5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
3AAAC 2MYOA 5CECB 3V30A 1AP7A 5FINA 4C48B 3V2XA 3TWTA 1WDYA 3ZNGA 1MX4A 2ETBA 4U8YD 4N5QA 3J5PA 1BD8A 3TWSA 2DZOA 4JB8P 5EYPF 2VGEA 3V31A 3C5RA 4HNAD 4DX2A 4O1OA 4YDYA 5KWDA 1YYHA 1UOHA 4CZ2D 1OY3D 3NOCD 4GMRA 2NYJA 4O1PA 3Q9UC 3UI2A 3HG0D 4K5CA 4BETA 1MX2A 2XZDG 4OAVB 2AJAA 2F37A 1QYMA 3J5QB 4HQDA 5KBAA 2V5QC 3F6QA 5KNGA 1IKND 4NIKA 3ZU7B 3NBNB 1BLXB 4LG6A 4HRMB 4F1PA 1S70B 5ENSD 4BSZB 1YMPA 2XZTG 2B0OE 3AJIA 4Z68A 1BU9A 4DX6D 4HLLA 2DWZA 3T8KA 3KEAA 2XENA 1K3ZD 4K5BA 3TWRA 4DUIA 2KXPC 2XEEA 5EYLA 1NFIE 5CBOA 2PNNA 5JA4D 2KBXA 5EIBE 2JABA 4GPMA 4F6RD 1K1BA 2ZGGA 4HI9A 1K1AA 5AN8A 2RFAA 4TUMA 4HI8A 1A5EA 3UTMA 3JXIA 4G8KA 5EIDA 2HE0A 3DEPA 4HRLA 4QFVA 3EU9A 2A5EA 3TWQA 5AAOA 2QYJA 1MJ0A 3NOGD 4QQIA 4DRXE 4OAUC 2DZNA 5BXUA 4K5AB 5ENOD 3EHRA 4U8VD 5ENRD 5ITZF 3TWUA 1N11A 2Y1LE 5CBNA 2QC9A 4ATZD 3JUEA 4HB5A 2ETAA 5AQAA 5EN5D 3B95A 5HKPA 5CEAA 1MYOA 3W9FA 4BEPA 3V2OA 3DEOA 5AARA 3UXGA 3Q9NC 3W9GA 4DX7D 5ENQD 1D9SA 1N0QA 3LJNA 2DVWA 1BI8B 1DCQA 1SVXA 5ENTD 4DX5D 1MX6A 1WG0A 5JMND 4ZFHA 3D9HA 5AQ7A 2L6BA 2ETCA 2P2CP 3IXEA 4RLYA 3SO8A 4A63B 4LSZE 2RFMA 2J8SD 4U96D 4HBDA 5HRYA 5CEDB 1YCSB 2V4HC 5CERB 2XEHA 1G3NB 5D66A 1OT8A 3TWXA 4B93B 4HRNA 3JXJA 4G8LA 2F8XK 5AQBA 5KNHD 4U95D 2BKGA 5HS0A 1SW6A 3ZKJA 2Y0BG 5FIOA 3TWVA 2FO1E 4ZHBA 3EHQA 2ZGDA 4J8YA 4UUCA 1TR4A 1DC2A 1N0RA 4BERA 3ZUVB 3V79K 4YDWA 4CYMD 5BXOA 1IXVA 4J7WA 2F8YA 5AQ9A 4BESA 1BI7B 2BKKB 4LNUD 5EILA 4O60A 4DX1A 3HRAA 3B7BA 3T9KA 1IHBA 3TWWA 5ENPD 1AWCB
chains in the Genus database with same CATH superfamily
1N95A 2WXRA 2L0IA 4C9BB 5LP0A 1UN9A 2IQCA 4L2YA 3CHRA 2KC7A 3KS2A 5CRVA 1HF8A 5EX3A 3FP3A 2PQNA 3NBNB 1E96B 1TNUA 1D8DA 2YINA 3IHVA 5EKQD 1X5BA 4PDXA 2XRYA 3FDHA 2XRZA 2XEEA 1MHQA 4IN3B 4F3VA 4GPMA 3DPDA 4HI9A 3HXDA 4EHMA 2RFAA 1D8EA 1HFAA 3MKQB 1H6OA 1TN6A 3EU9A 2RD0A 3FU3A 4K5AB 4U8VD 2E2EA 2Y1LE 3PZ4A 4FLBA 2WXMA 3IBEA 2OCCE 4BTBA 2X6FA 3O4ZA 5JMND 4ZFHA 5A23A 4L9PA 4KXKB 4YDEA 4HXIA 1O1RA 4LEUA 2QYUA 1HX8A 1UJKA 1LD8A 1JWFA 5KJLA 4AEZC 3MV2B 3L54A 4AXHA 1E8WA 3EHMA 1TNBA 3DRAA 4N2QA 2GRPB 3CVLA 3JQ0A 1HU3A 5ARGA 1BI7B 2NC9A 3U66A 3CVQA 4BWRA 3UPVA 4JD2G 4GZ3A 3Q15A 3EIQC 4XI9A 1L5JA 5CRUA 3CR3A 1SZ9A 2P9SG 4GTOA 1N9AA 5G04C 3OAWA 2VTBB 2X6HA 3FUHA 2XCCA 2FEZA 3L17A 1JPLA 2XS8A 4M3OA 3D9KA 3URZA 4BT8A 1NFIE 1FT2A 2H6IA 2WXHA 1K1BA 3Q73A 3MX3A 2EINE 4G2VA 3AG4E 1E90A 4WNGA 4MKTA 2QYJA 2X6IA 3MGBA 3S7DA 3BG0B 4N2SA 3Q49B 3G2VA 3B95A 1JCQA 3VTYA 3CV0A 3FUNA 3CGHA 2P9KG 3NQPA 3B7TA 2P9PG 4Y6WA 2OVFA 2J4DA 2J8SD 3FTYA 4U96D 5HRYA 5T8IA 3ZYLA 5D66A 5LCWJ 1OT8A 5J90A 3LJ3A 3DSUA 3CVXA 5FIOA 2R17C 1N0RA 2XPZA 4XX5A 1NP7A 2BKKB 5HQ8A 3HRAA 4A1GA 3IEGA 3EUVA 3RSEG 3ULYA 3MKQA 5KJMA 1S64A 4N5QA 3J5PA 4JB8P 1S0PA 1YYHA 2R5SA 4A55A 1KZOA 2DCPA 4NQ0A 3QJZA 3R9AB 1KPSB 2EQXA 3ZU7B 3PE4A 1S70B 5ENSD 2LUHA 2XZTG 4BFRA 1HH8A 4Z68A 4JL0A 4HLLA 1TNZA 3ASFA 5JA4D 3ZFWA 3UM3A 5J08A 3PUKA 3EHNA 3PEVB 3ZW3A 3DWLG 4GA1A 3FY4A 1KT1A 4MS6A 1SA5A 3TG5A 2C2LA 5FQ6A 4UI9J 4YVQC 4DPRA 1OWMA 4FA6A 3CHQA 3U4TA 3FUIA 3KD7A 5HKPA 5CEAA 3D9PA 2XCBA 5G2NA 2YHEA 1BI8B 1KT0A 5ENTD 2Y4TA 2L6BA 4RG9A 3IXEA 1HZ4A 3ISMC 4HBDA 5CCMA 3RK6A 4HOTA 3SGHA 4N5CA 3E30A 4G8LA 4KZCA 5FWQA 4A3VA 4G26A 4TRQA 4U95D 3CEQA 4JEHA 4A1SA 2ZGDA 3UQ3A 4GYOA 2C0LA 1TEZA 3PEUB 2EIJE 5LOZA 4YDWA 1O5MA 1TN7A 1IXVA 2XS1A 3HVEA 2MRIA 2WXOA 4LNUD 4HS2A 4DLOA 5M72A 1AP7A 2QZAA 1YA0A 3TWTA 4EBAG 3CHMA 1IHGA 1Y8MA 2HO1A 5EYPF 4M7CA 1UOHA 2L0TB 4LNGA 2XZDG 2F37A 2PM7A 1UG3A 2IONA 4NIKA 4Q69A 5G05J 4Y6CA 5H7PA 4AM9A 3SF4A 4NRHB 2UWJG 3FH8A 1H2VC 4E85A 5CMYA 2KBXA 3PREA 2I9CA 5AN8A 3ZIMA 3BU8A 3ZRHA 3IKOB 3AG1E 3DBSA 5BV0A 2VGYA 1EPUA 2LSVA 1QQEA 5AAOA 3K9IA 4G24A 3EHRA 3PZ1A 2J4BA 2GRLA 3MEKA 2Y69E 4NACA 4JC8A 4GCNA 3FH5A 2WXNA 4Q96A 3QC1A 5FT9A 3ZXPA 2XGOA 4R7LA 4CT0A 3UMVA 2A5UA 3DSSA 3C72A 1YCSB 3UX4A 3FWVA 4B94A 4FHJA 2Y0BG 2LXMA 3ZN3A 4KT6B 4UI9C 3NF1A 4BERA 2OV8A 4BT9A 1RZ4A 4O6FA 3T9KA 4TV3A 3SQVA 2WMOA 1SQMA 2GGFA 2MYOA 2UY1B 2A4ZA 2FO7A 2J9QA 3TWSA 4GU5A 4YVOA 4CZ2D 4LUNU 4AVXA 3L6AA 2P9NG 2CG2A 3FU6A 1OWLA 3QKYA 4FP7A 4HFGA 5D0QD 4KBQA 5KCMA 4GTTA 3ZGQA 3MCXA 3CQCB 4DX6D 5ANRA 4ACKA 3KEAA 2CFZA 4CT4A 3FUFA 1ZBPA 2PNNA 3Q47B 3SBSA 4U8HA 4URKA 3G2TA 3ASHA 3FTSA 3ABKE 5EIDA 3IV0A 3GZ1A 4EZLA 5DIZA 2OEVA 5ENOD 5G05C 5CMWA 4HLEA 1N11A 3QWPA 4UQZA 1TNOA 4JXTA 3W9FA 1IQRA 5FZRA 1JCRA 1N94A 2BTDA 5JJ6A 3CK7A 3L16A 5AENA 4IULA 4ME2A 4RLYA 4WNFA 1O1TA 4IYPA 1H0AA 3JXJA 2BKGA 2WXPA 4MRUA 5BUZA 4XEIG 1TR4A 1DC2A 1K8KG 4I17A 2VGXB 3CVVA 2AVPA 1SZAA 2GW1A 5AYWD 3DSWA 1WDYA 1IYGA 2AXUA 3CVYA 3SFYA 3S2AA 3Q9UC 4FU3A 4OAVB 2H6HA 2NSZA 1A17A 3GW4A 1BLXB 2HM8A 2V8SE 3E32A 4HOQA 3E37A 1OWNA 5EYLA 2VQ2A 3HXFA 4AV7A 2VYIA 4J8FA 4JA7A 3PVLA 2LAIA 4TUMA 2YQ8A 3Q78A 4GTMA 2XEVA 1PC2A 5KJKA 3OTNA 3TAXA 2XPIA 1HG2A 3SI5A 2LNIA 2WXQA 2EIKE 3S7FA 1FCHA 2L6JA 3B7SA 5ITZF 2R05A 1NA0A 4LRZA 5E76A 3LY8A 4U0UA 1ZB1A 3Q9NC 1D9SA 3S7BA 2QY7A 3AU4A 2KCVA 4GZ5A 1TJFA 3NAWA 1WG0A 3RAUA 4A63B 3SD5A 3OXFA 4LSZE 4N3CA 2LAHA 2I1JA 1RW2A 4B0ZA 4H7YA 3SBTB 5FQ7A 3UINC 2F8XK 5FQ8A 2WB2A 2R2LA 4AY6A 4RSYA 2PQRA 2IOSA 5EX0A 1MQSA 1E7VA 4O60A 1KZPA 3TWWA 3RU0A 5CECB 3V30A 3PZDA 4C48B 3ZNGA 2V4LA 1QNFA 1TN8A 1JUQA 4KZ0A 1DNPA 3L9TA 2WQHA 2X6KA 4BETA 4MLPA 2CHZA 4AJWA 5LFAA 4JVSA 4ATGA 2V5QC 1LTXA 3UM1A 4BSXA 2LO6A 2ZXWE 2BEDA 4WNEA 1H19A 2WXLA 4HORA 2DWZA 3G2WA 4GMJA 3UT4A 3TWRA 1E8XA 2ZGGA 4UWLA 1P5QA 4ILGA 2Y4UA 2PM6A 3JXIA 3E33A 2BF0X 4HRLA 3FHEA 3GZ2A 3TWQA 3C3RA 2OOEA 4APOA 4U07A 4G25A 3ONKA 1UN8A 2F0YA 5AQAA 4N3BA 4GPKA 4EZKA 3TG4A 4ABNA 1HO8A 3ABME 3HXBA 1NI1A 2Y3AA 4AP2A 1HG5A 4GYYA 3PUJA 2RFMA 3ENEA 3P2BA 4JHJA 3DSVA 4I9EA 4J6IA 4APFA 3LYAA 4UWGA 4ACLA 2EIME 2VSYA 2P58C 2Q7FA 4G23A 2L9BA 4GA0A 3GZSA 4UUCA 3TL5A 4CDRA 3ZUVB 4PUCA 3S7JA 3APCA 4WUYA 1E8YA 3OXGA 4C0EA 4UI9K 3R7QA 1V54E 1QZ2A 3FULA 5IY5E 2ZISA 4WAFA 3SFZA 4HRMB 2VSOE 2ZU6B 1BU9A 4DUIA 4GZ6A 4F53A 4FC8A 3FUKA 3UIPC 3QK0A 3UTMA 1OCRE 2VSXE 2HE0A 3RRUA 3QDNA 2J49A 4OAUC 3ZEFA 3PZ2A 1KLXA 2QC9A 4HB5A 4GB9A 2X38A 3C3QA 1MYOA 5D2MC 3RRMB 3HXCA 4I6JA 4FLHA 3FEXA 2KM4A 3HDXA 4N3AA 3JCKC 1Z3XA 2I6HA 4DI3A 4OVUA 3CSTA 3BG1B 4L23A 5AQBA 4OVVA 3SFXA 4GTRA 5AJDA 3EJNA 5D0OD 3ASNE 3AS5A 5BW8C 3V79K 4BX8A 4LCTA 3ML8A 3G2UA 4DJAA 3B7UX 4ANVA 3L82A 5ENPD 4CRWA 5FINA 2JLBA 3APDA 1U3CA 2DYSE 1MX4A 5AIJA 4O1OA 1OCOE 2VGXA 4WWOA 4GTVA 2VTBA 4LG6A 4F1PA 4FJZA 3NZUA 4KVMA 1YMPA 4FJYA 4J8EA 3LDZA 5B1BE 4GTSA 3Q7FA 2KXPC 3QWVA 1H2TC 3FH7A 4JHRA 3DXMG 2R03A 1TNYA 2WVIA 3C3OA 1XNFA 2UY1A 3WXXA 3APFA 3UT8A 3RO3A 4TXRA 5BXUA 3CVPA 2WXIA 3RKVA 3VTXA 4ATZD 4UQXA 2ETAA 3AG3E 2PL2A 5AARA 3UXGA 5A6CA 2PZIA 2ZIRA 4HVBA 3KSQA 2ETCA 2P2CP 2WQ6A 4BY6A 3ABLE 1O1SA 3U64A 3E4BA 3TWXA 2MOWA 5HS0A 4GZDA 5JHAA 4HOSA 3ESKA 4K0RA 3TXMA 2P9IG 3IHYA 3C98A 2I2OA 4J7WA 3WG7E 5EILA 1OXJA 1DCEA 1N4SA 5BNWA 4X8QA 4GMLA 4LERA 2VGEA 5KWDA 3UI2A 5EDSA 3JQ1A 5LX8A 3FUEA 1OUVA 3I5PA 2IO2C 1IKND 3N71A 4Q94A 5LCWC 4BSZB 2GRRB 2YNQA 2CFUA 4UQYA 3PNTB 4HI8A 3LCAA 1A5EA 3ASDA 2BUGA 1INZA 5C1DA 3R7RA 4WWPA 5FZQA 1S63A 4QFVA 4PS3A 4V3IA 2DZNA 3TWUA 2NXPA 1SA4A 4U63A 2M63A 3ZYQA 2X6JA 1BPOA 3UM2A 2R59A 4JEUA 4I1AA 4DI4A 3ONLA 3ZVVA 3FUMA 4J0UA 4L1BA 4I6GA 5G55A 4EECA 3FEYA 3HXEA 3I4GA 5CERB 4EZJA 1QBQA 1ELRA 2P9LG 1SW6A 4I1MA 2CHXA 2JEKA 4PH4B 3CQGB 3UIOC 4CDNA 2I1KA 1HS6A 1VDYA 1OWPA 1H6KA 4P29A 3AAAC 3V2XA 1ELKA 3AS4A 3RRNB 1PAQA 2X3MA 4XKBA 3V31A 5ENNA 3C5RA 4L2LA 3DSXA 5CHEE 4GAAA 1Z3YA 4K5CA 2AJAA 1FVFA 3PH0C 3PS6A 1N52A 5B3SE 2WXFA 2WXJA 3PNLB 1E7UA 1K3ZD 3ULEG 3D9LA 2OVBA 5JJ7A 2JABA 3DPYA 3PDNA 2VJ8A 3B7RL 2H6FA 3CSFA 3L08A 2GRNB 2A5EA 1MJ0A 2YHCA 5B1AE 4XI0A 1JWGA 1W3BA 4CEMA 3TJPA 3Q4AB 3D9NA 4CCAA 2IOLA 3D3MA 4H7XA 3B13A 5ARFA 4UWFA 3D9HA 3SNXA 3UT7A 3G2SA 4TXPA 3ZYKA 3FTUA 3BUAA 4CGWA 3LKUA 3LVRE 4CYMD 3LPZA 4J8SA 4A3TA 4DX1A 3B7BA 2HR2A 3ULQA 1IHBA 2FULA 4NURA 4YDOA 3PRZA 3ZYMA 4ANUA 2DZOA 3D9JA 4DX2A 3ZHEB 4HNAD 3FTZA 1OY3D 1ELWA 4I1OB 4O1PA 3HG0D 1MX2A 4HQDA 3UKUG 5KBAA 1NA3A 3T8MA 4I2ZA 4GTQA 5HI7A 2DIWA 3LXUX 5CBOA 5EIBE 3X2QE 4GTPA 3DEPA 2IO3C 2KCLA 1ZU2A 4U0ZA 4ILIA 2WPVA 3RO2A 1Y6IA 2IY0C 3U3WA 4AY5A 2ILRA 3FUJA 2KZTA 3MJWA 1V55E 1SVXA 4E6HA 3TXNA 1MX6A 3ASOE 3JUIA 2IF4A 2HYZA 1N54A 1WAO1 1Q2ZA 3CHOA 1NL4A 3TGOA 2FO1E 2GRMA 3D9OA 2J07A 4BESA 5G04J 1XGWA 3SY2A 4C0MA 3HHMA 1FVHA 3FU0A 1BD8A 1TYQG 3HVEB 4GMRA 4JHKA 2LSUA 4J8DA 3NZSA 2IJGX 1OCCE 3Q7AA 3FFLA 3KAEA 1NZNA 5BT1A 4WNDA 2KCKA 2WXKA 4EBAA 1HE8A 2V5FA 2B0OE 3RJVA 3UUXA 2J09A 4K5BA 3I4RB 3P1UA 4XE0A 1OCZE 3MA5A 4JW1A 3CK8A 3QWWA 3QARA 4MBGA 3CHPA 3L22A 4G8KA 3ESLA 1IQUA 3FUDA 3Q75A 4GYWA 4DRXE 1UW4B 3CK9A 2RKKA 4L7TA 5CCLA 4EQFA 4KYOB 4KMOA 4HOUA 2AWIA 2WMNA 4DK5A 5A7DB 1LD7A 3DEOA 4I43A 4DLQA 4PS7A 1OWOA 2DVWA 4FADA 2IU1A 1DCQA 3LS8A 3ML9A 1B89A 5FQ4A 3FTVA 3SO8A 1GW6A 2B6CA 4OYSA 2R02A 4N39A 4AOFA 2V4HC 1N4QA 3QB2A 1LF8A 5T3RA 3CHSA 5KNHD 3ZKJA 2CHWA 5BPPA 3TWVA 4ZHBA 3EHQA 3VLFA 5BXOA 2FBNA 1Z5SC 3VLEA 2GRQB 1AWCB 2VSNA 3DXKG 3CLJA 2ONDA 4K03A 3U9WA 4YDYA 3NOCD 2NYJA 3D9IA 3CVNA 1DVPA 2WXGA 1FPPA 5JJTA 1Z6TA 1U2VG 4W9RA 4B89A 3LY9A 5AJLA 4KVOA 4TXQA 1H2UA 2CG3A 4RQIA 1TJCA 1HXIA 3LY7A 1PY1A 1WM5A 1FT1A 4ANWA 3SZ7A 4GA2A 3NB2A 1WY6A 4ANXA 3NOGD 3L13A 2FI7A 3HIZA 5ENRD 3SHFA 4GZCA 2WM9A 4TUUA 1EDUA 5EN5D 2IEJA 3V2OA 3W9GA 4DX7D 4DX5D 3BQOA 3AG2E 1N4PA 4U04A 2XEHA 2EILE 2GROB 5E75A 3GYZA 4F7AA 2V0PA 1EYHA 4B8AA 3CVUA 4G1TA 4LNBA 4EPZA 3CVWA 2H6GA 2ETBA 3CKBA 4WWNA 3FU5A 2AW6A 1QYMA 3J5QB 4JZYA 2QFCA 3PE3A 3F6QA 4YNDA 3O48A 3MYVA 3FTXA 5FJYA 3T8KA 4F6RD 4XIFA 1K1AA 4BTAA 3KEZA 1EF1C 3QAQA 2OEWA 4I9CA 1H6PA 3ASGA 4I2WA 3R9MA 4QQIA 3MKRA 3E34A 5T4YA 3I3NA 5CBNA 3JUEA 1U3DA 2J08A 4BEPA 2AXVA 5KJNA 4GCOA 5ENQD 3AU5A 1MZCA 4G11A 1X81A 3LVQE 4JPSA 3UKRG 2DYRE 5AQ7A 4D10C 3UM0A 5CEDB 3ZPJA 2FF4A 4IRUA 4AIFA 1G3NB 2WQ7A 3RIBA 4CGVA 3LEWA 3VLDA 2F8YA 5AQ9A 4BX9A 3T5XA 3EU5A 4JA9A 1N4RA 2RG8A 4U7EB 4U8YD 5ANLA 3EIJA 3Q5MA 5FTPA 4I6EA 2XGMA 2AXZA 3JYSA 3QOUA 5KNGA 2XPYA 3AJIA 2XENA 3HYMB 4RVBA 4PS8A 4RG6A 5BV1A 4UWHA 3ZXSA 2KATA 4UWKA 4XKCA 1E8ZA 5C2YA 4B8CB 2DBAA 4FULA 2LXLA 3FTWA 3PZ3A 3T5VA 4CDMA 3MV3B 3D9MA 2XHEA 2E0IA 3EDTB 2IFUA 1N0QA 3LJNA 3ZHEA 3KSLA 4U0SA 3CKCA 2MHKA 3DSTA 2P9UG 2XQ0A 4F1SA 5JHBA 4B93B 1JCSA 3OXLA 4HRNA 1UJJA 3MZLB 4XZ4A 3CIAA 5FZSA 3QNKA 2C0MA 3BEEA 4J8YA 3AS8A 5DBKA 4ILHB 2XGSA 3Q79A 2KZTB 4FHKA
chains in the Genus database with same CATH topology
3AAAC 2MYOA 5CECB 3V30A 1AP7A 5FINA 4C48B 3V2XA 3TWTA 1WDYA 3ZNGA 1MX4A 2ETBA 4U8YD 4N5QA 3J5PA 1BD8A 3TWSA 2DZOA 4JB8P 5EYPF 2VGEA 3V31A 3C5RA 4HNAD 4DX2A 4O1OA 4YDYA 5KWDA 1YYHA 1UOHA 4CZ2D 1OY3D 3NOCD 4GMRA 2NYJA 4O1PA 3Q9UC 3UI2A 3HG0D 4K5CA 4BETA 1MX2A 2XZDG 4OAVB 2AJAA 2F37A 1QYMA 3J5QB 4HQDA 5KBAA 2V5QC 3F6QA 5KNGA 1IKND 4NIKA 3ZU7B 3NBNB 1BLXB 4LG6A 4HRMB 4F1PA 1S70B 5ENSD 4BSZB 1YMPA 2XZTG 2B0OE 3AJIA 4Z68A 1BU9A 4DX6D 4HLLA 2DWZA 3T8KA 3KEAA 2XENA 1K3ZD 4K5BA 3TWRA 4DUIA 2KXPC 2XEEA 5EYLA 1NFIE 5CBOA 2PNNA 5JA4D 2KBXA 5EIBE 2JABA 4GPMA 4F6RD 1K1BA 2ZGGA 4HI9A 1K1AA 5AN8A 2RFAA 4TUMA 4HI8A 1A5EA 3UTMA 3JXIA 4G8KA 5EIDA 2HE0A 3DEPA 4HRLA 4QFVA 3EU9A 2A5EA 3TWQA 5AAOA 2QYJA 1MJ0A 3NOGD 4QQIA 4DRXE 4OAUC 2DZNA 5BXUA 4K5AB 5ENOD 3EHRA 4U8VD 5ENRD 5ITZF 3TWUA 1N11A 2Y1LE 5CBNA 2QC9A 4ATZD 3JUEA 4HB5A 2ETAA 5AQAA 5EN5D 3B95A 5HKPA 5CEAA 1MYOA 3W9FA 4BEPA 3V2OA 3DEOA 5AARA 3UXGA 3Q9NC 3W9GA 4DX7D 5ENQD 1D9SA 1N0QA 3LJNA 2DVWA 1BI8B 1DCQA 1SVXA 5ENTD 4DX5D 1MX6A 1WG0A 5JMND 4ZFHA 3D9HA 5AQ7A 2L6BA 2ETCA 2P2CP 3IXEA 4RLYA 3SO8A 4A63B 4LSZE 2RFMA 2J8SD 4U96D 4HBDA 5HRYA 5CEDB 1YCSB 2V4HC 5CERB 2XEHA 1G3NB 5D66A 1OT8A 3TWXA 4B93B 4HRNA 3JXJA 4G8LA 2F8XK 5AQBA 5KNHD 4U95D 2BKGA 5HS0A 1SW6A 3ZKJA 2Y0BG 5FIOA 3TWVA 2FO1E 4ZHBA 3EHQA 2ZGDA 4J8YA 4UUCA 1TR4A 1DC2A 1N0RA 4BERA 3ZUVB 3V79K 4YDWA 4CYMD 5BXOA 1IXVA 4J7WA 2F8YA 5AQ9A 4BESA 1BI7B 2BKKB 4LNUD 5EILA 4O60A 4DX1A 3HRAA 3B7BA 3T9KA 1IHBA 3TWWA 5ENPD 1AWCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAA C;  2MYO A;  5CEC B;  3V30 A;  1AP7 A;  5FIN A;  4C48 B;  3V2X A;  3TWT A;  1WDY A;  3ZNG A;  1MX4 A;  2ETB A;  4U8Y D;  4N5Q A;  3J5P A;  1BD8 A;  3TWS A;  2DZO A;  4JB8 P;  5EYP F;  2VGE A;  3V31 A;  3C5R A;  4HNA D;  4DX2 A;  4O1O A;  4YDY A;  5KWD A;  1YYH A;  1UOH A;  4CZ2 D;  1OY3 D;  3NOC D;  4GMR A;  2NYJ A;  4O1P A;  3Q9U C;  3UI2 A;  3HG0 D;  4K5C A;  4BET A;  1MX2 A;  2XZD G;  4OAV B;  2AJA A;  2F37 A;  1QYM A;  3J5Q B;  4HQD A;  5KBA A;  2V5Q C;  3F6Q A;  5KNG A;  1IKN D;  4NIK A;  3ZU7 B;  3NBN B;  1BLX B;  4LG6 A;  4HRM B;  4F1P A;  1S70 B;  5ENS D;  4BSZ B;  1YMP A;  2XZT G;  2B0O E;  3AJI A;  4Z68 A;  1BU9 A;  4DX6 D;  4HLL A;  2DWZ A;  3T8K A;  3KEA A;  2XEN A;  1K3Z D;  4K5B A;  3TWR A;  4DUI A;  2KXP C;  2XEE A;  5EYL A;  1NFI E;  5CBO A;  2PNN A;  5JA4 D;  2KBX A;  5EIB E;  2JAB A;  4GPM A;  4F6R D;  1K1B A;  2ZGG A;  4HI9 A;  1K1A A;  5AN8 A;  2RFA A;  4TUM A;  4HI8 A;  1A5E A;  3UTM A;  3JXI A;  4G8K A;  5EID A;  2HE0 A;  3DEP A;  4HRL A;  4QFV A;  3EU9 A;  2A5E A;  3TWQ A;  5AAO A;  2QYJ A;  1MJ0 A;  3NOG D;  4QQI A;  4DRX E;  4OAU C;  2DZN A;  5BXU A;  4K5A B;  5ENO D;  3EHR A;  4U8V D;  5ENR D;  5ITZ F;  3TWU A;  1N11 A;  2Y1L E;  5CBN A;  2QC9 A;  4ATZ D;  3JUE A;  4HB5 A;  2ETA A;  5AQA A;  5EN5 D;  3B95 A;  5HKP A;  5CEA A;  1MYO A;  3W9F A;  4BEP A;  3V2O A;  3DEO A;  5AAR A;  3UXG A;  3Q9N C;  3W9G A;  4DX7 D;  5ENQ D;  1D9S A;  1N0Q A;  3LJN A;  2DVW A;  1BI8 B;  1DCQ A;  1SVX A;  5ENT D;  4DX5 D;  1MX6 A;  1WG0 A;  5JMN D;  4ZFH A;  3D9H A;  5AQ7 A;  2L6B A;  2ETC A;  2P2C P;  3IXE A;  4RLY A;  3SO8 A;  4A63 B;  4LSZ E;  2RFM A;  2J8S D;  4U96 D;  4HBD A;  5HRY A;  5CED B;  1YCS B;  2V4H C;  5CER B;  2XEH A;  1G3N B;  5D66 A;  1OT8 A;  3TWX A;  4B93 B;  4HRN A;  3JXJ A;  4G8L A;  2F8X K;  5AQB A;  5KNH D;  4U95 D;  2BKG A;  5HS0 A;  1SW6 A;  3ZKJ A;  2Y0B G;  5FIO A;  3TWV A;  2FO1 E;  4ZHB A;  3EHQ A;  2ZGD A;  4J8Y A;  4UUC A;  1TR4 A;  1DC2 A;  1N0R A;  4BER A;  3ZUV B;  3V79 K;  4YDW A;  4CYM D;  5BXO A;  1IXV A;  4J7W A;  2F8Y A;  5AQ9 A;  4BES A;  1BI7 B;  2BKK B;  4LNU D;  5EIL A;  4O60 A;  4DX1 A;  3HRA A;  3B7B A;  3T9K A;  1IHB A;  3TWW A;  5ENP D;  1AWC B; 
#chains in the Genus database with same CATH topology
 1N95 A;  2WXR A;  2L0I A;  4C9B B;  5LP0 A;  1UN9 A;  2IQC A;  4L2Y A;  3CHR A;  2KC7 A;  3KS2 A;  5CRV A;  1HF8 A;  5EX3 A;  3FP3 A;  2PQN A;  3NBN B;  1E96 B;  1TNU A;  1D8D A;  2YIN A;  3IHV A;  5EKQ D;  1X5B A;  4PDX A;  2XRY A;  3FDH A;  2XRZ A;  2XEE A;  1MHQ A;  4IN3 B;  4F3V A;  4GPM A;  3DPD A;  4HI9 A;  3HXD A;  4EHM A;  2RFA A;  1D8E A;  1HFA A;  3MKQ B;  1H6O A;  1TN6 A;  3EU9 A;  2RD0 A;  3FU3 A;  4K5A B;  4U8V D;  2E2E A;  2Y1L E;  3PZ4 A;  4FLB A;  2WXM A;  3IBE A;  2OCC E;  4BTB A;  2X6F A;  3O4Z A;  5JMN D;  4ZFH A;  5A23 A;  4L9P A;  4KXK B;  4YDE A;  4HXI A;  1O1R A;  4LEU A;  2QYU A;  1HX8 A;  1UJK A;  1LD8 A;  1JWF A;  5KJL A;  4AEZ C;  3MV2 B;  3L54 A;  4AXH A;  1E8W A;  3EHM A;  1TNB A;  3DRA A;  4N2Q A;  2GRP B;  3CVL A;  3JQ0 A;  1HU3 A;  5ARG A;  1BI7 B;  2NC9 A;  3U66 A;  3CVQ A;  4BWR A;  3UPV A;  4JD2 G;  4GZ3 A;  3Q15 A;  3EIQ C;  4XI9 A;  1L5J A;  5CRU A;  3CR3 A;  1SZ9 A;  2P9S G;  4GTO A;  1N9A A;  5G04 C;  3OAW A;  2VTB B;  2X6H A;  3FUH A;  2XCC A;  2FEZ A;  3L17 A;  1JPL A;  2XS8 A;  4M3O A;  3D9K A;  3URZ A;  4BT8 A;  1NFI E;  1FT2 A;  2H6I A;  2WXH A;  1K1B A;  3Q73 A;  3MX3 A;  2EIN E;  4G2V A;  3AG4 E;  1E90 A;  4WNG A;  4MKT A;  2QYJ A;  2X6I A;  3MGB A;  3S7D A;  3BG0 B;  4N2S A;  3Q49 B;  3G2V A;  3B95 A;  1JCQ A;  3VTY A;  3CV0 A;  3FUN A;  3CGH A;  2P9K G;  3NQP A;  3B7T A;  2P9P G;  4Y6W A;  2OVF A;  2J4D A;  2J8S D;  3FTY A;  4U96 D;  5HRY A;  5T8I A;  3ZYL A;  5D66 A;  5LCW J;  1OT8 A;  5J90 A;  3LJ3 A;  3DSU A;  3CVX A;  5FIO A;  2R17 C;  1N0R A;  2XPZ A;  4XX5 A;  1NP7 A;  2BKK B;  5HQ8 A;  3HRA A;  4A1G A;  3IEG A;  3EUV A;  3RSE G;  3ULY A;  3MKQ A;  5KJM A;  1S64 A;  4N5Q A;  3J5P A;  4JB8 P;  1S0P A;  1YYH A;  2R5S A;  4A55 A;  1KZO A;  2DCP A;  4NQ0 A;  3QJZ A;  3R9A B;  1KPS B;  2EQX A;  3ZU7 B;  3PE4 A;  1S70 B;  5ENS D;  2LUH A;  2XZT G;  4BFR A;  1HH8 A;  4Z68 A;  4JL0 A;  4HLL A;  1TNZ A;  3ASF A;  5JA4 D;  3ZFW A;  3UM3 A;  5J08 A;  3PUK A;  3EHN A;  3PEV B;  3ZW3 A;  3DWL G;  4GA1 A;  3FY4 A;  1KT1 A;  4MS6 A;  1SA5 A;  3TG5 A;  2C2L A;  5FQ6 A;  4UI9 J;  4YVQ C;  4DPR A;  1OWM A;  4FA6 A;  3CHQ A;  3U4T A;  3FUI A;  3KD7 A;  5HKP A;  5CEA A;  3D9P A;  2XCB A;  5G2N A;  2YHE A;  1BI8 B;  1KT0 A;  5ENT D;  2Y4T A;  2L6B A;  4RG9 A;  3IXE A;  1HZ4 A;  3ISM C;  4HBD A;  5CCM A;  3RK6 A;  4HOT A;  3SGH A;  4N5C A;  3E30 A;  4G8L A;  4KZC A;  5FWQ A;  4A3V A;  4G26 A;  4TRQ A;  4U95 D;  3CEQ A;  4JEH A;  4A1S A;  2ZGD A;  3UQ3 A;  4GYO A;  2C0L A;  1TEZ A;  3PEU B;  2EIJ E;  5LOZ A;  4YDW A;  1O5M A;  1TN7 A;  1IXV A;  2XS1 A;  3HVE A;  2MRI A;  2WXO A;  4LNU D;  4HS2 A;  4DLO A;  5M72 A;  1AP7 A;  2QZA A;  1YA0 A;  3TWT A;  4EBA G;  3CHM A;  1IHG A;  1Y8M A;  2HO1 A;  5EYP F;  4M7C A;  1UOH A;  2L0T B;  4LNG A;  2XZD G;  2F37 A;  2PM7 A;  1UG3 A;  2ION A;  4NIK A;  4Q69 A;  5G05 J;  4Y6C A;  5H7P A;  4AM9 A;  3SF4 A;  4NRH B;  2UWJ G;  3FH8 A;  1H2V C;  4E85 A;  5CMY A;  2KBX A;  3PRE A;  2I9C A;  5AN8 A;  3ZIM A;  3BU8 A;  3ZRH A;  3IKO B;  3AG1 E;  3DBS A;  5BV0 A;  2VGY A;  1EPU A;  2LSV A;  1QQE A;  5AAO A;  3K9I A;  4G24 A;  3EHR A;  3PZ1 A;  2J4B A;  2GRL A;  3MEK A;  2Y69 E;  4NAC A;  4JC8 A;  4GCN A;  3FH5 A;  2WXN A;  4Q96 A;  3QC1 A;  5FT9 A;  3ZXP A;  2XGO A;  4R7L A;  4CT0 A;  3UMV A;  2A5U A;  3DSS A;  3C72 A;  1YCS B;  3UX4 A;  3FWV A;  4B94 A;  4FHJ A;  2Y0B G;  2LXM A;  3ZN3 A;  4KT6 B;  4UI9 C;  3NF1 A;  4BER A;  2OV8 A;  4BT9 A;  1RZ4 A;  4O6F A;  3T9K A;  4TV3 A;  3SQV A;  2WMO A;  1SQM A;  2GGF A;  2MYO A;  2UY1 B;  2A4Z A;  2FO7 A;  2J9Q A;  3TWS A;  4GU5 A;  4YVO A;  4CZ2 D;  4LUN U;  4AVX A;  3L6A A;  2P9N G;  2CG2 A;  3FU6 A;  1OWL A;  3QKY A;  4FP7 A;  4HFG A;  5D0Q D;  4KBQ A;  5KCM A;  4GTT A;  3ZGQ A;  3MCX A;  3CQC B;  4DX6 D;  5ANR A;  4ACK A;  3KEA A;  2CFZ A;  4CT4 A;  3FUF A;  1ZBP A;  2PNN A;  3Q47 B;  3SBS A;  4U8H A;  4URK A;  3G2T A;  3ASH A;  3FTS A;  3ABK E;  5EID A;  3IV0 A;  3GZ1 A;  4EZL A;  5DIZ A;  2OEV A;  5ENO D;  5G05 C;  5CMW A;  4HLE A;  1N11 A;  3QWP A;  4UQZ A;  1TNO A;  4JXT A;  3W9F A;  1IQR A;  5FZR A;  1JCR A;  1N94 A;  2BTD A;  5JJ6 A;  3CK7 A;  3L16 A;  5AEN A;  4IUL A;  4ME2 A;  4RLY A;  4WNF A;  1O1T A;  4IYP A;  1H0A A;  3JXJ A;  2BKG A;  2WXP A;  4MRU A;  5BUZ A;  4XEI G;  1TR4 A;  1DC2 A;  1K8K G;  4I17 A;  2VGX B;  3CVV A;  2AVP A;  1SZA A;  2GW1 A;  5AYW D;  3DSW A;  1WDY A;  1IYG A;  2AXU A;  3CVY A;  3SFY A;  3S2A A;  3Q9U C;  4FU3 A;  4OAV B;  2H6H A;  2NSZ A;  1A17 A;  3GW4 A;  1BLX B;  2HM8 A;  2V8S E;  3E32 A;  4HOQ A;  3E37 A;  1OWN A;  5EYL A;  2VQ2 A;  3HXF A;  4AV7 A;  2VYI A;  4J8F A;  4JA7 A;  3PVL A;  2LAI A;  4TUM A;  2YQ8 A;  3Q78 A;  4GTM A;  2XEV A;  1PC2 A;  5KJK A;  3OTN A;  3TAX A;  2XPI A;  1HG2 A;  3SI5 A;  2LNI A;  2WXQ A;  2EIK E;  3S7F A;  1FCH A;  2L6J A;  3B7S A;  5ITZ F;  2R05 A;  1NA0 A;  4LRZ A;  5E76 A;  3LY8 A;  4U0U A;  1ZB1 A;  3Q9N C;  1D9S A;  3S7B A;  2QY7 A;  3AU4 A;  2KCV A;  4GZ5 A;  1TJF A;  3NAW A;  1WG0 A;  3RAU A;  4A63 B;  3SD5 A;  3OXF A;  4LSZ E;  4N3C A;  2LAH A;  2I1J A;  1RW2 A;  4B0Z A;  4H7Y A;  3SBT B;  5FQ7 A;  3UIN C;  2F8X K;  5FQ8 A;  2WB2 A;  2R2L A;  4AY6 A;  4RSY A;  2PQR A;  2IOS A;  5EX0 A;  1MQS A;  1E7V A;  4O60 A;  1KZP A;  3TWW A;  3RU0 A;  5CEC B;  3V30 A;  3PZD A;  4C48 B;  3ZNG A;  2V4L A;  1QNF A;  1TN8 A;  1JUQ A;  4KZ0 A;  1DNP A;  3L9T A;  2WQH A;  2X6K A;  4BET A;  4MLP A;  2CHZ A;  4AJW A;  5LFA A;  4JVS A;  4ATG A;  2V5Q C;  1LTX A;  3UM1 A;  4BSX A;  2LO6 A;  2ZXW E;  2BED A;  4WNE A;  1H19 A;  2WXL A;  4HOR A;  2DWZ A;  3G2W A;  4GMJ A;  3UT4 A;  3TWR A;  1E8X A;  2ZGG A;  4UWL A;  1P5Q A;  4ILG A;  2Y4U A;  2PM6 A;  3JXI A;  3E33 A;  2BF0 X;  4HRL A;  3FHE A;  3GZ2 A;  3TWQ A;  3C3R A;  2OOE A;  4APO A;  4U07 A;  4G25 A;  3ONK A;  1UN8 A;  2F0Y A;  5AQA A;  4N3B A;  4GPK A;  4EZK A;  3TG4 A;  4ABN A;  1HO8 A;  3ABM E;  3HXB A;  1NI1 A;  2Y3A A;  4AP2 A;  1HG5 A;  4GYY A;  3PUJ A;  2RFM A;  3ENE A;  3P2B A;  4JHJ A;  3DSV A;  4I9E A;  4J6I A;  4APF A;  3LYA A;  4UWG A;  4ACL A;  2EIM E;  2VSY A;  2P58 C;  2Q7F A;  4G23 A;  2L9B A;  4GA0 A;  3GZS A;  4UUC A;  3TL5 A;  4CDR A;  3ZUV B;  4PUC A;  3S7J A;  3APC A;  4WUY A;  1E8Y A;  3OXG A;  4C0E A;  4UI9 K;  3R7Q A;  1V54 E;  1QZ2 A;  3FUL A;  5IY5 E;  2ZIS A;  4WAF A;  3SFZ A;  4HRM B;  2VSO E;  2ZU6 B;  1BU9 A;  4DUI A;  4GZ6 A;  4F53 A;  4FC8 A;  3FUK A;  3UIP C;  3QK0 A;  3UTM A;  1OCR E;  2VSX E;  2HE0 A;  3RRU A;  3QDN A;  2J49 A;  4OAU C;  3ZEF A;  3PZ2 A;  1KLX A;  2QC9 A;  4HB5 A;  4GB9 A;  2X38 A;  3C3Q A;  1MYO A;  5D2M C;  3RRM B;  3HXC A;  4I6J A;  4FLH A;  3FEX A;  2KM4 A;  3HDX A;  4N3A A;  3JCK C;  1Z3X A;  2I6H A;  4DI3 A;  4OVU A;  3CST A;  3BG1 B;  4L23 A;  5AQB A;  4OVV A;  3SFX A;  4GTR A;  5AJD A;  3EJN A;  5D0O D;  3ASN E;  3AS5 A;  5BW8 C;  3V79 K;  4BX8 A;  4LCT A;  3ML8 A;  3G2U A;  4DJA A;  3B7U X;  4ANV A;  3L82 A;  5ENP D;  4CRW A;  5FIN A;  2JLB A;  3APD A;  1U3C A;  2DYS E;  1MX4 A;  5AIJ A;  4O1O A;  1OCO E;  2VGX A;  4WWO A;  4GTV A;  2VTB A;  4LG6 A;  4F1P A;  4FJZ A;  3NZU A;  4KVM A;  1YMP A;  4FJY A;  4J8E A;  3LDZ A;  5B1B E;  4GTS A;  3Q7F A;  2KXP C;  3QWV A;  1H2T C;  3FH7 A;  4JHR A;  3DXM G;  2R03 A;  1TNY A;  2WVI A;  3C3O A;  1XNF A;  2UY1 A;  3WXX A;  3APF A;  3UT8 A;  3RO3 A;  4TXR A;  5BXU A;  3CVP A;  2WXI A;  3RKV A;  3VTX A;  4ATZ D;  4UQX A;  2ETA A;  3AG3 E;  2PL2 A;  5AAR A;  3UXG A;  5A6C A;  2PZI A;  2ZIR A;  4HVB A;  3KSQ A;  2ETC A;  2P2C P;  2WQ6 A;  4BY6 A;  3ABL E;  1O1S A;  3U64 A;  3E4B A;  3TWX A;  2MOW A;  5HS0 A;  4GZD A;  5JHA A;  4HOS A;  3ESK A;  4K0R A;  3TXM A;  2P9I G;  3IHY A;  3C98 A;  2I2O A;  4J7W A;  3WG7 E;  5EIL A;  1OXJ A;  1DCE A;  1N4S A;  5BNW A;  4X8Q A;  4GML A;  4LER A;  2VGE A;  5KWD A;  3UI2 A;  5EDS A;  3JQ1 A;  5LX8 A;  3FUE A;  1OUV A;  3I5P A;  2IO2 C;  1IKN D;  3N71 A;  4Q94 A;  5LCW C;  4BSZ B;  2GRR B;  2YNQ A;  2CFU A;  4UQY A;  3PNT B;  4HI8 A;  3LCA A;  1A5E A;  3ASD A;  2BUG A;  1INZ A;  5C1D A;  3R7R A;  4WWP A;  5FZQ A;  1S63 A;  4QFV A;  4PS3 A;  4V3I A;  2DZN A;  3TWU A;  2NXP A;  1SA4 A;  4U63 A;  2M63 A;  3ZYQ A;  2X6J A;  1BPO A;  3UM2 A;  2R59 A;  4JEU A;  4I1A A;  4DI4 A;  3ONL A;  3ZVV A;  3FUM A;  4J0U A;  4L1B A;  4I6G A;  5G55 A;  4EEC A;  3FEY A;  3HXE A;  3I4G A;  5CER B;  4EZJ A;  1QBQ A;  1ELR A;  2P9L G;  1SW6 A;  4I1M A;  2CHX A;  2JEK A;  4PH4 B;  3CQG B;  3UIO C;  4CDN A;  2I1K A;  1HS6 A;  1VDY A;  1OWP A;  1H6K A;  4P29 A;  3AAA C;  3V2X A;  1ELK A;  3AS4 A;  3RRN B;  1PAQ A;  2X3M A;  4XKB A;  3V31 A;  5ENN A;  3C5R A;  4L2L A;  3DSX A;  5CHE E;  4GAA A;  1Z3Y A;  4K5C A;  2AJA A;  1FVF A;  3PH0 C;  3PS6 A;  1N52 A;  5B3S E;  2WXF A;  2WXJ A;  3PNL B;  1E7U A;  1K3Z D;  3ULE G;  3D9L A;  2OVB A;  5JJ7 A;  2JAB A;  3DPY A;  3PDN A;  2VJ8 A;  3B7R L;  2H6F A;  3CSF A;  3L08 A;  2GRN B;  2A5E A;  1MJ0 A;  2YHC A;  5B1A E;  4XI0 A;  1JWG A;  1W3B A;  4CEM A;  3TJP A;  3Q4A B;  3D9N A;  4CCA A;  2IOL A;  3D3M A;  4H7X A;  3B13 A;  5ARF A;  4UWF A;  3D9H A;  3SNX A;  3UT7 A;  3G2S A;  4TXP A;  3ZYK A;  3FTU A;  3BUA A;  4CGW A;  3LKU A;  3LVR E;  4CYM D;  3LPZ A;  4J8S A;  4A3T A;  4DX1 A;  3B7B A;  2HR2 A;  3ULQ A;  1IHB A;  2FUL A;  4NUR A;  4YDO A;  3PRZ A;  3ZYM A;  4ANU A;  2DZO A;  3D9J A;  4DX2 A;  3ZHE B;  4HNA D;  3FTZ A;  1OY3 D;  1ELW A;  4I1O B;  4O1P A;  3HG0 D;  1MX2 A;  4HQD A;  3UKU G;  5KBA A;  1NA3 A;  3T8M A;  4I2Z A;  4GTQ A;  5HI7 A;  2DIW A;  3LXU X;  5CBO A;  5EIB E;  3X2Q E;  4GTP A;  3DEP A;  2IO3 C;  2KCL A;  1ZU2 A;  4U0Z A;  4ILI A;  2WPV A;  3RO2 A;  1Y6I A;  2IY0 C;  3U3W A;  4AY5 A;  2ILR A;  3FUJ A;  2KZT A;  3MJW A;  1V55 E;  1SVX A;  4E6H A;  3TXN A;  1MX6 A;  3ASO E;  3JUI A;  2IF4 A;  2HYZ A;  1N54 A;  1WAO 1;  1Q2Z A;  3CHO A;  1NL4 A;  3TGO A;  2FO1 E;  2GRM A;  3D9O A;  2J07 A;  4BES A;  5G04 J;  1XGW A;  3SY2 A;  4C0M A;  3HHM A;  1FVH A;  3FU0 A;  1BD8 A;  1TYQ G;  3HVE B;  4GMR A;  4JHK A;  2LSU A;  4J8D A;  3NZS A;  2IJG X;  1OCC E;  3Q7A A;  3FFL A;  3KAE A;  1NZN A;  5BT1 A;  4WND A;  2KCK A;  2WXK A;  4EBA A;  1HE8 A;  2V5F A;  2B0O E;  3RJV A;  3UUX A;  2J09 A;  4K5B A;  3I4R B;  3P1U A;  4XE0 A;  1OCZ E;  3MA5 A;  4JW1 A;  3CK8 A;  3QWW A;  3QAR A;  4MBG A;  3CHP A;  3L22 A;  4G8K A;  3ESL A;  1IQU A;  3FUD A;  3Q75 A;  4GYW A;  4DRX E;  1UW4 B;  3CK9 A;  2RKK A;  4L7T A;  5CCL A;  4EQF A;  4KYO B;  4KMO A;  4HOU A;  2AWI A;  2WMN A;  4DK5 A;  5A7D B;  1LD7 A;  3DEO A;  4I43 A;  4DLQ A;  4PS7 A;  1OWO A;  2DVW A;  4FAD A;  2IU1 A;  1DCQ A;  3LS8 A;  3ML9 A;  1B89 A;  5FQ4 A;  3FTV A;  3SO8 A;  1GW6 A;  2B6C A;  4OYS A;  2R02 A;  4N39 A;  4AOF A;  2V4H C;  1N4Q A;  3QB2 A;  1LF8 A;  5T3R A;  3CHS A;  5KNH D;  3ZKJ A;  2CHW A;  5BPP A;  3TWV A;  4ZHB A;  3EHQ A;  3VLF A;  5BXO A;  2FBN A;  1Z5S C;  3VLE A;  2GRQ B;  1AWC B;  2VSN A;  3DXK G;  3CLJ A;  2OND A;  4K03 A;  3U9W A;  4YDY A;  3NOC D;  2NYJ A;  3D9I A;  3CVN A;  1DVP A;  2WXG A;  1FPP A;  5JJT A;  1Z6T A;  1U2V G;  4W9R A;  4B89 A;  3LY9 A;  5AJL A;  4KVO A;  4TXQ A;  1H2U A;  2CG3 A;  4RQI A;  1TJC A;  1HXI A;  3LY7 A;  1PY1 A;  1WM5 A;  1FT1 A;  4ANW A;  3SZ7 A;  4GA2 A;  3NB2 A;  1WY6 A;  4ANX A;  3NOG D;  3L13 A;  2FI7 A;  3HIZ A;  5ENR D;  3SHF A;  4GZC A;  2WM9 A;  4TUU A;  1EDU A;  5EN5 D;  2IEJ A;  3V2O A;  3W9G A;  4DX7 D;  4DX5 D;  3BQO A;  3AG2 E;  1N4P A;  4U04 A;  2XEH A;  2EIL E;  2GRO B;  5E75 A;  3GYZ A;  4F7A A;  2V0P A;  1EYH A;  4B8A A;  3CVU A;  4G1T A;  4LNB A;  4EPZ A;  3CVW A;  2H6G A;  2ETB A;  3CKB A;  4WWN A;  3FU5 A;  2AW6 A;  1QYM A;  3J5Q B;  4JZY A;  2QFC A;  3PE3 A;  3F6Q A;  4YND A;  3O48 A;  3MYV A;  3FTX A;  5FJY A;  3T8K A;  4F6R D;  4XIF A;  1K1A A;  4BTA A;  3KEZ A;  1EF1 C;  3QAQ A;  2OEW A;  4I9C A;  1H6P A;  3ASG A;  4I2W A;  3R9M A;  4QQI A;  3MKR A;  3E34 A;  5T4Y A;  3I3N A;  5CBN A;  3JUE A;  1U3D A;  2J08 A;  4BEP A;  2AXV A;  5KJN A;  4GCO A;  5ENQ D;  3AU5 A;  1MZC A;  4G11 A;  1X81 A;  3LVQ E;  4JPS A;  3UKR G;  2DYR E;  5AQ7 A;  4D10 C;  3UM0 A;  5CED B;  3ZPJ A;  2FF4 A;  4IRU A;  4AIF A;  1G3N B;  2WQ7 A;  3RIB A;  4CGV A;  3LEW A;  3VLD A;  2F8Y A;  5AQ9 A;  4BX9 A;  3T5X A;  3EU5 A;  4JA9 A;  1N4R A;  2RG8 A;  4U7E B;  4U8Y D;  5ANL A;  3EIJ A;  3Q5M A;  5FTP A;  4I6E A;  2XGM A;  2AXZ A;  3JYS A;  3QOU A;  5KNG A;  2XPY A;  3AJI A;  2XEN A;  3HYM B;  4RVB A;  4PS8 A;  4RG6 A;  5BV1 A;  4UWH A;  3ZXS A;  2KAT A;  4UWK A;  4XKC A;  1E8Z A;  5C2Y A;  4B8C B;  2DBA A;  4FUL A;  2LXL A;  3FTW A;  3PZ3 A;  3T5V A;  4CDM A;  3MV3 B;  3D9M A;  2XHE A;  2E0I A;  3EDT B;  2IFU A;  1N0Q A;  3LJN A;  3ZHE A;  3KSL A;  4U0S A;  3CKC A;  2MHK A;  3DST A;  2P9U G;  2XQ0 A;  4F1S A;  5JHB A;  4B93 B;  1JCS A;  3OXL A;  4HRN A;  1UJJ A;  3MZL B;  4XZ4 A;  3CIA A;  5FZS A;  3QNK A;  2C0M A;  3BEE A;  4J8Y A;  3AS8 A;  5DBK A;  4ILH B;  2XGS A;  3Q79 A;  2KZT B;  4FHK A; 
#chains in the Genus database with same CATH homology
 3AAA C;  2MYO A;  5CEC B;  3V30 A;  1AP7 A;  5FIN A;  4C48 B;  3V2X A;  3TWT A;  1WDY A;  3ZNG A;  1MX4 A;  2ETB A;  4U8Y D;  4N5Q A;  3J5P A;  1BD8 A;  3TWS A;  2DZO A;  4JB8 P;  5EYP F;  2VGE A;  3V31 A;  3C5R A;  4HNA D;  4DX2 A;  4O1O A;  4YDY A;  5KWD A;  1YYH A;  1UOH A;  4CZ2 D;  1OY3 D;  3NOC D;  4GMR A;  2NYJ A;  4O1P A;  3Q9U C;  3UI2 A;  3HG0 D;  4K5C A;  4BET A;  1MX2 A;  2XZD G;  4OAV B;  2AJA A;  2F37 A;  1QYM A;  3J5Q B;  4HQD A;  5KBA A;  2V5Q C;  3F6Q A;  5KNG A;  1IKN D;  4NIK A;  3ZU7 B;  3NBN B;  1BLX B;  4LG6 A;  4HRM B;  4F1P A;  1S70 B;  5ENS D;  4BSZ B;  1YMP A;  2XZT G;  2B0O E;  3AJI A;  4Z68 A;  1BU9 A;  4DX6 D;  4HLL A;  2DWZ A;  3T8K A;  3KEA A;  2XEN A;  1K3Z D;  4K5B A;  3TWR A;  4DUI A;  2KXP C;  2XEE A;  5EYL A;  1NFI E;  5CBO A;  2PNN A;  5JA4 D;  2KBX A;  5EIB E;  2JAB A;  4GPM A;  4F6R D;  1K1B A;  2ZGG A;  4HI9 A;  1K1A A;  5AN8 A;  2RFA A;  4TUM A;  4HI8 A;  1A5E A;  3UTM A;  3JXI A;  4G8K A;  5EID A;  2HE0 A;  3DEP A;  4HRL A;  4QFV A;  3EU9 A;  2A5E A;  3TWQ A;  5AAO A;  2QYJ A;  1MJ0 A;  3NOG D;  4QQI A;  4DRX E;  4OAU C;  2DZN A;  5BXU A;  4K5A B;  5ENO D;  3EHR A;  4U8V D;  5ENR D;  5ITZ F;  3TWU A;  1N11 A;  2Y1L E;  5CBN A;  2QC9 A;  4ATZ D;  3JUE A;  4HB5 A;  2ETA A;  5AQA A;  5EN5 D;  3B95 A;  5HKP A;  5CEA A;  1MYO A;  3W9F A;  4BEP A;  3V2O A;  3DEO A;  5AAR A;  3UXG A;  3Q9N C;  3W9G A;  4DX7 D;  5ENQ D;  1D9S A;  1N0Q A;  3LJN A;  2DVW A;  1BI8 B;  1DCQ A;  1SVX A;  5ENT D;  4DX5 D;  1MX6 A;  1WG0 A;  5JMN D;  4ZFH A;  3D9H A;  5AQ7 A;  2L6B A;  2ETC A;  2P2C P;  3IXE A;  4RLY A;  3SO8 A;  4A63 B;  4LSZ E;  2RFM A;  2J8S D;  4U96 D;  4HBD A;  5HRY A;  5CED B;  1YCS B;  2V4H C;  5CER B;  2XEH A;  1G3N B;  5D66 A;  1OT8 A;  3TWX A;  4B93 B;  4HRN A;  3JXJ A;  4G8L A;  2F8X K;  5AQB A;  5KNH D;  4U95 D;  2BKG A;  5HS0 A;  1SW6 A;  3ZKJ A;  2Y0B G;  5FIO A;  3TWV A;  2FO1 E;  4ZHB A;  3EHQ A;  2ZGD A;  4J8Y A;  4UUC A;  1TR4 A;  1DC2 A;  1N0R A;  4BER A;  3ZUV B;  3V79 K;  4YDW A;  4CYM D;  5BXO A;  1IXV A;  4J7W A;  2F8Y A;  5AQ9 A;  4BES A;  1BI7 B;  2BKK B;  4LNU D;  5EIL A;  4O60 A;  4DX1 A;  3HRA A;  3B7B A;  3T9K A;  1IHB A;  3TWW A;  5ENP D;  1AWC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...