5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
1BI8B 1YCSB 2FO1E 4DX7D 4BSZB 5CBNA 3EU9A 5CERB 5AARA 3JUEA 3EHQA 3Q9NC 4YDYA 1MJ0A 5AAOA 5HKPA 5ENSD 2XEHA 2KBXA 3D9HA 1WDYA 5ENPD 5EN5D 1SW6A 1QYMA 3TWVA 4K5AB 3W9FA 3F6QA 4O60A 1BU9A 3V2OA 4JB8P 1N0RA 2KXPC 2PNNA 3TWRA 1MX4A 2L6BA 4DX6D 1K1BA 3B95A 3ZU7B 5AN8A 5EIDA 3TWUA 5KWDA 3V2XA 3ZUVB 2VGEA 4LNUD 1MX6A 4HI8A 5CECB 1OT8A 3EHRA 2Y1LE 4ZFHA 1YMPA 4G8LA 1N11A 1A5EA 2V5QC 3ZKJA 4BETA 3J5PA 5ITZF 4O1OA 4C48B 5AQAA 2DZOA 4DX5D 3V30A 1MX2A 1MYOA 2XEEA 3KEAA 4GMRA 3W9GA 4BESA 4B93B 1K3ZD 3V79K 5ENOD 1D9SA 4DX2A 5EYPF 2ZGDA 4ZHBA 5D66A 2B0OE 4J8YA 2AJAA 3T9KA 1IKND 2J8SD 3T8KA 4F6RD 2F37A 4LG6A 1AP7A 3LJNA 3NBNB 2DVWA 4Z68A 4HRMB 5ENTD 1SVXA 4DX1A 4HLLA 4U8VD 2BKKB 3TWQA 3JXJA 4QQIA 3J5QB 5CEDB 5KNHD 3HRAA 4N5QA 4CYMD 2JABA 3NOGD 4OAVB 5KNGA 2BKGA 4U8YD 4OAUC 5CEAA 4RLYA 4U95D 4CZ2D 4K5BA 1DCQA 4J7WA 5AQ9A 5EILA 5JMND 4G8KA 4HBDA 5AQBA 2DWZA 1G3NB 3DEPA 4YDWA 1AWCB 5JA4D 4GPMA 1TR4A 4DRXE 2A5EA 4HNAD 2XZDG 5FINA 3TWXA 2XENA 5ENQD 3UI2A 3NOCD 1BI7B 2DZNA 2HE0A 4HQDA 3B7BA 4BEPA 5FIOA 3JXIA 2ETAA 5ENRD 1NFIE 1BLXB 4UUCA 1YYHA 5HS0A 3DEOA 4U96D 1UOHA 2QYJA 3V31A 2F8XK 5BXOA 3AJIA 5EIBE 2P2CP 4O1PA 3UTMA 5AQ7A 1K1AA 4DUIA 4NIKA 4BERA 1IXVA 4K5CA 2RFMA 1BD8A 2XZTG 3IXEA 4QFVA 4HB5A 4HRNA 2F8YA 2ETBA 3HG0D 3TWWA 3UXGA 4A63B 5CBOA 4TUMA 2ETCA 1DC2A 2RFAA 3TWSA 2NYJA 4HRLA 3TWTA 4ATZD 1WG0A 2QC9A 3Q9UC 2Y0BG 5HRYA 1OY3D 3SO8A 5KBAA 5BXUA 2ZGGA 1S70B 2V4HC 3C5RA 2MYOA 4LSZE 1IHBA 4HI9A 5EYLA 3ZNGA 4F1PA 3AAAC 1N0QA
chains in the Genus database with same CATH superfamily
5CBNA 4J6IA 2QY7A 5BNWA 2EILE 5BPPA 5ENPD 4G1TA 4JHRA 4AJWA 2DCPA 3CK9A 4I9EA 3Q5MA 1O1RA 2V0PA 3LYAA 5LCWJ 3NB2A 2WB2A 1ZB1A 5G05J 4BT9A 1SQMA 3T9KA 2OV8A 5DBKA 3FU5A 3FUIA 3E4BA 4U95D 3APCA 4C0EA 1TJCA 5G55A 1AWCB 4N3BA 4GPMA 3RO3A 4CDRA 2VGYA 5KJLA 1NZNA 5FZQA 4I9CA 1S63A 3ZN3A 4ANVA 5HS0A 1KT0A 3LJ3A 1SZAA 3V31A 4URKA 3CVUA 4X8QA 3IHVA 1K1AA 4AY6A 3GZSA 3ZPJA 5G05C 4HB5A 3URZA 1PC2A 3HDXA 4I1OB 3DPDA 3HXDA 4RG9A 4GCOA 2E0IA 3DPYA 4CDMA 2LNIA 4WWPA 4TXRA 4DX7D 3C72A 5BW8C 5AARA 3HXFA 4HLEA 4FHKA 2CG2A 1MJ0A 3MEKA 3D9HA 3SBSA 3D9KA 2V4LA 4YVQC 1FCHA 4GZ5A 1QBQA 1HE8A 3I3NA 4DI3A 3SBTB 2XGSA 4E85A 3ZKJA 1TN7A 2H6GA 3DSXA 1TNZA 4B93B 3EIJA 3SD5A 1D9SA 4NACA 4RQIA 5EYPF 4AVXA 2YINA 5G04C 1IKND 1SZ9A 2A4ZA 4EZKA 4U0SA 3OAWA 1Z3XA 2AW6A 3MA5A 3ABLE 3ASNE 1W3BA 4J8SA 1JWGA 4WWNA 4L2YA 4KBQA 3LY7A 1OCOE 4NURA 2H6FA 5LX8A 1H2UA 3TWXA 2B6CA 3UI2A 4JVSA 5D2MC 4XX5A 4YDOA 2HE0A 1MHQA 2WXHA 5CMYA 4A1SA 3Q75A 4PH4B 1X81A 4U07A 2WXRA 1OUVA 5JHAA 4A1GA 2BTDA 1TYQG 3U3WA 5FZRA 1OCRE 3TJPA 3UX4A 3S7DA 2WMNA 3ZYKA 3AU5A 2Q7FA 3LVQE 3DXMG 2X6JA 5EYLA 5T8IA 3RIBA 4HOQA 5LOZA 5JJ7A 1E8ZA 4HOSA 4U63A 3D9PA 3KAEA 3TL5A 2VGXA 2L6BA 4JD2G 4BX9A 3HVEA 3C3QA 4TRQA 3UM2A 3V2XA 5EX3A 5H7PA 2R05A 1MX6A 2WXLA 4BWRA 2KCVA 5C2YA 5ITZF 1MX2A 3CQGB 4E6HA 2YQ8A 1N95A 3L17A 3RO2A 4ZHBA 3LKUA 4RG6A 2AJAA 2J8SD 4UI9J 4BFRA 2NXPA 3HRAA 3ULEG 3PDNA 4OAUC 2LAHA 3FU3A 3L82A 1OWLA 3S2AA 5HQ8A 4TXQA 4FLBA 2XPZA 1YYHA 3DEOA 4U96D 3SQVA 4HXIA 3ZVVA 3GYZA 2F8XK 4B0ZA 3ML8A 3UTMA 2X6FA 3UKRG 1HG2A 3HXCA 1WG0A 2GRPB 3FUEA 1TNUA 3R9AB 4OVUA 3QB2A 3P1UA 3PE3A 4LSZE 3PVLA 1KLXA 2XS1A 3RRUA 4B8AA 5DIZA 4ILHB 4FP7A 4YDYA 3SHFA 2JLBA 4ATGA 4LNBA 2RD0A 4WNFA 1INZA 4GTTA 3FH5A 3B7RL 2FI7A 3SI5A 1HZ4A 3V2OA 5FQ7A 5M72A 4EHMA 4UQXA 2P9NG 3UIPC 5ARFA 3ZXPA 3ZEFA 4C48B 3CVLA 2EIKE 5FT9A 5JJTA 3FTXA 3PNLB 2B0OE 5HI7A 3QDNA 2LSVA 4HLLA 2P9KG 1DNPA 1DCQA 5AQ9A 3VLEA 3ABME 3HIZA 4DRXE 3PZ3A 4CT4A 3CLJA 5LFAA 4BY6A 4CDNA 4Q96A 1OWPA 2VSOE 3RK6A 3IKOB 2KC7A 3E32A 4XKBA 5LP0A 2XZTG 5A6CA 2ETBA 1DC2A 4GB9A 4HRLA 4N2SA 3X2QE 4U0UA 3DSWA 5BXUA 2YHEA 2IF4A 2DBAA 1K8KG 3PZ2A 4KZCA 2WXQA 4DJAA 2QYUA 2VJ8A 2WQHA 3JUIA 4A3VA 4GPKA 5BV1A 4ILGA 2XRYA 4JW1A 3EDTB 5KJKA 1E8YA 3FULA 4AP2A 4BETA 3J5PA 4XI9A 5C1DA 4G24A 3GZ2A 4GMRA 2LO6A 3ABKE 1KZOA 3ULYA 5ENOD 4BX8A 4DX2A 2QFCA 4GYWA 3TG4A 1OWOA 3TGOA 4UWFA 3ENEA 2WXPA 4Z68A 4RSYA 4MS6A 1L5JA 4QQIA 3FUKA 2BKGA 4RVBA 3FU0A 4KVMA 3CVYA 1JCSA 3Q73A 5J90A 5CCMA 3PUKA 5AJDA 3FTYA 2XENA 4I2WA 3EIQC 4BT8A 3RAUA 5FIOA 2CHZA 4GTPA 2VSYA 5FJYA 3PRZA 5EIBE 3ONLA 4XIFA 1DVPA 1IXVA 5AENA 1FPPA 3TWTA 4CEMA 2WXFA 2Y4UA 2ZGGA 3CVVA 5ARGA 3C3OA 1EDUA 3VLFA 3CSFA 3NQPA 3JUEA 2WXMA 5ENSD 1HO8A 2LUHA 3RSEG 3LPZA 3R7QA 4OVVA 4G26A 1E7UA 2Y4TA 3HYMB 4DLOA 2L9BA 3ESKA 2LSUA 5ANLA 3EHRA 1NA0A 2V5QC 4J0UA 4O1OA 4BESA 2L6JA 3ZXSA 1IQRA 2I1JA 3ISMC 2P9IG 1ZBPA 4HRMB 3IV0A 3UPVA 4O6FA 3TWQA 2VTBA 2LAIA 3J5QB 1FVHA 4G25A 4ANUA 3CR3A 3PH0C 4FA6A 1TNOA 2NSZA 4YDWA 3EUVA 2V5FA 4G2VA 2FF4A 1O5MA 4HQDA 4JC8A 1E90A 3JXIA 2OEWA 1P5QA 2EQXA 2Y69E 3UM1A 5FQ6A 3MJWA 3RKVA 2GRNB 5AIJA 4GZDA 4NIKA 3DXKG 3CKCA 3UXGA 3LY9A 2FBNA 3HG0D 3GZ1A 3CHOA 1FT1A 2RFAA 3KEZA 4J8EA 5A23A 3ASGA 2CFUA 2WVIA 3GW4A 3L22A 1TN6A 2J07A 3IHYA 4JEHA 4NQ0A 4UI9K 4JA9A 4DK5A 2WXGA 3FEYA 3LCAA 4FLHA 1NP7A 1V54E 2C0LA 3JYSA 2X3MA 4XI0A 4F7AA 3FUFA 2PQNA 3ZYMA 1LF8A 3ZUVB 3CVWA 4D10C 2ILRA 4U04A 3U9WA 5IY5E 3B7UX 1LD7A 1QQEA 3ASHA 3FTWA 4IN3B 3SFZA 1PY1A 5ENTD 4F1SA 2BKKB 4EZJA 3Q7AA 5B3SE 3L9TA 5CEDB 3DSTA 4RLYA 4G8KA 2RG8A 3FP3A 4CGVA 1O1SA 4NRHB 3G2TA 5FINA 4JXTA 4J8DA 3CHMA 3E33A 5FQ4A 1X5BA 4GTOA 2GW1A 4WAFA 4UUCA 3LY8A 5FTPA 1LTXA 3VTYA 3L54A 4AEZC 2GRLA 4CGWA 2YHCA 3TAXA 3Q15A 2CG3A 3EHNA 1MZCA 3MGBA 3PEVB 3PS6A 1GW6A 3SO8A 4GAAA 2VGXB 5KBAA 3FUNA 2XQ0A 4LEUA 4WNGA 3L08A 2UY1B 2MYOA 2I9CA 3ZNGA 3MV2B 1N0QA 3ZU7B 1HG5A 1D8EA 3Q9NC 4TV3A 2ZISA 5LCWC 3QWWA 3MCXA 4K5AB 4FJZA 3I4GA 1N0RA 4UWHA 3NZSA 4ME2A 1K1BA 3B7TA 5KWDA 1VDYA 3S7BA 4MBGA 4ZFHA 3CV0A 4UWKA 1YA0A 3IEGA 4L23A 2IY0C 1XNFA 3V30A 4I1MA 3KEAA 2R5SA 2ZXWE 1H19A 3HXBA 4I17A 4XZ4A 4J8YA 4BTBA 4EECA 2CHWA 2OCCE 4N5CA 1FT2A 5KNHD 3LVRE 1B89A 2A5UA 5KJNA 4K03A 3ZIMA 4N39A 4HBDA 2IQCA 2LXMA 5EKQD 1QZ2A 4YVOA 4GA0A 4A3TA 1TNYA 1EF1C 1U3CA 3JQ0A 3D9LA 5ENRD 2DYSE 4WNEA 1UW4B 4O1PA 3FH7A 4GZ3A 5FZSA 3AS5A 4QFVA 2F8YA 2XGMA 2GROB 4XE0A 3MZLB 3PREA 4GU5A 1OY3D 3D9JA 2HO1A 2WXNA 2VSXE 5CCLA 2V4HC 1UN9A 4GZCA 3ASFA 2IOSA 1SA4A 1UN8A 2KCKA 3PEUB 5HKPA 3LDZA 2HYZA 4GTRA 4GCNA 4L2LA 5E75A 3I5PA 1HS6A 2OVFA 5AJLA 3IBEA 3KSLA 2KXPC 2PNNA 2P9LG 4Q69A 3ULQA 2MRIA 4U8HA 3UM3A 3CHRA 1EPUA 3Q4AB 2IOLA 3TG5A 4N2QA 3KSQA 3QKYA 2BEDA 3PE4A 1AP7A 3SNXA 2XCBA 4B89A 4HOTA 2PZIA 3JXJA 3RU0A 4ILIA 3NOGD 5CEAA 5D0OD 3AG2E 3R9MA 5EILA 3ASOE 3C98A 1DCEA 4CT0A 4DI4A 3FY4A 3JQ1A 4GMJA 3B7BA 3QWPA 3MKQB 5ENNA 3U66A 4G11A 2KATA 2PQRA 3SY2A 3SZ7A 4JPSA 4ANXA 2EIME 3IXEA 2Y3AA 5BUZA 1Y6IA 3PZDA 3B7SA 4AM9A 4JL0A 2DYRE 5HRYA 4XEIG 1UJKA 3C3RA 3MKRA 2YNQA 3PZ1A 3AAAC 4HI8A 4IULA 4L9PA 3UINC 3DWLG 5AYWD 2FEZA 2L0TB 2P9UG 4U7EB 3ESLA 5T3RA 2J08A 4APFA 2GRMA 3D9NA 4CCAA 1OWMA 1MX4A 4GYOA 2OVBA 2KCLA 5FWQA 3T5XA 4HS2A 5CECB 2Y1LE 2OOEA 4KVOA 3T8MA 1NA3A 1MYOA 3ZFWA 1K3ZD 2R02A 5KJMA 2J09A 2J9QA 3VTXA 4C9BB 3QARA 2MHKA 1SVXA 4DX1A 2RKKA 1RW2A 2ONDA 4K0RA 3CGHA 4W9RA 3L6AA 4I6GA 3APDA 3O48A 1TJFA 3I4RB 1ZU2A 2IEJA 3CK7A 2C0MA 1ELRA 2FULA 3D3MA 2PL2A 3AG3E 4UI9C 4EQFA 3AJIA 5D0QD 2FO7A 2RFMA 1BD8A 5E76A 3DSUA 4AOFA 2VYIA 3OTNA 4HORA 5B1AE 3R7RA 3AG4E 5EX0A 4G8LA 1H2VC 4DUIA 2FO1E 1HXIA 4BSZB 2XGOA 2EINE 4L7TA 5AAOA 4FJYA 1WDYA 2WXKA 5EN5D 3W9FA 3G2WA 2IJGX 3BEEA 3D9IA 3NAWA 4LNUD 4EPZA 4J8FA 2M63A 2WQ7A 2P9SG 4PS8A 3E34A 1N4RA 4EBAA 4ACLA 1U2VG 2L0IA 3Q7FA 4F6RD 4UQZA 1KT1A 5G2NA 3N71A 2IU1A 4KMOA 4N5QA 4YNDA 2JABA 1EYHA 3UKUG 2UY1A 4J7WA 5JMND 3O4ZA 3ZW3A 1TR4A 2XEVA 2ZU6B 5BT1A 1N54A 4PS3A 2DZNA 2WQ6A 1NFIE 1BLXB 1HFAA 5T4YA 4AY5A 2J49A 3KD7A 4HFGA 3Q49B 3G2UA 4N3AA 4GMLA 4TUMA 4PUCA 3QWVA 2ZIRA 4C0MA 3KS2A 1IHBA 5G04J 4APOA 1BI8B 1H6OA 3EU9A 3Q78A 1TNBA 3MV3B 1E8XA 3CHQA 2XHEA 2VTBB 2DIWA 1OXJA 1BU9A 1QNFA 3TWRA 5CRVA 3L16A 5EIDA 3ASDA 4ABNA 4MKTA 3AG1E 1N9AA 1TN8A 5JJ6A 4JHJA 3V79K 4GTVA 5FQ8A 4A55A 1HX8A 2E2EA 3Q79A 4H7XA 4I1AA 1JCQA 1JUQA 3QAQA 4U8YD 3QC1A 1N52A 4K5BA 3D9OA 3HVEB 3CVXA 5AQBA 1IYGA 3MYVA 5JA4D 3FUDA 2PM7A 4FHJA 3CIAA 4B94A 3K9IA 2AXUA 4BEPA 2WMOA 4H7YA 2P2CP 3EJNA 4TXPA 4BSXA 4GYYA 3FFLA 3TXNA 3BQOA 3CSTA 4A63B 3TWSA 2PM6A 4F53A 3CKBA 3CVQA 3HXEA 3FU6A 4PDXA 4FADA 4MLPA 1U3DA 4G23A 3EHQA 3ONKA 3EHMA 2XEHA 2AWIA 2WM9A 4EZLA 1S64A 4O60A 2MOWA 1JCRA 3WG7E 3TWUA 2X6IA 2UWJG 5A7DB 4BTAA 3FTVA 3S7JA 3BG1B 4HOUA 3MKQA 4DX5D 2CFZA 4AXHA 3CVNA 3W9GA 1ELWA 1HF8A 2F37A 4LG6A 4UWGA 3VLDA 2XPIA 3BG0B 2WXJA 3APFA 1UG3A 4CYMD 4UWLA 3FUHA 4JZYA 1E96B 2DWZA 1G3NB 3CEQA 4M7CA 2A5EA 4M3OA 4EBAG 5ENQD 3HHMA 4UQYA 3CQCB 3FDHA 2ETAA 3UMVA 1A17A 2AVPA 2HM8A 4GTSA 4K5CA 2AXZA 2R2LA 5CBOA 4ATZD 4WNDA 1HH8A 1N4QA 1JPLA 3U64A 1SA5A 4XKCA 4HVBA 4AV7A 3T5VA 2R03A 4F1PA 4CRWA 2C2LA 4KXKB 3UM0A 2J4DA 4KT6B 2KBXA 3SFYA 3SGHA 3ZRHA 3AS4A 3S7FA 3UT8A 2R17C 3TWVA 3F6QA 3QJZA 2J4BA 4DX6D 1Y8MA 5AN8A 2P58C 4WUYA 1Z3YA 3DRAA 1N4SA 1HU3A 4GA1A 5D66A 3AS8A 4Y6WA 1PAQA 1D8DA 2I2OA 3ZYQA 3LJNA 2DVWA 5CRUA 2BF0X 2I1KA 3E37A 2IFUA 3ZHEA 3L13A 4MRUA 5KNGA 4LRZA 4Y6CA 2I6HA 1MQSA 3UUXA 2HR2A 4HNAD 4U0ZA 5CMWA 2GGFA 4LERA 2IONA 4KYOB 3FUMA 1H0AA 4GTQA 2F0YA 3ML9A 1UOHA 2QYJA 2R59A 5AQ7A 3RJVA 4BERA 3ZGQA 3BU8A 1OCCE 3TWWA 4JHKA 2ETCA 2NYJA 2QC9A 1H6PA 3UT7A 4F3VA 2X6KA 3EU5A 4JEUA 5CHEE 1FVFA 4FULA 3CK8A 1V55E 5JHBA 4ACKA 1QYMA 4JB8P 3BUAA 1Z6TA 4OYSA 3FUJA 3RRMB 1UJJA 4ANWA 3B13A 2EIJE 4R7LA 4B8CB 4GA2A 1N11A 3G2SA 3QK0A 2VQ2A 4V3IA 5AQAA 1KZPA 3FTSA 3QNKA 4GZ6A 2XRZA 5KCMA 3T8KA 1WAO1 3NZUA 1OWNA 4TUUA 4I43A 3WXXA 3DSSA 1BPOA 1WM5A 4LCTA 3RRNB 1OCZE 3OXLA 4OAVB 4FC8A 5BV0A 1S0PA 4JA7A 4CZ2D 3UT4A 3UQ3A 4IRUA 1IQUA 3FEXA 5J08A 3D9MA 2X6HA 3E30A 3AU4A 4DLQA 3ZHEB 2NC9A 4P29A 1N4PA 3NOCD 3CHSA 4YDEA 1BI7B 2BUGA 3FTUA 1E7VA 3Q47B 2GRQB 2OEVA 3QOUA 3CVPA 4I2ZA 3TXMA 3FWVA 2IO3C 4I6EA 3Q9UC 3LS8A 2AXVA 2LXLA 3OXGA 3SFXA 4HI9A 1YCSB 1H2TC 5CERB 3FH8A 1Q2ZA 2X38A 4DPRA 4KZ0A 1H6KA 2KZTB 1WY6A 3PNTB 1SW6A 3OXFA 3CHPA 1NI1A 3G2VA 3B95A 5EDSA 4I6JA 2XPYA 3P2BA 2VGEA 2KM4A 1OT8A 3DSVA 3LXUX 1YMPA 1A5EA 1E8WA 1N94A 2QZAA 2DZOA 4LUNU 1JWFA 3ZYLA 4FU3A 2VSNA 2XEEA 4AIFA 2WPVA 1XGWA 2JEKA 4LNGA 1ELKA 3JCKC 2ZGDA 1IHGA 3FTZA 2V8SE 3FHEA 3NBNB 2XCCA 3LEWA 4U8VD 4L1BA 3PZ4A 5B1BE 3DBSA 4GTMA 2P9PG 2KZTA 3MX3A 4IYPA 2IO2C 1KPSB 4N3CA 3DEPA 2XS8A 2XZDG 1RZ4A 2H6HA 4WWOA 1NL4A 2H6IA 1TEZA 2CHXA 2GRRB 2WXOA 1O1TA 5BXOA 1LD8A 3NF1A 5ANRA 4Q94A 4HRNA 3UIOC 1Z5SC 3SF4A 3PUJA 2Y0BG 4PS7A 1S70B 3U4TA 3C5RA 2WXIA
chains in the Genus database with same CATH topology
1BI8B 1YCSB 2FO1E 4DX7D 4BSZB 5CBNA 3EU9A 5CERB 5AARA 3JUEA 3EHQA 3Q9NC 4YDYA 1MJ0A 5AAOA 5HKPA 5ENSD 2XEHA 2KBXA 3D9HA 1WDYA 5ENPD 5EN5D 1SW6A 1QYMA 3TWVA 4K5AB 3W9FA 3F6QA 4O60A 1BU9A 3V2OA 4JB8P 1N0RA 2KXPC 2PNNA 3TWRA 1MX4A 2L6BA 4DX6D 1K1BA 3B95A 3ZU7B 5AN8A 5EIDA 3TWUA 5KWDA 3V2XA 3ZUVB 2VGEA 4LNUD 1MX6A 4HI8A 5CECB 1OT8A 3EHRA 2Y1LE 4ZFHA 1YMPA 4G8LA 1N11A 1A5EA 2V5QC 3ZKJA 4BETA 3J5PA 5ITZF 4O1OA 4C48B 5AQAA 2DZOA 4DX5D 3V30A 1MX2A 1MYOA 2XEEA 3KEAA 4GMRA 3W9GA 4BESA 4B93B 1K3ZD 3V79K 5ENOD 1D9SA 4DX2A 5EYPF 2ZGDA 4ZHBA 5D66A 2B0OE 4J8YA 2AJAA 3T9KA 1IKND 2J8SD 3T8KA 4F6RD 2F37A 4LG6A 1AP7A 3LJNA 3NBNB 2DVWA 4Z68A 4HRMB 5ENTD 1SVXA 4DX1A 4HLLA 4U8VD 2BKKB 3TWQA 3JXJA 4QQIA 3J5QB 5CEDB 5KNHD 3HRAA 4N5QA 4CYMD 2JABA 3NOGD 4OAVB 5KNGA 2BKGA 4U8YD 4OAUC 5CEAA 4RLYA 4U95D 4CZ2D 4K5BA 1DCQA 4J7WA 5AQ9A 5EILA 5JMND 4G8KA 4HBDA 5AQBA 2DWZA 1G3NB 3DEPA 4YDWA 1AWCB 5JA4D 4GPMA 1TR4A 4DRXE 2A5EA 4HNAD 2XZDG 5FINA 3TWXA 2XENA 5ENQD 3UI2A 3NOCD 1BI7B 2DZNA 2HE0A 4HQDA 3B7BA 4BEPA 5FIOA 3JXIA 2ETAA 5ENRD 1NFIE 1BLXB 4UUCA 1YYHA 5HS0A 3DEOA 4U96D 1UOHA 2QYJA 3V31A 2F8XK 5BXOA 3AJIA 5EIBE 2P2CP 4O1PA 3UTMA 5AQ7A 1K1AA 4DUIA 4NIKA 4BERA 1IXVA 4K5CA 2RFMA 1BD8A 2XZTG 3IXEA 4QFVA 4HB5A 4HRNA 2F8YA 2ETBA 3HG0D 3TWWA 3UXGA 4A63B 5CBOA 4TUMA 2ETCA 1DC2A 2RFAA 3TWSA 2NYJA 4HRLA 3TWTA 4ATZD 1WG0A 2QC9A 3Q9UC 2Y0BG 5HRYA 1OY3D 3SO8A 5KBAA 5BXUA 2ZGGA 1S70B 2V4HC 3C5RA 2MYOA 4LSZE 1IHBA 4HI9A 5EYLA 3ZNGA 4F1PA 3AAAC 1N0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI8 B;  1YCS B;  2FO1 E;  4DX7 D;  4BSZ B;  5CBN A;  3EU9 A;  5CER B;  5AAR A;  3JUE A;  3EHQ A;  3Q9N C;  4YDY A;  1MJ0 A;  5AAO A;  5HKP A;  5ENS D;  2XEH A;  2KBX A;  3D9H A;  1WDY A;  5ENP D;  5EN5 D;  1SW6 A;  1QYM A;  3TWV A;  4K5A B;  3W9F A;  3F6Q A;  4O60 A;  1BU9 A;  3V2O A;  4JB8 P;  1N0R A;  2KXP C;  2PNN A;  3TWR A;  1MX4 A;  2L6B A;  4DX6 D;  1K1B A;  3B95 A;  3ZU7 B;  5AN8 A;  5EID A;  3TWU A;  5KWD A;  3V2X A;  3ZUV B;  2VGE A;  4LNU D;  1MX6 A;  4HI8 A;  5CEC B;  1OT8 A;  3EHR A;  2Y1L E;  4ZFH A;  1YMP A;  4G8L A;  1N11 A;  1A5E A;  2V5Q C;  3ZKJ A;  4BET A;  3J5P A;  5ITZ F;  4O1O A;  4C48 B;  5AQA A;  2DZO A;  4DX5 D;  3V30 A;  1MX2 A;  1MYO A;  2XEE A;  3KEA A;  4GMR A;  3W9G A;  4BES A;  4B93 B;  1K3Z D;  3V79 K;  5ENO D;  1D9S A;  4DX2 A;  5EYP F;  2ZGD A;  4ZHB A;  5D66 A;  2B0O E;  4J8Y A;  2AJA A;  3T9K A;  1IKN D;  2J8S D;  3T8K A;  4F6R D;  2F37 A;  4LG6 A;  1AP7 A;  3LJN A;  3NBN B;  2DVW A;  4Z68 A;  4HRM B;  5ENT D;  1SVX A;  4DX1 A;  4HLL A;  4U8V D;  2BKK B;  3TWQ A;  3JXJ A;  4QQI A;  3J5Q B;  5CED B;  5KNH D;  3HRA A;  4N5Q A;  4CYM D;  2JAB A;  3NOG D;  4OAV B;  5KNG A;  2BKG A;  4U8Y D;  4OAU C;  5CEA A;  4RLY A;  4U95 D;  4CZ2 D;  4K5B A;  1DCQ A;  4J7W A;  5AQ9 A;  5EIL A;  5JMN D;  4G8K A;  4HBD A;  5AQB A;  2DWZ A;  1G3N B;  3DEP A;  4YDW A;  1AWC B;  5JA4 D;  4GPM A;  1TR4 A;  4DRX E;  2A5E A;  4HNA D;  2XZD G;  5FIN A;  3TWX A;  2XEN A;  5ENQ D;  3UI2 A;  3NOC D;  1BI7 B;  2DZN A;  2HE0 A;  4HQD A;  3B7B A;  4BEP A;  5FIO A;  3JXI A;  2ETA A;  5ENR D;  1NFI E;  1BLX B;  4UUC A;  1YYH A;  5HS0 A;  3DEO A;  4U96 D;  1UOH A;  2QYJ A;  3V31 A;  2F8X K;  5BXO A;  3AJI A;  5EIB E;  2P2C P;  4O1P A;  3UTM A;  5AQ7 A;  1K1A A;  4DUI A;  4NIK A;  4BER A;  1IXV A;  4K5C A;  2RFM A;  1BD8 A;  2XZT G;  3IXE A;  4QFV A;  4HB5 A;  4HRN A;  2F8Y A;  2ETB A;  3HG0 D;  3TWW A;  3UXG A;  4A63 B;  5CBO A;  4TUM A;  2ETC A;  1DC2 A;  2RFA A;  3TWS A;  2NYJ A;  4HRL A;  3TWT A;  4ATZ D;  1WG0 A;  2QC9 A;  3Q9U C;  2Y0B G;  5HRY A;  1OY3 D;  3SO8 A;  5KBA A;  5BXU A;  2ZGG A;  1S70 B;  2V4H C;  3C5R A;  2MYO A;  4LSZ E;  1IHB A;  4HI9 A;  5EYL A;  3ZNG A;  4F1P A;  3AAA C;  1N0Q A; 
#chains in the Genus database with same CATH topology
 5CBN A;  4J6I A;  2QY7 A;  5BNW A;  2EIL E;  5BPP A;  5ENP D;  4G1T A;  4JHR A;  4AJW A;  2DCP A;  3CK9 A;  4I9E A;  3Q5M A;  1O1R A;  2V0P A;  3LYA A;  5LCW J;  3NB2 A;  2WB2 A;  1ZB1 A;  5G05 J;  4BT9 A;  1SQM A;  3T9K A;  2OV8 A;  5DBK A;  3FU5 A;  3FUI A;  3E4B A;  4U95 D;  3APC A;  4C0E A;  1TJC A;  5G55 A;  1AWC B;  4N3B A;  4GPM A;  3RO3 A;  4CDR A;  2VGY A;  5KJL A;  1NZN A;  5FZQ A;  4I9C A;  1S63 A;  3ZN3 A;  4ANV A;  5HS0 A;  1KT0 A;  3LJ3 A;  1SZA A;  3V31 A;  4URK A;  3CVU A;  4X8Q A;  3IHV A;  1K1A A;  4AY6 A;  3GZS A;  3ZPJ A;  5G05 C;  4HB5 A;  3URZ A;  1PC2 A;  3HDX A;  4I1O B;  3DPD A;  3HXD A;  4RG9 A;  4GCO A;  2E0I A;  3DPY A;  4CDM A;  2LNI A;  4WWP A;  4TXR A;  4DX7 D;  3C72 A;  5BW8 C;  5AAR A;  3HXF A;  4HLE A;  4FHK A;  2CG2 A;  1MJ0 A;  3MEK A;  3D9H A;  3SBS A;  3D9K A;  2V4L A;  4YVQ C;  1FCH A;  4GZ5 A;  1QBQ A;  1HE8 A;  3I3N A;  4DI3 A;  3SBT B;  2XGS A;  4E85 A;  3ZKJ A;  1TN7 A;  2H6G A;  3DSX A;  1TNZ A;  4B93 B;  3EIJ A;  3SD5 A;  1D9S A;  4NAC A;  4RQI A;  5EYP F;  4AVX A;  2YIN A;  5G04 C;  1IKN D;  1SZ9 A;  2A4Z A;  4EZK A;  4U0S A;  3OAW A;  1Z3X A;  2AW6 A;  3MA5 A;  3ABL E;  3ASN E;  1W3B A;  4J8S A;  1JWG A;  4WWN A;  4L2Y A;  4KBQ A;  3LY7 A;  1OCO E;  4NUR A;  2H6F A;  5LX8 A;  1H2U A;  3TWX A;  2B6C A;  3UI2 A;  4JVS A;  5D2M C;  4XX5 A;  4YDO A;  2HE0 A;  1MHQ A;  2WXH A;  5CMY A;  4A1S A;  3Q75 A;  4PH4 B;  1X81 A;  4U07 A;  2WXR A;  1OUV A;  5JHA A;  4A1G A;  2BTD A;  1TYQ G;  3U3W A;  5FZR A;  1OCR E;  3TJP A;  3UX4 A;  3S7D A;  2WMN A;  3ZYK A;  3AU5 A;  2Q7F A;  3LVQ E;  3DXM G;  2X6J A;  5EYL A;  5T8I A;  3RIB A;  4HOQ A;  5LOZ A;  5JJ7 A;  1E8Z A;  4HOS A;  4U63 A;  3D9P A;  3KAE A;  3TL5 A;  2VGX A;  2L6B A;  4JD2 G;  4BX9 A;  3HVE A;  3C3Q A;  4TRQ A;  3UM2 A;  3V2X A;  5EX3 A;  5H7P A;  2R05 A;  1MX6 A;  2WXL A;  4BWR A;  2KCV A;  5C2Y A;  5ITZ F;  1MX2 A;  3CQG B;  4E6H A;  2YQ8 A;  1N95 A;  3L17 A;  3RO2 A;  4ZHB A;  3LKU A;  4RG6 A;  2AJA A;  2J8S D;  4UI9 J;  4BFR A;  2NXP A;  3HRA A;  3ULE G;  3PDN A;  4OAU C;  2LAH A;  3FU3 A;  3L82 A;  1OWL A;  3S2A A;  5HQ8 A;  4TXQ A;  4FLB A;  2XPZ A;  1YYH A;  3DEO A;  4U96 D;  3SQV A;  4HXI A;  3ZVV A;  3GYZ A;  2F8X K;  4B0Z A;  3ML8 A;  3UTM A;  2X6F A;  3UKR G;  1HG2 A;  3HXC A;  1WG0 A;  2GRP B;  3FUE A;  1TNU A;  3R9A B;  4OVU A;  3QB2 A;  3P1U A;  3PE3 A;  4LSZ E;  3PVL A;  1KLX A;  2XS1 A;  3RRU A;  4B8A A;  5DIZ A;  4ILH B;  4FP7 A;  4YDY A;  3SHF A;  2JLB A;  4ATG A;  4LNB A;  2RD0 A;  4WNF A;  1INZ A;  4GTT A;  3FH5 A;  3B7R L;  2FI7 A;  3SI5 A;  1HZ4 A;  3V2O A;  5FQ7 A;  5M72 A;  4EHM A;  4UQX A;  2P9N G;  3UIP C;  5ARF A;  3ZXP A;  3ZEF A;  4C48 B;  3CVL A;  2EIK E;  5FT9 A;  5JJT A;  3FTX A;  3PNL B;  2B0O E;  5HI7 A;  3QDN A;  2LSV A;  4HLL A;  2P9K G;  1DNP A;  1DCQ A;  5AQ9 A;  3VLE A;  3ABM E;  3HIZ A;  4DRX E;  3PZ3 A;  4CT4 A;  3CLJ A;  5LFA A;  4BY6 A;  4CDN A;  4Q96 A;  1OWP A;  2VSO E;  3RK6 A;  3IKO B;  2KC7 A;  3E32 A;  4XKB A;  5LP0 A;  2XZT G;  5A6C A;  2ETB A;  1DC2 A;  4GB9 A;  4HRL A;  4N2S A;  3X2Q E;  4U0U A;  3DSW A;  5BXU A;  2YHE A;  2IF4 A;  2DBA A;  1K8K G;  3PZ2 A;  4KZC A;  2WXQ A;  4DJA A;  2QYU A;  2VJ8 A;  2WQH A;  3JUI A;  4A3V A;  4GPK A;  5BV1 A;  4ILG A;  2XRY A;  4JW1 A;  3EDT B;  5KJK A;  1E8Y A;  3FUL A;  4AP2 A;  4BET A;  3J5P A;  4XI9 A;  5C1D A;  4G24 A;  3GZ2 A;  4GMR A;  2LO6 A;  3ABK E;  1KZO A;  3ULY A;  5ENO D;  4BX8 A;  4DX2 A;  2QFC A;  4GYW A;  3TG4 A;  1OWO A;  3TGO A;  4UWF A;  3ENE A;  2WXP A;  4Z68 A;  4RSY A;  4MS6 A;  1L5J A;  4QQI A;  3FUK A;  2BKG A;  4RVB A;  3FU0 A;  4KVM A;  3CVY A;  1JCS A;  3Q73 A;  5J90 A;  5CCM A;  3PUK A;  5AJD A;  3FTY A;  2XEN A;  4I2W A;  3EIQ C;  4BT8 A;  3RAU A;  5FIO A;  2CHZ A;  4GTP A;  2VSY A;  5FJY A;  3PRZ A;  5EIB E;  3ONL A;  4XIF A;  1DVP A;  1IXV A;  5AEN A;  1FPP A;  3TWT A;  4CEM A;  2WXF A;  2Y4U A;  2ZGG A;  3CVV A;  5ARG A;  3C3O A;  1EDU A;  3VLF A;  3CSF A;  3NQP A;  3JUE A;  2WXM A;  5ENS D;  1HO8 A;  2LUH A;  3RSE G;  3LPZ A;  3R7Q A;  4OVV A;  4G26 A;  1E7U A;  2Y4T A;  3HYM B;  4DLO A;  2L9B A;  3ESK A;  2LSU A;  5ANL A;  3EHR A;  1NA0 A;  2V5Q C;  4J0U A;  4O1O A;  4BES A;  2L6J A;  3ZXS A;  1IQR A;  2I1J A;  3ISM C;  2P9I G;  1ZBP A;  4HRM B;  3IV0 A;  3UPV A;  4O6F A;  3TWQ A;  2VTB A;  2LAI A;  3J5Q B;  1FVH A;  4G25 A;  4ANU A;  3CR3 A;  3PH0 C;  4FA6 A;  1TNO A;  2NSZ A;  4YDW A;  3EUV A;  2V5F A;  4G2V A;  2FF4 A;  1O5M A;  4HQD A;  4JC8 A;  1E90 A;  3JXI A;  2OEW A;  1P5Q A;  2EQX A;  2Y69 E;  3UM1 A;  5FQ6 A;  3MJW A;  3RKV A;  2GRN B;  5AIJ A;  4GZD A;  4NIK A;  3DXK G;  3CKC A;  3UXG A;  3LY9 A;  2FBN A;  3HG0 D;  3GZ1 A;  3CHO A;  1FT1 A;  2RFA A;  3KEZ A;  4J8E A;  5A23 A;  3ASG A;  2CFU A;  2WVI A;  3GW4 A;  3L22 A;  1TN6 A;  2J07 A;  3IHY A;  4JEH A;  4NQ0 A;  4UI9 K;  4JA9 A;  4DK5 A;  2WXG A;  3FEY A;  3LCA A;  4FLH A;  1NP7 A;  1V54 E;  2C0L A;  3JYS A;  2X3M A;  4XI0 A;  4F7A A;  3FUF A;  2PQN A;  3ZYM A;  1LF8 A;  3ZUV B;  3CVW A;  4D10 C;  2ILR A;  4U04 A;  3U9W A;  5IY5 E;  3B7U X;  1LD7 A;  1QQE A;  3ASH A;  3FTW A;  4IN3 B;  3SFZ A;  1PY1 A;  5ENT D;  4F1S A;  2BKK B;  4EZJ A;  3Q7A A;  5B3S E;  3L9T A;  5CED B;  3DST A;  4RLY A;  4G8K A;  2RG8 A;  3FP3 A;  4CGV A;  1O1S A;  4NRH B;  3G2T A;  5FIN A;  4JXT A;  4J8D A;  3CHM A;  3E33 A;  5FQ4 A;  1X5B A;  4GTO A;  2GW1 A;  4WAF A;  4UUC A;  3LY8 A;  5FTP A;  1LTX A;  3VTY A;  3L54 A;  4AEZ C;  2GRL A;  4CGW A;  2YHC A;  3TAX A;  3Q15 A;  2CG3 A;  3EHN A;  1MZC A;  3MGB A;  3PEV B;  3PS6 A;  1GW6 A;  3SO8 A;  4GAA A;  2VGX B;  5KBA A;  3FUN A;  2XQ0 A;  4LEU A;  4WNG A;  3L08 A;  2UY1 B;  2MYO A;  2I9C A;  3ZNG A;  3MV2 B;  1N0Q A;  3ZU7 B;  1HG5 A;  1D8E A;  3Q9N C;  4TV3 A;  2ZIS A;  5LCW C;  3QWW A;  3MCX A;  4K5A B;  4FJZ A;  3I4G A;  1N0R A;  4UWH A;  3NZS A;  4ME2 A;  1K1B A;  3B7T A;  5KWD A;  1VDY A;  3S7B A;  4MBG A;  4ZFH A;  3CV0 A;  4UWK A;  1YA0 A;  3IEG A;  4L23 A;  2IY0 C;  1XNF A;  3V30 A;  4I1M A;  3KEA A;  2R5S A;  2ZXW E;  1H19 A;  3HXB A;  4I17 A;  4XZ4 A;  4J8Y A;  4BTB A;  4EEC A;  2CHW A;  2OCC E;  4N5C A;  1FT2 A;  5KNH D;  3LVR E;  1B89 A;  2A5U A;  5KJN A;  4K03 A;  3ZIM A;  4N39 A;  4HBD A;  2IQC A;  2LXM A;  5EKQ D;  1QZ2 A;  4YVO A;  4GA0 A;  4A3T A;  1TNY A;  1EF1 C;  1U3C A;  3JQ0 A;  3D9L A;  5ENR D;  2DYS E;  4WNE A;  1UW4 B;  4O1P A;  3FH7 A;  4GZ3 A;  5FZS A;  3AS5 A;  4QFV A;  2F8Y A;  2XGM A;  2GRO B;  4XE0 A;  3MZL B;  3PRE A;  4GU5 A;  1OY3 D;  3D9J A;  2HO1 A;  2WXN A;  2VSX E;  5CCL A;  2V4H C;  1UN9 A;  4GZC A;  3ASF A;  2IOS A;  1SA4 A;  1UN8 A;  2KCK A;  3PEU B;  5HKP A;  3LDZ A;  2HYZ A;  4GTR A;  4GCN A;  4L2L A;  5E75 A;  3I5P A;  1HS6 A;  2OVF A;  5AJL A;  3IBE A;  3KSL A;  2KXP C;  2PNN A;  2P9L G;  4Q69 A;  3ULQ A;  2MRI A;  4U8H A;  3UM3 A;  3CHR A;  1EPU A;  3Q4A B;  2IOL A;  3TG5 A;  4N2Q A;  3KSQ A;  3QKY A;  2BED A;  3PE4 A;  1AP7 A;  3SNX A;  2XCB A;  4B89 A;  4HOT A;  2PZI A;  3JXJ A;  3RU0 A;  4ILI A;  3NOG D;  5CEA A;  5D0O D;  3AG2 E;  3R9M A;  5EIL A;  3ASO E;  3C98 A;  1DCE A;  4CT0 A;  4DI4 A;  3FY4 A;  3JQ1 A;  4GMJ A;  3B7B A;  3QWP A;  3MKQ B;  5ENN A;  3U66 A;  4G11 A;  2KAT A;  2PQR A;  3SY2 A;  3SZ7 A;  4JPS A;  4ANX A;  2EIM E;  3IXE A;  2Y3A A;  5BUZ A;  1Y6I A;  3PZD A;  3B7S A;  4AM9 A;  4JL0 A;  2DYR E;  5HRY A;  4XEI G;  1UJK A;  3C3R A;  3MKR A;  2YNQ A;  3PZ1 A;  3AAA C;  4HI8 A;  4IUL A;  4L9P A;  3UIN C;  3DWL G;  5AYW D;  2FEZ A;  2L0T B;  2P9U G;  4U7E B;  3ESL A;  5T3R A;  2J08 A;  4APF A;  2GRM A;  3D9N A;  4CCA A;  1OWM A;  1MX4 A;  4GYO A;  2OVB A;  2KCL A;  5FWQ A;  3T5X A;  4HS2 A;  5CEC B;  2Y1L E;  2OOE A;  4KVO A;  3T8M A;  1NA3 A;  1MYO A;  3ZFW A;  1K3Z D;  2R02 A;  5KJM A;  2J09 A;  2J9Q A;  3VTX A;  4C9B B;  3QAR A;  2MHK A;  1SVX A;  4DX1 A;  2RKK A;  1RW2 A;  2OND A;  4K0R A;  3CGH A;  4W9R A;  3L6A A;  4I6G A;  3APD A;  3O48 A;  1TJF A;  3I4R B;  1ZU2 A;  2IEJ A;  3CK7 A;  2C0M A;  1ELR A;  2FUL A;  3D3M A;  2PL2 A;  3AG3 E;  4UI9 C;  4EQF A;  3AJI A;  5D0Q D;  2FO7 A;  2RFM A;  1BD8 A;  5E76 A;  3DSU A;  4AOF A;  2VYI A;  3OTN A;  4HOR A;  5B1A E;  3R7R A;  3AG4 E;  5EX0 A;  4G8L A;  1H2V C;  4DUI A;  2FO1 E;  1HXI A;  4BSZ B;  2XGO A;  2EIN E;  4L7T A;  5AAO A;  4FJY A;  1WDY A;  2WXK A;  5EN5 D;  3W9F A;  3G2W A;  2IJG X;  3BEE A;  3D9I A;  3NAW A;  4LNU D;  4EPZ A;  4J8F A;  2M63 A;  2WQ7 A;  2P9S G;  4PS8 A;  3E34 A;  1N4R A;  4EBA A;  4ACL A;  1U2V G;  2L0I A;  3Q7F A;  4F6R D;  4UQZ A;  1KT1 A;  5G2N A;  3N71 A;  2IU1 A;  4KMO A;  4N5Q A;  4YND A;  2JAB A;  1EYH A;  3UKU G;  2UY1 A;  4J7W A;  5JMN D;  3O4Z A;  3ZW3 A;  1TR4 A;  2XEV A;  2ZU6 B;  5BT1 A;  1N54 A;  4PS3 A;  2DZN A;  2WQ6 A;  1NFI E;  1BLX B;  1HFA A;  5T4Y A;  4AY5 A;  2J49 A;  3KD7 A;  4HFG A;  3Q49 B;  3G2U A;  4N3A A;  4GML A;  4TUM A;  4PUC A;  3QWV A;  2ZIR A;  4C0M A;  3KS2 A;  1IHB A;  5G04 J;  4APO A;  1BI8 B;  1H6O A;  3EU9 A;  3Q78 A;  1TNB A;  3MV3 B;  1E8X A;  3CHQ A;  2XHE A;  2VTB B;  2DIW A;  1OXJ A;  1BU9 A;  1QNF A;  3TWR A;  5CRV A;  3L16 A;  5EID A;  3ASD A;  4ABN A;  4MKT A;  3AG1 E;  1N9A A;  1TN8 A;  5JJ6 A;  4JHJ A;  3V79 K;  4GTV A;  5FQ8 A;  4A55 A;  1HX8 A;  2E2E A;  3Q79 A;  4H7X A;  4I1A A;  1JCQ A;  1JUQ A;  3QAQ A;  4U8Y D;  3QC1 A;  1N52 A;  4K5B A;  3D9O A;  3HVE B;  3CVX A;  5AQB A;  1IYG A;  3MYV A;  5JA4 D;  3FUD A;  2PM7 A;  4FHJ A;  3CIA A;  4B94 A;  3K9I A;  2AXU A;  4BEP A;  2WMO A;  4H7Y A;  2P2C P;  3EJN A;  4TXP A;  4BSX A;  4GYY A;  3FFL A;  3TXN A;  3BQO A;  3CST A;  4A63 B;  3TWS A;  2PM6 A;  4F53 A;  3CKB A;  3CVQ A;  3HXE A;  3FU6 A;  4PDX A;  4FAD A;  4MLP A;  1U3D A;  4G23 A;  3EHQ A;  3ONK A;  3EHM A;  2XEH A;  2AWI A;  2WM9 A;  4EZL A;  1S64 A;  4O60 A;  2MOW A;  1JCR A;  3WG7 E;  3TWU A;  2X6I A;  2UWJ G;  5A7D B;  4BTA A;  3FTV A;  3S7J A;  3BG1 B;  4HOU A;  3MKQ A;  4DX5 D;  2CFZ A;  4AXH A;  3CVN A;  3W9G A;  1ELW A;  1HF8 A;  2F37 A;  4LG6 A;  4UWG A;  3VLD A;  2XPI A;  3BG0 B;  2WXJ A;  3APF A;  1UG3 A;  4CYM D;  4UWL A;  3FUH A;  4JZY A;  1E96 B;  2DWZ A;  1G3N B;  3CEQ A;  4M7C A;  2A5E A;  4M3O A;  4EBA G;  5ENQ D;  3HHM A;  4UQY A;  3CQC B;  3FDH A;  2ETA A;  3UMV A;  1A17 A;  2AVP A;  2HM8 A;  4GTS A;  4K5C A;  2AXZ A;  2R2L A;  5CBO A;  4ATZ D;  4WND A;  1HH8 A;  1N4Q A;  1JPL A;  3U64 A;  1SA5 A;  4XKC A;  4HVB A;  4AV7 A;  3T5V A;  2R03 A;  4F1P A;  4CRW A;  2C2L A;  4KXK B;  3UM0 A;  2J4D A;  4KT6 B;  2KBX A;  3SFY A;  3SGH A;  3ZRH A;  3AS4 A;  3S7F A;  3UT8 A;  2R17 C;  3TWV A;  3F6Q A;  3QJZ A;  2J4B A;  4DX6 D;  1Y8M A;  5AN8 A;  2P58 C;  4WUY A;  1Z3Y A;  3DRA A;  1N4S A;  1HU3 A;  4GA1 A;  5D66 A;  3AS8 A;  4Y6W A;  1PAQ A;  1D8D A;  2I2O A;  3ZYQ A;  3LJN A;  2DVW A;  5CRU A;  2BF0 X;  2I1K A;  3E37 A;  2IFU A;  3ZHE A;  3L13 A;  4MRU A;  5KNG A;  4LRZ A;  4Y6C A;  2I6H A;  1MQS A;  3UUX A;  2HR2 A;  4HNA D;  4U0Z A;  5CMW A;  2GGF A;  4LER A;  2ION A;  4KYO B;  3FUM A;  1H0A A;  4GTQ A;  2F0Y A;  3ML9 A;  1UOH A;  2QYJ A;  2R59 A;  5AQ7 A;  3RJV A;  4BER A;  3ZGQ A;  3BU8 A;  1OCC E;  3TWW A;  4JHK A;  2ETC A;  2NYJ A;  2QC9 A;  1H6P A;  3UT7 A;  4F3V A;  2X6K A;  3EU5 A;  4JEU A;  5CHE E;  1FVF A;  4FUL A;  3CK8 A;  1V55 E;  5JHB A;  4ACK A;  1QYM A;  4JB8 P;  3BUA A;  1Z6T A;  4OYS A;  3FUJ A;  3RRM B;  1UJJ A;  4ANW A;  3B13 A;  2EIJ E;  4R7L A;  4B8C B;  4GA2 A;  1N11 A;  3G2S A;  3QK0 A;  2VQ2 A;  4V3I A;  5AQA A;  1KZP A;  3FTS A;  3QNK A;  4GZ6 A;  2XRZ A;  5KCM A;  3T8K A;  1WAO 1;  3NZU A;  1OWN A;  4TUU A;  4I43 A;  3WXX A;  3DSS A;  1BPO A;  1WM5 A;  4LCT A;  3RRN B;  1OCZ E;  3OXL A;  4OAV B;  4FC8 A;  5BV0 A;  1S0P A;  4JA7 A;  4CZ2 D;  3UT4 A;  3UQ3 A;  4IRU A;  1IQU A;  3FEX A;  5J08 A;  3D9M A;  2X6H A;  3E30 A;  3AU4 A;  4DLQ A;  3ZHE B;  2NC9 A;  4P29 A;  1N4P A;  3NOC D;  3CHS A;  4YDE A;  1BI7 B;  2BUG A;  3FTU A;  1E7V A;  3Q47 B;  2GRQ B;  2OEV A;  3QOU A;  3CVP A;  4I2Z A;  3TXM A;  3FWV A;  2IO3 C;  4I6E A;  3Q9U C;  3LS8 A;  2AXV A;  2LXL A;  3OXG A;  3SFX A;  4HI9 A;  1YCS B;  1H2T C;  5CER B;  3FH8 A;  1Q2Z A;  2X38 A;  4DPR A;  4KZ0 A;  1H6K A;  2KZT B;  1WY6 A;  3PNT B;  1SW6 A;  3OXF A;  3CHP A;  1NI1 A;  3G2V A;  3B95 A;  5EDS A;  4I6J A;  2XPY A;  3P2B A;  2VGE A;  2KM4 A;  1OT8 A;  3DSV A;  3LXU X;  1YMP A;  1A5E A;  1E8W A;  1N94 A;  2QZA A;  2DZO A;  4LUN U;  1JWF A;  3ZYL A;  4FU3 A;  2VSN A;  2XEE A;  4AIF A;  2WPV A;  1XGW A;  2JEK A;  4LNG A;  1ELK A;  3JCK C;  2ZGD A;  1IHG A;  3FTZ A;  2V8S E;  3FHE A;  3NBN B;  2XCC A;  3LEW A;  4U8V D;  4L1B A;  3PZ4 A;  5B1B E;  3DBS A;  4GTM A;  2P9P G;  2KZT A;  3MX3 A;  4IYP A;  2IO2 C;  1KPS B;  4N3C A;  3DEP A;  2XS8 A;  2XZD G;  1RZ4 A;  2H6H A;  4WWO A;  1NL4 A;  2H6I A;  1TEZ A;  2CHX A;  2GRR B;  2WXO A;  1O1T A;  5BXO A;  1LD8 A;  3NF1 A;  5ANR A;  4Q94 A;  4HRN A;  3UIO C;  1Z5S C;  3SF4 A;  3PUJ A;  2Y0B G;  4PS7 A;  1S70 B;  3U4T A;  3C5R A;  2WXI A; 
#chains in the Genus database with same CATH homology
 1BI8 B;  1YCS B;  2FO1 E;  4DX7 D;  4BSZ B;  5CBN A;  3EU9 A;  5CER B;  5AAR A;  3JUE A;  3EHQ A;  3Q9N C;  4YDY A;  1MJ0 A;  5AAO A;  5HKP A;  5ENS D;  2XEH A;  2KBX A;  3D9H A;  1WDY A;  5ENP D;  5EN5 D;  1SW6 A;  1QYM A;  3TWV A;  4K5A B;  3W9F A;  3F6Q A;  4O60 A;  1BU9 A;  3V2O A;  4JB8 P;  1N0R A;  2KXP C;  2PNN A;  3TWR A;  1MX4 A;  2L6B A;  4DX6 D;  1K1B A;  3B95 A;  3ZU7 B;  5AN8 A;  5EID A;  3TWU A;  5KWD A;  3V2X A;  3ZUV B;  2VGE A;  4LNU D;  1MX6 A;  4HI8 A;  5CEC B;  1OT8 A;  3EHR A;  2Y1L E;  4ZFH A;  1YMP A;  4G8L A;  1N11 A;  1A5E A;  2V5Q C;  3ZKJ A;  4BET A;  3J5P A;  5ITZ F;  4O1O A;  4C48 B;  5AQA A;  2DZO A;  4DX5 D;  3V30 A;  1MX2 A;  1MYO A;  2XEE A;  3KEA A;  4GMR A;  3W9G A;  4BES A;  4B93 B;  1K3Z D;  3V79 K;  5ENO D;  1D9S A;  4DX2 A;  5EYP F;  2ZGD A;  4ZHB A;  5D66 A;  2B0O E;  4J8Y A;  2AJA A;  3T9K A;  1IKN D;  2J8S D;  3T8K A;  4F6R D;  2F37 A;  4LG6 A;  1AP7 A;  3LJN A;  3NBN B;  2DVW A;  4Z68 A;  4HRM B;  5ENT D;  1SVX A;  4DX1 A;  4HLL A;  4U8V D;  2BKK B;  3TWQ A;  3JXJ A;  4QQI A;  3J5Q B;  5CED B;  5KNH D;  3HRA A;  4N5Q A;  4CYM D;  2JAB A;  3NOG D;  4OAV B;  5KNG A;  2BKG A;  4U8Y D;  4OAU C;  5CEA A;  4RLY A;  4U95 D;  4CZ2 D;  4K5B A;  1DCQ A;  4J7W A;  5AQ9 A;  5EIL A;  5JMN D;  4G8K A;  4HBD A;  5AQB A;  2DWZ A;  1G3N B;  3DEP A;  4YDW A;  1AWC B;  5JA4 D;  4GPM A;  1TR4 A;  4DRX E;  2A5E A;  4HNA D;  2XZD G;  5FIN A;  3TWX A;  2XEN A;  5ENQ D;  3UI2 A;  3NOC D;  1BI7 B;  2DZN A;  2HE0 A;  4HQD A;  3B7B A;  4BEP A;  5FIO A;  3JXI A;  2ETA A;  5ENR D;  1NFI E;  1BLX B;  4UUC A;  1YYH A;  5HS0 A;  3DEO A;  4U96 D;  1UOH A;  2QYJ A;  3V31 A;  2F8X K;  5BXO A;  3AJI A;  5EIB E;  2P2C P;  4O1P A;  3UTM A;  5AQ7 A;  1K1A A;  4DUI A;  4NIK A;  4BER A;  1IXV A;  4K5C A;  2RFM A;  1BD8 A;  2XZT G;  3IXE A;  4QFV A;  4HB5 A;  4HRN A;  2F8Y A;  2ETB A;  3HG0 D;  3TWW A;  3UXG A;  4A63 B;  5CBO A;  4TUM A;  2ETC A;  1DC2 A;  2RFA A;  3TWS A;  2NYJ A;  4HRL A;  3TWT A;  4ATZ D;  1WG0 A;  2QC9 A;  3Q9U C;  2Y0B G;  5HRY A;  1OY3 D;  3SO8 A;  5KBA A;  5BXU A;  2ZGG A;  1S70 B;  2V4H C;  3C5R A;  2MYO A;  4LSZ E;  1IHB A;  4HI9 A;  5EYL A;  3ZNG A;  4F1P A;  3AAA C;  1N0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...