5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
4NIKA 5EYLA 2PNNA 4LSZE 5EIDA 4HRMB 4U95D 1AWCB 2Y1LE 3V79K 2L6BA 3NOGD 2BKKB 3J5QB 5HKPA 1K1BA 4HLLA 1YYHA 1D9SA 4CYMD 5BXOA 3Q9UC 2QC9A 5AQAA 1DCQA 1IKND 3HRAA 1IXVA 4DX5D 4BESA 4K5AB 1S70B 1A5EA 4F1PA 1BU9A 1DC2A 5CBNA 5KBAA 5FIOA 4Z68A 4F6RD 5EN5D 4A63B 3TWSA 3D9HA 4O60A 4O1PA 2XEHA 3T8KA 4C48B 1WDYA 3EHRA 4DX6D 1AP7A 4K5CA 3TWXA 1OY3D 3DEOA 4LNUD 2JABA 4DX2A 1K1AA 4DRXE 4DX7D 4OAUC 3UTMA 4DUIA 4HRNA 3ZNGA 2ETBA 4N5QA 3TWRA 3V30A 1MX6A 4YDYA 2BKGA 2XZTG 1BD8A 5KWDA 3JXIA 2MYOA 4UUCA 3TWVA 3V2XA 1WG0A 4HB5A 5CERB 2KXPC 2B0OE 5AQ7A 4G8KA 4LG6A 2RFAA 2ETCA 4QFVA 1BI8B 3Q9NC 1N0RA 2A5EA 5AAOA 3TWQA 4ZFHA 2NYJA 2KBXA 3UI2A 4YDWA 2DZNA 3NBNB 5BXUA 5CEAA 1N0QA 2HE0A 3B95A 5AQ9A 4GMRA 5KNGA 5ENOD 5AARA 3ZU7B 4ATZD 2F8XK 5AN8A 2P2CP 3HG0D 2F8YA 1UOHA 2XZDG 5JMND 1MJ0A 4DX1A 4O1OA 4HRLA 2DWZA 3EHQA 2ZGDA 5KNHD 2ETAA 1K3ZD 3IXEA 4OAVB 4K5BA 1N11A 4J7WA 4BETA 4HI9A 1SW6A 5AQBA 4BERA 5EYPF 3F6QA 2J8SD 3DEPA 4JB8P 3SO8A 5ENSD 4B93B 4BSZB 2F37A 5ITZF 3B7BA 3KEAA 4HNAD 4U8YD 1MX2A 1MX4A 3ZUVB 3V31A 4J8YA 4BEPA 5CEDB 2DZOA 3J5PA 5D66A 2XENA 1BI7B 5HS0A 3TWUA 3W9GA 3TWWA 1G3NB 5JA4D 1OT8A 3LJNA 2VGEA 3C5RA 4ZHBA 4HQDA 5CECB 3JXJA 2QYJA 5EILA 2XEEA 4G8LA 2RFMA 1NFIE 3W9FA 4QQIA 1MYOA 5EIBE 3EU9A 1QYMA 4U96D 2DVWA 4CZ2D 3AJIA 4RLYA 2AJAA 2V5QC 3TWTA 5CBOA 2Y0BG 5ENTD 5ENPD 3NOCD 1IHBA 2FO1E 5HRYA 3JUEA 3ZKJA 4U8VD 3AAAC 5ENRD 3UXGA 4HBDA 1BLXB 4TUMA 3T9KA 5FINA 4GPMA 1YCSB 1TR4A 4HI8A 1YMPA 5ENQD 2ZGGA 1SVXA 2V4HC 3V2OA
chains in the Genus database with same CATH superfamily
4ME2A 1E96B 2EILE 3FUMA 3K9IA 4GYWA 4HOUA 2VSYA 3LVRE 4PH4B 4MLPA 3GZ2A 2CFZA 3D9NA 3U66A 4U0SA 2EIJE 2MHKA 4PDXA 3CK8A 4DX6D 4GYOA 3EHNA 2ONDA 4DUIA 4GTQA 4APFA 1OCOE 3DSSA 3JCKC 2MYOA 4GZ3A 4UUCA 3ESLA 3V2XA 1ZB1A 4YVQC 3UIPC 1PAQA 4YDOA 2P2CP 4NURA 3UM2A 1N4SA 2DWZA 3S7BA 3EHQA 2ZGDA 1K3ZD 3X2QE 1TNUA 3IXEA 2GRMA 5ARFA 1S0PA 2DCPA 1MQSA 3UM1A 2OOEA 5ENSD 1Z3YA 4HNAD 4APOA 3CVVA 3LJNA 1L5JA 2VGEA 4CT0A 3QWWA 5EKQD 3FUFA 4LNBA 3RRUA 2WXPA 2Y0BG 2LUHA 2YQ8A 3U4TA 3CKCA 2ZGGA 3FDHA 3OAWA 3U3WA 5B1BE 1H2UA 2X6IA 5EYLA 3TXMA 4HRMB 3ML9A 2AWIA 1FVFA 2KATA 1DCQA 1OXJA 5EX3A 5KBAA 2KZTA 3PUJA 5HI7A 3SBSA 1TN8A 4I6EA 4UI9C 3HVEB 1ELKA 5FWQA 4FJYA 4OAUC 3DXKG 1A17A 3ZNGA 3UMVA 4G23A 2X38A 1N9AA 2F0YA 1N4QA 4LG6A 4B89A 4C9BB 3Q9NC 1HG5A 1OCZE 3HXCA 1Z6TA 3B95A 4XKCA 3C3RA 1HG2A 2YNQA 3MCXA 5JHBA 3B7SA 2KZTB 5JMND 1TYQG 2XGOA 1N95A 3CGHA 4O1OA 3FEYA 3IHVA 2C0MA 3HVEA 4J7WA 2UY1A 4BX8A 4JB8P 1SA4A 3KSLA 4U8YD 3KEAA 4FA6A 3PEUB 2XENA 4PS3A 3L16A 1E8YA 2J4BA 3JXJA 2QYJA 5A23A 5EILA 4I1AA 3DSVA 1TEZA 1KT0A 3AG4E 4BY6A 4JHRA 3E4BA 2XGSA 5ENTD 4CT4A 5HRYA 2P9UG 5ENRD 3UINC 1HO8A 1NZNA 4D10C 1SVXA 3CLJA 1DNPA 2HM8A 4B8AA 1PY1A 2V8SE 2L6BA 3UM3A 4JZYA 1YYHA 4CYMD 1QQEA 4DX5D 4BESA 1DC2A 2I1KA 4WWOA 2VGXA 4IYPA 4TUUA 2I6HA 3GZSA 4O1PA 5FT9A 5AIJA 3G2UA 3ABME 2WXQA 4YDYA 3QJZA 2XHEA 4URKA 2LXMA 2B0OE 5A7DB 1OWOA 4G8KA 3FTVA 4XI0A 3UI2A 1SQMA 3UT7A 3FP3A 4DX1A 3SFXA 1S64A 3LVQE 5JHAA 4XE0A 1U2VG 3CEQA 4LEUA 2OEVA 3LPZA 3TWWA 5JA4D 3DSXA 5G05J 1EPUA 5FZSA 2R5SA 4M7CA 3LEWA 2GRPB 4AXHA 2WQ6A 4JHJA 2GW1A 3Q73A 1FT2A 1VDYA 3L9TA 3CVYA 5C2YA 3EJNA 3SZ7A 1E8WA 3D9IA 3APFA 4AM9A 5G04C 2XCBA 4V3IA 5LX8A 3ZYMA 2ZXWE 5EN5D 4N39A 5LCWC 3QKYA 2J9QA 4JA7A 1UW4B 2ETBA 1H0AA 2IY0C 1N52A 1BD8A 2XZTG 4YNDA 3UT8A 3RO3A 3HHMA 4DPRA 2WB2A 2UY1B 4U63A 5G55A 1YA0A 4U7EB 2XPYA 1HE8A 2OV8A 1E8ZA 2ILRA 2E2EA 3L22A 4WAFA 2WXFA 5KNHD 4EZJA 1BPOA 5LCWJ 3GW4A 3QOUA 2P9NG 3C3QA 5AYWD 2QFCA 3B7BA 4LERA 4U0ZA 3T8MA 1H2TC 1TNZA 2DZOA 2AVPA 2P9PG 3CHOA 3VLEA 2PZIA 3AG2E 3C5RA 3TAXA 3P1UA 1JPLA 2OEWA 3BQOA 3MZLB 3LY8A 3AJIA 2V5QC 3MKQB 2OCCE 5ENPD 4H7XA 3UPVA 3UXGA 4C0MA 2PQRA 3ZYKA 3PRZA 1TNOA 2CHXA 2KM4A 5DIZA 1AWCB 3AU5A 3V79K 2C0LA 1D8EA 2LSUA 2UWJG 4J8EA 1WAO1 4G25A 2LNIA 4C48B 1WDYA 3ML8A 3TWXA 3CVUA 4GU5A 4KZ0A 3CVNA 1MHQA 5JJ6A 5BV0A 3EU5A 1OCRE 2H6FA 2R03A 2XEVA 2A5UA 4GA0A 2RFAA 2A5EA 3QWPA 2IF4A 2QY7A 4CDRA 1Z3XA 3C72A 2X6KA 5E76A 1N4PA 1LTXA 4N2QA 3G2WA 2P9IG 3NAWA 4BSZB 4WWPA 5LFAA 2X6FA 3FUHA 4I2WA 1E7UA 2LAHA 4WWNA 2IO2C 5JJ7A 4A1GA 3AS5A 4GZCA 1NFIE 4AEZC 2HYZA 2Q7FA 4A1SA 2DBAA 4AVXA 4BT9A 3T9KA 1YCSB 5ENQD 1YMPA 5BNWA 2IEJA 2QYUA 3N71A 3RK6A 2J09A 5HKPA 1ELWA 5BXOA 1NA0A 5AQAA 3HRAA 3SFYA 4LNGA 1JWGA 4EPZA 4GTVA 4O60A 1AP7A 3P2BA 4DRXE 4CDMA 5BPPA 3FU0A 1UN9A 5FJYA 5BT1A 1X81A 4WNDA 3DSWA 1BI8B 1NA3A 4ZFHA 2KBXA 3PH0C 4XIFA 2CFUA 3OTNA 3FUKA 5AN8A 3PNLB 1HZ4A 2WXMA 4HRLA 2EIME 4GB9A 3DSUA 2KCKA 3URZA 1N11A 2ZU6B 4FLHA 1SW6A 4CRWA 1HF8A 1MZCA 1D8DA 4ANUA 5KCMA 4GA2A 3UKRG 1NP7A 2IQCA 3D9OA 3CVLA 3NZUA 4G11A 3U9WA 3NB2A 3KEZA 2NSZA 3Q49B 4BT8A 3BG0B 3FH7A 3RJVA 1E7VA 3LJ3A 4QQIA 3AS8A 4WNFA 2P9KG 3EIJA 3AG1E 2AJAA 5CBOA 4I43A 2WXIA 2NC9A 5J90A 3DPYA 1ELRA 3FEXA 1OCCE 2JLBA 2HO1A 3C98A 1E8XA 2VSXE 2YINA 4ANXA 5HQ8A 2BKKB 2WPVA 2WVIA 3CVPA 1O1SA 2YHEA 3JYSA 4F6RD 4A63B 3FTUA 2H6HA 5KJLA 3SFZA 4HVBA 4LNUD 4DX7D 4O6FA 3LCAA 1MX6A 3RSEG 2LXLA 4DJAA 3NF1A 3CIAA 3E37A 2ZISA 4HB5A 3TG5A 3Q79A 3FUDA 2WXGA 2GRRB 5CEAA 5AARA 5ENOD 2BF0X 3ZU7B 4J8FA 4Y6WA 4MBGA 2VGXB 4GCOA 4WUYA 3O4ZA 4FC8A 4HI9A 2X6HA 5AQBA 3LYAA 3SO8A 2HR2A 3MKRA 3ZUVB 4R7LA 2I2OA 4ATGA 2J07A 3HXBA 4Q94A 3OXLA 3ZFWA 5D0QD 3DRAA 5CMWA 3ZXPA 3D9LA 3IBEA 4J0UA 3SI5A 2E0IA 3VLDA 5D2MC 5EIBE 2DVWA 2GRQB 2IU1A 2FO1E 2J49A 3S7FA 4HBDA 4GYYA 3QB2A 2WQHA 1IQUA 2IFUA 4AIFA 1LF8A 3D9MA 1O5MA 4GMJA 1K1BA 3LY9A 4JXTA 4J8SA 3ABLE 3QDNA 1BU9A 4G26A 4GCNA 3SNXA 1SZ9A 4XX5A 3ESKA 2JABA 4B8CB 2WXLA 4XI9A 1XGWA 4HOQA 1U3CA 5M72A 5CERB 4I1OB 3FTXA 3AS4A 3IEGA 4FULA 3ISMC 1SZAA 2F8XK 4ATZD 4JPSA 2F8YA 1NL4A 4BTBA 3I5PA 3G2SA 2RKKA 4EBAG 3RO2A 3PZ4A 4M3OA 4L1BA 2FI7A 1SA5A 4Q69A 2ZIRA 3ASHA 1FT1A 5A6CA 3ONKA 2PL2A 4L2YA 3KS2A 2DYRE 1JWFA 4NACA 2NXPA 3OXGA 5H7PA 3Q15A 1H2VC 4JA9A 4G24A 5D0OD 4ILGA 2FULA 3FTYA 4CDNA 1IHGA 5LOZA 4CZ2D 4JD2G 3CSFA 2AW6A 3ASOE 4H7YA 4RQIA 1PC2A 3E33A 2OVFA 3SQVA 4HLEA 5FQ7A 4L2LA 1ZU2A 4K0RA 4CGVA 1JCSA 4I2ZA 5FZRA 3T5VA 1KT1A 2VQ2A 2PM6A 3ZN3A 2IO3C 3G2TA 3UIOC 1ZBPA 2IOLA 3G2VA 1WG0A 2I1JA 2EINE 2CG2A 5T8IA 2KCVA 3NBNB 3BUAA 5BXUA 4DLOA 3HIZA 4GPKA 3UM0A 1UOHA 1K8KG 3RIBA 3AU4A 3NQPA 4DI3A 5KJMA 1MX4A 1O1TA 3APCA 3CHRA 3ZIMA 3B7UX 2FO7A 5HS0A 3D9KA 1INZA 4A3TA 4TXQA 4RG6A 3VLFA 2GRNB 3KD7A 4UWLA 5CECB 4TV3A 4JEHA 1KZOA 3Q5MA 1MYOA 4JEUA 4U96D 5KJKA 4ILHB 4KYOB 3PS6A 1WM5A 3D3MA 3C3OA 4CEMA 2VJ8A 4EBAA 4HORA 3FU5A 2P58C 4U0UA 4K03A 3V31A 2VGYA 3ULEG 4NQ0A 3SF4A 4FJZA 2WXNA 1NI1A 4MRUA 3ASFA 3VTXA 4HLLA 2QC9A 3I3NA 3ULQA 1IXVA 2VTBA 4MKTA 3SD5A 3RRMB 4MS6A 4FHJA 3BU8A 5BV1A 4N2SA 1K1AA 4I6GA 3UTMA 4XZ4A 4GMLA 3GZ1A 3TWRA 2BKGA 3MJWA 4CCAA 1DCEA 2DIWA 3FUNA 4OVUA 4KBQA 2L0TB 1UJJA 1E90A 3ZVVA 1GW6A 1Z5SC 4HS2A 2IJGX 1TJCA 5AQ9A 4P29A 2XZDG 3LS8A 1HXIA 5FTPA 5B1AE 3PREA 3D9JA 4BERA 3DEPA 3ZGQA 1EF1C 2VSNA 5DBKA 3FH5A 4BEPA 1H6OA 1HFAA 3TWUA 4F53A 3FH8A 2R05A 2Y3AA 2V0PA 4GTOA 2WQ7A 3PNTB 3U64A 4HOTA 3TWTA 3NOCD 1Q2ZA 3RRNB 4X8QA 4RVBA 3QC1A 2J4DA 3CHQA 2M63A 2Y69E 1IYGA 4ILIA 4IULA 3SHFA 1UN8A 3EDTB 5FQ6A 1HX8A 3KAEA 3OXFA 3BEEA 1JCQA 4N3BA 2XGMA 1JUQA 2LAIA 1KZPA 3CVWA 2KC7A 3B7RL 3ZPJA 1N94A 3L08A 3CR3A 4HRNA 4ACKA 4N5QA 4TRQA 2XRZA 2AXUA 3S2AA 3HXFA 4DI4A 4KVOA 1OWPA 5CCMA 3MA5A 3RAUA 2IONA 4B0ZA 3ZYQA 2AXVA 4PS7A 4A55A 4XEIG 2Y4TA 3FTWA 1Y6IA 3R7RA 5ARGA 5BW8C 2XPZA 2H6IA 3F6QA 1TJFA 3L13A 3MV3B 4UWHA 2F37A 3DPDA 3TGOA 4BTAA 3PDNA 3PVLA 3S7JA 3MX3A 3ASGA 4KZCA 3HYMB 3UQ3A 3I4RB 3CHSA 3FWVA 4UQXA 2B6CA 4UWFA 2XCCA 5FZQA 3R9AB 1RZ4A 2EIKE 4GTSA 3DWLG 4E85A 3ZKJA 1UJKA 4U8VD 3ZEFA 2P9LG 4BSXA 5FINA 3CK9A 3FTZA 4HFGA 1U3DA 3QAQA 3LDZA 2VSOE 4U07A 3UUXA 2PQNA 5CRUA 4K5AB 3GYZA 1KLXA 2GROB 3EHRA 4Y6CA 1JCRA 1P5QA 4K5CA 1OY3D 5LP0A 1HU3A 3NZSA 3L54A 3RU0A 3V30A 3CQGB 4G1TA 3IKOB 4UWGA 3Q7AA 3KSQA 3MYVA 5AQ7A 1S63A 3PUKA 4PS8A 2NYJA 5ENNA 4YDWA 4J6IA 5BUZA 2HE0A 5CMYA 1RW2A 2WMOA 1DVPA 4KMOA 2QZAA 4GTPA 2KCLA 3DXMG 2BUGA 2LO6A 5EYPF 4EHMA 2YHCA 4OYSA 1O1RA 5CCLA 3PE4A 1LD8A 5JJTA 2FBNA 2WM9A 3JQ0A 3WG7E 4XKBA 4IN3B 1QBQA 2XEEA 3W9FA 4KT6B 2RD0A 5AJLA 1N54A 4EZKA 1UG3A 2P9SG 3EUVA 4TUMA 4HI8A 3ZXSA 3V2OA 4AJWA 2WXKA 4LRZA 4U95D 1HS6A 3NOGD 3EIQC 2RG8A 4GTTA 2AXZA 3CK7A 3ASDA 1A5EA 1QZ2A 3SGHA 4Z68A 4PUCA 3APDA 3HXEA 3UX4A 4EZLA 3R9MA 4GTMA 4DX2A 4JC8A 4AOFA 4JW1A 4AY6A 5KJNA 2R02A 3ZYLA 3TWVA 1N0RA 2X6JA 1FPPA 1B89A 4F7AA 3ZRHA 3D9PA 4L23A 2OVBA 2CG3A 4ACLA 4AV7A 5EDSA 4K5BA 1TN7A 3DBSA 1OWLA 4U8HA 4E6HA 1IQRA 5FQ4A 1V54E 2XPIA 2WXJA 5CHEE 3PZDA 2V4LA 4L7TA 2J08A 2DYSE 3ABKE 4N3AA 4G8LA 4CGWA 2VYIA 4FU3A 3CSTA 4RLYA 4KXKB 4GZ6A 1TN6A 4EECA 4WNEA 1BLXB 3L82A 3QWVA 4GPMA 4AP2A 2I9CA 3DSTA 4RG9A 2CHWA 3Q78A 3UT4A 2PNNA 5EIDA 3ULYA 1D9SA 3Q9UC 2XS1A 3MEKA 4J8DA 4GTRA 3QNKA 4ANWA 3BG1B 1H6PA 4ABNA 2R59A 3PEVB 5G2NA 2MRIA 4GZDA 4KVMA 3TXNA 4JHKA 1XNFA 2XQ0A 3L17A 4QFVA 3ZHEA 2XRYA 2L9BA 1V55E 2X3MA 3TL5A 2LSVA 3CHMA 1H19A 4I9CA 5ANLA 4LCTA 4F3VA 1OWMA 4B93B 3AG3E 1FVHA 1X5BA 3Q75A 1MX2A 1QNFA 4IRUA 4UI9K 5CEDB 2A4ZA 3J5PA 5D66A 1BI7B 5ANRA 3WXXA 1FCHA 1G3NB 3E30A 1OT8A 1KPSB 4LUNU 3FUIA 3LY7A 4DLQA 2WMNA 3Q7FA 1EDUA 4UWKA 1IHBA 3FUEA 2L0IA 2EQXA 2L6JA 2MOWA 4L9PA 3FUJA 4NIKA 3MKQA 5C1DA 3HXDA 2Y1LE 3J5QB 1IKND 5CBNA 4GZ5A 2PM7A 3T8KA 3SBTB 4NRHB 1TNBA 2JEKA 3FTSA 5EX0A 3VTYA 2GRLA 2IOSA 5KWDA 4FHKA 2GGFA 4ANVA 5T4YA 4HXIA 4I17A 3PZ2A 3TWQA 1N4RA 5AENA 1N0QA 5KNGA 4GMRA 3ONLA 4I6JA 2FEZA 3HG0D 3JUIA 4I1MA 2WXRA 4C0EA 2Y4UA 3JQ1A 3ZW3A 2V5FA 4JVSA 2J8SD 1TNYA 4YVOA 5ITZF 3IHYA 3R7QA 2WXOA 2XS8A 4EQFA 4J8YA 3E32A 3QARA 3CHPA 4BWRA 3SY2A 3T5XA 4G2VA 4AY5A 3EU9A 1QYMA 4WNGA 3JUEA 3ENEA 4BX9A 3S7DA 3PZ3A 1TR4A 4N3CA 1HH8A 2VTBB 4W9RA 3TJPA 4LSZE 5E75A 3QK0A 2H6GA 5IY5E 3FU3A 5T3RA 3I4GA 1S70B 2BEDA 2R17C 4F1PA 4HOSA 4TXRA 5FIOA 5G04J 5FQ8A 4GAAA 4BFRA 3LXUX 4OVVA 3TWSA 3D9HA 1Y8MA 2XEHA 5CRVA 3DEOA 4YDEA 3ZHEB 3LKUA 4A3VA 3B13A 4JL0A 3CKBA 3HDXA 3MGBA 2WXHA 4FLBA 3JXIA 1OWNA 4I9EA 2KXPC 2ETCA 1W3BA 1LD7A 3FULA 5G05C 3CVQA 2DZNA 3CVXA 4Q96A 4UI9J 4FADA 4N5CA 3FU6A 1MJ0A 3ASNE 4TXPA 4DK5A 2CHZA 3Q4AB 3IV0A 2ETAA 4OAVB 4BETA 3FY4A 2R2LA 3L6AA 3PE3A 4U04A 2FF4A 5J08A 3FFLA 5B3SE 3TG4A 3O48A 1EYHA 3PZ1A 4UQZA 3W9GA 3B7TA 3EHMA 3RKVA 4FP7A 3CQCB 4ZHBA 4UQYA 3Q47B 4HQDA 4B94A 1H6KA 2RFMA 4GA1A 4RSYA 3E34A 3CV0A 3MV2B 3AAAC 2BTDA 3FHEA 1OUVA 4F1SA 1WY6A 2C2LA 3UKUG 5AJDA 5AAOA 2V4HC
chains in the Genus database with same CATH topology
4NIKA 5EYLA 2PNNA 4LSZE 5EIDA 4HRMB 4U95D 1AWCB 2Y1LE 3V79K 2L6BA 3NOGD 2BKKB 3J5QB 5HKPA 1K1BA 4HLLA 1YYHA 1D9SA 4CYMD 5BXOA 3Q9UC 2QC9A 5AQAA 1DCQA 1IKND 3HRAA 1IXVA 4DX5D 4BESA 4K5AB 1S70B 1A5EA 4F1PA 1BU9A 1DC2A 5CBNA 5KBAA 5FIOA 4Z68A 4F6RD 5EN5D 4A63B 3TWSA 3D9HA 4O60A 4O1PA 2XEHA 3T8KA 4C48B 1WDYA 3EHRA 4DX6D 1AP7A 4K5CA 3TWXA 1OY3D 3DEOA 4LNUD 2JABA 4DX2A 1K1AA 4DRXE 4DX7D 4OAUC 3UTMA 4DUIA 4HRNA 3ZNGA 2ETBA 4N5QA 3TWRA 3V30A 1MX6A 4YDYA 2BKGA 2XZTG 1BD8A 5KWDA 3JXIA 2MYOA 4UUCA 3TWVA 3V2XA 1WG0A 4HB5A 5CERB 2KXPC 2B0OE 5AQ7A 4G8KA 4LG6A 2RFAA 2ETCA 4QFVA 1BI8B 3Q9NC 1N0RA 2A5EA 5AAOA 3TWQA 4ZFHA 2NYJA 2KBXA 3UI2A 4YDWA 2DZNA 3NBNB 5BXUA 5CEAA 1N0QA 2HE0A 3B95A 5AQ9A 4GMRA 5KNGA 5ENOD 5AARA 3ZU7B 4ATZD 2F8XK 5AN8A 2P2CP 3HG0D 2F8YA 1UOHA 2XZDG 5JMND 1MJ0A 4DX1A 4O1OA 4HRLA 2DWZA 3EHQA 2ZGDA 5KNHD 2ETAA 1K3ZD 3IXEA 4OAVB 4K5BA 1N11A 4J7WA 4BETA 4HI9A 1SW6A 5AQBA 4BERA 5EYPF 3F6QA 2J8SD 3DEPA 4JB8P 3SO8A 5ENSD 4B93B 4BSZB 2F37A 5ITZF 3B7BA 3KEAA 4HNAD 4U8YD 1MX2A 1MX4A 3ZUVB 3V31A 4J8YA 4BEPA 5CEDB 2DZOA 3J5PA 5D66A 2XENA 1BI7B 5HS0A 3TWUA 3W9GA 3TWWA 1G3NB 5JA4D 1OT8A 3LJNA 2VGEA 3C5RA 4ZHBA 4HQDA 5CECB 3JXJA 2QYJA 5EILA 2XEEA 4G8LA 2RFMA 1NFIE 3W9FA 4QQIA 1MYOA 5EIBE 3EU9A 1QYMA 4U96D 2DVWA 4CZ2D 3AJIA 4RLYA 2AJAA 2V5QC 3TWTA 5CBOA 2Y0BG 5ENTD 5ENPD 3NOCD 1IHBA 2FO1E 5HRYA 3JUEA 3ZKJA 4U8VD 3AAAC 5ENRD 3UXGA 4HBDA 1BLXB 4TUMA 3T9KA 5FINA 4GPMA 1YCSB 1TR4A 4HI8A 1YMPA 5ENQD 2ZGGA 1SVXA 2V4HC 3V2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NIK A;  5EYL A;  2PNN A;  4LSZ E;  5EID A;  4HRM B;  4U95 D;  1AWC B;  2Y1L E;  3V79 K;  2L6B A;  3NOG D;  2BKK B;  3J5Q B;  5HKP A;  1K1B A;  4HLL A;  1YYH A;  1D9S A;  4CYM D;  5BXO A;  3Q9U C;  2QC9 A;  5AQA A;  1DCQ A;  1IKN D;  3HRA A;  1IXV A;  4DX5 D;  4BES A;  4K5A B;  1S70 B;  1A5E A;  4F1P A;  1BU9 A;  1DC2 A;  5CBN A;  5KBA A;  5FIO A;  4Z68 A;  4F6R D;  5EN5 D;  4A63 B;  3TWS A;  3D9H A;  4O60 A;  4O1P A;  2XEH A;  3T8K A;  4C48 B;  1WDY A;  3EHR A;  4DX6 D;  1AP7 A;  4K5C A;  3TWX A;  1OY3 D;  3DEO A;  4LNU D;  2JAB A;  4DX2 A;  1K1A A;  4DRX E;  4DX7 D;  4OAU C;  3UTM A;  4DUI A;  4HRN A;  3ZNG A;  2ETB A;  4N5Q A;  3TWR A;  3V30 A;  1MX6 A;  4YDY A;  2BKG A;  2XZT G;  1BD8 A;  5KWD A;  3JXI A;  2MYO A;  4UUC A;  3TWV A;  3V2X A;  1WG0 A;  4HB5 A;  5CER B;  2KXP C;  2B0O E;  5AQ7 A;  4G8K A;  4LG6 A;  2RFA A;  2ETC A;  4QFV A;  1BI8 B;  3Q9N C;  1N0R A;  2A5E A;  5AAO A;  3TWQ A;  4ZFH A;  2NYJ A;  2KBX A;  3UI2 A;  4YDW A;  2DZN A;  3NBN B;  5BXU A;  5CEA A;  1N0Q A;  2HE0 A;  3B95 A;  5AQ9 A;  4GMR A;  5KNG A;  5ENO D;  5AAR A;  3ZU7 B;  4ATZ D;  2F8X K;  5AN8 A;  2P2C P;  3HG0 D;  2F8Y A;  1UOH A;  2XZD G;  5JMN D;  1MJ0 A;  4DX1 A;  4O1O A;  4HRL A;  2DWZ A;  3EHQ A;  2ZGD A;  5KNH D;  2ETA A;  1K3Z D;  3IXE A;  4OAV B;  4K5B A;  1N11 A;  4J7W A;  4BET A;  4HI9 A;  1SW6 A;  5AQB A;  4BER A;  5EYP F;  3F6Q A;  2J8S D;  3DEP A;  4JB8 P;  3SO8 A;  5ENS D;  4B93 B;  4BSZ B;  2F37 A;  5ITZ F;  3B7B A;  3KEA A;  4HNA D;  4U8Y D;  1MX2 A;  1MX4 A;  3ZUV B;  3V31 A;  4J8Y A;  4BEP A;  5CED B;  2DZO A;  3J5P A;  5D66 A;  2XEN A;  1BI7 B;  5HS0 A;  3TWU A;  3W9G A;  3TWW A;  1G3N B;  5JA4 D;  1OT8 A;  3LJN A;  2VGE A;  3C5R A;  4ZHB A;  4HQD A;  5CEC B;  3JXJ A;  2QYJ A;  5EIL A;  2XEE A;  4G8L A;  2RFM A;  1NFI E;  3W9F A;  4QQI A;  1MYO A;  5EIB E;  3EU9 A;  1QYM A;  4U96 D;  2DVW A;  4CZ2 D;  3AJI A;  4RLY A;  2AJA A;  2V5Q C;  3TWT A;  5CBO A;  2Y0B G;  5ENT D;  5ENP D;  3NOC D;  1IHB A;  2FO1 E;  5HRY A;  3JUE A;  3ZKJ A;  4U8V D;  3AAA C;  5ENR D;  3UXG A;  4HBD A;  1BLX B;  4TUM A;  3T9K A;  5FIN A;  4GPM A;  1YCS B;  1TR4 A;  4HI8 A;  1YMP A;  5ENQ D;  2ZGG A;  1SVX A;  2V4H C;  3V2O A; 
#chains in the Genus database with same CATH topology
 4ME2 A;  1E96 B;  2EIL E;  3FUM A;  3K9I A;  4GYW A;  4HOU A;  2VSY A;  3LVR E;  4PH4 B;  4MLP A;  3GZ2 A;  2CFZ A;  3D9N A;  3U66 A;  4U0S A;  2EIJ E;  2MHK A;  4PDX A;  3CK8 A;  4DX6 D;  4GYO A;  3EHN A;  2OND A;  4DUI A;  4GTQ A;  4APF A;  1OCO E;  3DSS A;  3JCK C;  2MYO A;  4GZ3 A;  4UUC A;  3ESL A;  3V2X A;  1ZB1 A;  4YVQ C;  3UIP C;  1PAQ A;  4YDO A;  2P2C P;  4NUR A;  3UM2 A;  1N4S A;  2DWZ A;  3S7B A;  3EHQ A;  2ZGD A;  1K3Z D;  3X2Q E;  1TNU A;  3IXE A;  2GRM A;  5ARF A;  1S0P A;  2DCP A;  1MQS A;  3UM1 A;  2OOE A;  5ENS D;  1Z3Y A;  4HNA D;  4APO A;  3CVV A;  3LJN A;  1L5J A;  2VGE A;  4CT0 A;  3QWW A;  5EKQ D;  3FUF A;  4LNB A;  3RRU A;  2WXP A;  2Y0B G;  2LUH A;  2YQ8 A;  3U4T A;  3CKC A;  2ZGG A;  3FDH A;  3OAW A;  3U3W A;  5B1B E;  1H2U A;  2X6I A;  5EYL A;  3TXM A;  4HRM B;  3ML9 A;  2AWI A;  1FVF A;  2KAT A;  1DCQ A;  1OXJ A;  5EX3 A;  5KBA A;  2KZT A;  3PUJ A;  5HI7 A;  3SBS A;  1TN8 A;  4I6E A;  4UI9 C;  3HVE B;  1ELK A;  5FWQ A;  4FJY A;  4OAU C;  3DXK G;  1A17 A;  3ZNG A;  3UMV A;  4G23 A;  2X38 A;  1N9A A;  2F0Y A;  1N4Q A;  4LG6 A;  4B89 A;  4C9B B;  3Q9N C;  1HG5 A;  1OCZ E;  3HXC A;  1Z6T A;  3B95 A;  4XKC A;  3C3R A;  1HG2 A;  2YNQ A;  3MCX A;  5JHB A;  3B7S A;  2KZT B;  5JMN D;  1TYQ G;  2XGO A;  1N95 A;  3CGH A;  4O1O A;  3FEY A;  3IHV A;  2C0M A;  3HVE A;  4J7W A;  2UY1 A;  4BX8 A;  4JB8 P;  1SA4 A;  3KSL A;  4U8Y D;  3KEA A;  4FA6 A;  3PEU B;  2XEN A;  4PS3 A;  3L16 A;  1E8Y A;  2J4B A;  3JXJ A;  2QYJ A;  5A23 A;  5EIL A;  4I1A A;  3DSV A;  1TEZ A;  1KT0 A;  3AG4 E;  4BY6 A;  4JHR A;  3E4B A;  2XGS A;  5ENT D;  4CT4 A;  5HRY A;  2P9U G;  5ENR D;  3UIN C;  1HO8 A;  1NZN A;  4D10 C;  1SVX A;  3CLJ A;  1DNP A;  2HM8 A;  4B8A A;  1PY1 A;  2V8S E;  2L6B A;  3UM3 A;  4JZY A;  1YYH A;  4CYM D;  1QQE A;  4DX5 D;  4BES A;  1DC2 A;  2I1K A;  4WWO A;  2VGX A;  4IYP A;  4TUU A;  2I6H A;  3GZS A;  4O1P A;  5FT9 A;  5AIJ A;  3G2U A;  3ABM E;  2WXQ A;  4YDY A;  3QJZ A;  2XHE A;  4URK A;  2LXM A;  2B0O E;  5A7D B;  1OWO A;  4G8K A;  3FTV A;  4XI0 A;  3UI2 A;  1SQM A;  3UT7 A;  3FP3 A;  4DX1 A;  3SFX A;  1S64 A;  3LVQ E;  5JHA A;  4XE0 A;  1U2V G;  3CEQ A;  4LEU A;  2OEV A;  3LPZ A;  3TWW A;  5JA4 D;  3DSX A;  5G05 J;  1EPU A;  5FZS A;  2R5S A;  4M7C A;  3LEW A;  2GRP B;  4AXH A;  2WQ6 A;  4JHJ A;  2GW1 A;  3Q73 A;  1FT2 A;  1VDY A;  3L9T A;  3CVY A;  5C2Y A;  3EJN A;  3SZ7 A;  1E8W A;  3D9I A;  3APF A;  4AM9 A;  5G04 C;  2XCB A;  4V3I A;  5LX8 A;  3ZYM A;  2ZXW E;  5EN5 D;  4N39 A;  5LCW C;  3QKY A;  2J9Q A;  4JA7 A;  1UW4 B;  2ETB A;  1H0A A;  2IY0 C;  1N52 A;  1BD8 A;  2XZT G;  4YND A;  3UT8 A;  3RO3 A;  3HHM A;  4DPR A;  2WB2 A;  2UY1 B;  4U63 A;  5G55 A;  1YA0 A;  4U7E B;  2XPY A;  1HE8 A;  2OV8 A;  1E8Z A;  2ILR A;  2E2E A;  3L22 A;  4WAF A;  2WXF A;  5KNH D;  4EZJ A;  1BPO A;  5LCW J;  3GW4 A;  3QOU A;  2P9N G;  3C3Q A;  5AYW D;  2QFC A;  3B7B A;  4LER A;  4U0Z A;  3T8M A;  1H2T C;  1TNZ A;  2DZO A;  2AVP A;  2P9P G;  3CHO A;  3VLE A;  2PZI A;  3AG2 E;  3C5R A;  3TAX A;  3P1U A;  1JPL A;  2OEW A;  3BQO A;  3MZL B;  3LY8 A;  3AJI A;  2V5Q C;  3MKQ B;  2OCC E;  5ENP D;  4H7X A;  3UPV A;  3UXG A;  4C0M A;  2PQR A;  3ZYK A;  3PRZ A;  1TNO A;  2CHX A;  2KM4 A;  5DIZ A;  1AWC B;  3AU5 A;  3V79 K;  2C0L A;  1D8E A;  2LSU A;  2UWJ G;  4J8E A;  1WAO 1;  4G25 A;  2LNI A;  4C48 B;  1WDY A;  3ML8 A;  3TWX A;  3CVU A;  4GU5 A;  4KZ0 A;  3CVN A;  1MHQ A;  5JJ6 A;  5BV0 A;  3EU5 A;  1OCR E;  2H6F A;  2R03 A;  2XEV A;  2A5U A;  4GA0 A;  2RFA A;  2A5E A;  3QWP A;  2IF4 A;  2QY7 A;  4CDR A;  1Z3X A;  3C72 A;  2X6K A;  5E76 A;  1N4P A;  1LTX A;  4N2Q A;  3G2W A;  2P9I G;  3NAW A;  4BSZ B;  4WWP A;  5LFA A;  2X6F A;  3FUH A;  4I2W A;  1E7U A;  2LAH A;  4WWN A;  2IO2 C;  5JJ7 A;  4A1G A;  3AS5 A;  4GZC A;  1NFI E;  4AEZ C;  2HYZ A;  2Q7F A;  4A1S A;  2DBA A;  4AVX A;  4BT9 A;  3T9K A;  1YCS B;  5ENQ D;  1YMP A;  5BNW A;  2IEJ A;  2QYU A;  3N71 A;  3RK6 A;  2J09 A;  5HKP A;  1ELW A;  5BXO A;  1NA0 A;  5AQA A;  3HRA A;  3SFY A;  4LNG A;  1JWG A;  4EPZ A;  4GTV A;  4O60 A;  1AP7 A;  3P2B A;  4DRX E;  4CDM A;  5BPP A;  3FU0 A;  1UN9 A;  5FJY A;  5BT1 A;  1X81 A;  4WND A;  3DSW A;  1BI8 B;  1NA3 A;  4ZFH A;  2KBX A;  3PH0 C;  4XIF A;  2CFU A;  3OTN A;  3FUK A;  5AN8 A;  3PNL B;  1HZ4 A;  2WXM A;  4HRL A;  2EIM E;  4GB9 A;  3DSU A;  2KCK A;  3URZ A;  1N11 A;  2ZU6 B;  4FLH A;  1SW6 A;  4CRW A;  1HF8 A;  1MZC A;  1D8D A;  4ANU A;  5KCM A;  4GA2 A;  3UKR G;  1NP7 A;  2IQC A;  3D9O A;  3CVL A;  3NZU A;  4G11 A;  3U9W A;  3NB2 A;  3KEZ A;  2NSZ A;  3Q49 B;  4BT8 A;  3BG0 B;  3FH7 A;  3RJV A;  1E7V A;  3LJ3 A;  4QQI A;  3AS8 A;  4WNF A;  2P9K G;  3EIJ A;  3AG1 E;  2AJA A;  5CBO A;  4I43 A;  2WXI A;  2NC9 A;  5J90 A;  3DPY A;  1ELR A;  3FEX A;  1OCC E;  2JLB A;  2HO1 A;  3C98 A;  1E8X A;  2VSX E;  2YIN A;  4ANX A;  5HQ8 A;  2BKK B;  2WPV A;  2WVI A;  3CVP A;  1O1S A;  2YHE A;  3JYS A;  4F6R D;  4A63 B;  3FTU A;  2H6H A;  5KJL A;  3SFZ A;  4HVB A;  4LNU D;  4DX7 D;  4O6F A;  3LCA A;  1MX6 A;  3RSE G;  2LXL A;  4DJA A;  3NF1 A;  3CIA A;  3E37 A;  2ZIS A;  4HB5 A;  3TG5 A;  3Q79 A;  3FUD A;  2WXG A;  2GRR B;  5CEA A;  5AAR A;  5ENO D;  2BF0 X;  3ZU7 B;  4J8F A;  4Y6W A;  4MBG A;  2VGX B;  4GCO A;  4WUY A;  3O4Z A;  4FC8 A;  4HI9 A;  2X6H A;  5AQB A;  3LYA A;  3SO8 A;  2HR2 A;  3MKR A;  3ZUV B;  4R7L A;  2I2O A;  4ATG A;  2J07 A;  3HXB A;  4Q94 A;  3OXL A;  3ZFW A;  5D0Q D;  3DRA A;  5CMW A;  3ZXP A;  3D9L A;  3IBE A;  4J0U A;  3SI5 A;  2E0I A;  3VLD A;  5D2M C;  5EIB E;  2DVW A;  2GRQ B;  2IU1 A;  2FO1 E;  2J49 A;  3S7F A;  4HBD A;  4GYY A;  3QB2 A;  2WQH A;  1IQU A;  2IFU A;  4AIF A;  1LF8 A;  3D9M A;  1O5M A;  4GMJ A;  1K1B A;  3LY9 A;  4JXT A;  4J8S A;  3ABL E;  3QDN A;  1BU9 A;  4G26 A;  4GCN A;  3SNX A;  1SZ9 A;  4XX5 A;  3ESK A;  2JAB A;  4B8C B;  2WXL A;  4XI9 A;  1XGW A;  4HOQ A;  1U3C A;  5M72 A;  5CER B;  4I1O B;  3FTX A;  3AS4 A;  3IEG A;  4FUL A;  3ISM C;  1SZA A;  2F8X K;  4ATZ D;  4JPS A;  2F8Y A;  1NL4 A;  4BTB A;  3I5P A;  3G2S A;  2RKK A;  4EBA G;  3RO2 A;  3PZ4 A;  4M3O A;  4L1B A;  2FI7 A;  1SA5 A;  4Q69 A;  2ZIR A;  3ASH A;  1FT1 A;  5A6C A;  3ONK A;  2PL2 A;  4L2Y A;  3KS2 A;  2DYR E;  1JWF A;  4NAC A;  2NXP A;  3OXG A;  5H7P A;  3Q15 A;  1H2V C;  4JA9 A;  4G24 A;  5D0O D;  4ILG A;  2FUL A;  3FTY A;  4CDN A;  1IHG A;  5LOZ A;  4CZ2 D;  4JD2 G;  3CSF A;  2AW6 A;  3ASO E;  4H7Y A;  4RQI A;  1PC2 A;  3E33 A;  2OVF A;  3SQV A;  4HLE A;  5FQ7 A;  4L2L A;  1ZU2 A;  4K0R A;  4CGV A;  1JCS A;  4I2Z A;  5FZR A;  3T5V A;  1KT1 A;  2VQ2 A;  2PM6 A;  3ZN3 A;  2IO3 C;  3G2T A;  3UIO C;  1ZBP A;  2IOL A;  3G2V A;  1WG0 A;  2I1J A;  2EIN E;  2CG2 A;  5T8I A;  2KCV A;  3NBN B;  3BUA A;  5BXU A;  4DLO A;  3HIZ A;  4GPK A;  3UM0 A;  1UOH A;  1K8K G;  3RIB A;  3AU4 A;  3NQP A;  4DI3 A;  5KJM A;  1MX4 A;  1O1T A;  3APC A;  3CHR A;  3ZIM A;  3B7U X;  2FO7 A;  5HS0 A;  3D9K A;  1INZ A;  4A3T A;  4TXQ A;  4RG6 A;  3VLF A;  2GRN B;  3KD7 A;  4UWL A;  5CEC B;  4TV3 A;  4JEH A;  1KZO A;  3Q5M A;  1MYO A;  4JEU A;  4U96 D;  5KJK A;  4ILH B;  4KYO B;  3PS6 A;  1WM5 A;  3D3M A;  3C3O A;  4CEM A;  2VJ8 A;  4EBA A;  4HOR A;  3FU5 A;  2P58 C;  4U0U A;  4K03 A;  3V31 A;  2VGY A;  3ULE G;  4NQ0 A;  3SF4 A;  4FJZ A;  2WXN A;  1NI1 A;  4MRU A;  3ASF A;  3VTX A;  4HLL A;  2QC9 A;  3I3N A;  3ULQ A;  1IXV A;  2VTB A;  4MKT A;  3SD5 A;  3RRM B;  4MS6 A;  4FHJ A;  3BU8 A;  5BV1 A;  4N2S A;  1K1A A;  4I6G A;  3UTM A;  4XZ4 A;  4GML A;  3GZ1 A;  3TWR A;  2BKG A;  3MJW A;  4CCA A;  1DCE A;  2DIW A;  3FUN A;  4OVU A;  4KBQ A;  2L0T B;  1UJJ A;  1E90 A;  3ZVV A;  1GW6 A;  1Z5S C;  4HS2 A;  2IJG X;  1TJC A;  5AQ9 A;  4P29 A;  2XZD G;  3LS8 A;  1HXI A;  5FTP A;  5B1A E;  3PRE A;  3D9J A;  4BER A;  3DEP A;  3ZGQ A;  1EF1 C;  2VSN A;  5DBK A;  3FH5 A;  4BEP A;  1H6O A;  1HFA A;  3TWU A;  4F53 A;  3FH8 A;  2R05 A;  2Y3A A;  2V0P A;  4GTO A;  2WQ7 A;  3PNT B;  3U64 A;  4HOT A;  3TWT A;  3NOC D;  1Q2Z A;  3RRN B;  4X8Q A;  4RVB A;  3QC1 A;  2J4D A;  3CHQ A;  2M63 A;  2Y69 E;  1IYG A;  4ILI A;  4IUL A;  3SHF A;  1UN8 A;  3EDT B;  5FQ6 A;  1HX8 A;  3KAE A;  3OXF A;  3BEE A;  1JCQ A;  4N3B A;  2XGM A;  1JUQ A;  2LAI A;  1KZP A;  3CVW A;  2KC7 A;  3B7R L;  3ZPJ A;  1N94 A;  3L08 A;  3CR3 A;  4HRN A;  4ACK A;  4N5Q A;  4TRQ A;  2XRZ A;  2AXU A;  3S2A A;  3HXF A;  4DI4 A;  4KVO A;  1OWP A;  5CCM A;  3MA5 A;  3RAU A;  2ION A;  4B0Z A;  3ZYQ A;  2AXV A;  4PS7 A;  4A55 A;  4XEI G;  2Y4T A;  3FTW A;  1Y6I A;  3R7R A;  5ARG A;  5BW8 C;  2XPZ A;  2H6I A;  3F6Q A;  1TJF A;  3L13 A;  3MV3 B;  4UWH A;  2F37 A;  3DPD A;  3TGO A;  4BTA A;  3PDN A;  3PVL A;  3S7J A;  3MX3 A;  3ASG A;  4KZC A;  3HYM B;  3UQ3 A;  3I4R B;  3CHS A;  3FWV A;  4UQX A;  2B6C A;  4UWF A;  2XCC A;  5FZQ A;  3R9A B;  1RZ4 A;  2EIK E;  4GTS A;  3DWL G;  4E85 A;  3ZKJ A;  1UJK A;  4U8V D;  3ZEF A;  2P9L G;  4BSX A;  5FIN A;  3CK9 A;  3FTZ A;  4HFG A;  1U3D A;  3QAQ A;  3LDZ A;  2VSO E;  4U07 A;  3UUX A;  2PQN A;  5CRU A;  4K5A B;  3GYZ A;  1KLX A;  2GRO B;  3EHR A;  4Y6C A;  1JCR A;  1P5Q A;  4K5C A;  1OY3 D;  5LP0 A;  1HU3 A;  3NZS A;  3L54 A;  3RU0 A;  3V30 A;  3CQG B;  4G1T A;  3IKO B;  4UWG A;  3Q7A A;  3KSQ A;  3MYV A;  5AQ7 A;  1S63 A;  3PUK A;  4PS8 A;  2NYJ A;  5ENN A;  4YDW A;  4J6I A;  5BUZ A;  2HE0 A;  5CMY A;  1RW2 A;  2WMO A;  1DVP A;  4KMO A;  2QZA A;  4GTP A;  2KCL A;  3DXM G;  2BUG A;  2LO6 A;  5EYP F;  4EHM A;  2YHC A;  4OYS A;  1O1R A;  5CCL A;  3PE4 A;  1LD8 A;  5JJT A;  2FBN A;  2WM9 A;  3JQ0 A;  3WG7 E;  4XKB A;  4IN3 B;  1QBQ A;  2XEE A;  3W9F A;  4KT6 B;  2RD0 A;  5AJL A;  1N54 A;  4EZK A;  1UG3 A;  2P9S G;  3EUV A;  4TUM A;  4HI8 A;  3ZXS A;  3V2O A;  4AJW A;  2WXK A;  4LRZ A;  4U95 D;  1HS6 A;  3NOG D;  3EIQ C;  2RG8 A;  4GTT A;  2AXZ A;  3CK7 A;  3ASD A;  1A5E A;  1QZ2 A;  3SGH A;  4Z68 A;  4PUC A;  3APD A;  3HXE A;  3UX4 A;  4EZL A;  3R9M A;  4GTM A;  4DX2 A;  4JC8 A;  4AOF A;  4JW1 A;  4AY6 A;  5KJN A;  2R02 A;  3ZYL A;  3TWV A;  1N0R A;  2X6J A;  1FPP A;  1B89 A;  4F7A A;  3ZRH A;  3D9P A;  4L23 A;  2OVB A;  2CG3 A;  4ACL A;  4AV7 A;  5EDS A;  4K5B A;  1TN7 A;  3DBS A;  1OWL A;  4U8H A;  4E6H A;  1IQR A;  5FQ4 A;  1V54 E;  2XPI A;  2WXJ A;  5CHE E;  3PZD A;  2V4L A;  4L7T A;  2J08 A;  2DYS E;  3ABK E;  4N3A A;  4G8L A;  4CGW A;  2VYI A;  4FU3 A;  3CST A;  4RLY A;  4KXK B;  4GZ6 A;  1TN6 A;  4EEC A;  4WNE A;  1BLX B;  3L82 A;  3QWV A;  4GPM A;  4AP2 A;  2I9C A;  3DST A;  4RG9 A;  2CHW A;  3Q78 A;  3UT4 A;  2PNN A;  5EID A;  3ULY A;  1D9S A;  3Q9U C;  2XS1 A;  3MEK A;  4J8D A;  4GTR A;  3QNK A;  4ANW A;  3BG1 B;  1H6P A;  4ABN A;  2R59 A;  3PEV B;  5G2N A;  2MRI A;  4GZD A;  4KVM A;  3TXN A;  4JHK A;  1XNF A;  2XQ0 A;  3L17 A;  4QFV A;  3ZHE A;  2XRY A;  2L9B A;  1V55 E;  2X3M A;  3TL5 A;  2LSV A;  3CHM A;  1H19 A;  4I9C A;  5ANL A;  4LCT A;  4F3V A;  1OWM A;  4B93 B;  3AG3 E;  1FVH A;  1X5B A;  3Q75 A;  1MX2 A;  1QNF A;  4IRU A;  4UI9 K;  5CED B;  2A4Z A;  3J5P A;  5D66 A;  1BI7 B;  5ANR A;  3WXX A;  1FCH A;  1G3N B;  3E30 A;  1OT8 A;  1KPS B;  4LUN U;  3FUI A;  3LY7 A;  4DLQ A;  2WMN A;  3Q7F A;  1EDU A;  4UWK A;  1IHB A;  3FUE A;  2L0I A;  2EQX A;  2L6J A;  2MOW A;  4L9P A;  3FUJ A;  4NIK A;  3MKQ A;  5C1D A;  3HXD A;  2Y1L E;  3J5Q B;  1IKN D;  5CBN A;  4GZ5 A;  2PM7 A;  3T8K A;  3SBT B;  4NRH B;  1TNB A;  2JEK A;  3FTS A;  5EX0 A;  3VTY A;  2GRL A;  2IOS A;  5KWD A;  4FHK A;  2GGF A;  4ANV A;  5T4Y A;  4HXI A;  4I17 A;  3PZ2 A;  3TWQ A;  1N4R A;  5AEN A;  1N0Q A;  5KNG A;  4GMR A;  3ONL A;  4I6J A;  2FEZ A;  3HG0 D;  3JUI A;  4I1M A;  2WXR A;  4C0E A;  2Y4U A;  3JQ1 A;  3ZW3 A;  2V5F A;  4JVS A;  2J8S D;  1TNY A;  4YVO A;  5ITZ F;  3IHY A;  3R7Q A;  2WXO A;  2XS8 A;  4EQF A;  4J8Y A;  3E32 A;  3QAR A;  3CHP A;  4BWR A;  3SY2 A;  3T5X A;  4G2V A;  4AY5 A;  3EU9 A;  1QYM A;  4WNG A;  3JUE A;  3ENE A;  4BX9 A;  3S7D A;  3PZ3 A;  1TR4 A;  4N3C A;  1HH8 A;  2VTB B;  4W9R A;  3TJP A;  4LSZ E;  5E75 A;  3QK0 A;  2H6G A;  5IY5 E;  3FU3 A;  5T3R A;  3I4G A;  1S70 B;  2BED A;  2R17 C;  4F1P A;  4HOS A;  4TXR A;  5FIO A;  5G04 J;  5FQ8 A;  4GAA A;  4BFR A;  3LXU X;  4OVV A;  3TWS A;  3D9H A;  1Y8M A;  2XEH A;  5CRV A;  3DEO A;  4YDE A;  3ZHE B;  3LKU A;  4A3V A;  3B13 A;  4JL0 A;  3CKB A;  3HDX A;  3MGB A;  2WXH A;  4FLB A;  3JXI A;  1OWN A;  4I9E A;  2KXP C;  2ETC A;  1W3B A;  1LD7 A;  3FUL A;  5G05 C;  3CVQ A;  2DZN A;  3CVX A;  4Q96 A;  4UI9 J;  4FAD A;  4N5C A;  3FU6 A;  1MJ0 A;  3ASN E;  4TXP A;  4DK5 A;  2CHZ A;  3Q4A B;  3IV0 A;  2ETA A;  4OAV B;  4BET A;  3FY4 A;  2R2L A;  3L6A A;  3PE3 A;  4U04 A;  2FF4 A;  5J08 A;  3FFL A;  5B3S E;  3TG4 A;  3O48 A;  1EYH A;  3PZ1 A;  4UQZ A;  3W9G A;  3B7T A;  3EHM A;  3RKV A;  4FP7 A;  3CQC B;  4ZHB A;  4UQY A;  3Q47 B;  4HQD A;  4B94 A;  1H6K A;  2RFM A;  4GA1 A;  4RSY A;  3E34 A;  3CV0 A;  3MV2 B;  3AAA C;  2BTD A;  3FHE A;  1OUV A;  4F1S A;  1WY6 A;  2C2L A;  3UKU G;  5AJD A;  5AAO A;  2V4H C; 
#chains in the Genus database with same CATH homology
 4NIK A;  5EYL A;  2PNN A;  4LSZ E;  5EID A;  4HRM B;  4U95 D;  1AWC B;  2Y1L E;  3V79 K;  2L6B A;  3NOG D;  2BKK B;  3J5Q B;  5HKP A;  1K1B A;  4HLL A;  1YYH A;  1D9S A;  4CYM D;  5BXO A;  3Q9U C;  2QC9 A;  5AQA A;  1DCQ A;  1IKN D;  3HRA A;  1IXV A;  4DX5 D;  4BES A;  4K5A B;  1S70 B;  1A5E A;  4F1P A;  1BU9 A;  1DC2 A;  5CBN A;  5KBA A;  5FIO A;  4Z68 A;  4F6R D;  5EN5 D;  4A63 B;  3TWS A;  3D9H A;  4O60 A;  4O1P A;  2XEH A;  3T8K A;  4C48 B;  1WDY A;  3EHR A;  4DX6 D;  1AP7 A;  4K5C A;  3TWX A;  1OY3 D;  3DEO A;  4LNU D;  2JAB A;  4DX2 A;  1K1A A;  4DRX E;  4DX7 D;  4OAU C;  3UTM A;  4DUI A;  4HRN A;  3ZNG A;  2ETB A;  4N5Q A;  3TWR A;  3V30 A;  1MX6 A;  4YDY A;  2BKG A;  2XZT G;  1BD8 A;  5KWD A;  3JXI A;  2MYO A;  4UUC A;  3TWV A;  3V2X A;  1WG0 A;  4HB5 A;  5CER B;  2KXP C;  2B0O E;  5AQ7 A;  4G8K A;  4LG6 A;  2RFA A;  2ETC A;  4QFV A;  1BI8 B;  3Q9N C;  1N0R A;  2A5E A;  5AAO A;  3TWQ A;  4ZFH A;  2NYJ A;  2KBX A;  3UI2 A;  4YDW A;  2DZN A;  3NBN B;  5BXU A;  5CEA A;  1N0Q A;  2HE0 A;  3B95 A;  5AQ9 A;  4GMR A;  5KNG A;  5ENO D;  5AAR A;  3ZU7 B;  4ATZ D;  2F8X K;  5AN8 A;  2P2C P;  3HG0 D;  2F8Y A;  1UOH A;  2XZD G;  5JMN D;  1MJ0 A;  4DX1 A;  4O1O A;  4HRL A;  2DWZ A;  3EHQ A;  2ZGD A;  5KNH D;  2ETA A;  1K3Z D;  3IXE A;  4OAV B;  4K5B A;  1N11 A;  4J7W A;  4BET A;  4HI9 A;  1SW6 A;  5AQB A;  4BER A;  5EYP F;  3F6Q A;  2J8S D;  3DEP A;  4JB8 P;  3SO8 A;  5ENS D;  4B93 B;  4BSZ B;  2F37 A;  5ITZ F;  3B7B A;  3KEA A;  4HNA D;  4U8Y D;  1MX2 A;  1MX4 A;  3ZUV B;  3V31 A;  4J8Y A;  4BEP A;  5CED B;  2DZO A;  3J5P A;  5D66 A;  2XEN A;  1BI7 B;  5HS0 A;  3TWU A;  3W9G A;  3TWW A;  1G3N B;  5JA4 D;  1OT8 A;  3LJN A;  2VGE A;  3C5R A;  4ZHB A;  4HQD A;  5CEC B;  3JXJ A;  2QYJ A;  5EIL A;  2XEE A;  4G8L A;  2RFM A;  1NFI E;  3W9F A;  4QQI A;  1MYO A;  5EIB E;  3EU9 A;  1QYM A;  4U96 D;  2DVW A;  4CZ2 D;  3AJI A;  4RLY A;  2AJA A;  2V5Q C;  3TWT A;  5CBO A;  2Y0B G;  5ENT D;  5ENP D;  3NOC D;  1IHB A;  2FO1 E;  5HRY A;  3JUE A;  3ZKJ A;  4U8V D;  3AAA C;  5ENR D;  3UXG A;  4HBD A;  1BLX B;  4TUM A;  3T9K A;  5FIN A;  4GPM A;  1YCS B;  1TR4 A;  4HI8 A;  1YMP A;  5ENQ D;  2ZGG A;  1SVX A;  2V4H C;  3V2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...