3O48A

Crystal structure of fission protein fis1 from saccharomyces cerevisiae
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
129
structure length
129
Chain Sequence
DFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKEENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondria fission 1 protein
publication title The 1.75 Angstrom resolution structure of fission protein Fis1 from Saccharomyces cerevisiae reveals elusive interactions of the autoinhibitory domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 51
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14852 Fis1_TPR_N Fis1 N-terminal tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3o48A01
3UQ3A 5G04C 3ZHEB 4YVQC 2FF4A 3MA5A 4BT9A 2MHKA 3S7JA 4I2WA 2UY1B 3S7DA 4GCOA 5D0OD 4Y6CA 5ARFA 1PC2A 3QDNA 5JJ7A 4HORA 1IHGA 4H7YA 2FI7A 4RG9A 4J8FA 2VSYA 1YA0A 4YVOA 4A1SA 3PE3A 3Q5MA 4J0UA 3LCAA 3FFLA 3R9AB 4CGVA 5G05J 4N3CA 4J8EA 3KD7A 3PE4A 1HH8A 4I2ZA 5KJNA 2JLBA 5ARGA 4AIFA 5FT9A 3TGOA 4WNFA 2J9QA 2AVPA 1HXIA 4CDRA 4NQ0A 2IFUA 2FEZA 1WM5A 4WNGA 4AY5A 5M72A 4WUYA 4CGWA 4GPKA 4N2QA 2WPVA 4G1TA 3FWVA 5EKQD 4GYOA 2PL2A 1ZU2A 4U04A 3AS5A 1NA0A 4I9EA 1OUVA 1NA3A 4H7XA 2P58C 5JJTA 5LCWJ 3URZA 3LKUA 5FTPA 3QWWA 3ZPJA 5CCMA 5HI7A 4U0UA 2PZIA 3Q49B 2OOEA 1ZBPA 5A6CA 2C2LA 5FZRA 4YNDA 1P5QA 3CV0A 4HOQA 4BT8A 4NRHB 2VYIA 3RKVA 5A7DB 5BW8C 2XPIA 4G25A 1NZNA 3QWPA 3AS8A 2E2EA 2XGOA 3UUXA 1FCHA 4GCNA 3GZ2A 2Y4UA 4KXKB 2LSVA 3S7FA 2KCLA 2XGSA 1E96B 3QKYA 3MV3B 3KAEA 1QZ2A 2HYZA 2WQHA 3CVNA 2XCCA 1ELWA 2PQRA 3QOUA 2ONDA 2FBNA 5LCWC 2Q7FA 3LYAA 3O48A 4JA9A 3HYMB 2LSUA 3WXXA 3AS4A 4GA0A 2C0LA 2YHCA 3PDNA 3U3WA 3E4BA 3GW4A 3MEKA 3TAXA 2C0MA 3VTYA 4I1AA 5FJYA 3NF1A 4N3AA 2PQNA 2VGXA 1A17A 2VSNA 3OXGA 2QFCA 1B89A 4UQXA 4XIFA 3SF4A 3QWVA 3LPZA 4W9RA 2UWJG 1IYGA 2YQ8A 2V5FA 4GYWA 2BUGA 3BEEA 4LEUA 5G04J 1TJCA 1KLXA 5FZQA 4G26A 3K9IA 1HZ4A 5FZSA 3RIBA 5G05C 5BT1A 1KT1A 3RU0A 3TG4A 3ASGA 1W3BA 5JJ6A 2VGYA 3UPVA 2I6HA 3CK9A 4GZ5A 4GZ3A 4JHRA 5KJMA 4UQYA 2DBAA 4APOA 4I9CA 3ESKA 4I17A 4G24A 3EDTB 4GZ6A 5CHEE 4U0SA 2R5SA 5KJKA 4AY6A 4IN3B 4HOUA 2KCKA 3ASHA 5AYWD 4UQZA 2XGMA 3OXFA 4B94A 4UI9K 4J8DA 4AM9A 1Y8MA 4ABNA 5D0QD 3Q47B 3CK8A 3ULQA 3RO3A 3SZ7A 3LY8A 3CVQA 5DIZA 4F3VA 2XEVA 3LY7A 3N71A 2VGXB 3CEQA 2KC7A 3ZHEA 3KS2A 4XI9A 5C1DA 3ASFA 4N5CA 3ASDA 4GYYA 3CVLA 2UY1A 4ME2A 3OXLA 4JA7A 4Y6WA 3GZ1A 1WAO1 5DBKA 4UI9J 5EX3A 4KYOB 5HQ8A 4EQFA 3VTXA 2KATA 3U4TA 3IEGA 2XCBA 4GA1A 2LNIA 2IF4A 3JYSA 4XI0A 3TG5A 3ZN3A 4JL0A 4O6FA 4N3BA 4RG6A 4BTBA 5KJLA 4KBQA 3ZGQA 3LY9A 4G23A 5CCLA 3S7BA 4U07A 2Y4TA 1XNFA 4HOTA 3MV2B 4WNDA 3CKCA 2NC9A 5BNWA 3FP3A 5EX0A 1KT0A 3RO2A 4HOSA 3CKBA 4GA2A 3Q15A 3CK7A 3RJVA 3CVPA 2VQ2A 2L6JA 3Q4AB 3MKRA 4N2SA 2HO1A 4G2VA 2FO7A 3ZFWA 3GYZA 4N39A 4UI9C 1QQEA 2KCVA 2HR2A 4BTAA 2GW1A 4U0ZA 4BWRA 1ELRA 4WNEA
chains in the Genus database with same CATH superfamily
2WXPA 5G04C 3ZRHA 4BT9A 1KZOA 3I4GA 3MYVA 1TNYA 3S7JA 4TUUA 3B13A 5BXOA 1FVFA 5D0OD 4N5QA 5JJ7A 4HORA 1D8DA 2RG8A 4K0RA 5FIOA 4B93B 1EYHA 5E76A 2P9IG 2MYOA 2GGFA 2WXIA 2R2LA 4C0EA 4AIFA 5FT9A 5JHAA 3KSQA 3TGOA 2J9QA 2OVFA 2WXFA 4BEPA 1O1TA 4MRUA 3FH7A 4Q69A 1SZ9A 3FTYA 5G2NA 4GPKA 4XX5A 2LXLA 2P9LG 3AJIA 4U8VD 3VLDA 1WY6A 3Q7FA 2ZXWE 3B7TA 3PZDA 1JCRA 4H7XA 4KT6B 2OVBA 5FTPA 3ZPJA 3FDHA 3JUIA 3ASOE 4UWKA 1ZBPA 5FINA 1N9AA 2JABA 2Y0BG 5CBOA 3ZYQA 5JHBA 2BTDA 4NRHB 3KEZA 4I43A 4U8YD 3TXMA 1Z3YA 4FADA 2E2EA 2BF0X 2XGOA 2IOSA 4U95D 2Y4UA 2DCPA 4YDOA 4OVUA 3CVYA 4DX2A 2IQCA 2XGSA 4HI9A 3T5XA 2WQHA 2I1JA 3ONLA 2AXZA 1X5BA 3CVNA 2XCCA 2XS1A 2PQRA 3QOUA 3HXFA 3U64A 4OAUC 2X6FA 5KNGA 1N11A 3B7BA 2XHEA 1UW4B 2NXPA 4DX7D 3TWVA 5AJDA 1MJ0A 5B1BE 2YHCA 3V31A 3E4BA 1U2VG 5FJYA 5LP0A 3ZUVB 3V79K 1S64A 1QBQA 5LOZA 5A23A 1N0QA 1Q2ZA 4O1PA 4JVSA 4ACKA 2PQNA 4HFGA 2VSNA 4XEIG 3ML8A 2P2CP 2GRPB 4C9BB 3Q79A 2DVWA 4BERA 2QY7A 3BUAA 5AN8A 3QJZA 3SGHA 1DNPA 3CGHA 5G04J 5AQBA 2VSOE 4QFVA 2B0OE 4B8CB 3UT8A 4G26A 3EUVA 3RIBA 1FVHA 2ETCA 5BT1A 2CHWA 4JHJA 1IHBA 1TNUA 4TRQA 4RSYA 4AP2A 5JJ6A 3ZIMA 4NACA 3DRAA 3G2TA 3IBEA 4YDEA 3DBSA 3CSFA 5KJMA 4OAVB 2LUHA 2DBAA 3ESKA 1UOHA 5CHEE 2P9KG 3PREA 2IOLA 4U0SA 2WXOA 3LS8A 1TN6A 2AXUA 4XKCA 5AYWD 3MJWA 3OXFA 4EBAG 3JCKC 1Z5SC 3NBNB 4KVMA 4F1PA 4ILHB 3RO3A 4CT0A 3E32A 5DIZA 2XEVA 2WXNA 3DEPA 2IO2C 1TN7A 2KM4A 2KC7A 4U7EB 3AAAC 3P2BA 4LG6A 5ENOD 3ASDA 3JQ1A 3DXKG 3C5RA 4GYYA 5G55A 3OXLA 4LRZA 3UM2A 2GRLA 3PEVB 4EZLA 2XPZA 2GRRB 3GZ1A 2F8XK 4CZ2D 3U9WA 3FH5A 2XEEA 4KYOB 5EX3A 2VGEA 2ZGGA 4CEMA 5HQ8A 1YYHA 3IXEA 2XCBA 2V0PA 2LNIA 4GTOA 2J08A 1JPLA 5CEAA 2YHEA 3DSXA 3TG5A 3ONKA 1TNZA 2MRIA 4CCAA 4RG6A 5KJLA 3ZGQA 4E6HA 1D9SA 4U07A 3UM1A 3B7UX 2OV8A 4IYPA 4WNDA 2NC9A 2QZAA 5EX0A 4MS6A 5ENRD 4KZCA 1S70B 5KCMA 2R03A 5FQ4A 4EHMA 2L6JA 3UI2A 4PUCA 4TUMA 4I1OB 2I2OA 3ZFWA 2H6FA 2KCVA 3EHNA 4BTAA 1N4RA 5LX8A 2GW1A 3TWSA 1MYOA 1HX8A 1ELRA 2DYSE 3LJ3A 4D10C 2R59A 3C3QA 1INZA 4EBAA 4YVQC 3PZ2A 2X6JA 3MA5A 1OCRE 3CHQA 4CRWA 2J49A 5CRVA 4DUIA 1AWCB 4Y6CA 1PC2A 3QDNA 3B7RL 1HU3A 4KMOA 1IHGA 3DSWA 4J8FA 2VSYA 2WQ6A 3O4ZA 3PE3A 3LCAA 3R9AB 4UWLA 3MZLB 3EIQC 5T8IA 2XQ0A 4I2ZA 4XKBA 2JLBA 3FUHA 3ULEG 4L1BA 4FJZA 1HXIA 2P9UG 3NZUA 3X2QE 1VDYA 2IFUA 4XZ4A 3ZXSA 2YINA 4JB8P 5AENA 4X8QA 2WPVA 3FH8A 1JWFA 5EKQD 4ANUA 3PVLA 3V2OA 1JCQA 1UN9A 4L9PA 2GRQB 2PL2A 3MKQB 1OUVA 4F6RD 2KZTB 3UINC 3FTSA 4JC8A 4JW1A 4P29A 3ZYMA 1Y6IA 2XEHA 3EHMA 2DWZA 2A4ZA 3R7QA 3W9GA 2PZIA 2OOEA 3Q49B 3JXIA 3QB2A 1MQSA 5FZRA 1OXJA 3CV0A 3Q7AA 4BT8A 1PAQA 4O60A 2VYIA 2VJ8A 3HXDA 4MLPA 2XPIA 1BI8B 3AS8A 3LVRE 1DCQA 2B6CA 3DWLG 3UUXA 1FCHA 3NZSA 4GCNA 4TV3A 4FHKA 2V5QC 2LSVA 2WXQA 1S63A 1YCSB 4K5CA 4J7WA 2NYJA 3QKYA 3MV3B 3HVEA 1QZ2A 1MZCA 4GTRA 4U63A 3ULYA 2BKKB 2FBNA 3FTVA 3IHVA 5LCWC 5J08A 2ETBA 1K8KG 3D9MA 3I5PA 3CSTA 3O48A 4PS7A 1SW6A 3WXXA 1E8WA 5BXUA 3PRZA 2NSZA 1HFAA 3GW4A 5AARA 2C0MA 2L0TB 5ANRA 3PZ4A 3RK6A 3DSVA 2CG2A 3T5VA 2VGXA 3UIPC 3V30A 4UWGA 4A1GA 4FHJA 4FLBA 2QFCA 4AEZC 3FTXA 1OWMA 4LERA 4XIFA 1TNBA 5FWQA 2VTBB 1UN8A 2UWJG 3SNXA 2YQ8A 3RSEG 5T4YA 2BUGA 1TJFA 5ENNA 1TN8A 3FTUA 1TJCA 3TWQA 3LDZA 3QNKA 4WWPA 1KLXA 3LJNA 4F7AA 4YDWA 2IJGX 2DYRE 1SZAA 1HZ4A 3VLEA 3FUIA 5FZSA 5G05C 2GRNB 3FEXA 4BSXA 3E34A 2E0IA 5AQ7A 5ENTD 3UPVA 1KZPA 1LTXA 5KNHD 3DXMG 4UQYA 4I9CA 3FUEA 3Q75A 1ELKA 3MKQA 1HG2A 5EYLA 5KJKA 3MX3A 1OCCE 2WXKA 3FU6A 3RRMB 1JCSA 4ANWA 4UI9K 4CT4A 4EZJA 2A5UA 2I1KA 3CK8A 3ULQA 3T8KA 2XPYA 3LY8A 4HRNA 2QYJA 4F3VA 4B8AA 5H7PA 1RW2A 4ILGA 2WVIA 2PM7A 3ESLA 3UT4A 5HRYA 3TL5A 3SQVA 4L2LA 3UMVA 4IRUA 5CBNA 3NQPA 2JEKA 1O1SA 4ME2A 3LEWA 3MCXA 2X6IA 3DSSA 5D2MC 3FU0A 2KBXA 3IKOB 1RZ4A 4GAAA 2XRYA 3TWXA 1WAO1 5DBKA 4UI9J 4BETA 4ZHBA 2FO1E 3PNTB 2F0YA 4EQFA 2LAHA 5FQ8A 5EIBE 3U4TA 2OEVA 4A63B 5C2YA 3FUNA 3ZXPA 4XI0A 3ZN3A 3SD5A 4O6FA 4C0MA 4N3BA 4U8HA 2YNQA 3LY9A 5CCLA 3TWWA 3S7BA 2Y4TA 1XNFA 4HOTA 1D8EA 4L23A 2X6HA 5BNWA 4GTMA 2Y1LE 1EDUA 1MX4A 2DZOA 4HOSA 3CKBA 3TXNA 4GA2A 4FC8A 2QYUA 3Q4AB 4GU5A 3MKRA 3QAQA 4G2VA 1ZB1A 2EIKE 4M3OA 5CMYA 4Q96A 5FQ7A 1MHQA 4U0ZA 4BWRA 4K5BA 5AQ9A 5B3SE 3ZHEB 3Q73A 4YDYA 2FF4A 1H6KA 4KVOA 1U3DA 4PDXA 1A5EA 2QC9A 3R9MA 2UY1B 3SO8A 5CECB 3S7DA 4TXQA 4B89A 4GCOA 1Z3XA 5ARFA 3CHMA 1JUQA 4H7YA 1N94A 3J5QB 3L22A 4BX9A 2M63A 3ABKE 1E8XA 4JHKA 1YA0A 4A1SA 3CHSA 4ANVA 3QC1A 3FFLA 4CGVA 5G05J 4N3CA 4LSZE 4KZ0A 3KD7A 2IO3C 1HH8A 3PE4A 4IULA 2X3MA 4HLLA 2CFZA 4DX1A 1N4QA 5HKPA 2EINE 3EHQA 4NQ0A 5ITZF 3PUJA 3FUKA 3ZNGA 2AJAA 2OEWA 2V4LA 4WNGA 3FUFA 4RQIA 5M72A 1LD7A 1QYMA 4CGWA 2WMNA 4N2QA 3DPDA 1AP7A 1UJJA 4GTTA 4NIKA 3UM3A 4ANXA 4DI4A 4FU3A 1ZU2A 1IQRA 3UM0A 4U04A 3AS5A 2P58C 2WXRA 3FU5A 1UG3A 3ABLE 3Q78A 1WG0A 3LKUA 2XRZA 1U3CA 4R7LA 4TXRA 4U0UA 2CHXA 3LVQE 1H2TC 2C2LA 3FEYA 4RVBA 4FJYA 3FULA 3SFZA 3G2UA 1N0RA 1BPOA 3AU4A 1TR4A 5BV1A 3PZ1A 5A7DB 3S2AA 4G25A 1NZNA 4FA6A 1EPUA 4LUNU 4K03A 1OY3D 3SFXA 4HB5A 1NFIE 4BFRA 2CFUA 4HNAD 3DSTA 4GMLA 4A55A 2KCLA 4GZDA 3UKRG 2MOWA 3BG0B 3KAEA 3HXCA 2HYZA 3OAWA 4LCTA 2A5EA 5D66A 5AJLA 1ELWA 4DX5D 2ONDA 3U66A 3OTNA 4DLOA 2Q7FA 3HDXA 2WXLA 3L82A 4JA9A 1LD8A 3NOGD 3D9OA 3GZSA 2LSUA 3AG4E 1SA5A 3UT7A 4GA0A 4PH4B 4J8SA 3PDNA 3U3WA 3F6QA 2WMOA 2RKKA 3C3OA 3MEKA 3FU3A 4I1AA 3EIJA 1E8YA 4GTVA 4F1SA 1K3ZD 2WXJA 4AJWA 1H2VC 2EQXA 4U96D 4MBGA 3T9KA 2J8SD 4HRLA 3OXGA 4UQXA 1OWLA 3SFYA 3G2SA 2CG3A 2ZU6B 4DK5A 3QWVA 3L08A 4W9RA 2CHZA 4DRXE 1KPSB 3L9TA 4JEHA 4BSZB 2AXVA 4G8LA 4LNUD 4I6EA 2V5FA 4GYWA 3AG3E 3BEEA 4DX6D 5CERB 4HLEA 4BY6A 1DC2A 1L5JA 3K9IA 3KSLA 5AQAA 1FT2A 3PH0C 2AW6A 1W3BA 3CK9A 5EILA 4GZ3A 4JHRA 2J4BA 3AG2E 3Q9UC 1TNOA 3BQOA 3HG0D 4G24A 3EDTB 4GZ6A 2FULA 4PS8A 3CVUA 3ML9A 4V3IA 4JXTA 5BUZA 1TYQG 4I6JA 3HXBA 5J90A 1PY1A 3ASHA 1TEZA 2J07A 1O1RA 2XGMA 5HS0A 3UX4A 2L0IA 1S0PA 3CLJA 3HRAA 4B94A 4J6IA 1Y8MA 4ABNA 3FHEA 3CQCB 1X81A 2DIWA 1E8ZA 3D9PA 2I9CA 3SZ7A 2X38A 4PS3A 4M7CA 3APFA 4A3VA 4HXIA 3L17A 3NB2A 4I6GA 2WB2A 3CHOA 1H19A 3KS2A 4XI9A 1NL4A 5C1DA 3ASFA 4N5CA 3D9NA 4HRMB 3CVLA 1UJKA 4GTQA 2HM8A 4Y6WA 3CVVA 3DEOA 4LNGA 4C48B 2J09A 4DJAA 1V54E 3TWTA 3CVXA 5FQ6A 1IQUA 2ZISA 1G3NB 3KEAA 4ZFHA 2BKGA 2KATA 5JA4D 5ANLA 1H6PA 3IEGA 4GA1A 4QQIA 2IF4A 2P9SG 3JYSA 2L6BA 3D3MA 3JUEA 5EN5D 2EIJE 3IHYA 4BTBA 1XGWA 4G23A 2ETAA 2P9NG 1HS6A 3C72A 3PEUB 3TWRA 4O1OA 1KT0A 4G8KA 3FUJA 3Q15A 4G11A 2GROB 3CK7A 3RRNB 3RJVA 1FPPA 5AAOA 3FTWA 2KZTA 4ILIA 4N39A 1MX2A 4CDMA 4HBDA 5T3RA 5CMWA 3MGBA 1QQEA 2BEDA 2HR2A 3SY2A 2F8YA 3AG1E 3CQGB 4WNEA 4B0ZA 4APFA 3UQ3A 5AIJA 2GRMA 2MHKA 4CDNA 4F53A 4I1MA 3L16A 1BLXB 1N4PA 4I2WA 3SHFA 2HE0A 2RFAA 5LFAA 5B1AE 4A3TA 2IEJA 1E7VA 5BPPA 2ZIRA 3ENEA 4GPMA 2FI7A 4RG9A 4UUCA 3TWUA 5ENSD 2VSXE 4ATGA 4AOFA 4HS2A 4YVOA 2IONA 3Q5MA 4J0UA 3LXUX 4GZCA 1Z6TA 3NAWA 3CIAA 4J8EA 3HIZA 1H2UA 3RRUA 2OCCE 5KJNA 5CRUA 1K1BA 2XZDG 4DI3A 5ARGA 3WG7E 3EJNA 4WNFA 5CEDB 3C98A 4MKTA 1IXVA 2AVPA 1E90A 4CDRA 1MX6A 4K5AB 4GTSA 3QK0A 1H0AA 1WM5A 2FEZA 1WDYA 3ISMC 4AY5A 1BI7B 4WUYA 2H6HA 3CHPA 3CVWA 1YMPA 3W9FA 3CHRA 4G1TA 3ZVVA 3FWVA 1HE8A 4J8YA 2LXMA 4GYOA 4FLHA 2V4HC 3ZEFA 1DCEA 4JPSA 4XE0A 4BESA 1NA0A 4I9EA 1OWOA 1NA3A 3SBTB 5JJTA 3CR3A 1HF8A 5LCWJ 4EPZA 3URZA 3QWWA 4LNBA 1N4SA 5CCMA 3EU5A 5HI7A 2VTBA 5A6CA 1IKND 4YNDA 1P5QA 2LAIA 2PM6A 4HOQA 2P9PG 3BG1B 5EIDA 3RKVA 5BW8C 4L2YA 3QWPA 2EIME 3D9IA 2XENA 2AWIA 3D9JA 1HG5A 2XS8A 2RFMA 2R02A 1OWNA 2IU1A 3GZ2A 4WWOA 2RD0A 4KXKB 2IY0C 3FUDA 5E75A 3S7FA 1E96B 3C3RA 2EILE 3FY4A 4HQDA 2L9BA 3PS6A 3RAUA 3D9LA 3E33A 3FTZA 4E85A 1OWPA 4GB9A 3D9HA 4JEUA 1GW6A 1NI1A 4Z68A 3UIOC 4L7TA 2PNNA 3LYAA 4CYMD 5ENPD 3HYMB 3AS4A 2X6KA 2C0LA 3L13A 3AU5A 2H6GA 3V2XA 4GTPA 3TAXA 3VTYA 1BD8A 3NF1A 4JZYA 3SBSA 2DZNA 4EZKA 4N3AA 1H6OA 3Q9NC 1N95A 1SQMA 2F37A 4HI8A 3R7RA 2LO6A 1O5MA 3NOCD 1A17A 5EYPF 3UKUG 3FUMA 4HVBA 1B89A 3SF4A 3LPZA 3E30A 1IYGA 4WAFA 3HXEA 5KBAA 3ZU7B 3EU9A 1NP7A 3ABME 4JD2G 4RLYA 4LEUA 4EECA 5FZQA 4FULA 2Y69E 1OCZE 3D9KA 1KT1A 3RU0A 1N54A 5KWDA 3B7SA 3T8MA 3TG4A 3ASGA 2XZTG 2VGYA 2I6HA 4GZ5A 1FT1A 4WWNA 1LF8A 2R17C 4Q94A 5ENQD 4APOA 1DVPA 4I17A 3HVEB 3DPYA 3IV0A 4BX8A 2R5SA 3L54A 3JQ0A 3BU8A 4ATZD 4AY6A 4IN3B 4HOUA 2H6IA 2KCKA 3HHMA 4UQZA 3I4RB 1QNFA 1OT8A 4J8DA 4AM9A 5D0QD 3Q47B 1E7UA 3CVQA 3PZ3A 1EF1C 3ASNE 1SVXA 3LY7A 3N71A 2VGXB 3SI5A 3CEQA 1K1AA 4GMRA 3TJPA 3ZHEA 1OCOE 3DSUA 1JWGA 3ZKJA 4NURA 4DPRA 2UY1A 5JMND 3APDA 4JA7A 2WXHA 2Y3AA 1HO8A 2ZGDA 2WXMA 4DLQA 4FP7A 2WXGA 4AVXA 3P1UA 1N52A 2WQ7A 4URKA 4UWHA 3EHRA 1SA4A 2KXPC 4AXHA 3VTXA 2ILRA 4OYSA 3I3NA 3QARA 5IY5E 3B95A 4JL0A 2R05A 4TXPA 2J4DA 4KBQA 3L6AA 3APCA 5BV0A 3MV2B 3CKCA 3E37A 3FP3A 3PNLB 4AV7A 3RO2A 3VLFA 3J5PA 1V55E 4GMJA 3PUKA 3JXJA 3CVPA 2VQ2A 2V8SE 3UXGA 4N2SA 3UTMA 4OVVA 2HO1A 5EDSA 2FO7A 3G2VA 3ZYLA 3GYZA 4UI9C 4ACLA 2WM9A 3G2WA 1BU9A 3ZYKA 4UWFA 3ZW3A
chains in the Genus database with same CATH topology
3UQ3A 5AIJA 2WXPA 5G04C 3ZRHA 1INZA 3ZHEB 4EBAA 2GRMA 4YVQC 2FF4A 2X6JA 3MA5A 1H6KA 4BT9A 2MHKA 4CDNA 4KVOA 3I4GA 4F53A 3CHQA 1U3DA 3MYVA 4PDXA 4I1MA 4CRWA 3L16A 2J49A 3S7JA 4I2WA 3SHFA 2UY1B 4TUUA 5LFAA 3B13A 3S7DA 4A3TA 1E7VA 1FVFA 4GCOA 4B89A 5BPPA 5D0OD 4Y6CA 1Z3XA 5ARFA 3UT8A 1PC2A 1JUQA 3CHMA 3ENEA 3QDNA 3B7RL 5JJ7A 1HU3A 4HORA 4KMOA 1IHGA 4H7YA 2FI7A 3L22A 4RG9A 4BX9A 2M63A 2VSXE 2RG8A 4J8FA 1E8XA 4JHKA 4HS2A 2VSYA 4K0RA 4ATGA 4AOFA 2WQ6A 1YA0A 3O4ZA 4YVOA 4A1SA 3PE3A 3CHSA 2IONA 3Q5MA 1EYHA 4J0UA 3LCAA 3LXUX 3QC1A 4GZCA 3FFLA 3R9AB 4UWLA 4ANVA 3MZLB 5E76A 5G05J 4CGVA 1Z6TA 3EIQC 4N3CA 3CIAA 4KZ0A 4J8EA 5T8IA 3KD7A 2XQ0A 3HIZA 1H2UA 3PE4A 1HH8A 4I2ZA 3RRUA 5KJNA 4XKBA 2JLBA 4IULA 3FUHA 2X3MA 4DI3A 2GGFA 2WXIA 5ARGA 4L1BA 2CFZA 4C0EA 4AIFA 5FT9A 5JHAA 3EJNA 3TGOA 4WNFA 2J9QA 3C98A 4MKTA 4FJZA 2AVPA 1HXIA 2OVFA 1E90A 4CDRA 3NZUA 4NQ0A 1VDYA 2IFUA 4XZ4A 2WXFA 3ZXSA 2YINA 3QK0A 3PUJA 1H0AA 1WM5A 2FEZA 3FUKA 2V4LA 4MRUA 4WNGA 3FH7A 3FUFA 4AY5A 5M72A 4Q69A 4WUYA 1SZ9A 3FTYA 5G2NA 5AENA 3CHPA 4CGWA 3CVWA 2WMNA 4GPKA 4N2QA 3DPDA 2WPVA 3CHRA 4G1TA 4XX5A 3ZVVA 3FWVA 1HE8A 3FH8A 1JWFA 1UJJA 5EKQD 3PVLA 4ANUA 4GYOA 4FLHA 4ANXA 4DI4A 1UN9A 4FU3A 3VLDA 4JPSA 2PL2A 3ZEFA 1WY6A 1IQRA 1ZU2A 4U04A 3AS5A 4XE0A 3B7TA 3MKQB 1NA0A 3PZDA 4I9EA 1OUVA 1OWOA 1NA3A 4H7XA 2P58C 2WXRA 3FU5A 1UG3A 2KZTB 3SBTB 5JJTA 4KT6B 3CR3A 1HF8A 3FTSA 2OVBA 4JC8A 3URZA 4EPZA 5LCWJ 4JW1A 3LKUA 2XRZA 4P29A 5FTPA 3QWWA 3ZYMA 1Y6IA 3EHMA 1U3CA 4R7LA 3R7QA 2A4ZA 3ZPJA 5CCMA 5HI7A 4U0UA 2VTBA 2PZIA 2CHXA 3FDHA 3JUIA 2OOEA 3LVQE 3Q49B 1H2TC 1ZBPA 4UWKA 5A6CA 2C2LA 1MQSA 3FEYA 3QB2A 4RVBA 5FZRA 4FJYA 4YNDA 1P5QA 4D10C 2LAIA 2PM6A 3FULA 3CV0A 4HOQA 3ZYQA 4BT8A 3SFZA 5JHBA 1PAQA 2BTDA 3G2UA 4NRHB 2VYIA 2VJ8A 1BPOA 3BG1B 3AU4A 4MLPA 5BV1A 3KEZA 5A7DB 3RKVA 4I43A 5BW8C 3S2AA 2XPIA 3TXMA 4G25A 1NZNA 1Z3YA 4L2YA 4FA6A 3QWPA 4FADA 1EPUA 3AS8A 2E2EA 2BF0X 3D9IA 2XGOA 3LVRE 2IOSA 4LUNU 2AWIA 3D9JA 4K03A 1HG5A 3UUXA 1FCHA 3NZSA 4GCNA 4BFRA 1OWNA 4TV3A 2IU1A 4FHKA 2CFUA 3GZ2A 2Y4UA 4WWOA 2RD0A 2DCPA 4KXKB 5E75A 3FUDA 2LSVA 4GMLA 3S7FA 4A55A 2WXQA 4OVUA 2KCLA 3CVYA 2IQCA 2XGSA 1E96B 4GZDA 2MOWA 3FY4A 3QKYA 3MV3B 3BG0B 3KAEA 3T5XA 2L9BA 3HVEA 1QZ2A 2HYZA 3OAWA 3PS6A 2WQHA 2I1JA 3ONLA 4LCTA 2AXZA 1X5BA 4U63A 3CVNA 3D9LA 2XCCA 5AJLA 1ELWA 3FTZA 4E85A 2PQRA 3QOUA 2FBNA 2ONDA 3FTVA 1OWPA 3U66A 3IHVA 4GB9A 5LCWC 3U64A 3OTNA 4DLOA 4JEUA 5J08A 2Q7FA 1GW6A 2X6FA 3HDXA 4L7TA 3D9MA 2XHEA 3I5PA 1UW4B 3CSTA 3LYAA 2NXPA 3O48A 2WXLA 4JA9A 4PS7A 5AJDA 3D9OA 3GZSA 2LSUA 3HYMB 3UT7A 3WXXA 1E8WA 3AS4A 2X6KA 4GA0A 4PH4B 2C0LA 3L13A 3AU5A 2YHCA 4J8SA 3PRZA 2NSZA 3PDNA 3U3WA 1HFAA 2WMOA 3E4BA 3GW4A 3MEKA 3FU3A 3TAXA 2C0MA 3VTYA 4I1AA 3EIJA 5FJYA 5LP0A 2L0TB 3NF1A 4JZYA 5ANRA 1E8YA 3SBSA 4EZKA 3RK6A 4F1SA 4N3AA 5LOZA 5A23A 2WXJA 4AJWA 1H2VC 1SQMA 2CG2A 2EQXA 4JVSA 3R7RA 4ACKA 3T5VA 2PQNA 2LO6A 2VGXA 4HFGA 1A17A 2VSNA 3ML8A 4UWGA 4A1GA 3OXGA 4FLBA 4FHJA 2QFCA 4AEZC 3FUMA 4C9BB 4HVBA 1B89A 4UQXA 1OWLA 3FTXA 3G2SA 1OWMA 4LERA 4XIFA 2CG3A 2ZU6B 2QY7A 4DK5A 3SF4A 3QWVA 3L08A 5FWQA 3LPZA 4W9RA 1UN8A 2VTBB 3QJZA 2UWJG 1IYGA 2CHZA 4WAFA 3SNXA 4JEHA 3SGHA 2AXVA 2YQ8A 1NP7A 4I6EA 2V5FA 4GYWA 1DNPA 5T4YA 3CGHA 2BUGA 1TJFA 5ENNA 3BEEA 4LEUA 4EECA 5G04J 3FTUA 1TJCA 2VSOE 3LDZA 3QNKA 4HLEA 4QFVA 4WWPA 1KLXA 4F7AA 2IJGX 4BY6A 5FZQA 4B8CB 1L5JA 1SZAA 1HZ4A 3FUIA 3K9IA 4G26A 1FVHA 4FULA 5FZSA 5G05C 3RIBA 3VLEA 5BT1A 3D9KA 1KT1A 3RU0A 1N54A 3PH0C 2CHWA 2AW6A 3FEXA 4JHJA 4BSXA 2E0IA 3B7SA 3T8MA 4TRQA 4RSYA 3TG4A 4AP2A 3ASGA 1W3BA 5JJ6A 2VGYA 4NACA 3ZIMA 3UPVA 3G2TA 2I6HA 3IBEA 3CK9A 4GZ5A 4WWNA 1LF8A 4GZ3A 4JHRA 3DBSA 2R17C 3CSFA 5KJMA 2J4BA 4Q94A 4UQYA 2DBAA 4APOA 1DVPA 4I9CA 3ESKA 4I17A 3FUEA 3EDTB 4G24A 3HVEB 4GZ6A 2FULA 5CHEE 4PS8A 3CVUA 3ML9A 3IV0A 4BX8A 1ELKA 3PREA 2IOLA 3MKQA 4U0SA 4V3IA 2R5SA 3L54A 1HG2A 4JXTA 5BUZA 3JQ0A 4I6JA 2WXOA 5KJKA 4AY6A 3LS8A 5J90A 3MX3A 4IN3B 4HOUA 1PY1A 2KCKA 2WXKA 2AXUA 3HHMA 4XKCA 3ASHA 3FU6A 1TEZA 2J07A 5AYWD 4UQZA 3RRMB 2XGMA 3MJWA 3OXFA 3I4RB 3UX4A 4EBAG 1QNFA 3JCKC 2L0IA 1S0PA 3CLJA 4ANWA 4B94A 4UI9K 4CT4A 4J6IA 4J8DA 4EZJA 4AM9A 1Y8MA 4KVMA 4ABNA 2A5UA 3FHEA 5D0QD 3CQCB 3Q47B 2I1KA 2DIWA 3CK8A 1E8ZA 1E7UA 3ULQA 3D9PA 2XPYA 2I9CA 4ILHB 3RO3A 3LY8A 3SZ7A 4CT0A 2X38A 3CVQA 4PS3A 5DIZA 1EF1C 4F3VA 4B8AA 2XEVA 2WXNA 4ILGA 2WVIA 3APFA 4A3VA 3LY7A 2PM7A 3N71A 2VGXB 4HXIA 3L17A 4I6GA 2WB2A 3ESLA 3SI5A 3CEQA 2KM4A 2KC7A 3CHOA 3UT4A 1H19A 3TL5A 3TJPA 3ZHEA 4L2LA 3KS2A 4XI9A 3UMVA 4IRUA 3ASFA 3P2BA 5C1DA 4N5CA 3NQPA 3ASDA 3JQ1A 2JEKA 4GYYA 1JWGA 3D9NA 4NURA 3CVLA 4DPRA 1UJKA 2UY1A 5G55A 4ME2A 3LEWA 3OXLA 3MCXA 4LRZA 2X6IA 3APDA 2HM8A 2GRLA 4JA7A 4Y6WA 3CVVA 3PEVB 4EZLA 3FU0A 2WXHA 2Y3AA 2XPZA 3IKOB 1HO8A 3GZ1A 2J09A 2WXMA 4GAAA 2XRYA 4DLQA 1WAO1 5DBKA 4FP7A 2WXGA 4UI9J 4DJAA 4AVXA 3P1UA 1N52A 3U9WA 2WQ7A 3FH5A 5EX3A 4KYOB 4URKA 3CVXA 5FQ6A 1IQUA 4UWHA 3PNTB 4CEMA 5HQ8A 4EQFA 2LAHA 4AXHA 5FQ8A 3VTXA 2KATA 3U4TA 5ANLA 3IEGA 2XCBA 2ILRA 2V0PA 4GA1A 2LNIA 5C2YA 2IF4A 4OYSA 3JYSA 3FUNA 3I3NA 3QARA 2J08A 1JPLA 4XI0A 2YHEA 3TG5A 3D3MA 3ONKA 3ZN3A 4JL0A 2MRIA 4CCAA 3SD5A 4O6FA 4C0MA 4N3BA 3IHYA 4RG6A 2J4DA 4U8HA 4BTBA 5KJLA 4KBQA 2YNQA 1XGWA 3ZGQA 3LY9A 4G23A 4E6HA 5CCLA 3L6AA 3S7BA 3APCA 4U07A 3B7UX 1HS6A 2Y4TA 1XNFA 5BV0A 4HOTA 2OV8A 3MV2B 4IYPA 4WNDA 3CKCA 2NC9A 4L23A 2X6HA 3PEUB 5BNWA 3FP3A 3PNLB 5EX0A 1KT0A 4MS6A 1EDUA 4AV7A 3RO2A 4KZCA 3VLFA 4HOSA 3FUJA 3CKBA 5KCMA 3TXNA 4GA2A 3Q15A 4GMJA 3PUKA 5FQ4A 4G11A 4FC8A 3CK7A 3RRNB 3RJVA 3CVPA 2VQ2A 2L6JA 3Q4AB 2V8SE 4GU5A 3MKRA 3QAQA 4N2SA 4OVVA 2HO1A 4G2VA 4PUCA 5EDSA 2FO7A 3G2VA 4I1OB 2I2OA 3ZYLA 3FTWA 3ZFWA 2KZTA 4ILIA 3GYZA 4M3OA 4N39A 4UI9C 4ACLA 2WM9A 5CMYA 4CDMA 5T3RA 5CMWA 3MGBA 1QQEA 4Q96A 2KCVA 5FQ7A 2HR2A 3EHNA 4BTAA 3G2WA 5LX8A 1MHQA 2GW1A 4U0ZA 3CQGB 4BWRA 1HX8A 3ZYKA 1ELRA 4UWFA 3ZW3A 4WNEA 3LJ3A 4B0ZA 4APFA 2R59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQ3 A;  5G04 C;  3ZHE B;  4YVQ C;  2FF4 A;  3MA5 A;  4BT9 A;  2MHK A;  3S7J A;  4I2W A;  2UY1 B;  3S7D A;  4GCO A;  5D0O D;  4Y6C A;  5ARF A;  1PC2 A;  3QDN A;  5JJ7 A;  4HOR A;  1IHG A;  4H7Y A;  2FI7 A;  4RG9 A;  4J8F A;  2VSY A;  1YA0 A;  4YVO A;  4A1S A;  3PE3 A;  3Q5M A;  4J0U A;  3LCA A;  3FFL A;  3R9A B;  4CGV A;  5G05 J;  4N3C A;  4J8E A;  3KD7 A;  3PE4 A;  1HH8 A;  4I2Z A;  5KJN A;  2JLB A;  5ARG A;  4AIF A;  5FT9 A;  3TGO A;  4WNF A;  2J9Q A;  2AVP A;  1HXI A;  4CDR A;  4NQ0 A;  2IFU A;  2FEZ A;  1WM5 A;  4WNG A;  4AY5 A;  5M72 A;  4WUY A;  4CGW A;  4GPK A;  4N2Q A;  2WPV A;  4G1T A;  3FWV A;  5EKQ D;  4GYO A;  2PL2 A;  1ZU2 A;  4U04 A;  3AS5 A;  1NA0 A;  4I9E A;  1OUV A;  1NA3 A;  4H7X A;  2P58 C;  5JJT A;  5LCW J;  3URZ A;  3LKU A;  5FTP A;  3QWW A;  3ZPJ A;  5CCM A;  5HI7 A;  4U0U A;  2PZI A;  3Q49 B;  2OOE A;  1ZBP A;  5A6C A;  2C2L A;  5FZR A;  4YND A;  1P5Q A;  3CV0 A;  4HOQ A;  4BT8 A;  4NRH B;  2VYI A;  3RKV A;  5A7D B;  5BW8 C;  2XPI A;  4G25 A;  1NZN A;  3QWP A;  3AS8 A;  2E2E A;  2XGO A;  3UUX A;  1FCH A;  4GCN A;  3GZ2 A;  2Y4U A;  4KXK B;  2LSV A;  3S7F A;  2KCL A;  2XGS A;  1E96 B;  3QKY A;  3MV3 B;  3KAE A;  1QZ2 A;  2HYZ A;  2WQH A;  3CVN A;  2XCC A;  1ELW A;  2PQR A;  3QOU A;  2OND A;  2FBN A;  5LCW C;  2Q7F A;  3LYA A;  3O48 A;  4JA9 A;  3HYM B;  2LSU A;  3WXX A;  3AS4 A;  4GA0 A;  2C0L A;  2YHC A;  3PDN A;  3U3W A;  3E4B A;  3GW4 A;  3MEK A;  3TAX A;  2C0M A;  3VTY A;  4I1A A;  5FJY A;  3NF1 A;  4N3A A;  2PQN A;  2VGX A;  1A17 A;  2VSN A;  3OXG A;  2QFC A;  1B89 A;  4UQX A;  4XIF A;  3SF4 A;  3QWV A;  3LPZ A;  4W9R A;  2UWJ G;  1IYG A;  2YQ8 A;  2V5F A;  4GYW A;  2BUG A;  3BEE A;  4LEU A;  5G04 J;  1TJC A;  1KLX A;  5FZQ A;  4G26 A;  3K9I A;  1HZ4 A;  5FZS A;  3RIB A;  5G05 C;  5BT1 A;  1KT1 A;  3RU0 A;  3TG4 A;  3ASG A;  1W3B A;  5JJ6 A;  2VGY A;  3UPV A;  2I6H A;  3CK9 A;  4GZ5 A;  4GZ3 A;  4JHR A;  5KJM A;  4UQY A;  2DBA A;  4APO A;  4I9C A;  3ESK A;  4I17 A;  4G24 A;  3EDT B;  4GZ6 A;  5CHE E;  4U0S A;  2R5S A;  5KJK A;  4AY6 A;  4IN3 B;  4HOU A;  2KCK A;  3ASH A;  5AYW D;  4UQZ A;  2XGM A;  3OXF A;  4B94 A;  4UI9 K;  4J8D A;  4AM9 A;  1Y8M A;  4ABN A;  5D0Q D;  3Q47 B;  3CK8 A;  3ULQ A;  3RO3 A;  3SZ7 A;  3LY8 A;  3CVQ A;  5DIZ A;  4F3V A;  2XEV A;  3LY7 A;  3N71 A;  2VGX B;  3CEQ A;  2KC7 A;  3ZHE A;  3KS2 A;  4XI9 A;  5C1D A;  3ASF A;  4N5C A;  3ASD A;  4GYY A;  3CVL A;  2UY1 A;  4ME2 A;  3OXL A;  4JA7 A;  4Y6W A;  3GZ1 A;  1WAO 1;  5DBK A;  4UI9 J;  5EX3 A;  4KYO B;  5HQ8 A;  4EQF A;  3VTX A;  2KAT A;  3U4T A;  3IEG A;  2XCB A;  4GA1 A;  2LNI A;  2IF4 A;  3JYS A;  4XI0 A;  3TG5 A;  3ZN3 A;  4JL0 A;  4O6F A;  4N3B A;  4RG6 A;  4BTB A;  5KJL A;  4KBQ A;  3ZGQ A;  3LY9 A;  4G23 A;  5CCL A;  3S7B A;  4U07 A;  2Y4T A;  1XNF A;  4HOT A;  3MV2 B;  4WND A;  3CKC A;  2NC9 A;  5BNW A;  3FP3 A;  5EX0 A;  1KT0 A;  3RO2 A;  4HOS A;  3CKB A;  4GA2 A;  3Q15 A;  3CK7 A;  3RJV A;  3CVP A;  2VQ2 A;  2L6J A;  3Q4A B;  3MKR A;  4N2S A;  2HO1 A;  4G2V A;  2FO7 A;  3ZFW A;  3GYZ A;  4N39 A;  4UI9 C;  1QQE A;  2KCV A;  2HR2 A;  4BTA A;  2GW1 A;  4U0Z A;  4BWR A;  1ELR A;  4WNE A; 
#chains in the Genus database with same CATH topology
 2WXP A;  5G04 C;  3ZRH A;  4BT9 A;  1KZO A;  3I4G A;  3MYV A;  1TNY A;  3S7J A;  4TUU A;  3B13 A;  5BXO A;  1FVF A;  5D0O D;  4N5Q A;  5JJ7 A;  4HOR A;  1D8D A;  2RG8 A;  4K0R A;  5FIO A;  4B93 B;  1EYH A;  5E76 A;  2P9I G;  2MYO A;  2GGF A;  2WXI A;  2R2L A;  4C0E A;  4AIF A;  5FT9 A;  5JHA A;  3KSQ A;  3TGO A;  2J9Q A;  2OVF A;  2WXF A;  4BEP A;  1O1T A;  4MRU A;  3FH7 A;  4Q69 A;  1SZ9 A;  3FTY A;  5G2N A;  4GPK A;  4XX5 A;  2LXL A;  2P9L G;  3AJI A;  4U8V D;  3VLD A;  1WY6 A;  3Q7F A;  2ZXW E;  3B7T A;  3PZD A;  1JCR A;  4H7X A;  4KT6 B;  2OVB A;  5FTP A;  3ZPJ A;  3FDH A;  3JUI A;  3ASO E;  4UWK A;  1ZBP A;  5FIN A;  1N9A A;  2JAB A;  2Y0B G;  5CBO A;  3ZYQ A;  5JHB A;  2BTD A;  4NRH B;  3KEZ A;  4I43 A;  4U8Y D;  3TXM A;  1Z3Y A;  4FAD A;  2E2E A;  2BF0 X;  2XGO A;  2IOS A;  4U95 D;  2Y4U A;  2DCP A;  4YDO A;  4OVU A;  3CVY A;  4DX2 A;  2IQC A;  2XGS A;  4HI9 A;  3T5X A;  2WQH A;  2I1J A;  3ONL A;  2AXZ A;  1X5B A;  3CVN A;  2XCC A;  2XS1 A;  2PQR A;  3QOU A;  3HXF A;  3U64 A;  4OAU C;  2X6F A;  5KNG A;  1N11 A;  3B7B A;  2XHE A;  1UW4 B;  2NXP A;  4DX7 D;  3TWV A;  5AJD A;  1MJ0 A;  5B1B E;  2YHC A;  3V31 A;  3E4B A;  1U2V G;  5FJY A;  5LP0 A;  3ZUV B;  3V79 K;  1S64 A;  1QBQ A;  5LOZ A;  5A23 A;  1N0Q A;  1Q2Z A;  4O1P A;  4JVS A;  4ACK A;  2PQN A;  4HFG A;  2VSN A;  4XEI G;  3ML8 A;  2P2C P;  2GRP B;  4C9B B;  3Q79 A;  2DVW A;  4BER A;  2QY7 A;  3BUA A;  5AN8 A;  3QJZ A;  3SGH A;  1DNP A;  3CGH A;  5G04 J;  5AQB A;  2VSO E;  4QFV A;  2B0O E;  4B8C B;  3UT8 A;  4G26 A;  3EUV A;  3RIB A;  1FVH A;  2ETC A;  5BT1 A;  2CHW A;  4JHJ A;  1IHB A;  1TNU A;  4TRQ A;  4RSY A;  4AP2 A;  5JJ6 A;  3ZIM A;  4NAC A;  3DRA A;  3G2T A;  3IBE A;  4YDE A;  3DBS A;  3CSF A;  5KJM A;  4OAV B;  2LUH A;  2DBA A;  3ESK A;  1UOH A;  5CHE E;  2P9K G;  3PRE A;  2IOL A;  4U0S A;  2WXO A;  3LS8 A;  1TN6 A;  2AXU A;  4XKC A;  5AYW D;  3MJW A;  3OXF A;  4EBA G;  3JCK C;  1Z5S C;  3NBN B;  4KVM A;  4F1P A;  4ILH B;  3RO3 A;  4CT0 A;  3E32 A;  5DIZ A;  2XEV A;  2WXN A;  3DEP A;  2IO2 C;  1TN7 A;  2KM4 A;  2KC7 A;  4U7E B;  3AAA C;  3P2B A;  4LG6 A;  5ENO D;  3ASD A;  3JQ1 A;  3DXK G;  3C5R A;  4GYY A;  5G55 A;  3OXL A;  4LRZ A;  3UM2 A;  2GRL A;  3PEV B;  4EZL A;  2XPZ A;  2GRR B;  3GZ1 A;  2F8X K;  4CZ2 D;  3U9W A;  3FH5 A;  2XEE A;  4KYO B;  5EX3 A;  2VGE A;  2ZGG A;  4CEM A;  5HQ8 A;  1YYH A;  3IXE A;  2XCB A;  2V0P A;  2LNI A;  4GTO A;  2J08 A;  1JPL A;  5CEA A;  2YHE A;  3DSX A;  3TG5 A;  3ONK A;  1TNZ A;  2MRI A;  4CCA A;  4RG6 A;  5KJL A;  3ZGQ A;  4E6H A;  1D9S A;  4U07 A;  3UM1 A;  3B7U X;  2OV8 A;  4IYP A;  4WND A;  2NC9 A;  2QZA A;  5EX0 A;  4MS6 A;  5ENR D;  4KZC A;  1S70 B;  5KCM A;  2R03 A;  5FQ4 A;  4EHM A;  2L6J A;  3UI2 A;  4PUC A;  4TUM A;  4I1O B;  2I2O A;  3ZFW A;  2H6F A;  2KCV A;  3EHN A;  4BTA A;  1N4R A;  5LX8 A;  2GW1 A;  3TWS A;  1MYO A;  1HX8 A;  1ELR A;  2DYS E;  3LJ3 A;  4D10 C;  2R59 A;  3C3Q A;  1INZ A;  4EBA A;  4YVQ C;  3PZ2 A;  2X6J A;  3MA5 A;  1OCR E;  3CHQ A;  4CRW A;  2J49 A;  5CRV A;  4DUI A;  1AWC B;  4Y6C A;  1PC2 A;  3QDN A;  3B7R L;  1HU3 A;  4KMO A;  1IHG A;  3DSW A;  4J8F A;  2VSY A;  2WQ6 A;  3O4Z A;  3PE3 A;  3LCA A;  3R9A B;  4UWL A;  3MZL B;  3EIQ C;  5T8I A;  2XQ0 A;  4I2Z A;  4XKB A;  2JLB A;  3FUH A;  3ULE G;  4L1B A;  4FJZ A;  1HXI A;  2P9U G;  3NZU A;  3X2Q E;  1VDY A;  2IFU A;  4XZ4 A;  3ZXS A;  2YIN A;  4JB8 P;  5AEN A;  4X8Q A;  2WPV A;  3FH8 A;  1JWF A;  5EKQ D;  4ANU A;  3PVL A;  3V2O A;  1JCQ A;  1UN9 A;  4L9P A;  2GRQ B;  2PL2 A;  3MKQ B;  1OUV A;  4F6R D;  2KZT B;  3UIN C;  3FTS A;  4JC8 A;  4JW1 A;  4P29 A;  3ZYM A;  1Y6I A;  2XEH A;  3EHM A;  2DWZ A;  2A4Z A;  3R7Q A;  3W9G A;  2PZI A;  2OOE A;  3Q49 B;  3JXI A;  3QB2 A;  1MQS A;  5FZR A;  1OXJ A;  3CV0 A;  3Q7A A;  4BT8 A;  1PAQ A;  4O60 A;  2VYI A;  2VJ8 A;  3HXD A;  4MLP A;  2XPI A;  1BI8 B;  3AS8 A;  3LVR E;  1DCQ A;  2B6C A;  3DWL G;  3UUX A;  1FCH A;  3NZS A;  4GCN A;  4TV3 A;  4FHK A;  2V5Q C;  2LSV A;  2WXQ A;  1S63 A;  1YCS B;  4K5C A;  4J7W A;  2NYJ A;  3QKY A;  3MV3 B;  3HVE A;  1QZ2 A;  1MZC A;  4GTR A;  4U63 A;  3ULY A;  2BKK B;  2FBN A;  3FTV A;  3IHV A;  5LCW C;  5J08 A;  2ETB A;  1K8K G;  3D9M A;  3I5P A;  3CST A;  3O48 A;  4PS7 A;  1SW6 A;  3WXX A;  1E8W A;  5BXU A;  3PRZ A;  2NSZ A;  1HFA A;  3GW4 A;  5AAR A;  2C0M A;  2L0T B;  5ANR A;  3PZ4 A;  3RK6 A;  3DSV A;  2CG2 A;  3T5V A;  2VGX A;  3UIP C;  3V30 A;  4UWG A;  4A1G A;  4FHJ A;  4FLB A;  2QFC A;  4AEZ C;  3FTX A;  1OWM A;  4LER A;  4XIF A;  1TNB A;  5FWQ A;  2VTB B;  1UN8 A;  2UWJ G;  3SNX A;  2YQ8 A;  3RSE G;  5T4Y A;  2BUG A;  1TJF A;  5ENN A;  1TN8 A;  3FTU A;  1TJC A;  3TWQ A;  3LDZ A;  3QNK A;  4WWP A;  1KLX A;  3LJN A;  4F7A A;  4YDW A;  2IJG X;  2DYR E;  1SZA A;  1HZ4 A;  3VLE A;  3FUI A;  5FZS A;  5G05 C;  2GRN B;  3FEX A;  4BSX A;  3E34 A;  2E0I A;  5AQ7 A;  5ENT D;  3UPV A;  1KZP A;  1LTX A;  5KNH D;  3DXM G;  4UQY A;  4I9C A;  3FUE A;  3Q75 A;  1ELK A;  3MKQ A;  1HG2 A;  5EYL A;  5KJK A;  3MX3 A;  1OCC E;  2WXK A;  3FU6 A;  3RRM B;  1JCS A;  4ANW A;  4UI9 K;  4CT4 A;  4EZJ A;  2A5U A;  2I1K A;  3CK8 A;  3ULQ A;  3T8K A;  2XPY A;  3LY8 A;  4HRN A;  2QYJ A;  4F3V A;  4B8A A;  5H7P A;  1RW2 A;  4ILG A;  2WVI A;  2PM7 A;  3ESL A;  3UT4 A;  5HRY A;  3TL5 A;  3SQV A;  4L2L A;  3UMV A;  4IRU A;  5CBN A;  3NQP A;  2JEK A;  1O1S A;  4ME2 A;  3LEW A;  3MCX A;  2X6I A;  3DSS A;  5D2M C;  3FU0 A;  2KBX A;  3IKO B;  1RZ4 A;  4GAA A;  2XRY A;  3TWX A;  1WAO 1;  5DBK A;  4UI9 J;  4BET A;  4ZHB A;  2FO1 E;  3PNT B;  2F0Y A;  4EQF A;  2LAH A;  5FQ8 A;  5EIB E;  3U4T A;  2OEV A;  4A63 B;  5C2Y A;  3FUN A;  3ZXP A;  4XI0 A;  3ZN3 A;  3SD5 A;  4O6F A;  4C0M A;  4N3B A;  4U8H A;  2YNQ A;  3LY9 A;  5CCL A;  3TWW A;  3S7B A;  2Y4T A;  1XNF A;  4HOT A;  1D8E A;  4L23 A;  2X6H A;  5BNW A;  4GTM A;  2Y1L E;  1EDU A;  1MX4 A;  2DZO A;  4HOS A;  3CKB A;  3TXN A;  4GA2 A;  4FC8 A;  2QYU A;  3Q4A B;  4GU5 A;  3MKR A;  3QAQ A;  4G2V A;  1ZB1 A;  2EIK E;  4M3O A;  5CMY A;  4Q96 A;  5FQ7 A;  1MHQ A;  4U0Z A;  4BWR A;  4K5B A;  5AQ9 A;  5B3S E;  3ZHE B;  3Q73 A;  4YDY A;  2FF4 A;  1H6K A;  4KVO A;  1U3D A;  4PDX A;  1A5E A;  2QC9 A;  3R9M A;  2UY1 B;  3SO8 A;  5CEC B;  3S7D A;  4TXQ A;  4B89 A;  4GCO A;  1Z3X A;  5ARF A;  3CHM A;  1JUQ A;  4H7Y A;  1N94 A;  3J5Q B;  3L22 A;  4BX9 A;  2M63 A;  3ABK E;  1E8X A;  4JHK A;  1YA0 A;  4A1S A;  3CHS A;  4ANV A;  3QC1 A;  3FFL A;  4CGV A;  5G05 J;  4N3C A;  4LSZ E;  4KZ0 A;  3KD7 A;  2IO3 C;  1HH8 A;  3PE4 A;  4IUL A;  2X3M A;  4HLL A;  2CFZ A;  4DX1 A;  1N4Q A;  5HKP A;  2EIN E;  3EHQ A;  4NQ0 A;  5ITZ F;  3PUJ A;  3FUK A;  3ZNG A;  2AJA A;  2OEW A;  2V4L A;  4WNG A;  3FUF A;  4RQI A;  5M72 A;  1LD7 A;  1QYM A;  4CGW A;  2WMN A;  4N2Q A;  3DPD A;  1AP7 A;  1UJJ A;  4GTT A;  4NIK A;  3UM3 A;  4ANX A;  4DI4 A;  4FU3 A;  1ZU2 A;  1IQR A;  3UM0 A;  4U04 A;  3AS5 A;  2P58 C;  2WXR A;  3FU5 A;  1UG3 A;  3ABL E;  3Q78 A;  1WG0 A;  3LKU A;  2XRZ A;  1U3C A;  4R7L A;  4TXR A;  4U0U A;  2CHX A;  3LVQ E;  1H2T C;  2C2L A;  3FEY A;  4RVB A;  4FJY A;  3FUL A;  3SFZ A;  3G2U A;  1N0R A;  1BPO A;  3AU4 A;  1TR4 A;  5BV1 A;  3PZ1 A;  5A7D B;  3S2A A;  4G25 A;  1NZN A;  4FA6 A;  1EPU A;  4LUN U;  4K03 A;  1OY3 D;  3SFX A;  4HB5 A;  1NFI E;  4BFR A;  2CFU A;  4HNA D;  3DST A;  4GML A;  4A55 A;  2KCL A;  4GZD A;  3UKR G;  2MOW A;  3BG0 B;  3KAE A;  3HXC A;  2HYZ A;  3OAW A;  4LCT A;  2A5E A;  5D66 A;  5AJL A;  1ELW A;  4DX5 D;  2OND A;  3U66 A;  3OTN A;  4DLO A;  2Q7F A;  3HDX A;  2WXL A;  3L82 A;  4JA9 A;  1LD8 A;  3NOG D;  3D9O A;  3GZS A;  2LSU A;  3AG4 E;  1SA5 A;  3UT7 A;  4GA0 A;  4PH4 B;  4J8S A;  3PDN A;  3U3W A;  3F6Q A;  2WMO A;  2RKK A;  3C3O A;  3MEK A;  3FU3 A;  4I1A A;  3EIJ A;  1E8Y A;  4GTV A;  4F1S A;  1K3Z D;  2WXJ A;  4AJW A;  1H2V C;  2EQX A;  4U96 D;  4MBG A;  3T9K A;  2J8S D;  4HRL A;  3OXG A;  4UQX A;  1OWL A;  3SFY A;  3G2S A;  2CG3 A;  2ZU6 B;  4DK5 A;  3QWV A;  3L08 A;  4W9R A;  2CHZ A;  4DRX E;  1KPS B;  3L9T A;  4JEH A;  4BSZ B;  2AXV A;  4G8L A;  4LNU D;  4I6E A;  2V5F A;  4GYW A;  3AG3 E;  3BEE A;  4DX6 D;  5CER B;  4HLE A;  4BY6 A;  1DC2 A;  1L5J A;  3K9I A;  3KSL A;  5AQA A;  1FT2 A;  3PH0 C;  2AW6 A;  1W3B A;  3CK9 A;  5EIL A;  4GZ3 A;  4JHR A;  2J4B A;  3AG2 E;  3Q9U C;  1TNO A;  3BQO A;  3HG0 D;  4G24 A;  3EDT B;  4GZ6 A;  2FUL A;  4PS8 A;  3CVU A;  3ML9 A;  4V3I A;  4JXT A;  5BUZ A;  1TYQ G;  4I6J A;  3HXB A;  5J90 A;  1PY1 A;  3ASH A;  1TEZ A;  2J07 A;  1O1R A;  2XGM A;  5HS0 A;  3UX4 A;  2L0I A;  1S0P A;  3CLJ A;  3HRA A;  4B94 A;  4J6I A;  1Y8M A;  4ABN A;  3FHE A;  3CQC B;  1X81 A;  2DIW A;  1E8Z A;  3D9P A;  2I9C A;  3SZ7 A;  2X38 A;  4PS3 A;  4M7C A;  3APF A;  4A3V A;  4HXI A;  3L17 A;  3NB2 A;  4I6G A;  2WB2 A;  3CHO A;  1H19 A;  3KS2 A;  4XI9 A;  1NL4 A;  5C1D A;  3ASF A;  4N5C A;  3D9N A;  4HRM B;  3CVL A;  1UJK A;  4GTQ A;  2HM8 A;  4Y6W A;  3CVV A;  3DEO A;  4LNG A;  4C48 B;  2J09 A;  4DJA A;  1V54 E;  3TWT A;  3CVX A;  5FQ6 A;  1IQU A;  2ZIS A;  1G3N B;  3KEA A;  4ZFH A;  2BKG A;  2KAT A;  5JA4 D;  5ANL A;  1H6P A;  3IEG A;  4GA1 A;  4QQI A;  2IF4 A;  2P9S G;  3JYS A;  2L6B A;  3D3M A;  3JUE A;  5EN5 D;  2EIJ E;  3IHY A;  4BTB A;  1XGW A;  4G23 A;  2ETA A;  2P9N G;  1HS6 A;  3C72 A;  3PEU B;  3TWR A;  4O1O A;  1KT0 A;  4G8K A;  3FUJ A;  3Q15 A;  4G11 A;  2GRO B;  3CK7 A;  3RRN B;  3RJV A;  1FPP A;  5AAO A;  3FTW A;  2KZT A;  4ILI A;  4N39 A;  1MX2 A;  4CDM A;  4HBD A;  5T3R A;  5CMW A;  3MGB A;  1QQE A;  2BED A;  2HR2 A;  3SY2 A;  2F8Y A;  3AG1 E;  3CQG B;  4WNE A;  4B0Z A;  4APF A;  3UQ3 A;  5AIJ A;  2GRM A;  2MHK A;  4CDN A;  4F53 A;  4I1M A;  3L16 A;  1BLX B;  1N4P A;  4I2W A;  3SHF A;  2HE0 A;  2RFA A;  5LFA A;  5B1A E;  4A3T A;  2IEJ A;  1E7V A;  5BPP A;  2ZIR A;  3ENE A;  4GPM A;  2FI7 A;  4RG9 A;  4UUC A;  3TWU A;  5ENS D;  2VSX E;  4ATG A;  4AOF A;  4HS2 A;  4YVO A;  2ION A;  3Q5M A;  4J0U A;  3LXU X;  4GZC A;  1Z6T A;  3NAW A;  3CIA A;  4J8E A;  3HIZ A;  1H2U A;  3RRU A;  2OCC E;  5KJN A;  5CRU A;  1K1B A;  2XZD G;  4DI3 A;  5ARG A;  3WG7 E;  3EJN A;  4WNF A;  5CED B;  3C98 A;  4MKT A;  1IXV A;  2AVP A;  1E90 A;  4CDR A;  1MX6 A;  4K5A B;  4GTS A;  3QK0 A;  1H0A A;  1WM5 A;  2FEZ A;  1WDY A;  3ISM C;  4AY5 A;  1BI7 B;  4WUY A;  2H6H A;  3CHP A;  3CVW A;  1YMP A;  3W9F A;  3CHR A;  4G1T A;  3ZVV A;  3FWV A;  1HE8 A;  4J8Y A;  2LXM A;  4GYO A;  4FLH A;  2V4H C;  3ZEF A;  1DCE A;  4JPS A;  4XE0 A;  4BES A;  1NA0 A;  4I9E A;  1OWO A;  1NA3 A;  3SBT B;  5JJT A;  3CR3 A;  1HF8 A;  5LCW J;  4EPZ A;  3URZ A;  3QWW A;  4LNB A;  1N4S A;  5CCM A;  3EU5 A;  5HI7 A;  2VTB A;  5A6C A;  1IKN D;  4YND A;  1P5Q A;  2LAI A;  2PM6 A;  4HOQ A;  2P9P G;  3BG1 B;  5EID A;  3RKV A;  5BW8 C;  4L2Y A;  3QWP A;  2EIM E;  3D9I A;  2XEN A;  2AWI A;  3D9J A;  1HG5 A;  2XS8 A;  2RFM A;  2R02 A;  1OWN A;  2IU1 A;  3GZ2 A;  4WWO A;  2RD0 A;  4KXK B;  2IY0 C;  3FUD A;  5E75 A;  3S7F A;  1E96 B;  3C3R A;  2EIL E;  3FY4 A;  4HQD A;  2L9B A;  3PS6 A;  3RAU A;  3D9L A;  3E33 A;  3FTZ A;  4E85 A;  1OWP A;  4GB9 A;  3D9H A;  4JEU A;  1GW6 A;  1NI1 A;  4Z68 A;  3UIO C;  4L7T A;  2PNN A;  3LYA A;  4CYM D;  5ENP D;  3HYM B;  3AS4 A;  2X6K A;  2C0L A;  3L13 A;  3AU5 A;  2H6G A;  3V2X A;  4GTP A;  3TAX A;  3VTY A;  1BD8 A;  3NF1 A;  4JZY A;  3SBS A;  2DZN A;  4EZK A;  4N3A A;  1H6O A;  3Q9N C;  1N95 A;  1SQM A;  2F37 A;  4HI8 A;  3R7R A;  2LO6 A;  1O5M A;  3NOC D;  1A17 A;  5EYP F;  3UKU G;  3FUM A;  4HVB A;  1B89 A;  3SF4 A;  3LPZ A;  3E30 A;  1IYG A;  4WAF A;  3HXE A;  5KBA A;  3ZU7 B;  3EU9 A;  1NP7 A;  3ABM E;  4JD2 G;  4RLY A;  4LEU A;  4EEC A;  5FZQ A;  4FUL A;  2Y69 E;  1OCZ E;  3D9K A;  1KT1 A;  3RU0 A;  1N54 A;  5KWD A;  3B7S A;  3T8M A;  3TG4 A;  3ASG A;  2XZT G;  2VGY A;  2I6H A;  4GZ5 A;  1FT1 A;  4WWN A;  1LF8 A;  2R17 C;  4Q94 A;  5ENQ D;  4APO A;  1DVP A;  4I17 A;  3HVE B;  3DPY A;  3IV0 A;  4BX8 A;  2R5S A;  3L54 A;  3JQ0 A;  3BU8 A;  4ATZ D;  4AY6 A;  4IN3 B;  4HOU A;  2H6I A;  2KCK A;  3HHM A;  4UQZ A;  3I4R B;  1QNF A;  1OT8 A;  4J8D A;  4AM9 A;  5D0Q D;  3Q47 B;  1E7U A;  3CVQ A;  3PZ3 A;  1EF1 C;  3ASN E;  1SVX A;  3LY7 A;  3N71 A;  2VGX B;  3SI5 A;  3CEQ A;  1K1A A;  4GMR A;  3TJP A;  3ZHE A;  1OCO E;  3DSU A;  1JWG A;  3ZKJ A;  4NUR A;  4DPR A;  2UY1 A;  5JMN D;  3APD A;  4JA7 A;  2WXH A;  2Y3A A;  1HO8 A;  2ZGD A;  2WXM A;  4DLQ A;  4FP7 A;  2WXG A;  4AVX A;  3P1U A;  1N52 A;  2WQ7 A;  4URK A;  4UWH A;  3EHR A;  1SA4 A;  2KXP C;  4AXH A;  3VTX A;  2ILR A;  4OYS A;  3I3N A;  3QAR A;  5IY5 E;  3B95 A;  4JL0 A;  2R05 A;  4TXP A;  2J4D A;  4KBQ A;  3L6A A;  3APC A;  5BV0 A;  3MV2 B;  3CKC A;  3E37 A;  3FP3 A;  3PNL B;  4AV7 A;  3RO2 A;  3VLF A;  3J5P A;  1V55 E;  4GMJ A;  3PUK A;  3JXJ A;  3CVP A;  2VQ2 A;  2V8S E;  3UXG A;  4N2S A;  3UTM A;  4OVV A;  2HO1 A;  5EDS A;  2FO7 A;  3G2V A;  3ZYL A;  3GYZ A;  4UI9 C;  4ACL A;  2WM9 A;  3G2W A;  1BU9 A;  3ZYK A;  4UWF A;  3ZW3 A; 
#chains in the Genus database with same CATH homology
 3UQ3 A;  5AIJ A;  2WXP A;  5G04 C;  3ZRH A;  1INZ A;  3ZHE B;  4EBA A;  2GRM A;  4YVQ C;  2FF4 A;  2X6J A;  3MA5 A;  1H6K A;  4BT9 A;  2MHK A;  4CDN A;  4KVO A;  3I4G A;  4F53 A;  3CHQ A;  1U3D A;  3MYV A;  4PDX A;  4I1M A;  4CRW A;  3L16 A;  2J49 A;  3S7J A;  4I2W A;  3SHF A;  2UY1 B;  4TUU A;  5LFA A;  3B13 A;  3S7D A;  4A3T A;  1E7V A;  1FVF A;  4GCO A;  4B89 A;  5BPP A;  5D0O D;  4Y6C A;  1Z3X A;  5ARF A;  3UT8 A;  1PC2 A;  1JUQ A;  3CHM A;  3ENE A;  3QDN A;  3B7R L;  5JJ7 A;  1HU3 A;  4HOR A;  4KMO A;  1IHG A;  4H7Y A;  2FI7 A;  3L22 A;  4RG9 A;  4BX9 A;  2M63 A;  2VSX E;  2RG8 A;  4J8F A;  1E8X A;  4JHK A;  4HS2 A;  2VSY A;  4K0R A;  4ATG A;  4AOF A;  2WQ6 A;  1YA0 A;  3O4Z A;  4YVO A;  4A1S A;  3PE3 A;  3CHS A;  2ION A;  3Q5M A;  1EYH A;  4J0U A;  3LCA A;  3LXU X;  3QC1 A;  4GZC A;  3FFL A;  3R9A B;  4UWL A;  4ANV A;  3MZL B;  5E76 A;  5G05 J;  4CGV A;  1Z6T A;  3EIQ C;  4N3C A;  3CIA A;  4KZ0 A;  4J8E A;  5T8I A;  3KD7 A;  2XQ0 A;  3HIZ A;  1H2U A;  3PE4 A;  1HH8 A;  4I2Z A;  3RRU A;  5KJN A;  4XKB A;  2JLB A;  4IUL A;  3FUH A;  2X3M A;  4DI3 A;  2GGF A;  2WXI A;  5ARG A;  4L1B A;  2CFZ A;  4C0E A;  4AIF A;  5FT9 A;  5JHA A;  3EJN A;  3TGO A;  4WNF A;  2J9Q A;  3C98 A;  4MKT A;  4FJZ A;  2AVP A;  1HXI A;  2OVF A;  1E90 A;  4CDR A;  3NZU A;  4NQ0 A;  1VDY A;  2IFU A;  4XZ4 A;  2WXF A;  3ZXS A;  2YIN A;  3QK0 A;  3PUJ A;  1H0A A;  1WM5 A;  2FEZ A;  3FUK A;  2V4L A;  4MRU A;  4WNG A;  3FH7 A;  3FUF A;  4AY5 A;  5M72 A;  4Q69 A;  4WUY A;  1SZ9 A;  3FTY A;  5G2N A;  5AEN A;  3CHP A;  4CGW A;  3CVW A;  2WMN A;  4GPK A;  4N2Q A;  3DPD A;  2WPV A;  3CHR A;  4G1T A;  4XX5 A;  3ZVV A;  3FWV A;  1HE8 A;  3FH8 A;  1JWF A;  1UJJ A;  5EKQ D;  3PVL A;  4ANU A;  4GYO A;  4FLH A;  4ANX A;  4DI4 A;  1UN9 A;  4FU3 A;  3VLD A;  4JPS A;  2PL2 A;  3ZEF A;  1WY6 A;  1IQR A;  1ZU2 A;  4U04 A;  3AS5 A;  4XE0 A;  3B7T A;  3MKQ B;  1NA0 A;  3PZD A;  4I9E A;  1OUV A;  1OWO A;  1NA3 A;  4H7X A;  2P58 C;  2WXR A;  3FU5 A;  1UG3 A;  2KZT B;  3SBT B;  5JJT A;  4KT6 B;  3CR3 A;  1HF8 A;  3FTS A;  2OVB A;  4JC8 A;  3URZ A;  4EPZ A;  5LCW J;  4JW1 A;  3LKU A;  2XRZ A;  4P29 A;  5FTP A;  3QWW A;  3ZYM A;  1Y6I A;  3EHM A;  1U3C A;  4R7L A;  3R7Q A;  2A4Z A;  3ZPJ A;  5CCM A;  5HI7 A;  4U0U A;  2VTB A;  2PZI A;  2CHX A;  3FDH A;  3JUI A;  2OOE A;  3LVQ E;  3Q49 B;  1H2T C;  1ZBP A;  4UWK A;  5A6C A;  2C2L A;  1MQS A;  3FEY A;  3QB2 A;  4RVB A;  5FZR A;  4FJY A;  4YND A;  1P5Q A;  4D10 C;  2LAI A;  2PM6 A;  3FUL A;  3CV0 A;  4HOQ A;  3ZYQ A;  4BT8 A;  3SFZ A;  5JHB A;  1PAQ A;  2BTD A;  3G2U A;  4NRH B;  2VYI A;  2VJ8 A;  1BPO A;  3BG1 B;  3AU4 A;  4MLP A;  5BV1 A;  3KEZ A;  5A7D B;  3RKV A;  4I43 A;  5BW8 C;  3S2A A;  2XPI A;  3TXM A;  4G25 A;  1NZN A;  1Z3Y A;  4L2Y A;  4FA6 A;  3QWP A;  4FAD A;  1EPU A;  3AS8 A;  2E2E A;  2BF0 X;  3D9I A;  2XGO A;  3LVR E;  2IOS A;  4LUN U;  2AWI A;  3D9J A;  4K03 A;  1HG5 A;  3UUX A;  1FCH A;  3NZS A;  4GCN A;  4BFR A;  1OWN A;  4TV3 A;  2IU1 A;  4FHK A;  2CFU A;  3GZ2 A;  2Y4U A;  4WWO A;  2RD0 A;  2DCP A;  4KXK B;  5E75 A;  3FUD A;  2LSV A;  4GML A;  3S7F A;  4A55 A;  2WXQ A;  4OVU A;  2KCL A;  3CVY A;  2IQC A;  2XGS A;  1E96 B;  4GZD A;  2MOW A;  3FY4 A;  3QKY A;  3MV3 B;  3BG0 B;  3KAE A;  3T5X A;  2L9B A;  3HVE A;  1QZ2 A;  2HYZ A;  3OAW A;  3PS6 A;  2WQH A;  2I1J A;  3ONL A;  4LCT A;  2AXZ A;  1X5B A;  4U63 A;  3CVN A;  3D9L A;  2XCC A;  5AJL A;  1ELW A;  3FTZ A;  4E85 A;  2PQR A;  3QOU A;  2FBN A;  2OND A;  3FTV A;  1OWP A;  3U66 A;  3IHV A;  4GB9 A;  5LCW C;  3U64 A;  3OTN A;  4DLO A;  4JEU A;  5J08 A;  2Q7F A;  1GW6 A;  2X6F A;  3HDX A;  4L7T A;  3D9M A;  2XHE A;  3I5P A;  1UW4 B;  3CST A;  3LYA A;  2NXP A;  3O48 A;  2WXL A;  4JA9 A;  4PS7 A;  5AJD A;  3D9O A;  3GZS A;  2LSU A;  3HYM B;  3UT7 A;  3WXX A;  1E8W A;  3AS4 A;  2X6K A;  4GA0 A;  4PH4 B;  2C0L A;  3L13 A;  3AU5 A;  2YHC A;  4J8S A;  3PRZ A;  2NSZ A;  3PDN A;  3U3W A;  1HFA A;  2WMO A;  3E4B A;  3GW4 A;  3MEK A;  3FU3 A;  3TAX A;  2C0M A;  3VTY A;  4I1A A;  3EIJ A;  5FJY A;  5LP0 A;  2L0T B;  3NF1 A;  4JZY A;  5ANR A;  1E8Y A;  3SBS A;  4EZK A;  3RK6 A;  4F1S A;  4N3A A;  5LOZ A;  5A23 A;  2WXJ A;  4AJW A;  1H2V C;  1SQM A;  2CG2 A;  2EQX A;  4JVS A;  3R7R A;  4ACK A;  3T5V A;  2PQN A;  2LO6 A;  2VGX A;  4HFG A;  1A17 A;  2VSN A;  3ML8 A;  4UWG A;  4A1G A;  3OXG A;  4FLB A;  4FHJ A;  2QFC A;  4AEZ C;  3FUM A;  4C9B B;  4HVB A;  1B89 A;  4UQX A;  1OWL A;  3FTX A;  3G2S A;  1OWM A;  4LER A;  4XIF A;  2CG3 A;  2ZU6 B;  2QY7 A;  4DK5 A;  3SF4 A;  3QWV A;  3L08 A;  5FWQ A;  3LPZ A;  4W9R A;  1UN8 A;  2VTB B;  3QJZ A;  2UWJ G;  1IYG A;  2CHZ A;  4WAF A;  3SNX A;  4JEH A;  3SGH A;  2AXV A;  2YQ8 A;  1NP7 A;  4I6E A;  2V5F A;  4GYW A;  1DNP A;  5T4Y A;  3CGH A;  2BUG A;  1TJF A;  5ENN A;  3BEE A;  4LEU A;  4EEC A;  5G04 J;  3FTU A;  1TJC A;  2VSO E;  3LDZ A;  3QNK A;  4HLE A;  4QFV A;  4WWP A;  1KLX A;  4F7A A;  2IJG X;  4BY6 A;  5FZQ A;  4B8C B;  1L5J A;  1SZA A;  1HZ4 A;  3FUI A;  3K9I A;  4G26 A;  1FVH A;  4FUL A;  5FZS A;  5G05 C;  3RIB A;  3VLE A;  5BT1 A;  3D9K A;  1KT1 A;  3RU0 A;  1N54 A;  3PH0 C;  2CHW A;  2AW6 A;  3FEX A;  4JHJ A;  4BSX A;  2E0I A;  3B7S A;  3T8M A;  4TRQ A;  4RSY A;  3TG4 A;  4AP2 A;  3ASG A;  1W3B A;  5JJ6 A;  2VGY A;  4NAC A;  3ZIM A;  3UPV A;  3G2T A;  2I6H A;  3IBE A;  3CK9 A;  4GZ5 A;  4WWN A;  1LF8 A;  4GZ3 A;  4JHR A;  3DBS A;  2R17 C;  3CSF A;  5KJM A;  2J4B A;  4Q94 A;  4UQY A;  2DBA A;  4APO A;  1DVP A;  4I9C A;  3ESK A;  4I17 A;  3FUE A;  3EDT B;  4G24 A;  3HVE B;  4GZ6 A;  2FUL A;  5CHE E;  4PS8 A;  3CVU A;  3ML9 A;  3IV0 A;  4BX8 A;  1ELK A;  3PRE A;  2IOL A;  3MKQ A;  4U0S A;  4V3I A;  2R5S A;  3L54 A;  1HG2 A;  4JXT A;  5BUZ A;  3JQ0 A;  4I6J A;  2WXO A;  5KJK A;  4AY6 A;  3LS8 A;  5J90 A;  3MX3 A;  4IN3 B;  4HOU A;  1PY1 A;  2KCK A;  2WXK A;  2AXU A;  3HHM A;  4XKC A;  3ASH A;  3FU6 A;  1TEZ A;  2J07 A;  5AYW D;  4UQZ A;  3RRM B;  2XGM A;  3MJW A;  3OXF A;  3I4R B;  3UX4 A;  4EBA G;  1QNF A;  3JCK C;  2L0I A;  1S0P A;  3CLJ A;  4ANW A;  4B94 A;  4UI9 K;  4CT4 A;  4J6I A;  4J8D A;  4EZJ A;  4AM9 A;  1Y8M A;  4KVM A;  4ABN A;  2A5U A;  3FHE A;  5D0Q D;  3CQC B;  3Q47 B;  2I1K A;  2DIW A;  3CK8 A;  1E8Z A;  1E7U A;  3ULQ A;  3D9P A;  2XPY A;  2I9C A;  4ILH B;  3RO3 A;  3LY8 A;  3SZ7 A;  4CT0 A;  2X38 A;  3CVQ A;  4PS3 A;  5DIZ A;  1EF1 C;  4F3V A;  4B8A A;  2XEV A;  2WXN A;  4ILG A;  2WVI A;  3APF A;  4A3V A;  3LY7 A;  2PM7 A;  3N71 A;  2VGX B;  4HXI A;  3L17 A;  4I6G A;  2WB2 A;  3ESL A;  3SI5 A;  3CEQ A;  2KM4 A;  2KC7 A;  3CHO A;  3UT4 A;  1H19 A;  3TL5 A;  3TJP A;  3ZHE A;  4L2L A;  3KS2 A;  4XI9 A;  3UMV A;  4IRU A;  3ASF A;  3P2B A;  5C1D A;  4N5C A;  3NQP A;  3ASD A;  3JQ1 A;  2JEK A;  4GYY A;  1JWG A;  3D9N A;  4NUR A;  3CVL A;  4DPR A;  1UJK A;  2UY1 A;  5G55 A;  4ME2 A;  3LEW A;  3OXL A;  3MCX A;  4LRZ A;  2X6I A;  3APD A;  2HM8 A;  2GRL A;  4JA7 A;  4Y6W A;  3CVV A;  3PEV B;  4EZL A;  3FU0 A;  2WXH A;  2Y3A A;  2XPZ A;  3IKO B;  1HO8 A;  3GZ1 A;  2J09 A;  2WXM A;  4GAA A;  2XRY A;  4DLQ A;  1WAO 1;  5DBK A;  4FP7 A;  2WXG A;  4UI9 J;  4DJA A;  4AVX A;  3P1U A;  1N52 A;  3U9W A;  2WQ7 A;  3FH5 A;  5EX3 A;  4KYO B;  4URK A;  3CVX A;  5FQ6 A;  1IQU A;  4UWH A;  3PNT B;  4CEM A;  5HQ8 A;  4EQF A;  2LAH A;  4AXH A;  5FQ8 A;  3VTX A;  2KAT A;  3U4T A;  5ANL A;  3IEG A;  2XCB A;  2ILR A;  2V0P A;  4GA1 A;  2LNI A;  5C2Y A;  2IF4 A;  4OYS A;  3JYS A;  3FUN A;  3I3N A;  3QAR A;  2J08 A;  1JPL A;  4XI0 A;  2YHE A;  3TG5 A;  3D3M A;  3ONK A;  3ZN3 A;  4JL0 A;  2MRI A;  4CCA A;  3SD5 A;  4O6F A;  4C0M A;  4N3B A;  3IHY A;  4RG6 A;  2J4D A;  4U8H A;  4BTB A;  5KJL A;  4KBQ A;  2YNQ A;  1XGW A;  3ZGQ A;  3LY9 A;  4G23 A;  4E6H A;  5CCL A;  3L6A A;  3S7B A;  3APC A;  4U07 A;  3B7U X;  1HS6 A;  2Y4T A;  1XNF A;  5BV0 A;  4HOT A;  2OV8 A;  3MV2 B;  4IYP A;  4WND A;  3CKC A;  2NC9 A;  4L23 A;  2X6H A;  3PEU B;  5BNW A;  3FP3 A;  3PNL B;  5EX0 A;  1KT0 A;  4MS6 A;  1EDU A;  4AV7 A;  3RO2 A;  4KZC A;  3VLF A;  4HOS A;  3FUJ A;  3CKB A;  5KCM A;  3TXN A;  4GA2 A;  3Q15 A;  4GMJ A;  3PUK A;  5FQ4 A;  4G11 A;  4FC8 A;  3CK7 A;  3RRN B;  3RJV A;  3CVP A;  2VQ2 A;  2L6J A;  3Q4A B;  2V8S E;  4GU5 A;  3MKR A;  3QAQ A;  4N2S A;  4OVV A;  2HO1 A;  4G2V A;  4PUC A;  5EDS A;  2FO7 A;  3G2V A;  4I1O B;  2I2O A;  3ZYL A;  3FTW A;  3ZFW A;  2KZT A;  4ILI A;  3GYZ A;  4M3O A;  4N39 A;  4UI9 C;  4ACL A;  2WM9 A;  5CMY A;  4CDM A;  5T3R A;  5CMW A;  3MGB A;  1QQE A;  4Q96 A;  2KCV A;  5FQ7 A;  2HR2 A;  3EHN A;  4BTA A;  3G2W A;  5LX8 A;  1MHQ A;  2GW1 A;  4U0Z A;  3CQG B;  4BWR A;  1HX8 A;  3ZYK A;  1ELR A;  4UWF A;  3ZW3 A;  4WNE A;  3LJ3 A;  4B0Z A;  4APF A;  2R59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...