5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
5KBAA 2RFAA 4LG6A 5CECB 2J8SD 3DEPA 3F6QA 5AN8A 5AARA 1DCQA 3HRAA 3D9HA 1WG0A 5FIOA 4DRXE 3EU9A 4U8YD 2XZTG 1N11A 4HNAD 2B0OE 4HRNA 3V30A 4A63B 4K5CA 3W9FA 5EIBE 3UI2A 4G8KA 1K3ZD 4G8LA 4U96D 5ENRD 4BERA 4U95D 2KBXA 1MYOA 3V31A 2V5QC 3LJNA 5CBNA 5ENQD 4HLLA 4JB8P 4HRLA 5BXOA 5JMND 2Y1LE 1IHBA 4F6RD 3JXJA 4GMRA 3ZUVB 3J5QB 4NIKA 5D66A 3SO8A 3TWXA 5AQBA 4HRMB 2XEHA 4ZFHA 5CEDB 2MYOA 5ITZF 3V79K 1QYMA 3JUEA 2DVWA 1G3NB 4QFVA 3EHQA 1N0QA 2HE0A 3NOCD 1SVXA 5KNHD 4DX5D 1S70B 5EN5D 4OAUC 3C5RA 1IKND 4C48B 4CZ2D 4BSZB 3TWQA 4ATZD 1N0RA 3T8KA 3NBNB 4DUIA 2RFMA 5EYPF 1MX6A 5BXUA 2A5EA 3DEOA 4LSZE 4Z68A 3AJIA 3T9KA 1DC2A 3AAAC 4O1OA 4N5QA 2XZDG 5EYLA 1BI8B 2XEEA 1UOHA 1NFIE 2QC9A 5CEAA 4YDYA 5HRYA 1BLXB 1YCSB 1YYHA 4HI9A 4CYMD 4DX2A 1AP7A 1BU9A 2DWZA 1MX2A 2QYJA 2ETBA 1A5EA 2L6BA 3EHRA 5ENOD 4J8YA 5JA4D 5CERB 2F37A 5AQ7A 2AJAA 5AAOA 1MX4A 4K5BA 3TWSA 3TWTA 4DX6D 5AQAA 2ZGGA 2Y0BG 2P2CP 5EIDA 3V2OA 4GPMA 1K1AA 2NYJA 2PNNA 2V4HC 4HBDA 4U8VD 2FO1E 1BI7B 1OT8A 2DZNA 3B95A 1BD8A 4J7WA 2ZGDA 2KXPC 4RLYA 3Q9UC 4O1PA 1D9SA 1AWCB 4TUMA 5AQ9A 3ZU7B 5KWDA 3W9GA 1SW6A 5ENTD 3V2XA 3ZNGA 4BESA 2ETCA 4O60A 3B7BA 4HI8A 4YDWA 1K1BA 3TWUA 2ETAA 3KEAA 1MJ0A 5ENSD 4DX1A 4DX7D 3NOGD 4K5AB 1IXVA 2VGEA 2JABA 5HKPA 3TWWA 3TWVA 5CBOA 4HB5A 1TR4A 4BEPA 4BETA 4F1PA 2BKGA 2XENA 3J5PA 3HG0D 5KNGA 3TWRA 5EILA 4ZHBA 5FINA 5HS0A 4QQIA 4HQDA 4OAVB 3UXGA 3ZKJA 3Q9NC 4B93B 3JXIA 2F8XK 2BKKB 1WDYA 1YMPA 4LNUD 5ENPD 3UTMA 1OY3D 3IXEA 4UUCA 2F8YA 2DZOA
chains in the Genus database with same CATH superfamily
4LG6A 1EPUA 2GRRB 2J8SD 3KSLA 5CMYA 3G2VA 4EQFA 3FDHA 3DRAA 2OV8A 4EZLA 4ABNA 4GPKA 2XPZA 2I2OA 3JQ0A 4GTRA 4NRHB 4XI0A 1K3ZD 3I4RB 2WQ7A 2LUHA 3V31A 3IV0A 4ILHB 4YDOA 5DBKA 2WXHA 2AWIA 4WWPA 1E8XA 4I17A 3SO8A 3FHEA 1FCHA 3FTVA 2GW1A 4CEMA 1INZA 1UW4B 3RIBA 4BSXA 2A5EA 3LYAA 5HRYA 1HZ4A 3TL5A 5G04C 3AS4A 4KXKB 4UQYA 4WNFA 4HOQA 4M7CA 4N3BA 3NB2A 2F37A 5CRVA 5AQAA 4ILGA 2X6IA 1TNZA 3AG2E 3ZEFA 4AY5A 3ZHEA 3ZVVA 4APOA 2GGFA 2X3MA 1ELWA 4RG9A 1KT1A 5AQ9A 3LY9A 1O1SA 3SFYA 5AIJA 5T4YA 3FU3A 3PEUB 3HVEA 4WUYA 3VLDA 3NZUA 3PE3A 3ABME 3UXGA 3QJZA 4KMOA 2GROB 3CIAA 3JXIA 2XQ0A 5FQ7A 3R7RA 3S7DA 5AN8A 3HRAA 4HOTA 1N11A 5FTPA 3OTNA 4GA0A 3D9LA 4L1BA 2Y1LE 1V55E 2OVFA 3LJ3A 4NIKA 3CHSA 3PNTB 2JLBA 3ASGA 2DVWA 1HF8A 2WVIA 4C9BB 4KZCA 3OXFA 3B7TA 2BEDA 3CGHA 2Y3AA 1E8WA 1DC2A 2XZDG 2H6IA 4IYPA 1H2VC 4DPRA 4LERA 1HG2A 4UWGA 3ZGQA 2H6FA 1IYGA 3LVQE 3SQVA 1IQUA 2KXPC 4YVOA 1OCZE 4U8HA 3JCKC 4JEUA 4LCTA 1OCOE 1V54E 4I6EA 3NOGD 3U9WA 2YHCA 1DVPA 3QNKA 4PUCA 3FU0A 2HM8A 3CVPA 1O1RA 3DSVA 3BG0B 1NA0A 2XRYA 3UT4A 2QFCA 4UUCA 2DZOA 2NXPA 3FP3A 2LAHA 4MKTA 3C72A 5DIZA 3CK9A 3UM1A 1TN7A 4TRQA 3AG1E 1UN8A 5EIBE 4G8KA 4CCAA 4CDRA 4EPZA 1N52A 4HLLA 3T5XA 4F3VA 4GZ6A 5KCMA 4UWKA 1QYMA 4GB9A 4R7LA 3DXMG 2VSOE 3D9OA 1SA5A 2WQHA 3BG1B 4EZJA 3PE4A 3UKRG 5CRUA 3RJVA 2L0IA 4LSZE 1ELRA 5EYLA 5M72A 2FI7A 4U0UA 2DWZA 1MX2A 3ULYA 1U2VG 3G2SA 3TJPA 1SQMA 3CVQA 2DZNA 4AY6A 2X38A 2EQXA 4CGVA 3ZU7B 3ZIMA 3V2XA 1SZAA 2J4BA 3LDZA 3NQPA 3O48A 3MV3B 1Y6IA 2GRNB 2KCLA 3O4ZA 3JYSA 4ILIA 1JUQA 5EILA 4YVQC 4HORA 3SY2A 3DPYA 4BX8A 3U3WA 4DK5A 4GZCA 2FULA 3D9IA 4U63A 3MKQB 5FIOA 2NSZA 2EIME 4HNAD 3SF4A 4K5CA 4UWLA 2C2LA 5G04J 4JD2G 3APCA 1X5BA 2WPVA 2PM6A 4J0UA 1IHBA 2IY0C 3TWXA 3IBEA 3VTYA 4ME2A 3EIQC 3E37A 5JJTA 3NZSA 2IEJA 5KNHD 1UJJA 5EKQD 1IKND 3RO2A 4CZ2D 1N0RA 3FY4A 4IN3B 3AJIA 3RRMB 2GRQB 1BI8B 2WXOA 1BLXB 1Z3XA 1HX8A 3Q15A 3EHRA 4B94A 1D8DA 2PQRA 3ABKE 2P2CP 3ZHEB 5AENA 3GZ1A 4GCOA 4KT6B 3X2QE 3HIZA 3D9JA 2GRLA 1OWMA 3PZ1A 4B8CB 3ABLE 3G2UA 3Q49B 4YDWA 1S64A 2C0LA 1K1BA 5LP0A 3Q73A 3ML8A 1VDYA 1OCRE 4DX7D 3FUFA 3I5PA 1RW2A 4GTMA 3FUHA 4I1MA 5HS0A 2E0IA 2FF4A 1WDYA 1YMPA 3LY7A 2F8YA 4JA7A 2WXGA 3FULA 3C3OA 3DEPA 4AIFA 2Y4UA 2YQ8A 2B0OE 3B7RL 3N71A 3CV0A 5ENRD 4G24A 2FBNA 4JB8P 3AU5A 3CHRA 1NP7A 3CLJA 2P9LG 2P9SG 3CK7A 4J8FA 5AQBA 4UWFA 3QB2A 3L22A 2XHEA 3HXEA 2AXUA 3UT8A 3URZA 1N54A 3QK0A 1OWNA 3DEOA 4O1OA 4N5QA 1TYQG 2I6HA 4CYMD 4N5CA 4DX2A 4JZYA 4I43A 2L6BA 3JUIA 5IY5E 2IQCA 1E8YA 4TXRA 2NYJA 4J7WA 4KVOA 3HVEB 1D9SA 3UM0A 2NC9A 5KWDA 4UI9K 1XGWA 3HXCA 3HXDA 3PZ2A 3MA5A 4Q94A 2VSXE 4F1PA 4I1OB 3DSUA 4OYSA 2KZTA 5KNGA 4JXTA 4EZKA 2VTBB 3UINC 2EINE 2WM9A 2IOSA 3QWVA 4EBAG 5KJLA 2BTDA 1U3DA 4GYOA 3B7SA 3KAEA 3L54A 4U96D 3BUAA 3FUKA 3OXGA 2V0PA 3CVWA 2IOLA 4F6RD 3UUXA 1TNOA 4GMRA 3ASOE 3CVLA 4LNGA 5ITZF 4HRMB 2XEHA 5HI7A 3EHQA 3PNLB 4FC8A 4TXPA 2DCPA 4BT9A 3C98A 4DX5D 4GTPA 3S7JA 4GCNA 4CT0A 4FULA 5D0QD 4UQZA 5A23A 4UI9J 4ATZD 3T8KA 2PM7A 3VLFA 2RFMA 2LXLA 3T9KA 1YYHA 2WXPA 2IJGX 3ZYQA 4J6IA 1OWOA 1B89A 4HOSA 3PEVB 3EIJA 2WMOA 1NZNA 1OT8A 4DI4A 3FTZA 2UY1B 3Q9UC 1K8KG 3WG7E 3EHMA 4GYWA 2I1KA 3B7BA 4GYYA 5FZRA 3ULEG 3UMVA 3QOUA 1OXJA 4B8AA 1TN8A 4GZDA 2VGEA 2JABA 3I4GA 4GZ5A 4I2WA 3GZ2A 3FH5A 2CHWA 4U0ZA 4MLPA 2L0TB 3HHMA 5AARA 1JWFA 2XGMA 1FT1A 1HO8A 2XZTG 4HRNA 2IFUA 3CR3A 2R02A 1S0PA 4DLOA 2J49A 3NAWA 3FEYA 4Y6WA 1KLXA 5CBNA 1H2TC 2M63A 4AP2A 3BU8A 5ENNA 3AS8A 5BPPA 4N39A 3WXXA 1L5JA 4TXQA 1JPLA 4XE0A 4ZFHA 2VGXB 2LO6A 1N4RA 3D3MA 1TJCA 2P9PG 4GMLA 3G2TA 3CHOA 3MCXA 3RAUA 3Q47B 2QYUA 3NBNB 3APFA 5EYPF 1WY6A 3IEGA 1NFIE 3PRZA 3BQOA 5FQ6A 4UI9C 4JC8A 2DYSE 5AQ7A 3MYVA 2IF4A 1KZPA 2OEVA 3GW4A 4U8VD 4V3IA 1N9AA 2LAIA 4NURA 4FHJA 4TUMA 3L16A 2ETCA 2UWJG 2L9BA 3Q7AA 3MJWA 4E6HA 3LPZA 2XCCA 3ZW3A 4JPSA 3T5VA 4HB5A 3J5PA 4TUUA 2EILE 2J09A 5B1BE 3ZYMA 3R9MA 3D9KA 4UQXA 1E7VA 4BT8A 3FH7A 1FPPA 2FEZA 4A55A 3ZRHA 1OWPA 5FQ8A 4AOFA 2WXFA 3CQGB 4I2ZA 1H6PA 1OCCE 3ULQA 4WNDA 4GMJA 5E76A 4FHKA 2KCVA 3PS6A 1TNYA 4C0EA 1H2UA 1HS6A 4YDEA 4BTAA 3OXLA 2CHZA 2AXVA 4X8QA 1ZBPA 2XEEA 2QC9A 4YDYA 1AP7A 2H6HA 3TG5A 1QBQA 4JHJA 1N94A 3TWTA 4HXIA 4K5BA 4L2YA 4AEZC 3HYMB 3TAXA 4O1PA 2KM4A 4NACA 4B0ZA 3GZSA 4WNEA 5BV0A 5J90A 2R2LA 2YHEA 1H0AA 3RKVA 3CVUA 3JQ1A 3DBSA 3ESKA 2MRIA 2LNIA 1MJ0A 3DXKG 3HXBA 4P29A 3ZPJA 3MX3A 4ZHBA 3UIOC 3U64A 1OUVA 3UQ3A 1E96B 5EDSA 2F8XK 5ENPD 3UTMA 1OY3D 2CG2A 3CSFA 3ZN3A 4Y6CA 3FUDA 1HFAA 2AXZA 3UM2A 1LTXA 3AG4E 4TV3A 1DCEA 4BERA 3DSTA 3CHPA 4N3AA 4AXHA 1NL4A 2VQ2A 3PZ4A 4JL0A 3LS8A 3MGBA 5JJ6A 2WXKA 1E90A 1WM5A 5G2NA 3MEKA 5B3SE 5BUZA 2IU1A 4G2VA 3AS5A 1SVXA 2WQ6A 4ANUA 3D9PA 3FFLA 2XS1A 4FADA 5KJNA 1MQSA 4WWNA 1UN9A 4PS7A 3UT7A 1MX6A 2R17C 5FT9A 1KPSB 2DIWA 1FT2A 4B89A 4OVUA 2VSYA 1E7UA 1MX4A 4GTOA 2ZGGA 4U0SA 3V2OA 1K1AA 3P2BA 4MBGA 4FU3A 4FJZA 3E32A 1E8ZA 2RD0A 3ZNGA 3PZ3A 4C0MA 5HQ8A 1JWGA 4KZ0A 1N4QA 5T3RA 5B1AE 5CCMA 3AU4A 4OVVA 5G55A 4BTBA 2XENA 5FINA 4QQIA 1JCQA 3ZKJA 5BT1A 1FVHA 4FP7A 5JHBA 3ISMC 3FUJA 3D9HA 1WG0A 4GA2A 4K03A 2BF0X 5FQ4A 1EF1C 3GYZA 3W9FA 2R5SA 3UI2A 2GRPB 3SD5A 2DBAA 1MYOA 1W3BA 3G2WA 2AVPA 3FUNA 2JEKA 5BW8C 4GTQA 2Y4TA 3UIPC 3NOCD 2KATA 1S70B 3APDA 4HLEA 4JA9A 4J8DA 2PL2A 2KZTB 3S2AA 2H6GA 5BV1A 2R03A 1UG3A 4CDNA 3PUJA 5CEAA 3Q78A 4FLBA 3KSQA 3RK6A 3PUKA 2WB2A 5ENOD 4J8YA 4W9RA 2R59A 3CVNA 3VLEA 1A17A 2WXNA 2FO1E 1BI7B 5ANRA 1BD8A 3ESLA 1QZ2A 3L82A 1AWCB 3NF1A 4LEUA 3ZXSA 4D10C 1SW6A 4GTSA 1X81A 1H6KA 5ANLA 3Q7FA 3S7FA 2XPIA 3I3NA 5BNWA 4MRUA 1Q2ZA 2X6FA 4F53A 2V5FA 2RFAA 4UWHA 5CECB 4GU5A 3F6QA 3ENEA 2ZXWE 4AM9A 3ONLA 4DRXE 3SI5A 5C2YA 3CHQA 3MV2B 2XRZA 2Y69E 4RQIA 5AJDA 4I1AA 3FU6A 3PREA 1HXIA 4L2LA 4IULA 2WXLA 1PY1A 4HRLA 3VTXA 4EECA 3D9MA 3E30A 2XGOA 1JCRA 3CSTA 2IO2C 4QFVA 4JEHA 2J9QA 4C48B 4BSZB 2XEVA 2XCBA 3EDTB 2P9NG 2OOEA 2KC7A 1N4PA 2L6JA 5D2MC 3L08A 2XS8A 2ZIRA 4DI3A 4A3VA 1TJFA 3E33A 3QDNA 3ZFWA 5A6CA 4FJYA 4F7AA 1LD7A 2WXJA 4LRZA 4U04A 1XNFA 1N95A 3CQCB 4JW1A 5FZSA 2WXRA 5FWQA 5CHEE 2DYRE 3EHNA 4EBAA 4L9PA 1BPOA 3E34A 4XKBA 2ZISA 5HKPA 2B6CA 1KT0A 4BEPA 4JHKA 4K0RA 4I9EA 3HG0D 2CHXA 2ONDA 3PZDA 2PQNA 3CVYA 4B93B 1UJKA 4KBQA 3Q75A 2AW6A 5E75A 3EU9A 4U8YD 4FA6A 3R7QA 1Y8MA 4HFGA 4G8LA 2KBXA 4GZ3A 4HOUA 2YNQA 3FTYA 3LJNA 5ENQD 1Z6TA 4ACKA 3ZYLA 2WXIA 2UY1A 5LCWC 2KCKA 3J5QB 3MKRA 3QWWA 3RRNB 2HO1A 1G3NB 4E85A 2X6HA 3ONKA 2BUGA 2J07A 3E4BA 4KVMA 3TXNA 1RZ4A 3UKUG 3IHVA 1UOHA 3PH0C 5C1DA 1YCSB 4CGWA 1H6OA 3C3RA 4JHRA 1MZCA 2VSNA 4WWOA 3SBTB 1DNPA 3SFZA 4N2QA 3IHYA 3ASDA 4HS2A 3EJNA 2RG8A 5T8IA 1HU3A 4BESA 4ANWA 2LSUA 3SFXA 4BX9A 2ILRA 2EIKE 3TWVA 3DSSA 4A1GA 4A3TA 3RU0A 3TWRA 2I1JA 3DWLG 4G1TA 4A1SA 3R9AB 3DSWA 1QQEA 4HVBA 3FTUA 2EIJE 5KBAA 3L17A 3S7BA 4L23A 1TNUA 3TGOA 2LSVA 3FEXA 2V5QC 1TN6A 4CT4A 3LCAA 5BXOA 4XEIG 5JMND 1JCSA 5AYWD 3CVVA 3V79K 4H7YA 3ZXPA 4OAUC 1SA4A 5J08A 3SZ7A 3TXMA 4DUIA 3KD7A 1H19A 3AAAC 1NI1A 3SGHA 1HH8A 4HI9A 4EHMA 4I6JA 5G05J 1BU9A 2OCCE 5JA4D 2I9CA 3LY8A 4I6GA 4IRUA 3Q4AB 2Y0BG 3CHMA 2PNNA 2V4HC 5H7PA 3D9NA 3DPDA 2VYIA 2V4LA 4Q69A 3K9IA 4XKCA 1ZB1A 3ZYKA 3TWUA 2E2EA 4GAAA 5ARGA 2XPYA 4K5AB 1IXVA 1SZ9A 4Q96A 3L6AA 2X6JA 4N2SA 5D0OD 4NQ0A 1U3CA 2BKKB 3IXEA 2P9IG 1N4SA 3ML9A 1EYHA 3RSEG 1QNFA 3RRUA 3BEEA 3CKBA 3TG4A 1IHGA 4BWRA 5A7DB 2CG3A 4G11A 4J8SA 2A4ZA 4URKA 3KS2A 2ZU6B 4GA1A 1Z5SC 2VTBA 3ZUVB 4I9CA 5CEDB 2HR2A 2MYOA 5AJLA 3JUEA 3CK8A 4J8EA 5CMWA 5JHAA 2HE0A 1IQRA 2LXMA 1KZOA 3C5RA 4RG6A 2WXMA 4MS6A 3TWQA 2P9UG 3EU5A 4Z68A 4O6FA 3ASNE 4APFA 4G25A 4AJWA 3FWVA 4PS8A 1NA3A 4CRWA 5CERB 5AAOA 3KEZA 3B95A 3LVRE 2ZGDA 4RLYA 2WMNA 4PS3A 3W9GA 4L7TA 3P1UA 4HI8A 4YNDA 2Q7FA 4DX1A 1S63A 3U4TA 4BETA 2BKGA 3MKQA 3ASHA 3ASFA 1O5MA 1PC2A 1PAQA 4AVXA 3Q9NC 3FTWA 4AV7A 2V8SE 3B13A 4LNUD 1YA0A 2OEWA 2WXQA 3UM3A 4JVSA 1TEZA 3CVXA 2MHKA 3OAWA 2IONA 3V30A 3LEWA 4U95D 3PDNA 4XZ4A 3HDXA 1LF8A 3JXJA 2CFZA 3CEQA 3MZLB 2R05A 1N0QA 3IKOB 3EUVA 2C0MA 3FTXA 4ATGA 3LXUX 3QARA 1TNBA 4F1SA 3FH8A 4PH4B 4LUNU 4XIFA 3FUMA 3Q79A 2ETBA 1D8EA 1A5EA 3QAQA 2PZIA 3QKYA 5KJKA 4FLHA 4XI9A 3QC1A 2A5UA 1O1TA 2VJ8A 2P9KG 5ENTD 4ACLA 1MHQA 3LKUA 3CKCA 5FJYA 5LCWJ 2ETAA 3KEAA 4RVBA 1TR4A 3B7UX 3T8MA 2GRMA 2XGSA 5CCLA 4HQDA 2HYZA 3HXFA 4PDXA 3L13A 2F0YA 1OWLA 4ANVA 1DCQA 3SNXA 3UX4A 4BFRA 2RKKA 4A63B 5KJMA 5JJ7A 3FUIA 4H7XA 5G05C 3FTSA 4RSYA 1HG5A 3SBSA 4GTVA 4WAFA 2VGXA 2VGYA 5D66A 1GW6A 2IO3C 3UPVA 2MOWA 5EN5D 5ARFA 2P58C 4DJAA 5LX8A 4WNGA 4LNBA 4U07A 2QY7A 3RO3A 4BY6A 5BXUA 5FZQA 4XX5A 4N3CA 3FU5A 3Q5MA 4ANXA 4U7EB 5EX3A 5EX0A 3AG3E 4GTTA 3QWPA 2QYJA 2X6KA 1HE8A 2FO7A 1ZU2A 2J08A 2AJAA 5LOZA 4DLQA 1FVFA 4DX6D 4G23A 3TWSA 2YINA 3FUEA 5EIDA 4GPMA 4HBDA 4G26A 1P5QA 3DSXA 3C3QA 1Z3YA 5LFAA 1EDUA 4O60A 3SHFA 4CDMA 4KYOB 2QZAA 1ELKA 2CFUA 1WAO1 5ENSD 3TWWA 5CBOA 4M3OA 2OVBA 1LD8A 4OAVB 3L9TA 3U66A 2J4DA 3PVLA
chains in the Genus database with same CATH topology
5KBAA 2RFAA 4LG6A 5CECB 2J8SD 3DEPA 3F6QA 5AN8A 5AARA 1DCQA 3HRAA 3D9HA 1WG0A 5FIOA 4DRXE 3EU9A 4U8YD 2XZTG 1N11A 4HNAD 2B0OE 4HRNA 3V30A 4A63B 4K5CA 3W9FA 5EIBE 3UI2A 4G8KA 1K3ZD 4G8LA 4U96D 5ENRD 4BERA 4U95D 2KBXA 1MYOA 3V31A 2V5QC 3LJNA 5CBNA 5ENQD 4HLLA 4JB8P 4HRLA 5BXOA 5JMND 2Y1LE 1IHBA 4F6RD 3JXJA 4GMRA 3ZUVB 3J5QB 4NIKA 5D66A 3SO8A 3TWXA 5AQBA 4HRMB 2XEHA 4ZFHA 5CEDB 2MYOA 5ITZF 3V79K 1QYMA 3JUEA 2DVWA 1G3NB 4QFVA 3EHQA 1N0QA 2HE0A 3NOCD 1SVXA 5KNHD 4DX5D 1S70B 5EN5D 4OAUC 3C5RA 1IKND 4C48B 4CZ2D 4BSZB 3TWQA 4ATZD 1N0RA 3T8KA 3NBNB 4DUIA 2RFMA 5EYPF 1MX6A 5BXUA 2A5EA 3DEOA 4LSZE 4Z68A 3AJIA 3T9KA 1DC2A 3AAAC 4O1OA 4N5QA 2XZDG 5EYLA 1BI8B 2XEEA 1UOHA 1NFIE 2QC9A 5CEAA 4YDYA 5HRYA 1BLXB 1YCSB 1YYHA 4HI9A 4CYMD 4DX2A 1AP7A 1BU9A 2DWZA 1MX2A 2QYJA 2ETBA 1A5EA 2L6BA 3EHRA 5ENOD 4J8YA 5JA4D 5CERB 2F37A 5AQ7A 2AJAA 5AAOA 1MX4A 4K5BA 3TWSA 3TWTA 4DX6D 5AQAA 2ZGGA 2Y0BG 2P2CP 5EIDA 3V2OA 4GPMA 1K1AA 2NYJA 2PNNA 2V4HC 4HBDA 4U8VD 2FO1E 1BI7B 1OT8A 2DZNA 3B95A 1BD8A 4J7WA 2ZGDA 2KXPC 4RLYA 3Q9UC 4O1PA 1D9SA 1AWCB 4TUMA 5AQ9A 3ZU7B 5KWDA 3W9GA 1SW6A 5ENTD 3V2XA 3ZNGA 4BESA 2ETCA 4O60A 3B7BA 4HI8A 4YDWA 1K1BA 3TWUA 2ETAA 3KEAA 1MJ0A 5ENSD 4DX1A 4DX7D 3NOGD 4K5AB 1IXVA 2VGEA 2JABA 5HKPA 3TWWA 3TWVA 5CBOA 4HB5A 1TR4A 4BEPA 4BETA 4F1PA 2BKGA 2XENA 3J5PA 3HG0D 5KNGA 3TWRA 5EILA 4ZHBA 5FINA 5HS0A 4QQIA 4HQDA 4OAVB 3UXGA 3ZKJA 3Q9NC 4B93B 3JXIA 2F8XK 2BKKB 1WDYA 1YMPA 4LNUD 5ENPD 3UTMA 1OY3D 3IXEA 4UUCA 2F8YA 2DZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KBA A;  2RFA A;  4LG6 A;  5CEC B;  2J8S D;  3DEP A;  3F6Q A;  5AN8 A;  5AAR A;  1DCQ A;  3HRA A;  3D9H A;  1WG0 A;  5FIO A;  4DRX E;  3EU9 A;  4U8Y D;  2XZT G;  1N11 A;  4HNA D;  2B0O E;  4HRN A;  3V30 A;  4A63 B;  4K5C A;  3W9F A;  5EIB E;  3UI2 A;  4G8K A;  1K3Z D;  4G8L A;  4U96 D;  5ENR D;  4BER A;  4U95 D;  2KBX A;  1MYO A;  3V31 A;  2V5Q C;  3LJN A;  5CBN A;  5ENQ D;  4HLL A;  4JB8 P;  4HRL A;  5BXO A;  5JMN D;  2Y1L E;  1IHB A;  4F6R D;  3JXJ A;  4GMR A;  3ZUV B;  3J5Q B;  4NIK A;  5D66 A;  3SO8 A;  3TWX A;  5AQB A;  4HRM B;  2XEH A;  4ZFH A;  5CED B;  2MYO A;  5ITZ F;  3V79 K;  1QYM A;  3JUE A;  2DVW A;  1G3N B;  4QFV A;  3EHQ A;  1N0Q A;  2HE0 A;  3NOC D;  1SVX A;  5KNH D;  4DX5 D;  1S70 B;  5EN5 D;  4OAU C;  3C5R A;  1IKN D;  4C48 B;  4CZ2 D;  4BSZ B;  3TWQ A;  4ATZ D;  1N0R A;  3T8K A;  3NBN B;  4DUI A;  2RFM A;  5EYP F;  1MX6 A;  5BXU A;  2A5E A;  3DEO A;  4LSZ E;  4Z68 A;  3AJI A;  3T9K A;  1DC2 A;  3AAA C;  4O1O A;  4N5Q A;  2XZD G;  5EYL A;  1BI8 B;  2XEE A;  1UOH A;  1NFI E;  2QC9 A;  5CEA A;  4YDY A;  5HRY A;  1BLX B;  1YCS B;  1YYH A;  4HI9 A;  4CYM D;  4DX2 A;  1AP7 A;  1BU9 A;  2DWZ A;  1MX2 A;  2QYJ A;  2ETB A;  1A5E A;  2L6B A;  3EHR A;  5ENO D;  4J8Y A;  5JA4 D;  5CER B;  2F37 A;  5AQ7 A;  2AJA A;  5AAO A;  1MX4 A;  4K5B A;  3TWS A;  3TWT A;  4DX6 D;  5AQA A;  2ZGG A;  2Y0B G;  2P2C P;  5EID A;  3V2O A;  4GPM A;  1K1A A;  2NYJ A;  2PNN A;  2V4H C;  4HBD A;  4U8V D;  2FO1 E;  1BI7 B;  1OT8 A;  2DZN A;  3B95 A;  1BD8 A;  4J7W A;  2ZGD A;  2KXP C;  4RLY A;  3Q9U C;  4O1P A;  1D9S A;  1AWC B;  4TUM A;  5AQ9 A;  3ZU7 B;  5KWD A;  3W9G A;  1SW6 A;  5ENT D;  3V2X A;  3ZNG A;  4BES A;  2ETC A;  4O60 A;  3B7B A;  4HI8 A;  4YDW A;  1K1B A;  3TWU A;  2ETA A;  3KEA A;  1MJ0 A;  5ENS D;  4DX1 A;  4DX7 D;  3NOG D;  4K5A B;  1IXV A;  2VGE A;  2JAB A;  5HKP A;  3TWW A;  3TWV A;  5CBO A;  4HB5 A;  1TR4 A;  4BEP A;  4BET A;  4F1P A;  2BKG A;  2XEN A;  3J5P A;  3HG0 D;  5KNG A;  3TWR A;  5EIL A;  4ZHB A;  5FIN A;  5HS0 A;  4QQI A;  4HQD A;  4OAV B;  3UXG A;  3ZKJ A;  3Q9N C;  4B93 B;  3JXI A;  2F8X K;  2BKK B;  1WDY A;  1YMP A;  4LNU D;  5ENP D;  3UTM A;  1OY3 D;  3IXE A;  4UUC A;  2F8Y A;  2DZO A; 
#chains in the Genus database with same CATH topology
 4LG6 A;  1EPU A;  2GRR B;  2J8S D;  3KSL A;  5CMY A;  3G2V A;  4EQF A;  3FDH A;  3DRA A;  2OV8 A;  4EZL A;  4ABN A;  4GPK A;  2XPZ A;  2I2O A;  3JQ0 A;  4GTR A;  4NRH B;  4XI0 A;  1K3Z D;  3I4R B;  2WQ7 A;  2LUH A;  3V31 A;  3IV0 A;  4ILH B;  4YDO A;  5DBK A;  2WXH A;  2AWI A;  4WWP A;  1E8X A;  4I17 A;  3SO8 A;  3FHE A;  1FCH A;  3FTV A;  2GW1 A;  4CEM A;  1INZ A;  1UW4 B;  3RIB A;  4BSX A;  2A5E A;  3LYA A;  5HRY A;  1HZ4 A;  3TL5 A;  5G04 C;  3AS4 A;  4KXK B;  4UQY A;  4WNF A;  4HOQ A;  4M7C A;  4N3B A;  3NB2 A;  2F37 A;  5CRV A;  5AQA A;  4ILG A;  2X6I A;  1TNZ A;  3AG2 E;  3ZEF A;  4AY5 A;  3ZHE A;  3ZVV A;  4APO A;  2GGF A;  2X3M A;  1ELW A;  4RG9 A;  1KT1 A;  5AQ9 A;  3LY9 A;  1O1S A;  3SFY A;  5AIJ A;  5T4Y A;  3FU3 A;  3PEU B;  3HVE A;  4WUY A;  3VLD A;  3NZU A;  3PE3 A;  3ABM E;  3UXG A;  3QJZ A;  4KMO A;  2GRO B;  3CIA A;  3JXI A;  2XQ0 A;  5FQ7 A;  3R7R A;  3S7D A;  5AN8 A;  3HRA A;  4HOT A;  1N11 A;  5FTP A;  3OTN A;  4GA0 A;  3D9L A;  4L1B A;  2Y1L E;  1V55 E;  2OVF A;  3LJ3 A;  4NIK A;  3CHS A;  3PNT B;  2JLB A;  3ASG A;  2DVW A;  1HF8 A;  2WVI A;  4C9B B;  4KZC A;  3OXF A;  3B7T A;  2BED A;  3CGH A;  2Y3A A;  1E8W A;  1DC2 A;  2XZD G;  2H6I A;  4IYP A;  1H2V C;  4DPR A;  4LER A;  1HG2 A;  4UWG A;  3ZGQ A;  2H6F A;  1IYG A;  3LVQ E;  3SQV A;  1IQU A;  2KXP C;  4YVO A;  1OCZ E;  4U8H A;  3JCK C;  4JEU A;  4LCT A;  1OCO E;  1V54 E;  4I6E A;  3NOG D;  3U9W A;  2YHC A;  1DVP A;  3QNK A;  4PUC A;  3FU0 A;  2HM8 A;  3CVP A;  1O1R A;  3DSV A;  3BG0 B;  1NA0 A;  2XRY A;  3UT4 A;  2QFC A;  4UUC A;  2DZO A;  2NXP A;  3FP3 A;  2LAH A;  4MKT A;  3C72 A;  5DIZ A;  3CK9 A;  3UM1 A;  1TN7 A;  4TRQ A;  3AG1 E;  1UN8 A;  5EIB E;  4G8K A;  4CCA A;  4CDR A;  4EPZ A;  1N52 A;  4HLL A;  3T5X A;  4F3V A;  4GZ6 A;  5KCM A;  4UWK A;  1QYM A;  4GB9 A;  4R7L A;  3DXM G;  2VSO E;  3D9O A;  1SA5 A;  2WQH A;  3BG1 B;  4EZJ A;  3PE4 A;  3UKR G;  5CRU A;  3RJV A;  2L0I A;  4LSZ E;  1ELR A;  5EYL A;  5M72 A;  2FI7 A;  4U0U A;  2DWZ A;  1MX2 A;  3ULY A;  1U2V G;  3G2S A;  3TJP A;  1SQM A;  3CVQ A;  2DZN A;  4AY6 A;  2X38 A;  2EQX A;  4CGV A;  3ZU7 B;  3ZIM A;  3V2X A;  1SZA A;  2J4B A;  3LDZ A;  3NQP A;  3O48 A;  3MV3 B;  1Y6I A;  2GRN B;  2KCL A;  3O4Z A;  3JYS A;  4ILI A;  1JUQ A;  5EIL A;  4YVQ C;  4HOR A;  3SY2 A;  3DPY A;  4BX8 A;  3U3W A;  4DK5 A;  4GZC A;  2FUL A;  3D9I A;  4U63 A;  3MKQ B;  5FIO A;  2NSZ A;  2EIM E;  4HNA D;  3SF4 A;  4K5C A;  4UWL A;  2C2L A;  5G04 J;  4JD2 G;  3APC A;  1X5B A;  2WPV A;  2PM6 A;  4J0U A;  1IHB A;  2IY0 C;  3TWX A;  3IBE A;  3VTY A;  4ME2 A;  3EIQ C;  3E37 A;  5JJT A;  3NZS A;  2IEJ A;  5KNH D;  1UJJ A;  5EKQ D;  1IKN D;  3RO2 A;  4CZ2 D;  1N0R A;  3FY4 A;  4IN3 B;  3AJI A;  3RRM B;  2GRQ B;  1BI8 B;  2WXO A;  1BLX B;  1Z3X A;  1HX8 A;  3Q15 A;  3EHR A;  4B94 A;  1D8D A;  2PQR A;  3ABK E;  2P2C P;  3ZHE B;  5AEN A;  3GZ1 A;  4GCO A;  4KT6 B;  3X2Q E;  3HIZ A;  3D9J A;  2GRL A;  1OWM A;  3PZ1 A;  4B8C B;  3ABL E;  3G2U A;  3Q49 B;  4YDW A;  1S64 A;  2C0L A;  1K1B A;  5LP0 A;  3Q73 A;  3ML8 A;  1VDY A;  1OCR E;  4DX7 D;  3FUF A;  3I5P A;  1RW2 A;  4GTM A;  3FUH A;  4I1M A;  5HS0 A;  2E0I A;  2FF4 A;  1WDY A;  1YMP A;  3LY7 A;  2F8Y A;  4JA7 A;  2WXG A;  3FUL A;  3C3O A;  3DEP A;  4AIF A;  2Y4U A;  2YQ8 A;  2B0O E;  3B7R L;  3N71 A;  3CV0 A;  5ENR D;  4G24 A;  2FBN A;  4JB8 P;  3AU5 A;  3CHR A;  1NP7 A;  3CLJ A;  2P9L G;  2P9S G;  3CK7 A;  4J8F A;  5AQB A;  4UWF A;  3QB2 A;  3L22 A;  2XHE A;  3HXE A;  2AXU A;  3UT8 A;  3URZ A;  1N54 A;  3QK0 A;  1OWN A;  3DEO A;  4O1O A;  4N5Q A;  1TYQ G;  2I6H A;  4CYM D;  4N5C A;  4DX2 A;  4JZY A;  4I43 A;  2L6B A;  3JUI A;  5IY5 E;  2IQC A;  1E8Y A;  4TXR A;  2NYJ A;  4J7W A;  4KVO A;  3HVE B;  1D9S A;  3UM0 A;  2NC9 A;  5KWD A;  4UI9 K;  1XGW A;  3HXC A;  3HXD A;  3PZ2 A;  3MA5 A;  4Q94 A;  2VSX E;  4F1P A;  4I1O B;  3DSU A;  4OYS A;  2KZT A;  5KNG A;  4JXT A;  4EZK A;  2VTB B;  3UIN C;  2EIN E;  2WM9 A;  2IOS A;  3QWV A;  4EBA G;  5KJL A;  2BTD A;  1U3D A;  4GYO A;  3B7S A;  3KAE A;  3L54 A;  4U96 D;  3BUA A;  3FUK A;  3OXG A;  2V0P A;  3CVW A;  2IOL A;  4F6R D;  3UUX A;  1TNO A;  4GMR A;  3ASO E;  3CVL A;  4LNG A;  5ITZ F;  4HRM B;  2XEH A;  5HI7 A;  3EHQ A;  3PNL B;  4FC8 A;  4TXP A;  2DCP A;  4BT9 A;  3C98 A;  4DX5 D;  4GTP A;  3S7J A;  4GCN A;  4CT0 A;  4FUL A;  5D0Q D;  4UQZ A;  5A23 A;  4UI9 J;  4ATZ D;  3T8K A;  2PM7 A;  3VLF A;  2RFM A;  2LXL A;  3T9K A;  1YYH A;  2WXP A;  2IJG X;  3ZYQ A;  4J6I A;  1OWO A;  1B89 A;  4HOS A;  3PEV B;  3EIJ A;  2WMO A;  1NZN A;  1OT8 A;  4DI4 A;  3FTZ A;  2UY1 B;  3Q9U C;  1K8K G;  3WG7 E;  3EHM A;  4GYW A;  2I1K A;  3B7B A;  4GYY A;  5FZR A;  3ULE G;  3UMV A;  3QOU A;  1OXJ A;  4B8A A;  1TN8 A;  4GZD A;  2VGE A;  2JAB A;  3I4G A;  4GZ5 A;  4I2W A;  3GZ2 A;  3FH5 A;  2CHW A;  4U0Z A;  4MLP A;  2L0T B;  3HHM A;  5AAR A;  1JWF A;  2XGM A;  1FT1 A;  1HO8 A;  2XZT G;  4HRN A;  2IFU A;  3CR3 A;  2R02 A;  1S0P A;  4DLO A;  2J49 A;  3NAW A;  3FEY A;  4Y6W A;  1KLX A;  5CBN A;  1H2T C;  2M63 A;  4AP2 A;  3BU8 A;  5ENN A;  3AS8 A;  5BPP A;  4N39 A;  3WXX A;  1L5J A;  4TXQ A;  1JPL A;  4XE0 A;  4ZFH A;  2VGX B;  2LO6 A;  1N4R A;  3D3M A;  1TJC A;  2P9P G;  4GML A;  3G2T A;  3CHO A;  3MCX A;  3RAU A;  3Q47 B;  2QYU A;  3NBN B;  3APF A;  5EYP F;  1WY6 A;  3IEG A;  1NFI E;  3PRZ A;  3BQO A;  5FQ6 A;  4UI9 C;  4JC8 A;  2DYS E;  5AQ7 A;  3MYV A;  2IF4 A;  1KZP A;  2OEV A;  3GW4 A;  4U8V D;  4V3I A;  1N9A A;  2LAI A;  4NUR A;  4FHJ A;  4TUM A;  3L16 A;  2ETC A;  2UWJ G;  2L9B A;  3Q7A A;  3MJW A;  4E6H A;  3LPZ A;  2XCC A;  3ZW3 A;  4JPS A;  3T5V A;  4HB5 A;  3J5P A;  4TUU A;  2EIL E;  2J09 A;  5B1B E;  3ZYM A;  3R9M A;  3D9K A;  4UQX A;  1E7V A;  4BT8 A;  3FH7 A;  1FPP A;  2FEZ A;  4A55 A;  3ZRH A;  1OWP A;  5FQ8 A;  4AOF A;  2WXF A;  3CQG B;  4I2Z A;  1H6P A;  1OCC E;  3ULQ A;  4WND A;  4GMJ A;  5E76 A;  4FHK A;  2KCV A;  3PS6 A;  1TNY A;  4C0E A;  1H2U A;  1HS6 A;  4YDE A;  4BTA A;  3OXL A;  2CHZ A;  2AXV A;  4X8Q A;  1ZBP A;  2XEE A;  2QC9 A;  4YDY A;  1AP7 A;  2H6H A;  3TG5 A;  1QBQ A;  4JHJ A;  1N94 A;  3TWT A;  4HXI A;  4K5B A;  4L2Y A;  4AEZ C;  3HYM B;  3TAX A;  4O1P A;  2KM4 A;  4NAC A;  4B0Z A;  3GZS A;  4WNE A;  5BV0 A;  5J90 A;  2R2L A;  2YHE A;  1H0A A;  3RKV A;  3CVU A;  3JQ1 A;  3DBS A;  3ESK A;  2MRI A;  2LNI A;  1MJ0 A;  3DXK G;  3HXB A;  4P29 A;  3ZPJ A;  3MX3 A;  4ZHB A;  3UIO C;  3U64 A;  1OUV A;  3UQ3 A;  1E96 B;  5EDS A;  2F8X K;  5ENP D;  3UTM A;  1OY3 D;  2CG2 A;  3CSF A;  3ZN3 A;  4Y6C A;  3FUD A;  1HFA A;  2AXZ A;  3UM2 A;  1LTX A;  3AG4 E;  4TV3 A;  1DCE A;  4BER A;  3DST A;  3CHP A;  4N3A A;  4AXH A;  1NL4 A;  2VQ2 A;  3PZ4 A;  4JL0 A;  3LS8 A;  3MGB A;  5JJ6 A;  2WXK A;  1E90 A;  1WM5 A;  5G2N A;  3MEK A;  5B3S E;  5BUZ A;  2IU1 A;  4G2V A;  3AS5 A;  1SVX A;  2WQ6 A;  4ANU A;  3D9P A;  3FFL A;  2XS1 A;  4FAD A;  5KJN A;  1MQS A;  4WWN A;  1UN9 A;  4PS7 A;  3UT7 A;  1MX6 A;  2R17 C;  5FT9 A;  1KPS B;  2DIW A;  1FT2 A;  4B89 A;  4OVU A;  2VSY A;  1E7U A;  1MX4 A;  4GTO A;  2ZGG A;  4U0S A;  3V2O A;  1K1A A;  3P2B A;  4MBG A;  4FU3 A;  4FJZ A;  3E32 A;  1E8Z A;  2RD0 A;  3ZNG A;  3PZ3 A;  4C0M A;  5HQ8 A;  1JWG A;  4KZ0 A;  1N4Q A;  5T3R A;  5B1A E;  5CCM A;  3AU4 A;  4OVV A;  5G55 A;  4BTB A;  2XEN A;  5FIN A;  4QQI A;  1JCQ A;  3ZKJ A;  5BT1 A;  1FVH A;  4FP7 A;  5JHB A;  3ISM C;  3FUJ A;  3D9H A;  1WG0 A;  4GA2 A;  4K03 A;  2BF0 X;  5FQ4 A;  1EF1 C;  3GYZ A;  3W9F A;  2R5S A;  3UI2 A;  2GRP B;  3SD5 A;  2DBA A;  1MYO A;  1W3B A;  3G2W A;  2AVP A;  3FUN A;  2JEK A;  5BW8 C;  4GTQ A;  2Y4T A;  3UIP C;  3NOC D;  2KAT A;  1S70 B;  3APD A;  4HLE A;  4JA9 A;  4J8D A;  2PL2 A;  2KZT B;  3S2A A;  2H6G A;  5BV1 A;  2R03 A;  1UG3 A;  4CDN A;  3PUJ A;  5CEA A;  3Q78 A;  4FLB A;  3KSQ A;  3RK6 A;  3PUK A;  2WB2 A;  5ENO D;  4J8Y A;  4W9R A;  2R59 A;  3CVN A;  3VLE A;  1A17 A;  2WXN A;  2FO1 E;  1BI7 B;  5ANR A;  1BD8 A;  3ESL A;  1QZ2 A;  3L82 A;  1AWC B;  3NF1 A;  4LEU A;  3ZXS A;  4D10 C;  1SW6 A;  4GTS A;  1X81 A;  1H6K A;  5ANL A;  3Q7F A;  3S7F A;  2XPI A;  3I3N A;  5BNW A;  4MRU A;  1Q2Z A;  2X6F A;  4F53 A;  2V5F A;  2RFA A;  4UWH A;  5CEC B;  4GU5 A;  3F6Q A;  3ENE A;  2ZXW E;  4AM9 A;  3ONL A;  4DRX E;  3SI5 A;  5C2Y A;  3CHQ A;  3MV2 B;  2XRZ A;  2Y69 E;  4RQI A;  5AJD A;  4I1A A;  3FU6 A;  3PRE A;  1HXI A;  4L2L A;  4IUL A;  2WXL A;  1PY1 A;  4HRL A;  3VTX A;  4EEC A;  3D9M A;  3E30 A;  2XGO A;  1JCR A;  3CST A;  2IO2 C;  4QFV A;  4JEH A;  2J9Q A;  4C48 B;  4BSZ B;  2XEV A;  2XCB A;  3EDT B;  2P9N G;  2OOE A;  2KC7 A;  1N4P A;  2L6J A;  5D2M C;  3L08 A;  2XS8 A;  2ZIR A;  4DI3 A;  4A3V A;  1TJF A;  3E33 A;  3QDN A;  3ZFW A;  5A6C A;  4FJY A;  4F7A A;  1LD7 A;  2WXJ A;  4LRZ A;  4U04 A;  1XNF A;  1N95 A;  3CQC B;  4JW1 A;  5FZS A;  2WXR A;  5FWQ A;  5CHE E;  2DYR E;  3EHN A;  4EBA A;  4L9P A;  1BPO A;  3E34 A;  4XKB A;  2ZIS A;  5HKP A;  2B6C A;  1KT0 A;  4BEP A;  4JHK A;  4K0R A;  4I9E A;  3HG0 D;  2CHX A;  2OND A;  3PZD A;  2PQN A;  3CVY A;  4B93 B;  1UJK A;  4KBQ A;  3Q75 A;  2AW6 A;  5E75 A;  3EU9 A;  4U8Y D;  4FA6 A;  3R7Q A;  1Y8M A;  4HFG A;  4G8L A;  2KBX A;  4GZ3 A;  4HOU A;  2YNQ A;  3FTY A;  3LJN A;  5ENQ D;  1Z6T A;  4ACK A;  3ZYL A;  2WXI A;  2UY1 A;  5LCW C;  2KCK A;  3J5Q B;  3MKR A;  3QWW A;  3RRN B;  2HO1 A;  1G3N B;  4E85 A;  2X6H A;  3ONK A;  2BUG A;  2J07 A;  3E4B A;  4KVM A;  3TXN A;  1RZ4 A;  3UKU G;  3IHV A;  1UOH A;  3PH0 C;  5C1D A;  1YCS B;  4CGW A;  1H6O A;  3C3R A;  4JHR A;  1MZC A;  2VSN A;  4WWO A;  3SBT B;  1DNP A;  3SFZ A;  4N2Q A;  3IHY A;  3ASD A;  4HS2 A;  3EJN A;  2RG8 A;  5T8I A;  1HU3 A;  4BES A;  4ANW A;  2LSU A;  3SFX A;  4BX9 A;  2ILR A;  2EIK E;  3TWV A;  3DSS A;  4A1G A;  4A3T A;  3RU0 A;  3TWR A;  2I1J A;  3DWL G;  4G1T A;  4A1S A;  3R9A B;  3DSW A;  1QQE A;  4HVB A;  3FTU A;  2EIJ E;  5KBA A;  3L17 A;  3S7B A;  4L23 A;  1TNU A;  3TGO A;  2LSV A;  3FEX A;  2V5Q C;  1TN6 A;  4CT4 A;  3LCA A;  5BXO A;  4XEI G;  5JMN D;  1JCS A;  5AYW D;  3CVV A;  3V79 K;  4H7Y A;  3ZXP A;  4OAU C;  1SA4 A;  5J08 A;  3SZ7 A;  3TXM A;  4DUI A;  3KD7 A;  1H19 A;  3AAA C;  1NI1 A;  3SGH A;  1HH8 A;  4HI9 A;  4EHM A;  4I6J A;  5G05 J;  1BU9 A;  2OCC E;  5JA4 D;  2I9C A;  3LY8 A;  4I6G A;  4IRU A;  3Q4A B;  2Y0B G;  3CHM A;  2PNN A;  2V4H C;  5H7P A;  3D9N A;  3DPD A;  2VYI A;  2V4L A;  4Q69 A;  3K9I A;  4XKC A;  1ZB1 A;  3ZYK A;  3TWU A;  2E2E A;  4GAA A;  5ARG A;  2XPY A;  4K5A B;  1IXV A;  1SZ9 A;  4Q96 A;  3L6A A;  2X6J A;  4N2S A;  5D0O D;  4NQ0 A;  1U3C A;  2BKK B;  3IXE A;  2P9I G;  1N4S A;  3ML9 A;  1EYH A;  3RSE G;  1QNF A;  3RRU A;  3BEE A;  3CKB A;  3TG4 A;  1IHG A;  4BWR A;  5A7D B;  2CG3 A;  4G11 A;  4J8S A;  2A4Z A;  4URK A;  3KS2 A;  2ZU6 B;  4GA1 A;  1Z5S C;  2VTB A;  3ZUV B;  4I9C A;  5CED B;  2HR2 A;  2MYO A;  5AJL A;  3JUE A;  3CK8 A;  4J8E A;  5CMW A;  5JHA A;  2HE0 A;  1IQR A;  2LXM A;  1KZO A;  3C5R A;  4RG6 A;  2WXM A;  4MS6 A;  3TWQ A;  2P9U G;  3EU5 A;  4Z68 A;  4O6F A;  3ASN E;  4APF A;  4G25 A;  4AJW A;  3FWV A;  4PS8 A;  1NA3 A;  4CRW A;  5CER B;  5AAO A;  3KEZ A;  3B95 A;  3LVR E;  2ZGD A;  4RLY A;  2WMN A;  4PS3 A;  3W9G A;  4L7T A;  3P1U A;  4HI8 A;  4YND A;  2Q7F A;  4DX1 A;  1S63 A;  3U4T A;  4BET A;  2BKG A;  3MKQ A;  3ASH A;  3ASF A;  1O5M A;  1PC2 A;  1PAQ A;  4AVX A;  3Q9N C;  3FTW A;  4AV7 A;  2V8S E;  3B13 A;  4LNU D;  1YA0 A;  2OEW A;  2WXQ A;  3UM3 A;  4JVS A;  1TEZ A;  3CVX A;  2MHK A;  3OAW A;  2ION A;  3V30 A;  3LEW A;  4U95 D;  3PDN A;  4XZ4 A;  3HDX A;  1LF8 A;  3JXJ A;  2CFZ A;  3CEQ A;  3MZL B;  2R05 A;  1N0Q A;  3IKO B;  3EUV A;  2C0M A;  3FTX A;  4ATG A;  3LXU X;  3QAR A;  1TNB A;  4F1S A;  3FH8 A;  4PH4 B;  4LUN U;  4XIF A;  3FUM A;  3Q79 A;  2ETB A;  1D8E A;  1A5E A;  3QAQ A;  2PZI A;  3QKY A;  5KJK A;  4FLH A;  4XI9 A;  3QC1 A;  2A5U A;  1O1T A;  2VJ8 A;  2P9K G;  5ENT D;  4ACL A;  1MHQ A;  3LKU A;  3CKC A;  5FJY A;  5LCW J;  2ETA A;  3KEA A;  4RVB A;  1TR4 A;  3B7U X;  3T8M A;  2GRM A;  2XGS A;  5CCL A;  4HQD A;  2HYZ A;  3HXF A;  4PDX A;  3L13 A;  2F0Y A;  1OWL A;  4ANV A;  1DCQ A;  3SNX A;  3UX4 A;  4BFR A;  2RKK A;  4A63 B;  5KJM A;  5JJ7 A;  3FUI A;  4H7X A;  5G05 C;  3FTS A;  4RSY A;  1HG5 A;  3SBS A;  4GTV A;  4WAF A;  2VGX A;  2VGY A;  5D66 A;  1GW6 A;  2IO3 C;  3UPV A;  2MOW A;  5EN5 D;  5ARF A;  2P58 C;  4DJA A;  5LX8 A;  4WNG A;  4LNB A;  4U07 A;  2QY7 A;  3RO3 A;  4BY6 A;  5BXU A;  5FZQ A;  4XX5 A;  4N3C A;  3FU5 A;  3Q5M A;  4ANX A;  4U7E B;  5EX3 A;  5EX0 A;  3AG3 E;  4GTT A;  3QWP A;  2QYJ A;  2X6K A;  1HE8 A;  2FO7 A;  1ZU2 A;  2J08 A;  2AJA A;  5LOZ A;  4DLQ A;  1FVF A;  4DX6 D;  4G23 A;  3TWS A;  2YIN A;  3FUE A;  5EID A;  4GPM A;  4HBD A;  4G26 A;  1P5Q A;  3DSX A;  3C3Q A;  1Z3Y A;  5LFA A;  1EDU A;  4O60 A;  3SHF A;  4CDM A;  4KYO B;  2QZA A;  1ELK A;  2CFU A;  1WAO 1;  5ENS D;  3TWW A;  5CBO A;  4M3O A;  2OVB A;  1LD8 A;  4OAV B;  3L9T A;  3U66 A;  2J4D A;  3PVL A; 
#chains in the Genus database with same CATH homology
 5KBA A;  2RFA A;  4LG6 A;  5CEC B;  2J8S D;  3DEP A;  3F6Q A;  5AN8 A;  5AAR A;  1DCQ A;  3HRA A;  3D9H A;  1WG0 A;  5FIO A;  4DRX E;  3EU9 A;  4U8Y D;  2XZT G;  1N11 A;  4HNA D;  2B0O E;  4HRN A;  3V30 A;  4A63 B;  4K5C A;  3W9F A;  5EIB E;  3UI2 A;  4G8K A;  1K3Z D;  4G8L A;  4U96 D;  5ENR D;  4BER A;  4U95 D;  2KBX A;  1MYO A;  3V31 A;  2V5Q C;  3LJN A;  5CBN A;  5ENQ D;  4HLL A;  4JB8 P;  4HRL A;  5BXO A;  5JMN D;  2Y1L E;  1IHB A;  4F6R D;  3JXJ A;  4GMR A;  3ZUV B;  3J5Q B;  4NIK A;  5D66 A;  3SO8 A;  3TWX A;  5AQB A;  4HRM B;  2XEH A;  4ZFH A;  5CED B;  2MYO A;  5ITZ F;  3V79 K;  1QYM A;  3JUE A;  2DVW A;  1G3N B;  4QFV A;  3EHQ A;  1N0Q A;  2HE0 A;  3NOC D;  1SVX A;  5KNH D;  4DX5 D;  1S70 B;  5EN5 D;  4OAU C;  3C5R A;  1IKN D;  4C48 B;  4CZ2 D;  4BSZ B;  3TWQ A;  4ATZ D;  1N0R A;  3T8K A;  3NBN B;  4DUI A;  2RFM A;  5EYP F;  1MX6 A;  5BXU A;  2A5E A;  3DEO A;  4LSZ E;  4Z68 A;  3AJI A;  3T9K A;  1DC2 A;  3AAA C;  4O1O A;  4N5Q A;  2XZD G;  5EYL A;  1BI8 B;  2XEE A;  1UOH A;  1NFI E;  2QC9 A;  5CEA A;  4YDY A;  5HRY A;  1BLX B;  1YCS B;  1YYH A;  4HI9 A;  4CYM D;  4DX2 A;  1AP7 A;  1BU9 A;  2DWZ A;  1MX2 A;  2QYJ A;  2ETB A;  1A5E A;  2L6B A;  3EHR A;  5ENO D;  4J8Y A;  5JA4 D;  5CER B;  2F37 A;  5AQ7 A;  2AJA A;  5AAO A;  1MX4 A;  4K5B A;  3TWS A;  3TWT A;  4DX6 D;  5AQA A;  2ZGG A;  2Y0B G;  2P2C P;  5EID A;  3V2O A;  4GPM A;  1K1A A;  2NYJ A;  2PNN A;  2V4H C;  4HBD A;  4U8V D;  2FO1 E;  1BI7 B;  1OT8 A;  2DZN A;  3B95 A;  1BD8 A;  4J7W A;  2ZGD A;  2KXP C;  4RLY A;  3Q9U C;  4O1P A;  1D9S A;  1AWC B;  4TUM A;  5AQ9 A;  3ZU7 B;  5KWD A;  3W9G A;  1SW6 A;  5ENT D;  3V2X A;  3ZNG A;  4BES A;  2ETC A;  4O60 A;  3B7B A;  4HI8 A;  4YDW A;  1K1B A;  3TWU A;  2ETA A;  3KEA A;  1MJ0 A;  5ENS D;  4DX1 A;  4DX7 D;  3NOG D;  4K5A B;  1IXV A;  2VGE A;  2JAB A;  5HKP A;  3TWW A;  3TWV A;  5CBO A;  4HB5 A;  1TR4 A;  4BEP A;  4BET A;  4F1P A;  2BKG A;  2XEN A;  3J5P A;  3HG0 D;  5KNG A;  3TWR A;  5EIL A;  4ZHB A;  5FIN A;  5HS0 A;  4QQI A;  4HQD A;  4OAV B;  3UXG A;  3ZKJ A;  3Q9N C;  4B93 B;  3JXI A;  2F8X K;  2BKK B;  1WDY A;  1YMP A;  4LNU D;  5ENP D;  3UTM A;  1OY3 D;  3IXE A;  4UUC A;  2F8Y A;  2DZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...