2IEJA

Human protein farnesyltransferase complexed with inhibitor compound stn-48 and fpp analog at 1.8a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Resistance mutations at the lipid substrate binding site of Plasmodium falciparum protein farnesyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 127
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2iejA00
1TNYA 4L9PA 3PZ1A 4GTMA 4LNGA 4GTQA 1D8DA 1N4PA 3HXFA 3PZ3A 3E37A 2BEDA 1TN7A 3Q79A 2H6IA 1NL4A 1LD7A 1NI1A 1KZPA 3E33A 1JCRA 4GTRA 1N4RA 3PZ2A 1TN8A 3EUVA 2ZISA 3KSLA 1FPPA 4EHMA 1O1SA 2F0YA 4GTOA 4MBGA 3PZ4A 3KSQA 1N4SA 1TN6A 1TNOA 3DSVA 3SFXA 1SA4A 3HXBA 4GTTA 2H6FA 3Q73A 1LD8A 1DCEA 1TNBA 1MZCA 3E34A 1SA5A 1O1TA 1X81A 3C72A 3DSUA 3SFYA 1N95A 1LTXA 2IEJA 1TNUA 1O5MA 4YDEA 2ZIRA 2R2LA 3DSXA 3Q75A 3HXEA 3HXDA 1KZOA 3EU5A 3DSWA 1N9AA 3E30A 1N4QA 3DRAA 3E32A 1QBQA 4LNBA 4YDOA 1N94A 1JCSA 3Q7FA 3DSSA 4GTSA 2H6GA 3Q78A 1S64A 4GTPA 1S63A 4GTVA 3HXCA 1O1RA 1JCQA 3Q7AA 1D8EA 1TNZA 3DPYA 3DSTA 2H6HA 1FT1A 1FT2A
chains in the Genus database with same CATH superfamily
4I9CA 2V0PA 4CRWA 4XI0A 4BY6A 1BI8B 3FH8A 3PE3A 4ILIA 3EJNA 4HS2A 3MCXA 3Q79A 3ZHEB 4KVMA 5E76A 4HLEA 4GTRA 5G04J 2CG3A 2YHEA 1KLXA 2A4ZA 3FH7A 3PDNA 2VJ8A 2P9IG 1UJKA 3QWWA 2CG2A 1KT1A 5IY5E 3HDXA 2ZGDA 4EZLA 1N4SA 3RK6A 1TNOA 3UM3A 4JVSA 4GMLA 5EYLA 4BSXA 3ZUVB 2EQXA 1OWNA 4BTBA 2XEEA 1QQEA 3FEYA 1LTXA 4YVOA 3NOCD 1A17A 2QFCA 1O5MA 4GMRA 5CRVA 3LS8A 3L22A 1YCSB 3DSXA 5FINA 3JQ1A 3FULA 5KNGA 3TWTA 3W9GA 1XGWA 4O6FA 2KATA 5D66A 1K3ZD 4AJWA 5J90A 2HE0A 2WXFA 3EU9A 4DLQA 5HKPA 2JEKA 3JUIA 3ML8A 3QDNA 1H6OA 3UT4A 2J09A 4FHJA 3ZVVA 1DVPA 4GB9A 3SGHA 4Q94A 3CLJA 2DYSE 2Y3AA 2HM8A 2OEWA 4HFGA 2FULA 3T8KA 3NBNB 5ENQD 3HRAA 3UPVA 3FUFA 3LVQE 4ANVA 4BESA 1E90A 4FJZA 2VSXE 5FZQA 2VTBA 3L9TA 3B7SA 1MX2A 4TV3A 4OVVA 3E33A 4K5BA 1IQUA 4XEIG 3LVRE 4A1SA 3QC1A 4I1AA 3FTYA 3L82A 4MBGA 3PZ4A 1ZBPA 4BX9A 2FO7A 1Z3YA 3DSVA 4B93B 2C2LA 2IY0C 3CR3A 4U0ZA 3NZUA 1TNBA 4JHJA 4TXQA 4NURA 4HVBA 3TGOA 1IHGA 1SZ9A 1N52A 1MYOA 4R7LA 4HQDA 2V5FA 3E32A 1QBQA 2IJGX 3UUXA 1NA3A 1OWLA 4APFA 4ANWA 2KCLA 2QYJA 4GTSA 2RKKA 5AJDA 3LY7A 1H2VC 3DPYA 4UQZA 2P9KG 2LXLA 1OXJA 3FH5A 3JYSA 2V5QC 2J8SD 4A63B 2DCPA 2R17C 2F8YA 2ETAA 1OUVA 4MLPA 3GYZA 4I2ZA 2UWJG 2GRQB 4UI9J 4B8CB 4AV7A 1KZPA 1N4RA 4RLYA 3C3QA 5JMND 3UKUG 2ZGGA 1YMPA 5AAOA 1N0QA 3FUIA 4OVUA 4K0RA 1X5BA 2VQ2A 1EYHA 3D9PA 2Y69E 3KEZA 4UUCA 3ZYLA 1BU9A 4RSYA 5FT9A 3CQGB 4CDMA 3TWXA 3FUKA 2AXZA 3AU5A 2X6IA 2L6JA 3URZA 1EDUA 3CGHA 3AG1E 5ENTD 2IONA 1TNUA 2WM9A 2AVPA 2M63A 3ESKA 3UMVA 3PVLA 4CCAA 5KJLA 3HXEA 3PEVB 2PNNA 4XKBA 2Y4TA 1N9AA 5D2MC 3T5VA 2WXPA 1V54E 2P9NG 3ULEG 4AP2A 4XI9A 2WXMA 3QARA 5BNWA 3Q78A 1HZ4A 2WXJA 3HXCA 3P1UA 3FU0A 4EBAG 2IO2C 2YQ8A 4UWFA 1WDYA 3U64A 3FUHA 3ZEFA 4GZ5A 3RJVA 3PZ1A 3D9HA 4DLOA 4BSZB 3R9MA 2DVWA 4F3VA 4I6GA 1H6KA 1NI1A 2Y1LE 1HE8A 3PZ2A 1MHQA 4J8SA 3LJNA 3HHMA 4UWLA 2I9CA 2KCVA 2JABA 2ZISA 4F53A 4PUCA 1H19A 3KSQA 4N5QA 3MV3B 2OCCE 3SFXA 2V8SE 3CVXA 4AM9A 3JUEA 4HNAD 3BEEA 3ASHA 2XPYA 4WAFA 3MEKA 5AENA 1TJFA 3LEWA 2ZIRA 1OY3D 1RW2A 1UJJA 2VSYA 2BKGA 3DEOA 2FO1E 3D9JA 3OXGA 1MX4A 3EU5A 4DI4A 3FU3A 2XRZA 4EBAA 3DRAA 3S2AA 4GZCA 3D3MA 1HU3A 4XX5A 3J5PA 4CGWA 4BWRA 5HRYA 2H6HA 1FT2A 3Q9NC 3L08A 2OEVA 3PZDA 4URKA 5ARFA 1P5QA 4I1OB 3I5PA 4KBQA 2WXLA 3GZ2A 2PQNA 1PC2A 1WAO1 4HXIA 2GGFA 3CK9A 2L6BA 1TN7A 2WQHA 5FZRA 1OCRE 1JUQA 3NB2A 1WY6A 3L17A 1AP7A 3AS5A 2RD0A 1FCHA 3JQ0A 3FTWA 3SI5A 3RO2A 3AS4A 2F0YA 3R9AB 3EIQC 5G05J 2AXVA 2UY1B 1MJ0A 2XPZA 5JJ7A 4C48B 1Y6IA 3T5XA 5AN8A 2YINA 4FJYA 4G2VA 2XQ0A 2KZTB 3OTNA 4QQIA 2LSVA 3L13A 3MZLB 4L2LA 3SHFA 2OVFA 3HVEA 4YDEA 4DPRA 2R02A 1N0RA 3MKQB 3IKOB 5M72A 4JL0A 2P9UG 3B95A 1HX8A 2NXPA 4MRUA 3D9OA 4PS8A 2R05A 3V2OA 1U3DA 3Q4AB 3IBEA 3PH0C 3E30A 1OCOE 2PQRA 4J8FA 2WVIA 4GCNA 3LY8A 4LNUD 3C5RA 5BW8C 4E85A 3SY2A 3ZYMA 5KJKA 3G2UA 2OV8A 5EILA 3MKQA 2XGSA 4K5AB 1MX6A 1RZ4A 2GRPB 4QFVA 5LCWC 4GTMA 2X38A 4GA2A 3R7RA 3QAQA 3TAXA 1NA0A 3CK8A 1H0AA 5KBAA 1H6PA 5G05C 4HI9A 4X8QA 3TJPA 3LJ3A 5KWDA 2LXMA 4ZFHA 2P9LG 4Q96A 1U2VG 2XGOA 3QK0A 4P29A 3CSTA 4DJAA 4Q69A 4PH4B 2X6KA 3CHSA 3KS2A 3ZW3A 3G2SA 2I1KA 2CHZA 4A55A 2V4LA 3FEXA 5D0OD 5ENPD 3DWLG 3ZHEA 3FUDA 2J9QA 1SA5A 4LG6A 2WQ6A 3ZIMA 3HVEB 2KC7A 3T8MA 3ZYKA 5FIOA 2PM6A 4G23A 3D9NA 2R2LA 5CECB 2VYIA 3MYVA 3T9KA 3UI2A 4TRQA 1S70B 4GYWA 3PNLB 2EIJE 1UG3A 5HQ8A 1HXIA 2R5SA 4M7CA 2XZTG 5G04C 4B89A 1S64A 1OWMA 2XZDG 3SNXA 2LAHA 3RSEG 4CYMD 3CQCB 4JXTA 3D9LA 4RVBA 5AQ9A 1D8EA 4HRMB 4BERA 5LP0A 3J5QB 3UM2A 5B3SE 3QJZA 1HS6A 2PM7A 1WM5A 3BQOA 4EZKA 4D10C 2XS1A 5AJLA 1E8XA 3ASFA 4U0SA 3E37A 2BF0X 3KAEA 3AU4A 3FUMA 3AG2E 4RG9A 3LDZA 4FC8A 2E2EA 4L2YA 4GYOA 3CHQA 3QNKA 3UIOC 3MA5A 4RQIA 2GW1A 3CV0A 4WUYA 3TG4A 3E4BA 2J4BA 1ZB1A 4U8YD 3ULQA 4B0ZA 4DX7D 4EQFA 3RIBA 4KZ0A 1JWFA 3WXXA 3UINC 4DX6D 4BFRA 3SF4A 3SBSA 3FDHA 3CHPA 2C0LA 4J7WA 4KXKB 3DSWA 3QWPA 3U4TA 2WMOA 4U8HA 1FVFA 1JCSA 3ENEA 5AQAA 4J8YA 3Q7FA 4AY6A 2E0IA 3MV2B 1KT0A 4IULA 3RRMB 3B7BA 3RRUA 4XE0A 4LNGA 4PS7A 2WXNA 5FQ4A 4WNFA 3ZGQA 4DX1A 1UN9A 2AW6A 2H6IA 3GZ1A 3CVUA 2ETBA 5ITZF 3CVYA 3CIAA 3I4RB 1OCCE 3ZRHA 4CT0A 3UTMA 5ENRD 3G2VA 2DZOA 4FHKA 5JA4D 2A5EA 2QYUA 3FTUA 3BG0B 3FP3A 3Q73A 4C0EA 4ANUA 2KZTA 5FQ8A 2DIWA 4F1PA 3ZU7B 3RU0A 4G11A 4HB5A 5BV0A 3BU8A 2I6HA 3B13A 1N95A 4I2WA 2EINE 2IEJA 1VDYA 1TEZA 4I43A 3SZ7A 1GW6A 5J08A 2PZIA 3GW4A 1IKND 4DK5A 3HXDA 4OYSA 4F1SA 2HYZA 3ISMC 1SVXA 3LYAA 2IOLA 2MYOA 3HIZA 1OWPA 4BT8A 3CHMA 4JHRA 2R59A 3TWVA 4MKTA 1IQRA 3EHNA 3SD5A 1TR4A 4HRNA 3Q7AA 2DYRE 3FTVA 4N5CA 4HOQA 4WWPA 1XNFA 5KCMA 1QZ2A 4BT9A 4AY5A 4BTAA 4K03A 2XCBA 4GYYA 3ASNE 2P58C 5CRUA 3PE4A 1N54A 4G24A 2BEDA 5AARA 4HOTA 1PAQA 3G2WA 2WXGA 4KMOA 3ASOE 2IF4A 3ABLE 4IRUA 4L23A 3EUVA 1JPLA 4ACLA 2VGEA 4C0MA 5EDSA 3ZXPA 3TXMA 3AG3E 4OAVB 4GA0A 4JA7A 5D0QD 3CVNA 4XZ4A 3IHYA 4O1PA 3B7TA 1LD8A 4RG6A 3FUNA 5KJMA 3S7FA 1MZCA 3R7QA 1S0PA 4N3BA 3EIJA 1HO8A 2RFAA 4U7EB 3Q47B 4GMJA 5CMWA 4BX8A 2CFUA 2AWIA 4CGVA 2NC9A 1G3NB 3C3RA 5DBKA 3OXFA 2DWZA 2L9BA 2CFZA 5LFAA 4ABNA 1V55E 2P9PG 1O1RA 3F6QA 5T8IA 1H2UA 3DBSA 4ILGA 2WXIA 3OAWA 3LKUA 1E8YA 1ZU2A 3D9KA 5AQBA 2IFUA 2J07A 3CVVA 4GZ6A 4UWHA 4GPMA 3SQVA 1QNFA 4IN3B 1IHBA 4HBDA 1WG0A 5ENNA 1Z3XA 3KD7A 4C9BB 3TWQA 4APOA 3CVQA 4ACKA 3ZXSA 5EX3A 3ASGA 4HOSA 3SO8A 4AVXA 3Q49B 3APDA 5ARGA 3CHOA 5EN5D 5JJ6A 1SA4A 4U95D 4FP7A 4UWGA 3AAAC 3LPZA 3Q9UC 3O4ZA 3AG4E 4W9RA 2WXHA 3SFZA 2F37A 5E75A 3C72A 2HR2A 2GRLA 3DSUA 3U66A 1YYHA 3S7BA 4FU3A 4M3OA 2XEHA 4NACA 1KPSB 4BEPA 2NSZA 4JA9A 2R03A 5EIDA 1KZOA 4AIFA 5FWQA 5BPPA 4FULA 1MQSA 4HOUA 2KM4A 4G8KA 3DEPA 2B0OE 2XEVA 1FVHA 2H6GA 1ELKA 1E8WA 1UW4B 4GTVA 4PDXA 3V30A 2X6JA 2VGYA 5B1BE 2CHWA 2X6FA 2EIKE 3ESLA 4V3IA 4I17A 1Z6TA 4N3CA 4DUIA 4CEMA 3UXGA 5A23A 2AJAA 2BKKB 3APCA 1OT8A 1LD7A 2QZAA 2VSOE 2NYJA 4HORA 5CEDB 3PS6A 4NIKA 4GPKA 4XIFA 5BXOA 2PL2A 3Q5MA 2WXRA 1LF8A 2EILE 3CKCA 2XGMA 3HYMB 1TN6A 5LOZA 5ENSD 1IYGA 5ANLA 1IXVA 4GTTA 4O60A 3PUKA 5B1AE 5AQ7A 3AS8A 1O1TA 4DX2A 3SFYA 3UM1A 4JEHA 2VSNA 1SQMA 3CSFA 3K9IA 3IHVA 4DRXE 4UWKA 2B6CA 2I1JA 5G2NA 2IU1A 1OCZE 2Q7FA 3UIPC 4J8EA 1ELWA 5FQ6A 3LY9A 4J0UA 1D9SA 2LO6A 2L0TB 2WPVA 4NRHB 1TNYA 3W9FA 4G25A 4DI3A 5EYPF 4AEZC 2HO1A 3JCKC 2AXUA 4UQXA 3I4GA 3AJIA 1BD8A 1Y8MA 5JHAA 3IEGA 1N4PA 3HXFA 2FBNA 3WG7E 4I6EA 1ELRA 4Z68A 2XENA 3ONLA 1NZNA 4A1GA 4WNDA 3CVLA 3CVWA 1JWGA 1TN8A 2GRNB 3U9WA 4CDRA 3QKYA 4WWNA 3S7DA 4F7AA 4JC8A 3NOGD 1E7VA 4I9EA 3OXLA 3UT8A 4HLLA 3ULYA 2ZU6B 1SW6A 2F8XK 5CCMA 2I2OA 3TWRA 3C3OA 1BPOA 3ZFWA 3ABKE 4N3AA 1E8ZA 5CBNA 2P2CP 3NQPA 5CBOA 2ETCA 3ZYQA 1L5JA 4CZ2D 2QC9A 2LNIA 3N71A 4LRZA 4GTPA 4TXRA 2KCKA 4JEUA 4GZDA 4UQYA 1K8KG 1JCQA 2KBXA 2ZXWE 3IXEA 3RO3A 5A7DB 2DZNA 4HI8A 3EDTB 4HRLA 1PY1A 3FWVA 3VTXA 3O48A 4YNDA 5EKQD 3EHRA 4WWOA 4CT4A 5G55A 5BV1A 4FA6A 5FQ7A 4U63A 4Y6WA 3FHEA 1N11A 3X2QE 3FUEA 2ONDA 2VGXB 1A5EA 3FTZA 4UI9K 3ZKJA 3CVPA 4N2QA 1O1SA 4Y6CA 4YDYA 4G1TA 5FJYA 5DIZA 4MS6A 5T3RA 4AXHA 3APFA 4YVQC 2LAIA 2RG8A 2BUGA 5FTPA 3TWSA 4K5CA 1QYMA 1X81A 2P9SG 3TXNA 3FUJA 3DPDA 2WXQA 4UI9C 4PS3A 5C2YA 3RKVA 1YA0A 1AWCB 1H2TC 3UKRG 1DCQA 3ZNGA 5CCLA 4LCTA 4ILHB 2IO3C 3ONKA 3ZN3A 3RRNB 1UOHA 4J6IA 5AYWD 3EHQA 3DSSA 5BUZA 5ENOD 4H7XA 3TWWA 2OVBA 2ILRA 3QOUA 4U8VD 4KT6B 2MRIA 5ANRA 4JZYA 3L6AA 4L1BA 4AOFA 4L9PA 2QY7A 3B7UX 3V2XA 3DXMG 3FTSA 1HG2A 4GTQA 5LCWJ 3V79K 2WB2A 4GZ3A 2JLBA 1JCRA 4TXPA 2FI7A 5HI7A 5CHEE 3KSLA 1FPPA 4G26A 5BT1A 4EHMA 1E7UA 2WXKA 4N39A 2UY1A 3CKBA 3TL5A 5LX8A 1K1AA 5T4YA 2J4DA 3UM0A 2XPIA 2IOSA 3CK7A 3FU6A 2C0MA 1SZAA 3KEAA 5JHBA 4L7TA 4GU5A 4TUUA 3PRZA 5EX0A 3ASDA 2J49A 1U3CA 5KNHD 2WMNA 3C98A 3U3WA 2KXPC 4ATGA 4B8AA 4NQ0A 4LNBA 4I1MA 1TJCA 1N94A 1Z5SC 3GZSA 2RFMA 2IQCA 4LUNU 5C1DA 3VLEA 2J08A 5AIJA 3UX4A 4DX5D 5KJNA 1FT1A 3JXIA 3ZPJA 3SBTB 3Q15A 2Y0BG 3VLDA 4U07A 5A6CA 4EECA 3HG0D 4GCOA 4BETA 2MHKA 5H7PA 3TG5A 1INZA 3FY4A 1NL4A 4XKCA 2LUHA 2CHXA 2VTBB 3PEUB 1EPUA 4KYOB 1BI7B 3VLFA 2YHCA 2BTDA 4H7YA 4LERA 3NAWA 5BXUA 1OWOA 2EIME 4GTOA 3B7RL 2GROB 4J8DA 1HG5A 3FTXA 3UQ3A 2OOEA 3HXBA 5EIBE 2GRRB 3MX3A 3UT7A 4FLBA 4I6JA 3ABME 3E34A 4A3TA 1HH8A 2X6HA 1NFIE 4N2SA 4OAUC 3NF1A 4JW1A 3MJWA 2Y4UA 4B94A 3VTYA 3CHRA 3RAUA 3PNTB 4IYPA 4ME2A 3Q75A 4ATZD 1EF1C 4JB8P 4TUMA 2WQ7A 5CERB 3MKRA 1N4QA 1BLXB 3BG1B 4LEUA 2XRYA 3V31A 4ZHBA 4YDOA 2L0IA 1B89A 4LSZE 4JD2G 2LSUA 3S7JA 3ML9A 4WNGA 4A3VA 2X3MA 1S63A 4YDWA 1NP7A 4FADA 4U96D 3PREA 3LXUX 5JJTA 2XS8A 4CDNA 2YNQA 3D9IA 3IV0A 3NZSA 1E96B 3CEQA 4JHKA 3I3NA 1D8DA 4GAAA 4FLHA 3PZ3A 3L16A 1TYQG 4E6HA 4O1OA 3PUJA 3L54A 2GRMA 5CMYA 5FZSA 2XHEA 1HFAA 5CEAA 4G8LA 3QB2A 3G2TA 2MOWA 2VGXA 2H6FA 3FU5A 5HS0A 2DBAA 1DCEA 1UN8A 3D9MA 4GA1A 3MGBA 4U04A 1Q2ZA 3LCAA 3DXKG 3JXJA 4F6RD 4KVOA 1HF8A 2V4HC 4WNEA 2A5UA 4JPSA 2XCCA 1DNPA 1W3BA 1DC2A 2WXOA 3BUAA 3EHMA 3TWUA 3FFLA 4EPZA 4U0UA 4ANXA 1K1BA 3QWVA 3P2BA 4EZJA 1TNZA 3DSTA 2FEZA 4KZCA 2FF4A
chains in the Genus database with same CATH topology
1TNYA 4L9PA 3PZ1A 4GTMA 4LNGA 4GTQA 1D8DA 1N4PA 3HXFA 3PZ3A 3E37A 2BEDA 1TN7A 3Q79A 2H6IA 1NL4A 1LD7A 1NI1A 1KZPA 3E33A 1JCRA 4GTRA 1N4RA 3PZ2A 1TN8A 3EUVA 2ZISA 3KSLA 1FPPA 4EHMA 1O1SA 2F0YA 4GTOA 4MBGA 3PZ4A 3KSQA 1N4SA 1TN6A 1TNOA 3DSVA 3SFXA 1SA4A 3HXBA 4GTTA 2H6FA 3Q73A 1LD8A 1DCEA 1TNBA 1MZCA 3E34A 1SA5A 1O1TA 1X81A 3C72A 3DSUA 3SFYA 1N95A 1LTXA 2IEJA 1TNUA 1O5MA 4YDEA 2ZIRA 2R2LA 3DSXA 3Q75A 3HXEA 3HXDA 1KZOA 3EU5A 3DSWA 1N9AA 3E30A 1N4QA 3DRAA 3E32A 1QBQA 4LNBA 4YDOA 1N94A 1JCSA 3Q7FA 3DSSA 4GTSA 2H6GA 3Q78A 1S64A 4GTPA 1S63A 4GTVA 3HXCA 1O1RA 1JCQA 3Q7AA 1D8EA 1TNZA 3DPYA 3DSTA 2H6HA 1FT1A 1FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNY A;  4L9P A;  3PZ1 A;  4GTM A;  4LNG A;  4GTQ A;  1D8D A;  1N4P A;  3HXF A;  3PZ3 A;  3E37 A;  2BED A;  1TN7 A;  3Q79 A;  2H6I A;  1NL4 A;  1LD7 A;  1NI1 A;  1KZP A;  3E33 A;  1JCR A;  4GTR A;  1N4R A;  3PZ2 A;  1TN8 A;  3EUV A;  2ZIS A;  3KSL A;  1FPP A;  4EHM A;  1O1S A;  2F0Y A;  4GTO A;  4MBG A;  3PZ4 A;  3KSQ A;  1N4S A;  1TN6 A;  1TNO A;  3DSV A;  3SFX A;  1SA4 A;  3HXB A;  4GTT A;  2H6F A;  3Q73 A;  1LD8 A;  1DCE A;  1TNB A;  1MZC A;  3E34 A;  1SA5 A;  1O1T A;  1X81 A;  3C72 A;  3DSU A;  3SFY A;  1N95 A;  1LTX A;  2IEJ A;  1TNU A;  1O5M A;  4YDE A;  2ZIR A;  2R2L A;  3DSX A;  3Q75 A;  3HXE A;  3HXD A;  1KZO A;  3EU5 A;  3DSW A;  1N9A A;  3E30 A;  1N4Q A;  3DRA A;  3E32 A;  1QBQ A;  4LNB A;  4YDO A;  1N94 A;  1JCS A;  3Q7F A;  3DSS A;  4GTS A;  2H6G A;  3Q78 A;  1S64 A;  4GTP A;  1S63 A;  4GTV A;  3HXC A;  1O1R A;  1JCQ A;  3Q7A A;  1D8E A;  1TNZ A;  3DPY A;  3DST A;  2H6H A;  1FT1 A;  1FT2 A; 
#chains in the Genus database with same CATH topology
 4I9C A;  2V0P A;  4CRW A;  4XI0 A;  4BY6 A;  1BI8 B;  3FH8 A;  3PE3 A;  4ILI A;  3EJN A;  4HS2 A;  3MCX A;  3Q79 A;  3ZHE B;  4KVM A;  5E76 A;  4HLE A;  4GTR A;  5G04 J;  2CG3 A;  2YHE A;  1KLX A;  2A4Z A;  3FH7 A;  3PDN A;  2VJ8 A;  2P9I G;  1UJK A;  3QWW A;  2CG2 A;  1KT1 A;  5IY5 E;  3HDX A;  2ZGD A;  4EZL A;  1N4S A;  3RK6 A;  1TNO A;  3UM3 A;  4JVS A;  4GML A;  5EYL A;  4BSX A;  3ZUV B;  2EQX A;  1OWN A;  4BTB A;  2XEE A;  1QQE A;  3FEY A;  1LTX A;  4YVO A;  3NOC D;  1A17 A;  2QFC A;  1O5M A;  4GMR A;  5CRV A;  3LS8 A;  3L22 A;  1YCS B;  3DSX A;  5FIN A;  3JQ1 A;  3FUL A;  5KNG A;  3TWT A;  3W9G A;  1XGW A;  4O6F A;  2KAT A;  5D66 A;  1K3Z D;  4AJW A;  5J90 A;  2HE0 A;  2WXF A;  3EU9 A;  4DLQ A;  5HKP A;  2JEK A;  3JUI A;  3ML8 A;  3QDN A;  1H6O A;  3UT4 A;  2J09 A;  4FHJ A;  3ZVV A;  1DVP A;  4GB9 A;  3SGH A;  4Q94 A;  3CLJ A;  2DYS E;  2Y3A A;  2HM8 A;  2OEW A;  4HFG A;  2FUL A;  3T8K A;  3NBN B;  5ENQ D;  3HRA A;  3UPV A;  3FUF A;  3LVQ E;  4ANV A;  4BES A;  1E90 A;  4FJZ A;  2VSX E;  5FZQ A;  2VTB A;  3L9T A;  3B7S A;  1MX2 A;  4TV3 A;  4OVV A;  3E33 A;  4K5B A;  1IQU A;  4XEI G;  3LVR E;  4A1S A;  3QC1 A;  4I1A A;  3FTY A;  3L82 A;  4MBG A;  3PZ4 A;  1ZBP A;  4BX9 A;  2FO7 A;  1Z3Y A;  3DSV A;  4B93 B;  2C2L A;  2IY0 C;  3CR3 A;  4U0Z A;  3NZU A;  1TNB A;  4JHJ A;  4TXQ A;  4NUR A;  4HVB A;  3TGO A;  1IHG A;  1SZ9 A;  1N52 A;  1MYO A;  4R7L A;  4HQD A;  2V5F A;  3E32 A;  1QBQ A;  2IJG X;  3UUX A;  1NA3 A;  1OWL A;  4APF A;  4ANW A;  2KCL A;  2QYJ A;  4GTS A;  2RKK A;  5AJD A;  3LY7 A;  1H2V C;  3DPY A;  4UQZ A;  2P9K G;  2LXL A;  1OXJ A;  3FH5 A;  3JYS A;  2V5Q C;  2J8S D;  4A63 B;  2DCP A;  2R17 C;  2F8Y A;  2ETA A;  1OUV A;  4MLP A;  3GYZ A;  4I2Z A;  2UWJ G;  2GRQ B;  4UI9 J;  4B8C B;  4AV7 A;  1KZP A;  1N4R A;  4RLY A;  3C3Q A;  5JMN D;  3UKU G;  2ZGG A;  1YMP A;  5AAO A;  1N0Q A;  3FUI A;  4OVU A;  4K0R A;  1X5B A;  2VQ2 A;  1EYH A;  3D9P A;  2Y69 E;  3KEZ A;  4UUC A;  3ZYL A;  1BU9 A;  4RSY A;  5FT9 A;  3CQG B;  4CDM A;  3TWX A;  3FUK A;  2AXZ A;  3AU5 A;  2X6I A;  2L6J A;  3URZ A;  1EDU A;  3CGH A;  3AG1 E;  5ENT D;  2ION A;  1TNU A;  2WM9 A;  2AVP A;  2M63 A;  3ESK A;  3UMV A;  3PVL A;  4CCA A;  5KJL A;  3HXE A;  3PEV B;  2PNN A;  4XKB A;  2Y4T A;  1N9A A;  5D2M C;  3T5V A;  2WXP A;  1V54 E;  2P9N G;  3ULE G;  4AP2 A;  4XI9 A;  2WXM A;  3QAR A;  5BNW A;  3Q78 A;  1HZ4 A;  2WXJ A;  3HXC A;  3P1U A;  3FU0 A;  4EBA G;  2IO2 C;  2YQ8 A;  4UWF A;  1WDY A;  3U64 A;  3FUH A;  3ZEF A;  4GZ5 A;  3RJV A;  3PZ1 A;  3D9H A;  4DLO A;  4BSZ B;  3R9M A;  2DVW A;  4F3V A;  4I6G A;  1H6K A;  1NI1 A;  2Y1L E;  1HE8 A;  3PZ2 A;  1MHQ A;  4J8S A;  3LJN A;  3HHM A;  4UWL A;  2I9C A;  2KCV A;  2JAB A;  2ZIS A;  4F53 A;  4PUC A;  1H19 A;  3KSQ A;  4N5Q A;  3MV3 B;  2OCC E;  3SFX A;  2V8S E;  3CVX A;  4AM9 A;  3JUE A;  4HNA D;  3BEE A;  3ASH A;  2XPY A;  4WAF A;  3MEK A;  5AEN A;  1TJF A;  3LEW A;  2ZIR A;  1OY3 D;  1RW2 A;  1UJJ A;  2VSY A;  2BKG A;  3DEO A;  2FO1 E;  3D9J A;  3OXG A;  1MX4 A;  3EU5 A;  4DI4 A;  3FU3 A;  2XRZ A;  4EBA A;  3DRA A;  3S2A A;  4GZC A;  3D3M A;  1HU3 A;  4XX5 A;  3J5P A;  4CGW A;  4BWR A;  5HRY A;  2H6H A;  1FT2 A;  3Q9N C;  3L08 A;  2OEV A;  3PZD A;  4URK A;  5ARF A;  1P5Q A;  4I1O B;  3I5P A;  4KBQ A;  2WXL A;  3GZ2 A;  2PQN A;  1PC2 A;  1WAO 1;  4HXI A;  2GGF A;  3CK9 A;  2L6B A;  1TN7 A;  2WQH A;  5FZR A;  1OCR E;  1JUQ A;  3NB2 A;  1WY6 A;  3L17 A;  1AP7 A;  3AS5 A;  2RD0 A;  1FCH A;  3JQ0 A;  3FTW A;  3SI5 A;  3RO2 A;  3AS4 A;  2F0Y A;  3R9A B;  3EIQ C;  5G05 J;  2AXV A;  2UY1 B;  1MJ0 A;  2XPZ A;  5JJ7 A;  4C48 B;  1Y6I A;  3T5X A;  5AN8 A;  2YIN A;  4FJY A;  4G2V A;  2XQ0 A;  2KZT B;  3OTN A;  4QQI A;  2LSV A;  3L13 A;  3MZL B;  4L2L A;  3SHF A;  2OVF A;  3HVE A;  4YDE A;  4DPR A;  2R02 A;  1N0R A;  3MKQ B;  3IKO B;  5M72 A;  4JL0 A;  2P9U G;  3B95 A;  1HX8 A;  2NXP A;  4MRU A;  3D9O A;  4PS8 A;  2R05 A;  3V2O A;  1U3D A;  3Q4A B;  3IBE A;  3PH0 C;  3E30 A;  1OCO E;  2PQR A;  4J8F A;  2WVI A;  4GCN A;  3LY8 A;  4LNU D;  3C5R A;  5BW8 C;  4E85 A;  3SY2 A;  3ZYM A;  5KJK A;  3G2U A;  2OV8 A;  5EIL A;  3MKQ A;  2XGS A;  4K5A B;  1MX6 A;  1RZ4 A;  2GRP B;  4QFV A;  5LCW C;  4GTM A;  2X38 A;  4GA2 A;  3R7R A;  3QAQ A;  3TAX A;  1NA0 A;  3CK8 A;  1H0A A;  5KBA A;  1H6P A;  5G05 C;  4HI9 A;  4X8Q A;  3TJP A;  3LJ3 A;  5KWD A;  2LXM A;  4ZFH A;  2P9L G;  4Q96 A;  1U2V G;  2XGO A;  3QK0 A;  4P29 A;  3CST A;  4DJA A;  4Q69 A;  4PH4 B;  2X6K A;  3CHS A;  3KS2 A;  3ZW3 A;  3G2S A;  2I1K A;  2CHZ A;  4A55 A;  2V4L A;  3FEX A;  5D0O D;  5ENP D;  3DWL G;  3ZHE A;  3FUD A;  2J9Q A;  1SA5 A;  4LG6 A;  2WQ6 A;  3ZIM A;  3HVE B;  2KC7 A;  3T8M A;  3ZYK A;  5FIO A;  2PM6 A;  4G23 A;  3D9N A;  2R2L A;  5CEC B;  2VYI A;  3MYV A;  3T9K A;  3UI2 A;  4TRQ A;  1S70 B;  4GYW A;  3PNL B;  2EIJ E;  1UG3 A;  5HQ8 A;  1HXI A;  2R5S A;  4M7C A;  2XZT G;  5G04 C;  4B89 A;  1S64 A;  1OWM A;  2XZD G;  3SNX A;  2LAH A;  3RSE G;  4CYM D;  3CQC B;  4JXT A;  3D9L A;  4RVB A;  5AQ9 A;  1D8E A;  4HRM B;  4BER A;  5LP0 A;  3J5Q B;  3UM2 A;  5B3S E;  3QJZ A;  1HS6 A;  2PM7 A;  1WM5 A;  3BQO A;  4EZK A;  4D10 C;  2XS1 A;  5AJL A;  1E8X A;  3ASF A;  4U0S A;  3E37 A;  2BF0 X;  3KAE A;  3AU4 A;  3FUM A;  3AG2 E;  4RG9 A;  3LDZ A;  4FC8 A;  2E2E A;  4L2Y A;  4GYO A;  3CHQ A;  3QNK A;  3UIO C;  3MA5 A;  4RQI A;  2GW1 A;  3CV0 A;  4WUY A;  3TG4 A;  3E4B A;  2J4B A;  1ZB1 A;  4U8Y D;  3ULQ A;  4B0Z A;  4DX7 D;  4EQF A;  3RIB A;  4KZ0 A;  1JWF A;  3WXX A;  3UIN C;  4DX6 D;  4BFR A;  3SF4 A;  3SBS A;  3FDH A;  3CHP A;  2C0L A;  4J7W A;  4KXK B;  3DSW A;  3QWP A;  3U4T A;  2WMO A;  4U8H A;  1FVF A;  1JCS A;  3ENE A;  5AQA A;  4J8Y A;  3Q7F A;  4AY6 A;  2E0I A;  3MV2 B;  1KT0 A;  4IUL A;  3RRM B;  3B7B A;  3RRU A;  4XE0 A;  4LNG A;  4PS7 A;  2WXN A;  5FQ4 A;  4WNF A;  3ZGQ A;  4DX1 A;  1UN9 A;  2AW6 A;  2H6I A;  3GZ1 A;  3CVU A;  2ETB A;  5ITZ F;  3CVY A;  3CIA A;  3I4R B;  1OCC E;  3ZRH A;  4CT0 A;  3UTM A;  5ENR D;  3G2V A;  2DZO A;  4FHK A;  5JA4 D;  2A5E A;  2QYU A;  3FTU A;  3BG0 B;  3FP3 A;  3Q73 A;  4C0E A;  4ANU A;  2KZT A;  5FQ8 A;  2DIW A;  4F1P A;  3ZU7 B;  3RU0 A;  4G11 A;  4HB5 A;  5BV0 A;  3BU8 A;  2I6H A;  3B13 A;  1N95 A;  4I2W A;  2EIN E;  2IEJ A;  1VDY A;  1TEZ A;  4I43 A;  3SZ7 A;  1GW6 A;  5J08 A;  2PZI A;  3GW4 A;  1IKN D;  4DK5 A;  3HXD A;  4OYS A;  4F1S A;  2HYZ A;  3ISM C;  1SVX A;  3LYA A;  2IOL A;  2MYO A;  3HIZ A;  1OWP A;  4BT8 A;  3CHM A;  4JHR A;  2R59 A;  3TWV A;  4MKT A;  1IQR A;  3EHN A;  3SD5 A;  1TR4 A;  4HRN A;  3Q7A A;  2DYR E;  3FTV A;  4N5C A;  4HOQ A;  4WWP A;  1XNF A;  5KCM A;  1QZ2 A;  4BT9 A;  4AY5 A;  4BTA A;  4K03 A;  2XCB A;  4GYY A;  3ASN E;  2P58 C;  5CRU A;  3PE4 A;  1N54 A;  4G24 A;  2BED A;  5AAR A;  4HOT A;  1PAQ A;  3G2W A;  2WXG A;  4KMO A;  3ASO E;  2IF4 A;  3ABL E;  4IRU A;  4L23 A;  3EUV A;  1JPL A;  4ACL A;  2VGE A;  4C0M A;  5EDS A;  3ZXP A;  3TXM A;  3AG3 E;  4OAV B;  4GA0 A;  4JA7 A;  5D0Q D;  3CVN A;  4XZ4 A;  3IHY A;  4O1P A;  3B7T A;  1LD8 A;  4RG6 A;  3FUN A;  5KJM A;  3S7F A;  1MZC A;  3R7Q A;  1S0P A;  4N3B A;  3EIJ A;  1HO8 A;  2RFA A;  4U7E B;  3Q47 B;  4GMJ A;  5CMW A;  4BX8 A;  2CFU A;  2AWI A;  4CGV A;  2NC9 A;  1G3N B;  3C3R A;  5DBK A;  3OXF A;  2DWZ A;  2L9B A;  2CFZ A;  5LFA A;  4ABN A;  1V55 E;  2P9P G;  1O1R A;  3F6Q A;  5T8I A;  1H2U A;  3DBS A;  4ILG A;  2WXI A;  3OAW A;  3LKU A;  1E8Y A;  1ZU2 A;  3D9K A;  5AQB A;  2IFU A;  2J07 A;  3CVV A;  4GZ6 A;  4UWH A;  4GPM A;  3SQV A;  1QNF A;  4IN3 B;  1IHB A;  4HBD A;  1WG0 A;  5ENN A;  1Z3X A;  3KD7 A;  4C9B B;  3TWQ A;  4APO A;  3CVQ A;  4ACK A;  3ZXS A;  5EX3 A;  3ASG A;  4HOS A;  3SO8 A;  4AVX A;  3Q49 B;  3APD A;  5ARG A;  3CHO A;  5EN5 D;  5JJ6 A;  1SA4 A;  4U95 D;  4FP7 A;  4UWG A;  3AAA C;  3LPZ A;  3Q9U C;  3O4Z A;  3AG4 E;  4W9R A;  2WXH A;  3SFZ A;  2F37 A;  5E75 A;  3C72 A;  2HR2 A;  2GRL A;  3DSU A;  3U66 A;  1YYH A;  3S7B A;  4FU3 A;  4M3O A;  2XEH A;  4NAC A;  1KPS B;  4BEP A;  2NSZ A;  4JA9 A;  2R03 A;  5EID A;  1KZO A;  4AIF A;  5FWQ A;  5BPP A;  4FUL A;  1MQS A;  4HOU A;  2KM4 A;  4G8K A;  3DEP A;  2B0O E;  2XEV A;  1FVH A;  2H6G A;  1ELK A;  1E8W A;  1UW4 B;  4GTV A;  4PDX A;  3V30 A;  2X6J A;  2VGY A;  5B1B E;  2CHW A;  2X6F A;  2EIK E;  3ESL A;  4V3I A;  4I17 A;  1Z6T A;  4N3C A;  4DUI A;  4CEM A;  3UXG A;  5A23 A;  2AJA A;  2BKK B;  3APC A;  1OT8 A;  1LD7 A;  2QZA A;  2VSO E;  2NYJ A;  4HOR A;  5CED B;  3PS6 A;  4NIK A;  4GPK A;  4XIF A;  5BXO A;  2PL2 A;  3Q5M A;  2WXR A;  1LF8 A;  2EIL E;  3CKC A;  2XGM A;  3HYM B;  1TN6 A;  5LOZ A;  5ENS D;  1IYG A;  5ANL A;  1IXV A;  4GTT A;  4O60 A;  3PUK A;  5B1A E;  5AQ7 A;  3AS8 A;  1O1T A;  4DX2 A;  3SFY A;  3UM1 A;  4JEH A;  2VSN A;  1SQM A;  3CSF A;  3K9I A;  3IHV A;  4DRX E;  4UWK A;  2B6C A;  2I1J A;  5G2N A;  2IU1 A;  1OCZ E;  2Q7F A;  3UIP C;  4J8E A;  1ELW A;  5FQ6 A;  3LY9 A;  4J0U A;  1D9S A;  2LO6 A;  2L0T B;  2WPV A;  4NRH B;  1TNY A;  3W9F A;  4G25 A;  4DI3 A;  5EYP F;  4AEZ C;  2HO1 A;  3JCK C;  2AXU A;  4UQX A;  3I4G A;  3AJI A;  1BD8 A;  1Y8M A;  5JHA A;  3IEG A;  1N4P A;  3HXF A;  2FBN A;  3WG7 E;  4I6E A;  1ELR A;  4Z68 A;  2XEN A;  3ONL A;  1NZN A;  4A1G A;  4WND A;  3CVL A;  3CVW A;  1JWG A;  1TN8 A;  2GRN B;  3U9W A;  4CDR A;  3QKY A;  4WWN A;  3S7D A;  4F7A A;  4JC8 A;  3NOG D;  1E7V A;  4I9E A;  3OXL A;  3UT8 A;  4HLL A;  3ULY A;  2ZU6 B;  1SW6 A;  2F8X K;  5CCM A;  2I2O A;  3TWR A;  3C3O A;  1BPO A;  3ZFW A;  3ABK E;  4N3A A;  1E8Z A;  5CBN A;  2P2C P;  3NQP A;  5CBO A;  2ETC A;  3ZYQ A;  1L5J A;  4CZ2 D;  2QC9 A;  2LNI A;  3N71 A;  4LRZ A;  4GTP A;  4TXR A;  2KCK A;  4JEU A;  4GZD A;  4UQY A;  1K8K G;  1JCQ A;  2KBX A;  2ZXW E;  3IXE A;  3RO3 A;  5A7D B;  2DZN A;  4HI8 A;  3EDT B;  4HRL A;  1PY1 A;  3FWV A;  3VTX A;  3O48 A;  4YND A;  5EKQ D;  3EHR A;  4WWO A;  4CT4 A;  5G55 A;  5BV1 A;  4FA6 A;  5FQ7 A;  4U63 A;  4Y6W A;  3FHE A;  1N11 A;  3X2Q E;  3FUE A;  2OND A;  2VGX B;  1A5E A;  3FTZ A;  4UI9 K;  3ZKJ A;  3CVP A;  4N2Q A;  1O1S A;  4Y6C A;  4YDY A;  4G1T A;  5FJY A;  5DIZ A;  4MS6 A;  5T3R A;  4AXH A;  3APF A;  4YVQ C;  2LAI A;  2RG8 A;  2BUG A;  5FTP A;  3TWS A;  4K5C A;  1QYM A;  1X81 A;  2P9S G;  3TXN A;  3FUJ A;  3DPD A;  2WXQ A;  4UI9 C;  4PS3 A;  5C2Y A;  3RKV A;  1YA0 A;  1AWC B;  1H2T C;  3UKR G;  1DCQ A;  3ZNG A;  5CCL A;  4LCT A;  4ILH B;  2IO3 C;  3ONK A;  3ZN3 A;  3RRN B;  1UOH A;  4J6I A;  5AYW D;  3EHQ A;  3DSS A;  5BUZ A;  5ENO D;  4H7X A;  3TWW A;  2OVB A;  2ILR A;  3QOU A;  4U8V D;  4KT6 B;  2MRI A;  5ANR A;  4JZY A;  3L6A A;  4L1B A;  4AOF A;  4L9P A;  2QY7 A;  3B7U X;  3V2X A;  3DXM G;  3FTS A;  1HG2 A;  4GTQ A;  5LCW J;  3V79 K;  2WB2 A;  4GZ3 A;  2JLB A;  1JCR A;  4TXP A;  2FI7 A;  5HI7 A;  5CHE E;  3KSL A;  1FPP A;  4G26 A;  5BT1 A;  4EHM A;  1E7U A;  2WXK A;  4N39 A;  2UY1 A;  3CKB A;  3TL5 A;  5LX8 A;  1K1A A;  5T4Y A;  2J4D A;  3UM0 A;  2XPI A;  2IOS A;  3CK7 A;  3FU6 A;  2C0M A;  1SZA A;  3KEA A;  5JHB A;  4L7T A;  4GU5 A;  4TUU A;  3PRZ A;  5EX0 A;  3ASD A;  2J49 A;  1U3C A;  5KNH D;  2WMN A;  3C98 A;  3U3W A;  2KXP C;  4ATG A;  4B8A A;  4NQ0 A;  4LNB A;  4I1M A;  1TJC A;  1N94 A;  1Z5S C;  3GZS A;  2RFM A;  2IQC A;  4LUN U;  5C1D A;  3VLE A;  2J08 A;  5AIJ A;  3UX4 A;  4DX5 D;  5KJN A;  1FT1 A;  3JXI A;  3ZPJ A;  3SBT B;  3Q15 A;  2Y0B G;  3VLD A;  4U07 A;  5A6C A;  4EEC A;  3HG0 D;  4GCO A;  4BET A;  2MHK A;  5H7P A;  3TG5 A;  1INZ A;  3FY4 A;  1NL4 A;  4XKC A;  2LUH A;  2CHX A;  2VTB B;  3PEU B;  1EPU A;  4KYO B;  1BI7 B;  3VLF A;  2YHC A;  2BTD A;  4H7Y A;  4LER A;  3NAW A;  5BXU A;  1OWO A;  2EIM E;  4GTO A;  3B7R L;  2GRO B;  4J8D A;  1HG5 A;  3FTX A;  3UQ3 A;  2OOE A;  3HXB A;  5EIB E;  2GRR B;  3MX3 A;  3UT7 A;  4FLB A;  4I6J A;  3ABM E;  3E34 A;  4A3T A;  1HH8 A;  2X6H A;  1NFI E;  4N2S A;  4OAU C;  3NF1 A;  4JW1 A;  3MJW A;  2Y4U A;  4B94 A;  3VTY A;  3CHR A;  3RAU A;  3PNT B;  4IYP A;  4ME2 A;  3Q75 A;  4ATZ D;  1EF1 C;  4JB8 P;  4TUM A;  2WQ7 A;  5CER B;  3MKR A;  1N4Q A;  1BLX B;  3BG1 B;  4LEU A;  2XRY A;  3V31 A;  4ZHB A;  4YDO A;  2L0I A;  1B89 A;  4LSZ E;  4JD2 G;  2LSU A;  3S7J A;  3ML9 A;  4WNG A;  4A3V A;  2X3M A;  1S63 A;  4YDW A;  1NP7 A;  4FAD A;  4U96 D;  3PRE A;  3LXU X;  5JJT A;  2XS8 A;  4CDN A;  2YNQ A;  3D9I A;  3IV0 A;  3NZS A;  1E96 B;  3CEQ A;  4JHK A;  3I3N A;  1D8D A;  4GAA A;  4FLH A;  3PZ3 A;  3L16 A;  1TYQ G;  4E6H A;  4O1O A;  3PUJ A;  3L54 A;  2GRM A;  5CMY A;  5FZS A;  2XHE A;  1HFA A;  5CEA A;  4G8L A;  3QB2 A;  3G2T A;  2MOW A;  2VGX A;  2H6F A;  3FU5 A;  5HS0 A;  2DBA A;  1DCE A;  1UN8 A;  3D9M A;  4GA1 A;  3MGB A;  4U04 A;  1Q2Z A;  3LCA A;  3DXK G;  3JXJ A;  4F6R D;  4KVO A;  1HF8 A;  2V4H C;  4WNE A;  2A5U A;  4JPS A;  2XCC A;  1DNP A;  1W3B A;  1DC2 A;  2WXO A;  3BUA A;  3EHM A;  3TWU A;  3FFL A;  4EPZ A;  4U0U A;  4ANX A;  1K1B A;  3QWV A;  3P2B A;  4EZJ A;  1TNZ A;  3DST A;  2FEZ A;  4KZC A;  2FF4 A; 
#chains in the Genus database with same CATH homology
 1TNY A;  4L9P A;  3PZ1 A;  4GTM A;  4LNG A;  4GTQ A;  1D8D A;  1N4P A;  3HXF A;  3PZ3 A;  3E37 A;  2BED A;  1TN7 A;  3Q79 A;  2H6I A;  1NL4 A;  1LD7 A;  1NI1 A;  1KZP A;  3E33 A;  1JCR A;  4GTR A;  1N4R A;  3PZ2 A;  1TN8 A;  3EUV A;  2ZIS A;  3KSL A;  1FPP A;  4EHM A;  1O1S A;  2F0Y A;  4GTO A;  4MBG A;  3PZ4 A;  3KSQ A;  1N4S A;  1TN6 A;  1TNO A;  3DSV A;  3SFX A;  1SA4 A;  3HXB A;  4GTT A;  2H6F A;  3Q73 A;  1LD8 A;  1DCE A;  1TNB A;  1MZC A;  3E34 A;  1SA5 A;  1O1T A;  1X81 A;  3C72 A;  3DSU A;  3SFY A;  1N95 A;  1LTX A;  2IEJ A;  1TNU A;  1O5M A;  4YDE A;  2ZIR A;  2R2L A;  3DSX A;  3Q75 A;  3HXE A;  3HXD A;  1KZO A;  3EU5 A;  3DSW A;  1N9A A;  3E30 A;  1N4Q A;  3DRA A;  3E32 A;  1QBQ A;  4LNB A;  4YDO A;  1N94 A;  1JCS A;  3Q7F A;  3DSS A;  4GTS A;  2H6G A;  3Q78 A;  1S64 A;  4GTP A;  1S63 A;  4GTV A;  3HXC A;  1O1R A;  1JCQ A;  3Q7A A;  1D8E A;  1TNZ A;  3DPY A;  3DST A;  2H6H A;  1FT1 A;  1FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...