4K5AB

Co-crystallization with conformation-specific designed ankyrin repeat proteins explains the conformational flexibility of bcl-w
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
HHGSDLGKKLLEAANVGQHDEVRILMANGADVNAADKYGDTPLHLAAMNGHLEIVEVLLKTGADVNAVDFMGRTPLHLAADNGHLEIVEVLLKHGADVNAQAFWGKTPLHLAAQQGHLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Bcl-2-like protein 2
publication title Co-Crystallization with Conformation-Specific Designed Ankyrin Repeat Proteins Explains the Conformational Flexibility of BCL-W
pubmed doi rcsb
source organism Bos taurus
total genus 53
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2013-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4k5aB00
3B7BA 1IHBA 4JB8P 4YDWA 2DWZA 4GPMA 1YYHA 3T8KA 4BEPA 4ZHBA 5KNHD 4K5CA 5BXOA 5CBOA 4O1OA 3ZUVB 1AP7A 1TR4A 1YCSB 4DX7D 1N0QA 4UUCA 5EIDA 3V2OA 2RFMA 5CEAA 5CECB 2DZOA 1MJ0A 3NOGD 4BSZB 5AAOA 3Q9UC 3D9HA 1K1AA 2XEEA 3JUEA 4O1PA 2PNNA 1N0RA 3F6QA 5EILA 4F1PA 1BU9A 1D9SA 5EYPF 5AQAA 3B95A 4HI9A 1OY3D 3TWSA 4B93B 5EN5D 4RLYA 2L6BA 5HKPA 1G3NB 1K3ZD 1NFIE 4DRXE 2DZNA 2J8SD 1BD8A 4LSZE 3V2XA 2P2CP 5HRYA 3W9FA 3TWTA 4U8VD 4DX6D 4J7WA 3NBNB 4ZFHA 5BXUA 2XZTG 4J8YA 3ZU7B 4C48B 2ETCA 5AQBA 5KWDA 3ZNGA 4ATZD 4CYMD 2HE0A 5ENQD 3J5QB 1IXVA 2F8YA 4HLLA 2AJAA 1K1BA 3NOCD 2XENA 3TWUA 2KXPC 3TWXA 3V79K 1SW6A 2F8XK 5EIBE 3Q9NC 5FIOA 1S70B 1BI8B 1QYMA 1MX6A 2ZGGA 4BERA 2BKGA 3HRAA 2DVWA 5HS0A 3DEPA 3TWWA 5ENSD 3T9KA 2A5EA 4HRLA 3KEAA 2V5QC 3HG0D 1MX4A 5AN8A 1UOHA 3LJNA 5ENRD 4QQIA 5CEDB 4OAVB 1AWCB 3TWRA 2VGEA 1SVXA 3C5RA 3EU9A 4BETA 5JA4D 4Z68A 4HB5A 2FO1E 4K5BA 5ENPD 5KBAA 4HI8A 1MYOA 4DX2A 3IXEA 3TWQA 5AQ9A 5ITZF 5AARA 4QFVA 5ENOD 2Y1LE 5AQ7A 1IKND 4NIKA 3W9GA 4F6RD 4HNAD 4HBDA 5CBNA 2B0OE 4DX1A 1DCQA 2QC9A 5JMND 2ETBA 3DEOA 1A5EA 4BESA 4HRNA 5CERB 3EHRA 4HRMB 4HQDA 4LNUD 5D66A 3V30A 1DC2A 4O60A 3EHQA 2KBXA 2V4HC 4LG6A 2MYOA 3UTMA 5FINA 4A63B 2XZDG 2Y0BG 3UXGA 2ZGDA 5ENTD 1BI7B 1BLXB 4TUMA 3UI2A 4DUIA 3ZKJA 1N11A 4N5QA 4U8YD 4G8KA 4K5AB 5KNGA 3SO8A 4CZ2D 2QYJA 2BKKB 4U96D 2XEHA 1WG0A 4G8LA 4GMRA 2ETAA 4DX5D 4OAUC 2JABA 3TWVA 2F37A 1YMPA 1MX2A 1OT8A 3AAAC 3JXIA 4YDYA 3V31A 3JXJA 3J5PA 1WDYA 5EYLA 2NYJA 4U95D 2RFAA 3AJIA
chains in the Genus database with same CATH superfamily
5A6CA 3T8KA 3QARA 2XPYA 5M72A 2VGYA 5CECB 4TRQA 3L17A 3NOGD 4FJYA 1K1AA 2XEEA 3FU6A 3JQ1A 4JXTA 1D9SA 3B95A 5FZQA 2PL2A 3TGOA 3RJVA 4U04A 2Q7FA 2YNQA 4JEHA 4AY6A 2KZTA 2P2CP 3KS2A 4JC8A 3HYMB 3K9IA 3MA5A 4AXHA 1Q2ZA 1N4QA 1PAQA 3PUKA 2XENA 4BX8A 3CEQA 2VTBA 3QJZA 4W9RA 4J8EA 2YINA 4HRLA 4MLPA 2GRPB 4DLOA 3FUKA 1D8DA 5AJLA 5AN8A 3ZEFA 3MV2B 1SVXA 4CRWA 4BETA 3ZPJA 1U3CA 4FP7A 1HE8A 2FO1E 2J4BA 3DSUA 1E8XA 4C0EA 4F6RD 1OWPA 4ME2A 4HOUA 3MV3B 1GW6A 1DCQA 2RG8A 4RG9A 4HQDA 3G2WA 2QYUA 3P1UA 2FEZA 5FQ4A 3ABME 3GZ2A 3P2BA 3PRZA 2L0TB 4FADA 2JLBA 3R7QA 4OAUC 3DPYA 2KZTB 3QK0A 3ASNE 3JXIA 1S63A 3LY8A 1Y6IA 3ULEG 1TN7A 2EIME 1DNPA 2GRLA 1YYHA 2R5SA 4GMJA 3QAQA 2AVPA 2IO2C 3LYAA 2J9QA 2RFMA 2DZOA 4FC8A 2VTBB 3JUEA 4GTPA 4B93B 4PS3A 1HG5A 2X6FA 3UQ3A 4DX6D 5BPPA 3IBEA 4GYOA 2HE0A 2FULA 5ENQD 2XPZA 5A23A 3UM1A 2V5FA 1K1BA 1PC2A 4GA0A 5DBKA 3C3RA 3UUXA 3Q9NC 4B0ZA 3FTZA 1TNBA 3Q5MA 4I9CA 4PS7A 4LCTA 2L0IA 3TWRA 2VGEA 3C5RA 4GA1A 4PDXA 2PQRA 4ACLA 3T5VA 5KJMA 2B6CA 2YHEA 3PZ2A 1IKND 3UINC 5FJYA 3BG1B 3PZDA 3NAWA 4P29A 2IU1A 2P9LG 1N11A 3EIQC 2JEKA 3B7RL 2XGSA 3G2SA 2XEVA 5G05J 4BTAA 2YQ8A 1LF8A 1OCOE 4AVXA 2FO7A 3PZ3A 2KCKA 4UUCA 4AEZC 3FTWA 1RW2A 1Z3YA 3O4ZA 4HVBA 2OCCE 3AG3E 5A7DB 5LCWC 2NXPA 3RRNB 4L9PA 1MHQA 4J7WA 3FTYA 1HH8A 3D9OA 2IFUA 3D9PA 2R02A 4K0RA 3Q47B 2Y69E 5T3RA 2XPIA 4N2QA 3L16A 3QWVA 4F1SA 1LTXA 4ILGA 3FP3A 1ZU2A 4GPKA 3MKQA 3NF1A 1FPPA 1OWMA 3S7JA 2L6JA 3ASHA 4HI8A 3FU0A 4LNGA 1OXJA 4FHJA 4TXQA 3MYVA 4HBDA 4WUYA 4LNBA 4KVOA 5JHBA 1FVFA 1HFAA 2LSUA 1SZ9A 4RSYA 2UY1A 2EINE 3U9WA 1BPOA 4CZ2D 3FFLA 5FT9A 2MHKA 1N9AA 3CVWA 3U66A 5EYLA 1ELWA 4U0ZA 2WQHA 3PREA 2A5UA 4RG6A 4L2LA 4MBGA 3VTXA 3CVQA 3KSLA 2AXUA 3T8MA 5BNWA 3QNKA 3CHQA 3IV0A 4I6GA 1K3ZD 3ZFWA 4LERA 1N4PA 1XNFA 3PE3A 4ACKA 2LSVA 3OXLA 1H6OA 3ONKA 4BTBA 2KCLA 3G2VA 1S0PA 2OOEA 3Q4AB 4N5CA 1EPUA 4F3VA 1E7VA 2RKKA 1UJKA 3ZHEA 4EHMA 1NA3A 3ZN3A 3CHPA 4X8QA 2XGMA 4E6HA 1XGWA 3X2QE 2PM7A 4KMOA 4L1BA 3ASDA 3UX4A 1H19A 4FULA 2OV8A 2ZISA 4GZ3A 2FBNA 3E30A 4F53A 4LNUD 3GW4A 3V30A 4LG6A 3PZ1A 2X6KA 1Z6TA 3QB2A 3AU4A 2AXVA 2IF4A 1H6KA 3FUIA 1O5MA 2J09A 3HHMA 3FHEA 4Q96A 5AJDA 4I1AA 2NYJA 5B1BE 4A1SA 4O1OA 5C2YA 3S7DA 2PQNA 1O1SA 2XHEA 2J49A 4UWFA 3Q9UC 4GMLA 2WXRA 3F6QA 5E76A 3D9MA 3GZSA 3ZHEB 2DZNA 3V2XA 2DCPA 3OXGA 4N39A 2Y3AA 3SQVA 3QWWA 2ETCA 2IO3C 1IXVA 3I4GA 2F8YA 3CVNA 1TYQG 3G2TA 4KZ0A 3FTUA 1FT1A 2QZAA 2QY7A 2V8SE 3HRAA 5G04C 1H2VC 5EX0A 3LJ3A 1E8YA 4AIFA 4ANWA 4GZDA 5ENRD 2J07A 3HXCA 2P58C 5EDSA 5ENPD 1IQUA 4IYPA 3FU5A 2ZXWE 5ITZF 2DIWA 2PM6A 2XS8A 5AARA 5AQ7A 2XRZA 2I2OA 3ZYLA 4J6IA 1MZCA 1N4RA 2GRRB 3ISMC 3ASOE 1BI7B 5HI7A 3BUAA 4U8YD 4UWLA 3SO8A 3ZRHA 2BEDA 4H7YA 3I4RB 3UPVA 2IQCA 3LY7A 1IQRA 1HXIA 3TWVA 5JJ6A 3B7TA 3JXJA 4DI4A 1MQSA 3UMVA 4BY6A 1E7UA 1K8KG 3AG1E 1WAO1 4BEPA 2AW6A 4K5CA 3CIAA 3NZUA 5KJLA 1N0QA 3O48A 4A55A 4FHKA 1HF8A 4AM9A 4O1PA 2WXLA 4B94A 4WNEA 4NACA 2VSYA 1NFIE 1O1TA 4JHRA 4XI0A 5FZSA 4AV7A 3R9AB 3DSVA 3PH0C 1E8WA 1HS6A 5ARGA 3C3OA 4JA7A 3ZNGA 2CFZA 1WM5A 2AJAA 5D0OD 3SFXA 3T5XA 2WQ7A 2X6IA 2HO1A 3CHOA 1SA5A 4U07A 5AENA 3PNLB 2LAIA 3SI5A 2X6HA 5ENSD 4FJZA 3EU5A 3SGHA 3ULQA 1UJJA 3FTXA 3CQGB 2KATA 2XCBA 3W9GA 2WXOA 4GCNA 3UM0A 1DC2A 2KBXA 5FWQA 3D9IA 5FINA 4YVQC 2A4ZA 3ASFA 2XCCA 3B7SA 4KZCA 3UI2A 5J08A 4A3VA 2UWJG 4WNDA 4CT4A 3L82A 4PH4B 1NZNA 2VSOE 3DXMG 1YMPA 1MX2A 3IHVA 1JPLA 4GYWA 3UKUG 4GTTA 1IHGA 4DPRA 3FU3A 1HG2A 1H2TC 3V2OA 4PUCA 3ZYKA 5CEAA 3SY2A 4ATGA 4BSZB 4EQFA 3RO3A 1TNOA 3TWSA 3IEGA 4DRXE 2P9NG 1EF1C 2GROB 3E33A 3UT4A 1L5JA 3LKUA 3QKYA 2IOSA 4J8YA 4N2SA 2R2LA 4GCOA 2P9PG 3PEVB 2WXJA 4JZYA 1SW6A 1E96B 2XRYA 1EDUA 4R7LA 2WVIA 4HOQA 4OAVB 4Z68A 4HB5A 5E75A 3CVLA 3L22A 3IXEA 5JHAA 3TAXA 3C3QA 3KSQA 4B89A 3CV0A 2GRNB 3DEOA 5CERB 2X38A 3FWVA 4MS6A 2OEVA 2WXGA 3HVEA 3DSXA 1KPSB 3FUMA 1D8EA 2BKKB 2NSZA 1WG0A 2L9BA 4CEMA 1OWOA 2JABA 5AYWD 2QFCA 4G1TA 5H7PA 1OWNA 3AAAC 3DWLG 5JJ7A 4B8CB 3UM2A 3CVXA 4IULA 4YDWA 2I1JA 3APFA 5BXOA 1H0AA 1ZB1A 4UQZA 3ESKA 4JL0A 2P9UG 3FUEA 3LEWA 4XIFA 2I9CA 1OWLA 4G11A 3OTNA 5AAOA 4HXIA 4EECA 4B8AA 4XZ4A 3TG4A 4KYOB 5B1AE 1YA0A 2WXMA 3TJPA 1OCCE 2YHCA 2C0MA 3EHNA 4JHJA 3S7FA 1HX8A 4H7XA 4RVBA 3AS5A 4ZFHA 5BXUA 4YDEA 3TXNA 4U0SA 3LCAA 1KT1A 1JWGA 3SNXA 1FCHA 2ZGGA 3E32A 3HVEB 2WB2A 3D3MA 3DPDA 4NQ0A 3ZXPA 3EIJA 2IONA 3PVLA 4UWKA 3AS4A 3OAWA 1SZAA 4DX2A 4EZLA 5AQ9A 4HORA 3BEEA 4YDOA 5BW8C 4GZ5A 4CGWA 2I6HA 3FULA 1VDYA 3PDNA 4JA9A 2M63A 3RU0A 1JWFA 3QOUA 3E34A 4BFRA 2X3MA 3E4BA 2P9IG 3QC1A 1OT8A 4J8DA 3V31A 4XI9A 3Q15A 3R9MA 3CHRA 2LXMA 2H6IA 4FA6A 1N94A 3KEZA 1LD8A 2LXLA 4AOFA 5FQ7A 2PNNA 2CHWA 3FUDA 4KVMA 1BD8A 1X5BA 4C9BB 1TNZA 3L9TA 1TEZA 2H6GA 5CRVA 4UI9C 3J5QB 3SBTB 1N52A 4TXPA 3TWXA 5HQ8A 4BSXA 4I17A 4APFA 4GTQA 1MX6A 3MKQB 3D9KA 4GAAA 3TWWA 2X6JA 3C72A 5FZRA 3FH8A 2V5QC 1OCZE 4LUNU 3MZLB 1NL4A 4HFGA 3SF4A 5KCMA 3FUNA 4Y6CA 3TWQA 4GB9A 4WNFA 3Q7FA 4GU5A 3QWPA 4AP2A 2UY1B 3BU8A 2BUGA 3CR3A 3CVUA 1UG3A 5ENTD 2CFUA 2ONDA 2P9KG 2DBAA 2ETAA 2CHXA 2AXZA 1OCRE 2F0YA 3CHMA 1NA0A 4TUUA 4Q69A 1DVPA 2CHZA 3ZIMA 5G55A 3KAEA 3ZUVB 1Y8MA 5IY5E 1N0RA 4L23A 3G2UA 4I6JA 1G3NB 3FY4A 1DCEA 5CMYA 1B89A 3BG0B 2IEJA 3SZ7A 2LAHA 4GTRA 1H6PA 4GZ6A 4U8HA 4CYMD 4GTOA 4GZCA 4HLLA 4LRZA 2R17C 4O6FA 5LX8A 4J0UA 1U3DA 4WWOA 4I9EA 3CQCB 1TNUA 3KEAA 4CGVA 4APOA 4OVUA 1H2UA 3RO2A 4URKA 2LUHA 3UIPC 2GW1A 2VGXA 3PNTB 2EIJE 2B0OE 4Y6WA 5BV1A 2QC9A 2GGFA 4O60A 2VSXE 2XZDG 2WXHA 5CCMA 2R03A 4L7TA 4N5QA 3JUIA 5KNGA 2ILRA 2MOWA 4G8LA 1KLXA 4UQYA 4AY5A 2WXFA 4CDNA 4YVOA 1WDYA 4OYSA 3AJIA 4WAFA 3WXXA 3CKBA 3FUJA 4L2YA 4EZJA 1JUQA 3LVRE 3EHMA 2OVBA 4DX7D 1Z3XA 2ZU6B 1QZ2A 4XEIG 3ESLA 3C98A 3MGBA 4XKCA 4ABNA 1Z5SC 4UI9K 5AQAA 3CKCA 4EBAG 4RLYA 5ANRA 2L6BA 2C0LA 3CK9A 3NBNB 5G04J 3PEUB 5LOZA 3UT8A 2XZTG 4U63A 1UN8A 2WMNA 4CDMA 3RAUA 2V0PA 3BQOA 3NOCD 3TWUA 2F8XK 5EIBE 1INZA 4G24A 1HZ4A 4BERA 4WNGA 3D9LA 3ZYQA 4V3IA 3T9KA 2J08A 4CT0A 3R7RA 2WXIA 1TN8A 2WXPA 3ABLE 4DLQA 3SHFA 1QNFA 3FH5A 5J90A 3MKRA 3NZSA 3CHSA 4HOSA 3I3NA 5CCLA 4K03A 3QDNA 2Y0BG 3Q79A 3DRAA 1BLXB 4MRUA 2QYJA 3CK7A 4GTSA 4GMRA 5BUZA 4DK5A 3E37A 4KT6B 2HR2A 2RFAA 4CDRA 4JB8P 2DWZA 5KNHD 4G23A 4D10C 2Y4UA 2GRQB 5EIDA 4FU3A 1BU9A 3I5PA 4F1PA 4HI9A 5DIZA 3CSFA 2J8SD 3GYZA 3N71A 5ANLA 1UN9A 3Q78A 1WY6A 4I2WA 1TJCA 4OVVA 2J4DA 1NI1A 5ARFA 1S70B 3FTSA 4J8FA 1W3BA 2BKGA 2DVWA 3DEPA 3SBSA 5G2NA 5D0QD 4TV3A 3HIZA 4EZKA 1IYGA 2XS1A 3LJNA 4XX5A 2VSNA 3VLEA 1AWCB 3EU9A 4ANXA 3GZ1A 3SFYA 4A3TA 1N54A 2XGOA 4FLHA 2WXKA 3L6AA 3EHQA 3RSEG 4KBQA 4A63B 2OEWA 1KT0A 3ZGQA 4DUIA 3Q7AA 3EDTB 2EILE 3URZA 2F37A 3J5PA 5CRUA 5FQ8A 3B7BA 1IHBA 1A17A 4ZHBA 3U3WA 3ZW3A 1AP7A 3IKOB 1YCSB 3CVYA 3LY9A 5G05C 1RZ4A 5EILA 2LO6A 5EYPF 3AU5A 3JYSA 3DSSA 4XE0A 5HKPA 5T4YA 2H6FA 2E0IA 1KZPA 4ANVA 5D2MC 3AG4E 3TWTA 2BF0X 3FEYA 1TN6A 1O1RA 4C48B 3ZU7B 4U0UA 2Y4TA 5JJTA 1U2VG 4I2ZA 4BWRA 3WG7E 4N3CA 4F7AA 3FUHA 4I1MA 3D9NA 1BI8B 2OVFA 4JVSA 2LNIA 2A5EA 3ZXSA 3HG0D 3HXEA 1UOHA 3NQPA 3FUFA 1ZBPA 5CHEE 4YNDA 4K5BA 2NC9A 4HLEA 4JHKA 5LP0A 4IN3B 5KJKA 5C1DA 2AWIA 2ETBA 2H6HA 1A5EA 4BESA 4M7CA 2CG2A 5D66A 3NB2A 4BT8A 2MYOA 4UWHA 1KZOA 3UTMA 3RRUA 3RKVA 2ZGDA 3ZVVA 4EPZA 2PZIA 2WXQA 4K5AB 2HM8A 4N3AA 3ONLA 1PY1A 3UM3A 2I1KA 1P5QA 2ZIRA 4U95D 3D9JA 5FQ6A 3EUVA 2P9SG 3ABKE 3ML8A 5AIJA 2CG3A 4UWGA 4ILIA 3U64A 4EBAA 2E2EA 2VJ8A 4GYYA 3B13A 4I43A 2WQ6A 3TL5A 2HYZA 3FH7A 4JD2G 3CGHA 3S7BA 4G26A 3MCXA 5LCWJ 3APDA 4KXKB 4M3OA 3EJNA 3S2AA 1TJFA 4JEUA 5AQBA 5BV0A 2IJGX 5BT1A 3LDZA 2EIKE 4DI3A 3SD5A 3V79K 1E90A 2RD0A 5FIOA 1QYMA 3RRMB 5HS0A 1EYHA 1FVHA 3HXBA 4I6EA 3DXKG 2XQ0A 1QBQA 3JQ0A 1E8ZA 5JA4D 5T8IA 3TG5A 3UKRG 1QQEA 4BX9A 4QFVA 3ASGA 1X81A 4NIKA 4HNAD 4RQIA 5JMND 4HRNA 3EHRA 4HRMB 4TXRA 4ANUA 2V4HC 4G25A 3UXGA 4GTMA 3ENEA 4LEUA 1N4SA 2WM9A 4MKTA 3CVVA 2EQXA 3HDXA 3CVPA 5B3SE 1NP7A 1UW4B 4GTVA 5CBOA 1TR4A 2KM4A 4NURA 3CLJA 4UI9J 3ZYMA 4XKBA 4Q94A 1OY3D 5EN5D 1OUVA 3DSWA 3HXDA 3PE4A 3L54A 3L13A 3RK6A 4JPSA 3KD7A 3FEXA 5HRYA 3W9FA 4CCAA 3Q73A 3PS6A 5KWDA 4N3BA 5CMWA 4NRHB 4G2VA 2BTDA 3JCKC 1S64A 3TXMA 3LS8A 3IHYA 3MEKA 4A1GA 3LVQE 2DYSE 4E85A 5CEDB 2WXNA 3ULYA 3CSTA 4PS8A 1HU3A 1MYOA 3B7UX 2V4LA 5LFAA 5ENOD 4BT9A 5CBNA 1N95A 2FF4A 3LXUX 2WPVA 3DBSA 2R05A 4DJAA 3ML9A 4WWPA 3VTYA 4U96D 2XEHA 4J8SA 1FT2A 4DX5D 4GA2A 5KJNA 5EKQD 1JCSA 3MJWA 2C2LA 3SFZA 3VLDA 1JCQA 1HO8A 4U7EB 4GPMA 3AS8A 4JW1A 4HOTA 1SQMA 1MJ0A 3D9HA 4HS2A 3PZ4A 2KC7A 5ENNA 3CK8A 4LSZE 3AG2E 4C0MA 2IOLA 3FDHA 3VLFA 4U8VD 4IRUA 1V54E 4UQXA 1SA4A 1LD7A 1JCRA 4ATZD 3APCA 2VQ2A 2KXPC 4AJWA 2R59A 4I1OB 2FI7A 2WMOA 5EX3A 3OXFA 1TNYA 1MX4A 4QQIA 3UIOC 3PUJA 3RIBA 3Q49B 2IY0C 5KBAA 3FTVA 2KCVA 2VGXB 3Q75A 2MRIA 4ILHB 2VYIA 2Y1LE 2DYRE 3MX3A 1ELRA 4DX1A 4WWNA 1ELKA 3L08A 3LPZA 5FTPA 4TUMA 3ZKJA 4FLBA 4G8KA 3HXFA 3DSTA 3U4TA 1V55E 3UT7A 4YDYA 2GRMA
chains in the Genus database with same CATH topology
3B7BA 1IHBA 4JB8P 4YDWA 2DWZA 4GPMA 1YYHA 3T8KA 4BEPA 4ZHBA 5KNHD 4K5CA 5BXOA 5CBOA 4O1OA 3ZUVB 1AP7A 1TR4A 1YCSB 4DX7D 1N0QA 4UUCA 5EIDA 3V2OA 2RFMA 5CEAA 5CECB 2DZOA 1MJ0A 3NOGD 4BSZB 5AAOA 3Q9UC 3D9HA 1K1AA 2XEEA 3JUEA 4O1PA 2PNNA 1N0RA 3F6QA 5EILA 4F1PA 1BU9A 1D9SA 5EYPF 5AQAA 3B95A 4HI9A 1OY3D 3TWSA 4B93B 5EN5D 4RLYA 2L6BA 5HKPA 1G3NB 1K3ZD 1NFIE 4DRXE 2DZNA 2J8SD 1BD8A 4LSZE 3V2XA 2P2CP 5HRYA 3W9FA 3TWTA 4U8VD 4DX6D 4J7WA 3NBNB 4ZFHA 5BXUA 2XZTG 4J8YA 3ZU7B 4C48B 2ETCA 5AQBA 5KWDA 3ZNGA 4ATZD 4CYMD 2HE0A 5ENQD 3J5QB 1IXVA 2F8YA 4HLLA 2AJAA 1K1BA 3NOCD 2XENA 3TWUA 2KXPC 3TWXA 3V79K 1SW6A 2F8XK 5EIBE 3Q9NC 5FIOA 1S70B 1BI8B 1QYMA 1MX6A 2ZGGA 4BERA 2BKGA 3HRAA 2DVWA 5HS0A 3DEPA 3TWWA 5ENSD 3T9KA 2A5EA 4HRLA 3KEAA 2V5QC 3HG0D 1MX4A 5AN8A 1UOHA 3LJNA 5ENRD 4QQIA 5CEDB 4OAVB 1AWCB 3TWRA 2VGEA 1SVXA 3C5RA 3EU9A 4BETA 5JA4D 4Z68A 4HB5A 2FO1E 4K5BA 5ENPD 5KBAA 4HI8A 1MYOA 4DX2A 3IXEA 3TWQA 5AQ9A 5ITZF 5AARA 4QFVA 5ENOD 2Y1LE 5AQ7A 1IKND 4NIKA 3W9GA 4F6RD 4HNAD 4HBDA 5CBNA 2B0OE 4DX1A 1DCQA 2QC9A 5JMND 2ETBA 3DEOA 1A5EA 4BESA 4HRNA 5CERB 3EHRA 4HRMB 4HQDA 4LNUD 5D66A 3V30A 1DC2A 4O60A 3EHQA 2KBXA 2V4HC 4LG6A 2MYOA 3UTMA 5FINA 4A63B 2XZDG 2Y0BG 3UXGA 2ZGDA 5ENTD 1BI7B 1BLXB 4TUMA 3UI2A 4DUIA 3ZKJA 1N11A 4N5QA 4U8YD 4G8KA 4K5AB 5KNGA 3SO8A 4CZ2D 2QYJA 2BKKB 4U96D 2XEHA 1WG0A 4G8LA 4GMRA 2ETAA 4DX5D 4OAUC 2JABA 3TWVA 2F37A 1YMPA 1MX2A 1OT8A 3AAAC 3JXIA 4YDYA 3V31A 3JXJA 3J5PA 1WDYA 5EYLA 2NYJA 4U95D 2RFAA 3AJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7B A;  1IHB A;  4JB8 P;  4YDW A;  2DWZ A;  4GPM A;  1YYH A;  3T8K A;  4BEP A;  4ZHB A;  5KNH D;  4K5C A;  5BXO A;  5CBO A;  4O1O A;  3ZUV B;  1AP7 A;  1TR4 A;  1YCS B;  4DX7 D;  1N0Q A;  4UUC A;  5EID A;  3V2O A;  2RFM A;  5CEA A;  5CEC B;  2DZO A;  1MJ0 A;  3NOG D;  4BSZ B;  5AAO A;  3Q9U C;  3D9H A;  1K1A A;  2XEE A;  3JUE A;  4O1P A;  2PNN A;  1N0R A;  3F6Q A;  5EIL A;  4F1P A;  1BU9 A;  1D9S A;  5EYP F;  5AQA A;  3B95 A;  4HI9 A;  1OY3 D;  3TWS A;  4B93 B;  5EN5 D;  4RLY A;  2L6B A;  5HKP A;  1G3N B;  1K3Z D;  1NFI E;  4DRX E;  2DZN A;  2J8S D;  1BD8 A;  4LSZ E;  3V2X A;  2P2C P;  5HRY A;  3W9F A;  3TWT A;  4U8V D;  4DX6 D;  4J7W A;  3NBN B;  4ZFH A;  5BXU A;  2XZT G;  4J8Y A;  3ZU7 B;  4C48 B;  2ETC A;  5AQB A;  5KWD A;  3ZNG A;  4ATZ D;  4CYM D;  2HE0 A;  5ENQ D;  3J5Q B;  1IXV A;  2F8Y A;  4HLL A;  2AJA A;  1K1B A;  3NOC D;  2XEN A;  3TWU A;  2KXP C;  3TWX A;  3V79 K;  1SW6 A;  2F8X K;  5EIB E;  3Q9N C;  5FIO A;  1S70 B;  1BI8 B;  1QYM A;  1MX6 A;  2ZGG A;  4BER A;  2BKG A;  3HRA A;  2DVW A;  5HS0 A;  3DEP A;  3TWW A;  5ENS D;  3T9K A;  2A5E A;  4HRL A;  3KEA A;  2V5Q C;  3HG0 D;  1MX4 A;  5AN8 A;  1UOH A;  3LJN A;  5ENR D;  4QQI A;  5CED B;  4OAV B;  1AWC B;  3TWR A;  2VGE A;  1SVX A;  3C5R A;  3EU9 A;  4BET A;  5JA4 D;  4Z68 A;  4HB5 A;  2FO1 E;  4K5B A;  5ENP D;  5KBA A;  4HI8 A;  1MYO A;  4DX2 A;  3IXE A;  3TWQ A;  5AQ9 A;  5ITZ F;  5AAR A;  4QFV A;  5ENO D;  2Y1L E;  5AQ7 A;  1IKN D;  4NIK A;  3W9G A;  4F6R D;  4HNA D;  4HBD A;  5CBN A;  2B0O E;  4DX1 A;  1DCQ A;  2QC9 A;  5JMN D;  2ETB A;  3DEO A;  1A5E A;  4BES A;  4HRN A;  5CER B;  3EHR A;  4HRM B;  4HQD A;  4LNU D;  5D66 A;  3V30 A;  1DC2 A;  4O60 A;  3EHQ A;  2KBX A;  2V4H C;  4LG6 A;  2MYO A;  3UTM A;  5FIN A;  4A63 B;  2XZD G;  2Y0B G;  3UXG A;  2ZGD A;  5ENT D;  1BI7 B;  1BLX B;  4TUM A;  3UI2 A;  4DUI A;  3ZKJ A;  1N11 A;  4N5Q A;  4U8Y D;  4G8K A;  4K5A B;  5KNG A;  3SO8 A;  4CZ2 D;  2QYJ A;  2BKK B;  4U96 D;  2XEH A;  1WG0 A;  4G8L A;  4GMR A;  2ETA A;  4DX5 D;  4OAU C;  2JAB A;  3TWV A;  2F37 A;  1YMP A;  1MX2 A;  1OT8 A;  3AAA C;  3JXI A;  4YDY A;  3V31 A;  3JXJ A;  3J5P A;  1WDY A;  5EYL A;  2NYJ A;  4U95 D;  2RFA A;  3AJI A; 
#chains in the Genus database with same CATH topology
 5A6C A;  3T8K A;  3QAR A;  2XPY A;  5M72 A;  2VGY A;  5CEC B;  4TRQ A;  3L17 A;  3NOG D;  4FJY A;  1K1A A;  2XEE A;  3FU6 A;  3JQ1 A;  4JXT A;  1D9S A;  3B95 A;  5FZQ A;  2PL2 A;  3TGO A;  3RJV A;  4U04 A;  2Q7F A;  2YNQ A;  4JEH A;  4AY6 A;  2KZT A;  2P2C P;  3KS2 A;  4JC8 A;  3HYM B;  3K9I A;  3MA5 A;  4AXH A;  1Q2Z A;  1N4Q A;  1PAQ A;  3PUK A;  2XEN A;  4BX8 A;  3CEQ A;  2VTB A;  3QJZ A;  4W9R A;  4J8E A;  2YIN A;  4HRL A;  4MLP A;  2GRP B;  4DLO A;  3FUK A;  1D8D A;  5AJL A;  5AN8 A;  3ZEF A;  3MV2 B;  1SVX A;  4CRW A;  4BET A;  3ZPJ A;  1U3C A;  4FP7 A;  1HE8 A;  2FO1 E;  2J4B A;  3DSU A;  1E8X A;  4C0E A;  4F6R D;  1OWP A;  4ME2 A;  4HOU A;  3MV3 B;  1GW6 A;  1DCQ A;  2RG8 A;  4RG9 A;  4HQD A;  3G2W A;  2QYU A;  3P1U A;  2FEZ A;  5FQ4 A;  3ABM E;  3GZ2 A;  3P2B A;  3PRZ A;  2L0T B;  4FAD A;  2JLB A;  3R7Q A;  4OAU C;  3DPY A;  2KZT B;  3QK0 A;  3ASN E;  3JXI A;  1S63 A;  3LY8 A;  1Y6I A;  3ULE G;  1TN7 A;  2EIM E;  1DNP A;  2GRL A;  1YYH A;  2R5S A;  4GMJ A;  3QAQ A;  2AVP A;  2IO2 C;  3LYA A;  2J9Q A;  2RFM A;  2DZO A;  4FC8 A;  2VTB B;  3JUE A;  4GTP A;  4B93 B;  4PS3 A;  1HG5 A;  2X6F A;  3UQ3 A;  4DX6 D;  5BPP A;  3IBE A;  4GYO A;  2HE0 A;  2FUL A;  5ENQ D;  2XPZ A;  5A23 A;  3UM1 A;  2V5F A;  1K1B A;  1PC2 A;  4GA0 A;  5DBK A;  3C3R A;  3UUX A;  3Q9N C;  4B0Z A;  3FTZ A;  1TNB A;  3Q5M A;  4I9C A;  4PS7 A;  4LCT A;  2L0I A;  3TWR A;  2VGE A;  3C5R A;  4GA1 A;  4PDX A;  2PQR A;  4ACL A;  3T5V A;  5KJM A;  2B6C A;  2YHE A;  3PZ2 A;  1IKN D;  3UIN C;  5FJY A;  3BG1 B;  3PZD A;  3NAW A;  4P29 A;  2IU1 A;  2P9L G;  1N11 A;  3EIQ C;  2JEK A;  3B7R L;  2XGS A;  3G2S A;  2XEV A;  5G05 J;  4BTA A;  2YQ8 A;  1LF8 A;  1OCO E;  4AVX A;  2FO7 A;  3PZ3 A;  2KCK A;  4UUC A;  4AEZ C;  3FTW A;  1RW2 A;  1Z3Y A;  3O4Z A;  4HVB A;  2OCC E;  3AG3 E;  5A7D B;  5LCW C;  2NXP A;  3RRN B;  4L9P A;  1MHQ A;  4J7W A;  3FTY A;  1HH8 A;  3D9O A;  2IFU A;  3D9P A;  2R02 A;  4K0R A;  3Q47 B;  2Y69 E;  5T3R A;  2XPI A;  4N2Q A;  3L16 A;  3QWV A;  4F1S A;  1LTX A;  4ILG A;  3FP3 A;  1ZU2 A;  4GPK A;  3MKQ A;  3NF1 A;  1FPP A;  1OWM A;  3S7J A;  2L6J A;  3ASH A;  4HI8 A;  3FU0 A;  4LNG A;  1OXJ A;  4FHJ A;  4TXQ A;  3MYV A;  4HBD A;  4WUY A;  4LNB A;  4KVO A;  5JHB A;  1FVF A;  1HFA A;  2LSU A;  1SZ9 A;  4RSY A;  2UY1 A;  2EIN E;  3U9W A;  1BPO A;  4CZ2 D;  3FFL A;  5FT9 A;  2MHK A;  1N9A A;  3CVW A;  3U66 A;  5EYL A;  1ELW A;  4U0Z A;  2WQH A;  3PRE A;  2A5U A;  4RG6 A;  4L2L A;  4MBG A;  3VTX A;  3CVQ A;  3KSL A;  2AXU A;  3T8M A;  5BNW A;  3QNK A;  3CHQ A;  3IV0 A;  4I6G A;  1K3Z D;  3ZFW A;  4LER A;  1N4P A;  1XNF A;  3PE3 A;  4ACK A;  2LSV A;  3OXL A;  1H6O A;  3ONK A;  4BTB A;  2KCL A;  3G2V A;  1S0P A;  2OOE A;  3Q4A B;  4N5C A;  1EPU A;  4F3V A;  1E7V A;  2RKK A;  1UJK A;  3ZHE A;  4EHM A;  1NA3 A;  3ZN3 A;  3CHP A;  4X8Q A;  2XGM A;  4E6H A;  1XGW A;  3X2Q E;  2PM7 A;  4KMO A;  4L1B A;  3ASD A;  3UX4 A;  1H19 A;  4FUL A;  2OV8 A;  2ZIS A;  4GZ3 A;  2FBN A;  3E30 A;  4F53 A;  4LNU D;  3GW4 A;  3V30 A;  4LG6 A;  3PZ1 A;  2X6K A;  1Z6T A;  3QB2 A;  3AU4 A;  2AXV A;  2IF4 A;  1H6K A;  3FUI A;  1O5M A;  2J09 A;  3HHM A;  3FHE A;  4Q96 A;  5AJD A;  4I1A A;  2NYJ A;  5B1B E;  4A1S A;  4O1O A;  5C2Y A;  3S7D A;  2PQN A;  1O1S A;  2XHE A;  2J49 A;  4UWF A;  3Q9U C;  4GML A;  2WXR A;  3F6Q A;  5E76 A;  3D9M A;  3GZS A;  3ZHE B;  2DZN A;  3V2X A;  2DCP A;  3OXG A;  4N39 A;  2Y3A A;  3SQV A;  3QWW A;  2ETC A;  2IO3 C;  1IXV A;  3I4G A;  2F8Y A;  3CVN A;  1TYQ G;  3G2T A;  4KZ0 A;  3FTU A;  1FT1 A;  2QZA A;  2QY7 A;  2V8S E;  3HRA A;  5G04 C;  1H2V C;  5EX0 A;  3LJ3 A;  1E8Y A;  4AIF A;  4ANW A;  4GZD A;  5ENR D;  2J07 A;  3HXC A;  2P58 C;  5EDS A;  5ENP D;  1IQU A;  4IYP A;  3FU5 A;  2ZXW E;  5ITZ F;  2DIW A;  2PM6 A;  2XS8 A;  5AAR A;  5AQ7 A;  2XRZ A;  2I2O A;  3ZYL A;  4J6I A;  1MZC A;  1N4R A;  2GRR B;  3ISM C;  3ASO E;  1BI7 B;  5HI7 A;  3BUA A;  4U8Y D;  4UWL A;  3SO8 A;  3ZRH A;  2BED A;  4H7Y A;  3I4R B;  3UPV A;  2IQC A;  3LY7 A;  1IQR A;  1HXI A;  3TWV A;  5JJ6 A;  3B7T A;  3JXJ A;  4DI4 A;  1MQS A;  3UMV A;  4BY6 A;  1E7U A;  1K8K G;  3AG1 E;  1WAO 1;  4BEP A;  2AW6 A;  4K5C A;  3CIA A;  3NZU A;  5KJL A;  1N0Q A;  3O48 A;  4A55 A;  4FHK A;  1HF8 A;  4AM9 A;  4O1P A;  2WXL A;  4B94 A;  4WNE A;  4NAC A;  2VSY A;  1NFI E;  1O1T A;  4JHR A;  4XI0 A;  5FZS A;  4AV7 A;  3R9A B;  3DSV A;  3PH0 C;  1E8W A;  1HS6 A;  5ARG A;  3C3O A;  4JA7 A;  3ZNG A;  2CFZ A;  1WM5 A;  2AJA A;  5D0O D;  3SFX A;  3T5X A;  2WQ7 A;  2X6I A;  2HO1 A;  3CHO A;  1SA5 A;  4U07 A;  5AEN A;  3PNL B;  2LAI A;  3SI5 A;  2X6H A;  5ENS D;  4FJZ A;  3EU5 A;  3SGH A;  3ULQ A;  1UJJ A;  3FTX A;  3CQG B;  2KAT A;  2XCB A;  3W9G A;  2WXO A;  4GCN A;  3UM0 A;  1DC2 A;  2KBX A;  5FWQ A;  3D9I A;  5FIN A;  4YVQ C;  2A4Z A;  3ASF A;  2XCC A;  3B7S A;  4KZC A;  3UI2 A;  5J08 A;  4A3V A;  2UWJ G;  4WND A;  4CT4 A;  3L82 A;  4PH4 B;  1NZN A;  2VSO E;  3DXM G;  1YMP A;  1MX2 A;  3IHV A;  1JPL A;  4GYW A;  3UKU G;  4GTT A;  1IHG A;  4DPR A;  3FU3 A;  1HG2 A;  1H2T C;  3V2O A;  4PUC A;  3ZYK A;  5CEA A;  3SY2 A;  4ATG A;  4BSZ B;  4EQF A;  3RO3 A;  1TNO A;  3TWS A;  3IEG A;  4DRX E;  2P9N G;  1EF1 C;  2GRO B;  3E33 A;  3UT4 A;  1L5J A;  3LKU A;  3QKY A;  2IOS A;  4J8Y A;  4N2S A;  2R2L A;  4GCO A;  2P9P G;  3PEV B;  2WXJ A;  4JZY A;  1SW6 A;  1E96 B;  2XRY A;  1EDU A;  4R7L A;  2WVI A;  4HOQ A;  4OAV B;  4Z68 A;  4HB5 A;  5E75 A;  3CVL A;  3L22 A;  3IXE A;  5JHA A;  3TAX A;  3C3Q A;  3KSQ A;  4B89 A;  3CV0 A;  2GRN B;  3DEO A;  5CER B;  2X38 A;  3FWV A;  4MS6 A;  2OEV A;  2WXG A;  3HVE A;  3DSX A;  1KPS B;  3FUM A;  1D8E A;  2BKK B;  2NSZ A;  1WG0 A;  2L9B A;  4CEM A;  1OWO A;  2JAB A;  5AYW D;  2QFC A;  4G1T A;  5H7P A;  1OWN A;  3AAA C;  3DWL G;  5JJ7 A;  4B8C B;  3UM2 A;  3CVX A;  4IUL A;  4YDW A;  2I1J A;  3APF A;  5BXO A;  1H0A A;  1ZB1 A;  4UQZ A;  3ESK A;  4JL0 A;  2P9U G;  3FUE A;  3LEW A;  4XIF A;  2I9C A;  1OWL A;  4G11 A;  3OTN A;  5AAO A;  4HXI A;  4EEC A;  4B8A A;  4XZ4 A;  3TG4 A;  4KYO B;  5B1A E;  1YA0 A;  2WXM A;  3TJP A;  1OCC E;  2YHC A;  2C0M A;  3EHN A;  4JHJ A;  3S7F A;  1HX8 A;  4H7X A;  4RVB A;  3AS5 A;  4ZFH A;  5BXU A;  4YDE A;  3TXN A;  4U0S A;  3LCA A;  1KT1 A;  1JWG A;  3SNX A;  1FCH A;  2ZGG A;  3E32 A;  3HVE B;  2WB2 A;  3D3M A;  3DPD A;  4NQ0 A;  3ZXP A;  3EIJ A;  2ION A;  3PVL A;  4UWK A;  3AS4 A;  3OAW A;  1SZA A;  4DX2 A;  4EZL A;  5AQ9 A;  4HOR A;  3BEE A;  4YDO A;  5BW8 C;  4GZ5 A;  4CGW A;  2I6H A;  3FUL A;  1VDY A;  3PDN A;  4JA9 A;  2M63 A;  3RU0 A;  1JWF A;  3QOU A;  3E34 A;  4BFR A;  2X3M A;  3E4B A;  2P9I G;  3QC1 A;  1OT8 A;  4J8D A;  3V31 A;  4XI9 A;  3Q15 A;  3R9M A;  3CHR A;  2LXM A;  2H6I A;  4FA6 A;  1N94 A;  3KEZ A;  1LD8 A;  2LXL A;  4AOF A;  5FQ7 A;  2PNN A;  2CHW A;  3FUD A;  4KVM A;  1BD8 A;  1X5B A;  4C9B B;  1TNZ A;  3L9T A;  1TEZ A;  2H6G A;  5CRV A;  4UI9 C;  3J5Q B;  3SBT B;  1N52 A;  4TXP A;  3TWX A;  5HQ8 A;  4BSX A;  4I17 A;  4APF A;  4GTQ A;  1MX6 A;  3MKQ B;  3D9K A;  4GAA A;  3TWW A;  2X6J A;  3C72 A;  5FZR A;  3FH8 A;  2V5Q C;  1OCZ E;  4LUN U;  3MZL B;  1NL4 A;  4HFG A;  3SF4 A;  5KCM A;  3FUN A;  4Y6C A;  3TWQ A;  4GB9 A;  4WNF A;  3Q7F A;  4GU5 A;  3QWP A;  4AP2 A;  2UY1 B;  3BU8 A;  2BUG A;  3CR3 A;  3CVU A;  1UG3 A;  5ENT D;  2CFU A;  2OND A;  2P9K G;  2DBA A;  2ETA A;  2CHX A;  2AXZ A;  1OCR E;  2F0Y A;  3CHM A;  1NA0 A;  4TUU A;  4Q69 A;  1DVP A;  2CHZ A;  3ZIM A;  5G55 A;  3KAE A;  3ZUV B;  1Y8M A;  5IY5 E;  1N0R A;  4L23 A;  3G2U A;  4I6J A;  1G3N B;  3FY4 A;  1DCE A;  5CMY A;  1B89 A;  3BG0 B;  2IEJ A;  3SZ7 A;  2LAH A;  4GTR A;  1H6P A;  4GZ6 A;  4U8H A;  4CYM D;  4GTO A;  4GZC A;  4HLL A;  4LRZ A;  2R17 C;  4O6F A;  5LX8 A;  4J0U A;  1U3D A;  4WWO A;  4I9E A;  3CQC B;  1TNU A;  3KEA A;  4CGV A;  4APO A;  4OVU A;  1H2U A;  3RO2 A;  4URK A;  2LUH A;  3UIP C;  2GW1 A;  2VGX A;  3PNT B;  2EIJ E;  2B0O E;  4Y6W A;  5BV1 A;  2QC9 A;  2GGF A;  4O60 A;  2VSX E;  2XZD G;  2WXH A;  5CCM A;  2R03 A;  4L7T A;  4N5Q A;  3JUI A;  5KNG A;  2ILR A;  2MOW A;  4G8L A;  1KLX A;  4UQY A;  4AY5 A;  2WXF A;  4CDN A;  4YVO A;  1WDY A;  4OYS A;  3AJI A;  4WAF A;  3WXX A;  3CKB A;  3FUJ A;  4L2Y A;  4EZJ A;  1JUQ A;  3LVR E;  3EHM A;  2OVB A;  4DX7 D;  1Z3X A;  2ZU6 B;  1QZ2 A;  4XEI G;  3ESL A;  3C98 A;  3MGB A;  4XKC A;  4ABN A;  1Z5S C;  4UI9 K;  5AQA A;  3CKC A;  4EBA G;  4RLY A;  5ANR A;  2L6B A;  2C0L A;  3CK9 A;  3NBN B;  5G04 J;  3PEU B;  5LOZ A;  3UT8 A;  2XZT G;  4U63 A;  1UN8 A;  2WMN A;  4CDM A;  3RAU A;  2V0P A;  3BQO A;  3NOC D;  3TWU A;  2F8X K;  5EIB E;  1INZ A;  4G24 A;  1HZ4 A;  4BER A;  4WNG A;  3D9L A;  3ZYQ A;  4V3I A;  3T9K A;  2J08 A;  4CT0 A;  3R7R A;  2WXI A;  1TN8 A;  2WXP A;  3ABL E;  4DLQ A;  3SHF A;  1QNF A;  3FH5 A;  5J90 A;  3MKR A;  3NZS A;  3CHS A;  4HOS A;  3I3N A;  5CCL A;  4K03 A;  3QDN A;  2Y0B G;  3Q79 A;  3DRA A;  1BLX B;  4MRU A;  2QYJ A;  3CK7 A;  4GTS A;  4GMR A;  5BUZ A;  4DK5 A;  3E37 A;  4KT6 B;  2HR2 A;  2RFA A;  4CDR A;  4JB8 P;  2DWZ A;  5KNH D;  4G23 A;  4D10 C;  2Y4U A;  2GRQ B;  5EID A;  4FU3 A;  1BU9 A;  3I5P A;  4F1P A;  4HI9 A;  5DIZ A;  3CSF A;  2J8S D;  3GYZ A;  3N71 A;  5ANL A;  1UN9 A;  3Q78 A;  1WY6 A;  4I2W A;  1TJC A;  4OVV A;  2J4D A;  1NI1 A;  5ARF A;  1S70 B;  3FTS A;  4J8F A;  1W3B A;  2BKG A;  2DVW A;  3DEP A;  3SBS A;  5G2N A;  5D0Q D;  4TV3 A;  3HIZ A;  4EZK A;  1IYG A;  2XS1 A;  3LJN A;  4XX5 A;  2VSN A;  3VLE A;  1AWC B;  3EU9 A;  4ANX A;  3GZ1 A;  3SFY A;  4A3T A;  1N54 A;  2XGO A;  4FLH A;  2WXK A;  3L6A A;  3EHQ A;  3RSE G;  4KBQ A;  4A63 B;  2OEW A;  1KT0 A;  3ZGQ A;  4DUI A;  3Q7A A;  3EDT B;  2EIL E;  3URZ A;  2F37 A;  3J5P A;  5CRU A;  5FQ8 A;  3B7B A;  1IHB A;  1A17 A;  4ZHB A;  3U3W A;  3ZW3 A;  1AP7 A;  3IKO B;  1YCS B;  3CVY A;  3LY9 A;  5G05 C;  1RZ4 A;  5EIL A;  2LO6 A;  5EYP F;  3AU5 A;  3JYS A;  3DSS A;  4XE0 A;  5HKP A;  5T4Y A;  2H6F A;  2E0I A;  1KZP A;  4ANV A;  5D2M C;  3AG4 E;  3TWT A;  2BF0 X;  3FEY A;  1TN6 A;  1O1R A;  4C48 B;  3ZU7 B;  4U0U A;  2Y4T A;  5JJT A;  1U2V G;  4I2Z A;  4BWR A;  3WG7 E;  4N3C A;  4F7A A;  3FUH A;  4I1M A;  3D9N A;  1BI8 B;  2OVF A;  4JVS A;  2LNI A;  2A5E A;  3ZXS A;  3HG0 D;  3HXE A;  1UOH A;  3NQP A;  3FUF A;  1ZBP A;  5CHE E;  4YND A;  4K5B A;  2NC9 A;  4HLE A;  4JHK A;  5LP0 A;  4IN3 B;  5KJK A;  5C1D A;  2AWI A;  2ETB A;  2H6H A;  1A5E A;  4BES A;  4M7C A;  2CG2 A;  5D66 A;  3NB2 A;  4BT8 A;  2MYO A;  4UWH A;  1KZO A;  3UTM A;  3RRU A;  3RKV A;  2ZGD A;  3ZVV A;  4EPZ A;  2PZI A;  2WXQ A;  4K5A B;  2HM8 A;  4N3A A;  3ONL A;  1PY1 A;  3UM3 A;  2I1K A;  1P5Q A;  2ZIR A;  4U95 D;  3D9J A;  5FQ6 A;  3EUV A;  2P9S G;  3ABK E;  3ML8 A;  5AIJ A;  2CG3 A;  4UWG A;  4ILI A;  3U64 A;  4EBA A;  2E2E A;  2VJ8 A;  4GYY A;  3B13 A;  4I43 A;  2WQ6 A;  3TL5 A;  2HYZ A;  3FH7 A;  4JD2 G;  3CGH A;  3S7B A;  4G26 A;  3MCX A;  5LCW J;  3APD A;  4KXK B;  4M3O A;  3EJN A;  3S2A A;  1TJF A;  4JEU A;  5AQB A;  5BV0 A;  2IJG X;  5BT1 A;  3LDZ A;  2EIK E;  4DI3 A;  3SD5 A;  3V79 K;  1E90 A;  2RD0 A;  5FIO A;  1QYM A;  3RRM B;  5HS0 A;  1EYH A;  1FVH A;  3HXB A;  4I6E A;  3DXK G;  2XQ0 A;  1QBQ A;  3JQ0 A;  1E8Z A;  5JA4 D;  5T8I A;  3TG5 A;  3UKR G;  1QQE A;  4BX9 A;  4QFV A;  3ASG A;  1X81 A;  4NIK A;  4HNA D;  4RQI A;  5JMN D;  4HRN A;  3EHR A;  4HRM B;  4TXR A;  4ANU A;  2V4H C;  4G25 A;  3UXG A;  4GTM A;  3ENE A;  4LEU A;  1N4S A;  2WM9 A;  4MKT A;  3CVV A;  2EQX A;  3HDX A;  3CVP A;  5B3S E;  1NP7 A;  1UW4 B;  4GTV A;  5CBO A;  1TR4 A;  2KM4 A;  4NUR A;  3CLJ A;  4UI9 J;  3ZYM A;  4XKB A;  4Q94 A;  1OY3 D;  5EN5 D;  1OUV A;  3DSW A;  3HXD A;  3PE4 A;  3L54 A;  3L13 A;  3RK6 A;  4JPS A;  3KD7 A;  3FEX A;  5HRY A;  3W9F A;  4CCA A;  3Q73 A;  3PS6 A;  5KWD A;  4N3B A;  5CMW A;  4NRH B;  4G2V A;  2BTD A;  3JCK C;  1S64 A;  3TXM A;  3LS8 A;  3IHY A;  3MEK A;  4A1G A;  3LVQ E;  2DYS E;  4E85 A;  5CED B;  2WXN A;  3ULY A;  3CST A;  4PS8 A;  1HU3 A;  1MYO A;  3B7U X;  2V4L A;  5LFA A;  5ENO D;  4BT9 A;  5CBN A;  1N95 A;  2FF4 A;  3LXU X;  2WPV A;  3DBS A;  2R05 A;  4DJA A;  3ML9 A;  4WWP A;  3VTY A;  4U96 D;  2XEH A;  4J8S A;  1FT2 A;  4DX5 D;  4GA2 A;  5KJN A;  5EKQ D;  1JCS A;  3MJW A;  2C2L A;  3SFZ A;  3VLD A;  1JCQ A;  1HO8 A;  4U7E B;  4GPM A;  3AS8 A;  4JW1 A;  4HOT A;  1SQM A;  1MJ0 A;  3D9H A;  4HS2 A;  3PZ4 A;  2KC7 A;  5ENN A;  3CK8 A;  4LSZ E;  3AG2 E;  4C0M A;  2IOL A;  3FDH A;  3VLF A;  4U8V D;  4IRU A;  1V54 E;  4UQX A;  1SA4 A;  1LD7 A;  1JCR A;  4ATZ D;  3APC A;  2VQ2 A;  2KXP C;  4AJW A;  2R59 A;  4I1O B;  2FI7 A;  2WMO A;  5EX3 A;  3OXF A;  1TNY A;  1MX4 A;  4QQI A;  3UIO C;  3PUJ A;  3RIB A;  3Q49 B;  2IY0 C;  5KBA A;  3FTV A;  2KCV A;  2VGX B;  3Q75 A;  2MRI A;  4ILH B;  2VYI A;  2Y1L E;  2DYR E;  3MX3 A;  1ELR A;  4DX1 A;  4WWN A;  1ELK A;  3L08 A;  3LPZ A;  5FTP A;  4TUM A;  3ZKJ A;  4FLB A;  4G8K A;  3HXF A;  3DST A;  3U4T A;  1V55 E;  3UT7 A;  4YDY A;  2GRM A; 
#chains in the Genus database with same CATH homology
 3B7B A;  1IHB A;  4JB8 P;  4YDW A;  2DWZ A;  4GPM A;  1YYH A;  3T8K A;  4BEP A;  4ZHB A;  5KNH D;  4K5C A;  5BXO A;  5CBO A;  4O1O A;  3ZUV B;  1AP7 A;  1TR4 A;  1YCS B;  4DX7 D;  1N0Q A;  4UUC A;  5EID A;  3V2O A;  2RFM A;  5CEA A;  5CEC B;  2DZO A;  1MJ0 A;  3NOG D;  4BSZ B;  5AAO A;  3Q9U C;  3D9H A;  1K1A A;  2XEE A;  3JUE A;  4O1P A;  2PNN A;  1N0R A;  3F6Q A;  5EIL A;  4F1P A;  1BU9 A;  1D9S A;  5EYP F;  5AQA A;  3B95 A;  4HI9 A;  1OY3 D;  3TWS A;  4B93 B;  5EN5 D;  4RLY A;  2L6B A;  5HKP A;  1G3N B;  1K3Z D;  1NFI E;  4DRX E;  2DZN A;  2J8S D;  1BD8 A;  4LSZ E;  3V2X A;  2P2C P;  5HRY A;  3W9F A;  3TWT A;  4U8V D;  4DX6 D;  4J7W A;  3NBN B;  4ZFH A;  5BXU A;  2XZT G;  4J8Y A;  3ZU7 B;  4C48 B;  2ETC A;  5AQB A;  5KWD A;  3ZNG A;  4ATZ D;  4CYM D;  2HE0 A;  5ENQ D;  3J5Q B;  1IXV A;  2F8Y A;  4HLL A;  2AJA A;  1K1B A;  3NOC D;  2XEN A;  3TWU A;  2KXP C;  3TWX A;  3V79 K;  1SW6 A;  2F8X K;  5EIB E;  3Q9N C;  5FIO A;  1S70 B;  1BI8 B;  1QYM A;  1MX6 A;  2ZGG A;  4BER A;  2BKG A;  3HRA A;  2DVW A;  5HS0 A;  3DEP A;  3TWW A;  5ENS D;  3T9K A;  2A5E A;  4HRL A;  3KEA A;  2V5Q C;  3HG0 D;  1MX4 A;  5AN8 A;  1UOH A;  3LJN A;  5ENR D;  4QQI A;  5CED B;  4OAV B;  1AWC B;  3TWR A;  2VGE A;  1SVX A;  3C5R A;  3EU9 A;  4BET A;  5JA4 D;  4Z68 A;  4HB5 A;  2FO1 E;  4K5B A;  5ENP D;  5KBA A;  4HI8 A;  1MYO A;  4DX2 A;  3IXE A;  3TWQ A;  5AQ9 A;  5ITZ F;  5AAR A;  4QFV A;  5ENO D;  2Y1L E;  5AQ7 A;  1IKN D;  4NIK A;  3W9G A;  4F6R D;  4HNA D;  4HBD A;  5CBN A;  2B0O E;  4DX1 A;  1DCQ A;  2QC9 A;  5JMN D;  2ETB A;  3DEO A;  1A5E A;  4BES A;  4HRN A;  5CER B;  3EHR A;  4HRM B;  4HQD A;  4LNU D;  5D66 A;  3V30 A;  1DC2 A;  4O60 A;  3EHQ A;  2KBX A;  2V4H C;  4LG6 A;  2MYO A;  3UTM A;  5FIN A;  4A63 B;  2XZD G;  2Y0B G;  3UXG A;  2ZGD A;  5ENT D;  1BI7 B;  1BLX B;  4TUM A;  3UI2 A;  4DUI A;  3ZKJ A;  1N11 A;  4N5Q A;  4U8Y D;  4G8K A;  4K5A B;  5KNG A;  3SO8 A;  4CZ2 D;  2QYJ A;  2BKK B;  4U96 D;  2XEH A;  1WG0 A;  4G8L A;  4GMR A;  2ETA A;  4DX5 D;  4OAU C;  2JAB A;  3TWV A;  2F37 A;  1YMP A;  1MX2 A;  1OT8 A;  3AAA C;  3JXI A;  4YDY A;  3V31 A;  3JXJ A;  3J5P A;  1WDY A;  5EYL A;  2NYJ A;  4U95 D;  2RFA A;  3AJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...