5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
2Y1LE 1AP7A 4U95D 4UUCA 1AWCB 4B93B 1N0QA 5FINA 4HI9A 1UOHA 4F1PA 3J5PA 1DC2A 5ITZF 3EU9A 3ZNGA 4U8VD 3JXJA 5KWDA 1MYOA 3T8KA 5EYLA 3IXEA 5KNHD 4ZFHA 4HB5A 3T9KA 3EHQA 5JA4D 3TWRA 1QYMA 4DX1A 3V30A 3V79K 3F6QA 5HS0A 3C5RA 4U8YD 4O60A 5ENSD 3HRAA 1YYHA 5AAOA 1MJ0A 5HRYA 5CERB 4QQIA 5ENQD 5EN5D 3NBNB 3AAAC 1A5EA 2F37A 1WG0A 3Q9UC 3TWSA 3ZKJA 2VGEA 1G3NB 3UI2A 3ZU7B 2J8SD 3D9HA 5AQ7A 2ZGDA 3KEAA 2QC9A 4A63B 4ATZD 5BXOA 3TWTA 1SVXA 5CBOA 5ENOD 3HG0D 5AQBA 3J5QB 1OY3D 4O1PA 4LNUD 4BSZB 4OAUC 2ETAA 2PNNA 5EYPF 4BERA 4CYMD 2XENA 4BEPA 5AQAA 3W9FA 4HRLA 2F8YA 3JXIA 2JABA 4OAVB 4BESA 2ETCA 5EIDA 1BLXB 2BKGA 3DEPA 1N11A 5CEAA 3UXGA 4O1OA 4G8LA 4QFVA 3W9GA 5CEDB 5KBAA 4RLYA 4DRXE 4HBDA 3TWXA 1DCQA 4N5QA 1IHBA 5ENPD 5KNGA 4YDYA 5D66A 4DX6D 1MX2A 2XEEA 4ZHBA 5BXUA 1NFIE 2RFAA 2BKKB 1IKND 5CECB 1OT8A 4HRNA 5FIOA 2RFMA 3V31A 4DX7D 4NIKA 2MYOA 3TWWA 1MX4A 2V5QC 1BD8A 2V4HC 4YDWA 3V2OA 1BI8B 1IXVA 1YCSB 5JMND 3V2XA 1K1AA 5AARA 2DWZA 2DVWA 3EHRA 2KBXA 4LSZE 5AN8A 2AJAA 3B7BA 5ENTD 4TUMA 4HLLA 2FO1E 1K3ZD 4GMRA 3Q9NC 4DX5D 3ZUVB 4LG6A 3LJNA 1S70B 3TWVA 2QYJA 4GPMA 4K5BA 4HNAD 4DX2A 1D9SA 4HQDA 3B95A 4J8YA 2NYJA 2ETBA 5EILA 1SW6A 2XZTG 4BETA 2DZNA 1K1BA 2HE0A 5ENRD 5HKPA 2F8XK 4CZ2D 3NOGD 2A5EA 3NOCD 4HI8A 1TR4A 1BU9A 2ZGGA 1BI7B 2KXPC 4JB8P 2P2CP 1WDYA 2DZOA 3TWUA 5CBNA 2B0OE 1MX6A 3AJIA 4G8KA 1N0RA 5EIBE 2XZDG 2L6BA 5AQ9A 4F6RD 4HRMB 4K5AB 3TWQA 3JUEA 3SO8A 4Z68A 4U96D 2XEHA 2Y0BG 4J7WA 3DEOA 4K5CA 4DUIA 4C48B 3UTMA 1YMPA
chains in the Genus database with same CATH superfamily
4HOUA 3CVQA 4HI9A 2Q7FA 1OCZE 3ZYLA 3PEUB 3U64A 5E75A 1NZNA 3CQGB 4KZ0A 4Y6CA 4I2ZA 2X3MA 1XGWA 3VLFA 3CQCB 4GZ5A 3KSLA 5JHBA 4LRZA 1TNZA 1WY6A 2HM8A 4BTAA 3T5XA 3Q75A 3K9IA 4CEMA 3KEAA 3RK6A 2VSOE 1QNFA 3U4TA 4G1TA 4BSZB 3ASNE 2ETAA 5FQ7A 4UWKA 4PH4B 2BKGA 2WQHA 1N95A 3B7RL 2X6FA 3ZFWA 3DXMG 3AG1E 5D66A 4ZHBA 4GZCA 2Y3AA 4WNEA 2VTBB 4HRNA 4DX7D 4NQ0A 2GGFA 3CHPA 5KJMA 1KPSB 3JCKC 4APOA 3D9LA 3UT4A 3D9IA 3B7BA 4N5CA 5BT1A 3UKRG 2VSYA 4YDOA 4IRUA 4XI9A 1H6OA 1SW6A 2DZNA 1FVFA 5JHAA 5HKPA 3SQVA 3NOCD 1O5MA 3QWWA 4V3IA 4K03A 2ZU6B 4JA7A 4I6GA 3UT7A 1MQSA 1S64A 4FC8A 3IHVA 3CHQA 2GRMA 3KEZA 3VTYA 4B8AA 2IEJA 4B93B 3MEKA 4UWLA 5KWDA 4FJYA 1INZA 5LP0A 4RQIA 4M7CA 4DX1A 4FP7A 3FTVA 3ZYMA 4ANWA 2J07A 1H19A 4GCNA 1EF1C 1KT1A 5ANRA 4PDXA 1EPUA 2R59A 3PUKA 3OTNA 3GZ2A 2EIJE 1SA5A 2CHWA 1NA0A 4JA9A 4U07A 3L08A 3V31A 4HXIA 4GTQA 3DSUA 2IY0C 1IXVA 2DIWA 3AU5A 5T4YA 3DSSA 1FPPA 3Q9NC 3RIBA 3GZSA 4HOTA 1PAQA 3CK7A 4K5BA 3B95A 2NC9A 3LVQE 1ZB1A 1XNFA 5B1AE 3QWVA 3O4ZA 4N3CA 1TYQG 2A5EA 2RD0A 1BU9A 5J08A 4BX9A 4H7YA 3EDTB 5KJKA 2XCCA 4J6IA 3EHNA 1FCHA 5EIBE 3BG1B 4JZYA 2XEHA 2KM4A 1Z6TA 3L82A 2OCCE 3UTMA 5ITZF 3QC1A 2JLBA 4GU5A 3LDZA 1ZU2A 2R2LA 3D9PA 3UM1A 2IF4A 1Z3YA 2LUHA 2XEVA 5C1DA 1U3CA 5ARGA 4O60A 1YYHA 4L9PA 3U9WA 5A6CA 5B3SE 2BTDA 4PS3A 4JC8A 3QWPA 1ELRA 1Y6IA 2WXPA 2KZTB 3FUDA 5DIZA 1H2VC 2H6IA 2Y4UA 4DRXE 1IHBA 4FULA 3ZHEB 4EBAA 1NA3A 2XQ0A 3UT8A 1Y8MA 2X6JA 1MX4A 2IOLA 4HLLA 1OWLA 3I5PA 3D9JA 2C0LA 4KVMA 4UQZA 5G05C 5ENRD 4GA2A 1EYHA 4J8SA 4CDMA 1N0RA 4TUUA 1QQEA 1V54E 2Y4TA 1LD8A 3SF4A 1EDUA 5FINA 1UOHA 1DC2A 2AXVA 2MOWA 3G2VA 2YQ8A 3ZNGA 1LTXA 1N54A 2BEDA 3ZEFA 4EZKA 3V30A 3V79K 3RKVA 4W9RA 2X38A 2ILRA 5KCMA 3CHMA 3Q4AB 3R9MA 5AJLA 3JQ1A 2LSVA 2XRYA 3FUFA 3S7DA 5BXOA 1SZAA 4XX5A 3O48A 1H6KA 2PM7A 5J90A 1E8ZA 1JWGA 4OVVA 2EINE 5FZQA 3G2WA 4CGVA 1JCSA 2ZISA 5KNGA 2KCLA 4GMJA 2PZIA 3LKUA 3OXLA 4WNDA 2DBAA 3ZXSA 3V2XA 2DWZA 3FULA 3CK9A 4HOQA 2XS1A 4UI9J 3PZ3A 2A4ZA 3SGHA 4B89A 2PM6A 3E30A 3PREA 3TL5A 3KD7A 1E7UA 2YHCA 1K1BA 3URZA 4GTPA 4DLOA 3C98A 1WDYA 3ASOE 4A1GA 1HF8A 3TXMA 1E8YA 1E8WA 4B94A 4UI9K 5EX3A 2QY7A 4AJWA 2RG8A 3C72A 1GW6A 3JXJA 3T8KA 3CHSA 5A7DB 5EYLA 1NL4A 3PS6A 3S7BA 2GRRB 5C2YA 4G23A 3F6QA 1WM5A 4BT9A 2FULA 5CCLA 2PL2A 4CDNA 5CERB 3AAAC 4GA1A 4I43A 4CT4A 3Q9UC 3SZ7A 2PQRA 3ZU7B 2R17C 2QC9A 2IJGX 4JEUA 1HG2A 4MKTA 3UUXA 4ANXA 5LX8A 1X81A 2WXQA 4RSYA 4GPKA 4LNGA 3ZYQA 3DEPA 4WUYA 4G8LA 3HVEA 4Q69A 3CSFA 3GZ1A 3BEEA 3P1UA 1S63A 4HVBA 1YA0A 2OV8A 3MKRA 4FHJA 3MX3A 5BNWA 2IFUA 3CVVA 3EHRA 2VGXB 3CKCA 3BUAA 4I1MA 4FADA 3QK0A 2WQ7A 2IOSA 4BY6A 3L9TA 2LO6A 5M72A 2XZTG 3G2UA 2HE0A 5FTPA 3FDHA 3SFXA 4PUCA 1QZ2A 4A55A 2WPVA 3R7RA 2I9CA 4K0RA 3FTUA 4HRMB 3ASFA 4O6FA 4E6HA 5G05J 4K5CA 3NZUA 4C48B 3LXUX 4U95D 1U3DA 3WXXA 1OWPA 2E2EA 2FEZA 1JCRA 1TN8A 4LERA 1RW2A 4OVUA 5KNHD 3DSTA 3EIQC 2OVFA 2XS8A 5HQ8A 3FWVA 4UWGA 1L5JA 1TN6A 2GW1A 1WG0A 2OOEA 3NAWA 1TEZA 2LXLA 1OWMA 3CVUA 3TG4A 4NURA 2M63A 4O1PA 4AY5A 4GZ3A 3APDA 3UM2A 5AQAA 2F8YA 1OUVA 1N52A 3IKOB 3FEXA 3PE4A 3E32A 2KCVA 2GRNB 4LEUA 1DCEA 5AJDA 3E4BA 2WXOA 4PS8A 2XPIA 3HXFA 4D10C 2YINA 3UIPC 2X6IA 3L22A 4JXTA 1IQRA 2V4HC 3SBTB 4L2YA 1KZPA 1HG5A 3DBSA 5B1BE 4AOFA 4BFRA 3LCAA 4GZDA 3CR3A 4E85A 2F8XK 4G11A 3HXDA 3KS2A 2P9NG 2DZOA 3AJIA 1RZ4A 1D8EA 4YNDA 5BPPA 4Z68A 4XZ4A 3PZ2A 4GTSA 4BWRA 3CK8A 1AP7A 1SZ9A 3Q5MA 2C2LA 2V4LA 3EU9A 3FU0A 1NP7A 4F1SA 4JW1A 4GTRA 4LNBA 1V55E 3C5RA 1MJ0A 1TJCA 3FUIA 4ANVA 5BW8C 4IULA 4J8DA 4ACKA 1PY1A 3E33A 3S2AA 2J09A 2P9UG 3TGOA 4JHKA 2IO2C 2IU1A 3TJPA 2JABA 1UJJA 5EIDA 3JQ0A 5CEDB 3C3OA 3CV0A 4N5QA 4J8FA 3PE3A 4U0ZA 2R5SA 1TNOA 2V5QC 5G04C 1MZCA 3I4GA 4YVOA 3UPVA 5JJ7A 2GRPB 4G2VA 4L7TA 4WAFA 3ZUVB 4U7EB 1D9SA 4A1SA 1JPLA 2NYJA 3LY8A 2EIKE 2C0MA 4C0EA 2AW6A 3QARA 1Z5SC 5FZSA 5CBNA 4G8KA 2XZDG 4K5AB 4N2SA 1N9AA 3ESKA 5AENA 5CMYA 4DI4A 3IHYA 4J7WA 5KJNA 2P9LG 5G55A 2LNIA 3UM3A 3EUVA 2P9PG 1ZBPA 4XI0A 4TXPA 4XIFA 1O1SA 3T9KA 4CRWA 3UQ3A 3D3MA 3FFLA 2J49A 3SBSA 3ONKA 3HIZA 5EN5D 3NBNB 2F37A 3FUNA 3TWSA 3FTXA 4P29A 1N94A 3ZIMA 1FT1A 3OAWA 4JL0A 4UI9C 3ASGA 2PNNA 3MA5A 3AS8A 1IQUA 4GZ6A 4DX6D 3RAUA 3PVLA 2RFAA 4CDRA 2VSNA 1OT8A 3CGHA 3FUMA 4NIKA 1HO8A 1LF8A 4YDWA 1O1RA 3Q15A 2R02A 1HH8A 5FJYA 2VGYA 4G26A 4DX5D 3FTZA 3LJNA 3TWVA 4GA0A 2GROB 2WB2A 4ANUA 2X6HA 3LS8A 4XE0A 3KSQA 3RU0A 3NOGD 3ZHEA 2WXHA 1E7VA 3FU5A 3L54A 3PDNA 3RRMB 3ULYA 4YDEA 3ZPJA 4EBAG 2NXPA 5FZRA 4EECA 5LOZA 2XRZA 1VDYA 3E34A 4HORA 2FO7A 3TAXA 5LCWJ 4ILIA 2I2OA 3SFZA 2WMNA 4AY6A 1KLXA 3NQPA 5G2NA 4APFA 2PQNA 3ZGQA 4I17A 4U8YD 3FUJA 2XGSA 3Q73A 4BT8A 2HYZA 4ATZD 3TWTA 4GMLA 2WXIA 4U63A 1SA4A 3C3RA 5EYPF 4KYOB 3ZVVA 4EZLA 3R9AB 1K8KG 4L2LA 4B8CB 5FIOA 2RFMA 4WWPA 3UX4A 3MGBA 3ABLE 1K1AA 5AARA 1X5BA 2AJAA 3KAEA 4RG6A 1S70B 3JUIA 1O1TA 4HNAD 4HOSA 3L17A 5DBKA 2YHEA 5EILA 4KVOA 5ENNA 4GYYA 3CHOA 1ELKA 3ULQA 4BSXA 2ONDA 3FEYA 4G25A 3Q49B 4F6RD 3FH7A 5CRVA 4WWNA 4AIFA 3CVWA 3MZLB 4U96D 2NSZA 3VTXA 1YMPA 1JUQA 2WXKA 3AG2E 2HO1A 5A23A 3CVYA 2OEWA 1TNYA 4J0UA 4I6EA 5AIJA 4HB5A 4EZJA 3B7TA 2RKKA 1HX8A 2L0IA 5ENSD 5ENQD 5FQ4A 1HS6A 5JJTA 1DNPA 1G3NB 1NI1A 2EQXA 2CG2A 3HXCA 4MS6A 1N4RA 1OY3D 4OAUC 3RJVA 3RO3A 4ATGA 4CYMD 2XENA 3FTSA 3R7QA 5BV1A 3D9OA 3EJNA 1N11A 4JPSA 3T8MA 2FI7A 5CHEE 3QNKA 2VGXA 2WM9A 4Q94A 2WXJA 3HHMA 2XCBA 5BXUA 1P5QA 2H6HA 1TN7A 3DSWA 1YCSB 4N39A 4UWFA 2LXMA 2V8SE 2P58C 5AN8A 3HDXA 5AYWD 3HVEB 4FLBA 3CVNA 2J4BA 3ASHA 3QB2A 1IYGA 1N4SA 2EILE 4JHJA 4JHRA 1BI7B 5FWQA 3FUEA 2P9KG 1IHGA 2VQ2A 4DUIA 3SI5A 4NACA 1E90A 1HU3A 2A5UA 4I1AA 5JA4D 5EX0A 3TWRA 1FT2A 1SQMA 3HRAA 5AAOA 2CHZA 4QQIA 3AG3E 3ZN3A 4M3OA 3GW4A 3ULEG 4AEZC 1PC2A 4Y6WA 2GRQB 3AS4A 2AVPA 3EU5A 4KT6B 3Q79A 3TXNA 2LAHA 3PNTB 4BEPA 3CHRA 3W9FA 2CG3A 4RVBA 4F7AA 2CFUA 4RLYA 5LCWC 4HBDA 1U2VG 1DCQA 3ABME 4YDYA 1H2UA 5E76A 4EPZA 2XEEA 2EIME 4FJZA 5CCMA 4EHMA 4ACLA 5CECB 4HFGA 4GTOA 2DVWA 3QOUA 4TUMA 1OCOE 1K3ZD 1OCRE 4GCOA 4AVXA 1KZOA 1JWFA 3RRUA 5ANLA 3FU6A 5D0QD 3B7SA 3PNLB 2XPZA 4BTBA 1KT0A 3HXBA 2B0OE 3MKQB 3UKUG 3AS5A 1H0AA 3JUEA 3FP3A 3SO8A 3LPZA 2R05A 2Y0BG 3FH8A 3DEOA 4AM9A 4NRHB 1TNBA 2Y1LE 5JJ6A 3ONLA 3HXEA 3J5PA 3OXFA 4KZCA 3LJ3A 4U8VD 1MYOA 4JD2G 4XEIG 1QYMA 3PH0C 3D9KA 3MJWA 4L23A 3PZ4A 1B89A 4GTVA 4LCTA 4C0MA 3UI2A 3FY4A 3QJZA 3VLEA 2CFZA 3UINC 3ZYKA 4BERA 4TXQA 1UN9A 3DPYA 3APCA 2AWIA 3UXGA 3D9MA 3PRZA 3BG0B 3S7FA 5ENPD 1DVPA 3NF1A 1MX2A 3I4RB 3FTWA 3PZ1A 2I1JA 4ME2A 3TWWA 5D2MC 1BD8A 3V2OA 4UQXA 5JMND 4U0UA 3Q7FA 5FT9A 2ZIRA 4A3VA 4IYPA 2XHEA 1OXJA 4DX2A 4I6JA 2VSXE 2ETBA 2BUGA 2MHKA 3I3NA 4MBGA 3U66A 3SFYA 5EKQD 2WXFA 2ZGGA 5ARFA 2R03A 4DJAA 2E0IA 2L6BA 1UW4B 2B6CA 3DPDA 3AU4A 3NB2A 1WAO1 2L0TB 4G24A 4OYSA 4LUNU 3UM0A 4J8EA 3IXEA 1D8DA 1QBQA 2VYIA 3SNXA 4U8HA 2WVIA 1Z3XA 2I6HA 3T5VA 3E37A 4FU3A 2WXRA 1A5EA 3ZKJA 2VGEA 3QKYA 4KXKB 4H7XA 2DYRE 2ZGDA 4GAAA 3J5QB 2FBNA 3Q7AA 4HRLA 3JXIA 4TRQA 5LFAA 2ETCA 5FQ8A 5G04J 4I2WA 1OWOA 4QFVA 1LD7A 3G2TA 3SY2A 3TWXA 5BUZA 3L6AA 2MRIA 2QFCA 2CHXA 3FUKA 4WNGA 2F0YA 3APFA 4FHKA 1UJKA 2DCPA 2YNQA 1UN8A 4FLHA 3G2SA 4GMRA 2VTBA 1W3BA 4U0SA 4LG6A 4B0ZA 3ZRHA 4J8YA 3AG4E 4Q96A 2GRLA 2VJ8A 4CZ2D 3RSEG 3X2QE 5IY5E 4L1BA 5BV0A 3FU3A 3CVPA 4PS7A 2WQ6A 4GTTA 5AQ9A 3TWQA 3L13A 1MHQA 2BF0X 4GYWA 4EQFA 4HLEA 4KBQA 4N3BA 4UUCA 1AWCB 4F1PA 4CT0A 3UIOC 4N3AA 3LY7A 2V5FA 3UMVA 1TJFA 2H6FA 5HS0A 2J08A 3IEGA 3NZSA 2KZTA 3SD5A 5HRYA 4HS2A 4ILGA 3FH5A 5HI7A 2ZXWE 4UWHA 3QDNA 1HZ4A 4DK5A 4KMOA 4A63B 3RRNB 1SVXA 5ENOD 2OVBA 3HG0D 5AQBA 1OCCE 1E96B 5CEAA 3L16A 4O1OA 4CCAA 1A17A 1UG3A 4TV3A 3ML9A 2BKKB 2KC7A 2MYOA 2WXGA 4RG9A 4F3VA 2AXUA 4F53A 1HFAA 3ISMC 3CVLA 2QYJA 1ELWA 4HQDA 2DYSE 2WXMA 3LEWA 1N4QA 3CSTA 3RO2A 4JB8P 1S0PA 2P2CP 2IQCA 5KJLA 4DLQA 4UQYA 2L6JA 3IV0A 2Y69E 2HR2A 3P2BA 2J4DA 4FA6A 4U04A 1FVHA 1N0QA 5T3RA 3CIAA 3BQOA 2WXLA 3ASDA 4GYOA 3EHQA 3Q78A 2XPYA 3FTYA 2QZAA 4IN3B 5FQ6A 3DXKG 3MV3B 3TG5A 4N2QA 2J8SD 1H2TC 4A3TA 3VLDA 3Q47B 3MV2B 3LY9A 3GYZA 1N4PA 4DI3A 5T8IA 4BESA 3W9GA 5KBAA 5D0OD 5H7PA 1HE8A 1NFIE 3PZDA 3U3WA 4R7LA 3MCXA 3CEQA 3MYVA 2UY1A 2H6GA 3S7JA 4LSZE 4XKCA 5ENTD 2FO1E 4I1OB 2WXNA 2QYUA 3PEVB 4GPMA 4X8QA 2AXZA 3B13A 5CRUA 3MKQA 2P9IG 3JYSA 1TNUA 2V0PA 4GB9A 3DSVA 3PUJA 2IONA 4I9CA 2KXPC 2P9SG 1MX6A 1HXIA 2LSUA 3ZW3A 4AV7A 3CVXA 4MRUA 3DWLG 3WG7E 4YVQC 4AP2A 4ILHB 1H6PA 2IO3C 4ZFHA 3ML8A 3FUHA 3ZXPA 2KCKA 1OWNA 4ABNA 3OXGA 3ENEA 2I1KA 2XGOA 2KATA 1E8XA 3D9HA 5AQ7A 5CBOA 2WMOA 2OEVA 3CKBA 3IBEA 4LNUD 3D9NA 3CLJA 4DPRA 4OAVB 2L9BA 3N71A 1BLXB 3QAQA 4C9BB 2FF4A 1Q2ZA 2X6KA 3BU8A 3ESLA 4XKBA 1JCQA 4MLPA 2UY1B 5CMWA 1IKND 4WNFA 4TXRA 4AXHA 1BPOA 2XGMA 1BI8B 3FHEA 2KBXA 2J9QA 3DSXA 3B7UX 3EIJA 3SHFA 2LAIA 5EDSA 4BETA 3ABKE 3LVRE 4HI8A 4CGWA 1TR4A 2JEKA 4JVSA 3HYMB 4JEHA 3LYAA 3TWUA 3C3QA 2UWJG 4BX8A 3DRAA 4WWOA 3EHMA 4URKA 4GTMA 4I9EA
chains in the Genus database with same CATH topology
2Y1LE 1AP7A 4U95D 4UUCA 1AWCB 4B93B 1N0QA 5FINA 4HI9A 1UOHA 4F1PA 3J5PA 1DC2A 5ITZF 3EU9A 3ZNGA 4U8VD 3JXJA 5KWDA 1MYOA 3T8KA 5EYLA 3IXEA 5KNHD 4ZFHA 4HB5A 3T9KA 3EHQA 5JA4D 3TWRA 1QYMA 4DX1A 3V30A 3V79K 3F6QA 5HS0A 3C5RA 4U8YD 4O60A 5ENSD 3HRAA 1YYHA 5AAOA 1MJ0A 5HRYA 5CERB 4QQIA 5ENQD 5EN5D 3NBNB 3AAAC 1A5EA 2F37A 1WG0A 3Q9UC 3TWSA 3ZKJA 2VGEA 1G3NB 3UI2A 3ZU7B 2J8SD 3D9HA 5AQ7A 2ZGDA 3KEAA 2QC9A 4A63B 4ATZD 5BXOA 3TWTA 1SVXA 5CBOA 5ENOD 3HG0D 5AQBA 3J5QB 1OY3D 4O1PA 4LNUD 4BSZB 4OAUC 2ETAA 2PNNA 5EYPF 4BERA 4CYMD 2XENA 4BEPA 5AQAA 3W9FA 4HRLA 2F8YA 3JXIA 2JABA 4OAVB 4BESA 2ETCA 5EIDA 1BLXB 2BKGA 3DEPA 1N11A 5CEAA 3UXGA 4O1OA 4G8LA 4QFVA 3W9GA 5CEDB 5KBAA 4RLYA 4DRXE 4HBDA 3TWXA 1DCQA 4N5QA 1IHBA 5ENPD 5KNGA 4YDYA 5D66A 4DX6D 1MX2A 2XEEA 4ZHBA 5BXUA 1NFIE 2RFAA 2BKKB 1IKND 5CECB 1OT8A 4HRNA 5FIOA 2RFMA 3V31A 4DX7D 4NIKA 2MYOA 3TWWA 1MX4A 2V5QC 1BD8A 2V4HC 4YDWA 3V2OA 1BI8B 1IXVA 1YCSB 5JMND 3V2XA 1K1AA 5AARA 2DWZA 2DVWA 3EHRA 2KBXA 4LSZE 5AN8A 2AJAA 3B7BA 5ENTD 4TUMA 4HLLA 2FO1E 1K3ZD 4GMRA 3Q9NC 4DX5D 3ZUVB 4LG6A 3LJNA 1S70B 3TWVA 2QYJA 4GPMA 4K5BA 4HNAD 4DX2A 1D9SA 4HQDA 3B95A 4J8YA 2NYJA 2ETBA 5EILA 1SW6A 2XZTG 4BETA 2DZNA 1K1BA 2HE0A 5ENRD 5HKPA 2F8XK 4CZ2D 3NOGD 2A5EA 3NOCD 4HI8A 1TR4A 1BU9A 2ZGGA 1BI7B 2KXPC 4JB8P 2P2CP 1WDYA 2DZOA 3TWUA 5CBNA 2B0OE 1MX6A 3AJIA 4G8KA 1N0RA 5EIBE 2XZDG 2L6BA 5AQ9A 4F6RD 4HRMB 4K5AB 3TWQA 3JUEA 3SO8A 4Z68A 4U96D 2XEHA 2Y0BG 4J7WA 3DEOA 4K5CA 4DUIA 4C48B 3UTMA 1YMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1L E;  1AP7 A;  4U95 D;  4UUC A;  1AWC B;  4B93 B;  1N0Q A;  5FIN A;  4HI9 A;  1UOH A;  4F1P A;  3J5P A;  1DC2 A;  5ITZ F;  3EU9 A;  3ZNG A;  4U8V D;  3JXJ A;  5KWD A;  1MYO A;  3T8K A;  5EYL A;  3IXE A;  5KNH D;  4ZFH A;  4HB5 A;  3T9K A;  3EHQ A;  5JA4 D;  3TWR A;  1QYM A;  4DX1 A;  3V30 A;  3V79 K;  3F6Q A;  5HS0 A;  3C5R A;  4U8Y D;  4O60 A;  5ENS D;  3HRA A;  1YYH A;  5AAO A;  1MJ0 A;  5HRY A;  5CER B;  4QQI A;  5ENQ D;  5EN5 D;  3NBN B;  3AAA C;  1A5E A;  2F37 A;  1WG0 A;  3Q9U C;  3TWS A;  3ZKJ A;  2VGE A;  1G3N B;  3UI2 A;  3ZU7 B;  2J8S D;  3D9H A;  5AQ7 A;  2ZGD A;  3KEA A;  2QC9 A;  4A63 B;  4ATZ D;  5BXO A;  3TWT A;  1SVX A;  5CBO A;  5ENO D;  3HG0 D;  5AQB A;  3J5Q B;  1OY3 D;  4O1P A;  4LNU D;  4BSZ B;  4OAU C;  2ETA A;  2PNN A;  5EYP F;  4BER A;  4CYM D;  2XEN A;  4BEP A;  5AQA A;  3W9F A;  4HRL A;  2F8Y A;  3JXI A;  2JAB A;  4OAV B;  4BES A;  2ETC A;  5EID A;  1BLX B;  2BKG A;  3DEP A;  1N11 A;  5CEA A;  3UXG A;  4O1O A;  4G8L A;  4QFV A;  3W9G A;  5CED B;  5KBA A;  4RLY A;  4DRX E;  4HBD A;  3TWX A;  1DCQ A;  4N5Q A;  1IHB A;  5ENP D;  5KNG A;  4YDY A;  5D66 A;  4DX6 D;  1MX2 A;  2XEE A;  4ZHB A;  5BXU A;  1NFI E;  2RFA A;  2BKK B;  1IKN D;  5CEC B;  1OT8 A;  4HRN A;  5FIO A;  2RFM A;  3V31 A;  4DX7 D;  4NIK A;  2MYO A;  3TWW A;  1MX4 A;  2V5Q C;  1BD8 A;  2V4H C;  4YDW A;  3V2O A;  1BI8 B;  1IXV A;  1YCS B;  5JMN D;  3V2X A;  1K1A A;  5AAR A;  2DWZ A;  2DVW A;  3EHR A;  2KBX A;  4LSZ E;  5AN8 A;  2AJA A;  3B7B A;  5ENT D;  4TUM A;  4HLL A;  2FO1 E;  1K3Z D;  4GMR A;  3Q9N C;  4DX5 D;  3ZUV B;  4LG6 A;  3LJN A;  1S70 B;  3TWV A;  2QYJ A;  4GPM A;  4K5B A;  4HNA D;  4DX2 A;  1D9S A;  4HQD A;  3B95 A;  4J8Y A;  2NYJ A;  2ETB A;  5EIL A;  1SW6 A;  2XZT G;  4BET A;  2DZN A;  1K1B A;  2HE0 A;  5ENR D;  5HKP A;  2F8X K;  4CZ2 D;  3NOG D;  2A5E A;  3NOC D;  4HI8 A;  1TR4 A;  1BU9 A;  2ZGG A;  1BI7 B;  2KXP C;  4JB8 P;  2P2C P;  1WDY A;  2DZO A;  3TWU A;  5CBN A;  2B0O E;  1MX6 A;  3AJI A;  4G8K A;  1N0R A;  5EIB E;  2XZD G;  2L6B A;  5AQ9 A;  4F6R D;  4HRM B;  4K5A B;  3TWQ A;  3JUE A;  3SO8 A;  4Z68 A;  4U96 D;  2XEH A;  2Y0B G;  4J7W A;  3DEO A;  4K5C A;  4DUI A;  4C48 B;  3UTM A;  1YMP A; 
#chains in the Genus database with same CATH topology
 4HOU A;  3CVQ A;  4HI9 A;  2Q7F A;  1OCZ E;  3ZYL A;  3PEU B;  3U64 A;  5E75 A;  1NZN A;  3CQG B;  4KZ0 A;  4Y6C A;  4I2Z A;  2X3M A;  1XGW A;  3VLF A;  3CQC B;  4GZ5 A;  3KSL A;  5JHB A;  4LRZ A;  1TNZ A;  1WY6 A;  2HM8 A;  4BTA A;  3T5X A;  3Q75 A;  3K9I A;  4CEM A;  3KEA A;  3RK6 A;  2VSO E;  1QNF A;  3U4T A;  4G1T A;  4BSZ B;  3ASN E;  2ETA A;  5FQ7 A;  4UWK A;  4PH4 B;  2BKG A;  2WQH A;  1N95 A;  3B7R L;  2X6F A;  3ZFW A;  3DXM G;  3AG1 E;  5D66 A;  4ZHB A;  4GZC A;  2Y3A A;  4WNE A;  2VTB B;  4HRN A;  4DX7 D;  4NQ0 A;  2GGF A;  3CHP A;  5KJM A;  1KPS B;  3JCK C;  4APO A;  3D9L A;  3UT4 A;  3D9I A;  3B7B A;  4N5C A;  5BT1 A;  3UKR G;  2VSY A;  4YDO A;  4IRU A;  4XI9 A;  1H6O A;  1SW6 A;  2DZN A;  1FVF A;  5JHA A;  5HKP A;  3SQV A;  3NOC D;  1O5M A;  3QWW A;  4V3I A;  4K03 A;  2ZU6 B;  4JA7 A;  4I6G A;  3UT7 A;  1MQS A;  1S64 A;  4FC8 A;  3IHV A;  3CHQ A;  2GRM A;  3KEZ A;  3VTY A;  4B8A A;  2IEJ A;  4B93 B;  3MEK A;  4UWL A;  5KWD A;  4FJY A;  1INZ A;  5LP0 A;  4RQI A;  4M7C A;  4DX1 A;  4FP7 A;  3FTV A;  3ZYM A;  4ANW A;  2J07 A;  1H19 A;  4GCN A;  1EF1 C;  1KT1 A;  5ANR A;  4PDX A;  1EPU A;  2R59 A;  3PUK A;  3OTN A;  3GZ2 A;  2EIJ E;  1SA5 A;  2CHW A;  1NA0 A;  4JA9 A;  4U07 A;  3L08 A;  3V31 A;  4HXI A;  4GTQ A;  3DSU A;  2IY0 C;  1IXV A;  2DIW A;  3AU5 A;  5T4Y A;  3DSS A;  1FPP A;  3Q9N C;  3RIB A;  3GZS A;  4HOT A;  1PAQ A;  3CK7 A;  4K5B A;  3B95 A;  2NC9 A;  3LVQ E;  1ZB1 A;  1XNF A;  5B1A E;  3QWV A;  3O4Z A;  4N3C A;  1TYQ G;  2A5E A;  2RD0 A;  1BU9 A;  5J08 A;  4BX9 A;  4H7Y A;  3EDT B;  5KJK A;  2XCC A;  4J6I A;  3EHN A;  1FCH A;  5EIB E;  3BG1 B;  4JZY A;  2XEH A;  2KM4 A;  1Z6T A;  3L82 A;  2OCC E;  3UTM A;  5ITZ F;  3QC1 A;  2JLB A;  4GU5 A;  3LDZ A;  1ZU2 A;  2R2L A;  3D9P A;  3UM1 A;  2IF4 A;  1Z3Y A;  2LUH A;  2XEV A;  5C1D A;  1U3C A;  5ARG A;  4O60 A;  1YYH A;  4L9P A;  3U9W A;  5A6C A;  5B3S E;  2BTD A;  4PS3 A;  4JC8 A;  3QWP A;  1ELR A;  1Y6I A;  2WXP A;  2KZT B;  3FUD A;  5DIZ A;  1H2V C;  2H6I A;  2Y4U A;  4DRX E;  1IHB A;  4FUL A;  3ZHE B;  4EBA A;  1NA3 A;  2XQ0 A;  3UT8 A;  1Y8M A;  2X6J A;  1MX4 A;  2IOL A;  4HLL A;  1OWL A;  3I5P A;  3D9J A;  2C0L A;  4KVM A;  4UQZ A;  5G05 C;  5ENR D;  4GA2 A;  1EYH A;  4J8S A;  4CDM A;  1N0R A;  4TUU A;  1QQE A;  1V54 E;  2Y4T A;  1LD8 A;  3SF4 A;  1EDU A;  5FIN A;  1UOH A;  1DC2 A;  2AXV A;  2MOW A;  3G2V A;  2YQ8 A;  3ZNG A;  1LTX A;  1N54 A;  2BED A;  3ZEF A;  4EZK A;  3V30 A;  3V79 K;  3RKV A;  4W9R A;  2X38 A;  2ILR A;  5KCM A;  3CHM A;  3Q4A B;  3R9M A;  5AJL A;  3JQ1 A;  2LSV A;  2XRY A;  3FUF A;  3S7D A;  5BXO A;  1SZA A;  4XX5 A;  3O48 A;  1H6K A;  2PM7 A;  5J90 A;  1E8Z A;  1JWG A;  4OVV A;  2EIN E;  5FZQ A;  3G2W A;  4CGV A;  1JCS A;  2ZIS A;  5KNG A;  2KCL A;  4GMJ A;  2PZI A;  3LKU A;  3OXL A;  4WND A;  2DBA A;  3ZXS A;  3V2X A;  2DWZ A;  3FUL A;  3CK9 A;  4HOQ A;  2XS1 A;  4UI9 J;  3PZ3 A;  2A4Z A;  3SGH A;  4B89 A;  2PM6 A;  3E30 A;  3PRE A;  3TL5 A;  3KD7 A;  1E7U A;  2YHC A;  1K1B A;  3URZ A;  4GTP A;  4DLO A;  3C98 A;  1WDY A;  3ASO E;  4A1G A;  1HF8 A;  3TXM A;  1E8Y A;  1E8W A;  4B94 A;  4UI9 K;  5EX3 A;  2QY7 A;  4AJW A;  2RG8 A;  3C72 A;  1GW6 A;  3JXJ A;  3T8K A;  3CHS A;  5A7D B;  5EYL A;  1NL4 A;  3PS6 A;  3S7B A;  2GRR B;  5C2Y A;  4G23 A;  3F6Q A;  1WM5 A;  4BT9 A;  2FUL A;  5CCL A;  2PL2 A;  4CDN A;  5CER B;  3AAA C;  4GA1 A;  4I43 A;  4CT4 A;  3Q9U C;  3SZ7 A;  2PQR A;  3ZU7 B;  2R17 C;  2QC9 A;  2IJG X;  4JEU A;  1HG2 A;  4MKT A;  3UUX A;  4ANX A;  5LX8 A;  1X81 A;  2WXQ A;  4RSY A;  4GPK A;  4LNG A;  3ZYQ A;  3DEP A;  4WUY A;  4G8L A;  3HVE A;  4Q69 A;  3CSF A;  3GZ1 A;  3BEE A;  3P1U A;  1S63 A;  4HVB A;  1YA0 A;  2OV8 A;  3MKR A;  4FHJ A;  3MX3 A;  5BNW A;  2IFU A;  3CVV A;  3EHR A;  2VGX B;  3CKC A;  3BUA A;  4I1M A;  4FAD A;  3QK0 A;  2WQ7 A;  2IOS A;  4BY6 A;  3L9T A;  2LO6 A;  5M72 A;  2XZT G;  3G2U A;  2HE0 A;  5FTP A;  3FDH A;  3SFX A;  4PUC A;  1QZ2 A;  4A55 A;  2WPV A;  3R7R A;  2I9C A;  4K0R A;  3FTU A;  4HRM B;  3ASF A;  4O6F A;  4E6H A;  5G05 J;  4K5C A;  3NZU A;  4C48 B;  3LXU X;  4U95 D;  1U3D A;  3WXX A;  1OWP A;  2E2E A;  2FEZ A;  1JCR A;  1TN8 A;  4LER A;  1RW2 A;  4OVU A;  5KNH D;  3DST A;  3EIQ C;  2OVF A;  2XS8 A;  5HQ8 A;  3FWV A;  4UWG A;  1L5J A;  1TN6 A;  2GW1 A;  1WG0 A;  2OOE A;  3NAW A;  1TEZ A;  2LXL A;  1OWM A;  3CVU A;  3TG4 A;  4NUR A;  2M63 A;  4O1P A;  4AY5 A;  4GZ3 A;  3APD A;  3UM2 A;  5AQA A;  2F8Y A;  1OUV A;  1N52 A;  3IKO B;  3FEX A;  3PE4 A;  3E32 A;  2KCV A;  2GRN B;  4LEU A;  1DCE A;  5AJD A;  3E4B A;  2WXO A;  4PS8 A;  2XPI A;  3HXF A;  4D10 C;  2YIN A;  3UIP C;  2X6I A;  3L22 A;  4JXT A;  1IQR A;  2V4H C;  3SBT B;  4L2Y A;  1KZP A;  1HG5 A;  3DBS A;  5B1B E;  4AOF A;  4BFR A;  3LCA A;  4GZD A;  3CR3 A;  4E85 A;  2F8X K;  4G11 A;  3HXD A;  3KS2 A;  2P9N G;  2DZO A;  3AJI A;  1RZ4 A;  1D8E A;  4YND A;  5BPP A;  4Z68 A;  4XZ4 A;  3PZ2 A;  4GTS A;  4BWR A;  3CK8 A;  1AP7 A;  1SZ9 A;  3Q5M A;  2C2L A;  2V4L A;  3EU9 A;  3FU0 A;  1NP7 A;  4F1S A;  4JW1 A;  4GTR A;  4LNB A;  1V55 E;  3C5R A;  1MJ0 A;  1TJC A;  3FUI A;  4ANV A;  5BW8 C;  4IUL A;  4J8D A;  4ACK A;  1PY1 A;  3E33 A;  3S2A A;  2J09 A;  2P9U G;  3TGO A;  4JHK A;  2IO2 C;  2IU1 A;  3TJP A;  2JAB A;  1UJJ A;  5EID A;  3JQ0 A;  5CED B;  3C3O A;  3CV0 A;  4N5Q A;  4J8F A;  3PE3 A;  4U0Z A;  2R5S A;  1TNO A;  2V5Q C;  5G04 C;  1MZC A;  3I4G A;  4YVO A;  3UPV A;  5JJ7 A;  2GRP B;  4G2V A;  4L7T A;  4WAF A;  3ZUV B;  4U7E B;  1D9S A;  4A1S A;  1JPL A;  2NYJ A;  3LY8 A;  2EIK E;  2C0M A;  4C0E A;  2AW6 A;  3QAR A;  1Z5S C;  5FZS A;  5CBN A;  4G8K A;  2XZD G;  4K5A B;  4N2S A;  1N9A A;  3ESK A;  5AEN A;  5CMY A;  4DI4 A;  3IHY A;  4J7W A;  5KJN A;  2P9L G;  5G55 A;  2LNI A;  3UM3 A;  3EUV A;  2P9P G;  1ZBP A;  4XI0 A;  4TXP A;  4XIF A;  1O1S A;  3T9K A;  4CRW A;  3UQ3 A;  3D3M A;  3FFL A;  2J49 A;  3SBS A;  3ONK A;  3HIZ A;  5EN5 D;  3NBN B;  2F37 A;  3FUN A;  3TWS A;  3FTX A;  4P29 A;  1N94 A;  3ZIM A;  1FT1 A;  3OAW A;  4JL0 A;  4UI9 C;  3ASG A;  2PNN A;  3MA5 A;  3AS8 A;  1IQU A;  4GZ6 A;  4DX6 D;  3RAU A;  3PVL A;  2RFA A;  4CDR A;  2VSN A;  1OT8 A;  3CGH A;  3FUM A;  4NIK A;  1HO8 A;  1LF8 A;  4YDW A;  1O1R A;  3Q15 A;  2R02 A;  1HH8 A;  5FJY A;  2VGY A;  4G26 A;  4DX5 D;  3FTZ A;  3LJN A;  3TWV A;  4GA0 A;  2GRO B;  2WB2 A;  4ANU A;  2X6H A;  3LS8 A;  4XE0 A;  3KSQ A;  3RU0 A;  3NOG D;  3ZHE A;  2WXH A;  1E7V A;  3FU5 A;  3L54 A;  3PDN A;  3RRM B;  3ULY A;  4YDE A;  3ZPJ A;  4EBA G;  2NXP A;  5FZR A;  4EEC A;  5LOZ A;  2XRZ A;  1VDY A;  3E34 A;  4HOR A;  2FO7 A;  3TAX A;  5LCW J;  4ILI A;  2I2O A;  3SFZ A;  2WMN A;  4AY6 A;  1KLX A;  3NQP A;  5G2N A;  4APF A;  2PQN A;  3ZGQ A;  4I17 A;  4U8Y D;  3FUJ A;  2XGS A;  3Q73 A;  4BT8 A;  2HYZ A;  4ATZ D;  3TWT A;  4GML A;  2WXI A;  4U63 A;  1SA4 A;  3C3R A;  5EYP F;  4KYO B;  3ZVV A;  4EZL A;  3R9A B;  1K8K G;  4L2L A;  4B8C B;  5FIO A;  2RFM A;  4WWP A;  3UX4 A;  3MGB A;  3ABL E;  1K1A A;  5AAR A;  1X5B A;  2AJA A;  3KAE A;  4RG6 A;  1S70 B;  3JUI A;  1O1T A;  4HNA D;  4HOS A;  3L17 A;  5DBK A;  2YHE A;  5EIL A;  4KVO A;  5ENN A;  4GYY A;  3CHO A;  1ELK A;  3ULQ A;  4BSX A;  2OND A;  3FEY A;  4G25 A;  3Q49 B;  4F6R D;  3FH7 A;  5CRV A;  4WWN A;  4AIF A;  3CVW A;  3MZL B;  4U96 D;  2NSZ A;  3VTX A;  1YMP A;  1JUQ A;  2WXK A;  3AG2 E;  2HO1 A;  5A23 A;  3CVY A;  2OEW A;  1TNY A;  4J0U A;  4I6E A;  5AIJ A;  4HB5 A;  4EZJ A;  3B7T A;  2RKK A;  1HX8 A;  2L0I A;  5ENS D;  5ENQ D;  5FQ4 A;  1HS6 A;  5JJT A;  1DNP A;  1G3N B;  1NI1 A;  2EQX A;  2CG2 A;  3HXC A;  4MS6 A;  1N4R A;  1OY3 D;  4OAU C;  3RJV A;  3RO3 A;  4ATG A;  4CYM D;  2XEN A;  3FTS A;  3R7Q A;  5BV1 A;  3D9O A;  3EJN A;  1N11 A;  4JPS A;  3T8M A;  2FI7 A;  5CHE E;  3QNK A;  2VGX A;  2WM9 A;  4Q94 A;  2WXJ A;  3HHM A;  2XCB A;  5BXU A;  1P5Q A;  2H6H A;  1TN7 A;  3DSW A;  1YCS B;  4N39 A;  4UWF A;  2LXM A;  2V8S E;  2P58 C;  5AN8 A;  3HDX A;  5AYW D;  3HVE B;  4FLB A;  3CVN A;  2J4B A;  3ASH A;  3QB2 A;  1IYG A;  1N4S A;  2EIL E;  4JHJ A;  4JHR A;  1BI7 B;  5FWQ A;  3FUE A;  2P9K G;  1IHG A;  2VQ2 A;  4DUI A;  3SI5 A;  4NAC A;  1E90 A;  1HU3 A;  2A5U A;  4I1A A;  5JA4 D;  5EX0 A;  3TWR A;  1FT2 A;  1SQM A;  3HRA A;  5AAO A;  2CHZ A;  4QQI A;  3AG3 E;  3ZN3 A;  4M3O A;  3GW4 A;  3ULE G;  4AEZ C;  1PC2 A;  4Y6W A;  2GRQ B;  3AS4 A;  2AVP A;  3EU5 A;  4KT6 B;  3Q79 A;  3TXN A;  2LAH A;  3PNT B;  4BEP A;  3CHR A;  3W9F A;  2CG3 A;  4RVB A;  4F7A A;  2CFU A;  4RLY A;  5LCW C;  4HBD A;  1U2V G;  1DCQ A;  3ABM E;  4YDY A;  1H2U A;  5E76 A;  4EPZ A;  2XEE A;  2EIM E;  4FJZ A;  5CCM A;  4EHM A;  4ACL A;  5CEC B;  4HFG A;  4GTO A;  2DVW A;  3QOU A;  4TUM A;  1OCO E;  1K3Z D;  1OCR E;  4GCO A;  4AVX A;  1KZO A;  1JWF A;  3RRU A;  5ANL A;  3FU6 A;  5D0Q D;  3B7S A;  3PNL B;  2XPZ A;  4BTB A;  1KT0 A;  3HXB A;  2B0O E;  3MKQ B;  3UKU G;  3AS5 A;  1H0A A;  3JUE A;  3FP3 A;  3SO8 A;  3LPZ A;  2R05 A;  2Y0B G;  3FH8 A;  3DEO A;  4AM9 A;  4NRH B;  1TNB A;  2Y1L E;  5JJ6 A;  3ONL A;  3HXE A;  3J5P A;  3OXF A;  4KZC A;  3LJ3 A;  4U8V D;  1MYO A;  4JD2 G;  4XEI G;  1QYM A;  3PH0 C;  3D9K A;  3MJW A;  4L23 A;  3PZ4 A;  1B89 A;  4GTV A;  4LCT A;  4C0M A;  3UI2 A;  3FY4 A;  3QJZ A;  3VLE A;  2CFZ A;  3UIN C;  3ZYK A;  4BER A;  4TXQ A;  1UN9 A;  3DPY A;  3APC A;  2AWI A;  3UXG A;  3D9M A;  3PRZ A;  3BG0 B;  3S7F A;  5ENP D;  1DVP A;  3NF1 A;  1MX2 A;  3I4R B;  3FTW A;  3PZ1 A;  2I1J A;  4ME2 A;  3TWW A;  5D2M C;  1BD8 A;  3V2O A;  4UQX A;  5JMN D;  4U0U A;  3Q7F A;  5FT9 A;  2ZIR A;  4A3V A;  4IYP A;  2XHE A;  1OXJ A;  4DX2 A;  4I6J A;  2VSX E;  2ETB A;  2BUG A;  2MHK A;  3I3N A;  4MBG A;  3U66 A;  3SFY A;  5EKQ D;  2WXF A;  2ZGG A;  5ARF A;  2R03 A;  4DJA A;  2E0I A;  2L6B A;  1UW4 B;  2B6C A;  3DPD A;  3AU4 A;  3NB2 A;  1WAO 1;  2L0T B;  4G24 A;  4OYS A;  4LUN U;  3UM0 A;  4J8E A;  3IXE A;  1D8D A;  1QBQ A;  2VYI A;  3SNX A;  4U8H A;  2WVI A;  1Z3X A;  2I6H A;  3T5V A;  3E37 A;  4FU3 A;  2WXR A;  1A5E A;  3ZKJ A;  2VGE A;  3QKY A;  4KXK B;  4H7X A;  2DYR E;  2ZGD A;  4GAA A;  3J5Q B;  2FBN A;  3Q7A A;  4HRL A;  3JXI A;  4TRQ A;  5LFA A;  2ETC A;  5FQ8 A;  5G04 J;  4I2W A;  1OWO A;  4QFV A;  1LD7 A;  3G2T A;  3SY2 A;  3TWX A;  5BUZ A;  3L6A A;  2MRI A;  2QFC A;  2CHX A;  3FUK A;  4WNG A;  2F0Y A;  3APF A;  4FHK A;  1UJK A;  2DCP A;  2YNQ A;  1UN8 A;  4FLH A;  3G2S A;  4GMR A;  2VTB A;  1W3B A;  4U0S A;  4LG6 A;  4B0Z A;  3ZRH A;  4J8Y A;  3AG4 E;  4Q96 A;  2GRL A;  2VJ8 A;  4CZ2 D;  3RSE G;  3X2Q E;  5IY5 E;  4L1B A;  5BV0 A;  3FU3 A;  3CVP A;  4PS7 A;  2WQ6 A;  4GTT A;  5AQ9 A;  3TWQ A;  3L13 A;  1MHQ A;  2BF0 X;  4GYW A;  4EQF A;  4HLE A;  4KBQ A;  4N3B A;  4UUC A;  1AWC B;  4F1P A;  4CT0 A;  3UIO C;  4N3A A;  3LY7 A;  2V5F A;  3UMV A;  1TJF A;  2H6F A;  5HS0 A;  2J08 A;  3IEG A;  3NZS A;  2KZT A;  3SD5 A;  5HRY A;  4HS2 A;  4ILG A;  3FH5 A;  5HI7 A;  2ZXW E;  4UWH A;  3QDN A;  1HZ4 A;  4DK5 A;  4KMO A;  4A63 B;  3RRN B;  1SVX A;  5ENO D;  2OVB A;  3HG0 D;  5AQB A;  1OCC E;  1E96 B;  5CEA A;  3L16 A;  4O1O A;  4CCA A;  1A17 A;  1UG3 A;  4TV3 A;  3ML9 A;  2BKK B;  2KC7 A;  2MYO A;  2WXG A;  4RG9 A;  4F3V A;  2AXU A;  4F53 A;  1HFA A;  3ISM C;  3CVL A;  2QYJ A;  1ELW A;  4HQD A;  2DYS E;  2WXM A;  3LEW A;  1N4Q A;  3CST A;  3RO2 A;  4JB8 P;  1S0P A;  2P2C P;  2IQC A;  5KJL A;  4DLQ A;  4UQY A;  2L6J A;  3IV0 A;  2Y69 E;  2HR2 A;  3P2B A;  2J4D A;  4FA6 A;  4U04 A;  1FVH A;  1N0Q A;  5T3R A;  3CIA A;  3BQO A;  2WXL A;  3ASD A;  4GYO A;  3EHQ A;  3Q78 A;  2XPY A;  3FTY A;  2QZA A;  4IN3 B;  5FQ6 A;  3DXK G;  3MV3 B;  3TG5 A;  4N2Q A;  2J8S D;  1H2T C;  4A3T A;  3VLD A;  3Q47 B;  3MV2 B;  3LY9 A;  3GYZ A;  1N4P A;  4DI3 A;  5T8I A;  4BES A;  3W9G A;  5KBA A;  5D0O D;  5H7P A;  1HE8 A;  1NFI E;  3PZD A;  3U3W A;  4R7L A;  3MCX A;  3CEQ A;  3MYV A;  2UY1 A;  2H6G A;  3S7J A;  4LSZ E;  4XKC A;  5ENT D;  2FO1 E;  4I1O B;  2WXN A;  2QYU A;  3PEV B;  4GPM A;  4X8Q A;  2AXZ A;  3B13 A;  5CRU A;  3MKQ A;  2P9I G;  3JYS A;  1TNU A;  2V0P A;  4GB9 A;  3DSV A;  3PUJ A;  2ION A;  4I9C A;  2KXP C;  2P9S G;  1MX6 A;  1HXI A;  2LSU A;  3ZW3 A;  4AV7 A;  3CVX A;  4MRU A;  3DWL G;  3WG7 E;  4YVQ C;  4AP2 A;  4ILH B;  1H6P A;  2IO3 C;  4ZFH A;  3ML8 A;  3FUH A;  3ZXP A;  2KCK A;  1OWN A;  4ABN A;  3OXG A;  3ENE A;  2I1K A;  2XGO A;  2KAT A;  1E8X A;  3D9H A;  5AQ7 A;  5CBO A;  2WMO A;  2OEV A;  3CKB A;  3IBE A;  4LNU D;  3D9N A;  3CLJ A;  4DPR A;  4OAV B;  2L9B A;  3N71 A;  1BLX B;  3QAQ A;  4C9B B;  2FF4 A;  1Q2Z A;  2X6K A;  3BU8 A;  3ESL A;  4XKB A;  1JCQ A;  4MLP A;  2UY1 B;  5CMW A;  1IKN D;  4WNF A;  4TXR A;  4AXH A;  1BPO A;  2XGM A;  1BI8 B;  3FHE A;  2KBX A;  2J9Q A;  3DSX A;  3B7U X;  3EIJ A;  3SHF A;  2LAI A;  5EDS A;  4BET A;  3ABK E;  3LVR E;  4HI8 A;  4CGW A;  1TR4 A;  2JEK A;  4JVS A;  3HYM B;  4JEH A;  3LYA A;  3TWU A;  3C3Q A;  2UWJ G;  4BX8 A;  3DRA A;  4WWO A;  3EHM A;  4URK A;  4GTM A;  4I9E A; 
#chains in the Genus database with same CATH homology
 2Y1L E;  1AP7 A;  4U95 D;  4UUC A;  1AWC B;  4B93 B;  1N0Q A;  5FIN A;  4HI9 A;  1UOH A;  4F1P A;  3J5P A;  1DC2 A;  5ITZ F;  3EU9 A;  3ZNG A;  4U8V D;  3JXJ A;  5KWD A;  1MYO A;  3T8K A;  5EYL A;  3IXE A;  5KNH D;  4ZFH A;  4HB5 A;  3T9K A;  3EHQ A;  5JA4 D;  3TWR A;  1QYM A;  4DX1 A;  3V30 A;  3V79 K;  3F6Q A;  5HS0 A;  3C5R A;  4U8Y D;  4O60 A;  5ENS D;  3HRA A;  1YYH A;  5AAO A;  1MJ0 A;  5HRY A;  5CER B;  4QQI A;  5ENQ D;  5EN5 D;  3NBN B;  3AAA C;  1A5E A;  2F37 A;  1WG0 A;  3Q9U C;  3TWS A;  3ZKJ A;  2VGE A;  1G3N B;  3UI2 A;  3ZU7 B;  2J8S D;  3D9H A;  5AQ7 A;  2ZGD A;  3KEA A;  2QC9 A;  4A63 B;  4ATZ D;  5BXO A;  3TWT A;  1SVX A;  5CBO A;  5ENO D;  3HG0 D;  5AQB A;  3J5Q B;  1OY3 D;  4O1P A;  4LNU D;  4BSZ B;  4OAU C;  2ETA A;  2PNN A;  5EYP F;  4BER A;  4CYM D;  2XEN A;  4BEP A;  5AQA A;  3W9F A;  4HRL A;  2F8Y A;  3JXI A;  2JAB A;  4OAV B;  4BES A;  2ETC A;  5EID A;  1BLX B;  2BKG A;  3DEP A;  1N11 A;  5CEA A;  3UXG A;  4O1O A;  4G8L A;  4QFV A;  3W9G A;  5CED B;  5KBA A;  4RLY A;  4DRX E;  4HBD A;  3TWX A;  1DCQ A;  4N5Q A;  1IHB A;  5ENP D;  5KNG A;  4YDY A;  5D66 A;  4DX6 D;  1MX2 A;  2XEE A;  4ZHB A;  5BXU A;  1NFI E;  2RFA A;  2BKK B;  1IKN D;  5CEC B;  1OT8 A;  4HRN A;  5FIO A;  2RFM A;  3V31 A;  4DX7 D;  4NIK A;  2MYO A;  3TWW A;  1MX4 A;  2V5Q C;  1BD8 A;  2V4H C;  4YDW A;  3V2O A;  1BI8 B;  1IXV A;  1YCS B;  5JMN D;  3V2X A;  1K1A A;  5AAR A;  2DWZ A;  2DVW A;  3EHR A;  2KBX A;  4LSZ E;  5AN8 A;  2AJA A;  3B7B A;  5ENT D;  4TUM A;  4HLL A;  2FO1 E;  1K3Z D;  4GMR A;  3Q9N C;  4DX5 D;  3ZUV B;  4LG6 A;  3LJN A;  1S70 B;  3TWV A;  2QYJ A;  4GPM A;  4K5B A;  4HNA D;  4DX2 A;  1D9S A;  4HQD A;  3B95 A;  4J8Y A;  2NYJ A;  2ETB A;  5EIL A;  1SW6 A;  2XZT G;  4BET A;  2DZN A;  1K1B A;  2HE0 A;  5ENR D;  5HKP A;  2F8X K;  4CZ2 D;  3NOG D;  2A5E A;  3NOC D;  4HI8 A;  1TR4 A;  1BU9 A;  2ZGG A;  1BI7 B;  2KXP C;  4JB8 P;  2P2C P;  1WDY A;  2DZO A;  3TWU A;  5CBN A;  2B0O E;  1MX6 A;  3AJI A;  4G8K A;  1N0R A;  5EIB E;  2XZD G;  2L6B A;  5AQ9 A;  4F6R D;  4HRM B;  4K5A B;  3TWQ A;  3JUE A;  3SO8 A;  4Z68 A;  4U96 D;  2XEH A;  2Y0B G;  4J7W A;  3DEO A;  4K5C A;  4DUI A;  4C48 B;  3UTM A;  1YMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...