LCWJ 5BT1A 3ZHEB 3TG4A 3Q49B 4XIFA 2FBNA 1TJCA 2IFUA 2VSYA 2DBAA 5CCLA 4AY5A 3AS4A 3RO2A 1P5QA 3LKUA 4GZ3A 3AS5A 3GZ2A 3LY9A 4Y6WA 2XGOA 3O48A 3PE3A 3KAEA 3ZFWA 1IHGA 3OXFA 5JJTA 2R5SA 5EX0A 4UQZA 2C0MA 4GA1A 4N2QA 5ARGA 4I9EA 2UY1B 4KXKB 5FZRA 5G04C 3KS2A 3JYSA 3ULQA 5JJ6A 3MKRA 2UWJG 4ME2A 3OXGA 2NC9A 4U0ZA 1PC2A 4J8FA 2I6HA 1NA0A 4BTBA 4AM9A 4YNDA 2E2EA 4U04A 3CVNA 5KJKA 3U3WA 2FO7A 3VTXA 5FJYA 2PQNA 4HORA 5CCMA 4NRHB 5EX3A 4Y6CA 3PDNA 3LPZA 4O6FA 4I2WA 3FFLA 3GZ1A 1HH8A 2Q7FA 3LY8A 3QDNA 2HR2A 2UY1A 3BEEA 4XI9A 4GZ6A 2PQRA 5DIZA 2VQ2A 4H7YA 4UQYA 4J0UA 2L6JA 2OOEA 4G26A 4N2SA 5CHEE 3Q5MA 5KJMA 4GCNA 2HO1A 3WXXA 4YVOA 3IEGA 5LCWC 2KCLA 5A6CA 3GW4A 4WNGA 3MV3B 3RKVA 4GCOA 4KYOB 2Y4TA 4JL0A 2P58C 1A17A 3Q47B 3URZA 2PL2A 3K9IA 4UQXA 4YVQC 4EQFA 4CGWA 1ELWA 4B94A 3ASGA 5G05J 2JLBA 3QWVA
chains in the Genus database with same CATH superfamily
4FJZA 5EYLA 3ENEA 2QFCA 2CFZA 4HOTA 3CV0A 3D9LA 4I6GA 5AYWD 3APFA 2AVPA 4U96D 1VDYA 2PZIA 2VSNA 4KBQA 2KC7A 3UT4A 3FP3A 4JHJA 1Z3XA 3LEWA 5G04J 1O1RA 2XCBA 3QKYA 3MA5A 3QWWA 3PH0C 4NQ0A 3AG4E 2C0LA 3S7DA 2ETCA 5ENTD 2Y4UA 3JXIA 3NQPA 3CK8A 2ZGGA 3MEKA 3CKBA 2QZAA 4F3VA 4GTRA 3OAWA 4PH4B 2WM9A 5D0OD 3CVQA 4JEHA 3T8MA 1TEZA 5AAOA 3V79K 4G24A 3R7RA 5AQBA 3PS6A 2QYJA 4KT6B 2WXFA 3RO3A 4UI9C 4CEMA 4JA7A 2AXZA 3MX3A 4CYMD 2ZGDA 1UJJA 4UWKA 3RRUA 3Q15A 4HOQA 1E7VA 2YQ8A 2H6IA 1TN7A 2VGXB 3NAWA 3E33A 4BT9A 3OXLA 2L9BA 4GZ5A 3ML9A 2KZTA 4HRNA 4A3VA 4WNEA 1N0RA 3PNTB 3T8KA 3MKQA 3QWPA 2F0YA 5FT9A 5FTPA 5JMND 2FULA 1HZ4A 5D2MC 1QYMA 2WQ6A 1L5JA 3UI2A 4A1GA 1HS6A 1ZU2A 3ZYQA 4N3AA 4WAFA 2IF4A 3L22A 3CQCB 5AIJA 4EPZA 1ELRA 2ZISA 5A23A 3UM1A 4FLHA 4CRWA 3JXJA 3B7BA 1IYGA 4GA0A 5KNGA 1BI8B 2J9QA 2I9CA 4U0UA 4WWNA 3LDZA 3LYAA 3JUEA 3FUFA 5FZQA 4AJWA 1DCEA 1TNBA 4YDEA 3EUVA 2WB2A 3CSTA 1JCSA 2F8XK 4HNAD 2C2LA 4GZDA 2V0PA 3DSSA 2EILE 3FTYA 3SNXA 4GYOA 3O4ZA 2CFUA 4JA9A 2GRRB 4A1SA 3NF1A 5ENRD 1SZAA 2E0IA 5EIDA 2R17C 2CG2A 4XX5A 1E90A 4CGVA 4LNBA 4IN3B 4GU5A 2GRNB 1OUVA 2YHEA 4LEUA 4G8KA 4WWPA 2CHXA 2WXIA 3PEUB 3SQVA 2WVIA 3D3MA 3AS8A 4KZCA 3SF4A 1QQEA 3RAUA 1UW4B 1ZBPA 4GTVA 1QBQA 3J5PA 4GTSA 3I4GA 3LVQE 2BF0X 4MRUA 2J49A 5BT1A 2WXHA 3NZUA 3FY4A 4C0EA 3TG4A 3AG1E 4XIFA 2FBNA 5C2YA 1K3ZD 5CCLA 3SFZA 3DWLG 1EYHA 3D9JA 1SQMA 3PZ4A 3C72A 3AS5A 4F6RD 3LY9A 3UIPC 3ZFWA 2IU1A 2X6FA 1UG3A 2C0MA 4GA1A 4N2QA 5ARGA 4I9EA 2JEKA 2XHEA 4UWGA 3E32A 3ONKA 4Q94A 5G04C 2XEHA 4BERA 5JJ6A 3EHRA 1TYQG 4I6JA 3NB2A 2WXKA 3MKRA 3HHMA 4G8LA 1RZ4A 2R59A 4ME2A 1H6PA 2KXPC 2V5QC 2RG8A 4J8FA 2P9KG 3V30A 4BTBA 1U3CA 4K0RA 3UMVA 3ZU7B 3HXFA 4GTPA 3U3WA 2VSXE 4Y6CA 4UWLA 2LXLA 5ENQD 2X6JA 3CVYA 3BEEA 4LERA 3QARA 4I43A 4OYSA 3R9MA 2XPZA 3PUJA 4F53A 3UM3A 4XE0A 3TJPA 4G26A 4CT0A 1JCQA 2OV8A 3UM0A 3SY2A 3MJWA 2XENA 2AWIA 4GCNA 2WXJA 3T5VA 4U7EB 3UKUG 2WMOA 3MV3B 3RKVA 4GCOA 4KYOB 2Y4TA 4BSZB 2P58C 5AENA 5FWQA 3WG7E 3L08A 3MYVA 3HIZA 4GTOA 3Q47B 3FH7A 3ESLA 2F37A 4RVBA 4UQXA 4J7WA 3V31A 3ZNGA 4L1BA 4C9BB 1ELWA 4B94A 4Z68A 1D8DA 1S63A 4B89A 3IBEA 3ZRHA 2LO6A 2XS8A 4EHMA 2KCKA 3RU0A 3ABLE 4DJAA 2XZDG 4NIKA 4KMOA 5KJNA 4JW1A 1IQUA 3TXMA 1WAO1 4XI0A 3PREA 3ZW3A 2XGMA 2J09A 2GW1A 3ESKA 5C1DA 1HFAA 1HO8A 2P9SG 4TV3A 4YDYA 3AJIA 3FU5A 3FUEA 3KSQA 3FUDA 4DUIA 3FTUA 1E8ZA 3SBTB 3EJNA 2XQ0A 4BTAA 1N0QA 4L9PA 3FUJA 1TNZA 1YA0A 5D66A 4HI9A 3HG0D 3RRNB 4TXQA 1OY3D 1OCZE 4E85A 2WQ7A 4CDRA 1H6KA 1IXVA 2AW6A 1JWGA 4UWFA 5CERB 1Y8MA 4Q69A 5HS0A 3EDTB 1H2VC 4F7AA 4HRLA 2WXMA 4RQIA 3CK9A 2Y3AA 2RKKA 4TXPA 4ZHBA 4J8YA 3HXBA 2NYJA 5HI7A 1NA3A 2QC9A 4EBAA 4DX1A 2HM8A 5FINA 3Q73A 4FJYA 3I4RB 2MRIA 4F1SA 3TL5A 4M7CA 3FUNA 4FP7A 3UKRG 2J4BA 5G05C 3ZXPA 4CZ2D 4GTQA 3ASDA 1NZNA 3E4BA 3N71A 2J08A 5EKQD 4U8HA 3TWSA 1Y6IA 4KVMA 1MX2A 4JEUA 3KEAA 2VTBA 2FF4A 4RSYA 2X3MA 3DBSA 2V5FA 2BKKB 3P2BA 4APOA 1UN9A 2KM4A 4I2ZA 4U0SA 3TGOA 1TNYA 3Q9UC 4K5BA 1NFIE 1TJFA 1Z3YA 3D9PA 4FC8A 4EZLA 4FULA 5LX8A 3HVEB 5AJDA 4HI8A 4B0ZA 3ULEG 4FU3A 3RIBA 5BV0A 2MOWA 2GRLA 2J4DA 1YCSB 5BXUA 2RD0A 4BSXA 3GZSA 4DX6D 4U07A 4LUNU 5ANLA 3TWTA 2XRYA 3NZSA 4HB5A 2V8SE 2NSZA 2GRQB 2GRMA 3S7FA 3UQ3A 3Q75A 3EU9A 3DEPA 4I1OB 4I1AA 1JWFA 5E75A 5FQ8A 3CHMA 4N3CA 3B7RL 2P2CP 1YMPA 1OCCE 2LNIA 3AG3E 3KD7A 3CGHA 2P9PG 2J8SD 4KVOA 1N94A 1TN6A 1MYOA 3CVVA 5BNWA 2LSVA 2IO2C 4JPSA 2R02A 5KBAA 5ANRA 2XEVA 1V55E 5T8IA 2KATA 3UTMA 3U64A 4CDMA 2WMNA 4ANWA 3QK0A 1NP7A 4AOFA 3CSFA 3W9GA 2OVFA 5CBNA 3RO2A 1P5QA 1PAQA 3B7UX 3MCXA 3V2OA 3GZ2A 4PS8A 1X81A 3ZYLA 3ZIMA 4HLLA 2B0OE 5JJTA 3PZ3A 2HE0A 4QFVA 2LAHA 4URKA 3C3OA 5E76A 3HDXA 3X2QE 1U2VG 5G55A 4DI4A 3ULQA 3NBNB 2AXVA 3P1UA 2UWJG 1HG5A 4PDXA 4ZFHA 3OXGA 3IHVA 1H2UA 5J90A 4APFA 4DLQA 4I6EA 3ZUVB 2I6HA 3PZDA 1Z5SC 3I5PA 2R05A 1FT1A 1HX8A 1KPSB 4YNDA 2DVWA 1LD7A 4MBGA 5FJYA 3Q79A 1MX6A 2PQNA 4HORA 4JXTA 3E37A 3FUKA 3ABME 3BU8A 4EBAG 4I1MA 4NRHB 4B8CB 3Q78A 2DWZA 5J08A 5T3RA 5HKPA 3LPZA 4O6FA 3RRMB 1BD8A 3I3NA 3FFLA 3GZ1A 4M3OA 1HH8A 4MS6A 2CHZA 3LY8A 4EECA 3EHNA 3MZLB 5CECB 3CHQA 2UY1A 3FTWA 3C3RA 4JC8A 2IY0C 3Q9NC 4GZ6A 5DIZA 1MZCA 4LSZE 5CRVA 4FHKA 4WWOA 4DRXE 4H7YA 1E7UA 4N5QA 4UQYA 4ATGA 5B3SE 5AQAA 4ANXA 1O1SA 4U8YD 4N2SA 1OT8A 2DYRE 2IEJA 2R2LA 5CMWA 3WXXA 4YVOA 5LCWC 1BPOA 3GW4A 3KEZA 3AU5A 4E6HA 4O60A 4XKCA 3APCA 2VJ8A 4J6IA 3ZYKA 1DCQA 4CGWA 2BKGA 3ASGA 3TWVA 5G05J 4G25A 1OXJA 4HQDA 3FU6A 3AAAC 3BUAA 3JQ0A 2DYSE 3TAXA 5BPPA 3ZN3A 4AP2A 3CHPA 4A55A 2PM6A 5BUZA 4AV7A 2IO3C 1WM5A 3CKCA 2PM7A 2VGEA 2VGYA 2EQXA 1IKND 3HYMB 3G2VA 1HXIA 2HYZA 3E34A 3J5QB 4FADA 5FZSA 2GRPB 4J8EA 3FH5A 4G2VA 3LJNA 3OTNA 3FDHA 3D9MA 1W3BA 3QAQA 4ANVA 3HXCA 4RLYA 2ZU6B 2KZTB 3D9OA 2ZXWE 5LP0A 4G1TA 3L54A 3MKQB 2L0IA 5FQ6A 2AXUA 4N5CA 3IHYA 4A3TA 4HRMB 3CVPA 3PEVB 4V3IA 2DZNA 3DSVA 2WXOA 2EIME 1RW2A 2XPYA 1AWCB 1FT2A 1N52A 1N95A 4GYWA 3DPDA 5CEDB 2VSOE 1FCHA 3ZKJA 3SI5A 4C48B 3L17A 3U9WA 3AU4A 1LTXA 3G2UA 3CK7A 5IY5E 4HVBA 4GYYA 4N3BA 4GZCA 4BX8A 2Y69E 2J07A 1XGWA 2WXPA 3PZ2A 1MX4A 1X5BA 4UUCA 3PZ1A 3S7BA 3TWQA 1SA4A 3FU0A 5JHBA 2A5UA 3ONLA 1ZB1A 3FHEA 2X6IA 4AEZC 3ZVVA 2GROB 4BT8A 2X38A 5JJ7A 2H6GA 2JABA 4CT4A 3CEQA 4TRQA 1N11A 3C5RA 1KT0A 3UPVA 2VYIA 4L7TA 1JUQA 1E8YA 2AJAA 3NOCD 4AVXA 1OWLA 2WXNA 3UXGA 4HXIA 4A63B 4B8AA 4HLEA 2YHCA 3S2AA 2ETBA 1N4RA 3S7JA 3JUIA 4UI9K 3DSXA 4TUUA 5EN5D 2OEVA 3B13A 1H0AA 2VGXA 5CBOA 1B89A 3CVWA 3AG2E 4OAVB 5A7DB 3FUMA 1DC2A 4X8QA 3GYZA 3EIQC 4HS2A 2WXQA 2Y0BG 4N39A 3LS8A 1PY1A 3LCAA 1XNFA 1E96B 4FHJA 1FPPA 1SZ9A 2MHKA 3D9HA 5HRYA 4ACKA 3DRAA 3JQ1A 1ELKA 4L2LA 4LCTA 1Z6TA 1OWMA 4BFRA 3D9IA 1SW6A 3HRAA 1KT1A 5ARFA 2XS1A 3L6AA 3CLJA 4JB8P 1HG2A 2P9UG 4RG6A 3DSUA 4WNDA 3B7SA 3LJ3A 4AIFA 1O5MA 3TG5A 4G23A 4GB9A 3CQGB 5ENSD 3ZYMA 1WG0A 3FUIA 3ZGQA 3L16A 4IULA 5LCWJ 5AQ7A 3Q49B 3VLFA 2IFUA 2VSYA 2BEDA 3IXEA 2Y1LE 3ZXSA 1MJ0A 2XGOA 3PE3A 3KAEA 1IHGA 1IQRA 3OXFA 4OVUA 1OWNA 1KZOA 4LRZA 2R5SA 4UQZA 4BETA 3RK6A 1UOHA 2PNNA 2XRZA 1N4QA 3CR3A 4U95D 4GMLA 4JVSA 2A5EA 3QC1A 3B7TA 2X6KA 3KS2A 3VLDA 3L13A 3U66A 1S64A 2V4LA 3TWXA 2A4ZA 5B1AE 2WXLA 2BTDA 4ATZD 3CIAA 4BX9A 4GTTA 3DXMG 4DLOA 4U0ZA 3APDA 1PC2A 3FH8A 1A5EA 4CCAA 1UJKA 3FTVA 4ILHB 4Q96A 4AM9A 1MHQA 5KNHD 3ZEFA 1IHBA 4GPMA 3CVNA 2FO7A 2GGFA 3VTXA 4D10C 2XEEA 1JCRA 2WXGA 1EDUA 5EX3A 4IYPA 3PDNA 1K8KG 1AP7A 4I2WA 5EILA 2EIJE 3TWUA 2Q7FA 3QDNA 2B6CA 4OAUC 5H7PA 2IONA 1WDYA 4MKTA 4TXRA 4XI9A 2MYOA 1S0PA 3V2XA 3DPYA 3ML8A 1BLXB 2PQRA 2VQ2A 4PS7A 4K5CA 4J0UA 2L6JA 2OOEA 3SFYA 5KJMA 2CG3A 5BV1A 1OCRE 3C98A 2HO1A 2V4HC 5A6CA 3EIJA 4HBDA 5JHAA 3LVRE 4WNGA 3FTSA 3SD5A 4JL0A 1A17A 1SVXA 3URZA 2PL2A 3UT8A 5ENOD 5KWDA 3TXNA 2OVBA 4YVQC 2I1JA 1N4PA 4GTMA 2JLBA 3QWVA 5FIOA 1BU9A 3BG1B 1N4SA 2KBXA 1NL4A 2ILRA 2OCCE 2P9LG 1SA5A 2P9IG 4YDWA 3FEXA 2ETAA 4GMJA 4BWRA 1HF8A 4HFGA 3ZPJA 5CRUA 1QZ2A 2KCVA 3PRZA 2OEWA 2DZOA 2IJGX 4ILGA 3ZHEA 2WQHA 2ONDA 3D9KA 4F1PA 4OVVA 4JHRA 5BW8C 3QNKA 4DX5D 4PUCA 1LD8A 3Q4AB 2H6HA 4DK5A 1FVHA 2QY7A 4WNFA 3ASHA 4EZJA 4HOSA 3IV0A 2BUGA 4UWHA 3Q7AA 3SZ7A 3CVXA 3FU3A 5BXOA 1S70B 3IKOB 2LAIA 3C3QA 1E8XA 3PUKA 1WY6A 3CHRA 3FTZA 1KLXA 2RFAA 1H2TC 1TR4A 2I1KA 4LNGA 3ASFA 4H7XA 3Q7FA 5JA4D 3FWVA 5M72A 1H19A 3CHSA 5AARA 2VTBB 1K1BA 1FVFA 5DBKA 1QNFA 4ACLA 1UN8A 3RSEG 3PE4A 2QYUA 1LF8A 4ANUA 4J8SA 3RJVA 4L23A 4U63A 2I2OA 5CEAA 2LXMA 1N54A 3L82A 1HU3A 3MV2B 2EINE 2WPVA 4U8VD 3TWRA 2FI7A 3T5XA 5EIBE 4DPRA 3UM2A 3PNLB 4JZYA 3VLEA 3R9AB 5ITZF 3LXUX 4O1OA 3VTYA 3QOUA 4BEPA 5HQ8A 4CDNA 2YINA 5D0QD 1D8EA 5LFAA 3SGHA 3KSLA 5B1BE 3FUHA 3UX4A 4XZ4A 3R7QA 3JCKC 1V54E 4K5AB 4ABNA 4LG6A 1BI7B 2WXRA 4AY6A 1MQSA 2XPIA 1EPUA 2XCCA 4NURA 3E30A 1E8WA 4GPKA 3U4TA 1TNUA 3ULYA 3SBSA 3CVLA 4GA2A 3ISMC 4RG9A 3CHOA 3LY7A 3UINC 3UT7A 5EYPF 4WUYA 4YDOA 3HXDA 4P29A 3UUXA 1H6OA 2DIWA 4I17A 2LSUA 3W9FA 2X6HA 5KJLA 2R03A 4FLBA 3EHQA 5AJLA 4TUMA 2XGSA 4DI3A 2FEZA 4FA6A 2NXPA 4JD2G 2H6FA 4J8DA 4W9RA 3DEOA 4UI9J 3G2WA 1U3DA 4HOUA 3BG0B 4LNUD 4AXHA 4ILIA 5AQ9A 2P9NG 1N9AA 3ABKE 4KZ0A 3HVEA 3ASNE 3G2TA 5AN8A 1OCOE 4I9CA 3SO8A 3ZHEB 1YYHA 4L2YA 5CMYA 4R7LA 5T4YA 4IRUA 1TJCA 2XZTG 2DBAA 3D9NA 4BY6A 4AY5A 3PVLA 3AS4A 3HXEA 4XEIG 3LKUA 3SHFA 4GZ3A 5EDSA 4Y6WA 1GW6A 3O48A 1HE8A 1NI1A 4PS3A 3TWWA 5ENNA 4GAAA 5EX0A 2IOSA 3DSWA 1TN8A 3BQOA 1D9SA 4DX2A 2FO1E 3T9KA 4EZKA 2L0TB 4XKBA 2UY1B 3DXKG 4KXKB 2F8YA 5FZRA 4G11A 2L6BA 5LOZA 3JYSA 5ENPD 3F6QA 4B93B 2DCPA 1K1AA 4K03A 2NC9A 3NOGD 4O1PA 4JHKA 3CVUA 1NA0A 3QB2A 1O1TA 3L9TA 2E2EA 4U04A 3SFXA 5KJKA 4QQIA 5KCMA 5CCMA 2IOLA 3FEYA 1INZA 4DX7D 2ZIRA 1OWOA 1DVPA 3ASOE 3EHMA 1JPLA 2HR2A 2LUHA 3B95A 5FQ4A 3DSTA 2YNQA 1OWPA 4C0MA 4BESA 2EIKE 5CHEE 3Q5MA 2CHWA 5FQ7A 3FTXA 3MGBA 3QJZA 3IEGA 2KCLA 1G3NB 1KZPA 4MLPA 1Q2ZA 3UIOC 3FULA 1DNPA 3EU5A 3G2SA 3K9IA 5G2NA 1TNOA 2IQCA 2M63A 4EQFA 1EF1C 4GMRA 2RFMA 4NACA
chains in the Genus database with same CATH topology
4FJZA 4G25A 3ENEA 2QFCA 4B89A 2CFZA 3BG1B 3FU6A 3IBEA 4HOTA 3CV0A 3D9LA 3ZRHA 4I6GA 5AYWD 2LO6A 3APFA 3JQ0A 3TAXA 2ILRA 2AVPA 5BPPA 2KCKA 3ZN3A 1VDYA 3RU0A 2PZIA 4AP2A 2VSNA 4KBQA 2KC7A 3CHPA 3FP3A 3UT4A 4A55A 4JHJA 1Z3XA 3FEXA 2PM6A 4DJAA 5BUZA 4AV7A 4GMJA 3LEWA 1WM5A 5G04J 4BWRA 1HF8A 4HFGA 3CKCA 3ZPJA 2PM7A 2VGYA 1QZ2A 2XCBA 2KCVA 3PRZA 3QKYA 4KMOA 3MA5A 2EQXA 5KJNA 3HYMB 3QWWA 3G2VA 4JW1A 2IJGX 3PH0C 1IQUA 1HXIA 1WAO1 2HYZA 4XI0A 3TXMA 3PREA 4ILGA 3ZHEA 4FADA 2WQHA 3ZW3A 2XGMA 4NQ0A 2J09A 5FZSA 2ONDA 3D9KA 4J8EA 3FH5A 2C0LA 4G2VA 2GW1A 3S7DA 3ESKA 3OTNA 5C1DA 1HFAA 1HO8A 4OVVA 3FDHA 4JHRA 5BW8C 4TV3A 3QNKA 2Y4UA 3D9MA 4PUCA 3Q4AB 1W3BA 3QAQA 4ANVA 2ZU6B 4DK5A 2KZTB 1FVHA 3FU5A 2QY7A 3NQPA 3D9OA 3CK8A 4WNFA 3ASHA 3FUEA 4EZJA 3FUDA 3MEKA 4G1TA 3CKBA 5LP0A 4F3VA 3IV0A 4HOSA 2BUGA 3FTUA 3OAWA 4PH4B 3L54A 4UWHA 3MKQB 3SZ7A 1E8ZA 3SBTB 2L0IA 2WM9A 5D0OD 5FQ6A 3CVXA 3CVQA 3EJNA 2AXUA 3FU3A 4N5CA 3IHYA 2XQ0A 4JEHA 4A3TA 3T8MA 4BTAA 3IKOB 2LAIA 3CVPA 3PEVB 1E8XA 4V3IA 3FUJA 3PUKA 2WXOA 1TEZA 1WY6A 2XPYA 4G24A 1YA0A 3R7RA 3PS6A 3CHRA 3FTZA 1KLXA 1N52A 4GYWA 3DPDA 4KT6B 2WXFA 1H2TC 2VSOE 3RRNB 1FCHA 3RO3A 2I1KA 4UI9C 4E85A 4CEMA 3ASFA 4H7XA 2WQ7A 4JA7A 4CDRA 3SI5A 2AXZA 3FWVA 3MX3A 5M72A 1H19A 3CHSA 1H6KA 3L17A 2AW6A 1JWGA 3U9WA 3AU4A 2VTBB 1UJJA 4UWKA 1FVFA 4UWFA 3G2UA 5DBKA 3CK7A 1QNFA 4ACLA 1UN8A 3RRUA 1Y8MA 4Q69A 3Q15A 4HVBA 4GYYA 3PE4A 4HOQA 4N3BA 1E7VA 4GZCA 1LF8A 2YQ8A 4ANUA 3EDTB 1H2VC 4BX8A 4F7AA 2J07A 4J8SA 3RJVA 4L23A 2VGXB 4U63A 2WXMA 4BT9A 1XGWA 2I2OA 3OXLA 2L9BA 2WXPA 3CK9A 4GZ5A 3ML9A 2KZTA 1N54A 2Y3AA 1HU3A 3MV2B 4A3VA 4WNEA 1X5BA 2WPVA 3PNTB 5HI7A 2FI7A 3T5XA 1NA3A 3S7BA 3MKQA 3FU0A 4EBAA 4DPRA 5JHBA 2A5UA 3PNLB 3ONLA 2HM8A 3QWPA 4JZYA 3FHEA 2X6IA 5FT9A 4AEZC 3ZVVA 5FTPA 3VLEA 4FJYA 2X38A 4BT8A 5JJ7A 3R9AB 3LXUX 3I4RB 2MRIA 4F1SA 2FULA 4CT4A 3TL5A 3CEQA 3VTYA 4TRQA 1HZ4A 3QOUA 3FUNA 4FP7A 5HQ8A 4CDNA 1KT0A 3UPVA 2J4BA 2YINA 2VYIA 2WQ6A 5D0QD 5G05C 1L5JA 4L7TA 1JUQA 3SGHA 5LFAA 1E8YA 3ASDA 1NZNA 3E4BA 3FUHA 3N71A 1HS6A 4A1GA 1ZU2A 3UX4A 4XZ4A 3R7QA 3JCKC 3ZYQA 2J08A 4N3AA 5EKQD 4WAFA 2IF4A 4U8HA 3L22A 3CQCB 5AIJA 4EPZA 4ABNA 1ELRA 1Y6IA 4KVMA 4JEUA 5A23A 4FLHA 4AVXA 2VTBA 4CRWA 1OWLA 2FF4A 2WXNA 2WXRA 4RSYA 2X3MA 4HXIA 4AY6A 3DBSA 1MQSA 4B8AA 2XPIA 4HLEA 1EPUA 2V5FA 2XCCA 2YHCA 3S2AA 3P2BA 4APOA 4NURA 1IYGA 1UN9A 2KM4A 4GA0A 4I2ZA 4U0SA 2J9QA 3JUIA 2I9CA 4U0UA 3S7JA 3TGOA 1E8WA 4WWNA 4UI9K 4GPKA 3LDZA 3U4TA 4TUUA 3LYAA 1TJFA 1Z3YA 3D9PA 3FUFA 4FC8A 3B13A 5FZQA 4EZLA 3SBSA 3CVLA 1H0AA 4FULA 2VGXA 5LX8A 3HVEB 1B89A 4GA2A 5AJDA 4RG9A 3CHOA 3LY7A 3UT7A 4AJWA 3CVWA 4WUYA 4B0ZA 4FU3A 3RIBA 5BV0A 2MOWA 2WB2A 4P29A 3CSTA 3UUXA 5A7DB 2DIWA 4I17A 2LSUA 2GRLA 2J4DA 3FUMA 2C2LA 3GYZA 3EIQC 4GZDA 2RD0A 4HS2A 2V0PA 2WXQA 2X6HA 4BSXA 5KJLA 3FTYA 3SNXA 3GZSA 4GYOA 4U07A 4N39A 3LS8A 1PY1A 4LUNU 3O4ZA 2CFUA 4FLBA 5ANLA 3LCAA 4JA9A 1XNFA 1E96B 4A1SA 5AJLA 2XRYA 3NZSA 3NF1A 4FHJA 2V8SE 2XGSA 4DI3A 2NSZA 1SZAA 1SZ9A 2MHKA 2E0IA 2FEZA 2GRMA 4FA6A 3S7FA 2R17C 3UQ3A 2CG2A 4XX5A 4I1OB 2NXPA 1E90A 1JWFA 4I1AA 4CGVA 5E75A 4IN3B 5FQ8A 4GU5A 4ACKA 4J8DA 1OUVA 3CHMA 4N3CA 2YHEA 4W9RA 4LEUA 4UI9J 3B7RL 3JQ1A 1ELKA 4L2LA 4LCTA 4WWPA 1Z6TA 1OWMA 2LNIA 3G2WA 2CHXA 4BFRA 1U3DA 2WXIA 3D9IA 3PEUB 2WVIA 3KD7A 1KT1A 3CGHA 3D3MA 4HOUA 3BG0B 4KVOA 5ARFA 3L6AA 3AS8A 4KZCA 3CLJA 4AXHA 5BNWA 3SF4A 3CVVA 4ILIA 1HG2A 1QQEA 1UW4B 1ZBPA 2LSVA 4RG6A 4JPSA 4WNDA 3B7SA 3LJ3A 4AIFA 3TG5A 5ANRA 2XEVA 4G23A 4GB9A 3I4GA 3LVQE 2BF0X 3CQGB 5T8IA 4MRUA 4KZ0A 3ZYMA 3HVEA 3FUIA 3ZGQA 3L16A 3G2TA 2J49A 2KATA 4I9CA 4IULA 5LCWJ 3U64A 4CDMA 2WMNA 5BT1A 4ANWA 2WXHA 3NZUA 3ZHEB 4L2YA 3FY4A 5CMYA 4R7LA 3TG4A 4C0EA 3Q49B 3QK0A 3VLFA 4XIFA 5T4YA 4IRUA 2FBNA 1TJCA 2IFUA 1NP7A 2VSYA 5C2YA 4AOFA 2DBAA 3D9NA 3CSFA 2OVFA 4BY6A 5CCLA 3SFZA 3PVLA 3AS4A 3RO2A 1EYHA 4AY5A 1P5QA 3D9JA 1SQMA 3LKUA 3SHFA 4GZ3A 1PAQA 3B7UX 3MCXA 3AS5A 3GZ2A 3LY9A 4PS8A 5EDSA 3ZYLA 3ZXSA 4Y6WA 1GW6A 2XGOA 3O48A 1HE8A 3PE3A 4PS3A 3KAEA 3ZFWA 3ZIMA 1IHGA 1IQRA 3OXFA 4OVUA 2IU1A 1OWNA 5JJTA 5ENNA 2X6FA 4GAAA 4LRZA 2R5SA 1UG3A 4UQZA 2C0MA 5EX0A 4GA1A 2IOSA 3RK6A 4QFVA 2LAHA 2XRZA 4N2QA 5ARGA 4URKA 3CR3A 4I9EA 4EZKA 2L0TB 4GMLA 5E76A 2JEKA 3HDXA 3QC1A 2XHEA 4JVSA 4XKBA 2UY1B 3B7TA 4UWGA 3ONKA 2X6KA 4KXKB 5G55A 5FZRA 4DI4A 4Q94A 4G11A 5G04C 3KS2A 5LOZA 3JYSA 3VLDA 3L13A 3ULQA 3U66A 2AXVA 2V4LA 5JJ6A 2A4ZA 4I6JA 2WXKA 3MKRA 3HHMA 3P1UA 2DCPA 2R59A 2UWJG 1HG5A 2WXLA 4ME2A 4PDXA 4K03A 3OXGA 3IHVA 1H2UA 2BTDA 3CIAA 2NC9A 4APFA 4BX9A 4DLOA 5J90A 4U0ZA 3APDA 4JHKA 1PC2A 3FH8A 2RG8A 4DLQA 4J8FA 4I6EA 4CCAA 1UJKA 2I6HA 3CVUA 1NA0A 3QB2A 3PZDA 3FTVA 4ILHB 4BTBA 1U3CA 4K0RA 4Q96A 3UMVA 4AM9A 1MHQA 3I5PA 1HX8A 3ZEFA 4YNDA 2E2EA 4U04A 3CVNA 5KJKA 3U3WA 2FO7A 2GGFA 5FJYA 3VTXA 4D10C 2PQNA 4HORA 2VSXE 5KCMA 2WXGA 4JXTA 5CCMA 2IOLA 1EDUA 3FUKA 4EBAG 3FEYA 4I1MA 4NRHB 5EX3A 4Y6CA 4B8CB 1INZA 4IYPA 3PDNA 1OWOA 1DVPA 5T3RA 5J08A 3LPZA 4O6FA 4I2WA 3RRMB 3I3NA 3FFLA 3GZ1A 4M3OA 1HH8A 3EHMA 4UWLA 2Q7FA 2CHZA 3LY8A 4MS6A 3QDNA 1JPLA 4EECA 3EHNA 3MZLB 2HR2A 3CHQA 2UY1A 3FTWA 2X6JA 2IONA 3CVYA 3BEEA 4MKTA 5FQ4A 4JC8A 3QARA 1S0PA 4I43A 4LERA 4OYSA 4XI9A 3ML8A 2XPZA 2YNQA 4GZ6A 2PQRA 5DIZA 2VQ2A 1OWPA 3PUJA 4FHKA 4WWOA 4F53A 4C0MA 4PS7A 4H7YA 1E7UA 4UQYA 4ATGA 4J0UA 2L6JA 2OOEA 4XE0A 3TJPA 4ANXA 4G26A 4N2SA 5CHEE 4CT0A 3Q5MA 2OV8A 2CHWA 5KJMA 2CG3A 3MJWA 5BV1A 2AWIA 3C98A 5CMWA 4GCNA 2HO1A 3FTXA 3MGBA 5FQ7A 3WXXA 3QJZA 4YVOA 3IEGA 5LCWC 2KCLA 1BPOA 2WXJA 3EIJA 5A6CA 5JHAA 3T5VA 3GW4A 3KEZA 3AU5A 3LVRE 4E6HA 4WNGA 2WMOA 3MV3B 3FTSA 4XKCA 3RKVA 4GCOA 3SD5A 4KYOB 2Y4TA 4JL0A 2P58C 5AENA 5FWQA 3L08A 3APCA 3MYVA 4MLPA 3HIZA 1A17A 3FULA 1DNPA 3Q47B 2VJ8A 3FH7A 4J6IA 3URZA 3G2SA 3ZYKA 2PL2A 3K9IA 5G2NA 3ESLA 3UT8A 2IQCA 4RVBA 4UQXA 2OVBA 3TXNA 2M63A 4YVQC 4L1BA 1EF1C 2I1JA 4EQFA 4CGWA 4C9BB 1ELWA 4B94A 3ASGA 5G05J 4NACA 2JLBA 3QWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G25 A;  2QFC A;  4HOT A;  3CV0 A;  5AYW D;  3TAX A;  2AVP A;  2KCK A;  3ZN3 A;  3RU0 A;  2PZI A;  2VSN A;  4KBQ A;  2KC7 A;  3FP3 A;  5G04 J;  1WM5 A;  4BWR A;  3CKC A;  3ZPJ A;  2VGY A;  1QZ2 A;  2XCB A;  2KCV A;  3QKY A;  3MA5 A;  5KJN A;  3HYM B;  3QWW A;  1HXI A;  1WAO 1;  2HYZ A;  4XI0 A;  3ZHE A;  2WQH A;  2XGM A;  4NQ0 A;  5FZS A;  2OND A;  4J8E A;  2C0L A;  4G2V A;  2GW1 A;  3S7D A;  3ESK A;  5C1D A;  4JHR A;  5BW8 C;  2Y4U A;  3Q4A B;  1W3B A;  3CK8 A;  4WNF A;  3ASH A;  3MEK A;  4G1T A;  3CKB A;  4F3V A;  4HOS A;  2BUG A;  3SZ7 A;  5D0O D;  3CVQ A;  4N5C A;  4BTA A;  3CVP A;  4G24 A;  1YA0 A;  1KLX A;  4GYW A;  1FCH A;  3RO3 A;  4UI9 C;  3ASF A;  4H7X A;  4JA7 A;  4CDR A;  3FWV A;  5M72 A;  5DBK A;  3CK7 A;  1Y8M A;  3Q15 A;  4GYY A;  3PE4 A;  4HOQ A;  4N3B A;  2YQ8 A;  3EDT B;  3RJV A;  2VGX B;  4BT9 A;  3OXL A;  4GZ5 A;  3CK9 A;  3MV2 B;  4WNE A;  2WPV A;  5HI7 A;  2FI7 A;  1NA3 A;  3S7B A;  3QWP A;  5FT9 A;  5FTP A;  4BT8 A;  5JJ7 A;  3R9A B;  3CEQ A;  3VTY A;  1HZ4 A;  3QOU A;  5HQ8 A;  1KT0 A;  3UPV A;  2VYI A;  5D0Q D;  5G05 C;  3ASD A;  1NZN A;  3E4B A;  3N71 A;  1ZU2 A;  5EKQ D;  4N3A A;  2IF4 A;  4ABN A;  1ELR A;  2FF4 A;  4AY6 A;  2XPI A;  2YHC A;  2V5F A;  2XCC A;  4APO A;  1IYG A;  4GA0 A;  4I2Z A;  4U0S A;  2J9Q A;  3S7J A;  4U0U A;  3TGO A;  4UI9 K;  4GPK A;  3U4T A;  3LYA A;  5FZQ A;  3CVL A;  2VGX A;  1B89 A;  4GA2 A;  4RG9 A;  3LY7 A;  4WUY A;  3RIB A;  3UUX A;  5A7D B;  4I17 A;  2LSU A;  2C2L A;  3GYZ A;  5KJL A;  4GYO A;  4U07 A;  4N39 A;  3LCA A;  4JA9 A;  1XNF A;  1E96 B;  4A1S A;  3NF1 A;  2XGS A;  2MHK A;  2FEZ A;  3S7F A;  3UQ3 A;  4I1A A;  4CGV A;  4IN3 B;  4J8D A;  1OUV A;  4N3C A;  4W9R A;  4LEU A;  4UI9 J;  2LNI A;  3KD7 A;  1KT1 A;  4HOU A;  5ARF A;  3AS8 A;  5BNW A;  3SF4 A;  1QQE A;  1ZBP A;  2LSV A;  4RG6 A;  4WND A;  4AIF A;  3TG5 A;  2XEV A;  4G23 A;  3ZGQ A;  2KAT A;  4I9C A;  5LCW J;  5BT1 A;  3ZHE B;  3TG4 A;  3Q49 B;  4XIF A;  2FBN A;  1TJC A;  2IFU A;  2VSY A;  2DBA A;  5CCL A;  4AY5 A;  3AS4 A;  3RO2 A;  1P5Q A;  3LKU A;  4GZ3 A;  3AS5 A;  3GZ2 A;  3LY9 A;  4Y6W A;  2XGO A;  3O48 A;  3PE3 A;  3KAE A;  3ZFW A;  1IHG A;  3OXF A;  5JJT A;  2R5S A;  5EX0 A;  4UQZ A;  2C0M A;  4GA1 A;  4N2Q A;  5ARG A;  4I9E A;  2UY1 B;  4KXK B;  5FZR A;  5G04 C;  3KS2 A;  3JYS A;  3ULQ A;  5JJ6 A;  3MKR A;  2UWJ G;  4ME2 A;  3OXG A;  2NC9 A;  4U0Z A;  1PC2 A;  4J8F A;  2I6H A;  1NA0 A;  4BTB A;  4AM9 A;  4YND A;  2E2E A;  4U04 A;  3CVN A;  5KJK A;  3U3W A;  2FO7 A;  3VTX A;  5FJY A;  2PQN A;  4HOR A;  5CCM A;  4NRH B;  5EX3 A;  4Y6C A;  3PDN A;  3LPZ A;  4O6F A;  4I2W A;  3FFL A;  3GZ1 A;  1HH8 A;  2Q7F A;  3LY8 A;  3QDN A;  2HR2 A;  2UY1 A;  3BEE A;  4XI9 A;  4GZ6 A;  2PQR A;  5DIZ A;  2VQ2 A;  4H7Y A;  4UQY A;  4J0U A;  2L6J A;  2OOE A;  4G26 A;  4N2S A;  5CHE E;  3Q5M A;  5KJM A;  4GCN A;  2HO1 A;  3WXX A;  4YVO A;  3IEG A;  5LCW C;  2KCL A;  5A6C A;  3GW4 A;  4WNG A;  3MV3 B;  3RKV A;  4GCO A;  4KYO B;  2Y4T A;  4JL0 A;  2P58 C;  1A17 A;  3Q47 B;  3URZ A;  2PL2 A;  3K9I A;  4UQX A;  4YVQ C;  4EQF A;  4CGW A;  1ELW A;  4B94 A;  3ASG A;  5G05 J;  2JLB A;  3QWV A; 
#chains in the Genus database with same CATH topology
 4FJZ A;  5EYL A;  3ENE A;  2QFC A;  2CFZ A;  4HOT A;  3CV0 A;  3D9L A;  4I6G A;  5AYW D;  3APF A;  2AVP A;  4U96 D;  1VDY A;  2PZI A;  2VSN A;  4KBQ A;  2KC7 A;  3UT4 A;  3FP3 A;  4JHJ A;  1Z3X A;  3LEW A;  5G04 J;  1O1R A;  2XCB A;  3QKY A;  3MA5 A;  3QWW A;  3PH0 C;  4NQ0 A;  3AG4 E;  2C0L A;  3S7D A;  2ETC A;  5ENT D;  2Y4U A;  3JXI A;  3NQP A;  3CK8 A;  2ZGG A;  3MEK A;  3CKB A;  2QZA A;  4F3V A;  4GTR A;  3OAW A;  4PH4 B;  2WM9 A;  5D0O D;  3CVQ A;  4JEH A;  3T8M A;  1TEZ A;  5AAO A;  3V79 K;  4G24 A;  3R7R A;  5AQB A;  3PS6 A;  2QYJ A;  4KT6 B;  2WXF A;  3RO3 A;  4UI9 C;  4CEM A;  4JA7 A;  2AXZ A;  3MX3 A;  4CYM D;  2ZGD A;  1UJJ A;  4UWK A;  3RRU A;  3Q15 A;  4HOQ A;  1E7V A;  2YQ8 A;  2H6I A;  1TN7 A;  2VGX B;  3NAW A;  3E33 A;  4BT9 A;  3OXL A;  2L9B A;  4GZ5 A;  3ML9 A;  2KZT A;  4HRN A;  4A3V A;  4WNE A;  1N0R A;  3PNT B;  3T8K A;  3MKQ A;  3QWP A;  2F0Y A;  5FT9 A;  5FTP A;  5JMN D;  2FUL A;  1HZ4 A;  5D2M C;  1QYM A;  2WQ6 A;  1L5J A;  3UI2 A;  4A1G A;  1HS6 A;  1ZU2 A;  3ZYQ A;  4N3A A;  4WAF A;  2IF4 A;  3L22 A;  3CQC B;  5AIJ A;  4EPZ A;  1ELR A;  2ZIS A;  5A23 A;  3UM1 A;  4FLH A;  4CRW A;  3JXJ A;  3B7B A;  1IYG A;  4GA0 A;  5KNG A;  1BI8 B;  2J9Q A;  2I9C A;  4U0U A;  4WWN A;  3LDZ A;  3LYA A;  3JUE A;  3FUF A;  5FZQ A;  4AJW A;  1DCE A;  1TNB A;  4YDE A;  3EUV A;  2WB2 A;  3CST A;  1JCS A;  2F8X K;  4HNA D;  2C2L A;  4GZD A;  2V0P A;  3DSS A;  2EIL E;  3FTY A;  3SNX A;  4GYO A;  3O4Z A;  2CFU A;  4JA9 A;  2GRR B;  4A1S A;  3NF1 A;  5ENR D;  1SZA A;  2E0I A;  5EID A;  2R17 C;  2CG2 A;  4XX5 A;  1E90 A;  4CGV A;  4LNB A;  4IN3 B;  4GU5 A;  2GRN B;  1OUV A;  2YHE A;  4LEU A;  4G8K A;  4WWP A;  2CHX A;  2WXI A;  3PEU B;  3SQV A;  2WVI A;  3D3M A;  3AS8 A;  4KZC A;  3SF4 A;  1QQE A;  3RAU A;  1UW4 B;  1ZBP A;  4GTV A;  1QBQ A;  3J5P A;  4GTS A;  3I4G A;  3LVQ E;  2BF0 X;  4MRU A;  2J49 A;  5BT1 A;  2WXH A;  3NZU A;  3FY4 A;  4C0E A;  3TG4 A;  3AG1 E;  4XIF A;  2FBN A;  5C2Y A;  1K3Z D;  5CCL A;  3SFZ A;  3DWL G;  1EYH A;  3D9J A;  1SQM A;  3PZ4 A;  3C72 A;  3AS5 A;  4F6R D;  3LY9 A;  3UIP C;  3ZFW A;  2IU1 A;  2X6F A;  1UG3 A;  2C0M A;  4GA1 A;  4N2Q A;  5ARG A;  4I9E A;  2JEK A;  2XHE A;  4UWG A;  3E32 A;  3ONK A;  4Q94 A;  5G04 C;  2XEH A;  4BER A;  5JJ6 A;  3EHR A;  1TYQ G;  4I6J A;  3NB2 A;  2WXK A;  3MKR A;  3HHM A;  4G8L A;  1RZ4 A;  2R59 A;  4ME2 A;  1H6P A;  2KXP C;  2V5Q C;  2RG8 A;  4J8F A;  2P9K G;  3V30 A;  4BTB A;  1U3C A;  4K0R A;  3UMV A;  3ZU7 B;  3HXF A;  4GTP A;  3U3W A;  2VSX E;  4Y6C A;  4UWL A;  2LXL A;  5ENQ D;  2X6J A;  3CVY A;  3BEE A;  4LER A;  3QAR A;  4I43 A;  4OYS A;  3R9M A;  2XPZ A;  3PUJ A;  4F53 A;  3UM3 A;  4XE0 A;  3TJP A;  4G26 A;  4CT0 A;  1JCQ A;  2OV8 A;  3UM0 A;  3SY2 A;  3MJW A;  2XEN A;  2AWI A;  4GCN A;  2WXJ A;  3T5V A;  4U7E B;  3UKU G;  2WMO A;  3MV3 B;  3RKV A;  4GCO A;  4KYO B;  2Y4T A;  4BSZ B;  2P58 C;  5AEN A;  5FWQ A;  3WG7 E;  3L08 A;  3MYV A;  3HIZ A;  4GTO A;  3Q47 B;  3FH7 A;  3ESL A;  2F37 A;  4RVB A;  4UQX A;  4J7W A;  3V31 A;  3ZNG A;  4L1B A;  4C9B B;  1ELW A;  4B94 A;  4Z68 A;  1D8D A;  1S63 A;  4B89 A;  3IBE A;  3ZRH A;  2LO6 A;  2XS8 A;  4EHM A;  2KCK A;  3RU0 A;  3ABL E;  4DJA A;  2XZD G;  4NIK A;  4KMO A;  5KJN A;  4JW1 A;  1IQU A;  3TXM A;  1WAO 1;  4XI0 A;  3PRE A;  3ZW3 A;  2XGM A;  2J09 A;  2GW1 A;  3ESK A;  5C1D A;  1HFA A;  1HO8 A;  2P9S G;  4TV3 A;  4YDY A;  3AJI A;  3FU5 A;  3FUE A;  3KSQ A;  3FUD A;  4DUI A;  3FTU A;  1E8Z A;  3SBT B;  3EJN A;  2XQ0 A;  4BTA A;  1N0Q A;  4L9P A;  3FUJ A;  1TNZ A;  1YA0 A;  5D66 A;  4HI9 A;  3HG0 D;  3RRN B;  4TXQ A;  1OY3 D;  1OCZ E;  4E85 A;  2WQ7 A;  4CDR A;  1H6K A;  1IXV A;  2AW6 A;  1JWG A;  4UWF A;  5CER B;  1Y8M A;  4Q69 A;  5HS0 A;  3EDT B;  1H2V C;  4F7A A;  4HRL A;  2WXM A;  4RQI A;  3CK9 A;  2Y3A A;  2RKK A;  4TXP A;  4ZHB A;  4J8Y A;  3HXB A;  2NYJ A;  5HI7 A;  1NA3 A;  2QC9 A;  4EBA A;  4DX1 A;  2HM8 A;  5FIN A;  3Q73 A;  4FJY A;  3I4R B;  2MRI A;  4F1S A;  3TL5 A;  4M7C A;  3FUN A;  4FP7 A;  3UKR G;  2J4B A;  5G05 C;  3ZXP A;  4CZ2 D;  4GTQ A;  3ASD A;  1NZN A;  3E4B A;  3N71 A;  2J08 A;  5EKQ D;  4U8H A;  3TWS A;  1Y6I A;  4KVM A;  1MX2 A;  4JEU A;  3KEA A;  2VTB A;  2FF4 A;  4RSY A;  2X3M A;  3DBS A;  2V5F A;  2BKK B;  3P2B A;  4APO A;  1UN9 A;  2KM4 A;  4I2Z A;  4U0S A;  3TGO A;  1TNY A;  3Q9U C;  4K5B A;  1NFI E;  1TJF A;  1Z3Y A;  3D9P A;  4FC8 A;  4EZL A;  4FUL A;  5LX8 A;  3HVE B;  5AJD A;  4HI8 A;  4B0Z A;  3ULE G;  4FU3 A;  3RIB A;  5BV0 A;  2MOW A;  2GRL A;  2J4D A;  1YCS B;  5BXU A;  2RD0 A;  4BSX A;  3GZS A;  4DX6 D;  4U07 A;  4LUN U;  5ANL A;  3TWT A;  2XRY A;  3NZS A;  4HB5 A;  2V8S E;  2NSZ A;  2GRQ B;  2GRM A;  3S7F A;  3UQ3 A;  3Q75 A;  3EU9 A;  3DEP A;  4I1O B;  4I1A A;  1JWF A;  5E75 A;  5FQ8 A;  3CHM A;  4N3C A;  3B7R L;  2P2C P;  1YMP A;  1OCC E;  2LNI A;  3AG3 E;  3KD7 A;  3CGH A;  2P9P G;  2J8S D;  4KVO A;  1N94 A;  1TN6 A;  1MYO A;  3CVV A;  5BNW A;  2LSV A;  2IO2 C;  4JPS A;  2R02 A;  5KBA A;  5ANR A;  2XEV A;  1V55 E;  5T8I A;  2KAT A;  3UTM A;  3U64 A;  4CDM A;  2WMN A;  4ANW A;  3QK0 A;  1NP7 A;  4AOF A;  3CSF A;  3W9G A;  2OVF A;  5CBN A;  3RO2 A;  1P5Q A;  1PAQ A;  3B7U X;  3MCX A;  3V2O A;  3GZ2 A;  4PS8 A;  1X81 A;  3ZYL A;  3ZIM A;  4HLL A;  2B0O E;  5JJT A;  3PZ3 A;  2HE0 A;  4QFV A;  2LAH A;  4URK A;  3C3O A;  5E76 A;  3HDX A;  3X2Q E;  1U2V G;  5G55 A;  4DI4 A;  3ULQ A;  3NBN B;  2AXV A;  3P1U A;  2UWJ G;  1HG5 A;  4PDX A;  4ZFH A;  3OXG A;  3IHV A;  1H2U A;  5J90 A;  4APF A;  4DLQ A;  4I6E A;  3ZUV B;  2I6H A;  3PZD A;  1Z5S C;  3I5P A;  2R05 A;  1FT1 A;  1HX8 A;  1KPS B;  4YND A;  2DVW A;  1LD7 A;  4MBG A;  5FJY A;  3Q79 A;  1MX6 A;  2PQN A;  4HOR A;  4JXT A;  3E37 A;  3FUK A;  3ABM E;  3BU8 A;  4EBA G;  4I1M A;  4NRH B;  4B8C B;  3Q78 A;  2DWZ A;  5J08 A;  5T3R A;  5HKP A;  3LPZ A;  4O6F A;  3RRM B;  1BD8 A;  3I3N A;  3FFL A;  3GZ1 A;  4M3O A;  1HH8 A;  4MS6 A;  2CHZ A;  3LY8 A;  4EEC A;  3EHN A;  3MZL B;  5CEC B;  3CHQ A;  2UY1 A;  3FTW A;  3C3R A;  4JC8 A;  2IY0 C;  3Q9N C;  4GZ6 A;  5DIZ A;  1MZC A;  4LSZ E;  5CRV A;  4FHK A;  4WWO A;  4DRX E;  4H7Y A;  1E7U A;  4N5Q A;  4UQY A;  4ATG A;  5B3S E;  5AQA A;  4ANX A;  1O1S A;  4U8Y D;  4N2S A;  1OT8 A;  2DYR E;  2IEJ A;  2R2L A;  5CMW A;  3WXX A;  4YVO A;  5LCW C;  1BPO A;  3GW4 A;  3KEZ A;  3AU5 A;  4E6H A;  4O60 A;  4XKC A;  3APC A;  2VJ8 A;  4J6I A;  3ZYK A;  1DCQ A;  4CGW A;  2BKG A;  3ASG A;  3TWV A;  5G05 J;  4G25 A;  1OXJ A;  4HQD A;  3FU6 A;  3AAA C;  3BUA A;  3JQ0 A;  2DYS E;  3TAX A;  5BPP A;  3ZN3 A;  4AP2 A;  3CHP A;  4A55 A;  2PM6 A;  5BUZ A;  4AV7 A;  2IO3 C;  1WM5 A;  3CKC A;  2PM7 A;  2VGE A;  2VGY A;  2EQX A;  1IKN D;  3HYM B;  3G2V A;  1HXI A;  2HYZ A;  3E34 A;  3J5Q B;  4FAD A;  5FZS A;  2GRP B;  4J8E A;  3FH5 A;  4G2V A;  3LJN A;  3OTN A;  3FDH A;  3D9M A;  1W3B A;  3QAQ A;  4ANV A;  3HXC A;  4RLY A;  2ZU6 B;  2KZT B;  3D9O A;  2ZXW E;  5LP0 A;  4G1T A;  3L54 A;  3MKQ B;  2L0I A;  5FQ6 A;  2AXU A;  4N5C A;  3IHY A;  4A3T A;  4HRM B;  3CVP A;  3PEV B;  4V3I A;  2DZN A;  3DSV A;  2WXO A;  2EIM E;  1RW2 A;  2XPY A;  1AWC B;  1FT2 A;  1N52 A;  1N95 A;  4GYW A;  3DPD A;  5CED B;  2VSO E;  1FCH A;  3ZKJ A;  3SI5 A;  4C48 B;  3L17 A;  3U9W A;  3AU4 A;  1LTX A;  3G2U A;  3CK7 A;  5IY5 E;  4HVB A;  4GYY A;  4N3B A;  4GZC A;  4BX8 A;  2Y69 E;  2J07 A;  1XGW A;  2WXP A;  3PZ2 A;  1MX4 A;  1X5B A;  4UUC A;  3PZ1 A;  3S7B A;  3TWQ A;  1SA4 A;  3FU0 A;  5JHB A;  2A5U A;  3ONL A;  1ZB1 A;  3FHE A;  2X6I A;  4AEZ C;  3ZVV A;  2GRO B;  4BT8 A;  2X38 A;  5JJ7 A;  2H6G A;  2JAB A;  4CT4 A;  3CEQ A;  4TRQ A;  1N11 A;  3C5R A;  1KT0 A;  3UPV A;  2VYI A;  4L7T A;  1JUQ A;  1E8Y A;  2AJA A;  3NOC D;  4AVX A;  1OWL A;  2WXN A;  3UXG A;  4HXI A;  4A63 B;  4B8A A;  4HLE A;  2YHC A;  3S2A A;  2ETB A;  1N4R A;  3S7J A;  3JUI A;  4UI9 K;  3DSX A;  4TUU A;  5EN5 D;  2OEV A;  3B13 A;  1H0A A;  2VGX A;  5CBO A;  1B89 A;  3CVW A;  3AG2 E;  4OAV B;  5A7D B;  3FUM A;  1DC2 A;  4X8Q A;  3GYZ A;  3EIQ C;  4HS2 A;  2WXQ A;  2Y0B G;  4N39 A;  3LS8 A;  1PY1 A;  3LCA A;  1XNF A;  1E96 B;  4FHJ A;  1FPP A;  1SZ9 A;  2MHK A;  3D9H A;  5HRY A;  4ACK A;  3DRA A;  3JQ1 A;  1ELK A;  4L2L A;  4LCT A;  1Z6T A;  1OWM A;  4BFR A;  3D9I A;  1SW6 A;  3HRA A;  1KT1 A;  5ARF A;  2XS1 A;  3L6A A;  3CLJ A;  4JB8 P;  1HG2 A;  2P9U G;  4RG6 A;  3DSU A;  4WND A;  3B7S A;  3LJ3 A;  4AIF A;  1O5M A;  3TG5 A;  4G23 A;  4GB9 A;  3CQG B;  5ENS D;  3ZYM A;  1WG0 A;  3FUI A;  3ZGQ A;  3L16 A;  4IUL A;  5LCW J;  5AQ7 A;  3Q49 B;  3VLF A;  2IFU A;  2VSY A;  2BED A;  3IXE A;  2Y1L E;  3ZXS A;  1MJ0 A;  2XGO A;  3PE3 A;  3KAE A;  1IHG A;  1IQR A;  3OXF A;  4OVU A;  1OWN A;  1KZO A;  4LRZ A;  2R5S A;  4UQZ A;  4BET A;  3RK6 A;  1UOH A;  2PNN A;  2XRZ A;  1N4Q A;  3CR3 A;  4U95 D;  4GML A;  4JVS A;  2A5E A;  3QC1 A;  3B7T A;  2X6K A;  3KS2 A;  3VLD A;  3L13 A;  3U66 A;  1S64 A;  2V4L A;  3TWX A;  2A4Z A;  5B1A E;  2WXL A;  2BTD A;  4ATZ D;  3CIA A;  4BX9 A;  4GTT A;  3DXM G;  4DLO A;  4U0Z A;  3APD A;  1PC2 A;  3FH8 A;  1A5E A;  4CCA A;  1UJK A;  3FTV A;  4ILH B;  4Q96 A;  4AM9 A;  1MHQ A;  5KNH D;  3ZEF A;  1IHB A;  4GPM A;  3CVN A;  2FO7 A;  2GGF A;  3VTX A;  4D10 C;  2XEE A;  1JCR A;  2WXG A;  1EDU A;  5EX3 A;  4IYP A;  3PDN A;  1K8K G;  1AP7 A;  4I2W A;  5EIL A;  2EIJ E;  3TWU A;  2Q7F A;  3QDN A;  2B6C A;  4OAU C;  5H7P A;  2ION A;  1WDY A;  4MKT A;  4TXR A;  4XI9 A;  2MYO A;  1S0P A;  3V2X A;  3DPY A;  3ML8 A;  1BLX B;  2PQR A;  2VQ2 A;  4PS7 A;  4K5C A;  4J0U A;  2L6J A;  2OOE A;  3SFY A;  5KJM A;  2CG3 A;  5BV1 A;  1OCR E;  3C98 A;  2HO1 A;  2V4H C;  5A6C A;  3EIJ A;  4HBD A;  5JHA A;  3LVR E;  4WNG A;  3FTS A;  3SD5 A;  4JL0 A;  1A17 A;  1SVX A;  3URZ A;  2PL2 A;  3UT8 A;  5ENO D;  5KWD A;  3TXN A;  2OVB A;  4YVQ C;  2I1J A;  1N4P A;  4GTM A;  2JLB A;  3QWV A;  5FIO A;  1BU9 A;  3BG1 B;  1N4S A;  2KBX A;  1NL4 A;  2ILR A;  2OCC E;  2P9L G;  1SA5 A;  2P9I G;  4YDW A;  3FEX A;  2ETA A;  4GMJ A;  4BWR A;  1HF8 A;  4HFG A;  3ZPJ A;  5CRU A;  1QZ2 A;  2KCV A;  3PRZ A;  2OEW A;  2DZO A;  2IJG X;  4ILG A;  3ZHE A;  2WQH A;  2OND A;  3D9K A;  4F1P A;  4OVV A;  4JHR A;  5BW8 C;  3QNK A;  4DX5 D;  4PUC A;  1LD8 A;  3Q4A B;  2H6H A;  4DK5 A;  1FVH A;  2QY7 A;  4WNF A;  3ASH A;  4EZJ A;  4HOS A;  3IV0 A;  2BUG A;  4UWH A;  3Q7A A;  3SZ7 A;  3CVX A;  3FU3 A;  5BXO A;  1S70 B;  3IKO B;  2LAI A;  3C3Q A;  1E8X A;  3PUK A;  1WY6 A;  3CHR A;  3FTZ A;  1KLX A;  2RFA A;  1H2T C;  1TR4 A;  2I1K A;  4LNG A;  3ASF A;  4H7X A;  3Q7F A;  5JA4 D;  3FWV A;  5M72 A;  1H19 A;  3CHS A;  5AAR A;  2VTB B;  1K1B A;  1FVF A;  5DBK A;  1QNF A;  4ACL A;  1UN8 A;  3RSE G;  3PE4 A;  2QYU A;  1LF8 A;  4ANU A;  4J8S A;  3RJV A;  4L23 A;  4U63 A;  2I2O A;  5CEA A;  2LXM A;  1N54 A;  3L82 A;  1HU3 A;  3MV2 B;  2EIN E;  2WPV A;  4U8V D;  3TWR A;  2FI7 A;  3T5X A;  5EIB E;  4DPR A;  3UM2 A;  3PNL B;  4JZY A;  3VLE A;  3R9A B;  5ITZ F;  3LXU X;  4O1O A;  3VTY A;  3QOU A;  4BEP A;  5HQ8 A;  4CDN A;  2YIN A;  5D0Q D;  1D8E A;  5LFA A;  3SGH A;  3KSL A;  5B1B E;  3FUH A;  3UX4 A;  4XZ4 A;  3R7Q A;  3JCK C;  1V54 E;  4K5A B;  4ABN A;  4LG6 A;  1BI7 B;  2WXR A;  4AY6 A;  1MQS A;  2XPI A;  1EPU A;  2XCC A;  4NUR A;  3E30 A;  1E8W A;  4GPK A;  3U4T A;  1TNU A;  3ULY A;  3SBS A;  3CVL A;  4GA2 A;  3ISM C;  4RG9 A;  3CHO A;  3LY7 A;  3UIN C;  3UT7 A;  5EYP F;  4WUY A;  4YDO A;  3HXD A;  4P29 A;  3UUX A;  1H6O A;  2DIW A;  4I17 A;  2LSU A;  3W9F A;  2X6H A;  5KJL A;  2R03 A;  4FLB A;  3EHQ A;  5AJL A;  4TUM A;  2XGS A;  4DI3 A;  2FEZ A;  4FA6 A;  2NXP A;  4JD2 G;  2H6F A;  4J8D A;  4W9R A;  3DEO A;  4UI9 J;  3G2W A;  1U3D A;  4HOU A;  3BG0 B;  4LNU D;  4AXH A;  4ILI A;  5AQ9 A;  2P9N G;  1N9A A;  3ABK E;  4KZ0 A;  3HVE A;  3ASN E;  3G2T A;  5AN8 A;  1OCO E;  4I9C A;  3SO8 A;  3ZHE B;  1YYH A;  4L2Y A;  5CMY A;  4R7L A;  5T4Y A;  4IRU A;  1TJC A;  2XZT G;  2DBA A;  3D9N A;  4BY6 A;  4AY5 A;  3PVL A;  3AS4 A;  3HXE A;  4XEI G;  3LKU A;  3SHF A;  4GZ3 A;  5EDS A;  4Y6W A;  1GW6 A;  3O48 A;  1HE8 A;  1NI1 A;  4PS3 A;  3TWW A;  5ENN A;  4GAA A;  5EX0 A;  2IOS A;  3DSW A;  1TN8 A;  3BQO A;  1D9S A;  4DX2 A;  2FO1 E;  3T9K A;  4EZK A;  2L0T B;  4XKB A;  2UY1 B;  3DXK G;  4KXK B;  2F8Y A;  5FZR A;  4G11 A;  2L6B A;  5LOZ A;  3JYS A;  5ENP D;  3F6Q A;  4B93 B;  2DCP A;  1K1A A;  4K03 A;  2NC9 A;  3NOG D;  4O1P A;  4JHK A;  3CVU A;  1NA0 A;  3QB2 A;  1O1T A;  3L9T A;  2E2E A;  4U04 A;  3SFX A;  5KJK A;  4QQI A;  5KCM A;  5CCM A;  2IOL A;  3FEY A;  1INZ A;  4DX7 D;  2ZIR A;  1OWO A;  1DVP A;  3ASO E;  3EHM A;  1JPL A;  2HR2 A;  2LUH A;  3B95 A;  5FQ4 A;  3DST A;  2YNQ A;  1OWP A;  4C0M A;  4BES A;  2EIK E;  5CHE E;  3Q5M A;  2CHW A;  5FQ7 A;  3FTX A;  3MGB A;  3QJZ A;  3IEG A;  2KCL A;  1G3N B;  1KZP A;  4MLP A;  1Q2Z A;  3UIO C;  3FUL A;  1DNP A;  3EU5 A;  3G2S A;  3K9I A;  5G2N A;  1TNO A;  2IQC A;  2M63 A;  4EQF A;  1EF1 C;  4GMR A;  2RFM A;  4NAC A; 
#chains in the Genus database with same CATH homology
 4FJZ A;  4G25 A;  3ENE A;  2QFC A;  4B89 A;  2CFZ A;  3BG1 B;  3FU6 A;  3IBE A;  4HOT A;  3CV0 A;  3D9L A;  3ZRH A;  4I6G A;  5AYW D;  2LO6 A;  3APF A;  3JQ0 A;  3TAX A;  2ILR A;  2AVP A;  5BPP A;  2KCK A;  3ZN3 A;  1VDY A;  3RU0 A;  2PZI A;  4AP2 A;  2VSN A;  4KBQ A;  2KC7 A;  3CHP A;  3FP3 A;  3UT4 A;  4A55 A;  4JHJ A;  1Z3X A;  3FEX A;  2PM6 A;  4DJA A;  5BUZ A;  4AV7 A;  4GMJ A;  3LEW A;  1WM5 A;  5G04 J;  4BWR A;  1HF8 A;  4HFG A;  3CKC A;  3ZPJ A;  2PM7 A;  2VGY A;  1QZ2 A;  2XCB A;  2KCV A;  3PRZ A;  3QKY A;  4KMO A;  3MA5 A;  2EQX A;  5KJN A;  3HYM B;  3QWW A;  3G2V A;  4JW1 A;  2IJG X;  3PH0 C;  1IQU A;  1HXI A;  1WAO 1;  2HYZ A;  4XI0 A;  3TXM A;  3PRE A;  4ILG A;  3ZHE A;  4FAD A;  2WQH A;  3ZW3 A;  2XGM A;  4NQ0 A;  2J09 A;  5FZS A;  2OND A;  3D9K A;  4J8E A;  3FH5 A;  2C0L A;  4G2V A;  2GW1 A;  3S7D A;  3ESK A;  3OTN A;  5C1D A;  1HFA A;  1HO8 A;  4OVV A;  3FDH A;  4JHR A;  5BW8 C;  4TV3 A;  3QNK A;  2Y4U A;  3D9M A;  4PUC A;  3Q4A B;  1W3B A;  3QAQ A;  4ANV A;  2ZU6 B;  4DK5 A;  2KZT B;  1FVH A;  3FU5 A;  2QY7 A;  3NQP A;  3D9O A;  3CK8 A;  4WNF A;  3ASH A;  3FUE A;  4EZJ A;  3FUD A;  3MEK A;  4G1T A;  3CKB A;  5LP0 A;  4F3V A;  3IV0 A;  4HOS A;  2BUG A;  3FTU A;  3OAW A;  4PH4 B;  3L54 A;  4UWH A;  3MKQ B;  3SZ7 A;  1E8Z A;  3SBT B;  2L0I A;  2WM9 A;  5D0O D;  5FQ6 A;  3CVX A;  3CVQ A;  3EJN A;  2AXU A;  3FU3 A;  4N5C A;  3IHY A;  2XQ0 A;  4JEH A;  4A3T A;  3T8M A;  4BTA A;  3IKO B;  2LAI A;  3CVP A;  3PEV B;  1E8X A;  4V3I A;  3FUJ A;  3PUK A;  2WXO A;  1TEZ A;  1WY6 A;  2XPY A;  4G24 A;  1YA0 A;  3R7R A;  3PS6 A;  3CHR A;  3FTZ A;  1KLX A;  1N52 A;  4GYW A;  3DPD A;  4KT6 B;  2WXF A;  1H2T C;  2VSO E;  3RRN B;  1FCH A;  3RO3 A;  2I1K A;  4UI9 C;  4E85 A;  4CEM A;  3ASF A;  4H7X A;  2WQ7 A;  4JA7 A;  4CDR A;  3SI5 A;  2AXZ A;  3FWV A;  3MX3 A;  5M72 A;  1H19 A;  3CHS A;  1H6K A;  3L17 A;  2AW6 A;  1JWG A;  3U9W A;  3AU4 A;  2VTB B;  1UJJ A;  4UWK A;  1FVF A;  4UWF A;  3G2U A;  5DBK A;  3CK7 A;  1QNF A;  4ACL A;  1UN8 A;  3RRU A;  1Y8M A;  4Q69 A;  3Q15 A;  4HVB A;  4GYY A;  3PE4 A;  4HOQ A;  4N3B A;  1E7V A;  4GZC A;  1LF8 A;  2YQ8 A;  4ANU A;  3EDT B;  1H2V C;  4BX8 A;  4F7A A;  2J07 A;  4J8S A;  3RJV A;  4L23 A;  2VGX B;  4U63 A;  2WXM A;  4BT9 A;  1XGW A;  2I2O A;  3OXL A;  2L9B A;  2WXP A;  3CK9 A;  4GZ5 A;  3ML9 A;  2KZT A;  1N54 A;  2Y3A A;  1HU3 A;  3MV2 B;  4A3V A;  4WNE A;  1X5B A;  2WPV A;  3PNT B;  5HI7 A;  2FI7 A;  3T5X A;  1NA3 A;  3S7B A;  3MKQ A;  3FU0 A;  4EBA A;  4DPR A;  5JHB A;  2A5U A;  3PNL B;  3ONL A;  2HM8 A;  3QWP A;  4JZY A;  3FHE A;  2X6I A;  5FT9 A;  4AEZ C;  3ZVV A;  5FTP A;  3VLE A;  4FJY A;  2X38 A;  4BT8 A;  5JJ7 A;  3R9A B;  3LXU X;  3I4R B;  2MRI A;  4F1S A;  2FUL A;  4CT4 A;  3TL5 A;  3CEQ A;  3VTY A;  4TRQ A;  1HZ4 A;  3QOU A;  3FUN A;  4FP7 A;  5HQ8 A;  4CDN A;  1KT0 A;  3UPV A;  2J4B A;  2YIN A;  2VYI A;  2WQ6 A;  5D0Q D;  5G05 C;  1L5J A;  4L7T A;  1JUQ A;  3SGH A;  5LFA A;  1E8Y A;  3ASD A;  1NZN A;  3E4B A;  3FUH A;  3N71 A;  1HS6 A;  4A1G A;  1ZU2 A;  3UX4 A;  4XZ4 A;  3R7Q A;  3JCK C;  3ZYQ A;  2J08 A;  4N3A A;  5EKQ D;  4WAF A;  2IF4 A;  4U8H A;  3L22 A;  3CQC B;  5AIJ A;  4EPZ A;  4ABN A;  1ELR A;  1Y6I A;  4KVM A;  4JEU A;  5A23 A;  4FLH A;  4AVX A;  2VTB A;  4CRW A;  1OWL A;  2FF4 A;  2WXN A;  2WXR A;  4RSY A;  2X3M A;  4HXI A;  4AY6 A;  3DBS A;  1MQS A;  4B8A A;  2XPI A;  4HLE A;  1EPU A;  2V5F A;  2XCC A;  2YHC A;  3S2A A;  3P2B A;  4APO A;  4NUR A;  1IYG A;  1UN9 A;  2KM4 A;  4GA0 A;  4I2Z A;  4U0S A;  2J9Q A;  3JUI A;  2I9C A;  4U0U A;  3S7J A;  3TGO A;  1E8W A;  4WWN A;  4UI9 K;  4GPK A;  3LDZ A;  3U4T A;  4TUU A;  3LYA A;  1TJF A;  1Z3Y A;  3D9P A;  3FUF A;  4FC8 A;  3B13 A;  5FZQ A;  4EZL A;  3SBS A;  3CVL A;  1H0A A;  4FUL A;  2VGX A;  5LX8 A;  3HVE B;  1B89 A;  4GA2 A;  5AJD A;  4RG9 A;  3CHO A;  3LY7 A;  3UT7 A;  4AJW A;  3CVW A;  4WUY A;  4B0Z A;  4FU3 A;  3RIB A;  5BV0 A;  2MOW A;  2WB2 A;  4P29 A;  3CST A;  3UUX A;  5A7D B;  2DIW A;  4I17 A;  2LSU A;  2GRL A;  2J4D A;  3FUM A;  2C2L A;  3GYZ A;  3EIQ C;  4GZD A;  2RD0 A;  4HS2 A;  2V0P A;  2WXQ A;  2X6H A;  4BSX A;  5KJL A;  3FTY A;  3SNX A;  3GZS A;  4GYO A;  4U07 A;  4N39 A;  3LS8 A;  1PY1 A;  4LUN U;  3O4Z A;  2CFU A;  4FLB A;  5ANL A;  3LCA A;  4JA9 A;  1XNF A;  1E96 B;  4A1S A;  5AJL A;  2XRY A;  3NZS A;  3NF1 A;  4FHJ A;  2V8S E;  2XGS A;  4DI3 A;  2NSZ A;  1SZA A;  1SZ9 A;  2MHK A;  2E0I A;  2FEZ A;  2GRM A;  4FA6 A;  3S7F A;  2R17 C;  3UQ3 A;  2CG2 A;  4XX5 A;  4I1O B;  2NXP A;  1E90 A;  1JWF A;  4I1A A;  4CGV A;  5E75 A;  4IN3 B;  5FQ8 A;  4GU5 A;  4ACK A;  4J8D A;  1OUV A;  3CHM A;  4N3C A;  2YHE A;  4W9R A;  4LEU A;  4UI9 J;  3B7R L;  3JQ1 A;  1ELK A;  4L2L A;  4LCT A;  4WWP A;  1Z6T A;  1OWM A;  2LNI A;  3G2W A;  2CHX A;  4BFR A;  1U3D A;  2WXI A;  3D9I A;  3PEU B;  2WVI A;  3KD7 A;  1KT1 A;  3CGH A;  3D3M A;  4HOU A;  3BG0 B;  4KVO A;  5ARF A;  3L6A A;  3AS8 A;  4KZC A;  3CLJ A;  4AXH A;  5BNW A;  3SF4 A;  3CVV A;  4ILI A;  1HG2 A;  1QQE A;  1UW4 B;  1ZBP A;  2LSV A;  4RG6 A;  4JPS A;  4WND A;  3B7S A;  3LJ3 A;  4AIF A;  3TG5 A;  5ANR A;  2XEV A;  4G23 A;  4GB9 A;  3I4G A;  3LVQ E;  2BF0 X;  3CQG B;  5T8I A;  4MRU A;  4KZ0 A;  3ZYM A;  3HVE A;  3FUI A;  3ZGQ A;  3L16 A;  3G2T A;  2J49 A;  2KAT A;  4I9C A;  4IUL A;  5LCW J;  3U64 A;  4CDM A;  2WMN A;  5BT1 A;  4ANW A;  2WXH A;  3NZU A;  3ZHE B;  4L2Y A;  3FY4 A;  5CMY A;  4R7L A;  3TG4 A;  4C0E A;  3Q49 B;  3QK0 A;  3VLF A;  4XIF A;  5T4Y A;  4IRU A;  2FBN A;  1TJC A;  2IFU A;  1NP7 A;  2VSY A;  5C2Y A;  4AOF A;  2DBA A;  3D9N A;  3CSF A;  2OVF A;  4BY6 A;  5CCL A;  3SFZ A;  3PVL A;  3AS4 A;  3RO2 A;  1EYH A;  4AY5 A;  1P5Q A;  3D9J A;  1SQM A;  3LKU A;  3SHF A;  4GZ3 A;  1PAQ A;  3B7U X;  3MCX A;  3AS5 A;  3GZ2 A;  3LY9 A;  4PS8 A;  5EDS A;  3ZYL A;  3ZXS A;  4Y6W A;  1GW6 A;  2XGO A;  3O48 A;  1HE8 A;  3PE3 A;  4PS3 A;  3KAE A;  3ZFW A;  3ZIM A;  1IHG A;  1IQR A;  3OXF A;  4OVU A;  2IU1 A;  1OWN A;  5JJT A;  5ENN A;  2X6F A;  4GAA A;  4LRZ A;  2R5S A;  1UG3 A;  4UQZ A;  2C0M A;  5EX0 A;  4GA1 A;  2IOS A;  3RK6 A;  4QFV A;  2LAH A;  2XRZ A;  4N2Q A;  5ARG A;  4URK A;  3CR3 A;  4I9E A;  4EZK A;  2L0T B;  4GML A;  5E76 A;  2JEK A;  3HDX A;  3QC1 A;  2XHE A;  4JVS A;  4XKB A;  2UY1 B;  3B7T A;  4UWG A;  3ONK A;  2X6K A;  4KXK B;  5G55 A;  5FZR A;  4DI4 A;  4Q94 A;  4G11 A;  5G04 C;  3KS2 A;  5LOZ A;  3JYS A;  3VLD A;  3L13 A;  3ULQ A;  3U66 A;  2AXV A;  2V4L A;  5JJ6 A;  2A4Z A;  4I6J A;  2WXK A;  3MKR A;  3HHM A;  3P1U A;  2DCP A;  2R59 A;  2UWJ G;  1HG5 A;  2WXL A;  4ME2 A;  4PDX A;  4K03 A;  3OXG A;  3IHV A;  1H2U A;  2BTD A;  3CIA A;  2NC9 A;  4APF A;  4BX9 A;  4DLO A;  5J90 A;  4U0Z A;  3APD A;  4JHK A;  1PC2 A;  3FH8 A;  2RG8 A;  4DLQ A;  4J8F A;  4I6E A;  4CCA A;  1UJK A;  2I6H A;  3CVU A;  1NA0 A;  3QB2 A;  3PZD A;  3FTV A;  4ILH B;  4BTB A;  1U3C A;  4K0R A;  4Q96 A;  3UMV A;  4AM9 A;  1MHQ A;  3I5P A;  1HX8 A;  3ZEF A;  4YND A;  2E2E A;  4U04 A;  3CVN A;  5KJK A;  3U3W A;  2FO7 A;  2GGF A;  5FJY A;  3VTX A;  4D10 C;  2PQN A;  4HOR A;  2VSX E;  5KCM A;  2WXG A;  4JXT A;  5CCM A;  2IOL A;  1EDU A;  3FUK A;  4EBA G;  3FEY A;  4I1M A;  4NRH B;  5EX3 A;  4Y6C A;  4B8C B;  1INZ A;  4IYP A;  3PDN A;  1OWO A;  1DVP A;  5T3R A;  5J08 A;  3LPZ A;  4O6F A;  4I2W A;  3RRM B;  3I3N A;  3FFL A;  3GZ1 A;  4M3O A;  1HH8 A;  3EHM A;  4UWL A;  2Q7F A;  2CHZ A;  3LY8 A;  4MS6 A;  3QDN A;  1JPL A;  4EEC A;  3EHN A;  3MZL B;  2HR2 A;  3CHQ A;  2UY1 A;  3FTW A;  2X6J A;  2ION A;  3CVY A;  3BEE A;  4MKT A;  5FQ4 A;  4JC8 A;  3QAR A;  1S0P A;  4I43 A;  4LER A;  4OYS A;  4XI9 A;  3ML8 A;  2XPZ A;  2YNQ A;  4GZ6 A;  2PQR A;  5DIZ A;  2VQ2 A;  1OWP A;  3PUJ A;  4FHK A;  4WWO A;  4F53 A;  4C0M A;  4PS7 A;  4H7Y A;  1E7U A;  4UQY A;  4ATG A;  4J0U A;  2L6J A;  2OOE A;  4XE0 A;  3TJP A;  4ANX A;  4G26 A;  4N2S A;  5CHE E;  4CT0 A;  3Q5M A;  2OV8 A;  2CHW A;  5KJM A;  2CG3 A;  3MJW A;  5BV1 A;  2AWI A;  3C98 A;  5CMW A;  4GCN A;  2HO1 A;  3FTX A;  3MGB A;  5FQ7 A;  3WXX A;  3QJZ A;  4YVO A;  3IEG A;  5LCW C;  2KCL A;  1BPO A;  2WXJ A;  3EIJ A;  5A6C A;  5JHA A;  3T5V A;  3GW4 A;  3KEZ A;  3AU5 A;  3LVR E;  4E6H A;  4WNG A;  2WMO A;  3MV3 B;  3FTS A;  4XKC A;  3RKV A;  4GCO A;  3SD5 A;  4KYO B;  2Y4T A;  4JL0 A;  2P58 C;  5AEN A;  5FWQ A;  3L08 A;  3APC A;  3MYV A;  4MLP A;  3HIZ A;  1A17 A;  3FUL A;  1DNP A;  3Q47 B;  2VJ8 A;  3FH7 A;  4J6I A;  3URZ A;  3G2S A;  3ZYK A;  2PL2 A;  3K9I A;  5G2N A;  3ESL A;  3UT8 A;  2IQC A;  4RVB A;  4UQX A;  2OVB A;  3TXN A;  2M63 A;  4YVQ C;  4L1B A;  1EF1 C;  2I1J A;  4EQF A;  4CGW A;  4C9B B;  1ELW A;  4B94 A;  3ASG A;  5G05 J;  4NAC A;  2JLB A;  3QWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...