5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
5AAOA 5EILA 5KNHD 4K5AB 5ENPD 2KBXA 4BSZB 5CEDB 4DUIA 5AN8A 5JMND 1YMPA 2NYJA 3TWVA 4HLLA 3AJIA 5ENRD 2XZTG 5EIBE 4TUMA 3UTMA 5CBNA 2V5QC 2Y1LE 4HQDA 3UXGA 1TR4A 3JXIA 3NOCD 4BEPA 1BLXB 2JABA 3HG0D 1IHBA 1N11A 5ENSD 5BXOA 1K3ZD 1MJ0A 4HBDA 4BESA 3V30A 2MYOA 4N5QA 2Y0BG 4LSZE 4U8YD 4F6RD 5EYPF 2ETBA 4GPMA 2KXPC 2ZGDA 2XEHA 2AJAA 2B0OE 4U95D 2F8XK 4U8VD 1YCSB 5HS0A 5KWDA 3Q9UC 5CERB 3EHQA 5FIOA 3T9KA 3JXJA 3TWSA 4DX2A 2J8SD 4O1PA 2PNNA 3JUEA 4B93B 4NIKA 5AQBA 1N0QA 4C48B 4OAVB 3V2OA 5BXUA 2F37A 1BD8A 2DVWA 5EYLA 4G8KA 4ATZD 1N0RA 4ZHBA 3TWWA 5CECB 4HNAD 2A5EA 5HKPA 1A5EA 1MX2A 2DZNA 1MX4A 3DEPA 3B95A 1DCQA 3EHRA 2F8YA 4JB8P 4RLYA 2VGEA 3NBNB 4DX7D 1AP7A 4GMRA 3ZNGA 1BI7B 2DZOA 3V79K 5EN5D 5FINA 5AARA 2QYJA 2DWZA 5AQ9A 2ETCA 1S70B 4J7WA 2BKGA 1MYOA 3ZU7B 4CZ2D 1NFIE 3Q9NC 4A63B 1SVXA 2QC9A 2RFAA 2XZDG 1IXVA 1DC2A 1D9SA 5ENQD 3UI2A 3TWRA 2XENA 4ZFHA 5KBAA 1OY3D 3ZKJA 4UUCA 3TWQA 4HRLA 3TWUA 4HRMB 5JA4D 4O60A 3V31A 1WG0A 5CBOA 5KNGA 4DRXE 1QYMA 5AQAA 3DEOA 4K5CA 1OT8A 4G8LA 1K1BA 3KEAA 2RFMA 3HRAA 4J8YA 3AAAC 3NOGD 3TWTA 2V4HC 3J5PA 2ZGGA 4DX5D 4HRNA 1UOHA 1BU9A 3LJNA 1G3NB 5ENOD 4QQIA 2L6BA 2ETAA 4YDWA 1MX6A 5ENTD 3T8KA 2XEEA 3TWXA 5ITZF 4OAUC 5AQ7A 4DX6D 3J5QB 4YDYA 3B7BA 1YYHA 3V2XA 1WDYA 4BERA 3D9HA 4Z68A 4O1OA 5HRYA 3EU9A 4CYMD 4HI8A 5EIDA 1AWCB 2BKKB 4HB5A 1IKND 4LNUD 3IXEA 4HI9A 4QFVA 4LG6A 4F1PA 3SO8A 5D66A 4U96D 3W9FA 3W9GA 4DX1A 5CEAA 1BI8B 2FO1E 1K1AA 3ZUVB 3C5RA 2HE0A 4K5BA 4BETA 2P2CP 3F6QA 1SW6A
chains in the Genus database with same CATH superfamily
3ZYMA 4H7XA 2Y3AA 4L9PA 5AAOA 3HXFA 1N4QA 5KJNA 3TWVA 4U0ZA 4HLLA 2X38A 3RO2A 3EUVA 4G2VA 1V55E 4PDXA 4YVQC 3U3WA 2OV8A 4GA1A 4GTTA 2XRYA 1Y8MA 2R02A 2IO2C 4TUUA 2GRMA 1A5EA 2PQNA 4RG6A 2F8YA 4LUNU 2VGEA 4EECA 2AXUA 2ETCA 4EZKA 4F53A 2YQ8A 4DLOA 1IXVA 2IOLA 2AXZA 5FZRA 3QC1A 3ASDA 2KATA 5J90A 1TNBA 3QWVA 3TWQA 2P58C 3FY4A 2NSZA 3MGBA 5CBOA 4JC8A 4DRXE 3FTSA 4K5CA 5CRVA 3VLFA 2LSVA 2H6GA 4FHJA 5D2MC 1B89A 1OCCE 3UT8A 3CVWA 4HORA 3B7BA 3VLDA 3SI5A 1OWOA 5FZSA 1EDUA 3TGOA 3FH7A 4ILHB 3CVUA 3CSFA 1Z3XA 4RVBA 3TJPA 1OCRE 4N3AA 3LVRE 3EDTB 3FTXA 3X2QE 2XZTG 3ZGQA 4G24A 3UQ3A 4DLQA 3V30A 2KC7A 3L82A 3Q79A 2GGFA 5CERB 1IYGA 1O1RA 4G8KA 3LXUX 4OVUA 5A23A 3CQCB 1MX4A 3C3OA 3DEPA 2VGYA 3BG1B 4J6IA 1SA5A 2VSXE 3CEQA 3S7JA 5AQ9A 3MKRA 3TL5A 2VJ8A 1N9AA 3N71A 4PUCA 3MZLB 1HO8A 4GU5A 5BV1A 1FCHA 3MV2B 3UPVA 3V31A 1WG0A 4GMLA 1ELWA 1E90A 4ILGA 2EINE 2IO3C 3CLJA 4MS6A 1OXJA 3RO3A 3U9WA 2C2LA 4DX6D 3PZ1A 4N2SA 3E32A 2J9QA 2LXMA 2WQHA 5CMWA 1KT0A 2GRQB 1XNFA 3BU8A 2DYRE 3SBSA 5CEAA 1BI8B 2FO1E 4A1GA 5DIZA 3SQVA 2Y69E 3RRMB 4AY6A 1UJKA 3HXBA 3LJ3A 3MKQB 3L08A 2PM7A 4DI3A 3ZXSA 1X5BA 4G26A 3ZEFA 1BLXB 1EF1C 3HG0D 1IHBA 2XGSA 5DBKA 2XEHA 3ULQA 3Q9UC 4Y6WA 1SA4A 1DNPA 4TXRA 1HS6A 1PC2A 3K9IA 2NC9A 2DVWA 3PRZA 3D9IA 2BTDA 3EJNA 3Q49B 3R9MA 3HDXA 3R7QA 3ASFA 5H7PA 3LKUA 3GZSA 4U0SA 4AP2A 1S0PA 2QC9A 4HS2A 3R7RA 1D9SA 4G1TA 3ZYLA 4ZFHA 4UUCA 3TXNA 4M7CA 4HRMB 3RK6A 3SZ7A 2X6HA 1NL4A 1O1SA 2EIJE 2HM8A 1H6KA 3HRAA 1JPLA 4J8YA 2V4LA 2WXNA 1UOHA 3GZ1A 4YDWA 4J0UA 4FHKA 3TWXA 3ABLE 4DI4A 2P9PG 4UWGA 4EBAA 1WDYA 3D9HA 4AOFA 2P9UG 5CHEE 3G2SA 4HI9A 4FC8A 3ML8A 3W9FA 1GW6A 3W9GA 1VDYA 2RKKA 4ATGA 3BEEA 4WWNA 4BETA 3F6QA 2OVBA 3TAXA 4BSZB 3OXFA 2NYJA 3DSSA 4ABNA 3ASGA 4GZ6A 1DCEA 2VTBB 3VTYA 1SQMA 3RSEG 4WAFA 2XPIA 4N3CA 3LY7A 1HX8A 1TN6A 4L23A 4C48B 3FUMA 3FUIA 4ATZD 4I1MA 2DZNA 3EHRA 3MA5A 4DK5A 2IFUA 4X8QA 5JHAA 4JHRA 2GW1A 3D9LA 5JHBA 4J8EA 4H7YA 4OVVA 3KEZA 4GA0A 3L54A 4J8DA 5JA4D 1OCZE 3EHMA 5KNGA 5B3SE 4GMJA 3TG4A 1U3DA 3HHMA 1ELKA 1UN8A 4U07A 4AEZC 2ZGGA 1ZB1A 4RQIA 4QQIA 3S7BA 3ZVVA 2L6BA 2ETAA 4L7TA 2R59A 4EZLA 2RG8A 3FUDA 4CYMD 4Q69A 3L9TA 4C0EA 4JZYA 2GRNB 3HVEB 3CHPA 4JL0A 4UWLA 3QB2A 4GTPA 4P29A 4LNBA 5T4YA 4CGVA 1WAO1 4N5QA 5JJ7A 2L0IA 4XEIG 5J08A 4O1PA 3SFYA 2CFZA 4E85A 4F3VA 2WXHA 3LS8A 4Q94A 3FH5A 2CHZA 3LY9A 3Q75A 1DCQA 3QWPA 1NI1A 2A4ZA 4GYWA 4ME2A 4DX7D 4LCTA 1WY6A 3SBTB 1H6PA 4BFRA 3LCAA 1MYOA 3ZIMA 2VGXB 2WXPA 2RFAA 2XZDG 1DC2A 3T8MA 4N3BA 3CVYA 4CEMA 4AM9A 1QYMA 5EX3A 4JEUA 3JQ0A 3DPDA 2IF4A 4WNFA 4HOUA 5BUZA 3PZ2A 3E33A 1H2UA 2X6JA 4Y6CA 3RRNB 2OOEA 4NRHB 5ARGA 3UM1A 3V2XA 2IU1A 3CVLA 4GTSA 3DXKG 2LAIA 2XHEA 1N94A 2BF0X 1TYQG 2WXOA 1ZBPA 3HIZA 3RAUA 4GPKA 3CQGB 3FH8A 3ONLA 3L6AA 2WQ7A 2P2CP 3UXGA 1SW6A 1ZU2A 1TJCA 2WMNA 3RKVA 2LUHA 2FEZA 3NOCD 1UJJA 2DIWA 2EQXA 5JJ6A 3S7FA 4HBDA 3ZRHA 2ETBA 1YCSB 3UKRG 1V54E 1KLXA 4FADA 1N0RA 5CCMA 2KCLA 1LD8A 1Q2ZA 1NP7A 2J49A 1OCOE 4RG9A 5FINA 3AG2E 4GTOA 3GZ2A 1DVPA 4A63B 4AJWA 4GTQA 1NZNA 2I9CA 4JHKA 3Q15A 3D9MA 3D9PA 2AXVA 5ARFA 2JEKA 4U63A 1TJFA 4IRUA 4UQZA 1HG2A 2PM6A 4GYYA 2V4HC 4IN3B 3GW4A 4B8AA 4LNGA 5ENNA 3RRUA 1LD7A 4ACLA 5ANLA 4YDYA 2XGOA 5HRYA 2LAHA 2KCVA 4M3OA 2QY7A 1H19A 1K1AA 3ZYQA 3BG0B 5M72A 3PH0C 3ASOE 2Y4TA 3APDA 3QOUA 5CEDB 3DPYA 4BSXA 3AJIA 5ENRD 3EU5A 5CBNA 4CRWA 2YHEA 3MEKA 3JXIA 1XGWA 2ONDA 3KS2A 3BQOA 2R5SA 4GPMA 2XS1A 2ZGDA 4YVOA 3QAQA 2GROB 2HO1A 3DSWA 2XGMA 4PS7A 2F37A 3CVVA 3UT7A 3IV0A 1K8KG 3S7DA 3PUJA 4C9BB 4RLYA 2DZOA 4EZJA 4I2WA 4UQYA 2FI7A 2QYJA 1YA0A 1S70B 3SD5A 4A3VA 2I1KA 2J4DA 1OY3D 4U04A 3FU0A 2FBNA 2GRLA 3D3MA 3CGHA 2L0TB 5A6CA 1D8DA 3AS4A 3AAAC 1UG3A 2UWJG 2YHCA 2MOWA 3T5XA 1G3NB 4C0MA 3FUFA 3D9NA 4HFGA 2WXRA 2EIME 3Q4AB 5ITZF 5LOZA 4Z68A 3MJWA 4HOSA 3IKOB 1Z3YA 1JWFA 3CR3A 2C0LA 2KZTA 3Q73A 4MRUA 5E75A 2FULA 4K5BA 2VGXA 4U7EB 1PAQA 1KPSB 4XX5A 2V5FA 3ZHEB 2V5QC 2EILE 4J8SA 1E8ZA 3ABME 2AW6A 2HYZA 1K3ZD 1MJ0A 3PREA 1PY1A 4CT0A 3JCKC 5KWDA 4TXQA 2GRRB 3EHNA 1TNZA 3ZW3A 2AWIA 5KJLA 3FTZA 4BTBA 3AG3E 4BX8A 5ANRA 3QWWA 3SHFA 3RIBA 3NBNB 3LY8A 3ZNGA 4WNGA 2CFUA 4KVMA 2MRIA 3S2AA 4KYOB 4UI9J 2XPZA 4D10C 3UT4A 3UI2A 1FT1A 2UY1B 5AJDA 1RZ4A 3DSXA 2P9IG 4HRLA 3TWUA 3Q5MA 3MCXA 5FQ7A 3AU4A 1N4RA 1K1BA 4IYPA 3FTYA 5FT9A 2LO6A 3J5PA 4AY5A 3FP3A 4XI9A 3L13A 3FTVA 3T8KA 5G04J 4FLHA 3NB2A 4AV7A 2H6HA 2C0MA 1N4PA 5KCMA 4ACKA 3FUJA 5BW8C 4DPRA 4JVSA 2WXGA 4UI9C 5B1BE 5ENPD 4GZ5A 3ULYA 4EBAG 3I5PA 3C3RA 1FT2A 2Y1LE 3FUKA 1X81A 2JABA 4U8YD 2AJAA 2B0OE 2I6HA 4U8VD 4UWKA 4YDOA 5HS0A 4GZ3A 5BT1A 3TWSA 4I9EA 2PNNA 5T3RA 3JUEA 1KZOA 3PZ3A 3SNXA 1RW2A 3TWWA 4PH4B 4JB8P 2X3MA 5CMYA 3V79K 3QKYA 3ZU7B 4TRQA 2XENA 5KBAA 2M63A 3RU0A 3URZA 4GZDA 3E30A 2WMOA 2RFMA 4FU3A 3MYVA 4GAAA 1HG5A 3D9JA 5CRUA 4XZ4A 2XEEA 3IEGA 3NF1A 3PNTB 3IXEA 4GTRA 3SGHA 2I2OA 4JA9A 2CG2A 4I17A 4GTVA 2LSUA 4PS3A 1EYHA 3ZXPA 5EILA 2OEVA 2VSOE 2B6CA 3PZDA 1YMPA 3Q7AA 2ZIRA 4L2YA 4GZCA 3P1UA 4I1AA 4BESA 3FU6A 2MYOA 4BTAA 4UI9K 3ML9A 4W9RA 3KSQA 4BY6A 3CSTA 2DYSE 3DSVA 2WM9A 4HNAD 1TN7A 1JCQA 4FP7A 3T5VA 1N4SA 3CK9A 4GMRA 4JPSA 3HXCA 4CDRA 4R7LA 1E8YA 3O4ZA 1QZ2A 2WXJA 2IEJA 4URKA 3AS8A 3APCA 5FWQA 5KJMA 3TWRA 3ZHEA 4U8HA 5A7DB 1JWGA 2J09A 3E37A 3FWVA 2X6KA 3DEOA 4B89A 4MBGA 1NA3A 5FZQA 2VSNA 4GA2A 5ENOD 4KMOA 3MKQA 3RJVA 2XQ0A 2R05A 1S63A 2VSYA 5FQ8A 5FQ6A 3IBEA 4DX1A 3L16A 1HH8A 4K03A 4B93B 2L9BA 1TNYA 2DCPA 3L22A 4NURA 3DRAA 2VQ2A 1TR4A 3UMVA 2X6FA 3LYAA 3I4RB 4ANVA 3ULEG 2RD0A 4ILIA 2WB2A 3VLEA 4HVBA 3EIQC 3ENEA 3DBSA 3MX3A 3FFLA 4UWFA 4B94A 4G11A 3CVXA 2XS8A 2WPVA 3SFZA 3U66A 2P9KG 3OTNA 3CKBA 4APOA 3B95A 1QQEA 2VYIA 3KSLA 5EN5D 5AENA 3FU5A 2DWZA 5AJLA 4J7WA 2ZXWE 5FQ4A 5LX8A 3PEVB 4G25A 2J07A 2PL2A 2HR2A 2R2LA 4MKTA 4Q96A 2XCBA 4G8LA 3KEAA 3WG7E 2ZU6B 4O6FA 3NAWA 1JCSA 3DXMG 1E7UA 3P2BA 4FA6A 3UUXA 3G2UA 3QDNA 4E6HA 1YYHA 3DWLG 1FVHA 5KJKA 1E96B 4HB5A 1IKND 1L5JA 2VTBA 1N52A 4F1PA 1Z5SC 4B0ZA 4GCOA 1KZPA 5BV0A 1O1TA 4V3IA 4DUIA 1TN8A 1HZ4A 1H2TC 3Q47B 2A5UA 4BX9A 2WQ6A 1SZ9A 2J08A 3ASNE 5ENSD 5BXOA 1SZAA 5B1AE 4IULA 1E8WA 4I6GA 3EHQA 3EIJA 2WXLA 1BD8A 1UW4B 3APFA 3ONKA 5EYLA 4F7AA 5IY5E 2R03A 4L2LA 1U2VG 4BWRA 4YDEA 4A1SA 3B7SA 3FUNA 2WXQA 1BI7B 3FTUA 2P9SG 5AARA 2LXLA 3L17A 4XIFA 1LF8A 2BKGA 5CCLA 3ASHA 1H6OA 5G05J 2JLBA 2OCCE 1LTXA 5G55A 3CVQA 1W3BA 1HU3A 1ELRA 2I1JA 4CDMA 2KCKA 2XEVA 4GCNA 4KZ0A 4BT8A 4HOQA 4AXHA 1O5MA 3NOGD 3ESKA 3G2VA 3O48A 1N95A 1OWNA 3LDZA 4PS8A 1OWPA 3J5QB 3HVEA 3ESLA 2YINA 3AU5A 2YNQA 3UIOC 3E34A 1AWCB 3FULA 4KBQA 4LNUD 3QJZA 4I2ZA 3CKCA 2V0PA 4XE0A 3ZUVB 1HF8A 3LPZA 2HE0A 3I3NA 5G05C 2P9LG 3CVPA 1IQUA 5AYWD 5EIBE 3C3QA 4BEPA 1MHQA 3FEXA 4NQ0A 4F6RD 2E0IA 2WXFA 2F8XK 4A3TA 4NIKA 1N0QA 4FLBA 3CHQA 5CECB 1MX2A 1MZCA 2P9NG 4EQFA 3NQPA 3PE4A 3PZ4A 1TEZA 2H6IA 2IY0C 3NZUA 3PS6A 3U4TA 4BT9A 3Q9NC 1SVXA 4I43A 1HXIA 5LP0A 3CK7A 3R9AB 5AQAA 1OT8A 3IHVA 1IHGA 4JHJA 1OUVA 3QARA 4DX5D 3ZFWA 3D9KA 2R17C 5C1DA 3C98A 2Q7FA 4HXIA 4BERA 3AG1E 2X6IA 3FUHA 5EIDA 4JA7A 3HXEA 2BKKB 4AVXA 1TNOA 2MHKA 2CHXA 3HYMB 4JXTA 3SO8A 4WWPA 4APFA 1FPPA 3ISMC 5KNHD 4K5AB 5JMND 4CGWA 4I6EA 4N39A 3PUKA 1FVFA 3CHSA 4TUMA 2FF4A 3JQ1A 4WNEA 5LCWJ 4EHMA 1BPOA 2IOSA 2XCCA 4FJZA 2E2EA 1QBQA 4K0RA 5EKQD 4I9CA 3ZPJA 1QNFA 2WXKA 5D0QD 1IQRA 3E4BA 4EPZA 4UWHA 2NXPA 5AQBA 5BXUA 3WXXA 4ZHBA 3DSTA 5HKPA 3PDNA 4AIFA 2QYUA 3VTXA 3UKUG 1E7VA 4ANUA 2J4BA 4RSYA 1NA0A 3PE3A 1HE8A 5G2NA 4CDNA 4WWOA 4LEUA 5G04C 4A55A 5LCWC 2LNIA 3FUEA 4O60A 3G2TA 2BEDA 3FEYA 3OXLA 3TWTA 4I6JA 1BU9A 3LJNA 4TV3A 1MX6A 5ENTD 4OAUC 4WUYA 4O1OA 3QK0A 4L1BA 4HI8A 2ILRA 2CG3A 2QZAA 5D66A 4JW1A 5D0OD 5E76A 2KM4A 5AN8A 4CT4A 5FJYA 4YNDA 3ABKE 1UN9A 4HQDA 3AG4E 3JUIA 4KVOA 1N54A 1N11A 2F0YA 2Y0BG 4JD2G 2KXPC 1H2VC 2DBAA 2XRZA 3T9KA 3UINC 2GRPB 3Q7FA 4OAVB 2IJGX 1TNUA 3SY2A 3D9OA 4F1SA 2A5EA 4B8CB 5JJTA 3QNKA 3HXDA 3CV0A 3OXGA 4NACA 3FTWA 4LRZA 4KT6B 5AIJA 2IONA 3B7TA 1NFIE 4XKCA 1A17A 4G23A 3SF4A 3UX4A 3B13A 2BUGA 3I4GA 3PNLB 3UM2A 2OEWA 4UQXA 2ZISA 1OWMA 4JEHA 1H0AA 3FDHA 4HRNA 4J8FA 2L6JA 2EIKE 4U0UA 3TG5A 4MLPA 2Y4UA 3IHYA 4I1OB 3UM0A 5AQ7A 4HOTA 5FTPA 1E8XA 2AVPA 3UIPC 3CHMA 3U64A 4ANXA 3TXMA 4U96D 1S64A 4XKBA 3CVNA 4KXKB 3C5RA 1U3CA 4CCAA 3Q78A 3C72A 4OYSA 3GYZA 3DSUA 3ZYKA 3OAWA 2WXMA 2KBXA 3CHOA 3G2WA 2H6FA 4HLEA 1JCRA 3UTMA 1EPUA 4GTMA 3B7RL 4FJYA 5HQ8A 2CHWA 2KZTB 2WVIA 1JUQA 4LSZE 5EYPF 3KAEA 2XPYA 4U95D 4DJAA 5HI7A 5FIOA 3NZSA 3JXJA 4LERA 4DX2A 2J8SD 3KD7A 1P5QA 3V2OA 2UY1A 3JYSA 3MV3B 2WXIA 3LEWA 1WM5A 3SFXA 5EDSA 1AP7A 5BPPA 3B7UX 3PEUB 4GB9A 4N2QA 3AS5A 4N5CA 5BNWA 4CZ2D 5ENQD 2V8SE 2QFCA 4WNDA 3ZKJA 2PZIA 3BUAA 1D8EA 4GYOA 3PVLA 3ZN3A 3FU3A 4ANWA 3CIAA 1KT1A 1INZA 1MQSA 4FULA 3CK8A 4TXPA 3CHRA 2OVFA 3EU9A 3UM3A 2IQCA 2PQRA 2FO7A 1Y6IA 1Z6TA 5EX0A 4QFVA 4LG6A 5LFAA 1HFAA 5C2YA 3FHEA 3LVQE 5T8IA 1OWLA 4KZCA 4XI0A
chains in the Genus database with same CATH topology
5AAOA 5EILA 5KNHD 4K5AB 5ENPD 2KBXA 4BSZB 5CEDB 4DUIA 5AN8A 5JMND 1YMPA 2NYJA 3TWVA 4HLLA 3AJIA 5ENRD 2XZTG 5EIBE 4TUMA 3UTMA 5CBNA 2V5QC 2Y1LE 4HQDA 3UXGA 1TR4A 3JXIA 3NOCD 4BEPA 1BLXB 2JABA 3HG0D 1IHBA 1N11A 5ENSD 5BXOA 1K3ZD 1MJ0A 4HBDA 4BESA 3V30A 2MYOA 4N5QA 2Y0BG 4LSZE 4U8YD 4F6RD 5EYPF 2ETBA 4GPMA 2KXPC 2ZGDA 2XEHA 2AJAA 2B0OE 4U95D 2F8XK 4U8VD 1YCSB 5HS0A 5KWDA 3Q9UC 5CERB 3EHQA 5FIOA 3T9KA 3JXJA 3TWSA 4DX2A 2J8SD 4O1PA 2PNNA 3JUEA 4B93B 4NIKA 5AQBA 1N0QA 4C48B 4OAVB 3V2OA 5BXUA 2F37A 1BD8A 2DVWA 5EYLA 4G8KA 4ATZD 1N0RA 4ZHBA 3TWWA 5CECB 4HNAD 2A5EA 5HKPA 1A5EA 1MX2A 2DZNA 1MX4A 3DEPA 3B95A 1DCQA 3EHRA 2F8YA 4JB8P 4RLYA 2VGEA 3NBNB 4DX7D 1AP7A 4GMRA 3ZNGA 1BI7B 2DZOA 3V79K 5EN5D 5FINA 5AARA 2QYJA 2DWZA 5AQ9A 2ETCA 1S70B 4J7WA 2BKGA 1MYOA 3ZU7B 4CZ2D 1NFIE 3Q9NC 4A63B 1SVXA 2QC9A 2RFAA 2XZDG 1IXVA 1DC2A 1D9SA 5ENQD 3UI2A 3TWRA 2XENA 4ZFHA 5KBAA 1OY3D 3ZKJA 4UUCA 3TWQA 4HRLA 3TWUA 4HRMB 5JA4D 4O60A 3V31A 1WG0A 5CBOA 5KNGA 4DRXE 1QYMA 5AQAA 3DEOA 4K5CA 1OT8A 4G8LA 1K1BA 3KEAA 2RFMA 3HRAA 4J8YA 3AAAC 3NOGD 3TWTA 2V4HC 3J5PA 2ZGGA 4DX5D 4HRNA 1UOHA 1BU9A 3LJNA 1G3NB 5ENOD 4QQIA 2L6BA 2ETAA 4YDWA 1MX6A 5ENTD 3T8KA 2XEEA 3TWXA 5ITZF 4OAUC 5AQ7A 4DX6D 3J5QB 4YDYA 3B7BA 1YYHA 3V2XA 1WDYA 4BERA 3D9HA 4Z68A 4O1OA 5HRYA 3EU9A 4CYMD 4HI8A 5EIDA 1AWCB 2BKKB 4HB5A 1IKND 4LNUD 3IXEA 4HI9A 4QFVA 4LG6A 4F1PA 3SO8A 5D66A 4U96D 3W9FA 3W9GA 4DX1A 5CEAA 1BI8B 2FO1E 1K1AA 3ZUVB 3C5RA 2HE0A 4K5BA 4BETA 2P2CP 3F6QA 1SW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AAO A;  5EIL A;  5KNH D;  4K5A B;  5ENP D;  2KBX A;  4BSZ B;  5CED B;  4DUI A;  5AN8 A;  5JMN D;  1YMP A;  2NYJ A;  3TWV A;  4HLL A;  3AJI A;  5ENR D;  2XZT G;  5EIB E;  4TUM A;  3UTM A;  5CBN A;  2V5Q C;  2Y1L E;  4HQD A;  3UXG A;  1TR4 A;  3JXI A;  3NOC D;  4BEP A;  1BLX B;  2JAB A;  3HG0 D;  1IHB A;  1N11 A;  5ENS D;  5BXO A;  1K3Z D;  1MJ0 A;  4HBD A;  4BES A;  3V30 A;  2MYO A;  4N5Q A;  2Y0B G;  4LSZ E;  4U8Y D;  4F6R D;  5EYP F;  2ETB A;  4GPM A;  2KXP C;  2ZGD A;  2XEH A;  2AJA A;  2B0O E;  4U95 D;  2F8X K;  4U8V D;  1YCS B;  5HS0 A;  5KWD A;  3Q9U C;  5CER B;  3EHQ A;  5FIO A;  3T9K A;  3JXJ A;  3TWS A;  4DX2 A;  2J8S D;  4O1P A;  2PNN A;  3JUE A;  4B93 B;  4NIK A;  5AQB A;  1N0Q A;  4C48 B;  4OAV B;  3V2O A;  5BXU A;  2F37 A;  1BD8 A;  2DVW A;  5EYL A;  4G8K A;  4ATZ D;  1N0R A;  4ZHB A;  3TWW A;  5CEC B;  4HNA D;  2A5E A;  5HKP A;  1A5E A;  1MX2 A;  2DZN A;  1MX4 A;  3DEP A;  3B95 A;  1DCQ A;  3EHR A;  2F8Y A;  4JB8 P;  4RLY A;  2VGE A;  3NBN B;  4DX7 D;  1AP7 A;  4GMR A;  3ZNG A;  1BI7 B;  2DZO A;  3V79 K;  5EN5 D;  5FIN A;  5AAR A;  2QYJ A;  2DWZ A;  5AQ9 A;  2ETC A;  1S70 B;  4J7W A;  2BKG A;  1MYO A;  3ZU7 B;  4CZ2 D;  1NFI E;  3Q9N C;  4A63 B;  1SVX A;  2QC9 A;  2RFA A;  2XZD G;  1IXV A;  1DC2 A;  1D9S A;  5ENQ D;  3UI2 A;  3TWR A;  2XEN A;  4ZFH A;  5KBA A;  1OY3 D;  3ZKJ A;  4UUC A;  3TWQ A;  4HRL A;  3TWU A;  4HRM B;  5JA4 D;  4O60 A;  3V31 A;  1WG0 A;  5CBO A;  5KNG A;  4DRX E;  1QYM A;  5AQA A;  3DEO A;  4K5C A;  1OT8 A;  4G8L A;  1K1B A;  3KEA A;  2RFM A;  3HRA A;  4J8Y A;  3AAA C;  3NOG D;  3TWT A;  2V4H C;  3J5P A;  2ZGG A;  4DX5 D;  4HRN A;  1UOH A;  1BU9 A;  3LJN A;  1G3N B;  5ENO D;  4QQI A;  2L6B A;  2ETA A;  4YDW A;  1MX6 A;  5ENT D;  3T8K A;  2XEE A;  3TWX A;  5ITZ F;  4OAU C;  5AQ7 A;  4DX6 D;  3J5Q B;  4YDY A;  3B7B A;  1YYH A;  3V2X A;  1WDY A;  4BER A;  3D9H A;  4Z68 A;  4O1O A;  5HRY A;  3EU9 A;  4CYM D;  4HI8 A;  5EID A;  1AWC B;  2BKK B;  4HB5 A;  1IKN D;  4LNU D;  3IXE A;  4HI9 A;  4QFV A;  4LG6 A;  4F1P A;  3SO8 A;  5D66 A;  4U96 D;  3W9F A;  3W9G A;  4DX1 A;  5CEA A;  1BI8 B;  2FO1 E;  1K1A A;  3ZUV B;  3C5R A;  2HE0 A;  4K5B A;  4BET A;  2P2C P;  3F6Q A;  1SW6 A; 
#chains in the Genus database with same CATH topology
 3ZYM A;  4H7X A;  2Y3A A;  4L9P A;  5AAO A;  3HXF A;  1N4Q A;  5KJN A;  3TWV A;  4U0Z A;  4HLL A;  2X38 A;  3RO2 A;  3EUV A;  4G2V A;  1V55 E;  4PDX A;  4YVQ C;  3U3W A;  2OV8 A;  4GA1 A;  4GTT A;  2XRY A;  1Y8M A;  2R02 A;  2IO2 C;  4TUU A;  2GRM A;  1A5E A;  2PQN A;  4RG6 A;  2F8Y A;  4LUN U;  2VGE A;  4EEC A;  2AXU A;  2ETC A;  4EZK A;  4F53 A;  2YQ8 A;  4DLO A;  1IXV A;  2IOL A;  2AXZ A;  5FZR A;  3QC1 A;  3ASD A;  2KAT A;  5J90 A;  1TNB A;  3QWV A;  3TWQ A;  2P58 C;  3FY4 A;  2NSZ A;  3MGB A;  5CBO A;  4JC8 A;  4DRX E;  3FTS A;  4K5C A;  5CRV A;  3VLF A;  2LSV A;  2H6G A;  4FHJ A;  5D2M C;  1B89 A;  1OCC E;  3UT8 A;  3CVW A;  4HOR A;  3B7B A;  3VLD A;  3SI5 A;  1OWO A;  5FZS A;  1EDU A;  3TGO A;  3FH7 A;  4ILH B;  3CVU A;  3CSF A;  1Z3X A;  4RVB A;  3TJP A;  1OCR E;  4N3A A;  3LVR E;  3EDT B;  3FTX A;  3X2Q E;  2XZT G;  3ZGQ A;  4G24 A;  3UQ3 A;  4DLQ A;  3V30 A;  2KC7 A;  3L82 A;  3Q79 A;  2GGF A;  5CER B;  1IYG A;  1O1R A;  4G8K A;  3LXU X;  4OVU A;  5A23 A;  3CQC B;  1MX4 A;  3C3O A;  3DEP A;  2VGY A;  3BG1 B;  4J6I A;  1SA5 A;  2VSX E;  3CEQ A;  3S7J A;  5AQ9 A;  3MKR A;  3TL5 A;  2VJ8 A;  1N9A A;  3N71 A;  4PUC A;  3MZL B;  1HO8 A;  4GU5 A;  5BV1 A;  1FCH A;  3MV2 B;  3UPV A;  3V31 A;  1WG0 A;  4GML A;  1ELW A;  1E90 A;  4ILG A;  2EIN E;  2IO3 C;  3CLJ A;  4MS6 A;  1OXJ A;  3RO3 A;  3U9W A;  2C2L A;  4DX6 D;  3PZ1 A;  4N2S A;  3E32 A;  2J9Q A;  2LXM A;  2WQH A;  5CMW A;  1KT0 A;  2GRQ B;  1XNF A;  3BU8 A;  2DYR E;  3SBS A;  5CEA A;  1BI8 B;  2FO1 E;  4A1G A;  5DIZ A;  3SQV A;  2Y69 E;  3RRM B;  4AY6 A;  1UJK A;  3HXB A;  3LJ3 A;  3MKQ B;  3L08 A;  2PM7 A;  4DI3 A;  3ZXS A;  1X5B A;  4G26 A;  3ZEF A;  1BLX B;  1EF1 C;  3HG0 D;  1IHB A;  2XGS A;  5DBK A;  2XEH A;  3ULQ A;  3Q9U C;  4Y6W A;  1SA4 A;  1DNP A;  4TXR A;  1HS6 A;  1PC2 A;  3K9I A;  2NC9 A;  2DVW A;  3PRZ A;  3D9I A;  2BTD A;  3EJN A;  3Q49 B;  3R9M A;  3HDX A;  3R7Q A;  3ASF A;  5H7P A;  3LKU A;  3GZS A;  4U0S A;  4AP2 A;  1S0P A;  2QC9 A;  4HS2 A;  3R7R A;  1D9S A;  4G1T A;  3ZYL A;  4ZFH A;  4UUC A;  3TXN A;  4M7C A;  4HRM B;  3RK6 A;  3SZ7 A;  2X6H A;  1NL4 A;  1O1S A;  2EIJ E;  2HM8 A;  1H6K A;  3HRA A;  1JPL A;  4J8Y A;  2V4L A;  2WXN A;  1UOH A;  3GZ1 A;  4YDW A;  4J0U A;  4FHK A;  3TWX A;  3ABL E;  4DI4 A;  2P9P G;  4UWG A;  4EBA A;  1WDY A;  3D9H A;  4AOF A;  2P9U G;  5CHE E;  3G2S A;  4HI9 A;  4FC8 A;  3ML8 A;  3W9F A;  1GW6 A;  3W9G A;  1VDY A;  2RKK A;  4ATG A;  3BEE A;  4WWN A;  4BET A;  3F6Q A;  2OVB A;  3TAX A;  4BSZ B;  3OXF A;  2NYJ A;  3DSS A;  4ABN A;  3ASG A;  4GZ6 A;  1DCE A;  2VTB B;  3VTY A;  1SQM A;  3RSE G;  4WAF A;  2XPI A;  4N3C A;  3LY7 A;  1HX8 A;  1TN6 A;  4L23 A;  4C48 B;  3FUM A;  3FUI A;  4ATZ D;  4I1M A;  2DZN A;  3EHR A;  3MA5 A;  4DK5 A;  2IFU A;  4X8Q A;  5JHA A;  4JHR A;  2GW1 A;  3D9L A;  5JHB A;  4J8E A;  4H7Y A;  4OVV A;  3KEZ A;  4GA0 A;  3L54 A;  4J8D A;  5JA4 D;  1OCZ E;  3EHM A;  5KNG A;  5B3S E;  4GMJ A;  3TG4 A;  1U3D A;  3HHM A;  1ELK A;  1UN8 A;  4U07 A;  4AEZ C;  2ZGG A;  1ZB1 A;  4RQI A;  4QQI A;  3S7B A;  3ZVV A;  2L6B A;  2ETA A;  4L7T A;  2R59 A;  4EZL A;  2RG8 A;  3FUD A;  4CYM D;  4Q69 A;  3L9T A;  4C0E A;  4JZY A;  2GRN B;  3HVE B;  3CHP A;  4JL0 A;  4UWL A;  3QB2 A;  4GTP A;  4P29 A;  4LNB A;  5T4Y A;  4CGV A;  1WAO 1;  4N5Q A;  5JJ7 A;  2L0I A;  4XEI G;  5J08 A;  4O1P A;  3SFY A;  2CFZ A;  4E85 A;  4F3V A;  2WXH A;  3LS8 A;  4Q94 A;  3FH5 A;  2CHZ A;  3LY9 A;  3Q75 A;  1DCQ A;  3QWP A;  1NI1 A;  2A4Z A;  4GYW A;  4ME2 A;  4DX7 D;  4LCT A;  1WY6 A;  3SBT B;  1H6P A;  4BFR A;  3LCA A;  1MYO A;  3ZIM A;  2VGX B;  2WXP A;  2RFA A;  2XZD G;  1DC2 A;  3T8M A;  4N3B A;  3CVY A;  4CEM A;  4AM9 A;  1QYM A;  5EX3 A;  4JEU A;  3JQ0 A;  3DPD A;  2IF4 A;  4WNF A;  4HOU A;  5BUZ A;  3PZ2 A;  3E33 A;  1H2U A;  2X6J A;  4Y6C A;  3RRN B;  2OOE A;  4NRH B;  5ARG A;  3UM1 A;  3V2X A;  2IU1 A;  3CVL A;  4GTS A;  3DXK G;  2LAI A;  2XHE A;  1N94 A;  2BF0 X;  1TYQ G;  2WXO A;  1ZBP A;  3HIZ A;  3RAU A;  4GPK A;  3CQG B;  3FH8 A;  3ONL A;  3L6A A;  2WQ7 A;  2P2C P;  3UXG A;  1SW6 A;  1ZU2 A;  1TJC A;  2WMN A;  3RKV A;  2LUH A;  2FEZ A;  3NOC D;  1UJJ A;  2DIW A;  2EQX A;  5JJ6 A;  3S7F A;  4HBD A;  3ZRH A;  2ETB A;  1YCS B;  3UKR G;  1V54 E;  1KLX A;  4FAD A;  1N0R A;  5CCM A;  2KCL A;  1LD8 A;  1Q2Z A;  1NP7 A;  2J49 A;  1OCO E;  4RG9 A;  5FIN A;  3AG2 E;  4GTO A;  3GZ2 A;  1DVP A;  4A63 B;  4AJW A;  4GTQ A;  1NZN A;  2I9C A;  4JHK A;  3Q15 A;  3D9M A;  3D9P A;  2AXV A;  5ARF A;  2JEK A;  4U63 A;  1TJF A;  4IRU A;  4UQZ A;  1HG2 A;  2PM6 A;  4GYY A;  2V4H C;  4IN3 B;  3GW4 A;  4B8A A;  4LNG A;  5ENN A;  3RRU A;  1LD7 A;  4ACL A;  5ANL A;  4YDY A;  2XGO A;  5HRY A;  2LAH A;  2KCV A;  4M3O A;  2QY7 A;  1H19 A;  1K1A A;  3ZYQ A;  3BG0 B;  5M72 A;  3PH0 C;  3ASO E;  2Y4T A;  3APD A;  3QOU A;  5CED B;  3DPY A;  4BSX A;  3AJI A;  5ENR D;  3EU5 A;  5CBN A;  4CRW A;  2YHE A;  3MEK A;  3JXI A;  1XGW A;  2OND A;  3KS2 A;  3BQO A;  2R5S A;  4GPM A;  2XS1 A;  2ZGD A;  4YVO A;  3QAQ A;  2GRO B;  2HO1 A;  3DSW A;  2XGM A;  4PS7 A;  2F37 A;  3CVV A;  3UT7 A;  3IV0 A;  1K8K G;  3S7D A;  3PUJ A;  4C9B B;  4RLY A;  2DZO A;  4EZJ A;  4I2W A;  4UQY A;  2FI7 A;  2QYJ A;  1YA0 A;  1S70 B;  3SD5 A;  4A3V A;  2I1K A;  2J4D A;  1OY3 D;  4U04 A;  3FU0 A;  2FBN A;  2GRL A;  3D3M A;  3CGH A;  2L0T B;  5A6C A;  1D8D A;  3AS4 A;  3AAA C;  1UG3 A;  2UWJ G;  2YHC A;  2MOW A;  3T5X A;  1G3N B;  4C0M A;  3FUF A;  3D9N A;  4HFG A;  2WXR A;  2EIM E;  3Q4A B;  5ITZ F;  5LOZ A;  4Z68 A;  3MJW A;  4HOS A;  3IKO B;  1Z3Y A;  1JWF A;  3CR3 A;  2C0L A;  2KZT A;  3Q73 A;  4MRU A;  5E75 A;  2FUL A;  4K5B A;  2VGX A;  4U7E B;  1PAQ A;  1KPS B;  4XX5 A;  2V5F A;  3ZHE B;  2V5Q C;  2EIL E;  4J8S A;  1E8Z A;  3ABM E;  2AW6 A;  2HYZ A;  1K3Z D;  1MJ0 A;  3PRE A;  1PY1 A;  4CT0 A;  3JCK C;  5KWD A;  4TXQ A;  2GRR B;  3EHN A;  1TNZ A;  3ZW3 A;  2AWI A;  5KJL A;  3FTZ A;  4BTB A;  3AG3 E;  4BX8 A;  5ANR A;  3QWW A;  3SHF A;  3RIB A;  3NBN B;  3LY8 A;  3ZNG A;  4WNG A;  2CFU A;  4KVM A;  2MRI A;  3S2A A;  4KYO B;  4UI9 J;  2XPZ A;  4D10 C;  3UT4 A;  3UI2 A;  1FT1 A;  2UY1 B;  5AJD A;  1RZ4 A;  3DSX A;  2P9I G;  4HRL A;  3TWU A;  3Q5M A;  3MCX A;  5FQ7 A;  3AU4 A;  1N4R A;  1K1B A;  4IYP A;  3FTY A;  5FT9 A;  2LO6 A;  3J5P A;  4AY5 A;  3FP3 A;  4XI9 A;  3L13 A;  3FTV A;  3T8K A;  5G04 J;  4FLH A;  3NB2 A;  4AV7 A;  2H6H A;  2C0M A;  1N4P A;  5KCM A;  4ACK A;  3FUJ A;  5BW8 C;  4DPR A;  4JVS A;  2WXG A;  4UI9 C;  5B1B E;  5ENP D;  4GZ5 A;  3ULY A;  4EBA G;  3I5P A;  3C3R A;  1FT2 A;  2Y1L E;  3FUK A;  1X81 A;  2JAB A;  4U8Y D;  2AJA A;  2B0O E;  2I6H A;  4U8V D;  4UWK A;  4YDO A;  5HS0 A;  4GZ3 A;  5BT1 A;  3TWS A;  4I9E A;  2PNN A;  5T3R A;  3JUE A;  1KZO A;  3PZ3 A;  3SNX A;  1RW2 A;  3TWW A;  4PH4 B;  4JB8 P;  2X3M A;  5CMY A;  3V79 K;  3QKY A;  3ZU7 B;  4TRQ A;  2XEN A;  5KBA A;  2M63 A;  3RU0 A;  3URZ A;  4GZD A;  3E30 A;  2WMO A;  2RFM A;  4FU3 A;  3MYV A;  4GAA A;  1HG5 A;  3D9J A;  5CRU A;  4XZ4 A;  2XEE A;  3IEG A;  3NF1 A;  3PNT B;  3IXE A;  4GTR A;  3SGH A;  2I2O A;  4JA9 A;  2CG2 A;  4I17 A;  4GTV A;  2LSU A;  4PS3 A;  1EYH A;  3ZXP A;  5EIL A;  2OEV A;  2VSO E;  2B6C A;  3PZD A;  1YMP A;  3Q7A A;  2ZIR A;  4L2Y A;  4GZC A;  3P1U A;  4I1A A;  4BES A;  3FU6 A;  2MYO A;  4BTA A;  4UI9 K;  3ML9 A;  4W9R A;  3KSQ A;  4BY6 A;  3CST A;  2DYS E;  3DSV A;  2WM9 A;  4HNA D;  1TN7 A;  1JCQ A;  4FP7 A;  3T5V A;  1N4S A;  3CK9 A;  4GMR A;  4JPS A;  3HXC A;  4CDR A;  4R7L A;  1E8Y A;  3O4Z A;  1QZ2 A;  2WXJ A;  2IEJ A;  4URK A;  3AS8 A;  3APC A;  5FWQ A;  5KJM A;  3TWR A;  3ZHE A;  4U8H A;  5A7D B;  1JWG A;  2J09 A;  3E37 A;  3FWV A;  2X6K A;  3DEO A;  4B89 A;  4MBG A;  1NA3 A;  5FZQ A;  2VSN A;  4GA2 A;  5ENO D;  4KMO A;  3MKQ A;  3RJV A;  2XQ0 A;  2R05 A;  1S63 A;  2VSY A;  5FQ8 A;  5FQ6 A;  3IBE A;  4DX1 A;  3L16 A;  1HH8 A;  4K03 A;  4B93 B;  2L9B A;  1TNY A;  2DCP A;  3L22 A;  4NUR A;  3DRA A;  2VQ2 A;  1TR4 A;  3UMV A;  2X6F A;  3LYA A;  3I4R B;  4ANV A;  3ULE G;  2RD0 A;  4ILI A;  2WB2 A;  3VLE A;  4HVB A;  3EIQ C;  3ENE A;  3DBS A;  3MX3 A;  3FFL A;  4UWF A;  4B94 A;  4G11 A;  3CVX A;  2XS8 A;  2WPV A;  3SFZ A;  3U66 A;  2P9K G;  3OTN A;  3CKB A;  4APO A;  3B95 A;  1QQE A;  2VYI A;  3KSL A;  5EN5 D;  5AEN A;  3FU5 A;  2DWZ A;  5AJL A;  4J7W A;  2ZXW E;  5FQ4 A;  5LX8 A;  3PEV B;  4G25 A;  2J07 A;  2PL2 A;  2HR2 A;  2R2L A;  4MKT A;  4Q96 A;  2XCB A;  4G8L A;  3KEA A;  3WG7 E;  2ZU6 B;  4O6F A;  3NAW A;  1JCS A;  3DXM G;  1E7U A;  3P2B A;  4FA6 A;  3UUX A;  3G2U A;  3QDN A;  4E6H A;  1YYH A;  3DWL G;  1FVH A;  5KJK A;  1E96 B;  4HB5 A;  1IKN D;  1L5J A;  2VTB A;  1N52 A;  4F1P A;  1Z5S C;  4B0Z A;  4GCO A;  1KZP A;  5BV0 A;  1O1T A;  4V3I A;  4DUI A;  1TN8 A;  1HZ4 A;  1H2T C;  3Q47 B;  2A5U A;  4BX9 A;  2WQ6 A;  1SZ9 A;  2J08 A;  3ASN E;  5ENS D;  5BXO A;  1SZA A;  5B1A E;  4IUL A;  1E8W A;  4I6G A;  3EHQ A;  3EIJ A;  2WXL A;  1BD8 A;  1UW4 B;  3APF A;  3ONK A;  5EYL A;  4F7A A;  5IY5 E;  2R03 A;  4L2L A;  1U2V G;  4BWR A;  4YDE A;  4A1S A;  3B7S A;  3FUN A;  2WXQ A;  1BI7 B;  3FTU A;  2P9S G;  5AAR A;  2LXL A;  3L17 A;  4XIF A;  1LF8 A;  2BKG A;  5CCL A;  3ASH A;  1H6O A;  5G05 J;  2JLB A;  2OCC E;  1LTX A;  5G55 A;  3CVQ A;  1W3B A;  1HU3 A;  1ELR A;  2I1J A;  4CDM A;  2KCK A;  2XEV A;  4GCN A;  4KZ0 A;  4BT8 A;  4HOQ A;  4AXH A;  1O5M A;  3NOG D;  3ESK A;  3G2V A;  3O48 A;  1N95 A;  1OWN A;  3LDZ A;  4PS8 A;  1OWP A;  3J5Q B;  3HVE A;  3ESL A;  2YIN A;  3AU5 A;  2YNQ A;  3UIO C;  3E34 A;  1AWC B;  3FUL A;  4KBQ A;  4LNU D;  3QJZ A;  4I2Z A;  3CKC A;  2V0P A;  4XE0 A;  3ZUV B;  1HF8 A;  3LPZ A;  2HE0 A;  3I3N A;  5G05 C;  2P9L G;  3CVP A;  1IQU A;  5AYW D;  5EIB E;  3C3Q A;  4BEP A;  1MHQ A;  3FEX A;  4NQ0 A;  4F6R D;  2E0I A;  2WXF A;  2F8X K;  4A3T A;  4NIK A;  1N0Q A;  4FLB A;  3CHQ A;  5CEC B;  1MX2 A;  1MZC A;  2P9N G;  4EQF A;  3NQP A;  3PE4 A;  3PZ4 A;  1TEZ A;  2H6I A;  2IY0 C;  3NZU A;  3PS6 A;  3U4T A;  4BT9 A;  3Q9N C;  1SVX A;  4I43 A;  1HXI A;  5LP0 A;  3CK7 A;  3R9A B;  5AQA A;  1OT8 A;  3IHV A;  1IHG A;  4JHJ A;  1OUV A;  3QAR A;  4DX5 D;  3ZFW A;  3D9K A;  2R17 C;  5C1D A;  3C98 A;  2Q7F A;  4HXI A;  4BER A;  3AG1 E;  2X6I A;  3FUH A;  5EID A;  4JA7 A;  3HXE A;  2BKK B;  4AVX A;  1TNO A;  2MHK A;  2CHX A;  3HYM B;  4JXT A;  3SO8 A;  4WWP A;  4APF A;  1FPP A;  3ISM C;  5KNH D;  4K5A B;  5JMN D;  4CGW A;  4I6E A;  4N39 A;  3PUK A;  1FVF A;  3CHS A;  4TUM A;  2FF4 A;  3JQ1 A;  4WNE A;  5LCW J;  4EHM A;  1BPO A;  2IOS A;  2XCC A;  4FJZ A;  2E2E A;  1QBQ A;  4K0R A;  5EKQ D;  4I9C A;  3ZPJ A;  1QNF A;  2WXK A;  5D0Q D;  1IQR A;  3E4B A;  4EPZ A;  4UWH A;  2NXP A;  5AQB A;  5BXU A;  3WXX A;  4ZHB A;  3DST A;  5HKP A;  3PDN A;  4AIF A;  2QYU A;  3VTX A;  3UKU G;  1E7V A;  4ANU A;  2J4B A;  4RSY A;  1NA0 A;  3PE3 A;  1HE8 A;  5G2N A;  4CDN A;  4WWO A;  4LEU A;  5G04 C;  4A55 A;  5LCW C;  2LNI A;  3FUE A;  4O60 A;  3G2T A;  2BED A;  3FEY A;  3OXL A;  3TWT A;  4I6J A;  1BU9 A;  3LJN A;  4TV3 A;  1MX6 A;  5ENT D;  4OAU C;  4WUY A;  4O1O A;  3QK0 A;  4L1B A;  4HI8 A;  2ILR A;  2CG3 A;  2QZA A;  5D66 A;  4JW1 A;  5D0O D;  5E76 A;  2KM4 A;  5AN8 A;  4CT4 A;  5FJY A;  4YND A;  3ABK E;  1UN9 A;  4HQD A;  3AG4 E;  3JUI A;  4KVO A;  1N54 A;  1N11 A;  2F0Y A;  2Y0B G;  4JD2 G;  2KXP C;  1H2V C;  2DBA A;  2XRZ A;  3T9K A;  3UIN C;  2GRP B;  3Q7F A;  4OAV B;  2IJG X;  1TNU A;  3SY2 A;  3D9O A;  4F1S A;  2A5E A;  4B8C B;  5JJT A;  3QNK A;  3HXD A;  3CV0 A;  3OXG A;  4NAC A;  3FTW A;  4LRZ A;  4KT6 B;  5AIJ A;  2ION A;  3B7T A;  1NFI E;  4XKC A;  1A17 A;  4G23 A;  3SF4 A;  3UX4 A;  3B13 A;  2BUG A;  3I4G A;  3PNL B;  3UM2 A;  2OEW A;  4UQX A;  2ZIS A;  1OWM A;  4JEH A;  1H0A A;  3FDH A;  4HRN A;  4J8F A;  2L6J A;  2EIK E;  4U0U A;  3TG5 A;  4MLP A;  2Y4U A;  3IHY A;  4I1O B;  3UM0 A;  5AQ7 A;  4HOT A;  5FTP A;  1E8X A;  2AVP A;  3UIP C;  3CHM A;  3U64 A;  4ANX A;  3TXM A;  4U96 D;  1S64 A;  4XKB A;  3CVN A;  4KXK B;  3C5R A;  1U3C A;  4CCA A;  3Q78 A;  3C72 A;  4OYS A;  3GYZ A;  3DSU A;  3ZYK A;  3OAW A;  2WXM A;  2KBX A;  3CHO A;  3G2W A;  2H6F A;  4HLE A;  1JCR A;  3UTM A;  1EPU A;  4GTM A;  3B7R L;  4FJY A;  5HQ8 A;  2CHW A;  2KZT B;  2WVI A;  1JUQ A;  4LSZ E;  5EYP F;  3KAE A;  2XPY A;  4U95 D;  4DJA A;  5HI7 A;  5FIO A;  3NZS A;  3JXJ A;  4LER A;  4DX2 A;  2J8S D;  3KD7 A;  1P5Q A;  3V2O A;  2UY1 A;  3JYS A;  3MV3 B;  2WXI A;  3LEW A;  1WM5 A;  3SFX A;  5EDS A;  1AP7 A;  5BPP A;  3B7U X;  3PEU B;  4GB9 A;  4N2Q A;  3AS5 A;  4N5C A;  5BNW A;  4CZ2 D;  5ENQ D;  2V8S E;  2QFC A;  4WND A;  3ZKJ A;  2PZI A;  3BUA A;  1D8E A;  4GYO A;  3PVL A;  3ZN3 A;  3FU3 A;  4ANW A;  3CIA A;  1KT1 A;  1INZ A;  1MQS A;  4FUL A;  3CK8 A;  4TXP A;  3CHR A;  2OVF A;  3EU9 A;  3UM3 A;  2IQC A;  2PQR A;  2FO7 A;  1Y6I A;  1Z6T A;  5EX0 A;  4QFV A;  4LG6 A;  5LFA A;  1HFA A;  5C2Y A;  3FHE A;  3LVQ E;  5T8I A;  1OWL A;  4KZC A;  4XI0 A; 
#chains in the Genus database with same CATH homology
 5AAO A;  5EIL A;  5KNH D;  4K5A B;  5ENP D;  2KBX A;  4BSZ B;  5CED B;  4DUI A;  5AN8 A;  5JMN D;  1YMP A;  2NYJ A;  3TWV A;  4HLL A;  3AJI A;  5ENR D;  2XZT G;  5EIB E;  4TUM A;  3UTM A;  5CBN A;  2V5Q C;  2Y1L E;  4HQD A;  3UXG A;  1TR4 A;  3JXI A;  3NOC D;  4BEP A;  1BLX B;  2JAB A;  3HG0 D;  1IHB A;  1N11 A;  5ENS D;  5BXO A;  1K3Z D;  1MJ0 A;  4HBD A;  4BES A;  3V30 A;  2MYO A;  4N5Q A;  2Y0B G;  4LSZ E;  4U8Y D;  4F6R D;  5EYP F;  2ETB A;  4GPM A;  2KXP C;  2ZGD A;  2XEH A;  2AJA A;  2B0O E;  4U95 D;  2F8X K;  4U8V D;  1YCS B;  5HS0 A;  5KWD A;  3Q9U C;  5CER B;  3EHQ A;  5FIO A;  3T9K A;  3JXJ A;  3TWS A;  4DX2 A;  2J8S D;  4O1P A;  2PNN A;  3JUE A;  4B93 B;  4NIK A;  5AQB A;  1N0Q A;  4C48 B;  4OAV B;  3V2O A;  5BXU A;  2F37 A;  1BD8 A;  2DVW A;  5EYL A;  4G8K A;  4ATZ D;  1N0R A;  4ZHB A;  3TWW A;  5CEC B;  4HNA D;  2A5E A;  5HKP A;  1A5E A;  1MX2 A;  2DZN A;  1MX4 A;  3DEP A;  3B95 A;  1DCQ A;  3EHR A;  2F8Y A;  4JB8 P;  4RLY A;  2VGE A;  3NBN B;  4DX7 D;  1AP7 A;  4GMR A;  3ZNG A;  1BI7 B;  2DZO A;  3V79 K;  5EN5 D;  5FIN A;  5AAR A;  2QYJ A;  2DWZ A;  5AQ9 A;  2ETC A;  1S70 B;  4J7W A;  2BKG A;  1MYO A;  3ZU7 B;  4CZ2 D;  1NFI E;  3Q9N C;  4A63 B;  1SVX A;  2QC9 A;  2RFA A;  2XZD G;  1IXV A;  1DC2 A;  1D9S A;  5ENQ D;  3UI2 A;  3TWR A;  2XEN A;  4ZFH A;  5KBA A;  1OY3 D;  3ZKJ A;  4UUC A;  3TWQ A;  4HRL A;  3TWU A;  4HRM B;  5JA4 D;  4O60 A;  3V31 A;  1WG0 A;  5CBO A;  5KNG A;  4DRX E;  1QYM A;  5AQA A;  3DEO A;  4K5C A;  1OT8 A;  4G8L A;  1K1B A;  3KEA A;  2RFM A;  3HRA A;  4J8Y A;  3AAA C;  3NOG D;  3TWT A;  2V4H C;  3J5P A;  2ZGG A;  4DX5 D;  4HRN A;  1UOH A;  1BU9 A;  3LJN A;  1G3N B;  5ENO D;  4QQI A;  2L6B A;  2ETA A;  4YDW A;  1MX6 A;  5ENT D;  3T8K A;  2XEE A;  3TWX A;  5ITZ F;  4OAU C;  5AQ7 A;  4DX6 D;  3J5Q B;  4YDY A;  3B7B A;  1YYH A;  3V2X A;  1WDY A;  4BER A;  3D9H A;  4Z68 A;  4O1O A;  5HRY A;  3EU9 A;  4CYM D;  4HI8 A;  5EID A;  1AWC B;  2BKK B;  4HB5 A;  1IKN D;  4LNU D;  3IXE A;  4HI9 A;  4QFV A;  4LG6 A;  4F1P A;  3SO8 A;  5D66 A;  4U96 D;  3W9F A;  3W9G A;  4DX1 A;  5CEA A;  1BI8 B;  2FO1 E;  1K1A A;  3ZUV B;  3C5R A;  2HE0 A;  4K5B A;  4BET A;  2P2C P;  3F6Q A;  1SW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...