5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
3W9FA 5JA4D 3D9HA 5AAOA 2DVWA 2KXPC 4ZFHA 5JMND 5ENQD 5HRYA 2Y1LE 3EHRA 5EIBE 3ZU7B 4ATZD 5HKPA 5HS0A 5ENTD 5ENOD 3UI2A 2B0OE 4HLLA 5ENSD 1A5EA 1MJ0A 4YDWA 5AQ7A 3TWQA 1G3NB 3V2OA 4HRMB 3ZKJA 2V4HC 2F37A 5BXOA 1BLXB 3KEAA 4DRXE 1MX6A 3JUEA 4B93B 4HBDA 5CBOA 5CERB 4OAVB 5KWDA 3TWSA 2XZTG 3TWUA 4YDYA 5D66A 2ETCA 3SO8A 1BU9A 2RFMA 1K1AA 3EHQA 3UTMA 4HRLA 4CYMD 4U95D 2V5QC 1S70B 2A5EA 3Q9UC 3J5QB 2DZNA 1IKND 1IHBA 4HB5A 1IXVA 5AQBA 2J8SD 1WG0A 5ENRD 4HNAD 4GMRA 4K5BA 2FO1E 2XEHA 5EYPF 4O60A 4DX6D 2JABA 1MX2A 2RFAA 5KNGA 3NOGD 4K5AB 4ZHBA 5ITZF 1AP7A 5EYLA 2AJAA 3AAAC 4J7WA 4UUCA 4BETA 4OAUC 2BKGA 1WDYA 4DX7D 2ETAA 4G8KA 3B7BA 3NOCD 4J8YA 5EIDA 3AJIA 3DEOA 4HRNA 5AQ9A 4BESA 3IXEA 1DC2A 1NFIE 3TWVA 5AARA 3UXGA 4O1OA 4C48B 4HI9A 3Q9NC 4CZ2D 1D9SA 4LG6A 2L6BA 4DX5D 4A63B 2QC9A 3V79K 3NBNB 4GPMA 1N0QA 2XZDG 3ZUVB 2P2CP 1YCSB 1BI8B 3TWWA 3B95A 3HG0D 3TWRA 3W9GA 1UOHA 4F6RD 2XENA 3T9KA 5BXUA 3V30A 4U96D 4NIKA 3T8KA 5AQAA 2MYOA 4LSZE 2Y0BG 1AWCB 4RLYA 1MX4A 1MYOA 1TR4A 4QQIA 1K1BA 2ETBA 5KNHD 4BEPA 2QYJA 3ZNGA 2KBXA 4HI8A 3LJNA 4JB8P 1DCQA 1BI7B 4K5CA 5CECB 3JXJA 3J5PA 4DX2A 3C5RA 5CEAA 2NYJA 2XEEA 4N5QA 4DX1A 2HE0A 3HRAA 4QFVA 5CEDB 1YMPA 2F8XK 1N0RA 4HQDA 2DZOA 1K3ZD 2ZGDA 5EN5D 1N11A 5KBAA 2DWZA 1OT8A 5CBNA 4BERA 4U8VD 2BKKB 1OY3D 3V31A 3EU9A 2VGEA 4F1PA 5ENPD 4Z68A 2F8YA 2ZGGA 1QYMA 3TWXA 1SVXA 4TUMA 5AN8A 2PNNA 1BD8A 3F6QA 4LNUD 5FINA 1SW6A 4G8LA 4DUIA 4BSZB 3JXIA 4U8YD 3DEPA 5EILA 3TWTA 3V2XA 4O1PA 5FIOA 1YYHA
chains in the Genus database with same CATH superfamily
3CHRA 4HVBA 1WM5A 2XRYA 3CK9A 3ULEG 5HKPA 2FI7A 3MKQB 1HX8A 2X6IA 4UQXA 5D2MC 1S0PA 3UTMA 3ZYQA 4PS8A 3G2UA 1IXVA 1WG0A 2DYRE 4I1AA 5ENRD 5EYPF 2MOWA 5KJLA 1HO8A 3LDZA 1AP7A 3WXXA 3Q49B 4D10C 3ASOE 4K03A 1DC2A 3RJVA 3DSTA 5FZRA 4JZYA 3ZPJA 4EZLA 3R7RA 4GA1A 4LNGA 2KM4A 4JHRA 5JJ6A 4HORA 3DSXA 5BXUA 3B7TA 3T8KA 4BX8A 3C3QA 5T8IA 5KNHD 3U66A 3RO2A 5G55A 1H6PA 2ONDA 5CMWA 4ILHB 4I1OB 2L9BA 4GZ3A 4UQYA 3CVLA 1TEZA 1Z5SC 4KMOA 4GTRA 2XHEA 2WXMA 4F53A 3PZ3A 5BV0A 4U8YD 1DNPA 1YYHA 3I5PA 1HZ4A 3UT8A 3K9IA 4ZFHA 3AG4E 5HRYA 1S64A 5EIBE 4C0EA 1OWPA 2FO7A 4JHJA 2WXOA 4AY6A 3TWQA 3D9LA 4B93B 4HS2A 4JXTA 3SQVA 3AS4A 2XPZA 3JQ0A 4CYMD 1KLXA 3G2VA 3DSSA 3LY7A 3VTXA 2DZNA 3SBTB 1EYHA 4HNAD 4R7LA 2H6HA 5LX8A 4PDXA 4JW1A 3CR3A 3OTNA 4WNGA 3APFA 1OWNA 4OVUA 4C9BB 4DX7D 4HRNA 1X5BA 3LXUX 5AARA 3LKUA 3ML9A 4A63B 3PREA 4GPMA 3TWWA 3B95A 1TJCA 2DYSE 3CHQA 3OXGA 3Q79A 2V0PA 2R02A 3ZVVA 2EIKE 4K5CA 3RSEG 1ELWA 3ML8A 2PM7A 3ASNE 3QWWA 2OV8A 3FTUA 3QK0A 3DPYA 3VLEA 4BY6A 3TG5A 3C98A 3UKUG 1UN9A 3FUNA 3TWXA 2GRQB 3L9TA 3Q75A 1HU3A 2AVPA 2DCPA 3SGHA 5JA4D 1GW6A 3G2WA 3U4TA 2ZISA 4GCOA 5ENOD 4Q94A 4GYWA 5EX0A 4DRXE 3CVWA 3CHSA 4L7TA 1E8WA 3MV3B 2V4LA 4BWRA 2IO2C 3FTSA 5CCLA 2OEVA 3NB2A 3BG1B 5KNGA 3HDXA 1H2VC 1NL4A 3SNXA 2FEZA 3TG4A 3TXMA 4M7CA 2A5UA 1HFAA 5EIDA 1TYQG 3AJIA 3R9AB 3IXEA 2WXNA 2IONA 3RIBA 3U9WA 4E6HA 2PQRA 5FZSA 3NBNB 4H7XA 3OAWA 3ZFWA 3FTZA 3TWRA 2PZIA 3MEKA 4Q96A 3UPVA 5LFAA 3CQCB 4UWHA 3RRNB 1EDUA 4N5QA 4EBAG 3N71A 5IY5E 2J4DA 4HOSA 3UM2A 2GRMA 4IYPA 4KZCA 1OCZE 2PL2A 5ENPD 3QNKA 4L1BA 3CKCA 1TNYA 2H6GA 1IHGA 4G25A 2CG2A 2I2OA 3O48A 2IF4A 2VGXA 2V8SE 4ATZD 4HLLA 4U0SA 4FADA 3GYZA 3EU5A 2FBNA 4LERA 3PE4A 2C0LA 4XE0A 4TV3A 4FC8A 4MRUA 2YHCA 2AXZA 2AXUA 4AM9A 3PE3A 5ENNA 4AP2A 3I3NA 3BUAA 2AWIA 4K5AB 3S2AA 3FTWA 4U0ZA 3ISMC 4KYOB 1N4SA 5J90A 3SF4A 4U0UA 2BEDA 2KATA 3ZYLA 4YVOA 2JEKA 3RK6A 3FUFA 2XZDG 1TNZA 1IQUA 4HOUA 5DIZA 1RZ4A 1PY1A 3QWPA 4FLBA 2YHEA 3QJZA 4LSZE 5C2YA 3FUHA 2X6FA 2X6KA 1A17A 4JB8P 2R5SA 3JXJA 3GZ2A 1ELKA 3MCXA 3UUXA 4G24A 2X38A 2OVBA 3JCKC 4CDRA 2VTBA 4U63A 3HHMA 2GRNB 3R7QA 3ASGA 2ZGGA 4WAFA 1YA0A 5BV1A 3JXIA 2L6JA 4CGWA 5AAOA 2DVWA 4Q69A 4UWLA 3APDA 3DXMG 4GYYA 4O6FA 2B0OE 4M3OA 5CRUA 2V4HC 5AIJA 3C72A 2LXLA 1ELRA 1TN8A 2RFMA 2QZAA 2Y4TA 3VLDA 2A4ZA 2R17C 2P9NG 4FU3A 4BSXA 3MV2B 3AG1E 3C3OA 3OXFA 3KSLA 4BESA 5FQ4A 1NFIE 3MJWA 3NF1A 4GTOA 1PC2A 4I6GA 5JJ7A 5B1AE 3KEZA 1YCSB 5D0OD 2KCLA 4XKCA 1UOHA 5M72A 3UIOC 3B13A 2Y0BG 1MX4A 1MYOA 3AU5A 1TR4A 4QQIA 3ZHEA 2KBXA 3LJNA 1KT1A 3ASFA 3MA5A 5CECB 3G2TA 1U2VG 3LEWA 2UY1A 1K3ZD 3FU3A 2R05A 4E85A 3MGBA 1NA0A 2VSOE 4N3AA 2V5FA 1KZPA 2IOSA 4GMJA 1JUQA 4N3BA 4ABNA 2HM8A 3URZA 3LS8A 4XZ4A 4BSZB 2PM6A 4ME2A 5G05J 3ZYMA 2WMNA 4DLQA 3SZ7A 5JMND 5C1DA 2P9SG 4EECA 4MBGA 1OWLA 3FU5A 4WNEA 3TJPA 3PEVB 3ESKA 4RG6A 3D9IA 1E7UA 1K1AA 1L5JA 5AJLA 4DLOA 4TXQA 5ANLA 3VTYA 2J07A 2WB2A 4H7YA 2XS8A 4U04A 5HQ8A 4J7WA 5EKQD 3AG2E 4WNDA 2R2LA 3E33A 3GZ1A 3TWVA 2AW6A 2WXGA 1D9SA 4LG6A 3FUIA 3HXFA 3ZUVB 4GZ6A 3D9KA 3E30A 3DRAA 4A55A 3HG0D 3LPZA 2P9LG 2MYOA 3CVNA 3NZUA 2I1KA 3ONLA 2RD0A 4G23A 3NQPA 4WWPA 2MHKA 3J5PA 1OUVA 3T5XA 2WXQA 5BNWA 1P5QA 3GW4A 4UWFA 4A1SA 4HFGA 5G2NA 1QNFA 2WXRA 1N94A 2X6HA 1OY3D 5FWQA 1HG5A 3ZW3A 2IU1A 1Z3XA 3I4GA 2B6CA 3CVXA 3DSUA 3L6AA 3IBEA 4TXRA 3AU4A 2KZTA 4MKTA 4BTBA 3CQGB 3V2OA 4HRMB 2RG8A 4CDMA 3P1UA 5EDSA 3TWSA 2Q7FA 4AV7A 1Z6TA 4LEUA 3ZYKA 3FUJA 2IQCA 1S70B 4XIFA 3Q9UC 5CCMA 4B8AA 4GMRA 1FT2A 2LAHA 1SQMA 5ARGA 4F3VA 2WXJA 1N9AA 2YINA 1JCSA 4GMLA 2LSUA 2P58C 2XRZA 2IJGX 2P2CP 1OWOA 4HXIA 1N4RA 3JYSA 1TN7A 4J8FA 3BU8A 3ENEA 1EF1C 3G2SA 1DCQA 4G1TA 5B3SE 4GTSA 2KC7A 3UT7A 5ANRA 3PUJA 3CSTA 1H2UA 4JD2G 3PZ2A 4I6JA 4GTQA 3ZRHA 4U7EB 3NAWA 5FTPA 1N52A 2Y69E 2Y1LE 4APOA 4GTTA 2J4BA 1TN6A 5ENSD 2I9CA 4LCTA 5LCWC 5BXOA 1E8XA 3ULQA 4JL0A 5A7DB 4I9EA 3DBSA 5KCMA 2A5EA 3ASDA 2GRPB 1H6KA 1QBQA 4WNFA 3U3WA 1XGWA 2QFCA 2JABA 5A6CA 2GW1A 3NOGD 5ITZF 4MS6A 5EYLA 5BT1A 3AAAC 3FU0A 4BETA 1HG2A 5A23A 1UJJA 3GZSA 3Q9NC 3FP3A 3CGHA 1INZA 4WUYA 2EIME 3EHMA 4GTPA 3SFZA 1U3DA 3ZNGA 4HI8A 1S63A 1BI7B 4B94A 1N4QA 1XNFA 3HRAA 5FT9A 2WM9A 2GGFA 4HQDA 2DZOA 4I2ZA 4BTAA 1E96B 1OCCE 1LD8A 4EZJA 3CK7A 4XKBA 5BPPA 4Z68A 3LY9A 1QYMA 4CDNA 4EZKA 2HO1A 2GRRB 1SW6A 1KT0A 3FEYA 3HVEA 4KXKB 5EILA 2VSXE 5G04C 2WXLA 5E75A 2XGMA 4EBAA 5ENTD 3Q78A 5AQ7A 1BLXB 3JUEA 3UINC 1NP7A 1JPLA 4XX5A 3D9JA 2VTBB 4AXHA 1SA4A 3D9OA 4U95D 1KPSB 2P9UG 5AQBA 4O60A 3KAEA 1O1RA 1H19A 3JQ1A 4XI0A 3QB2A 2WPVA 2ETAA 3CVPA 4OYSA 4FA6A 1D8EA 2VSNA 4JPSA 4EQFA 4KT6B 5CHEE 3UXGA 3ZEFA 4CZ2D 4PUCA 4APFA 2E0IA 2Y4UA 3L17A 3T5VA 3Q73A 3SBSA 1RW2A 3HXDA 3T9KA 5LP0A 3V30A 4NIKA 1WAO1 2ZXWE 3ULYA 3C3RA 4DJAA 5J08A 3LYAA 2ZU6B 2OEWA 2KCVA 4L9PA 3L13A 3D9PA 5JJTA 4NRHB 2L0IA 3S7DA 1N11A 3FTXA 2CHXA 3X2QE 2NSZA 4RVBA 3CHPA 5LCWJ 1X81A 4U8VD 5LOZA 2BKKB 4BFRA 3B7SA 3EU9A 3D9MA 2BTDA 3HXEA 4FP7A 4I43A 4O1PA 5ARFA 2EINE 3NZSA 1OXJA 3TGOA 2I1JA 2UWJG 3L16A 3CIAA 2IEJA 3DWLG 4YDWA 5H7PA 1JWFA 3APCA 1SZ9A 2F37A 1LTXA 1Q2ZA 4YDYA 1WY6A 5FZQA 2ETCA 4FLHA 4NURA 4IN3B 3RRMB 1BPOA 3S7JA 2XS1A 4L2YA 2VGXB 3FUEA 3SD5A 1KZOA 4OAUC 4GB9A 4GTMA 3E34A 2X6JA 1MQSA 2CHWA 4J6IA 2RKKA 4B8CB 4LRZA 1UW4B 3MYVA 3ASHA 4Y6WA 4YVQC 5B1BE 1BI8B 4V3IA 2H6FA 3TL5A 4U96D 3CSFA 2J49A 2QYJA 2P9KG 1HF8A 3C5RA 2XEEA 3DSWA 4F7AA 4JA7A 5EN5D 2DWZA 4WWNA 3PNTB 4IULA 4I9CA 2VJ8A 2E2EA 3QWVA 1IYGA 3DPDA 4GYOA 2PNNA 4LNUD 4JEHA 5FINA 4DUIA 3V2XA 4JA9A 1O1SA 5FIOA 3LJ3A 5KJMA 5ENQD 3EHRA 4YDEA 2C0MA 1MX6A 2XZTG 4JHKA 5D66A 3EHNA 3FH7A 3IEGA 4GU5A 3QDNA 3SI5A 4RSYA 2MRIA 4K5BA 3ABLE 1MX2A 4PS3A 2AJAA 2WXIA 4ILIA 3CHMA 4W9RA 3SHFA 1MZCA 3SFXA 3IKOB 3CHOA 3DEOA 5FQ6A 3TAXA 2VGYA 4GZDA 2L6BA 3O4ZA 3MKQA 2XPYA 5JHBA 4ANVA 4RG9A 1N95A 1V54E 2OOEA 3FTYA 1AWCB 1TNUA 4BEPA 2ZIRA 4CT0A 1N54A 5CEAA 4DX1A 4QFVA 2QY7A 2XGSA 4GA2A 3ONKA 1V55E 1NZNA 1Y8MA 4I6EA 2VGEA 2WQHA 3CVYA 2F8YA 2GROB 4IRUA 5KJNA 2WXKA 4J8SA 3PRZA 3UX4A 4GAAA 3AS5A 4FULA 3W9FA 4FJZA 2WMOA 2QYUA 4GPKA 2R59A 4ILGA 1E90A 1MJ0A 1B89A 4J8EA 1HH8A 3D9NA 2LO6A 4L2LA 2L0TB 4FHJA 4U8HA 4UWGA 5T4YA 2FO1E 3ZGQA 4DI4A 2LXMA 2X3MA 2RFAA 2BUGA 4GZCA 3Q7AA 3AG3E 4UUCA 2FULA 4KBQA 2BKGA 1FVFA 3FEXA 4P29A 3HYMB 4J8DA 2WQ6A 4HOQA 3ZHEB 1HS6A 5KJKA 2QC9A 4G11A 2IY0C 1FT1A 4AIFA 1NI1A 4AEZC 4G2VA 1UJKA 4ANWA 1UG3A 2EQXA 2ETBA 3CVQA 1SA5A 4I2WA 5EX3A 2I6HA 2OCCE 2ZGDA 3KS2A 3PVLA 4JC8A 4A3TA 2LNIA 3V31A 3IHYA 3PUKA 5AN8A 5G04J 3F6QA 4GCNA 3DEPA 3TWTA 1OCRE 3B7RL 2XCBA 3UM1A 2ILRA 3ZKJA 1TNBA 3PNLB 3TWUA 3SO8A 3LCAA 4HRLA 2WVIA 3EIJA 3PS6A 5G05C 4ACKA 2PQNA 4CEMA 3J5QB 2OVFA 3B7UX 2HYZA 4L23A 3RAUA 4N2SA 3T8MA 4I1MA 2WXHA 4G8KA 1TJFA 1SZAA 3L82A 4HLEA 5AQ9A 1OCOE 3MX3A 2EIJE 2GRLA 3ESLA 3Q4AB 4DX5D 3EIQC 5AYWD 2WXPA 4BT8A 3EJNA 3W9GA 4F6RD 4GZ5A 4X8QA 4ANUA 2AXVA 1ZU2A 4N3CA 5CBNA 3TXNA 5CRVA 2UY1B 3SFYA 4DK5A 2Y3AA 3FTVA 3HVEB 4TUUA 3MZLB 3FHEA 4NACA 3RO3A 4UI9C 3QKYA 3UT4A 4YDOA 2XCCA 2XGOA 5JHAA 1OWMA 3KD7A 3R9MA 3ZU7B 4DPRA 2CHZA 4N2QA 5HS0A 3FFLA 3KEAA 3QC1A 5CERB 3FH8A 1U3CA 3ZXSA 4PH4B 4JVSA 3EHQA 3L08A 2V5QC 3L54A 1IKND 1IHBA 4HB5A 2J8SD 3LY8A 1H2TC 3L22A 4EHMA 2C2LA 3UMVA 1WDYA 4UI9K 2CFUA 3U64A 4NQ0A 5FJYA 5BUZA 2LUHA 3HXBA 3UQ3A 4G26A 2XEVA 3Q7FA 3BEEA 1EPUA 4PS7A 2VQ2A 1N0QA 3FY4A 3VLFA 5FQ8A 5CMYA 4WWOA 3E37A 4MLPA 4XI9A 3UM0A 1Y6IA 2IFUA 1H0AA 4BT9A 1ZB1A 1E8ZA 3IHVA 4RLYA 1W3BA 4AVXA 1K1BA 3LVQE 3CK8A 4C0MA 3HXCA 4I17A 3CLJA 5FQ7A 1D8DA 2DIWA 4AJWA 3S7FA 5KBAA 2KCKA 3P2BA 3ZN3A 1OT8A 1QQEA 4BERA 2M63A 2J9QA 1E8YA 4F1PA 4GA0A 1SVXA 4CRWA 3S7BA 3PZ4A 3RRUA 2VYIA 2LAIA 2LSVA 5BW8C 4Y6CA 3RU0A 3UI2A 1A5EA 4UI9J 3SY2A 1HE8A 3QAQA 3Q5MA 4HBDA 3Q15A 3EUVA 3PDNA 3ZIMA 2BF0X 4U07A 2CG3A 4YNDA 5HI7A 3PH0C 4CGVA 3CV0A 1NA3A 1O5MA 4ZHBA 4N5CA 3FWVA 4AOFA 3D3MA 4J0UA 4KVOA 3NOCD 4J8YA 4ACLA 2YQ8A 3ABKE 4FHKA 4O1OA 4C48B 4HI9A 1O1TA 3V79K 2KZTB 2XENA 3BQOA 5AQAA 4BX9A 4N39A 3BG0B 4JEUA 4TRQA 3CKBA 4EPZA 3ZXPA 4DX2A 3FUMA 1FPPA 3FUKA 3JUIA 1VDYA 2F8XK 1N0RA 1IQRA 3I4RB 3QARA 5D0QD 3WG7E 1FVHA 4CT4A 2XPIA 1BD8A 3PZDA 3EDTB 3UKRG 3RKVA 3AS8A 3D9HA 2WQ7A 2KXPC 3FULA 2JLBA 3KSQA 3MKRA 1DCEA 2VSYA 3Q47B 1G3NB 3E4BA 4OVVA 4FJYA 4LNBA 4UQZA 4OAVB 2R03A 5CBOA 4B0ZA 5KWDA 1MHQA 3FUDA 1BU9A 2IOLA 3E32A 1JWGA 4ATGA 4URKA 4F1SA 2P9IG 3ABME 1DVPA 3UM3A 2XEHA 4KVMA 3DSVA 4DX6D 5AJDA 1H6OA 4HOTA 4A3VA 2CFZA 3B7BA 4DI3A 5DBKA 1QZ2A 1K8KG 4KZ0A 5AENA 5T3RA 1ZBPA 2DBAA 4ANXA 3LVRE 2NC9A 1UN8A 3HIZA 4RQIA 3CVVA 1PAQA 1JCRA 5E76A 3FDHA 3CVUA 1HXIA 1LD7A 4A1GA 1Z3YA 2P9PG 2HR2A 4B89A 2J08A 4GTVA 4AY5A 1TNOA 4UWKA 2WXFA 2XQ0A 4K0RA 2YNQA 2J09A 3FH5A 1LF8A 2NYJA 3PEUB 2NXPA 4XEIG 2HE0A 5CEDB 1FCHA 1YMPA 2IO3C 3IV0A 3UIPC 3DXKG 1JCQA 1N4PA 4CCAA 3PZ1A 4LUNU 4TXPA 1E7VA 2FF4A 2H6IA 2F0YA 3CEQA 3FU6A 2EILE 4TUMA 3OXLA 4G8LA 3QOUA
chains in the Genus database with same CATH topology
3W9FA 5JA4D 3D9HA 5AAOA 2DVWA 2KXPC 4ZFHA 5JMND 5ENQD 5HRYA 2Y1LE 3EHRA 5EIBE 3ZU7B 4ATZD 5HKPA 5HS0A 5ENTD 5ENOD 3UI2A 2B0OE 4HLLA 5ENSD 1A5EA 1MJ0A 4YDWA 5AQ7A 3TWQA 1G3NB 3V2OA 4HRMB 3ZKJA 2V4HC 2F37A 5BXOA 1BLXB 3KEAA 4DRXE 1MX6A 3JUEA 4B93B 4HBDA 5CBOA 5CERB 4OAVB 5KWDA 3TWSA 2XZTG 3TWUA 4YDYA 5D66A 2ETCA 3SO8A 1BU9A 2RFMA 1K1AA 3EHQA 3UTMA 4HRLA 4CYMD 4U95D 2V5QC 1S70B 2A5EA 3Q9UC 3J5QB 2DZNA 1IKND 1IHBA 4HB5A 1IXVA 5AQBA 2J8SD 1WG0A 5ENRD 4HNAD 4GMRA 4K5BA 2FO1E 2XEHA 5EYPF 4O60A 4DX6D 2JABA 1MX2A 2RFAA 5KNGA 3NOGD 4K5AB 4ZHBA 5ITZF 1AP7A 5EYLA 2AJAA 3AAAC 4J7WA 4UUCA 4BETA 4OAUC 2BKGA 1WDYA 4DX7D 2ETAA 4G8KA 3B7BA 3NOCD 4J8YA 5EIDA 3AJIA 3DEOA 4HRNA 5AQ9A 4BESA 3IXEA 1DC2A 1NFIE 3TWVA 5AARA 3UXGA 4O1OA 4C48B 4HI9A 3Q9NC 4CZ2D 1D9SA 4LG6A 2L6BA 4DX5D 4A63B 2QC9A 3V79K 3NBNB 4GPMA 1N0QA 2XZDG 3ZUVB 2P2CP 1YCSB 1BI8B 3TWWA 3B95A 3HG0D 3TWRA 3W9GA 1UOHA 4F6RD 2XENA 3T9KA 5BXUA 3V30A 4U96D 4NIKA 3T8KA 5AQAA 2MYOA 4LSZE 2Y0BG 1AWCB 4RLYA 1MX4A 1MYOA 1TR4A 4QQIA 1K1BA 2ETBA 5KNHD 4BEPA 2QYJA 3ZNGA 2KBXA 4HI8A 3LJNA 4JB8P 1DCQA 1BI7B 4K5CA 5CECB 3JXJA 3J5PA 4DX2A 3C5RA 5CEAA 2NYJA 2XEEA 4N5QA 4DX1A 2HE0A 3HRAA 4QFVA 5CEDB 1YMPA 2F8XK 1N0RA 4HQDA 2DZOA 1K3ZD 2ZGDA 5EN5D 1N11A 5KBAA 2DWZA 1OT8A 5CBNA 4BERA 4U8VD 2BKKB 1OY3D 3V31A 3EU9A 2VGEA 4F1PA 5ENPD 4Z68A 2F8YA 2ZGGA 1QYMA 3TWXA 1SVXA 4TUMA 5AN8A 2PNNA 1BD8A 3F6QA 4LNUD 5FINA 1SW6A 4G8LA 4DUIA 4BSZB 3JXIA 4U8YD 3DEPA 5EILA 3TWTA 3V2XA 4O1PA 5FIOA 1YYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W9F A;  5JA4 D;  3D9H A;  5AAO A;  2DVW A;  2KXP C;  4ZFH A;  5JMN D;  5ENQ D;  5HRY A;  2Y1L E;  3EHR A;  5EIB E;  3ZU7 B;  4ATZ D;  5HKP A;  5HS0 A;  5ENT D;  5ENO D;  3UI2 A;  2B0O E;  4HLL A;  5ENS D;  1A5E A;  1MJ0 A;  4YDW A;  5AQ7 A;  3TWQ A;  1G3N B;  3V2O A;  4HRM B;  3ZKJ A;  2V4H C;  2F37 A;  5BXO A;  1BLX B;  3KEA A;  4DRX E;  1MX6 A;  3JUE A;  4B93 B;  4HBD A;  5CBO A;  5CER B;  4OAV B;  5KWD A;  3TWS A;  2XZT G;  3TWU A;  4YDY A;  5D66 A;  2ETC A;  3SO8 A;  1BU9 A;  2RFM A;  1K1A A;  3EHQ A;  3UTM A;  4HRL A;  4CYM D;  4U95 D;  2V5Q C;  1S70 B;  2A5E A;  3Q9U C;  3J5Q B;  2DZN A;  1IKN D;  1IHB A;  4HB5 A;  1IXV A;  5AQB A;  2J8S D;  1WG0 A;  5ENR D;  4HNA D;  4GMR A;  4K5B A;  2FO1 E;  2XEH A;  5EYP F;  4O60 A;  4DX6 D;  2JAB A;  1MX2 A;  2RFA A;  5KNG A;  3NOG D;  4K5A B;  4ZHB A;  5ITZ F;  1AP7 A;  5EYL A;  2AJA A;  3AAA C;  4J7W A;  4UUC A;  4BET A;  4OAU C;  2BKG A;  1WDY A;  4DX7 D;  2ETA A;  4G8K A;  3B7B A;  3NOC D;  4J8Y A;  5EID A;  3AJI A;  3DEO A;  4HRN A;  5AQ9 A;  4BES A;  3IXE A;  1DC2 A;  1NFI E;  3TWV A;  5AAR A;  3UXG A;  4O1O A;  4C48 B;  4HI9 A;  3Q9N C;  4CZ2 D;  1D9S A;  4LG6 A;  2L6B A;  4DX5 D;  4A63 B;  2QC9 A;  3V79 K;  3NBN B;  4GPM A;  1N0Q A;  2XZD G;  3ZUV B;  2P2C P;  1YCS B;  1BI8 B;  3TWW A;  3B95 A;  3HG0 D;  3TWR A;  3W9G A;  1UOH A;  4F6R D;  2XEN A;  3T9K A;  5BXU A;  3V30 A;  4U96 D;  4NIK A;  3T8K A;  5AQA A;  2MYO A;  4LSZ E;  2Y0B G;  1AWC B;  4RLY A;  1MX4 A;  1MYO A;  1TR4 A;  4QQI A;  1K1B A;  2ETB A;  5KNH D;  4BEP A;  2QYJ A;  3ZNG A;  2KBX A;  4HI8 A;  3LJN A;  4JB8 P;  1DCQ A;  1BI7 B;  4K5C A;  5CEC B;  3JXJ A;  3J5P A;  4DX2 A;  3C5R A;  5CEA A;  2NYJ A;  2XEE A;  4N5Q A;  4DX1 A;  2HE0 A;  3HRA A;  4QFV A;  5CED B;  1YMP A;  2F8X K;  1N0R A;  4HQD A;  2DZO A;  1K3Z D;  2ZGD A;  5EN5 D;  1N11 A;  5KBA A;  2DWZ A;  1OT8 A;  5CBN A;  4BER A;  4U8V D;  2BKK B;  1OY3 D;  3V31 A;  3EU9 A;  2VGE A;  4F1P A;  5ENP D;  4Z68 A;  2F8Y A;  2ZGG A;  1QYM A;  3TWX A;  1SVX A;  4TUM A;  5AN8 A;  2PNN A;  1BD8 A;  3F6Q A;  4LNU D;  5FIN A;  1SW6 A;  4G8L A;  4DUI A;  4BSZ B;  3JXI A;  4U8Y D;  3DEP A;  5EIL A;  3TWT A;  3V2X A;  4O1P A;  5FIO A;  1YYH A; 
#chains in the Genus database with same CATH topology
 3CHR A;  4HVB A;  1WM5 A;  2XRY A;  3CK9 A;  3ULE G;  5HKP A;  2FI7 A;  3MKQ B;  1HX8 A;  2X6I A;  4UQX A;  5D2M C;  1S0P A;  3UTM A;  3ZYQ A;  4PS8 A;  3G2U A;  1IXV A;  1WG0 A;  2DYR E;  4I1A A;  5ENR D;  5EYP F;  2MOW A;  5KJL A;  1HO8 A;  3LDZ A;  1AP7 A;  3WXX A;  3Q49 B;  4D10 C;  3ASO E;  4K03 A;  1DC2 A;  3RJV A;  3DST A;  5FZR A;  4JZY A;  3ZPJ A;  4EZL A;  3R7R A;  4GA1 A;  4LNG A;  2KM4 A;  4JHR A;  5JJ6 A;  4HOR A;  3DSX A;  5BXU A;  3B7T A;  3T8K A;  4BX8 A;  3C3Q A;  5T8I A;  5KNH D;  3U66 A;  3RO2 A;  5G55 A;  1H6P A;  2OND A;  5CMW A;  4ILH B;  4I1O B;  2L9B A;  4GZ3 A;  4UQY A;  3CVL A;  1TEZ A;  1Z5S C;  4KMO A;  4GTR A;  2XHE A;  2WXM A;  4F53 A;  3PZ3 A;  5BV0 A;  4U8Y D;  1DNP A;  1YYH A;  3I5P A;  1HZ4 A;  3UT8 A;  3K9I A;  4ZFH A;  3AG4 E;  5HRY A;  1S64 A;  5EIB E;  4C0E A;  1OWP A;  2FO7 A;  4JHJ A;  2WXO A;  4AY6 A;  3TWQ A;  3D9L A;  4B93 B;  4HS2 A;  4JXT A;  3SQV A;  3AS4 A;  2XPZ A;  3JQ0 A;  4CYM D;  1KLX A;  3G2V A;  3DSS A;  3LY7 A;  3VTX A;  2DZN A;  3SBT B;  1EYH A;  4HNA D;  4R7L A;  2H6H A;  5LX8 A;  4PDX A;  4JW1 A;  3CR3 A;  3OTN A;  4WNG A;  3APF A;  1OWN A;  4OVU A;  4C9B B;  4DX7 D;  4HRN A;  1X5B A;  3LXU X;  5AAR A;  3LKU A;  3ML9 A;  4A63 B;  3PRE A;  4GPM A;  3TWW A;  3B95 A;  1TJC A;  2DYS E;  3CHQ A;  3OXG A;  3Q79 A;  2V0P A;  2R02 A;  3ZVV A;  2EIK E;  4K5C A;  3RSE G;  1ELW A;  3ML8 A;  2PM7 A;  3ASN E;  3QWW A;  2OV8 A;  3FTU A;  3QK0 A;  3DPY A;  3VLE A;  4BY6 A;  3TG5 A;  3C98 A;  3UKU G;  1UN9 A;  3FUN A;  3TWX A;  2GRQ B;  3L9T A;  3Q75 A;  1HU3 A;  2AVP A;  2DCP A;  3SGH A;  5JA4 D;  1GW6 A;  3G2W A;  3U4T A;  2ZIS A;  4GCO A;  5ENO D;  4Q94 A;  4GYW A;  5EX0 A;  4DRX E;  3CVW A;  3CHS A;  4L7T A;  1E8W A;  3MV3 B;  2V4L A;  4BWR A;  2IO2 C;  3FTS A;  5CCL A;  2OEV A;  3NB2 A;  3BG1 B;  5KNG A;  3HDX A;  1H2V C;  1NL4 A;  3SNX A;  2FEZ A;  3TG4 A;  3TXM A;  4M7C A;  2A5U A;  1HFA A;  5EID A;  1TYQ G;  3AJI A;  3R9A B;  3IXE A;  2WXN A;  2ION A;  3RIB A;  3U9W A;  4E6H A;  2PQR A;  5FZS A;  3NBN B;  4H7X A;  3OAW A;  3ZFW A;  3FTZ A;  3TWR A;  2PZI A;  3MEK A;  4Q96 A;  3UPV A;  5LFA A;  3CQC B;  4UWH A;  3RRN B;  1EDU A;  4N5Q A;  4EBA G;  3N71 A;  5IY5 E;  2J4D A;  4HOS A;  3UM2 A;  2GRM A;  4IYP A;  4KZC A;  1OCZ E;  2PL2 A;  5ENP D;  3QNK A;  4L1B A;  3CKC A;  1TNY A;  2H6G A;  1IHG A;  4G25 A;  2CG2 A;  2I2O A;  3O48 A;  2IF4 A;  2VGX A;  2V8S E;  4ATZ D;  4HLL A;  4U0S A;  4FAD A;  3GYZ A;  3EU5 A;  2FBN A;  4LER A;  3PE4 A;  2C0L A;  4XE0 A;  4TV3 A;  4FC8 A;  4MRU A;  2YHC A;  2AXZ A;  2AXU A;  4AM9 A;  3PE3 A;  5ENN A;  4AP2 A;  3I3N A;  3BUA A;  2AWI A;  4K5A B;  3S2A A;  3FTW A;  4U0Z A;  3ISM C;  4KYO B;  1N4S A;  5J90 A;  3SF4 A;  4U0U A;  2BED A;  2KAT A;  3ZYL A;  4YVO A;  2JEK A;  3RK6 A;  3FUF A;  2XZD G;  1TNZ A;  1IQU A;  4HOU A;  5DIZ A;  1RZ4 A;  1PY1 A;  3QWP A;  4FLB A;  2YHE A;  3QJZ A;  4LSZ E;  5C2Y A;  3FUH A;  2X6F A;  2X6K A;  1A17 A;  4JB8 P;  2R5S A;  3JXJ A;  3GZ2 A;  1ELK A;  3MCX A;  3UUX A;  4G24 A;  2X38 A;  2OVB A;  3JCK C;  4CDR A;  2VTB A;  4U63 A;  3HHM A;  2GRN B;  3R7Q A;  3ASG A;  2ZGG A;  4WAF A;  1YA0 A;  5BV1 A;  3JXI A;  2L6J A;  4CGW A;  5AAO A;  2DVW A;  4Q69 A;  4UWL A;  3APD A;  3DXM G;  4GYY A;  4O6F A;  2B0O E;  4M3O A;  5CRU A;  2V4H C;  5AIJ A;  3C72 A;  2LXL A;  1ELR A;  1TN8 A;  2RFM A;  2QZA A;  2Y4T A;  3VLD A;  2A4Z A;  2R17 C;  2P9N G;  4FU3 A;  4BSX A;  3MV2 B;  3AG1 E;  3C3O A;  3OXF A;  3KSL A;  4BES A;  5FQ4 A;  1NFI E;  3MJW A;  3NF1 A;  4GTO A;  1PC2 A;  4I6G A;  5JJ7 A;  5B1A E;  3KEZ A;  1YCS B;  5D0O D;  2KCL A;  4XKC A;  1UOH A;  5M72 A;  3UIO C;  3B13 A;  2Y0B G;  1MX4 A;  1MYO A;  3AU5 A;  1TR4 A;  4QQI A;  3ZHE A;  2KBX A;  3LJN A;  1KT1 A;  3ASF A;  3MA5 A;  5CEC B;  3G2T A;  1U2V G;  3LEW A;  2UY1 A;  1K3Z D;  3FU3 A;  2R05 A;  4E85 A;  3MGB A;  1NA0 A;  2VSO E;  4N3A A;  2V5F A;  1KZP A;  2IOS A;  4GMJ A;  1JUQ A;  4N3B A;  4ABN A;  2HM8 A;  3URZ A;  3LS8 A;  4XZ4 A;  4BSZ B;  2PM6 A;  4ME2 A;  5G05 J;  3ZYM A;  2WMN A;  4DLQ A;  3SZ7 A;  5JMN D;  5C1D A;  2P9S G;  4EEC A;  4MBG A;  1OWL A;  3FU5 A;  4WNE A;  3TJP A;  3PEV B;  3ESK A;  4RG6 A;  3D9I A;  1E7U A;  1K1A A;  1L5J A;  5AJL A;  4DLO A;  4TXQ A;  5ANL A;  3VTY A;  2J07 A;  2WB2 A;  4H7Y A;  2XS8 A;  4U04 A;  5HQ8 A;  4J7W A;  5EKQ D;  3AG2 E;  4WND A;  2R2L A;  3E33 A;  3GZ1 A;  3TWV A;  2AW6 A;  2WXG A;  1D9S A;  4LG6 A;  3FUI A;  3HXF A;  3ZUV B;  4GZ6 A;  3D9K A;  3E30 A;  3DRA A;  4A55 A;  3HG0 D;  3LPZ A;  2P9L G;  2MYO A;  3CVN A;  3NZU A;  2I1K A;  3ONL A;  2RD0 A;  4G23 A;  3NQP A;  4WWP A;  2MHK A;  3J5P A;  1OUV A;  3T5X A;  2WXQ A;  5BNW A;  1P5Q A;  3GW4 A;  4UWF A;  4A1S A;  4HFG A;  5G2N A;  1QNF A;  2WXR A;  1N94 A;  2X6H A;  1OY3 D;  5FWQ A;  1HG5 A;  3ZW3 A;  2IU1 A;  1Z3X A;  3I4G A;  2B6C A;  3CVX A;  3DSU A;  3L6A A;  3IBE A;  4TXR A;  3AU4 A;  2KZT A;  4MKT A;  4BTB A;  3CQG B;  3V2O A;  4HRM B;  2RG8 A;  4CDM A;  3P1U A;  5EDS A;  3TWS A;  2Q7F A;  4AV7 A;  1Z6T A;  4LEU A;  3ZYK A;  3FUJ A;  2IQC A;  1S70 B;  4XIF A;  3Q9U C;  5CCM A;  4B8A A;  4GMR A;  1FT2 A;  2LAH A;  1SQM A;  5ARG A;  4F3V A;  2WXJ A;  1N9A A;  2YIN A;  1JCS A;  4GML A;  2LSU A;  2P58 C;  2XRZ A;  2IJG X;  2P2C P;  1OWO A;  4HXI A;  1N4R A;  3JYS A;  1TN7 A;  4J8F A;  3BU8 A;  3ENE A;  1EF1 C;  3G2S A;  1DCQ A;  4G1T A;  5B3S E;  4GTS A;  2KC7 A;  3UT7 A;  5ANR A;  3PUJ A;  3CST A;  1H2U A;  4JD2 G;  3PZ2 A;  4I6J A;  4GTQ A;  3ZRH A;  4U7E B;  3NAW A;  5FTP A;  1N52 A;  2Y69 E;  2Y1L E;  4APO A;  4GTT A;  2J4B A;  1TN6 A;  5ENS D;  2I9C A;  4LCT A;  5LCW C;  5BXO A;  1E8X A;  3ULQ A;  4JL0 A;  5A7D B;  4I9E A;  3DBS A;  5KCM A;  2A5E A;  3ASD A;  2GRP B;  1H6K A;  1QBQ A;  4WNF A;  3U3W A;  1XGW A;  2QFC A;  2JAB A;  5A6C A;  2GW1 A;  3NOG D;  5ITZ F;  4MS6 A;  5EYL A;  5BT1 A;  3AAA C;  3FU0 A;  4BET A;  1HG2 A;  5A23 A;  1UJJ A;  3GZS A;  3Q9N C;  3FP3 A;  3CGH A;  1INZ A;  4WUY A;  2EIM E;  3EHM A;  4GTP A;  3SFZ A;  1U3D A;  3ZNG A;  4HI8 A;  1S63 A;  1BI7 B;  4B94 A;  1N4Q A;  1XNF A;  3HRA A;  5FT9 A;  2WM9 A;  2GGF A;  4HQD A;  2DZO A;  4I2Z A;  4BTA A;  1E96 B;  1OCC E;  1LD8 A;  4EZJ A;  3CK7 A;  4XKB A;  5BPP A;  4Z68 A;  3LY9 A;  1QYM A;  4CDN A;  4EZK A;  2HO1 A;  2GRR B;  1SW6 A;  1KT0 A;  3FEY A;  3HVE A;  4KXK B;  5EIL A;  2VSX E;  5G04 C;  2WXL A;  5E75 A;  2XGM A;  4EBA A;  5ENT D;  3Q78 A;  5AQ7 A;  1BLX B;  3JUE A;  3UIN C;  1NP7 A;  1JPL A;  4XX5 A;  3D9J A;  2VTB B;  4AXH A;  1SA4 A;  3D9O A;  4U95 D;  1KPS B;  2P9U G;  5AQB A;  4O60 A;  3KAE A;  1O1R A;  1H19 A;  3JQ1 A;  4XI0 A;  3QB2 A;  2WPV A;  2ETA A;  3CVP A;  4OYS A;  4FA6 A;  1D8E A;  2VSN A;  4JPS A;  4EQF A;  4KT6 B;  5CHE E;  3UXG A;  3ZEF A;  4CZ2 D;  4PUC A;  4APF A;  2E0I A;  2Y4U A;  3L17 A;  3T5V A;  3Q73 A;  3SBS A;  1RW2 A;  3HXD A;  3T9K A;  5LP0 A;  3V30 A;  4NIK A;  1WAO 1;  2ZXW E;  3ULY A;  3C3R A;  4DJA A;  5J08 A;  3LYA A;  2ZU6 B;  2OEW A;  2KCV A;  4L9P A;  3L13 A;  3D9P A;  5JJT A;  4NRH B;  2L0I A;  3S7D A;  1N11 A;  3FTX A;  2CHX A;  3X2Q E;  2NSZ A;  4RVB A;  3CHP A;  5LCW J;  1X81 A;  4U8V D;  5LOZ A;  2BKK B;  4BFR A;  3B7S A;  3EU9 A;  3D9M A;  2BTD A;  3HXE A;  4FP7 A;  4I43 A;  4O1P A;  5ARF A;  2EIN E;  3NZS A;  1OXJ A;  3TGO A;  2I1J A;  2UWJ G;  3L16 A;  3CIA A;  2IEJ A;  3DWL G;  4YDW A;  5H7P A;  1JWF A;  3APC A;  1SZ9 A;  2F37 A;  1LTX A;  1Q2Z A;  4YDY A;  1WY6 A;  5FZQ A;  2ETC A;  4FLH A;  4NUR A;  4IN3 B;  3RRM B;  1BPO A;  3S7J A;  2XS1 A;  4L2Y A;  2VGX B;  3FUE A;  3SD5 A;  1KZO A;  4OAU C;  4GB9 A;  4GTM A;  3E34 A;  2X6J A;  1MQS A;  2CHW A;  4J6I A;  2RKK A;  4B8C B;  4LRZ A;  1UW4 B;  3MYV A;  3ASH A;  4Y6W A;  4YVQ C;  5B1B E;  1BI8 B;  4V3I A;  2H6F A;  3TL5 A;  4U96 D;  3CSF A;  2J49 A;  2QYJ A;  2P9K G;  1HF8 A;  3C5R A;  2XEE A;  3DSW A;  4F7A A;  4JA7 A;  5EN5 D;  2DWZ A;  4WWN A;  3PNT B;  4IUL A;  4I9C A;  2VJ8 A;  2E2E A;  3QWV A;  1IYG A;  3DPD A;  4GYO A;  2PNN A;  4LNU D;  4JEH A;  5FIN A;  4DUI A;  3V2X A;  4JA9 A;  1O1S A;  5FIO A;  3LJ3 A;  5KJM A;  5ENQ D;  3EHR A;  4YDE A;  2C0M A;  1MX6 A;  2XZT G;  4JHK A;  5D66 A;  3EHN A;  3FH7 A;  3IEG A;  4GU5 A;  3QDN A;  3SI5 A;  4RSY A;  2MRI A;  4K5B A;  3ABL E;  1MX2 A;  4PS3 A;  2AJA A;  2WXI A;  4ILI A;  3CHM A;  4W9R A;  3SHF A;  1MZC A;  3SFX A;  3IKO B;  3CHO A;  3DEO A;  5FQ6 A;  3TAX A;  2VGY A;  4GZD A;  2L6B A;  3O4Z A;  3MKQ A;  2XPY A;  5JHB A;  4ANV A;  4RG9 A;  1N95 A;  1V54 E;  2OOE A;  3FTY A;  1AWC B;  1TNU A;  4BEP A;  2ZIR A;  4CT0 A;  1N54 A;  5CEA A;  4DX1 A;  4QFV A;  2QY7 A;  2XGS A;  4GA2 A;  3ONK A;  1V55 E;  1NZN A;  1Y8M A;  4I6E A;  2VGE A;  2WQH A;  3CVY A;  2F8Y A;  2GRO B;  4IRU A;  5KJN A;  2WXK A;  4J8S A;  3PRZ A;  3UX4 A;  4GAA A;  3AS5 A;  4FUL A;  3W9F A;  4FJZ A;  2WMO A;  2QYU A;  4GPK A;  2R59 A;  4ILG A;  1E90 A;  1MJ0 A;  1B89 A;  4J8E A;  1HH8 A;  3D9N A;  2LO6 A;  4L2L A;  2L0T B;  4FHJ A;  4U8H A;  4UWG A;  5T4Y A;  2FO1 E;  3ZGQ A;  4DI4 A;  2LXM A;  2X3M A;  2RFA A;  2BUG A;  4GZC A;  3Q7A A;  3AG3 E;  4UUC A;  2FUL A;  4KBQ A;  2BKG A;  1FVF A;  3FEX A;  4P29 A;  3HYM B;  4J8D A;  2WQ6 A;  4HOQ A;  3ZHE B;  1HS6 A;  5KJK A;  2QC9 A;  4G11 A;  2IY0 C;  1FT1 A;  4AIF A;  1NI1 A;  4AEZ C;  4G2V A;  1UJK A;  4ANW A;  1UG3 A;  2EQX A;  2ETB A;  3CVQ A;  1SA5 A;  4I2W A;  5EX3 A;  2I6H A;  2OCC E;  2ZGD A;  3KS2 A;  3PVL A;  4JC8 A;  4A3T A;  2LNI A;  3V31 A;  3IHY A;  3PUK A;  5AN8 A;  5G04 J;  3F6Q A;  4GCN A;  3DEP A;  3TWT A;  1OCR E;  3B7R L;  2XCB A;  3UM1 A;  2ILR A;  3ZKJ A;  1TNB A;  3PNL B;  3TWU A;  3SO8 A;  3LCA A;  4HRL A;  2WVI A;  3EIJ A;  3PS6 A;  5G05 C;  4ACK A;  2PQN A;  4CEM A;  3J5Q B;  2OVF A;  3B7U X;  2HYZ A;  4L23 A;  3RAU A;  4N2S A;  3T8M A;  4I1M A;  2WXH A;  4G8K A;  1TJF A;  1SZA A;  3L82 A;  4HLE A;  5AQ9 A;  1OCO E;  3MX3 A;  2EIJ E;  2GRL A;  3ESL A;  3Q4A B;  4DX5 D;  3EIQ C;  5AYW D;  2WXP A;  4BT8 A;  3EJN A;  3W9G A;  4F6R D;  4GZ5 A;  4X8Q A;  4ANU A;  2AXV A;  1ZU2 A;  4N3C A;  5CBN A;  3TXN A;  5CRV A;  2UY1 B;  3SFY A;  4DK5 A;  2Y3A A;  3FTV A;  3HVE B;  4TUU A;  3MZL B;  3FHE A;  4NAC A;  3RO3 A;  4UI9 C;  3QKY A;  3UT4 A;  4YDO A;  2XCC A;  2XGO A;  5JHA A;  1OWM A;  3KD7 A;  3R9M A;  3ZU7 B;  4DPR A;  2CHZ A;  4N2Q A;  5HS0 A;  3FFL A;  3KEA A;  3QC1 A;  5CER B;  3FH8 A;  1U3C A;  3ZXS A;  4PH4 B;  4JVS A;  3EHQ A;  3L08 A;  2V5Q C;  3L54 A;  1IKN D;  1IHB A;  4HB5 A;  2J8S D;  3LY8 A;  1H2T C;  3L22 A;  4EHM A;  2C2L A;  3UMV A;  1WDY A;  4UI9 K;  2CFU A;  3U64 A;  4NQ0 A;  5FJY A;  5BUZ A;  2LUH A;  3HXB A;  3UQ3 A;  4G26 A;  2XEV A;  3Q7F A;  3BEE A;  1EPU A;  4PS7 A;  2VQ2 A;  1N0Q A;  3FY4 A;  3VLF A;  5FQ8 A;  5CMY A;  4WWO A;  3E37 A;  4MLP A;  4XI9 A;  3UM0 A;  1Y6I A;  2IFU A;  1H0A A;  4BT9 A;  1ZB1 A;  1E8Z A;  3IHV A;  4RLY A;  1W3B A;  4AVX A;  1K1B A;  3LVQ E;  3CK8 A;  4C0M A;  3HXC A;  4I17 A;  3CLJ A;  5FQ7 A;  1D8D A;  2DIW A;  4AJW A;  3S7F A;  5KBA A;  2KCK A;  3P2B A;  3ZN3 A;  1OT8 A;  1QQE A;  4BER A;  2M63 A;  2J9Q A;  1E8Y A;  4F1P A;  4GA0 A;  1SVX A;  4CRW A;  3S7B A;  3PZ4 A;  3RRU A;  2VYI A;  2LAI A;  2LSV A;  5BW8 C;  4Y6C A;  3RU0 A;  3UI2 A;  1A5E A;  4UI9 J;  3SY2 A;  1HE8 A;  3QAQ A;  3Q5M A;  4HBD A;  3Q15 A;  3EUV A;  3PDN A;  3ZIM A;  2BF0 X;  4U07 A;  2CG3 A;  4YND A;  5HI7 A;  3PH0 C;  4CGV A;  3CV0 A;  1NA3 A;  1O5M A;  4ZHB A;  4N5C A;  3FWV A;  4AOF A;  3D3M A;  4J0U A;  4KVO A;  3NOC D;  4J8Y A;  4ACL A;  2YQ8 A;  3ABK E;  4FHK A;  4O1O A;  4C48 B;  4HI9 A;  1O1T A;  3V79 K;  2KZT B;  2XEN A;  3BQO A;  5AQA A;  4BX9 A;  4N39 A;  3BG0 B;  4JEU A;  4TRQ A;  3CKB A;  4EPZ A;  3ZXP A;  4DX2 A;  3FUM A;  1FPP A;  3FUK A;  3JUI A;  1VDY A;  2F8X K;  1N0R A;  1IQR A;  3I4R B;  3QAR A;  5D0Q D;  3WG7 E;  1FVH A;  4CT4 A;  2XPI A;  1BD8 A;  3PZD A;  3EDT B;  3UKR G;  3RKV A;  3AS8 A;  3D9H A;  2WQ7 A;  2KXP C;  3FUL A;  2JLB A;  3KSQ A;  3MKR A;  1DCE A;  2VSY A;  3Q47 B;  1G3N B;  3E4B A;  4OVV A;  4FJY A;  4LNB A;  4UQZ A;  4OAV B;  2R03 A;  5CBO A;  4B0Z A;  5KWD A;  1MHQ A;  3FUD A;  1BU9 A;  2IOL A;  3E32 A;  1JWG A;  4ATG A;  4URK A;  4F1S A;  2P9I G;  3ABM E;  1DVP A;  3UM3 A;  2XEH A;  4KVM A;  3DSV A;  4DX6 D;  5AJD A;  1H6O A;  4HOT A;  4A3V A;  2CFZ A;  3B7B A;  4DI3 A;  5DBK A;  1QZ2 A;  1K8K G;  4KZ0 A;  5AEN A;  5T3R A;  1ZBP A;  2DBA A;  4ANX A;  3LVR E;  2NC9 A;  1UN8 A;  3HIZ A;  4RQI A;  3CVV A;  1PAQ A;  1JCR A;  5E76 A;  3FDH A;  3CVU A;  1HXI A;  1LD7 A;  4A1G A;  1Z3Y A;  2P9P G;  2HR2 A;  4B89 A;  2J08 A;  4GTV A;  4AY5 A;  1TNO A;  4UWK A;  2WXF A;  2XQ0 A;  4K0R A;  2YNQ A;  2J09 A;  3FH5 A;  1LF8 A;  2NYJ A;  3PEU B;  2NXP A;  4XEI G;  2HE0 A;  5CED B;  1FCH A;  1YMP A;  2IO3 C;  3IV0 A;  3UIP C;  3DXK G;  1JCQ A;  1N4P A;  4CCA A;  3PZ1 A;  4LUN U;  4TXP A;  1E7V A;  2FF4 A;  2H6I A;  2F0Y A;  3CEQ A;  3FU6 A;  2EIL E;  4TUM A;  3OXL A;  4G8L A;  3QOU A; 
#chains in the Genus database with same CATH homology
 3W9F A;  5JA4 D;  3D9H A;  5AAO A;  2DVW A;  2KXP C;  4ZFH A;  5JMN D;  5ENQ D;  5HRY A;  2Y1L E;  3EHR A;  5EIB E;  3ZU7 B;  4ATZ D;  5HKP A;  5HS0 A;  5ENT D;  5ENO D;  3UI2 A;  2B0O E;  4HLL A;  5ENS D;  1A5E A;  1MJ0 A;  4YDW A;  5AQ7 A;  3TWQ A;  1G3N B;  3V2O A;  4HRM B;  3ZKJ A;  2V4H C;  2F37 A;  5BXO A;  1BLX B;  3KEA A;  4DRX E;  1MX6 A;  3JUE A;  4B93 B;  4HBD A;  5CBO A;  5CER B;  4OAV B;  5KWD A;  3TWS A;  2XZT G;  3TWU A;  4YDY A;  5D66 A;  2ETC A;  3SO8 A;  1BU9 A;  2RFM A;  1K1A A;  3EHQ A;  3UTM A;  4HRL A;  4CYM D;  4U95 D;  2V5Q C;  1S70 B;  2A5E A;  3Q9U C;  3J5Q B;  2DZN A;  1IKN D;  1IHB A;  4HB5 A;  1IXV A;  5AQB A;  2J8S D;  1WG0 A;  5ENR D;  4HNA D;  4GMR A;  4K5B A;  2FO1 E;  2XEH A;  5EYP F;  4O60 A;  4DX6 D;  2JAB A;  1MX2 A;  2RFA A;  5KNG A;  3NOG D;  4K5A B;  4ZHB A;  5ITZ F;  1AP7 A;  5EYL A;  2AJA A;  3AAA C;  4J7W A;  4UUC A;  4BET A;  4OAU C;  2BKG A;  1WDY A;  4DX7 D;  2ETA A;  4G8K A;  3B7B A;  3NOC D;  4J8Y A;  5EID A;  3AJI A;  3DEO A;  4HRN A;  5AQ9 A;  4BES A;  3IXE A;  1DC2 A;  1NFI E;  3TWV A;  5AAR A;  3UXG A;  4O1O A;  4C48 B;  4HI9 A;  3Q9N C;  4CZ2 D;  1D9S A;  4LG6 A;  2L6B A;  4DX5 D;  4A63 B;  2QC9 A;  3V79 K;  3NBN B;  4GPM A;  1N0Q A;  2XZD G;  3ZUV B;  2P2C P;  1YCS B;  1BI8 B;  3TWW A;  3B95 A;  3HG0 D;  3TWR A;  3W9G A;  1UOH A;  4F6R D;  2XEN A;  3T9K A;  5BXU A;  3V30 A;  4U96 D;  4NIK A;  3T8K A;  5AQA A;  2MYO A;  4LSZ E;  2Y0B G;  1AWC B;  4RLY A;  1MX4 A;  1MYO A;  1TR4 A;  4QQI A;  1K1B A;  2ETB A;  5KNH D;  4BEP A;  2QYJ A;  3ZNG A;  2KBX A;  4HI8 A;  3LJN A;  4JB8 P;  1DCQ A;  1BI7 B;  4K5C A;  5CEC B;  3JXJ A;  3J5P A;  4DX2 A;  3C5R A;  5CEA A;  2NYJ A;  2XEE A;  4N5Q A;  4DX1 A;  2HE0 A;  3HRA A;  4QFV A;  5CED B;  1YMP A;  2F8X K;  1N0R A;  4HQD A;  2DZO A;  1K3Z D;  2ZGD A;  5EN5 D;  1N11 A;  5KBA A;  2DWZ A;  1OT8 A;  5CBN A;  4BER A;  4U8V D;  2BKK B;  1OY3 D;  3V31 A;  3EU9 A;  2VGE A;  4F1P A;  5ENP D;  4Z68 A;  2F8Y A;  2ZGG A;  1QYM A;  3TWX A;  1SVX A;  4TUM A;  5AN8 A;  2PNN A;  1BD8 A;  3F6Q A;  4LNU D;  5FIN A;  1SW6 A;  4G8L A;  4DUI A;  4BSZ B;  3JXI A;  4U8Y D;  3DEP A;  5EIL A;  3TWT A;  3V2X A;  4O1P A;  5FIO A;  1YYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...