5ENRD

Mbx3135 bound structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
total genus 50
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enrD00
1QYMA 4U95D 5KWDA 1BI8B 3V79K 3T8KA 4HRMB 2DZNA 3F6QA 2ZGDA 4YDWA 3TWRA 1MJ0A 4O1PA 5ENQD 4BEPA 1DCQA 4HI8A 2MYOA 4F6RD 4ZFHA 4C48B 4QFVA 4JB8P 4G8LA 5FINA 2Y1LE 3IXEA 5HRYA 3ZUVB 4CZ2D 2P2CP 4CYMD 5KNHD 1MX6A 3JXJA 3C5RA 1MX4A 3ZU7B 4GPMA 1N0RA 4DX1A 3UI2A 4TUMA 5EYPF 1D9SA 1N0QA 2FO1E 4DUIA 5CBNA 5CEDB 3KEAA 2XEEA 4DX2A 4J8YA 2QYJA 2XZDG 4A63B 3SO8A 4B93B 5EYLA 4U8YD 1K1AA 5ENTD 1UOHA 4G8KA 1OY3D 1G3NB 3T9KA 1OT8A 2HE0A 2QC9A 1IXVA 5AQBA 1YCSB 4K5AB 2A5EA 4HI9A 4HQDA 2F8YA 2ETCA 5KBAA 1DC2A 1K3ZD 1IKND 2RFAA 3AJIA 2F8XK 4ZHBA 5AARA 3UTMA 5AQ7A 5ITZF 5HS0A 2XENA 3HRAA 1BI7B 3J5QB 5ENRD 2DVWA 5EN5D 1BD8A 3HG0D 4HNAD 4Z68A 1WG0A 5JA4D 2V4HC 3V2XA 4BERA 5D66A 1A5EA 5AQ9A 4HLLA 3TWXA 5BXUA 2KBXA 3V31A 4DX5D 4J7WA 2NYJA 5CECB 3B7BA 5AQAA 1AP7A 4HRNA 5EIBE 4RLYA 4NIKA 1YYHA 5AN8A 4U8VD 5ENOD 4LSZE 1MYOA 3EU9A 3TWWA 5FIOA 2AJAA 2L6BA 4ATZD 3TWSA 3ZNGA 5EILA 2ETAA 4BSZB 4K5CA 4K5BA 2B0OE 4DRXE 3AAAC 4U96D 4LNUD 3JXIA 4HRLA 5EIDA 3EHQA 3UXGA 1IHBA 2Y0BG 4O60A 3TWQA 1SW6A 4BETA 5KNGA 3DEOA 2BKKB 4UUCA 5HKPA 3Q9NC 2KXPC 4BESA 1TR4A 5AAOA 3W9GA 4LG6A 3D9HA 2XZTG 3NOGD 3Q9UC 3TWVA 5BXOA 5CBOA 2DZOA 3DEPA 3JUEA 3TWTA 1SVXA 1MX2A 3J5PA 3V2OA 1BU9A 3W9FA 3B95A 1N11A 4YDYA 4OAVB 2JABA 1AWCB 4O1OA 2BKGA 3NOCD 1NFIE 5ENSD 2ZGGA 2XEHA 3TWUA 4DX7D 2VGEA 4F1PA 1K1BA 1BLXB 4OAUC 1WDYA 2DWZA 5CEAA 4QQIA 2V5QC 4DX6D 2PNNA 3ZKJA 2F37A 4HBDA 4GMRA 4HB5A 3LJNA 3V30A 5ENPD 5CERB 1S70B 1YMPA 2ETBA 3EHRA 4N5QA 2J8SD 5JMND 3NBNB 2RFMA
chains in the Genus database with same CATH superfamily
2UWJG 2DZNA 4X8QA 2P9KG 2XS1A 3QNKA 4FC8A 3DPDA 4BTAA 1MX6A 3C5RA 4JHRA 4JEUA 4DX1A 3UI2A 4GTPA 2FO1E 3PREA 1E96B 4JA9A 4GTTA 4A63B 3X2QE 2B6CA 2QZAA 4UQXA 3Q73A 4I2ZA 5IY5E 3FP3A 1Q2ZA 3AS8A 5FZSA 3FUDA 5AIJA 3ONLA 1N95A 4GTOA 5AQAA 5D0OD 5JHBA 1TYQG 1JCQA 2OVFA 4RG9A 2WVIA 4YNDA 3URZA 4WAFA 3FTXA 4N5CA 4LG6A 4G24A 2XZTG 2RG8A 3RK6A 3O48A 3TWVA 2X6JA 2VGEA 3ASGA 3OTNA 1OCRE 4J8SA 4DX6D 5LP0A 3Q5MA 3ZHEA 4E6HA 1SQMA 4UWKA 2WXGA 3PEVB 5KJKA 4U95D 2XEVA 2JLBA 3N71A 5KJLA 2IOSA 4O1PA 1FVHA 2H6HA 3PS6A 5ENNA 2X6IA 2WM9A 2OEWA 4A1SA 4CDMA 4FADA 4XX5A 1RW2A 4HOUA 4AOFA 3DSSA 4IRUA 5EYLA 2XS8A 4N39A 4KVOA 3ZN3A 1IHGA 3C98A 3DXKG 5KBAA 2WMOA 5ITZF 2CG3A 3HHMA 4U0ZA 3FH7A 4G11A 4LCTA 4U0UA 4DX5D 4B8CB 3B7BA 2I1KA 4GZDA 4L9PA 3E32A 2JEKA 3APDA 3ABLE 3FU6A 2J08A 2WXNA 4K5CA 3CKCA 4DLOA 3MA5A 3ASOE 4UUCA 3D9NA 3VLDA 2DBAA 3PNLB 1OUVA 4A3TA 3V2OA 4OAVB 2AXVA 4CCAA 3R7RA 1K1BA 4B8AA 3SBTB 3S7BA 1FPPA 4GMRA 4YVQC 3S7DA 2J49A 1S70B 2PL2A 3G2TA 5JJ6A 2X6FA 2MRIA 3NBNB 2RFMA 3CHQA 5KWDA 2YINA 2R05A 4L7TA 2KZTB 4ILIA 3FH5A 3APFA 3CVXA 1TN6A 2R03A 3G2UA 3JUIA 3MZLB 2IQCA 1JCRA 2EQXA 3FUJA 4DUIA 1QNFA 3AG1E 3ZIMA 2NXPA 4ANVA 1QBQA 3PZDA 4I43A 4HI9A 4JHJA 4B0ZA 2IFUA 3RIBA 3KSLA 3QWWA 2P58C 2KCLA 2NC9A 2GW1A 3BU8A 4N3CA 3TJPA 4HNAD 1EDUA 1SA4A 3AU4A 3TXNA 4HRNA 3D9MA 4FULA 3EU9A 2XCCA 4MKTA 4GTSA 4NQ0A 2PM7A 3ISMC 1IHBA 4RSYA 4I1MA 2EIME 1S64A 1N54A 3RU0A 4PS7A 3DBSA 5FZQA 2WXMA 4CDNA 4HOQA 1KLXA 2V5QC 4ANXA 1ZBPA 4G2VA 4LRZA 2IO3C 4H7XA 3CIAA 3ULYA 5B1AE 3LPZA 4GTVA 1FT2A 2CHXA 4UWHA 2WXPA 2WQ7A 2AVPA 3B7UX 3D9PA 4JB8P 2IY0C 3CLJA 4A3VA 1WY6A 4GPKA 1IQRA 1E8WA 1N52A 3AU5A 1KT0A 3L17A 4N3BA 2ZU6B 4P29A 5AQBA 4GYOA 5FZRA 4LNBA 2Q7FA 3LDZA 1DC2A 2F0YA 2F8XK 4DI3A 5BW8C 1H2VC 5D0QD 5DBKA 3HRAA 1SZAA 3Q78A 4JW1A 2DYSE 2XRZA 1MYOA 4AM9A 3CK7A 4HOSA 3CV0A 2Y4UA 3ZFWA 3CVNA 2B0OE 3HXFA 3MJWA 5KNGA 1TR4A 5HI7A 3W9GA 4C0MA 4GAAA 3RO2A 4CEMA 3CVQA 3CVLA 4AP2A 1MX2A 2GRLA 2X38A 4J8EA 2XEHA 3PUJA 3MV3B 4JA7A 3CHSA 4GTMA 3FDHA 2L6JA 3AG3E 1TN8A 3VLFA 3MYVA 4QFVA 1E8YA 1O1RA 4TXPA 2A5UA 3QB2A 4HI8A 4L2YA 4EECA 2YNQA 1SZ9A 4GTQA 2E2EA 3FTSA 3LVQE 3I3NA 3SY2A 1IXVA 3ZEFA 2VSOE 1S0PA 4HQDA 3CVWA 3PH0C 5AQ7A 4GZ6A 3T5XA 4A1GA 3TWXA 1AP7A 4FJZA 4I6GA 3KEZA 2ILRA 4APFA 3NB2A 2OOEA 4URKA 3MV2B 3AAAC 3JXIA 2Y69E 4BETA 3FFLA 4WUYA 5CBOA 3DEPA 2BUGA 3BG0B 2J9QA 2ZXWE 1GW6A 3D9LA 2LXMA 4M3OA 3FU5A 4J8FA 3ZYQA 4I6EA 5LOZA 3RSEG 4HVBA 3FY4A 1UJKA 3Q7AA 4LERA 3TWWA 2GRRB 4JXTA 2ZGDA 1MHQA 3VLEA 4BEPA 1N9AA 3ZGQA 3S7JA 1Z6TA 3KS2A 2I6HA 4JHKA 3G2VA 4RQIA 1JWFA 2WQHA 4FP7A 2GRNB 4RG6A 2P9UG 1K1AA 4FU3A 2OEVA 4EBAG 3O4ZA 1OT8A 2AXUA 3PZ3A 2WQ6A 2CFZA 3Q49B 4KMOA 1IKND 4Q96A 3E30A 3FUKA 4GZCA 4GA0A 1A17A 2I1JA 5ENRD 2DVWA 3R9AB 3UT8A 3V2XA 2VGXB 4C0EA 3QARA 5AN8A 3SNXA 2QFCA 3DSWA 4JC8A 3B7SA 4OVUA 1IQUA 4UQYA 3UXGA 3B7RL 2PQNA 5CMYA 4B94A 5AAOA 2GRQB 2P9SG 1O5MA 3ZXPA 4CT4A 4F1SA 2DIWA 3EUVA 3W9FA 3B95A 2JABA 3FWVA 3QOUA 2XGSA 3TWUA 5A23A 3DSVA 5ANRA 5ARGA 2DWZA 5B3SE 3SFYA 2BF0X 4NRHB 2PQRA 5EKQD 2ETBA 3EJNA 2QYUA 3EHNA 1MQSA 3EU5A 4V3IA 3CSTA 3P2BA 5ENQD 2VJ8A 2IONA 3HXDA 4I9CA 3R7QA 2VYIA 2P2CP 4GA1A 4XKBA 3JQ0A 5T4YA 3U64A 1D9SA 1DCEA 4J8YA 2QYJA 4G25A 3SO8A 3FTYA 3BUAA 4FLBA 4OVVA 1EF1C 1FVFA 3FUFA 5LFAA 4PH4B 4U07A 5FWQA 4AJWA 4BT8A 3B13A 1TJFA 1LF8A 3SZ7A 2KBXA 4CGVA 4YVOA 4I1OB 3UM1A 1N4RA 2YQ8A 4LSZE 3UT4A 3ASDA 4UQZA 4JPSA 4LNGA 3LY9A 3ZNGA 5EILA 4BSZB 1ZB1A 1LD8A 4PS3A 3I4RB 3CVVA 4O60A 2BKKB 4PS8A 3QJZA 2EIJE 3Q9NC 5C2YA 3NOGD 2V0PA 4XEIG 2P9PG 1U2VG 4M7CA 4N3AA 1SVXA 1TN7A 3J5PA 5BPPA 1MZCA 4K0RA 2H6IA 2RKKA 3NOCD 4IYPA 3AG2E 2WXHA 3PRZA 5C1DA 3WXXA 4HB5A 3ENEA 3VTYA 4NURA 5M72A 1E8ZA 3IKOB 1PAQA 4F6RD 3ASFA 3IXEA 3NAWA 2XQ0A 2VSNA 3AS4A 3PZ1A 4MRUA 1OWLA 2IU1A 1SA5A 1N0QA 4TXQA 4B93B 5ENTD 1UOHA 4G8KA 2WXLA 4KZ0A 3FH8A 1BPOA 2A5EA 5AYWD 4HOTA 1N4QA 2ETCA 4HLEA 2HM8A 2OV8A 3ZRHA 5LX8A 4E85A 5FQ4A 4GYYA 1LD7A 3LVRE 4HLLA 5CRVA 4J7WA 2NYJA 5G05J 1YYHA 2R59A 2MOWA 3ZW3A 3CQGB 5FIOA 4UWLA 1DVPA 2WMNA 5G04C 3EHQA 3G2SA 4TUUA 2J09A 2VTBB 3BQOA 3KAEA 3MX3A 3U3WA 5EDSA 2DZOA 3PUKA 4GZ3A 5G05C 2P9IG 3MGBA 1TNOA 1N4PA 3TG5A 3UX4A 5CHEE 3MEKA 4JL0A 2AWIA 2V4LA 2YHCA 5ARFA 3ZHEB 4XI0A 4EHMA 5CCMA 3L22A 4U04A 2GGFA 1XNFA 5BT1A 4B89A 1TEZA 3ZUVB 5HRYA 3FEXA 4KZCA 5KNHD 3GZ2A 3D9JA 3BEEA 4BT9A 1H2UA 1Y6IA 1HG2A 1Y8MA 2KC7A 3CHPA 3LJ3A 4UWFA 4OYSA 3KEAA 2XEEA 3RRNB 3GW4A 4TV3A 2LSVA 3EHMA 4AVXA 3APCA 3T9KA 3FULA 1YA0A 3EDTB 4ANUA 1K3ZD 3FTUA 2RFAA 1H0AA 4BX9A 1O1TA 4XKCA 3NZSA 4GA2A 3CGHA 3IHYA 5D66A 3SQVA 3CVPA 2V8SE 4PDXA 3PE4A 2ZISA 2H6GA 3TWSA 3UPVA 3CSFA 4CGWA 4DRXE 4GMJA 3ESLA 3QKYA 3UIPC 2Y0BG 2X6HA 3Q9UC 1ZU2A 2RD0A 3QK0A 2OVBA 1O1SA 4G23A 4GCOA 5ENSD 3ML8A 4BTBA 3T8MA 2FF4A 3D9KA 3SFZA 3ZKJA 2F37A 3FUHA 3CK9A 2HO1A 2H6FA 3NF1A 3E4BA 2A4ZA 3V79K 4DI4A 4ZFHA 4CYMD 5FINA 3SBSA 2Y1LE 4CZ2D 3TGOA 2CHZA 4I17A 5EX3A 5EYPF 3EIQC 2C0LA 4IN3B 2CFUA 3L82A 1NP7A 5KJMA 4WNEA 2GRMA 2Y4TA 5J08A 2X3MA 3AS5A 5DIZA 3U4TA 1H6KA 2FBNA 2HE0A 3UM3A 5BUZA 4K5AB 3D9OA 3FUNA 3B7TA 2F8YA 3AJIA 5AARA 2EINE 4GZ5A 5HQ8A 4JD2G 3L13A 3T5VA 4RVBA 3OXGA 2XCBA 1E8XA 4DK5A 1A5EA 3KSQA 4ACLA 5JHAA 2BEDA 4N2QA 4NIKA 4AY6A 1NL4A 3Q79A 2LSUA 3QWPA 1ELKA 2WPVA 4J0UA 4YDEA 1ELWA 3UKUG 4U7EB 4L2LA 1OCCE 2P9NG 1E7VA 2WXIA 2YHEA 4EZLA 4O1OA 3Q47B 2PZIA 1V55E 1JUQA 3PDNA 4OAUC 4ATGA 1Z3XA 1UN8A 1HFAA 4DJAA 1OWPA 5JJ7A 4APOA 1KPSB 3HXBA 1YMPA 2VTBA 2DYRE 4N5QA 1UW4B 4EBAA 1E90A 4ABNA 4L23A 3IHVA 3F6QA 3TWRA 4A55A 1FCHA 1N94A 5FJYA 2E0IA 2KCKA 4G8LA 1HXIA 3JXJA 2CG2A 2ZIRA 4GPMA 1N0RA 4U63A 4J6IA 3ESKA 3MKRA 3ASHA 4DX2A 5EX0A 4WNDA 1HH8A 3LXUX 4MS6A 2AXZA 2VGYA 2VSXE 4I9EA 2LAIA 5G04J 3UTMA 2BTDA 3ZPJA 2FEZA 1OWOA 4HORA 1BD8A 4BX8A 3IBEA 4BERA 4TXRA 4Y6WA 5EIBE 4U0SA 2I2OA 3ML9A 3ZYLA 4HXIA 3RAUA 4ATZD 3ABME 2XGMA 3CHOA 5FQ8A 2ETAA 5AENA 2WXKA 2R5SA 4WWNA 4G1TA 3DEOA 2IF4A 2KXPC 1JPLA 4BESA 4KVMA 4YDYA 2EILE 4GU5A 5AJLA 4F7AA 4L1BA 4AEZC 4QQIA 2KATA 4I6JA 3E33A 3FHEA 5ENPD 5H7PA 5KJNA 4KBQA 3EHRA 2HR2A 3LKUA 1QYMA 1BI8B 3DSUA 4GYWA 4G26A 2XRYA 5AJDA 1QZ2A 3SHFA 4XIFA 5FQ7A 2KM4A 3GYZA 5BV0A 4I2WA 5A6CA 5CEDB 4MBGA 4EPZA 2OCCE 1G3NB 2WXQA 2V5FA 4H7YA 4ANWA 5HS0A 1VDYA 3ASNE 3K9IA 1BI7B 3MCXA 1LTXA 5EN5D 4Z68A 5E75A 2L0TB 3RRMB 4FA6A 3TAXA 4UWGA 1KT1A 5BXUA 3JCKC 5CECB 3JQ1A 4RLYA 2FI7A 1D8DA 1S63A 4WNGA 5ENOD 2IO2C 3IV0A 4DLQA 4I1AA 1HS6A 2GRPB 1SW6A 3DWLG 5CCLA 5T8IA 2FO7A 1U3CA 4PUCA 2X6KA 3PNTB 5G55A 4GTRA 3TL5A 1AWCB 1HU3A 3C72A 5A7DB 1D8EA 5FT9A 2IOLA 4EQFA 3V30A 4O6FA 3TG4A 4EZJA 3T8KA 4YDWA 4BSXA 5KCMA 3BG1B 1JWGA 4C48B 3CVUA 1OCOE 1MX4A 3ZU7B 3C3RA 1FT1A 3HVEB 4TUMA 3HXCA 3U9WA 3Q15A 5FTPA 1QQEA 3FU3A 1HG5A 3U66A 3HXEA 3IEGA 3CVYA 2DCPA 1X5BA 3C3OA 1HF8A 2L0IA 1N4SA 2XENA 1WG0A 5JA4D 3ULEG 4WNFA 3V31A 3FU0A 3LS8A 1KZOA 4AXHA 3QWVA 3ULQA 4CRWA 1OWNA 4K03A 2LAHA 3OAWA 4F3VA 4LNUD 3L6AA 3HIZA 3OXFA 3LCAA 1UG3A 2XHEA 3UQ3A 3D9HA 3SI5A 4MLPA 3TWTA 3QC1A 3L16A 1K8KG 1E7UA 3L08A 2PM6A 2BKGA 3RO3A 3PVLA 1TNBA 1HZ4A 1TNUA 5LCWC 3RJVA 2VSYA 3ZYMA 4JZYA 2PNNA 5J90A 1RZ4A 3LJNA 4D10C 4ILGA 1HX8A 4KYOB 3R9MA 2VQ2A 1JCSA 2R02A 1MJ0A 1DNPA 1X81A 4IULA 3OXLA 1P5QA 3TXMA 4TRQA 5LCWJ 1H6PA 3QDNA 1KZPA 4GMLA 3NQPA 3LY8A 4LUNU 1B89A 2XPYA 3PEUB 4YDOA 4HFGA 3QAQA 1OY3D 1YCSB 3ABKE 3E37A 1PY1A 2IEJA 3J5QB 1Z3YA 3UMVA 2KCVA 3HG0D 1UN9A 1NA3A 4C9BB 4XZ4A 1HO8A 2WXFA 4JEHA 3C3QA 3PZ2A 3I5PA 4F53A 2L6BA 4K5BA 2XPZA 4U96D 4HRLA 1XGWA 2UY1A 4BFRA 1TNZA 2J4BA 2ONDA 4CDRA 4Y6CA 2J4DA 4Q94A 3RRUA 1TNYA 4FJYA 3CEQA 1WDYA 5CEAA 2LXLA 4HBDA 3GZSA 3AG4E 4W9RA 2EIKE 3E34A 1W3BA 4HRMB 3ZXSA 1V54E 2AW6A 2MYOA 1EYHA 2C0MA 3SFXA 4XE0A 1WM5A 3CR3A 3G2WA 3LEWA 3CHMA 4N2SA 4CT0A 4BWRA 5CBNA 2XZDG 3D3MA 1EPUA 3Q7FA 3SF4A 2QC9A 2Y3AA 2MHKA 3FUIA 5T3RA 2FULA 4DPRA 3DPYA 5JJTA 3CKBA 3UKRG 4ACKA 4WWPA 2WXOA 2V4HC 3UINC 5E76A 3P1UA 1OXJA 2XGOA 1HE8A 2WB2A 2LUHA 1UJJA 4U8VD 2QY7A 4FHJA 3S2AA 5ANLA 3DSXA 5BV1A 3FUEA 4WWOA 3I4GA 3HDXA 4ME2A 1ELRA 3TWQA 3S7FA 3UM0A 2P9LG 1Z5SC 3KD7A 2LNIA 5D2MC 3EIJA 3NZUA 3UUXA 1BU9A 1H19A 4UI9C 2HYZA 3PE3A 5B1BE 1L5JA 3Q4AB 2ZGGA 3Q75A 4DX7D 4F1PA 1NI1A 4XI9A 1PC2A 4AIFA 1H2TC 3DSTA 5FQ6A 5CERB 4BY6A 3CK8A 3VTXA 2J8SD 3MKQB 5JMND 4AY5A 2IJGX 1H6OA 3HYMB 3RKVA 5CMWA 1DCQA 3CQCB 4GCNA 4UI9J 3PZ4A 3ZYKA 3L9TA 4R7LA 2WXJA 1IYGA 5CRUA 4EZKA 2C2LA 3FEYA 2XPIA 2UY1B 2J07A 3HVEA 3MKQA 3CHRA 4U8YD 3UT7A 2NSZA 3FTZA 2L9BA 3LY7A 3GZ1A 1NA0A 3DXMG 4ZHBA 4FHKA 2R17C 4KXKB 4NACA 3SGHA 3JYSA 2R2LA 3LYAA 5AQ9A 3ZVVA 4GB9A 3ONKA 2GROB 4HS2A 3FTVA 4KT6B 2WXRA 2AJAA 1TJCA 2I9CA 5BNWA 3SD5A 4U8HA 3D9IA 2KZTA 1U3DA 3DRAA 4JVSA 5EIDA 4LEUA 3FUMA 3UIOC 4FLHA 5HKPA 2VGXA 2M63A 5BXOA 1OWMA 3L54A 3JUEA 3FTWA 1N11A 3WG7E 3UM2A 4Q69A 2CHWA 4UI9K 1NFIE 1WAO1 1BLXB 4AV7A 1OCZE 2LO6A 1NZNA 1INZA 4ILHB 4J8DA 5G2NA
chains in the Genus database with same CATH topology
1QYMA 4U95D 5KWDA 1BI8B 3V79K 3T8KA 4HRMB 2DZNA 3F6QA 2ZGDA 4YDWA 3TWRA 1MJ0A 4O1PA 5ENQD 4BEPA 1DCQA 4HI8A 2MYOA 4F6RD 4ZFHA 4C48B 4QFVA 4JB8P 4G8LA 5FINA 2Y1LE 3IXEA 5HRYA 3ZUVB 4CZ2D 2P2CP 4CYMD 5KNHD 1MX6A 3JXJA 3C5RA 1MX4A 3ZU7B 4GPMA 1N0RA 4DX1A 3UI2A 4TUMA 5EYPF 1D9SA 1N0QA 2FO1E 4DUIA 5CBNA 5CEDB 3KEAA 2XEEA 4DX2A 4J8YA 2QYJA 2XZDG 4A63B 3SO8A 4B93B 5EYLA 4U8YD 1K1AA 5ENTD 1UOHA 4G8KA 1OY3D 1G3NB 3T9KA 1OT8A 2HE0A 2QC9A 1IXVA 5AQBA 1YCSB 4K5AB 2A5EA 4HI9A 4HQDA 2F8YA 2ETCA 5KBAA 1DC2A 1K3ZD 1IKND 2RFAA 3AJIA 2F8XK 4ZHBA 5AARA 3UTMA 5AQ7A 5ITZF 5HS0A 2XENA 3HRAA 1BI7B 3J5QB 5ENRD 2DVWA 5EN5D 1BD8A 3HG0D 4HNAD 4Z68A 1WG0A 5JA4D 2V4HC 3V2XA 4BERA 5D66A 1A5EA 5AQ9A 4HLLA 3TWXA 5BXUA 2KBXA 3V31A 4DX5D 4J7WA 2NYJA 5CECB 3B7BA 5AQAA 1AP7A 4HRNA 5EIBE 4RLYA 4NIKA 1YYHA 5AN8A 4U8VD 5ENOD 4LSZE 1MYOA 3EU9A 3TWWA 5FIOA 2AJAA 2L6BA 4ATZD 3TWSA 3ZNGA 5EILA 2ETAA 4BSZB 4K5CA 4K5BA 2B0OE 4DRXE 3AAAC 4U96D 4LNUD 3JXIA 4HRLA 5EIDA 3EHQA 3UXGA 1IHBA 2Y0BG 4O60A 3TWQA 1SW6A 4BETA 5KNGA 3DEOA 2BKKB 4UUCA 5HKPA 3Q9NC 2KXPC 4BESA 1TR4A 5AAOA 3W9GA 4LG6A 3D9HA 2XZTG 3NOGD 3Q9UC 3TWVA 5BXOA 5CBOA 2DZOA 3DEPA 3JUEA 3TWTA 1SVXA 1MX2A 3J5PA 3V2OA 1BU9A 3W9FA 3B95A 1N11A 4YDYA 4OAVB 2JABA 1AWCB 4O1OA 2BKGA 3NOCD 1NFIE 5ENSD 2ZGGA 2XEHA 3TWUA 4DX7D 2VGEA 4F1PA 1K1BA 1BLXB 4OAUC 1WDYA 2DWZA 5CEAA 4QQIA 2V5QC 4DX6D 2PNNA 3ZKJA 2F37A 4HBDA 4GMRA 4HB5A 3LJNA 3V30A 5ENPD 5CERB 1S70B 1YMPA 2ETBA 3EHRA 4N5QA 2J8SD 5JMND 3NBNB 2RFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYM A;  4U95 D;  5KWD A;  1BI8 B;  3V79 K;  3T8K A;  4HRM B;  2DZN A;  3F6Q A;  2ZGD A;  4YDW A;  3TWR A;  1MJ0 A;  4O1P A;  5ENQ D;  4BEP A;  1DCQ A;  4HI8 A;  2MYO A;  4F6R D;  4ZFH A;  4C48 B;  4QFV A;  4JB8 P;  4G8L A;  5FIN A;  2Y1L E;  3IXE A;  5HRY A;  3ZUV B;  4CZ2 D;  2P2C P;  4CYM D;  5KNH D;  1MX6 A;  3JXJ A;  3C5R A;  1MX4 A;  3ZU7 B;  4GPM A;  1N0R A;  4DX1 A;  3UI2 A;  4TUM A;  5EYP F;  1D9S A;  1N0Q A;  2FO1 E;  4DUI A;  5CBN A;  5CED B;  3KEA A;  2XEE A;  4DX2 A;  4J8Y A;  2QYJ A;  2XZD G;  4A63 B;  3SO8 A;  4B93 B;  5EYL A;  4U8Y D;  1K1A A;  5ENT D;  1UOH A;  4G8K A;  1OY3 D;  1G3N B;  3T9K A;  1OT8 A;  2HE0 A;  2QC9 A;  1IXV A;  5AQB A;  1YCS B;  4K5A B;  2A5E A;  4HI9 A;  4HQD A;  2F8Y A;  2ETC A;  5KBA A;  1DC2 A;  1K3Z D;  1IKN D;  2RFA A;  3AJI A;  2F8X K;  4ZHB A;  5AAR A;  3UTM A;  5AQ7 A;  5ITZ F;  5HS0 A;  2XEN A;  3HRA A;  1BI7 B;  3J5Q B;  5ENR D;  2DVW A;  5EN5 D;  1BD8 A;  3HG0 D;  4HNA D;  4Z68 A;  1WG0 A;  5JA4 D;  2V4H C;  3V2X A;  4BER A;  5D66 A;  1A5E A;  5AQ9 A;  4HLL A;  3TWX A;  5BXU A;  2KBX A;  3V31 A;  4DX5 D;  4J7W A;  2NYJ A;  5CEC B;  3B7B A;  5AQA A;  1AP7 A;  4HRN A;  5EIB E;  4RLY A;  4NIK A;  1YYH A;  5AN8 A;  4U8V D;  5ENO D;  4LSZ E;  1MYO A;  3EU9 A;  3TWW A;  5FIO A;  2AJA A;  2L6B A;  4ATZ D;  3TWS A;  3ZNG A;  5EIL A;  2ETA A;  4BSZ B;  4K5C A;  4K5B A;  2B0O E;  4DRX E;  3AAA C;  4U96 D;  4LNU D;  3JXI A;  4HRL A;  5EID A;  3EHQ A;  3UXG A;  1IHB A;  2Y0B G;  4O60 A;  3TWQ A;  1SW6 A;  4BET A;  5KNG A;  3DEO A;  2BKK B;  4UUC A;  5HKP A;  3Q9N C;  2KXP C;  4BES A;  1TR4 A;  5AAO A;  3W9G A;  4LG6 A;  3D9H A;  2XZT G;  3NOG D;  3Q9U C;  3TWV A;  5BXO A;  5CBO A;  2DZO A;  3DEP A;  3JUE A;  3TWT A;  1SVX A;  1MX2 A;  3J5P A;  3V2O A;  1BU9 A;  3W9F A;  3B95 A;  1N11 A;  4YDY A;  4OAV B;  2JAB A;  1AWC B;  4O1O A;  2BKG A;  3NOC D;  1NFI E;  5ENS D;  2ZGG A;  2XEH A;  3TWU A;  4DX7 D;  2VGE A;  4F1P A;  1K1B A;  1BLX B;  4OAU C;  1WDY A;  2DWZ A;  5CEA A;  4QQI A;  2V5Q C;  4DX6 D;  2PNN A;  3ZKJ A;  2F37 A;  4HBD A;  4GMR A;  4HB5 A;  3LJN A;  3V30 A;  5ENP D;  5CER B;  1S70 B;  1YMP A;  2ETB A;  3EHR A;  4N5Q A;  2J8S D;  5JMN D;  3NBN B;  2RFM A; 
#chains in the Genus database with same CATH topology
 2UWJ G;  2DZN A;  4X8Q A;  2P9K G;  2XS1 A;  3QNK A;  4FC8 A;  3DPD A;  4BTA A;  1MX6 A;  3C5R A;  4JHR A;  4JEU A;  4DX1 A;  3UI2 A;  4GTP A;  2FO1 E;  3PRE A;  1E96 B;  4JA9 A;  4GTT A;  4A63 B;  3X2Q E;  2B6C A;  2QZA A;  4UQX A;  3Q73 A;  4I2Z A;  5IY5 E;  3FP3 A;  1Q2Z A;  3AS8 A;  5FZS A;  3FUD A;  5AIJ A;  3ONL A;  1N95 A;  4GTO A;  5AQA A;  5D0O D;  5JHB A;  1TYQ G;  1JCQ A;  2OVF A;  4RG9 A;  2WVI A;  4YND A;  3URZ A;  4WAF A;  3FTX A;  4N5C A;  4LG6 A;  4G24 A;  2XZT G;  2RG8 A;  3RK6 A;  3O48 A;  3TWV A;  2X6J A;  2VGE A;  3ASG A;  3OTN A;  1OCR E;  4J8S A;  4DX6 D;  5LP0 A;  3Q5M A;  3ZHE A;  4E6H A;  1SQM A;  4UWK A;  2WXG A;  3PEV B;  5KJK A;  4U95 D;  2XEV A;  2JLB A;  3N71 A;  5KJL A;  2IOS A;  4O1P A;  1FVH A;  2H6H A;  3PS6 A;  5ENN A;  2X6I A;  2WM9 A;  2OEW A;  4A1S A;  4CDM A;  4FAD A;  4XX5 A;  1RW2 A;  4HOU A;  4AOF A;  3DSS A;  4IRU A;  5EYL A;  2XS8 A;  4N39 A;  4KVO A;  3ZN3 A;  1IHG A;  3C98 A;  3DXK G;  5KBA A;  2WMO A;  5ITZ F;  2CG3 A;  3HHM A;  4U0Z A;  3FH7 A;  4G11 A;  4LCT A;  4U0U A;  4DX5 D;  4B8C B;  3B7B A;  2I1K A;  4GZD A;  4L9P A;  3E32 A;  2JEK A;  3APD A;  3ABL E;  3FU6 A;  2J08 A;  2WXN A;  4K5C A;  3CKC A;  4DLO A;  3MA5 A;  3ASO E;  4UUC A;  3D9N A;  3VLD A;  2DBA A;  3PNL B;  1OUV A;  4A3T A;  3V2O A;  4OAV B;  2AXV A;  4CCA A;  3R7R A;  1K1B A;  4B8A A;  3SBT B;  3S7B A;  1FPP A;  4GMR A;  4YVQ C;  3S7D A;  2J49 A;  1S70 B;  2PL2 A;  3G2T A;  5JJ6 A;  2X6F A;  2MRI A;  3NBN B;  2RFM A;  3CHQ A;  5KWD A;  2YIN A;  2R05 A;  4L7T A;  2KZT B;  4ILI A;  3FH5 A;  3APF A;  3CVX A;  1TN6 A;  2R03 A;  3G2U A;  3JUI A;  3MZL B;  2IQC A;  1JCR A;  2EQX A;  3FUJ A;  4DUI A;  1QNF A;  3AG1 E;  3ZIM A;  2NXP A;  4ANV A;  1QBQ A;  3PZD A;  4I43 A;  4HI9 A;  4JHJ A;  4B0Z A;  2IFU A;  3RIB A;  3KSL A;  3QWW A;  2P58 C;  2KCL A;  2NC9 A;  2GW1 A;  3BU8 A;  4N3C A;  3TJP A;  4HNA D;  1EDU A;  1SA4 A;  3AU4 A;  3TXN A;  4HRN A;  3D9M A;  4FUL A;  3EU9 A;  2XCC A;  4MKT A;  4GTS A;  4NQ0 A;  2PM7 A;  3ISM C;  1IHB A;  4RSY A;  4I1M A;  2EIM E;  1S64 A;  1N54 A;  3RU0 A;  4PS7 A;  3DBS A;  5FZQ A;  2WXM A;  4CDN A;  4HOQ A;  1KLX A;  2V5Q C;  4ANX A;  1ZBP A;  4G2V A;  4LRZ A;  2IO3 C;  4H7X A;  3CIA A;  3ULY A;  5B1A E;  3LPZ A;  4GTV A;  1FT2 A;  2CHX A;  4UWH A;  2WXP A;  2WQ7 A;  2AVP A;  3B7U X;  3D9P A;  4JB8 P;  2IY0 C;  3CLJ A;  4A3V A;  1WY6 A;  4GPK A;  1IQR A;  1E8W A;  1N52 A;  3AU5 A;  1KT0 A;  3L17 A;  4N3B A;  2ZU6 B;  4P29 A;  5AQB A;  4GYO A;  5FZR A;  4LNB A;  2Q7F A;  3LDZ A;  1DC2 A;  2F0Y A;  2F8X K;  4DI3 A;  5BW8 C;  1H2V C;  5D0Q D;  5DBK A;  3HRA A;  1SZA A;  3Q78 A;  4JW1 A;  2DYS E;  2XRZ A;  1MYO A;  4AM9 A;  3CK7 A;  4HOS A;  3CV0 A;  2Y4U A;  3ZFW A;  3CVN A;  2B0O E;  3HXF A;  3MJW A;  5KNG A;  1TR4 A;  5HI7 A;  3W9G A;  4C0M A;  4GAA A;  3RO2 A;  4CEM A;  3CVQ A;  3CVL A;  4AP2 A;  1MX2 A;  2GRL A;  2X38 A;  4J8E A;  2XEH A;  3PUJ A;  3MV3 B;  4JA7 A;  3CHS A;  4GTM A;  3FDH A;  2L6J A;  3AG3 E;  1TN8 A;  3VLF A;  3MYV A;  4QFV A;  1E8Y A;  1O1R A;  4TXP A;  2A5U A;  3QB2 A;  4HI8 A;  4L2Y A;  4EEC A;  2YNQ A;  1SZ9 A;  4GTQ A;  2E2E A;  3FTS A;  3LVQ E;  3I3N A;  3SY2 A;  1IXV A;  3ZEF A;  2VSO E;  1S0P A;  4HQD A;  3CVW A;  3PH0 C;  5AQ7 A;  4GZ6 A;  3T5X A;  4A1G A;  3TWX A;  1AP7 A;  4FJZ A;  4I6G A;  3KEZ A;  2ILR A;  4APF A;  3NB2 A;  2OOE A;  4URK A;  3MV2 B;  3AAA C;  3JXI A;  2Y69 E;  4BET A;  3FFL A;  4WUY A;  5CBO A;  3DEP A;  2BUG A;  3BG0 B;  2J9Q A;  2ZXW E;  1GW6 A;  3D9L A;  2LXM A;  4M3O A;  3FU5 A;  4J8F A;  3ZYQ A;  4I6E A;  5LOZ A;  3RSE G;  4HVB A;  3FY4 A;  1UJK A;  3Q7A A;  4LER A;  3TWW A;  2GRR B;  4JXT A;  2ZGD A;  1MHQ A;  3VLE A;  4BEP A;  1N9A A;  3ZGQ A;  3S7J A;  1Z6T A;  3KS2 A;  2I6H A;  4JHK A;  3G2V A;  4RQI A;  1JWF A;  2WQH A;  4FP7 A;  2GRN B;  4RG6 A;  2P9U G;  1K1A A;  4FU3 A;  2OEV A;  4EBA G;  3O4Z A;  1OT8 A;  2AXU A;  3PZ3 A;  2WQ6 A;  2CFZ A;  3Q49 B;  4KMO A;  1IKN D;  4Q96 A;  3E30 A;  3FUK A;  4GZC A;  4GA0 A;  1A17 A;  2I1J A;  5ENR D;  2DVW A;  3R9A B;  3UT8 A;  3V2X A;  2VGX B;  4C0E A;  3QAR A;  5AN8 A;  3SNX A;  2QFC A;  3DSW A;  4JC8 A;  3B7S A;  4OVU A;  1IQU A;  4UQY A;  3UXG A;  3B7R L;  2PQN A;  5CMY A;  4B94 A;  5AAO A;  2GRQ B;  2P9S G;  1O5M A;  3ZXP A;  4CT4 A;  4F1S A;  2DIW A;  3EUV A;  3W9F A;  3B95 A;  2JAB A;  3FWV A;  3QOU A;  2XGS A;  3TWU A;  5A23 A;  3DSV A;  5ANR A;  5ARG A;  2DWZ A;  5B3S E;  3SFY A;  2BF0 X;  4NRH B;  2PQR A;  5EKQ D;  2ETB A;  3EJN A;  2QYU A;  3EHN A;  1MQS A;  3EU5 A;  4V3I A;  3CST A;  3P2B A;  5ENQ D;  2VJ8 A;  2ION A;  3HXD A;  4I9C A;  3R7Q A;  2VYI A;  2P2C P;  4GA1 A;  4XKB A;  3JQ0 A;  5T4Y A;  3U64 A;  1D9S A;  1DCE A;  4J8Y A;  2QYJ A;  4G25 A;  3SO8 A;  3FTY A;  3BUA A;  4FLB A;  4OVV A;  1EF1 C;  1FVF A;  3FUF A;  5LFA A;  4PH4 B;  4U07 A;  5FWQ A;  4AJW A;  4BT8 A;  3B13 A;  1TJF A;  1LF8 A;  3SZ7 A;  2KBX A;  4CGV A;  4YVO A;  4I1O B;  3UM1 A;  1N4R A;  2YQ8 A;  4LSZ E;  3UT4 A;  3ASD A;  4UQZ A;  4JPS A;  4LNG A;  3LY9 A;  3ZNG A;  5EIL A;  4BSZ B;  1ZB1 A;  1LD8 A;  4PS3 A;  3I4R B;  3CVV A;  4O60 A;  2BKK B;  4PS8 A;  3QJZ A;  2EIJ E;  3Q9N C;  5C2Y A;  3NOG D;  2V0P A;  4XEI G;  2P9P G;  1U2V G;  4M7C A;  4N3A A;  1SVX A;  1TN7 A;  3J5P A;  5BPP A;  1MZC A;  4K0R A;  2H6I A;  2RKK A;  3NOC D;  4IYP A;  3AG2 E;  2WXH A;  3PRZ A;  5C1D A;  3WXX A;  4HB5 A;  3ENE A;  3VTY A;  4NUR A;  5M72 A;  1E8Z A;  3IKO B;  1PAQ A;  4F6R D;  3ASF A;  3IXE A;  3NAW A;  2XQ0 A;  2VSN A;  3AS4 A;  3PZ1 A;  4MRU A;  1OWL A;  2IU1 A;  1SA5 A;  1N0Q A;  4TXQ A;  4B93 B;  5ENT D;  1UOH A;  4G8K A;  2WXL A;  4KZ0 A;  3FH8 A;  1BPO A;  2A5E A;  5AYW D;  4HOT A;  1N4Q A;  2ETC A;  4HLE A;  2HM8 A;  2OV8 A;  3ZRH A;  5LX8 A;  4E85 A;  5FQ4 A;  4GYY A;  1LD7 A;  3LVR E;  4HLL A;  5CRV A;  4J7W A;  2NYJ A;  5G05 J;  1YYH A;  2R59 A;  2MOW A;  3ZW3 A;  3CQG B;  5FIO A;  4UWL A;  1DVP A;  2WMN A;  5G04 C;  3EHQ A;  3G2S A;  4TUU A;  2J09 A;  2VTB B;  3BQO A;  3KAE A;  3MX3 A;  3U3W A;  5EDS A;  2DZO A;  3PUK A;  4GZ3 A;  5G05 C;  2P9I G;  3MGB A;  1TNO A;  1N4P A;  3TG5 A;  3UX4 A;  5CHE E;  3MEK A;  4JL0 A;  2AWI A;  2V4L A;  2YHC A;  5ARF A;  3ZHE B;  4XI0 A;  4EHM A;  5CCM A;  3L22 A;  4U04 A;  2GGF A;  1XNF A;  5BT1 A;  4B89 A;  1TEZ A;  3ZUV B;  5HRY A;  3FEX A;  4KZC A;  5KNH D;  3GZ2 A;  3D9J A;  3BEE A;  4BT9 A;  1H2U A;  1Y6I A;  1HG2 A;  1Y8M A;  2KC7 A;  3CHP A;  3LJ3 A;  4UWF A;  4OYS A;  3KEA A;  2XEE A;  3RRN B;  3GW4 A;  4TV3 A;  2LSV A;  3EHM A;  4AVX A;  3APC A;  3T9K A;  3FUL A;  1YA0 A;  3EDT B;  4ANU A;  1K3Z D;  3FTU A;  2RFA A;  1H0A A;  4BX9 A;  1O1T A;  4XKC A;  3NZS A;  4GA2 A;  3CGH A;  3IHY A;  5D66 A;  3SQV A;  3CVP A;  2V8S E;  4PDX A;  3PE4 A;  2ZIS A;  2H6G A;  3TWS A;  3UPV A;  3CSF A;  4CGW A;  4DRX E;  4GMJ A;  3ESL A;  3QKY A;  3UIP C;  2Y0B G;  2X6H A;  3Q9U C;  1ZU2 A;  2RD0 A;  3QK0 A;  2OVB A;  1O1S A;  4G23 A;  4GCO A;  5ENS D;  3ML8 A;  4BTB A;  3T8M A;  2FF4 A;  3D9K A;  3SFZ A;  3ZKJ A;  2F37 A;  3FUH A;  3CK9 A;  2HO1 A;  2H6F A;  3NF1 A;  3E4B A;  2A4Z A;  3V79 K;  4DI4 A;  4ZFH A;  4CYM D;  5FIN A;  3SBS A;  2Y1L E;  4CZ2 D;  3TGO A;  2CHZ A;  4I17 A;  5EX3 A;  5EYP F;  3EIQ C;  2C0L A;  4IN3 B;  2CFU A;  3L82 A;  1NP7 A;  5KJM A;  4WNE A;  2GRM A;  2Y4T A;  5J08 A;  2X3M A;  3AS5 A;  5DIZ A;  3U4T A;  1H6K A;  2FBN A;  2HE0 A;  3UM3 A;  5BUZ A;  4K5A B;  3D9O A;  3FUN A;  3B7T A;  2F8Y A;  3AJI A;  5AAR A;  2EIN E;  4GZ5 A;  5HQ8 A;  4JD2 G;  3L13 A;  3T5V A;  4RVB A;  3OXG A;  2XCB A;  1E8X A;  4DK5 A;  1A5E A;  3KSQ A;  4ACL A;  5JHA A;  2BED A;  4N2Q A;  4NIK A;  4AY6 A;  1NL4 A;  3Q79 A;  2LSU A;  3QWP A;  1ELK A;  2WPV A;  4J0U A;  4YDE A;  1ELW A;  3UKU G;  4U7E B;  4L2L A;  1OCC E;  2P9N G;  1E7V A;  2WXI A;  2YHE A;  4EZL A;  4O1O A;  3Q47 B;  2PZI A;  1V55 E;  1JUQ A;  3PDN A;  4OAU C;  4ATG A;  1Z3X A;  1UN8 A;  1HFA A;  4DJA A;  1OWP A;  5JJ7 A;  4APO A;  1KPS B;  3HXB A;  1YMP A;  2VTB A;  2DYR E;  4N5Q A;  1UW4 B;  4EBA A;  1E90 A;  4ABN A;  4L23 A;  3IHV A;  3F6Q A;  3TWR A;  4A55 A;  1FCH A;  1N94 A;  5FJY A;  2E0I A;  2KCK A;  4G8L A;  1HXI A;  3JXJ A;  2CG2 A;  2ZIR A;  4GPM A;  1N0R A;  4U63 A;  4J6I A;  3ESK A;  3MKR A;  3ASH A;  4DX2 A;  5EX0 A;  4WND A;  1HH8 A;  3LXU X;  4MS6 A;  2AXZ A;  2VGY A;  2VSX E;  4I9E A;  2LAI A;  5G04 J;  3UTM A;  2BTD A;  3ZPJ A;  2FEZ A;  1OWO A;  4HOR A;  1BD8 A;  4BX8 A;  3IBE A;  4BER A;  4TXR A;  4Y6W A;  5EIB E;  4U0S A;  2I2O A;  3ML9 A;  3ZYL A;  4HXI A;  3RAU A;  4ATZ D;  3ABM E;  2XGM A;  3CHO A;  5FQ8 A;  2ETA A;  5AEN A;  2WXK A;  2R5S A;  4WWN A;  4G1T A;  3DEO A;  2IF4 A;  2KXP C;  1JPL A;  4BES A;  4KVM A;  4YDY A;  2EIL E;  4GU5 A;  5AJL A;  4F7A A;  4L1B A;  4AEZ C;  4QQI A;  2KAT A;  4I6J A;  3E33 A;  3FHE A;  5ENP D;  5H7P A;  5KJN A;  4KBQ A;  3EHR A;  2HR2 A;  3LKU A;  1QYM A;  1BI8 B;  3DSU A;  4GYW A;  4G26 A;  2XRY A;  5AJD A;  1QZ2 A;  3SHF A;  4XIF A;  5FQ7 A;  2KM4 A;  3GYZ A;  5BV0 A;  4I2W A;  5A6C A;  5CED B;  4MBG A;  4EPZ A;  2OCC E;  1G3N B;  2WXQ A;  2V5F A;  4H7Y A;  4ANW A;  5HS0 A;  1VDY A;  3ASN E;  3K9I A;  1BI7 B;  3MCX A;  1LTX A;  5EN5 D;  4Z68 A;  5E75 A;  2L0T B;  3RRM B;  4FA6 A;  3TAX A;  4UWG A;  1KT1 A;  5BXU A;  3JCK C;  5CEC B;  3JQ1 A;  4RLY A;  2FI7 A;  1D8D A;  1S63 A;  4WNG A;  5ENO D;  2IO2 C;  3IV0 A;  4DLQ A;  4I1A A;  1HS6 A;  2GRP B;  1SW6 A;  3DWL G;  5CCL A;  5T8I A;  2FO7 A;  1U3C A;  4PUC A;  2X6K A;  3PNT B;  5G55 A;  4GTR A;  3TL5 A;  1AWC B;  1HU3 A;  3C72 A;  5A7D B;  1D8E A;  5FT9 A;  2IOL A;  4EQF A;  3V30 A;  4O6F A;  3TG4 A;  4EZJ A;  3T8K A;  4YDW A;  4BSX A;  5KCM A;  3BG1 B;  1JWG A;  4C48 B;  3CVU A;  1OCO E;  1MX4 A;  3ZU7 B;  3C3R A;  1FT1 A;  3HVE B;  4TUM A;  3HXC A;  3U9W A;  3Q15 A;  5FTP A;  1QQE A;  3FU3 A;  1HG5 A;  3U66 A;  3HXE A;  3IEG A;  3CVY A;  2DCP A;  1X5B A;  3C3O A;  1HF8 A;  2L0I A;  1N4S A;  2XEN A;  1WG0 A;  5JA4 D;  3ULE G;  4WNF A;  3V31 A;  3FU0 A;  3LS8 A;  1KZO A;  4AXH A;  3QWV A;  3ULQ A;  4CRW A;  1OWN A;  4K03 A;  2LAH A;  3OAW A;  4F3V A;  4LNU D;  3L6A A;  3HIZ A;  3OXF A;  3LCA A;  1UG3 A;  2XHE A;  3UQ3 A;  3D9H A;  3SI5 A;  4MLP A;  3TWT A;  3QC1 A;  3L16 A;  1K8K G;  1E7U A;  3L08 A;  2PM6 A;  2BKG A;  3RO3 A;  3PVL A;  1TNB A;  1HZ4 A;  1TNU A;  5LCW C;  3RJV A;  2VSY A;  3ZYM A;  4JZY A;  2PNN A;  5J90 A;  1RZ4 A;  3LJN A;  4D10 C;  4ILG A;  1HX8 A;  4KYO B;  3R9M A;  2VQ2 A;  1JCS A;  2R02 A;  1MJ0 A;  1DNP A;  1X81 A;  4IUL A;  3OXL A;  1P5Q A;  3TXM A;  4TRQ A;  5LCW J;  1H6P A;  3QDN A;  1KZP A;  4GML A;  3NQP A;  3LY8 A;  4LUN U;  1B89 A;  2XPY A;  3PEU B;  4YDO A;  4HFG A;  3QAQ A;  1OY3 D;  1YCS B;  3ABK E;  3E37 A;  1PY1 A;  2IEJ A;  3J5Q B;  1Z3Y A;  3UMV A;  2KCV A;  3HG0 D;  1UN9 A;  1NA3 A;  4C9B B;  4XZ4 A;  1HO8 A;  2WXF A;  4JEH A;  3C3Q A;  3PZ2 A;  3I5P A;  4F53 A;  2L6B A;  4K5B A;  2XPZ A;  4U96 D;  4HRL A;  1XGW A;  2UY1 A;  4BFR A;  1TNZ A;  2J4B A;  2OND A;  4CDR A;  4Y6C A;  2J4D A;  4Q94 A;  3RRU A;  1TNY A;  4FJY A;  3CEQ A;  1WDY A;  5CEA A;  2LXL A;  4HBD A;  3GZS A;  3AG4 E;  4W9R A;  2EIK E;  3E34 A;  1W3B A;  4HRM B;  3ZXS A;  1V54 E;  2AW6 A;  2MYO A;  1EYH A;  2C0M A;  3SFX A;  4XE0 A;  1WM5 A;  3CR3 A;  3G2W A;  3LEW A;  3CHM A;  4N2S A;  4CT0 A;  4BWR A;  5CBN A;  2XZD G;  3D3M A;  1EPU A;  3Q7F A;  3SF4 A;  2QC9 A;  2Y3A A;  2MHK A;  3FUI A;  5T3R A;  2FUL A;  4DPR A;  3DPY A;  5JJT A;  3CKB A;  3UKR G;  4ACK A;  4WWP A;  2WXO A;  2V4H C;  3UIN C;  5E76 A;  3P1U A;  1OXJ A;  2XGO A;  1HE8 A;  2WB2 A;  2LUH A;  1UJJ A;  4U8V D;  2QY7 A;  4FHJ A;  3S2A A;  5ANL A;  3DSX A;  5BV1 A;  3FUE A;  4WWO A;  3I4G A;  3HDX A;  4ME2 A;  1ELR A;  3TWQ A;  3S7F A;  3UM0 A;  2P9L G;  1Z5S C;  3KD7 A;  2LNI A;  5D2M C;  3EIJ A;  3NZU A;  3UUX A;  1BU9 A;  1H19 A;  4UI9 C;  2HYZ A;  3PE3 A;  5B1B E;  1L5J A;  3Q4A B;  2ZGG A;  3Q75 A;  4DX7 D;  4F1P A;  1NI1 A;  4XI9 A;  1PC2 A;  4AIF A;  1H2T C;  3DST A;  5FQ6 A;  5CER B;  4BY6 A;  3CK8 A;  3VTX A;  2J8S D;  3MKQ B;  5JMN D;  4AY5 A;  2IJG X;  1H6O A;  3HYM B;  3RKV A;  5CMW A;  1DCQ A;  3CQC B;  4GCN A;  4UI9 J;  3PZ4 A;  3ZYK A;  3L9T A;  4R7L A;  2WXJ A;  1IYG A;  5CRU A;  4EZK A;  2C2L A;  3FEY A;  2XPI A;  2UY1 B;  2J07 A;  3HVE A;  3MKQ A;  3CHR A;  4U8Y D;  3UT7 A;  2NSZ A;  3FTZ A;  2L9B A;  3LY7 A;  3GZ1 A;  1NA0 A;  3DXM G;  4ZHB A;  4FHK A;  2R17 C;  4KXK B;  4NAC A;  3SGH A;  3JYS A;  2R2L A;  3LYA A;  5AQ9 A;  3ZVV A;  4GB9 A;  3ONK A;  2GRO B;  4HS2 A;  3FTV A;  4KT6 B;  2WXR A;  2AJA A;  1TJC A;  2I9C A;  5BNW A;  3SD5 A;  4U8H A;  3D9I A;  2KZT A;  1U3D A;  3DRA A;  4JVS A;  5EID A;  4LEU A;  3FUM A;  3UIO C;  4FLH A;  5HKP A;  2VGX A;  2M63 A;  5BXO A;  1OWM A;  3L54 A;  3JUE A;  3FTW A;  1N11 A;  3WG7 E;  3UM2 A;  4Q69 A;  2CHW A;  4UI9 K;  1NFI E;  1WAO 1;  1BLX B;  4AV7 A;  1OCZ E;  2LO6 A;  1NZN A;  1INZ A;  4ILH B;  4J8D A;  5G2N A; 
#chains in the Genus database with same CATH homology
 1QYM A;  4U95 D;  5KWD A;  1BI8 B;  3V79 K;  3T8K A;  4HRM B;  2DZN A;  3F6Q A;  2ZGD A;  4YDW A;  3TWR A;  1MJ0 A;  4O1P A;  5ENQ D;  4BEP A;  1DCQ A;  4HI8 A;  2MYO A;  4F6R D;  4ZFH A;  4C48 B;  4QFV A;  4JB8 P;  4G8L A;  5FIN A;  2Y1L E;  3IXE A;  5HRY A;  3ZUV B;  4CZ2 D;  2P2C P;  4CYM D;  5KNH D;  1MX6 A;  3JXJ A;  3C5R A;  1MX4 A;  3ZU7 B;  4GPM A;  1N0R A;  4DX1 A;  3UI2 A;  4TUM A;  5EYP F;  1D9S A;  1N0Q A;  2FO1 E;  4DUI A;  5CBN A;  5CED B;  3KEA A;  2XEE A;  4DX2 A;  4J8Y A;  2QYJ A;  2XZD G;  4A63 B;  3SO8 A;  4B93 B;  5EYL A;  4U8Y D;  1K1A A;  5ENT D;  1UOH A;  4G8K A;  1OY3 D;  1G3N B;  3T9K A;  1OT8 A;  2HE0 A;  2QC9 A;  1IXV A;  5AQB A;  1YCS B;  4K5A B;  2A5E A;  4HI9 A;  4HQD A;  2F8Y A;  2ETC A;  5KBA A;  1DC2 A;  1K3Z D;  1IKN D;  2RFA A;  3AJI A;  2F8X K;  4ZHB A;  5AAR A;  3UTM A;  5AQ7 A;  5ITZ F;  5HS0 A;  2XEN A;  3HRA A;  1BI7 B;  3J5Q B;  5ENR D;  2DVW A;  5EN5 D;  1BD8 A;  3HG0 D;  4HNA D;  4Z68 A;  1WG0 A;  5JA4 D;  2V4H C;  3V2X A;  4BER A;  5D66 A;  1A5E A;  5AQ9 A;  4HLL A;  3TWX A;  5BXU A;  2KBX A;  3V31 A;  4DX5 D;  4J7W A;  2NYJ A;  5CEC B;  3B7B A;  5AQA A;  1AP7 A;  4HRN A;  5EIB E;  4RLY A;  4NIK A;  1YYH A;  5AN8 A;  4U8V D;  5ENO D;  4LSZ E;  1MYO A;  3EU9 A;  3TWW A;  5FIO A;  2AJA A;  2L6B A;  4ATZ D;  3TWS A;  3ZNG A;  5EIL A;  2ETA A;  4BSZ B;  4K5C A;  4K5B A;  2B0O E;  4DRX E;  3AAA C;  4U96 D;  4LNU D;  3JXI A;  4HRL A;  5EID A;  3EHQ A;  3UXG A;  1IHB A;  2Y0B G;  4O60 A;  3TWQ A;  1SW6 A;  4BET A;  5KNG A;  3DEO A;  2BKK B;  4UUC A;  5HKP A;  3Q9N C;  2KXP C;  4BES A;  1TR4 A;  5AAO A;  3W9G A;  4LG6 A;  3D9H A;  2XZT G;  3NOG D;  3Q9U C;  3TWV A;  5BXO A;  5CBO A;  2DZO A;  3DEP A;  3JUE A;  3TWT A;  1SVX A;  1MX2 A;  3J5P A;  3V2O A;  1BU9 A;  3W9F A;  3B95 A;  1N11 A;  4YDY A;  4OAV B;  2JAB A;  1AWC B;  4O1O A;  2BKG A;  3NOC D;  1NFI E;  5ENS D;  2ZGG A;  2XEH A;  3TWU A;  4DX7 D;  2VGE A;  4F1P A;  1K1B A;  1BLX B;  4OAU C;  1WDY A;  2DWZ A;  5CEA A;  4QQI A;  2V5Q C;  4DX6 D;  2PNN A;  3ZKJ A;  2F37 A;  4HBD A;  4GMR A;  4HB5 A;  3LJN A;  3V30 A;  5ENP D;  5CER B;  1S70 B;  1YMP A;  2ETB A;  3EHR A;  4N5Q A;  2J8S D;  5JMN D;  3NBN B;  2RFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...