5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
4LNUD 3HRAA 4BETA 2HE0A 5CEDB 4LG6A 5KNHD 3ZKJA 5JMND 2ZGDA 2F8YA 4K5AB 4Z68A 4DRXE 1IKND 5EYLA 5KBAA 2Y0BG 2XZTG 3B95A 2FO1E 5KNGA 3SO8A 4F6RD 5CEAA 1K3ZD 3LJNA 3V79K 1YMPA 5EILA 5AQAA 2ZGGA 1QYMA 5HRYA 5ENSD 4U96D 3EU9A 4HLLA 3B7BA 3DEOA 2AJAA 5CBNA 5FINA 3W9GA 2V4HC 4C48B 3W9FA 5CBOA 3DEPA 3TWTA 2XEEA 3TWUA 4RLYA 5AARA 3TWXA 4HQDA 4LSZE 3TWWA 5HKPA 4N5QA 3T8KA 2PNNA 3Q9NC 2BKGA 1DCQA 4BSZB 5CECB 4J8YA 1YCSB 4ZHBA 2XEHA 2P2CP 3ZUVB 1MJ0A 3NOCD 4JB8P 4HRNA 5EN5D 3TWSA 5FIOA 5KWDA 4A63B 2KXPC 5D66A 4ZFHA 2BKKB 1OT8A 4HI8A 4YDYA 4QQIA 3UXGA 3V30A 1OY3D 4U8VD 4DX1A 5AQBA 4ATZD 3D9HA 2QYJA 5HS0A 4BERA 4OAUC 1SVXA 2B0OE 5ENOD 4BESA 2F8XK 1A5EA 4DX6D 2ETCA 4HB5A 2RFMA 4J7WA 4DX7D 2DZOA 4HBDA 5EIDA 3NBNB 4GMRA 4U95D 4CZ2D 1BI8B 1IHBA 1AWCB 4OAVB 3V31A 2V5QC 2DVWA 4DUIA 1NFIE 3UI2A 3NOGD 1WDYA 3TWRA 1MX2A 4O60A 4HNAD 4U8YD 2MYOA 5EIBE 2ETBA 2XENA 3EHQA 3HG0D 4HRMB 2RFAA 2ETAA 3JUEA 1UOHA 1N11A 3UTMA 5BXOA 1IXVA 1WG0A 4GPMA 2VGEA 3T9KA 4F1PA 2DZNA 2Y1LE 4CYMD 5AAOA 3V2XA 1N0QA 4HI9A 1BLXB 4K5CA 3C5RA 4YDWA 5ITZF 3TWQA 4HRLA 2A5EA 4G8KA 2QC9A 4TUMA 5ENRD 5EYPF 5JA4D 1BU9A 1K1BA 4B93B 4G8LA 3ZU7B 1TR4A 2L6BA 3KEAA 1D9SA 5ENTD 1MX4A 5BXUA 1BI7B 1N0RA 2DWZA 2XZDG 3AJIA 1G3NB 5AQ9A 2J8SD 4O1PA 4DX2A 2NYJA 3F6QA 2KBXA 1YYHA 5AQ7A 1BD8A 4DX5D 1SW6A 3V2OA 2JABA 3AAAC 3Q9UC 3IXEA 1S70B 4BEPA 3J5PA 4K5BA 4QFVA 3JXJA 5CERB 1MYOA 4UUCA 1K1AA 5AN8A 3JXIA 1DC2A 3EHRA 1MX6A 4NIKA 1AP7A 5ENQD 5ENPD 3TWVA 3ZNGA 4O1OA 3J5QB 2F37A
chains in the Genus database with same CATH superfamily
4CGVA 4F6RD 3SGHA 5AENA 2VJ8A 2H6HA 5IY5E 5HQ8A 2J09A 2CG3A 4V3IA 4XI0A 3ZVVA 5ANRA 4PDXA 2OCCE 3APFA 3UM1A 3CHQA 3HXCA 3Q4AB 3KAEA 3CKCA 5FIOA 3MV2B 3S2AA 5D66A 1MQSA 4ATGA 2UY1B 2IF4A 4QQIA 3V30A 4XI9A 1OY3D 3FUKA 4HS2A 4Q96A 3CSTA 4OAUC 3FUMA 2ETCA 4HBDA 4WNGA 1LD7A 2V5FA 2R5SA 2JEKA 3CV0A 2IY0C 4JHKA 3C3QA 2IOLA 3B13A 2R2LA 4HOUA 1H2UA 5KCMA 3UIPC 3GW4A 1W3BA 3HG0D 2EINE 5AJDA 4A1GA 3B7SA 3T9KA 3ASDA 4KVMA 4ILGA 4LNBA 5FTPA 1OWMA 4I1AA 3B7RL 1H19A 2NYJA 2KBXA 4FJYA 1DCEA 3D9JA 1TNOA 1S63A 5G2NA 3DRAA 1DC2A 4KBQA 4XKCA 3IBEA 3HRAA 2QFCA 4EZJA 5EX0A 4ANVA 4G1TA 4K5AB 4BFRA 3L82A 3IKOB 1XNFA 3ZRHA 3CEQA 4TUUA 4DLOA 2WXGA 5CMYA 2R02A 3L6AA 4H7YA 4GZ3A 2DBAA 5T8IA 1E96B 5FWQA 2ZXWE 3TWTA 2WXMA 4RLYA 3FH8A 3D9MA 4Q69A 3CVPA 3HIZA 2IJGX 2KXPC 1OCCE 3UXGA 1TNZA 4KXKB 2DIWA 3RRUA 4U8HA 4MBGA 3SI5A 4DJAA 2WQ6A 1UN8A 4UQXA 2L0IA 2J08A 1A17A 4O60A 2BEDA 3PNLB 3D9NA 4AY6A 4APFA 3DSTA 4OVVA 4AOFA 3L17A 4WWOA 1H6OA 3R7RA 4BTAA 4HRLA 4G8KA 5ENRD 3G2UA 3ZHEA 3QC1A 3TG5A 3FTZA 2VTBA 1E7UA 4APOA 3FTUA 1FCHA 1OWOA 4JZYA 2KC7A 4O1PA 3F6QA 1XGWA 3KEZA 3DPYA 3NAWA 1SQMA 2GRQB 4U7EB 5A23A 3QK0A 2HR2A 3UX4A 2LNIA 4GCNA 4PS7A 3SO8A 5FZRA 4NRHB 2ZGGA 2AWIA 4LERA 1QYMA 2RKKA 4JHJA 2R03A 3EIJA 3JUIA 5ANLA 2XGMA 3ULQA 1QBQA 4J8EA 4IN3B 2OOEA 1MJ0A 4RG9A 5CHEE 3BG0B 3EHNA 3UUXA 3D9HA 2LAIA 3FUIA 4HB5A 4B89A 3D9OA 2VSYA 2P9KG 3N71A 3E30A 2LO6A 1KZOA 4HOSA 3ASNE 1IHBA 3MCXA 4OAVB 3V31A 1Z6TA 3UM0A 3CVLA 4DUIA 2J4BA 3BU8A 2UY1A 4GA2A 1IHGA 3L16A 5D2MC 4HOQA 3ZXSA 3PEUB 3UTMA 4NACA 3ZYMA 2VGEA 2DZNA 2XCCA 3CHMA 2P9PG 3C5RA 5BPPA 2QC9A 2IQCA 2KZTB 3QB2A 4YNDA 5KJLA 1OWPA 2LUHA 1N0RA 2XZDG 3UKRG 2XPZA 5AQ7A 4B94A 2CHZA 4JC8A 4QFVA 4AV7A 1K1AA 4U0ZA 1KPSB 3C3RA 3G2WA 2EIJE 4FC8A 4GTRA 2F37A 1OWNA 3Q7FA 2HE0A 2OVFA 3CIAA 4EQFA 3UIOC 1UJKA 3ESLA 3U4TA 4LCTA 3B7BA 5C1DA 3UT8A 2J4DA 3TJPA 3I4RB 3LDZA 4I2WA 4HORA 3PH0C 5CECB 4J8YA 4CCAA 3B7TA 2NSZA 4CT4A 1EDUA 4F3VA 2EQXA 4UWKA 3QOUA 3L22A 2F0YA 4HLEA 1JCQA 2RD0A 2C2LA 3CHOA 1IQRA 1LD8A 4MS6A 3UI2A 4GZ6A 1MX2A 4J6IA 3HXEA 4U63A 2L9BA 3E34A 3ZFWA 4E6HA 3ZPJA 3CKBA 4AVXA 1UOHA 4UWHA 4YVQC 2AW6A 3PZ1A 5CRUA 3FUFA 1FPPA 1N54A 1BU9A 3U66A 3KEAA 4GA0A 3BG1B 3SBTB 2L6JA 5A6CA 1G3NB 4ACLA 1U3DA 3JQ1A 5AQ9A 4HXIA 3PE4A 3C72A 1BD8A 2JABA 3PEVB 3RRMB 4UWLA 2A5UA 2WXJA 3SD5A 2ZISA 3ABKE 4K0RA 2XGOA 1HG5A 2XPIA 3ONKA 3TG4A 4N2QA 2WXHA 3DSWA 4LSZE 4G11A 5HKPA 1O1SA 4BSZB 3ZUVB 1Z3YA 2Y4TA 3MGBA 2BKKB 5LX8A 4YDYA 2AXVA 3KS2A 1H2VC 5HS0A 3DBSA 3LY8A 1HG2A 2X6HA 2J49A 1HZ4A 1HS6A 3K9IA 4CGWA 1B89A 3TGOA 4MLPA 4BTBA 5M72A 3LCAA 2ZU6B 3PE3A 2OEVA 3KSLA 2Y3AA 1OCRE 2R17C 4GZ5A 4BT9A 2A4ZA 2I6HA 2VGXB 3IHVA 2A5EA 4TUMA 4N3CA 5BXUA 2L0TB 1JPLA 1YYHA 4X8QA 3V2OA 4YDOA 3GZ1A 3HXBA 1N4SA 1SZAA 3G2SA 5AN8A 4JHRA 2R59A 4XX5A 5ENQD 3DSUA 2BUGA 3I3NA 4D10C 3VLDA 1LTXA 2FI7A 2KZTA 4MKTA 2I9CA 4WNEA 2WXKA 1JUQA 5CMWA 4N2SA 3B95A 4TRQA 2YINA 3EUVA 1TEZA 3EU9A 4GA1A 2EILE 3W9GA 2WQHA 3CK9A 3DPDA 4N5QA 3PDNA 5JJ7A 2P2CP 3IV0A 4HRNA 4JEHA 1FT1A 2FF4A 3ZW3A 3DXMG 5JHBA 3AU4A 2XS8A 3DSSA 1OWLA 1UN9A 4M7CA 5T3RA 3RK6A 2NC9A 3EHMA 5AJLA 1WDYA 3HYMB 4C0EA 1TJFA 5KJMA 3EHQA 3Q49B 3VLEA 2ETAA 2H6IA 3CLJA 3SHFA 3ABLE 2GROB 1N9AA 4F1PA 1N0QA 4CRWA 4N39A 4G8LA 3ZU7B 1TR4A 1ZBPA 3G2TA 1MZCA 3FUEA 1HF8A 3FUDA 2X6KA 2AVPA 1DVPA 4AM9A 2DYSE 1WY6A 3JXJA 3UPVA 3JXIA 3EHRA 2B6CA 4C9BB 3LYAA 3AG3E 4O1OA 4CT0A 2WMNA 4WNDA 1PC2A 4UWFA 4GTOA 4CDMA 4N3AA 4LUNU 2PM7A 1E7VA 4XKBA 4GTTA 3AG1E 3DSXA 1KT0A 2E0IA 1OUVA 1HU3A 3OXGA 5KJKA 2GW1A 1PAQA 3Q9NC 1N52A 1TJCA 1N4QA 3MJWA 1OT8A 3FTVA 5JHAA 1RW2A 4JW1A 4UQYA 4JA7A 4G26A 3QWWA 3HXDA 2RFMA 3CVUA 4BSXA 4G24A 4FHKA 5A7DB 1Y8MA 4UWGA 3ZYQA 4W9RA 2WVIA 3MKRA 3ULEG 3S7JA 4RVBA 4L2LA 5ARFA 4FA6A 5BXOA 4AEZC 5AAOA 1TNUA 4TXRA 2KCLA 3L54A 3CVVA 1BI7B 1O5MA 2MRIA 4AIFA 1E8ZA 3MEKA 5CCMA 5E76A 4BEPA 4GCOA 4KMOA 4UUCA 3MX3A 2VGXA 5ENPD 1WG0A 2F8YA 4K03A 4I17A 3AS4A 1FVFA 4CDRA 5CEAA 4YDEA 2VSNA 5EILA 5AQAA 3Q7AA 4U96D 4GAAA 4I9CA 3DEOA 5CBNA 5C2YA 2I1JA 2KM4A 3B7UX 3P1UA 1K8KG 3GZ2A 3T8KA 3RRNB 4ZHBA 4FHJA 1ELKA 3D9PA 5LOZA 2P9NG 3FH7A 4ZFHA 2LSVA 2KCVA 2VSOE 2Q7FA 4LNGA 4AXHA 4ATZD 3S7DA 2VYIA 4DX7D 4A55A 3NF1A 4GMRA 4FULA 4L2YA 1P5QA 3T5VA 4DI4A 5BV1A 2X6FA 4MRUA 3E4BA 2IO3C 2ZIRA 4C0MA 1N11A 2P9UG 4CDNA 2PL2A 3LXUX 4HI9A 2I2OA 5EYPF 1E8XA 2L6BA 2CFZA 3L13A 2ILRA 3AG2E 4JVSA 2YQ8A 3I5PA 3CGHA 3WXXA 2J9QA 2I1KA 5BT1A 2V8SE 3TAXA 2GRRB 5G05J 1QNFA 3PREA 3CHPA 3FP3A 3FHEA 3AS5A 5B1AE 1EF1C 4GYYA 3SNXA 1IYGA 2CG2A 4HLLA 1VDYA 2EIKE 1NZNA 4C48B 1TN7A 1V54E 2YNQA 4URKA 1SA5A 3NOCD 3SZ7A 1D8EA 3NZSA 3RJVA 4U8VD 4DX1A 1WM5A 2QYJA 3C3OA 4BERA 3IHYA 2DZOA 2P9LG 2PM6A 1E8WA 3SFYA 3PS6A 5BUZA 2KATA 1NL4A 4HNAD 3PUKA 3DWLG 2ETBA 2RFAA 1U3CA 3QDNA 1TNYA 1BLXB 4YDWA 3EDTB 4GYWA 4JL0A 1K1BA 1D9SA 3OTNA 2X3MA 4BT8A 4J8SA 4AP2A 5AYWD 3MV3B 4J0UA 3RSEG 1ZU2A 2IO2C 2AXUA 5J90A 4DI3A 1MX6A 2P9IG 3D9KA 4LG6A 4ILIA 3CR3A 1JWFA 2Y0BG 1HX8A 3NZUA 2YHEA 3V79K 3SY2A 3ISMC 4B8AA 2XGSA 1YA0A 4ANUA 3O4ZA 1V55E 3T8MA 3JYSA 4I6GA 1OCZE 1OCOE 2CHXA 3MZLB 4EBAG 1DCQA 3RO3A 1YCSB 5EN5D 5KWDA 4RQIA 4HI8A 3LY7A 3SFXA 3CQCB 4IYPA 3UKUG 1MHQA 4BESA 1HE8A 3FUNA 2WXLA 3EU5A 3ZN3A 4KVOA 1NFIE 3NOGD 5CRVA 3U64A 1X5BA 3RO2A 4N3BA 2MHKA 3JUEA 4M3OA 4I2ZA 3FTWA 1S64A 4GPMA 4FJZA 4K5CA 3TWQA 4B93B 1EYHA 2IEJA 5HI7A 2CHWA 3FUHA 4DX2A 3Q78A 4WNFA 3FU3A 3ENEA 3J5PA 2HO1A 3QAQA 1TN6A 4WAFA 1AP7A 1Z5SC 3LEWA 3ZNGA 3HVEB 4LNUD 4BETA 5LP0A 1QQEA 4DRXE 3QWPA 3TXMA 3WG7E 4L7TA 3LPZA 4AJWA 2XQ0A 3R9MA 5ENSD 4GYOA 5G05C 4G23A 2IU1A 3LKUA 3UQ3A 3LJ3A 3APCA 3W9FA 3QJZA 5CBOA 5H7PA 3ESKA 3FWVA 3AU5A 3UMVA 5DBKA 3E37A 4ACKA 3ML8A 3CK7A 2XEVA 3PNTB 2XCBA 2WMOA 3T5XA 2IFUA 1H2TC 5E75A 4U0UA 5EIDA 3EJNA 1TNBA 3EIQC 2OVBA 2P58C 3FTYA 2DVWA 3ZGQA 2XENA 2BF0X 4GTQA 3Q73A 3FU6A 2V0PA 1IXVA 3CVYA 3D9IA 4XE0A 3FH5A 4YVOA 5EDSA 5EKQD 5BW8C 3S7FA 3FTXA 3LS8A 4FU3A 3TWVA 2WXQA 2NXPA 3LVRE 5KNHD 2XHEA 4UI9J 4NQ0A 2FO1E 3PZ4A 3RKVA 4ME2A 1K3ZD 4F53A 3ULYA 1TYQG 2OV8A 2V4HC 3QNKA 3VLFA 4GTPA 4JEUA 2PQRA 2XEEA 3UT7A 3BUAA 1LF8A 3CVNA 4O6FA 5LCWC 5G55A 2HM8A 2QYUA 2VGYA 3FU5A 4ABNA 3R7QA 4E85A 4TXPA 4EPZA 1A5EA 4EBAA 3NQPA 4GTMA 3CK8A 3FULA 2M63A 5BNWA 3ONLA 4J8FA 2MYOA 4Q94A 3CHRA 3QARA 2WXOA 4Y6CA 2H6GA 1UW4B 3KSQA 1UJJA 3P2BA 1MX4A 2AXZA 4ANWA 4GTSA 4I1OB 3X2QE 5FJYA 1INZA 4DX5D 2C0MA 3DSVA 2C0LA 3FUJA 3CVXA 1QZ2A 2WXNA 1FT2A 4J8DA 3Q79A 2XS1A 3ZKJA 4FADA 2UWJG 4GMLA 3PZ2A 3SBSA 1IKND 4PS3A 2X6IA 4WUYA 4Y6WA 1NI1A 2GRPB 2AJAA 2MOWA 1KT1A 4HFGA 2WXRA 5JJ6A 5FZSA 1NA0A 3MA5A 3HVEA 1X81A 4N5CA 2FO7A 4GMJA 3ASFA 2IONA 4L23A 3RAUA 3TWSA 3FU0A 2LXLA 4FLBA 2FEZA 5FQ4A 2WXFA 3GZSA 5DIZA 2B0OE 2F8XK 3ZYKA 4J7WA 3Q15A 4EZKA 2WB2A 1HXIA 2OEWA 3URZA 3ASOE 2GRMA 4U95D 4CZ2D 5J08A 1O1RA 2Y69E 3G2VA 3MYVA 2GRLA 4R7LA 4BX9A 3LY9A 4LRZA 4HRMB 5AIJA 1U2VG 4TV3A 1UG3A 2HYZA 3TL5A 4CYMD 4WWPA 3BQOA 2WM9A 1IQUA 3Q5MA 5D0QD 3UM3A 5B3SE 3CQGB 4ILHB 1H0AA 3OAWA 1SW6A 3AAAC 3IXEA 3Q75A 1GW6A 4OVUA 5CERB 1MYOA 4TXQA 1D8DA 3J5QB 3IEGA 2X38A 5FQ6A 5JMND 4L9PA 4JD2G 3QWVA 3FEYA 1HFAA 3FY4A 5HRYA 3CVWA 1NP7A 1PY1A 2PQNA 4DPRA 3CSFA 3MKQB 1SA4A 4G2VA 3SQVA 2CFUA 5FT9A 1HO8A 2QY7A 4UI9C 3S7BA 4HQDA 3TWWA 3FFLA 1ELRA 3I4GA 4OYSA 2Y4UA 1OXJA 2BTDA 1SZ9A 4KZ0A 3U3WA 4JB8P 2WQ7A 2EIME 3SF4A 4FP7A 4FLHA 4UI9K 4I1MA 5AQBA 2WXPA 3APDA 3ZEFA 2H6FA 1ZB1A 2V4LA 1BI8B 1AWCB 2QZAA 1E8YA 3KD7A 4KT6B 4XEIG 5FQ7A 3VTXA 2FBNA 2RG8A 4RSYA 1N95A 3U9WA 3V2XA 3TXNA 4PH4B 3UT4A 5JA4D 3SFZA 2KCKA 2GGFA 5G04J 3L08A 1TN8A 5BV0A 2ONDA 2JLBA 4BX8A 1EPUA 3Q9UC 1S70B 5T4YA 3DXKG 1O1TA 4PUCA 4NIKA 3L9TA 5CEDB 1E90A 5EX3A 3JQ0A 2ZGDA 1N4RA 5EYLA 2XZTG 5KNGA 4JPSA 5D0OD 4XZ4A 2XRZA 5KJNA 3PUJA 3NB2A 1N4PA 4RG6A 4KYOB 1BPOA 1ELWA 3DEPA 1H6PA 2DYRE 2IOSA 4NURA 4GB9A 2PNNA 2BKGA 2LXMA 5ARGA 3FTSA 2WXIA 2XEHA 2R05A 3FEXA 4A63B 4GPKA 4A1SA 3C98A 3R9AB 4F7AA 5LCWJ 3JCKC 4HOTA 4PS8A 3HXFA 3AS8A 4I43A 4AY5A 2XRYA 1SVXA 1H6KA 3PRZA 5B1BE 4HVBA 3OXFA 5LFAA 5JJTA 3NBNB 4ANXA 3HHMA 4BWRA 1KZPA 2V5QC 3LVQE 5CCLA 2FULA 3ASGA 4U8YD 1JWGA 1S0PA 4I6EA 3ASHA 3RIBA 2E2EA 1Q2ZA 5ITZF 3UINC 4A3TA 4P29A 4CEMA 2LSUA 3BEEA 3CHSA 1HH8A 4EHMA 4UQZA 3AJIA 4A3VA 2YHCA 2J8SD 1Y6IA 3PZ3A 4IRUA 1JCRA 2VSXE 1L5JA 3ZIMA 1Z3XA 3D9LA 3HDXA 2J07A 5FQ8A 2GRNB 4GU5A 4Z68A 3O48A 5KBAA 1KLXA 4BY6A 3LJNA 1YMPA 3UM2A 3Q47B 3E32A 4U07A 4XIFA 4KZCA 5FINA 2WPVA 4I6JA 1WAO1 4GZCA 3TWUA 5AARA 4DLQA 3TWXA 3PZDA 2VQ2A 2DCPA 4U04A 3ABME 1RZ4A 2PZIA 1FVHA 5ENOD 5FZQA 3MKQA 4DX6D 4U0SA 4G25A 3ZHEB 4EZLA 2VTBB 4GZDA 3OXLA 5ENNA 3TWRA 4F1SA 3ZXPA 5EIBE 4DK5A 3ZYLA 3RU0A 4L1BA 4LEUA 4WWNA 4JXTA 3QKYA 3VTYA 4I9EA 2X6JA 2Y1LE 4JA9A 4B0ZA 1DNPA 1N94A 4H7XA 5ENTD 2XPYA 2LAHA 4EECA 2DWZA 3GYZA 3PVLA 3E33A 3FDHA 4IULA 2P9SG 1NA3A 3AG4E 4GTVA 1JCSA 3ML9A 4K5BA 4B8CB 3D3MA 3CVQA 5G04C
chains in the Genus database with same CATH topology
4LNUD 3HRAA 4BETA 2HE0A 5CEDB 4LG6A 5KNHD 3ZKJA 5JMND 2ZGDA 2F8YA 4K5AB 4Z68A 4DRXE 1IKND 5EYLA 5KBAA 2Y0BG 2XZTG 3B95A 2FO1E 5KNGA 3SO8A 4F6RD 5CEAA 1K3ZD 3LJNA 3V79K 1YMPA 5EILA 5AQAA 2ZGGA 1QYMA 5HRYA 5ENSD 4U96D 3EU9A 4HLLA 3B7BA 3DEOA 2AJAA 5CBNA 5FINA 3W9GA 2V4HC 4C48B 3W9FA 5CBOA 3DEPA 3TWTA 2XEEA 3TWUA 4RLYA 5AARA 3TWXA 4HQDA 4LSZE 3TWWA 5HKPA 4N5QA 3T8KA 2PNNA 3Q9NC 2BKGA 1DCQA 4BSZB 5CECB 4J8YA 1YCSB 4ZHBA 2XEHA 2P2CP 3ZUVB 1MJ0A 3NOCD 4JB8P 4HRNA 5EN5D 3TWSA 5FIOA 5KWDA 4A63B 2KXPC 5D66A 4ZFHA 2BKKB 1OT8A 4HI8A 4YDYA 4QQIA 3UXGA 3V30A 1OY3D 4U8VD 4DX1A 5AQBA 4ATZD 3D9HA 2QYJA 5HS0A 4BERA 4OAUC 1SVXA 2B0OE 5ENOD 4BESA 2F8XK 1A5EA 4DX6D 2ETCA 4HB5A 2RFMA 4J7WA 4DX7D 2DZOA 4HBDA 5EIDA 3NBNB 4GMRA 4U95D 4CZ2D 1BI8B 1IHBA 1AWCB 4OAVB 3V31A 2V5QC 2DVWA 4DUIA 1NFIE 3UI2A 3NOGD 1WDYA 3TWRA 1MX2A 4O60A 4HNAD 4U8YD 2MYOA 5EIBE 2ETBA 2XENA 3EHQA 3HG0D 4HRMB 2RFAA 2ETAA 3JUEA 1UOHA 1N11A 3UTMA 5BXOA 1IXVA 1WG0A 4GPMA 2VGEA 3T9KA 4F1PA 2DZNA 2Y1LE 4CYMD 5AAOA 3V2XA 1N0QA 4HI9A 1BLXB 4K5CA 3C5RA 4YDWA 5ITZF 3TWQA 4HRLA 2A5EA 4G8KA 2QC9A 4TUMA 5ENRD 5EYPF 5JA4D 1BU9A 1K1BA 4B93B 4G8LA 3ZU7B 1TR4A 2L6BA 3KEAA 1D9SA 5ENTD 1MX4A 5BXUA 1BI7B 1N0RA 2DWZA 2XZDG 3AJIA 1G3NB 5AQ9A 2J8SD 4O1PA 4DX2A 2NYJA 3F6QA 2KBXA 1YYHA 5AQ7A 1BD8A 4DX5D 1SW6A 3V2OA 2JABA 3AAAC 3Q9UC 3IXEA 1S70B 4BEPA 3J5PA 4K5BA 4QFVA 3JXJA 5CERB 1MYOA 4UUCA 1K1AA 5AN8A 3JXIA 1DC2A 3EHRA 1MX6A 4NIKA 1AP7A 5ENQD 5ENPD 3TWVA 3ZNGA 4O1OA 3J5QB 2F37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNU D;  3HRA A;  4BET A;  2HE0 A;  5CED B;  4LG6 A;  5KNH D;  3ZKJ A;  5JMN D;  2ZGD A;  2F8Y A;  4K5A B;  4Z68 A;  4DRX E;  1IKN D;  5EYL A;  5KBA A;  2Y0B G;  2XZT G;  3B95 A;  2FO1 E;  5KNG A;  3SO8 A;  4F6R D;  5CEA A;  1K3Z D;  3LJN A;  3V79 K;  1YMP A;  5EIL A;  5AQA A;  2ZGG A;  1QYM A;  5HRY A;  5ENS D;  4U96 D;  3EU9 A;  4HLL A;  3B7B A;  3DEO A;  2AJA A;  5CBN A;  5FIN A;  3W9G A;  2V4H C;  4C48 B;  3W9F A;  5CBO A;  3DEP A;  3TWT A;  2XEE A;  3TWU A;  4RLY A;  5AAR A;  3TWX A;  4HQD A;  4LSZ E;  3TWW A;  5HKP A;  4N5Q A;  3T8K A;  2PNN A;  3Q9N C;  2BKG A;  1DCQ A;  4BSZ B;  5CEC B;  4J8Y A;  1YCS B;  4ZHB A;  2XEH A;  2P2C P;  3ZUV B;  1MJ0 A;  3NOC D;  4JB8 P;  4HRN A;  5EN5 D;  3TWS A;  5FIO A;  5KWD A;  4A63 B;  2KXP C;  5D66 A;  4ZFH A;  2BKK B;  1OT8 A;  4HI8 A;  4YDY A;  4QQI A;  3UXG A;  3V30 A;  1OY3 D;  4U8V D;  4DX1 A;  5AQB A;  4ATZ D;  3D9H A;  2QYJ A;  5HS0 A;  4BER A;  4OAU C;  1SVX A;  2B0O E;  5ENO D;  4BES A;  2F8X K;  1A5E A;  4DX6 D;  2ETC A;  4HB5 A;  2RFM A;  4J7W A;  4DX7 D;  2DZO A;  4HBD A;  5EID A;  3NBN B;  4GMR A;  4U95 D;  4CZ2 D;  1BI8 B;  1IHB A;  1AWC B;  4OAV B;  3V31 A;  2V5Q C;  2DVW A;  4DUI A;  1NFI E;  3UI2 A;  3NOG D;  1WDY A;  3TWR A;  1MX2 A;  4O60 A;  4HNA D;  4U8Y D;  2MYO A;  5EIB E;  2ETB A;  2XEN A;  3EHQ A;  3HG0 D;  4HRM B;  2RFA A;  2ETA A;  3JUE A;  1UOH A;  1N11 A;  3UTM A;  5BXO A;  1IXV A;  1WG0 A;  4GPM A;  2VGE A;  3T9K A;  4F1P A;  2DZN A;  2Y1L E;  4CYM D;  5AAO A;  3V2X A;  1N0Q A;  4HI9 A;  1BLX B;  4K5C A;  3C5R A;  4YDW A;  5ITZ F;  3TWQ A;  4HRL A;  2A5E A;  4G8K A;  2QC9 A;  4TUM A;  5ENR D;  5EYP F;  5JA4 D;  1BU9 A;  1K1B A;  4B93 B;  4G8L A;  3ZU7 B;  1TR4 A;  2L6B A;  3KEA A;  1D9S A;  5ENT D;  1MX4 A;  5BXU A;  1BI7 B;  1N0R A;  2DWZ A;  2XZD G;  3AJI A;  1G3N B;  5AQ9 A;  2J8S D;  4O1P A;  4DX2 A;  2NYJ A;  3F6Q A;  2KBX A;  1YYH A;  5AQ7 A;  1BD8 A;  4DX5 D;  1SW6 A;  3V2O A;  2JAB A;  3AAA C;  3Q9U C;  3IXE A;  1S70 B;  4BEP A;  3J5P A;  4K5B A;  4QFV A;  3JXJ A;  5CER B;  1MYO A;  4UUC A;  1K1A A;  5AN8 A;  3JXI A;  1DC2 A;  3EHR A;  1MX6 A;  4NIK A;  1AP7 A;  5ENQ D;  5ENP D;  3TWV A;  3ZNG A;  4O1O A;  3J5Q B;  2F37 A; 
#chains in the Genus database with same CATH topology
 4CGV A;  4F6R D;  3SGH A;  5AEN A;  2VJ8 A;  2H6H A;  5IY5 E;  5HQ8 A;  2J09 A;  2CG3 A;  4V3I A;  4XI0 A;  3ZVV A;  5ANR A;  4PDX A;  2OCC E;  3APF A;  3UM1 A;  3CHQ A;  3HXC A;  3Q4A B;  3KAE A;  3CKC A;  5FIO A;  3MV2 B;  3S2A A;  5D66 A;  1MQS A;  4ATG A;  2UY1 B;  2IF4 A;  4QQI A;  3V30 A;  4XI9 A;  1OY3 D;  3FUK A;  4HS2 A;  4Q96 A;  3CST A;  4OAU C;  3FUM A;  2ETC A;  4HBD A;  4WNG A;  1LD7 A;  2V5F A;  2R5S A;  2JEK A;  3CV0 A;  2IY0 C;  4JHK A;  3C3Q A;  2IOL A;  3B13 A;  2R2L A;  4HOU A;  1H2U A;  5KCM A;  3UIP C;  3GW4 A;  1W3B A;  3HG0 D;  2EIN E;  5AJD A;  4A1G A;  3B7S A;  3T9K A;  3ASD A;  4KVM A;  4ILG A;  4LNB A;  5FTP A;  1OWM A;  4I1A A;  3B7R L;  1H19 A;  2NYJ A;  2KBX A;  4FJY A;  1DCE A;  3D9J A;  1TNO A;  1S63 A;  5G2N A;  3DRA A;  1DC2 A;  4KBQ A;  4XKC A;  3IBE A;  3HRA A;  2QFC A;  4EZJ A;  5EX0 A;  4ANV A;  4G1T A;  4K5A B;  4BFR A;  3L82 A;  3IKO B;  1XNF A;  3ZRH A;  3CEQ A;  4TUU A;  4DLO A;  2WXG A;  5CMY A;  2R02 A;  3L6A A;  4H7Y A;  4GZ3 A;  2DBA A;  5T8I A;  1E96 B;  5FWQ A;  2ZXW E;  3TWT A;  2WXM A;  4RLY A;  3FH8 A;  3D9M A;  4Q69 A;  3CVP A;  3HIZ A;  2IJG X;  2KXP C;  1OCC E;  3UXG A;  1TNZ A;  4KXK B;  2DIW A;  3RRU A;  4U8H A;  4MBG A;  3SI5 A;  4DJA A;  2WQ6 A;  1UN8 A;  4UQX A;  2L0I A;  2J08 A;  1A17 A;  4O60 A;  2BED A;  3PNL B;  3D9N A;  4AY6 A;  4APF A;  3DST A;  4OVV A;  4AOF A;  3L17 A;  4WWO A;  1H6O A;  3R7R A;  4BTA A;  4HRL A;  4G8K A;  5ENR D;  3G2U A;  3ZHE A;  3QC1 A;  3TG5 A;  3FTZ A;  2VTB A;  1E7U A;  4APO A;  3FTU A;  1FCH A;  1OWO A;  4JZY A;  2KC7 A;  4O1P A;  3F6Q A;  1XGW A;  3KEZ A;  3DPY A;  3NAW A;  1SQM A;  2GRQ B;  4U7E B;  5A23 A;  3QK0 A;  2HR2 A;  3UX4 A;  2LNI A;  4GCN A;  4PS7 A;  3SO8 A;  5FZR A;  4NRH B;  2ZGG A;  2AWI A;  4LER A;  1QYM A;  2RKK A;  4JHJ A;  2R03 A;  3EIJ A;  3JUI A;  5ANL A;  2XGM A;  3ULQ A;  1QBQ A;  4J8E A;  4IN3 B;  2OOE A;  1MJ0 A;  4RG9 A;  5CHE E;  3BG0 B;  3EHN A;  3UUX A;  3D9H A;  2LAI A;  3FUI A;  4HB5 A;  4B89 A;  3D9O A;  2VSY A;  2P9K G;  3N71 A;  3E30 A;  2LO6 A;  1KZO A;  4HOS A;  3ASN E;  1IHB A;  3MCX A;  4OAV B;  3V31 A;  1Z6T A;  3UM0 A;  3CVL A;  4DUI A;  2J4B A;  3BU8 A;  2UY1 A;  4GA2 A;  1IHG A;  3L16 A;  5D2M C;  4HOQ A;  3ZXS A;  3PEU B;  3UTM A;  4NAC A;  3ZYM A;  2VGE A;  2DZN A;  2XCC A;  3CHM A;  2P9P G;  3C5R A;  5BPP A;  2QC9 A;  2IQC A;  2KZT B;  3QB2 A;  4YND A;  5KJL A;  1OWP A;  2LUH A;  1N0R A;  2XZD G;  3UKR G;  2XPZ A;  5AQ7 A;  4B94 A;  2CHZ A;  4JC8 A;  4QFV A;  4AV7 A;  1K1A A;  4U0Z A;  1KPS B;  3C3R A;  3G2W A;  2EIJ E;  4FC8 A;  4GTR A;  2F37 A;  1OWN A;  3Q7F A;  2HE0 A;  2OVF A;  3CIA A;  4EQF A;  3UIO C;  1UJK A;  3ESL A;  3U4T A;  4LCT A;  3B7B A;  5C1D A;  3UT8 A;  2J4D A;  3TJP A;  3I4R B;  3LDZ A;  4I2W A;  4HOR A;  3PH0 C;  5CEC B;  4J8Y A;  4CCA A;  3B7T A;  2NSZ A;  4CT4 A;  1EDU A;  4F3V A;  2EQX A;  4UWK A;  3QOU A;  3L22 A;  2F0Y A;  4HLE A;  1JCQ A;  2RD0 A;  2C2L A;  3CHO A;  1IQR A;  1LD8 A;  4MS6 A;  3UI2 A;  4GZ6 A;  1MX2 A;  4J6I A;  3HXE A;  4U63 A;  2L9B A;  3E34 A;  3ZFW A;  4E6H A;  3ZPJ A;  3CKB A;  4AVX A;  1UOH A;  4UWH A;  4YVQ C;  2AW6 A;  3PZ1 A;  5CRU A;  3FUF A;  1FPP A;  1N54 A;  1BU9 A;  3U66 A;  3KEA A;  4GA0 A;  3BG1 B;  3SBT B;  2L6J A;  5A6C A;  1G3N B;  4ACL A;  1U3D A;  3JQ1 A;  5AQ9 A;  4HXI A;  3PE4 A;  3C72 A;  1BD8 A;  2JAB A;  3PEV B;  3RRM B;  4UWL A;  2A5U A;  2WXJ A;  3SD5 A;  2ZIS A;  3ABK E;  4K0R A;  2XGO A;  1HG5 A;  2XPI A;  3ONK A;  3TG4 A;  4N2Q A;  2WXH A;  3DSW A;  4LSZ E;  4G11 A;  5HKP A;  1O1S A;  4BSZ B;  3ZUV B;  1Z3Y A;  2Y4T A;  3MGB A;  2BKK B;  5LX8 A;  4YDY A;  2AXV A;  3KS2 A;  1H2V C;  5HS0 A;  3DBS A;  3LY8 A;  1HG2 A;  2X6H A;  2J49 A;  1HZ4 A;  1HS6 A;  3K9I A;  4CGW A;  1B89 A;  3TGO A;  4MLP A;  4BTB A;  5M72 A;  3LCA A;  2ZU6 B;  3PE3 A;  2OEV A;  3KSL A;  2Y3A A;  1OCR E;  2R17 C;  4GZ5 A;  4BT9 A;  2A4Z A;  2I6H A;  2VGX B;  3IHV A;  2A5E A;  4TUM A;  4N3C A;  5BXU A;  2L0T B;  1JPL A;  1YYH A;  4X8Q A;  3V2O A;  4YDO A;  3GZ1 A;  3HXB A;  1N4S A;  1SZA A;  3G2S A;  5AN8 A;  4JHR A;  2R59 A;  4XX5 A;  5ENQ D;  3DSU A;  2BUG A;  3I3N A;  4D10 C;  3VLD A;  1LTX A;  2FI7 A;  2KZT A;  4MKT A;  2I9C A;  4WNE A;  2WXK A;  1JUQ A;  5CMW A;  4N2S A;  3B95 A;  4TRQ A;  2YIN A;  3EUV A;  1TEZ A;  3EU9 A;  4GA1 A;  2EIL E;  3W9G A;  2WQH A;  3CK9 A;  3DPD A;  4N5Q A;  3PDN A;  5JJ7 A;  2P2C P;  3IV0 A;  4HRN A;  4JEH A;  1FT1 A;  2FF4 A;  3ZW3 A;  3DXM G;  5JHB A;  3AU4 A;  2XS8 A;  3DSS A;  1OWL A;  1UN9 A;  4M7C A;  5T3R A;  3RK6 A;  2NC9 A;  3EHM A;  5AJL A;  1WDY A;  3HYM B;  4C0E A;  1TJF A;  5KJM A;  3EHQ A;  3Q49 B;  3VLE A;  2ETA A;  2H6I A;  3CLJ A;  3SHF A;  3ABL E;  2GRO B;  1N9A A;  4F1P A;  1N0Q A;  4CRW A;  4N39 A;  4G8L A;  3ZU7 B;  1TR4 A;  1ZBP A;  3G2T A;  1MZC A;  3FUE A;  1HF8 A;  3FUD A;  2X6K A;  2AVP A;  1DVP A;  4AM9 A;  2DYS E;  1WY6 A;  3JXJ A;  3UPV A;  3JXI A;  3EHR A;  2B6C A;  4C9B B;  3LYA A;  3AG3 E;  4O1O A;  4CT0 A;  2WMN A;  4WND A;  1PC2 A;  4UWF A;  4GTO A;  4CDM A;  4N3A A;  4LUN U;  2PM7 A;  1E7V A;  4XKB A;  4GTT A;  3AG1 E;  3DSX A;  1KT0 A;  2E0I A;  1OUV A;  1HU3 A;  3OXG A;  5KJK A;  2GW1 A;  1PAQ A;  3Q9N C;  1N52 A;  1TJC A;  1N4Q A;  3MJW A;  1OT8 A;  3FTV A;  5JHA A;  1RW2 A;  4JW1 A;  4UQY A;  4JA7 A;  4G26 A;  3QWW A;  3HXD A;  2RFM A;  3CVU A;  4BSX A;  4G24 A;  4FHK A;  5A7D B;  1Y8M A;  4UWG A;  3ZYQ A;  4W9R A;  2WVI A;  3MKR A;  3ULE G;  3S7J A;  4RVB A;  4L2L A;  5ARF A;  4FA6 A;  5BXO A;  4AEZ C;  5AAO A;  1TNU A;  4TXR A;  2KCL A;  3L54 A;  3CVV A;  1BI7 B;  1O5M A;  2MRI A;  4AIF A;  1E8Z A;  3MEK A;  5CCM A;  5E76 A;  4BEP A;  4GCO A;  4KMO A;  4UUC A;  3MX3 A;  2VGX A;  5ENP D;  1WG0 A;  2F8Y A;  4K03 A;  4I17 A;  3AS4 A;  1FVF A;  4CDR A;  5CEA A;  4YDE A;  2VSN A;  5EIL A;  5AQA A;  3Q7A A;  4U96 D;  4GAA A;  4I9C A;  3DEO A;  5CBN A;  5C2Y A;  2I1J A;  2KM4 A;  3B7U X;  3P1U A;  1K8K G;  3GZ2 A;  3T8K A;  3RRN B;  4ZHB A;  4FHJ A;  1ELK A;  3D9P A;  5LOZ A;  2P9N G;  3FH7 A;  4ZFH A;  2LSV A;  2KCV A;  2VSO E;  2Q7F A;  4LNG A;  4AXH A;  4ATZ D;  3S7D A;  2VYI A;  4DX7 D;  4A55 A;  3NF1 A;  4GMR A;  4FUL A;  4L2Y A;  1P5Q A;  3T5V A;  4DI4 A;  5BV1 A;  2X6F A;  4MRU A;  3E4B A;  2IO3 C;  2ZIR A;  4C0M A;  1N11 A;  2P9U G;  4CDN A;  2PL2 A;  3LXU X;  4HI9 A;  2I2O A;  5EYP F;  1E8X A;  2L6B A;  2CFZ A;  3L13 A;  2ILR A;  3AG2 E;  4JVS A;  2YQ8 A;  3I5P A;  3CGH A;  3WXX A;  2J9Q A;  2I1K A;  5BT1 A;  2V8S E;  3TAX A;  2GRR B;  5G05 J;  1QNF A;  3PRE A;  3CHP A;  3FP3 A;  3FHE A;  3AS5 A;  5B1A E;  1EF1 C;  4GYY A;  3SNX A;  1IYG A;  2CG2 A;  4HLL A;  1VDY A;  2EIK E;  1NZN A;  4C48 B;  1TN7 A;  1V54 E;  2YNQ A;  4URK A;  1SA5 A;  3NOC D;  3SZ7 A;  1D8E A;  3NZS A;  3RJV A;  4U8V D;  4DX1 A;  1WM5 A;  2QYJ A;  3C3O A;  4BER A;  3IHY A;  2DZO A;  2P9L G;  2PM6 A;  1E8W A;  3SFY A;  3PS6 A;  5BUZ A;  2KAT A;  1NL4 A;  4HNA D;  3PUK A;  3DWL G;  2ETB A;  2RFA A;  1U3C A;  3QDN A;  1TNY A;  1BLX B;  4YDW A;  3EDT B;  4GYW A;  4JL0 A;  1K1B A;  1D9S A;  3OTN A;  2X3M A;  4BT8 A;  4J8S A;  4AP2 A;  5AYW D;  3MV3 B;  4J0U A;  3RSE G;  1ZU2 A;  2IO2 C;  2AXU A;  5J90 A;  4DI3 A;  1MX6 A;  2P9I G;  3D9K A;  4LG6 A;  4ILI A;  3CR3 A;  1JWF A;  2Y0B G;  1HX8 A;  3NZU A;  2YHE A;  3V79 K;  3SY2 A;  3ISM C;  4B8A A;  2XGS A;  1YA0 A;  4ANU A;  3O4Z A;  1V55 E;  3T8M A;  3JYS A;  4I6G A;  1OCZ E;  1OCO E;  2CHX A;  3MZL B;  4EBA G;  1DCQ A;  3RO3 A;  1YCS B;  5EN5 D;  5KWD A;  4RQI A;  4HI8 A;  3LY7 A;  3SFX A;  3CQC B;  4IYP A;  3UKU G;  1MHQ A;  4BES A;  1HE8 A;  3FUN A;  2WXL A;  3EU5 A;  3ZN3 A;  4KVO A;  1NFI E;  3NOG D;  5CRV A;  3U64 A;  1X5B A;  3RO2 A;  4N3B A;  2MHK A;  3JUE A;  4M3O A;  4I2Z A;  3FTW A;  1S64 A;  4GPM A;  4FJZ A;  4K5C A;  3TWQ A;  4B93 B;  1EYH A;  2IEJ A;  5HI7 A;  2CHW A;  3FUH A;  4DX2 A;  3Q78 A;  4WNF A;  3FU3 A;  3ENE A;  3J5P A;  2HO1 A;  3QAQ A;  1TN6 A;  4WAF A;  1AP7 A;  1Z5S C;  3LEW A;  3ZNG A;  3HVE B;  4LNU D;  4BET A;  5LP0 A;  1QQE A;  4DRX E;  3QWP A;  3TXM A;  3WG7 E;  4L7T A;  3LPZ A;  4AJW A;  2XQ0 A;  3R9M A;  5ENS D;  4GYO A;  5G05 C;  4G23 A;  2IU1 A;  3LKU A;  3UQ3 A;  3LJ3 A;  3APC A;  3W9F A;  3QJZ A;  5CBO A;  5H7P A;  3ESK A;  3FWV A;  3AU5 A;  3UMV A;  5DBK A;  3E37 A;  4ACK A;  3ML8 A;  3CK7 A;  2XEV A;  3PNT B;  2XCB A;  2WMO A;  3T5X A;  2IFU A;  1H2T C;  5E75 A;  4U0U A;  5EID A;  3EJN A;  1TNB A;  3EIQ C;  2OVB A;  2P58 C;  3FTY A;  2DVW A;  3ZGQ A;  2XEN A;  2BF0 X;  4GTQ A;  3Q73 A;  3FU6 A;  2V0P A;  1IXV A;  3CVY A;  3D9I A;  4XE0 A;  3FH5 A;  4YVO A;  5EDS A;  5EKQ D;  5BW8 C;  3S7F A;  3FTX A;  3LS8 A;  4FU3 A;  3TWV A;  2WXQ A;  2NXP A;  3LVR E;  5KNH D;  2XHE A;  4UI9 J;  4NQ0 A;  2FO1 E;  3PZ4 A;  3RKV A;  4ME2 A;  1K3Z D;  4F53 A;  3ULY A;  1TYQ G;  2OV8 A;  2V4H C;  3QNK A;  3VLF A;  4GTP A;  4JEU A;  2PQR A;  2XEE A;  3UT7 A;  3BUA A;  1LF8 A;  3CVN A;  4O6F A;  5LCW C;  5G55 A;  2HM8 A;  2QYU A;  2VGY A;  3FU5 A;  4ABN A;  3R7Q A;  4E85 A;  4TXP A;  4EPZ A;  1A5E A;  4EBA A;  3NQP A;  4GTM A;  3CK8 A;  3FUL A;  2M63 A;  5BNW A;  3ONL A;  4J8F A;  2MYO A;  4Q94 A;  3CHR A;  3QAR A;  2WXO A;  4Y6C A;  2H6G A;  1UW4 B;  3KSQ A;  1UJJ A;  3P2B A;  1MX4 A;  2AXZ A;  4ANW A;  4GTS A;  4I1O B;  3X2Q E;  5FJY A;  1INZ A;  4DX5 D;  2C0M A;  3DSV A;  2C0L A;  3FUJ A;  3CVX A;  1QZ2 A;  2WXN A;  1FT2 A;  4J8D A;  3Q79 A;  2XS1 A;  3ZKJ A;  4FAD A;  2UWJ G;  4GML A;  3PZ2 A;  3SBS A;  1IKN D;  4PS3 A;  2X6I A;  4WUY A;  4Y6W A;  1NI1 A;  2GRP B;  2AJA A;  2MOW A;  1KT1 A;  4HFG A;  2WXR A;  5JJ6 A;  5FZS A;  1NA0 A;  3MA5 A;  3HVE A;  1X81 A;  4N5C A;  2FO7 A;  4GMJ A;  3ASF A;  2ION A;  4L23 A;  3RAU A;  3TWS A;  3FU0 A;  2LXL A;  4FLB A;  2FEZ A;  5FQ4 A;  2WXF A;  3GZS A;  5DIZ A;  2B0O E;  2F8X K;  3ZYK A;  4J7W A;  3Q15 A;  4EZK A;  2WB2 A;  1HXI A;  2OEW A;  3URZ A;  3ASO E;  2GRM A;  4U95 D;  4CZ2 D;  5J08 A;  1O1R A;  2Y69 E;  3G2V A;  3MYV A;  2GRL A;  4R7L A;  4BX9 A;  3LY9 A;  4LRZ A;  4HRM B;  5AIJ A;  1U2V G;  4TV3 A;  1UG3 A;  2HYZ A;  3TL5 A;  4CYM D;  4WWP A;  3BQO A;  2WM9 A;  1IQU A;  3Q5M A;  5D0Q D;  3UM3 A;  5B3S E;  3CQG B;  4ILH B;  1H0A A;  3OAW A;  1SW6 A;  3AAA C;  3IXE A;  3Q75 A;  1GW6 A;  4OVU A;  5CER B;  1MYO A;  4TXQ A;  1D8D A;  3J5Q B;  3IEG A;  2X38 A;  5FQ6 A;  5JMN D;  4L9P A;  4JD2 G;  3QWV A;  3FEY A;  1HFA A;  3FY4 A;  5HRY A;  3CVW A;  1NP7 A;  1PY1 A;  2PQN A;  4DPR A;  3CSF A;  3MKQ B;  1SA4 A;  4G2V A;  3SQV A;  2CFU A;  5FT9 A;  1HO8 A;  2QY7 A;  4UI9 C;  3S7B A;  4HQD A;  3TWW A;  3FFL A;  1ELR A;  3I4G A;  4OYS A;  2Y4U A;  1OXJ A;  2BTD A;  1SZ9 A;  4KZ0 A;  3U3W A;  4JB8 P;  2WQ7 A;  2EIM E;  3SF4 A;  4FP7 A;  4FLH A;  4UI9 K;  4I1M A;  5AQB A;  2WXP A;  3APD A;  3ZEF A;  2H6F A;  1ZB1 A;  2V4L A;  1BI8 B;  1AWC B;  2QZA A;  1E8Y A;  3KD7 A;  4KT6 B;  4XEI G;  5FQ7 A;  3VTX A;  2FBN A;  2RG8 A;  4RSY A;  1N95 A;  3U9W A;  3V2X A;  3TXN A;  4PH4 B;  3UT4 A;  5JA4 D;  3SFZ A;  2KCK A;  2GGF A;  5G04 J;  3L08 A;  1TN8 A;  5BV0 A;  2OND A;  2JLB A;  4BX8 A;  1EPU A;  3Q9U C;  1S70 B;  5T4Y A;  3DXK G;  1O1T A;  4PUC A;  4NIK A;  3L9T A;  5CED B;  1E90 A;  5EX3 A;  3JQ0 A;  2ZGD A;  1N4R A;  5EYL A;  2XZT G;  5KNG A;  4JPS A;  5D0O D;  4XZ4 A;  2XRZ A;  5KJN A;  3PUJ A;  3NB2 A;  1N4P A;  4RG6 A;  4KYO B;  1BPO A;  1ELW A;  3DEP A;  1H6P A;  2DYR E;  2IOS A;  4NUR A;  4GB9 A;  2PNN A;  2BKG A;  2LXM A;  5ARG A;  3FTS A;  2WXI A;  2XEH A;  2R05 A;  3FEX A;  4A63 B;  4GPK A;  4A1S A;  3C98 A;  3R9A B;  4F7A A;  5LCW J;  3JCK C;  4HOT A;  4PS8 A;  3HXF A;  3AS8 A;  4I43 A;  4AY5 A;  2XRY A;  1SVX A;  1H6K A;  3PRZ A;  5B1B E;  4HVB A;  3OXF A;  5LFA A;  5JJT A;  3NBN B;  4ANX A;  3HHM A;  4BWR A;  1KZP A;  2V5Q C;  3LVQ E;  5CCL A;  2FUL A;  3ASG A;  4U8Y D;  1JWG A;  1S0P A;  4I6E A;  3ASH A;  3RIB A;  2E2E A;  1Q2Z A;  5ITZ F;  3UIN C;  4A3T A;  4P29 A;  4CEM A;  2LSU A;  3BEE A;  3CHS A;  1HH8 A;  4EHM A;  4UQZ A;  3AJI A;  4A3V A;  2YHC A;  2J8S D;  1Y6I A;  3PZ3 A;  4IRU A;  1JCR A;  2VSX E;  1L5J A;  3ZIM A;  1Z3X A;  3D9L A;  3HDX A;  2J07 A;  5FQ8 A;  2GRN B;  4GU5 A;  4Z68 A;  3O48 A;  5KBA A;  1KLX A;  4BY6 A;  3LJN A;  1YMP A;  3UM2 A;  3Q47 B;  3E32 A;  4U07 A;  4XIF A;  4KZC A;  5FIN A;  2WPV A;  4I6J A;  1WAO 1;  4GZC A;  3TWU A;  5AAR A;  4DLQ A;  3TWX A;  3PZD A;  2VQ2 A;  2DCP A;  4U04 A;  3ABM E;  1RZ4 A;  2PZI A;  1FVH A;  5ENO D;  5FZQ A;  3MKQ A;  4DX6 D;  4U0S A;  4G25 A;  3ZHE B;  4EZL A;  2VTB B;  4GZD A;  3OXL A;  5ENN A;  3TWR A;  4F1S A;  3ZXP A;  5EIB E;  4DK5 A;  3ZYL A;  3RU0 A;  4L1B A;  4LEU A;  4WWN A;  4JXT A;  3QKY A;  3VTY A;  4I9E A;  2X6J A;  2Y1L E;  4JA9 A;  4B0Z A;  1DNP A;  1N94 A;  4H7X A;  5ENT D;  2XPY A;  2LAH A;  4EEC A;  2DWZ A;  3GYZ A;  3PVL A;  3E33 A;  3FDH A;  4IUL A;  2P9S G;  1NA3 A;  3AG4 E;  4GTV A;  1JCS A;  3ML9 A;  4K5B A;  4B8C B;  3D3M A;  3CVQ A;  5G04 C; 
#chains in the Genus database with same CATH homology
 4LNU D;  3HRA A;  4BET A;  2HE0 A;  5CED B;  4LG6 A;  5KNH D;  3ZKJ A;  5JMN D;  2ZGD A;  2F8Y A;  4K5A B;  4Z68 A;  4DRX E;  1IKN D;  5EYL A;  5KBA A;  2Y0B G;  2XZT G;  3B95 A;  2FO1 E;  5KNG A;  3SO8 A;  4F6R D;  5CEA A;  1K3Z D;  3LJN A;  3V79 K;  1YMP A;  5EIL A;  5AQA A;  2ZGG A;  1QYM A;  5HRY A;  5ENS D;  4U96 D;  3EU9 A;  4HLL A;  3B7B A;  3DEO A;  2AJA A;  5CBN A;  5FIN A;  3W9G A;  2V4H C;  4C48 B;  3W9F A;  5CBO A;  3DEP A;  3TWT A;  2XEE A;  3TWU A;  4RLY A;  5AAR A;  3TWX A;  4HQD A;  4LSZ E;  3TWW A;  5HKP A;  4N5Q A;  3T8K A;  2PNN A;  3Q9N C;  2BKG A;  1DCQ A;  4BSZ B;  5CEC B;  4J8Y A;  1YCS B;  4ZHB A;  2XEH A;  2P2C P;  3ZUV B;  1MJ0 A;  3NOC D;  4JB8 P;  4HRN A;  5EN5 D;  3TWS A;  5FIO A;  5KWD A;  4A63 B;  2KXP C;  5D66 A;  4ZFH A;  2BKK B;  1OT8 A;  4HI8 A;  4YDY A;  4QQI A;  3UXG A;  3V30 A;  1OY3 D;  4U8V D;  4DX1 A;  5AQB A;  4ATZ D;  3D9H A;  2QYJ A;  5HS0 A;  4BER A;  4OAU C;  1SVX A;  2B0O E;  5ENO D;  4BES A;  2F8X K;  1A5E A;  4DX6 D;  2ETC A;  4HB5 A;  2RFM A;  4J7W A;  4DX7 D;  2DZO A;  4HBD A;  5EID A;  3NBN B;  4GMR A;  4U95 D;  4CZ2 D;  1BI8 B;  1IHB A;  1AWC B;  4OAV B;  3V31 A;  2V5Q C;  2DVW A;  4DUI A;  1NFI E;  3UI2 A;  3NOG D;  1WDY A;  3TWR A;  1MX2 A;  4O60 A;  4HNA D;  4U8Y D;  2MYO A;  5EIB E;  2ETB A;  2XEN A;  3EHQ A;  3HG0 D;  4HRM B;  2RFA A;  2ETA A;  3JUE A;  1UOH A;  1N11 A;  3UTM A;  5BXO A;  1IXV A;  1WG0 A;  4GPM A;  2VGE A;  3T9K A;  4F1P A;  2DZN A;  2Y1L E;  4CYM D;  5AAO A;  3V2X A;  1N0Q A;  4HI9 A;  1BLX B;  4K5C A;  3C5R A;  4YDW A;  5ITZ F;  3TWQ A;  4HRL A;  2A5E A;  4G8K A;  2QC9 A;  4TUM A;  5ENR D;  5EYP F;  5JA4 D;  1BU9 A;  1K1B A;  4B93 B;  4G8L A;  3ZU7 B;  1TR4 A;  2L6B A;  3KEA A;  1D9S A;  5ENT D;  1MX4 A;  5BXU A;  1BI7 B;  1N0R A;  2DWZ A;  2XZD G;  3AJI A;  1G3N B;  5AQ9 A;  2J8S D;  4O1P A;  4DX2 A;  2NYJ A;  3F6Q A;  2KBX A;  1YYH A;  5AQ7 A;  1BD8 A;  4DX5 D;  1SW6 A;  3V2O A;  2JAB A;  3AAA C;  3Q9U C;  3IXE A;  1S70 B;  4BEP A;  3J5P A;  4K5B A;  4QFV A;  3JXJ A;  5CER B;  1MYO A;  4UUC A;  1K1A A;  5AN8 A;  3JXI A;  1DC2 A;  3EHR A;  1MX6 A;  4NIK A;  1AP7 A;  5ENQ D;  5ENP D;  3TWV A;  3ZNG A;  4O1O A;  3J5Q B;  2F37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...