5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
b'HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
3J5QB 3ZU7B 4HRLA 4RLYA 5ENOD 4K5CA 1OY3D 4U95D 3KEAA 1K1AA 1DCQA 1MYOA 2XEEA 3V2XA 3C5RA 3JXJA 5ENRD 4QFVA 5ENSD 3UTMA 3V30A 3T8KA 2DVWA 4LSZE 4U8YD 2ZGDA 3JXIA 2XZDG 3TWTA 4DX1A 2AJAA 2DZOA 5FIOA 5HRYA 5KNHD 2F8XK 3J5PA 3UI2A 2PNNA 2NYJA 3B7BA 1IXVA 3B95A 4GPMA 4J7WA 1K3ZD 4LNUD 5EILA 4B93B 4JB8P 5EN5D 3ZNGA 3W9GA 3TWWA 4ATZD 3AJIA 3V2OA 1SW6A 1BD8A 3JUEA 5AQ7A 4HLLA 5EIDA 4HB5A 1DC2A 3EHQA 2Y1LE 2B0OE 1YCSB 1NFIE 3HRAA 4CYMD 5EYLA 4OAUC 2BKGA 2J8SD 2V4HC 2A5EA 4U8VD 2DWZA 5AN8A 5HKPA 2DZNA 3DEPA 4HRMB 5KBAA 1A5EA 4TUMA 4DUIA 2QYJA 5CEDB 2V5QC 4J8YA 5AQ9A 3TWSA 3UXGA 1TR4A 1BLXB 2XENA 3NBNB 4OAVB 4HQDA 3TWUA 5ITZF 4HBDA 3TWQA 4DRXE 4HI9A 4NIKA 2F37A 3F6QA 1WG0A 3AAAC 2VGEA 5ENPD 2ETCA 4N5QA 3TWRA 4K5AB 1MX2A 2KXPC 3LJNA 5D66A 4LG6A 4HRNA 5BXUA 5ENQD 4UUCA 1UOHA 3SO8A 2ETBA 4O1PA 3T9KA 5AAOA 1IKND 4A63B 1AWCB 5AARA 3IXEA 4F6RD 1MX6A 5FINA 1D9SA 4DX2A 1N11A 3W9FA 1N0QA 2P2CP 2RFMA 4GMRA 4HNAD 4ZFHA 4G8LA 4ZHBA 4BETA 5AQBA 4HI8A 4BESA 5HS0A 4BSZB 4Z68A 1WDYA 1BI7B 3V31A 1N0RA 2ETAA 5CECB 1G3NB 5JA4D 4QQIA 5KWDA 4K5BA 2KBXA 1YMPA 2JABA 5CERB 4U96D 5EYPF 2BKKB 2XZTG 1IHBA 1OT8A 2ZGGA 2F8YA 4YDYA 4F1PA 2XEHA 3HG0D 2L6BA 1AP7A 3DEOA 1BU9A 5JMND 2MYOA 4C48B 3NOCD 5BXOA 4G8KA 3D9HA 3NOGD 5CBOA 2QC9A 5CEAA 3EHRA 1QYMA 1SVXA 5KNGA 5CBNA 1MX4A 1S70B 1K1BA 2RFAA 4DX7D 1YYHA 3V79K 4DX6D 5AQAA 4YDWA 3Q9NC 5ENTD 4BERA 5EIBE 3EU9A 4CZ2D 3TWXA 4O60A 3Q9UC 3TWVA 4O1OA 4BEPA 3ZUVB 1MJ0A 4DX5D 2HE0A 2Y0BG 1BI8B 3ZKJA 2FO1E
chains in the Genus database with same CATH superfamily
2PZIA 3DSTA 4J8SA 2AXZA 3V30A 4BT9A 3HXDA 2Y4TA 1UN8A 3PZ4A 2DCPA 4GTTA 3MGBA 4HLLA 1HS6A 3DSUA 3RKVA 4LERA 3LDZA 2KM4A 3SY2A 2V4HC 3R7RA 2XRYA 4XIFA 1A17A 4JXTA 5C2YA 3NBNB 3PNLB 4OAVB 3TWUA 1S0PA 3DPDA 4N2SA 4H7YA 3E34A 2KATA 4GB9A 2R5SA 3BQOA 1D9SA 3PUKA 2GRPB 5D0QD 4U0SA 4GYOA 4UQZA 2H6FA 3L16A 1IHGA 1OWNA 1FCHA 3VTXA 3CHRA 3ZVVA 3MA5A 5FZRA 5CCMA 1WY6A 3D9NA 4JHKA 4B8AA 1OT8A 2ZGGA 2I2OA 3SI5A 3CVYA 1TNOA 5G2NA 3Q79A 5C1DA 2C0MA 1QYMA 1SVXA 1SA4A 3QWPA 2X6IA 3QWWA 3PVLA 3NB2A 2J08A 3ZUVB 4DX5D 1JWGA 4HRLA 2WXRA 4ANWA 5FZQA 1MYOA 3CHPA 4CEMA 3BUAA 3UT4A 3BU8A 4Y6WA 4B0ZA 3SFZA 1U3CA 5EIDA 4G2VA 3CK8A 5A23A 2VGXA 5EYLA 2ZIRA 3FUMA 2VQ2A 2J8SD 3SD5A 4U8VD 3AG4E 5KBAA 3WG7E 1KZPA 5CEDB 3ZHEA 4NACA 2XGSA 3UMVA 4HI9A 3LPZA 2VGEA 3KSQA 3L6AA 2ETCA 5BT1A 5D66A 3Q7FA 2IOSA 2MHKA 5E75A 5AARA 1K8KG 1FT2A 4GA2A 2XEVA 1IQRA 4ACKA 3WXXA 1JPLA 4UWLA 4WNEA 5FTPA 4XZ4A 3RRMB 2BKKB 1BPOA 3D9JA 4C48B 2PM6A 3D9HA 3PH0C 4GTMA 3QWVA 2C0LA 3ASOE 2R17C 1HFAA 1MX4A 4KMOA 3V79K 5EIBE 5E76A 1Z5SC 3Q9UC 4XI9A 2J09A 3E4BA 5FQ6A 3L22A 2GROB 3FUNA 1O1RA 4IYPA 4KVMA 4I6EA 4I6GA 4C9BB 5T8IA 4U8HA 1UJJA 3ZFWA 4XKCA 4ACLA 2UWJG 5G55A 5AIJA 2WQ7A 2BUGA 4CYMD 2BKGA 2WXMA 2DZNA 2RKKA 5CRVA 2MOWA 3BG0B 5FQ4A 4J8YA 1HXIA 5BUZA 1TR4A 3QOUA 4N3CA 2WMOA 2LXLA 1H2VC 2YQ8A 2F37A 2VJ8A 4FA6A 3TWRA 2MRIA 1MX2A 2GW1A 2V4LA 3SBTB 3FH7A 4XI0A 3HXBA 2Y4UA 1TN8A 3W9FA 3SGHA 5BPPA 4Z68A 3FDHA 3HXFA 2ETAA 5FZSA 4A1SA 1H6PA 1KLXA 4KXKB 2V5FA 3CVNA 3RO2A 5CCLA 4KBQA 4WNFA 1D8DA 3S7BA 3C3QA 5BV0A 2J9QA 3HG0D 1E90A 3CGHA 3NOCD 3NOGD 3LY8A 3EHRA 4OVVA 2CHWA 2XPZA 1TJCA 4FC8A 4LNBA 2RFAA 1E8WA 1JWFA 2QYUA 1PAQA 4CZ2D 5LP0A 5EX0A 1MZCA 1MJ0A 4N3BA 3ZKJA 2FF4A 2L9BA 4TXRA 4K5CA 4LUNU 3UUXA 3V2XA 2VSYA 5ARFA 2XZDG 3APCA 2AJAA 4LRZA 3QC1A 1IXVA 2AWIA 4HXIA 3ZNGA 3TWWA 3BEEA 3JCKC 3UPVA 2VYIA 2R2LA 1E7UA 3GZ1A 5ARGA 2HM8A 1PC2A 3AU5A 3DXMG 4DK5A 4E85A 4PS3A 4UQYA 1TJFA 3SF4A 2P9LG 3F6QA 4PDXA 1V54E 3RK6A 4BWRA 3ASGA 3PEUB 1DCEA 1V55E 5G05J 3BG1B 3FHEA 2BTDA 4EZKA 2KBXA 3L82A 3G2WA 5BV1A 2AXUA 2H6GA 2R02A 3CHMA 4GMJA 2NXPA 4BTAA 4MRUA 5CEAA 4GTVA 3VLEA 3SZ7A 2Y3AA 1S70B 5ANLA 2X6HA 4GZCA 5D2MC 4N5CA 3Q9NC 3LEWA 3TWVA 3SFXA 4A63B 2Y0BG 5LX8A 3FUKA 5A7DB 3ZHEB 2WMNA 1EPUA 3KS2A 4DX1A 2I1KA 4I1AA 1XGWA 3MV3B 2EIKE 4J7WA 1X81A 4Q69A 4UI9J 4ATZD 2P9SG 4HB5A 4MBGA 2CFZA 3I5PA 4OAUC 3I4RB 2WXHA 2XPYA 3DSVA 4FJZA 4HRMB 3ONLA 4JA9A 1Y8MA 2V5QC 4MLPA 2I6HA 3PNTB 4NIKA 2XPIA 2XS1A 3FWVA 3ZRHA 2NC9A 4KT6B 5AAOA 4XEIG 4PH4B 2IY0C 3E33A 2GRMA 1N0RA 5A6CA 4TUUA 5CECB 3TG4A 3L54A 3DXKG 4AM9A 3ONKA 3OXFA 3LVQE 4L1BA 3G2UA 2YINA 4I6JA 3PZDA 4G8KA 4AV7A 3HXCA 2J4DA 2IQCA 2JEKA 3AS4A 2OVBA 2WB2A 4O60A 4UWHA 3ISMC 3U66A 2ZU6B 4UI9K 3TGOA 4RLYA 3QKYA 3QARA 3UTMA 5ENSD 1MHQA 4WWOA 4UWGA 3ULQA 2DZOA 5HRYA 4YVOA 2IO2C 4I9CA 3E37A 5EN5D 5DIZA 3T5VA 1UG3A 4EHMA 2AVPA 5J08A 4Q96A 3ZXPA 4RQIA 4RVBA 3D9PA 1ZB1A 3ENEA 1HH8A 3PRZA 4DUIA 2IU1A 4FU3A 4HVBA 3FH5A 1D8EA 3KSLA 4J8FA 3CHSA 2IONA 5BXUA 2WXJA 2OVFA 4GZ6A 2WVIA 4O1PA 1IKND 3K9IA 4NRHB 3IXEA 3S7DA 1MX6A 2E0IA 5B3SE 4JL0A 1QZ2A 4AVXA 4PS8A 2XS8A 3MX3A 5FWQA 2A5UA 4QQIA 4I17A 1JCSA 5EYPF 4YDYA 1OCCE 3FUEA 5EKQD 4HLEA 5CBOA 4YDOA 1ELRA 4LCTA 4ILGA 1S63A 4BERA 4BEPA 4DI3A 1OWMA 2OV8A 2ZXWE 4CT0A 3PUJA 3KEAA 1DCQA 4ILIA 3D9IA 2GRNB 3FUDA 2WQ6A 3SFYA 3ZXSA 4A3TA 4KYOB 2LSVA 3W9GA 4IULA 1SW6A 2FULA 4G26A 3PE4A 2NSZA 1X5BA 3DWLG 3D9MA 1N52A 5JHBA 2PQNA 3MKQA 2QYJA 3FU3A 2IJGX 4HQDA 4DRXE 3IHYA 4AIFA 4U0ZA 1OCRE 2LUHA 1TNZA 3LYAA 3FY4A 5AENA 4DX2A 1E8YA 3B7SA 3FTZA 4BESA 1TNUA 3OAWA 3V31A 4EBAG 4NQ0A 4F3VA 4B8CB 2XQ0A 4XKBA 1H2TC 3S7FA 3TXNA 5DBKA 2F8YA 4EZJA 2L6BA 2XCBA 5JMND 1XNFA 3I3NA 1S64A 2WXFA 3CKCA 3CHQA 3GZ2A 1LD7A 2CHXA 3PREA 3GZSA 2L6JA 2HO1A 3PE3A 5HI7A 3ZYMA 3D9KA 2GRLA 3C3RA 2UY1A 3ASNE 2XEEA 4GZDA 4LSZE 3UKUG 2ZGDA 2WXOA 4G11A 2GGFA 3S7JA 3J5PA 4C0MA 3HVEB 3L9TA 2EIJE 1N54A 3I4GA 3DSSA 2P9PG 1TNBA 2GRRB 3FEYA 3NAWA 1YCSB 3SHFA 3HRAA 2P9KG 2DWZA 3AU4A 4AY5A 3QNKA 2BEDA 4H7XA 3JQ1A 4GYWA 3CQCB 5FQ8A 4G25A 2PL2A 3MYVA 2VTBA 2GRQB 2IF4A 1JCRA 5JJTA 3CEQA 3EU5A 3LXUX 3NF1A 4Q94A 2J07A 3IKOB 1AWCB 3Q5MA 4F6RD 3FUFA 2VSXE 4G8LA 4GCNA 2KZTA 5HS0A 1ELWA 4U04A 4HFGA 5AYWD 1EDUA 4OVUA 4APFA 1HE8A 3O4ZA 5BW8C 2HR2A 4DPRA 4BX9A 3RIBA 1DNPA 4G1TA 4M7CA 4CCAA 4DX6D 3DBSA 4KVOA 5ANRA 1OWOA 3J5QB 4U95D 4EZLA 1TN6A 4ABNA 3C5RA 3AG2E 1U2VG 3VLFA 3T8MA 4I1MA 1LD8A 4B93B 2I1JA 3ASDA 4IRUA 2WXLA 1OCOE 4FLBA 4XX5A 3VTYA 5KJLA 3B13A 1SA5A 1NL4A 5CRUA 3QAQA 3QJZA 3Q47B 1KT0A 4TUMA 3Q49B 4EECA 1E7VA 4FADA 3G2SA 4L23A 3FTWA 4O6FA 3KD7A 4F1SA 2IOLA 2WXPA 3AAAC 1HX8A 1OXJA 4G24A 3LJNA 3UM2A 2Y69E 3LS8A 3FULA 5BNWA 4CT4A 2OEVA 4PUCA 4BSZB 3CQGB 3R9AB 2KCVA 3EHNA 3UM3A 4LEUA 4ANUA 4F1PA 5J90A 1H6KA 3R7QA 2WXNA 3RJVA 1U3DA 2DYSE 3CSFA 5G05C 3Q4AB 3SBSA 3MCXA 4DX7D 1ELKA 3B7RL 3TWXA 2WXIA 3PEVB 3ZU7B 3CK9A 5EX3A 1TEZA 2KC7A 4BSXA 1FT1A 3MKQB 3B7TA 2E2EA 4I2WA 5FIOA 4X8QA 3JYSA 1TYQG 5EILA 1JCQA 4I43A 1HZ4A 3URZA 3QB2A 4HOSA 1N4RA 1HG2A 4CDNA 2VGXB 4LNGA 4JEHA 3EHQA 4GMLA 1N4QA 2BF0X 2PQRA 3CIAA 3JQ0A 2A5EA 5AN8A 5KJKA 1Z3YA 2H6IA 1OCZE 4WAFA 4JHRA 3TWSA 4AEZC 3FUJA 5H7PA 4J8EA 4UI9C 4BX8A 2Q7FA 4KZCA 3PDNA 3UIOC 1UOHA 1FVHA 2LO6A 4L2YA 4ZFHA 4K03A 3ZIMA 4I9EA 4I1OB 1E8ZA 5CMYA 3JUIA 1Y6IA 2RG8A 2X6JA 4A3VA 4HOTA 4UWKA 4L7TA 4URKA 2JABA 1QQEA 2CFUA 1OUVA 3DRAA 4D10C 1UJKA 1BU9A 2LXMA 3ESLA 5CBNA 2QY7A 3RSEG 2YHCA 1W3BA 4NURA 3CSTA 1E8XA 4APOA 4O1OA 2FO1E 3TAXA 1KT1A 3UM1A 1UW4B 2X38A 4EPZA 3Q15A 4I2ZA 4CGVA 5ENRD 2P9IG 3IEGA 3JXIA 3FTXA 4P29A 2OOEA 1ZBPA 3OXLA 2V0PA 1QNFA 3RO3A 3ML9A 2V8SE 3CVPA 4TV3A 3AJIA 3ASHA 4E6HA 5ENNA 4GAAA 2YNQA 3HYMB 2KZTB 3ABKE 3RAUA 4JVSA 4J0UA 4N39A 4U0UA 3FTSA 1A5EA 1B89A 5LOZA 1DVPA 1NA0A 3PZ2A 3T5XA 4N5QA 3FEXA 1O1SA 3AG3E 1N11A 4ZHBA 1N0QA 2P2CP 4HNAD 3ZEFA 3LVRE 4WNDA 2XRZA 3AS5A 3P2BA 5KCMA 3ZW3A 4ILHB 3FP3A 4PS7A 2QC9A 1WAO1 5FQ7A 3AG1E 1N4PA 4BY6A 1IQUA 1YYHA 5JHAA 4CRWA 3HXEA 3UX4A 2IFUA 4A55A 1NA3A 4QFVA 4G23A 5B1AE 3CVXA 2LAIA 3TWTA 3CV0A 4ATGA 3EIQC 4K0RA 4LNUD 2J4BA 3FU5A 2IO3C 4L2LA 1EF1C 2I9CA 4YNDA 4J6IA 3OTNA 3CVLA 1DC2A 1VDYA 2EIME 4AP2A 3MJWA 4HOQA 3L13A 5B1BE 4U07A 2FI7A 4GTPA 3TWQA 1PY1A 4DLQA 1WG0A 2M63A 3QK0A 2LSUA 4GTOA 4HORA 3MV2B 4HRNA 4B94A 3Q73A 3SO8A 4GCOA 2HYZA 4AJWA 5FINA 3ESKA 4HS2A 3ZYQA 3C98A 4V3IA 3HHMA 3L08A 3R9MA 2XZTG 1WM5A 3SNXA 3DEOA 1SZ9A 1OWPA 5BXOA 4ME2A 2FO7A 2F0YA 4TXPA 3LKUA 5LFAA 3HIZA 3RRUA 2R59A 3ZN3A 4RG6A 1HO8A 3Q7AA 4JW1A 4JEUA 5ENOD 1OY3D 4JZYA 3APFA 2OCCE 4F53A 5M72A 2DYRE 3UINC 2NYJA 3B95A 3Q78A 3SQVA 4AXHA 4GZ3A 4HOUA 4IN3B 3JUEA 3HDXA 2B0OE 2R03A 1QBQA 5HKPA 5G04J 2XGOA 5G04C 3ABME 1P5QA 4FHJA 5EDSA 5KJNA 3ABLE 2XENA 5LCWJ 1Z6TA 4JHJA 3PZ3A 4W9RA 4ANXA 5ITZF 4HBDA 5LCWC 2QZAA 4KZ0A 5ENPD 2KXPC 5ENQD 4RG9A 4UUCA 1IYGA 4J8DA 4CGWA 2P9UG 3B7UX 4GMRA 4BETA 4HI8A 3U3WA 4C0EA 1E96B 1WDYA 2OEWA 2J49A 4U63A 2QFCA 2ILRA 3ML8A 1YMPA 3IHVA 2DIWA 4AOFA 1H2UA 1FVFA 4N2QA 2WXQA 2XEHA 3OXGA 2AXVA 4BTBA 2MYOA 4EBAA 4WUYA 3U9WA 2WXGA 3S2AA 3Q75A 2VGYA 5CHEE 4JC8A 1KPSB 5AQAA 4YDWA 5ENTD 4FHKA 4TXQA 5HQ8A 1YA0A 5FJYA 3CLJA 3DPYA 1BI8B 3UT7A 4FJYA 3VLDA 4TRQA 1O1TA 1H19A 3TXMA 1K1AA 3CVVA 3N71A 4GA1A 3EDTB 1GW6A 2RD0A 4BFRA 4EQFA 4GPMA 3TL5A 2WM9A 1N95A 1ZU2A 3RRNB 3DSWA 5IY5E 3V2OA 3FU6A 2FEZA 2Y1LE 1NFIE 3EIJA 3FH8A 2B6CA 1N9AA 2CG3A 3ASFA 4R7LA 1NZNA 1Q2ZA 3E32A 4GYYA 4N3AA 2VSNA 3ULYA 2EILE 1N4SA 3UXGA 1BLXB 3U64A 4RSYA 1RZ4A 3U4TA 3CHOA 2JLBA 3PS6A 3APDA 1RW2A 3UKRG 2C2LA 3TJPA 1NI1A 1NP7A 4GTRA 3T9KA 4CDRA 2CG2A 4DI4A 3C72A 3RU0A 3TG5A 4AY6A 4WWPA 2A4ZA 1BI7B 2LAHA 4L9PA 2L0IA 1G3NB 3CVQA 5KJMA 5KWDA 2WQHA 4K5BA 2ONDA 1H6OA 4U96D 2VSOE 3CVUA 1IHBA 1TN7A 3QDNA 4GU5A 5CMWA 4OYSA 2X3MA 3NZSA 5KNGA 2ZISA 1HF8A 4A1GA 4F7AA 5AJLA 3KEZA 2X6KA 3EU9A 3ULEG 3FFLA 3DSXA 3PZ1A 3CR3A 2XHEA 1EYHA 4FP7A 3KAEA 3EHMA 4YVQC 2WXKA 3FU0A 2CHZA 5FT9A 3T8KA 1UN9A 2YHEA 4U8YD 2PM7A 5T3RA 5KNHD 2F8XK 3FUHA 2PNNA 3B7BA 2LNIA 4XE0A 3UQ3A 3NZUA 2DBAA 3CK7A 3C3OA 2H6HA 3AS8A 3O48A 3GYZA 5AQ7A 3FTVA 1LTXA 3D3MA 4GA0A 1Z3XA 2FBNA 3NQPA 1O5MA 3LCAA 3DEPA 2KCLA 4BT8A 2IEJA 4U7EB 4B89A 3MEKA 4LG6A 1JUQA 5T4YA 2X6FA 2P58C 2EINE 4GZ5A 3MZLB 1N94A 4MS6A 3E30A 4JA7A 3EJNA 4YDEA 1L5JA 5JA4D 4Y6CA 1INZA 5CERB 4WWNA 3LY7A 4JD2G 1AP7A 2WPVA 3IBEA 1SZAA 4FULA 2L0TB 3FTUA 2EQXA 2KCKA 2UY1B 3CKBA 2HE0A 5AQ9A 3MKRA 3X2QE 4CDMA 3JXJA 4DLOA 2DVWA 3D9LA 3UM0A 1HU3A 1OWLA 3GW4A 5JJ7A 3UI2A 3G2TA 1K3ZD 4UWFA 1HG5A 4JB8P 3UT8A 4GTQA 3HVEA 1BD8A 2XGMA 5AJDA 3P1UA 3LJ3A 3FUIA 5JJ6A 4GTSA 2AW6A 2VTBB 3EUVA 3ZPJA 2XCCA 4FLHA 1H0AA 1LF8A 4UQXA 2P9NG 4K5AB 3CVWA 1FPPA 2ETBA 3G2VA 3ZGQA 4MKTA 2RFMA 4WNGA 5AQBA 4M3OA 3L17A 3D9OA 3LY9A 1KZOA 1MQSA 3ZYKA 4ANVA 5D0OD 3FTYA 4DJAA 4GPKA 1TNYA 2R05A 1SQMA 3UIPC 1K1BA 4JPSA 3ZYLA 3IV0A
chains in the Genus database with same CATH topology
3J5QB 3ZU7B 4HRLA 4RLYA 5ENOD 4K5CA 1OY3D 4U95D 3KEAA 1K1AA 1DCQA 1MYOA 2XEEA 3V2XA 3C5RA 3JXJA 5ENRD 4QFVA 5ENSD 3UTMA 3V30A 3T8KA 2DVWA 4LSZE 4U8YD 2ZGDA 3JXIA 2XZDG 3TWTA 4DX1A 2AJAA 2DZOA 5FIOA 5HRYA 5KNHD 2F8XK 3J5PA 3UI2A 2PNNA 2NYJA 3B7BA 1IXVA 3B95A 4GPMA 4J7WA 1K3ZD 4LNUD 5EILA 4B93B 4JB8P 5EN5D 3ZNGA 3W9GA 3TWWA 4ATZD 3AJIA 3V2OA 1SW6A 1BD8A 3JUEA 5AQ7A 4HLLA 5EIDA 4HB5A 1DC2A 3EHQA 2Y1LE 2B0OE 1YCSB 1NFIE 3HRAA 4CYMD 5EYLA 4OAUC 2BKGA 2J8SD 2V4HC 2A5EA 4U8VD 2DWZA 5AN8A 5HKPA 2DZNA 3DEPA 4HRMB 5KBAA 1A5EA 4TUMA 4DUIA 2QYJA 5CEDB 2V5QC 4J8YA 5AQ9A 3TWSA 3UXGA 1TR4A 1BLXB 2XENA 3NBNB 4OAVB 4HQDA 3TWUA 5ITZF 4HBDA 3TWQA 4DRXE 4HI9A 4NIKA 2F37A 3F6QA 1WG0A 3AAAC 2VGEA 5ENPD 2ETCA 4N5QA 3TWRA 4K5AB 1MX2A 2KXPC 3LJNA 5D66A 4LG6A 4HRNA 5BXUA 5ENQD 4UUCA 1UOHA 3SO8A 2ETBA 4O1PA 3T9KA 5AAOA 1IKND 4A63B 1AWCB 5AARA 3IXEA 4F6RD 1MX6A 5FINA 1D9SA 4DX2A 1N11A 3W9FA 1N0QA 2P2CP 2RFMA 4GMRA 4HNAD 4ZFHA 4G8LA 4ZHBA 4BETA 5AQBA 4HI8A 4BESA 5HS0A 4BSZB 4Z68A 1WDYA 1BI7B 3V31A 1N0RA 2ETAA 5CECB 1G3NB 5JA4D 4QQIA 5KWDA 4K5BA 2KBXA 1YMPA 2JABA 5CERB 4U96D 5EYPF 2BKKB 2XZTG 1IHBA 1OT8A 2ZGGA 2F8YA 4YDYA 4F1PA 2XEHA 3HG0D 2L6BA 1AP7A 3DEOA 1BU9A 5JMND 2MYOA 4C48B 3NOCD 5BXOA 4G8KA 3D9HA 3NOGD 5CBOA 2QC9A 5CEAA 3EHRA 1QYMA 1SVXA 5KNGA 5CBNA 1MX4A 1S70B 1K1BA 2RFAA 4DX7D 1YYHA 3V79K 4DX6D 5AQAA 4YDWA 3Q9NC 5ENTD 4BERA 5EIBE 3EU9A 4CZ2D 3TWXA 4O60A 3Q9UC 3TWVA 4O1OA 4BEPA 3ZUVB 1MJ0A 4DX5D 2HE0A 2Y0BG 1BI8B 3ZKJA 2FO1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J5Q B;  3ZU7 B;  4HRL A;  4RLY A;  5ENO D;  4K5C A;  1OY3 D;  4U95 D;  3KEA A;  1K1A A;  1DCQ A;  1MYO A;  2XEE A;  3V2X A;  3C5R A;  3JXJ A;  5ENR D;  4QFV A;  5ENS D;  3UTM A;  3V30 A;  3T8K A;  2DVW A;  4LSZ E;  4U8Y D;  2ZGD A;  3JXI A;  2XZD G;  3TWT A;  4DX1 A;  2AJA A;  2DZO A;  5FIO A;  5HRY A;  5KNH D;  2F8X K;  3J5P A;  3UI2 A;  2PNN A;  2NYJ A;  3B7B A;  1IXV A;  3B95 A;  4GPM A;  4J7W A;  1K3Z D;  4LNU D;  5EIL A;  4B93 B;  4JB8 P;  5EN5 D;  3ZNG A;  3W9G A;  3TWW A;  4ATZ D;  3AJI A;  3V2O A;  1SW6 A;  1BD8 A;  3JUE A;  5AQ7 A;  4HLL A;  5EID A;  4HB5 A;  1DC2 A;  3EHQ A;  2Y1L E;  2B0O E;  1YCS B;  1NFI E;  3HRA A;  4CYM D;  5EYL A;  4OAU C;  2BKG A;  2J8S D;  2V4H C;  2A5E A;  4U8V D;  2DWZ A;  5AN8 A;  5HKP A;  2DZN A;  3DEP A;  4HRM B;  5KBA A;  1A5E A;  4TUM A;  4DUI A;  2QYJ A;  5CED B;  2V5Q C;  4J8Y A;  5AQ9 A;  3TWS A;  3UXG A;  1TR4 A;  1BLX B;  2XEN A;  3NBN B;  4OAV B;  4HQD A;  3TWU A;  5ITZ F;  4HBD A;  3TWQ A;  4DRX E;  4HI9 A;  4NIK A;  2F37 A;  3F6Q A;  1WG0 A;  3AAA C;  2VGE A;  5ENP D;  2ETC A;  4N5Q A;  3TWR A;  4K5A B;  1MX2 A;  2KXP C;  3LJN A;  5D66 A;  4LG6 A;  4HRN A;  5BXU A;  5ENQ D;  4UUC A;  1UOH A;  3SO8 A;  2ETB A;  4O1P A;  3T9K A;  5AAO A;  1IKN D;  4A63 B;  1AWC B;  5AAR A;  3IXE A;  4F6R D;  1MX6 A;  5FIN A;  1D9S A;  4DX2 A;  1N11 A;  3W9F A;  1N0Q A;  2P2C P;  2RFM A;  4GMR A;  4HNA D;  4ZFH A;  4G8L A;  4ZHB A;  4BET A;  5AQB A;  4HI8 A;  4BES A;  5HS0 A;  4BSZ B;  4Z68 A;  1WDY A;  1BI7 B;  3V31 A;  1N0R A;  2ETA A;  5CEC B;  1G3N B;  5JA4 D;  4QQI A;  5KWD A;  4K5B A;  2KBX A;  1YMP A;  2JAB A;  5CER B;  4U96 D;  5EYP F;  2BKK B;  2XZT G;  1IHB A;  1OT8 A;  2ZGG A;  2F8Y A;  4YDY A;  4F1P A;  2XEH A;  3HG0 D;  2L6B A;  1AP7 A;  3DEO A;  1BU9 A;  5JMN D;  2MYO A;  4C48 B;  3NOC D;  5BXO A;  4G8K A;  3D9H A;  3NOG D;  5CBO A;  2QC9 A;  5CEA A;  3EHR A;  1QYM A;  1SVX A;  5KNG A;  5CBN A;  1MX4 A;  1S70 B;  1K1B A;  2RFA A;  4DX7 D;  1YYH A;  3V79 K;  4DX6 D;  5AQA A;  4YDW A;  3Q9N C;  5ENT D;  4BER A;  5EIB E;  3EU9 A;  4CZ2 D;  3TWX A;  4O60 A;  3Q9U C;  3TWV A;  4O1O A;  4BEP A;  3ZUV B;  1MJ0 A;  4DX5 D;  2HE0 A;  2Y0B G;  1BI8 B;  3ZKJ A;  2FO1 E; 
#chains in the Genus database with same CATH topology
 2PZI A;  3DST A;  4J8S A;  2AXZ A;  3V30 A;  4BT9 A;  3HXD A;  2Y4T A;  1UN8 A;  3PZ4 A;  2DCP A;  4GTT A;  3MGB A;  4HLL A;  1HS6 A;  3DSU A;  3RKV A;  4LER A;  3LDZ A;  2KM4 A;  3SY2 A;  2V4H C;  3R7R A;  2XRY A;  4XIF A;  1A17 A;  4JXT A;  5C2Y A;  3NBN B;  3PNL B;  4OAV B;  3TWU A;  1S0P A;  3DPD A;  4N2S A;  4H7Y A;  3E34 A;  2KAT A;  4GB9 A;  2R5S A;  3BQO A;  1D9S A;  3PUK A;  2GRP B;  5D0Q D;  4U0S A;  4GYO A;  4UQZ A;  2H6F A;  3L16 A;  1IHG A;  1OWN A;  1FCH A;  3VTX A;  3CHR A;  3ZVV A;  3MA5 A;  5FZR A;  5CCM A;  1WY6 A;  3D9N A;  4JHK A;  4B8A A;  1OT8 A;  2ZGG A;  2I2O A;  3SI5 A;  3CVY A;  1TNO A;  5G2N A;  3Q79 A;  5C1D A;  2C0M A;  1QYM A;  1SVX A;  1SA4 A;  3QWP A;  2X6I A;  3QWW A;  3PVL A;  3NB2 A;  2J08 A;  3ZUV B;  4DX5 D;  1JWG A;  4HRL A;  2WXR A;  4ANW A;  5FZQ A;  1MYO A;  3CHP A;  4CEM A;  3BUA A;  3UT4 A;  3BU8 A;  4Y6W A;  4B0Z A;  3SFZ A;  1U3C A;  5EID A;  4G2V A;  3CK8 A;  5A23 A;  2VGX A;  5EYL A;  2ZIR A;  3FUM A;  2VQ2 A;  2J8S D;  3SD5 A;  4U8V D;  3AG4 E;  5KBA A;  3WG7 E;  1KZP A;  5CED B;  3ZHE A;  4NAC A;  2XGS A;  3UMV A;  4HI9 A;  3LPZ A;  2VGE A;  3KSQ A;  3L6A A;  2ETC A;  5BT1 A;  5D66 A;  3Q7F A;  2IOS A;  2MHK A;  5E75 A;  5AAR A;  1K8K G;  1FT2 A;  4GA2 A;  2XEV A;  1IQR A;  4ACK A;  3WXX A;  1JPL A;  4UWL A;  4WNE A;  5FTP A;  4XZ4 A;  3RRM B;  2BKK B;  1BPO A;  3D9J A;  4C48 B;  2PM6 A;  3D9H A;  3PH0 C;  4GTM A;  3QWV A;  2C0L A;  3ASO E;  2R17 C;  1HFA A;  1MX4 A;  4KMO A;  3V79 K;  5EIB E;  5E76 A;  1Z5S C;  3Q9U C;  4XI9 A;  2J09 A;  3E4B A;  5FQ6 A;  3L22 A;  2GRO B;  3FUN A;  1O1R A;  4IYP A;  4KVM A;  4I6E A;  4I6G A;  4C9B B;  5T8I A;  4U8H A;  1UJJ A;  3ZFW A;  4XKC A;  4ACL A;  2UWJ G;  5G55 A;  5AIJ A;  2WQ7 A;  2BUG A;  4CYM D;  2BKG A;  2WXM A;  2DZN A;  2RKK A;  5CRV A;  2MOW A;  3BG0 B;  5FQ4 A;  4J8Y A;  1HXI A;  5BUZ A;  1TR4 A;  3QOU A;  4N3C A;  2WMO A;  2LXL A;  1H2V C;  2YQ8 A;  2F37 A;  2VJ8 A;  4FA6 A;  3TWR A;  2MRI A;  1MX2 A;  2GW1 A;  2V4L A;  3SBT B;  3FH7 A;  4XI0 A;  3HXB A;  2Y4U A;  1TN8 A;  3W9F A;  3SGH A;  5BPP A;  4Z68 A;  3FDH A;  3HXF A;  2ETA A;  5FZS A;  4A1S A;  1H6P A;  1KLX A;  4KXK B;  2V5F A;  3CVN A;  3RO2 A;  5CCL A;  4KBQ A;  4WNF A;  1D8D A;  3S7B A;  3C3Q A;  5BV0 A;  2J9Q A;  3HG0 D;  1E90 A;  3CGH A;  3NOC D;  3NOG D;  3LY8 A;  3EHR A;  4OVV A;  2CHW A;  2XPZ A;  1TJC A;  4FC8 A;  4LNB A;  2RFA A;  1E8W A;  1JWF A;  2QYU A;  1PAQ A;  4CZ2 D;  5LP0 A;  5EX0 A;  1MZC A;  1MJ0 A;  4N3B A;  3ZKJ A;  2FF4 A;  2L9B A;  4TXR A;  4K5C A;  4LUN U;  3UUX A;  3V2X A;  2VSY A;  5ARF A;  2XZD G;  3APC A;  2AJA A;  4LRZ A;  3QC1 A;  1IXV A;  2AWI A;  4HXI A;  3ZNG A;  3TWW A;  3BEE A;  3JCK C;  3UPV A;  2VYI A;  2R2L A;  1E7U A;  3GZ1 A;  5ARG A;  2HM8 A;  1PC2 A;  3AU5 A;  3DXM G;  4DK5 A;  4E85 A;  4PS3 A;  4UQY A;  1TJF A;  3SF4 A;  2P9L G;  3F6Q A;  4PDX A;  1V54 E;  3RK6 A;  4BWR A;  3ASG A;  3PEU B;  1DCE A;  1V55 E;  5G05 J;  3BG1 B;  3FHE A;  2BTD A;  4EZK A;  2KBX A;  3L82 A;  3G2W A;  5BV1 A;  2AXU A;  2H6G A;  2R02 A;  3CHM A;  4GMJ A;  2NXP A;  4BTA A;  4MRU A;  5CEA A;  4GTV A;  3VLE A;  3SZ7 A;  2Y3A A;  1S70 B;  5ANL A;  2X6H A;  4GZC A;  5D2M C;  4N5C A;  3Q9N C;  3LEW A;  3TWV A;  3SFX A;  4A63 B;  2Y0B G;  5LX8 A;  3FUK A;  5A7D B;  3ZHE B;  2WMN A;  1EPU A;  3KS2 A;  4DX1 A;  2I1K A;  4I1A A;  1XGW A;  3MV3 B;  2EIK E;  4J7W A;  1X81 A;  4Q69 A;  4UI9 J;  4ATZ D;  2P9S G;  4HB5 A;  4MBG A;  2CFZ A;  3I5P A;  4OAU C;  3I4R B;  2WXH A;  2XPY A;  3DSV A;  4FJZ A;  4HRM B;  3ONL A;  4JA9 A;  1Y8M A;  2V5Q C;  4MLP A;  2I6H A;  3PNT B;  4NIK A;  2XPI A;  2XS1 A;  3FWV A;  3ZRH A;  2NC9 A;  4KT6 B;  5AAO A;  4XEI G;  4PH4 B;  2IY0 C;  3E33 A;  2GRM A;  1N0R A;  5A6C A;  4TUU A;  5CEC B;  3TG4 A;  3L54 A;  3DXK G;  4AM9 A;  3ONK A;  3OXF A;  3LVQ E;  4L1B A;  3G2U A;  2YIN A;  4I6J A;  3PZD A;  4G8K A;  4AV7 A;  3HXC A;  2J4D A;  2IQC A;  2JEK A;  3AS4 A;  2OVB A;  2WB2 A;  4O60 A;  4UWH A;  3ISM C;  3U66 A;  2ZU6 B;  4UI9 K;  3TGO A;  4RLY A;  3QKY A;  3QAR A;  3UTM A;  5ENS D;  1MHQ A;  4WWO A;  4UWG A;  3ULQ A;  2DZO A;  5HRY A;  4YVO A;  2IO2 C;  4I9C A;  3E37 A;  5EN5 D;  5DIZ A;  3T5V A;  1UG3 A;  4EHM A;  2AVP A;  5J08 A;  4Q96 A;  3ZXP A;  4RQI A;  4RVB A;  3D9P A;  1ZB1 A;  3ENE A;  1HH8 A;  3PRZ A;  4DUI A;  2IU1 A;  4FU3 A;  4HVB A;  3FH5 A;  1D8E A;  3KSL A;  4J8F A;  3CHS A;  2ION A;  5BXU A;  2WXJ A;  2OVF A;  4GZ6 A;  2WVI A;  4O1P A;  1IKN D;  3K9I A;  4NRH B;  3IXE A;  3S7D A;  1MX6 A;  2E0I A;  5B3S E;  4JL0 A;  1QZ2 A;  4AVX A;  4PS8 A;  2XS8 A;  3MX3 A;  5FWQ A;  2A5U A;  4QQI A;  4I17 A;  1JCS A;  5EYP F;  4YDY A;  1OCC E;  3FUE A;  5EKQ D;  4HLE A;  5CBO A;  4YDO A;  1ELR A;  4LCT A;  4ILG A;  1S63 A;  4BER A;  4BEP A;  4DI3 A;  1OWM A;  2OV8 A;  2ZXW E;  4CT0 A;  3PUJ A;  3KEA A;  1DCQ A;  4ILI A;  3D9I A;  2GRN B;  3FUD A;  2WQ6 A;  3SFY A;  3ZXS A;  4A3T A;  4KYO B;  2LSV A;  3W9G A;  4IUL A;  1SW6 A;  2FUL A;  4G26 A;  3PE4 A;  2NSZ A;  1X5B A;  3DWL G;  3D9M A;  1N52 A;  5JHB A;  2PQN A;  3MKQ A;  2QYJ A;  3FU3 A;  2IJG X;  4HQD A;  4DRX E;  3IHY A;  4AIF A;  4U0Z A;  1OCR E;  2LUH A;  1TNZ A;  3LYA A;  3FY4 A;  5AEN A;  4DX2 A;  1E8Y A;  3B7S A;  3FTZ A;  4BES A;  1TNU A;  3OAW A;  3V31 A;  4EBA G;  4NQ0 A;  4F3V A;  4B8C B;  2XQ0 A;  4XKB A;  1H2T C;  3S7F A;  3TXN A;  5DBK A;  2F8Y A;  4EZJ A;  2L6B A;  2XCB A;  5JMN D;  1XNF A;  3I3N A;  1S64 A;  2WXF A;  3CKC A;  3CHQ A;  3GZ2 A;  1LD7 A;  2CHX A;  3PRE A;  3GZS A;  2L6J A;  2HO1 A;  3PE3 A;  5HI7 A;  3ZYM A;  3D9K A;  2GRL A;  3C3R A;  2UY1 A;  3ASN E;  2XEE A;  4GZD A;  4LSZ E;  3UKU G;  2ZGD A;  2WXO A;  4G11 A;  2GGF A;  3S7J A;  3J5P A;  4C0M A;  3HVE B;  3L9T A;  2EIJ E;  1N54 A;  3I4G A;  3DSS A;  2P9P G;  1TNB A;  2GRR B;  3FEY A;  3NAW A;  1YCS B;  3SHF A;  3HRA A;  2P9K G;  2DWZ A;  3AU4 A;  4AY5 A;  3QNK A;  2BED A;  4H7X A;  3JQ1 A;  4GYW A;  3CQC B;  5FQ8 A;  4G25 A;  2PL2 A;  3MYV A;  2VTB A;  2GRQ B;  2IF4 A;  1JCR A;  5JJT A;  3CEQ A;  3EU5 A;  3LXU X;  3NF1 A;  4Q94 A;  2J07 A;  3IKO B;  1AWC B;  3Q5M A;  4F6R D;  3FUF A;  2VSX E;  4G8L A;  4GCN A;  2KZT A;  5HS0 A;  1ELW A;  4U04 A;  4HFG A;  5AYW D;  1EDU A;  4OVU A;  4APF A;  1HE8 A;  3O4Z A;  5BW8 C;  2HR2 A;  4DPR A;  4BX9 A;  3RIB A;  1DNP A;  4G1T A;  4M7C A;  4CCA A;  4DX6 D;  3DBS A;  4KVO A;  5ANR A;  1OWO A;  3J5Q B;  4U95 D;  4EZL A;  1TN6 A;  4ABN A;  3C5R A;  3AG2 E;  1U2V G;  3VLF A;  3T8M A;  4I1M A;  1LD8 A;  4B93 B;  2I1J A;  3ASD A;  4IRU A;  2WXL A;  1OCO E;  4FLB A;  4XX5 A;  3VTY A;  5KJL A;  3B13 A;  1SA5 A;  1NL4 A;  5CRU A;  3QAQ A;  3QJZ A;  3Q47 B;  1KT0 A;  4TUM A;  3Q49 B;  4EEC A;  1E7V A;  4FAD A;  3G2S A;  4L23 A;  3FTW A;  4O6F A;  3KD7 A;  4F1S A;  2IOL A;  2WXP A;  3AAA C;  1HX8 A;  1OXJ A;  4G24 A;  3LJN A;  3UM2 A;  2Y69 E;  3LS8 A;  3FUL A;  5BNW A;  4CT4 A;  2OEV A;  4PUC A;  4BSZ B;  3CQG B;  3R9A B;  2KCV A;  3EHN A;  3UM3 A;  4LEU A;  4ANU A;  4F1P A;  5J90 A;  1H6K A;  3R7Q A;  2WXN A;  3RJV A;  1U3D A;  2DYS E;  3CSF A;  5G05 C;  3Q4A B;  3SBS A;  3MCX A;  4DX7 D;  1ELK A;  3B7R L;  3TWX A;  2WXI A;  3PEV B;  3ZU7 B;  3CK9 A;  5EX3 A;  1TEZ A;  2KC7 A;  4BSX A;  1FT1 A;  3MKQ B;  3B7T A;  2E2E A;  4I2W A;  5FIO A;  4X8Q A;  3JYS A;  1TYQ G;  5EIL A;  1JCQ A;  4I43 A;  1HZ4 A;  3URZ A;  3QB2 A;  4HOS A;  1N4R A;  1HG2 A;  4CDN A;  2VGX B;  4LNG A;  4JEH A;  3EHQ A;  4GML A;  1N4Q A;  2BF0 X;  2PQR A;  3CIA A;  3JQ0 A;  2A5E A;  5AN8 A;  5KJK A;  1Z3Y A;  2H6I A;  1OCZ E;  4WAF A;  4JHR A;  3TWS A;  4AEZ C;  3FUJ A;  5H7P A;  4J8E A;  4UI9 C;  4BX8 A;  2Q7F A;  4KZC A;  3PDN A;  3UIO C;  1UOH A;  1FVH A;  2LO6 A;  4L2Y A;  4ZFH A;  4K03 A;  3ZIM A;  4I9E A;  4I1O B;  1E8Z A;  5CMY A;  3JUI A;  1Y6I A;  2RG8 A;  2X6J A;  4A3V A;  4HOT A;  4UWK A;  4L7T A;  4URK A;  2JAB A;  1QQE A;  2CFU A;  1OUV A;  3DRA A;  4D10 C;  1UJK A;  1BU9 A;  2LXM A;  3ESL A;  5CBN A;  2QY7 A;  3RSE G;  2YHC A;  1W3B A;  4NUR A;  3CST A;  1E8X A;  4APO A;  4O1O A;  2FO1 E;  3TAX A;  1KT1 A;  3UM1 A;  1UW4 B;  2X38 A;  4EPZ A;  3Q15 A;  4I2Z A;  4CGV A;  5ENR D;  2P9I G;  3IEG A;  3JXI A;  3FTX A;  4P29 A;  2OOE A;  1ZBP A;  3OXL A;  2V0P A;  1QNF A;  3RO3 A;  3ML9 A;  2V8S E;  3CVP A;  4TV3 A;  3AJI A;  3ASH A;  4E6H A;  5ENN A;  4GAA A;  2YNQ A;  3HYM B;  2KZT B;  3ABK E;  3RAU A;  4JVS A;  4J0U A;  4N39 A;  4U0U A;  3FTS A;  1A5E A;  1B89 A;  5LOZ A;  1DVP A;  1NA0 A;  3PZ2 A;  3T5X A;  4N5Q A;  3FEX A;  1O1S A;  3AG3 E;  1N11 A;  4ZHB A;  1N0Q A;  2P2C P;  4HNA D;  3ZEF A;  3LVR E;  4WND A;  2XRZ A;  3AS5 A;  3P2B A;  5KCM A;  3ZW3 A;  4ILH B;  3FP3 A;  4PS7 A;  2QC9 A;  1WAO 1;  5FQ7 A;  3AG1 E;  1N4P A;  4BY6 A;  1IQU A;  1YYH A;  5JHA A;  4CRW A;  3HXE A;  3UX4 A;  2IFU A;  4A55 A;  1NA3 A;  4QFV A;  4G23 A;  5B1A E;  3CVX A;  2LAI A;  3TWT A;  3CV0 A;  4ATG A;  3EIQ C;  4K0R A;  4LNU D;  2J4B A;  3FU5 A;  2IO3 C;  4L2L A;  1EF1 C;  2I9C A;  4YND A;  4J6I A;  3OTN A;  3CVL A;  1DC2 A;  1VDY A;  2EIM E;  4AP2 A;  3MJW A;  4HOQ A;  3L13 A;  5B1B E;  4U07 A;  2FI7 A;  4GTP A;  3TWQ A;  1PY1 A;  4DLQ A;  1WG0 A;  2M63 A;  3QK0 A;  2LSU A;  4GTO A;  4HOR A;  3MV2 B;  4HRN A;  4B94 A;  3Q73 A;  3SO8 A;  4GCO A;  2HYZ A;  4AJW A;  5FIN A;  3ESK A;  4HS2 A;  3ZYQ A;  3C98 A;  4V3I A;  3HHM A;  3L08 A;  3R9M A;  2XZT G;  1WM5 A;  3SNX A;  3DEO A;  1SZ9 A;  1OWP A;  5BXO A;  4ME2 A;  2FO7 A;  2F0Y A;  4TXP A;  3LKU A;  5LFA A;  3HIZ A;  3RRU A;  2R59 A;  3ZN3 A;  4RG6 A;  1HO8 A;  3Q7A A;  4JW1 A;  4JEU A;  5ENO D;  1OY3 D;  4JZY A;  3APF A;  2OCC E;  4F53 A;  5M72 A;  2DYR E;  3UIN C;  2NYJ A;  3B95 A;  3Q78 A;  3SQV A;  4AXH A;  4GZ3 A;  4HOU A;  4IN3 B;  3JUE A;  3HDX A;  2B0O E;  2R03 A;  1QBQ A;  5HKP A;  5G04 J;  2XGO A;  5G04 C;  3ABM E;  1P5Q A;  4FHJ A;  5EDS A;  5KJN A;  3ABL E;  2XEN A;  5LCW J;  1Z6T A;  4JHJ A;  3PZ3 A;  4W9R A;  4ANX A;  5ITZ F;  4HBD A;  5LCW C;  2QZA A;  4KZ0 A;  5ENP D;  2KXP C;  5ENQ D;  4RG9 A;  4UUC A;  1IYG A;  4J8D A;  4CGW A;  2P9U G;  3B7U X;  4GMR A;  4BET A;  4HI8 A;  3U3W A;  4C0E A;  1E96 B;  1WDY A;  2OEW A;  2J49 A;  4U63 A;  2QFC A;  2ILR A;  3ML8 A;  1YMP A;  3IHV A;  2DIW A;  4AOF A;  1H2U A;  1FVF A;  4N2Q A;  2WXQ A;  2XEH A;  3OXG A;  2AXV A;  4BTB A;  2MYO A;  4EBA A;  4WUY A;  3U9W A;  2WXG A;  3S2A A;  3Q75 A;  2VGY A;  5CHE E;  4JC8 A;  1KPS B;  5AQA A;  4YDW A;  5ENT D;  4FHK A;  4TXQ A;  5HQ8 A;  1YA0 A;  5FJY A;  3CLJ A;  3DPY A;  1BI8 B;  3UT7 A;  4FJY A;  3VLD A;  4TRQ A;  1O1T A;  1H19 A;  3TXM A;  1K1A A;  3CVV A;  3N71 A;  4GA1 A;  3EDT B;  1GW6 A;  2RD0 A;  4BFR A;  4EQF A;  4GPM A;  3TL5 A;  2WM9 A;  1N95 A;  1ZU2 A;  3RRN B;  3DSW A;  5IY5 E;  3V2O A;  3FU6 A;  2FEZ A;  2Y1L E;  1NFI E;  3EIJ A;  3FH8 A;  2B6C A;  1N9A A;  2CG3 A;  3ASF A;  4R7L A;  1NZN A;  1Q2Z A;  3E32 A;  4GYY A;  4N3A A;  2VSN A;  3ULY A;  2EIL E;  1N4S A;  3UXG A;  1BLX B;  3U64 A;  4RSY A;  1RZ4 A;  3U4T A;  3CHO A;  2JLB A;  3PS6 A;  3APD A;  1RW2 A;  3UKR G;  2C2L A;  3TJP A;  1NI1 A;  1NP7 A;  4GTR A;  3T9K A;  4CDR A;  2CG2 A;  4DI4 A;  3C72 A;  3RU0 A;  3TG5 A;  4AY6 A;  4WWP A;  2A4Z A;  1BI7 B;  2LAH A;  4L9P A;  2L0I A;  1G3N B;  3CVQ A;  5KJM A;  5KWD A;  2WQH A;  4K5B A;  2OND A;  1H6O A;  4U96 D;  2VSO E;  3CVU A;  1IHB A;  1TN7 A;  3QDN A;  4GU5 A;  5CMW A;  4OYS A;  2X3M A;  3NZS A;  5KNG A;  2ZIS A;  1HF8 A;  4A1G A;  4F7A A;  5AJL A;  3KEZ A;  2X6K A;  3EU9 A;  3ULE G;  3FFL A;  3DSX A;  3PZ1 A;  3CR3 A;  2XHE A;  1EYH A;  4FP7 A;  3KAE A;  3EHM A;  4YVQ C;  2WXK A;  3FU0 A;  2CHZ A;  5FT9 A;  3T8K A;  1UN9 A;  2YHE A;  4U8Y D;  2PM7 A;  5T3R A;  5KNH D;  2F8X K;  3FUH A;  2PNN A;  3B7B A;  2LNI A;  4XE0 A;  3UQ3 A;  3NZU A;  2DBA A;  3CK7 A;  3C3O A;  2H6H A;  3AS8 A;  3O48 A;  3GYZ A;  5AQ7 A;  3FTV A;  1LTX A;  3D3M A;  4GA0 A;  1Z3X A;  2FBN A;  3NQP A;  1O5M A;  3LCA A;  3DEP A;  2KCL A;  4BT8 A;  2IEJ A;  4U7E B;  4B89 A;  3MEK A;  4LG6 A;  1JUQ A;  5T4Y A;  2X6F A;  2P58 C;  2EIN E;  4GZ5 A;  3MZL B;  1N94 A;  4MS6 A;  3E30 A;  4JA7 A;  3EJN A;  4YDE A;  1L5J A;  5JA4 D;  4Y6C A;  1INZ A;  5CER B;  4WWN A;  3LY7 A;  4JD2 G;  1AP7 A;  2WPV A;  3IBE A;  1SZA A;  4FUL A;  2L0T B;  3FTU A;  2EQX A;  2KCK A;  2UY1 B;  3CKB A;  2HE0 A;  5AQ9 A;  3MKR A;  3X2Q E;  4CDM A;  3JXJ A;  4DLO A;  2DVW A;  3D9L A;  3UM0 A;  1HU3 A;  1OWL A;  3GW4 A;  5JJ7 A;  3UI2 A;  3G2T A;  1K3Z D;  4UWF A;  1HG5 A;  4JB8 P;  3UT8 A;  4GTQ A;  3HVE A;  1BD8 A;  2XGM A;  5AJD A;  3P1U A;  3LJ3 A;  3FUI A;  5JJ6 A;  4GTS A;  2AW6 A;  2VTB B;  3EUV A;  3ZPJ A;  2XCC A;  4FLH A;  1H0A A;  1LF8 A;  4UQX A;  2P9N G;  4K5A B;  3CVW A;  1FPP A;  2ETB A;  3G2V A;  3ZGQ A;  4MKT A;  2RFM A;  4WNG A;  5AQB A;  4M3O A;  3L17 A;  3D9O A;  3LY9 A;  1KZO A;  1MQS A;  3ZYK A;  4ANV A;  5D0O D;  3FTY A;  4DJA A;  4GPK A;  1TNY A;  2R05 A;  1SQM A;  3UIP C;  1K1B A;  4JPS A;  3ZYL A;  3IV0 A; 
#chains in the Genus database with same CATH homology
 3J5Q B;  3ZU7 B;  4HRL A;  4RLY A;  5ENO D;  4K5C A;  1OY3 D;  4U95 D;  3KEA A;  1K1A A;  1DCQ A;  1MYO A;  2XEE A;  3V2X A;  3C5R A;  3JXJ A;  5ENR D;  4QFV A;  5ENS D;  3UTM A;  3V30 A;  3T8K A;  2DVW A;  4LSZ E;  4U8Y D;  2ZGD A;  3JXI A;  2XZD G;  3TWT A;  4DX1 A;  2AJA A;  2DZO A;  5FIO A;  5HRY A;  5KNH D;  2F8X K;  3J5P A;  3UI2 A;  2PNN A;  2NYJ A;  3B7B A;  1IXV A;  3B95 A;  4GPM A;  4J7W A;  1K3Z D;  4LNU D;  5EIL A;  4B93 B;  4JB8 P;  5EN5 D;  3ZNG A;  3W9G A;  3TWW A;  4ATZ D;  3AJI A;  3V2O A;  1SW6 A;  1BD8 A;  3JUE A;  5AQ7 A;  4HLL A;  5EID A;  4HB5 A;  1DC2 A;  3EHQ A;  2Y1L E;  2B0O E;  1YCS B;  1NFI E;  3HRA A;  4CYM D;  5EYL A;  4OAU C;  2BKG A;  2J8S D;  2V4H C;  2A5E A;  4U8V D;  2DWZ A;  5AN8 A;  5HKP A;  2DZN A;  3DEP A;  4HRM B;  5KBA A;  1A5E A;  4TUM A;  4DUI A;  2QYJ A;  5CED B;  2V5Q C;  4J8Y A;  5AQ9 A;  3TWS A;  3UXG A;  1TR4 A;  1BLX B;  2XEN A;  3NBN B;  4OAV B;  4HQD A;  3TWU A;  5ITZ F;  4HBD A;  3TWQ A;  4DRX E;  4HI9 A;  4NIK A;  2F37 A;  3F6Q A;  1WG0 A;  3AAA C;  2VGE A;  5ENP D;  2ETC A;  4N5Q A;  3TWR A;  4K5A B;  1MX2 A;  2KXP C;  3LJN A;  5D66 A;  4LG6 A;  4HRN A;  5BXU A;  5ENQ D;  4UUC A;  1UOH A;  3SO8 A;  2ETB A;  4O1P A;  3T9K A;  5AAO A;  1IKN D;  4A63 B;  1AWC B;  5AAR A;  3IXE A;  4F6R D;  1MX6 A;  5FIN A;  1D9S A;  4DX2 A;  1N11 A;  3W9F A;  1N0Q A;  2P2C P;  2RFM A;  4GMR A;  4HNA D;  4ZFH A;  4G8L A;  4ZHB A;  4BET A;  5AQB A;  4HI8 A;  4BES A;  5HS0 A;  4BSZ B;  4Z68 A;  1WDY A;  1BI7 B;  3V31 A;  1N0R A;  2ETA A;  5CEC B;  1G3N B;  5JA4 D;  4QQI A;  5KWD A;  4K5B A;  2KBX A;  1YMP A;  2JAB A;  5CER B;  4U96 D;  5EYP F;  2BKK B;  2XZT G;  1IHB A;  1OT8 A;  2ZGG A;  2F8Y A;  4YDY A;  4F1P A;  2XEH A;  3HG0 D;  2L6B A;  1AP7 A;  3DEO A;  1BU9 A;  5JMN D;  2MYO A;  4C48 B;  3NOC D;  5BXO A;  4G8K A;  3D9H A;  3NOG D;  5CBO A;  2QC9 A;  5CEA A;  3EHR A;  1QYM A;  1SVX A;  5KNG A;  5CBN A;  1MX4 A;  1S70 B;  1K1B A;  2RFA A;  4DX7 D;  1YYH A;  3V79 K;  4DX6 D;  5AQA A;  4YDW A;  3Q9N C;  5ENT D;  4BER A;  5EIB E;  3EU9 A;  4CZ2 D;  3TWX A;  4O60 A;  3Q9U C;  3TWV A;  4O1O A;  4BEP A;  3ZUV B;  1MJ0 A;  4DX5 D;  2HE0 A;  2Y0B G;  1BI8 B;  3ZKJ A;  2FO1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...