2IEJA

Human protein farnesyltransferase complexed with inhibitor compound stn-48 and fpp analog at 1.8a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
315
structure length
315
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Resistance mutations at the lipid substrate binding site of Plasmodium falciparum protein farnesyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 127
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2iejA00
1TN6A 4MBGA 3E32A 4EHMA 1TNYA 1N95A 1S63A 3E37A 3PZ3A 2F0YA 1NL4A 3HXEA 4LNGA 2H6FA 3DSWA 1N4PA 1KZPA 3HXCA 2IEJA 2ZISA 1D8EA 1D8DA 1LD8A 1N4SA 1JCRA 3PZ2A 3Q79A 1O1RA 3EU5A 3DSTA 1MZCA 3Q78A 1N4RA 3KSQA 3Q75A 1TN8A 4GTTA 2ZIRA 3C72A 1NI1A 3PZ4A 3DSSA 1N94A 3SFYA 2BEDA 1LD7A 2H6GA 3HXDA 1X81A 1TNOA 4YDOA 1JCQA 1DCEA 1FT2A 4L9PA 4GTSA 4GTPA 3HXFA 1SA5A 1O1SA 1TNUA 3Q73A 3HXBA 1TNZA 1TN7A 3DPYA 1S64A 3DSUA 1KZOA 1O1TA 1O5MA 1QBQA 4YDEA 3KSLA 4LNBA 3E33A 4GTRA 3DSVA 3DRAA 1FT1A 3SFXA 1SA4A 1N9AA 4GTVA 1LTXA 1TNBA 3PZ1A 4GTOA 4GTQA 2H6HA 2H6IA 4GTMA 3E30A 1N4QA 3Q7FA 2R2LA 1JCSA 3DSXA 3E34A 3Q7AA 3EUVA 1FPPA
chains in the Genus database with same CATH superfamily
5FJYA 3T9KA 3C5RA 2ZU6B 5CECB 1BPOA 5A6CA 1S63A 2LUHA 1Z5SC 3PS6A 3U66A 4ANUA 3G2UA 2JLBA 4UWHA 3C3RA 1RZ4A 2VGEA 3NZSA 4J0UA 2EIJE 3S7FA 3KSQA 1N0QA 4U8VD 2XEVA 2KCLA 1N94A 4DLOA 5AENA 4BFRA 4W9RA 2Y69E 3Q49B 5JJ6A 5C1DA 2A5UA 4UI9J 4DX7D 2EILE 4RSYA 3DSUA 4ANXA 4GPKA 2HM8A 4C0EA 4DRXE 2Y3AA 4MLPA 4HXIA 3G2SA 4JA9A 3TWSA 4U95D 3EDTB 3PUJA 3GZ1A 4MS6A 4GZ5A 4A63B 4A1GA 5J90A 3TG5A 1Y6IA 4CCAA 2GRQB 3VLDA 4DJAA 2OV8A 1ELRA 3G2TA 3DSXA 2I1KA 3ASFA 1YCSB 3E4BA 3U64A 5BV1A 3ZYLA 3HG0D 3E32A 3ZYKA 1UW4B 3L9TA 3IHVA 2NXPA 3ISMC 1DCQA 3ONLA 2DYRE 3D9OA 3CSTA 5T3RA 3SBSA 5CERB 2L0IA 4OVUA 4V3IA 1SZAA 2V4LA 3T8MA 2PZIA 4A3TA 1E7VA 4TUMA 2PL2A 3ONKA 2FBNA 4UQYA 3P1UA 3JXIA 2YQ8A 3UQ3A 1TNOA 4JVSA 5JJ7A 2EIME 4F3VA 3UPVA 3NBNB 3LY7A 4BEPA 5AJLA 4O60A 2OEWA 1HFAA 4U96D 3UKUG 2EINE 2ILRA 1ZBPA 3PH0C 4X8QA 3JYSA 1HG2A 3AJIA 4RG6A 4KZCA 3GZ2A 1PC2A 2GRNB 2WXMA 3UIPC 3E33A 3P2BA 5G04C 3O48A 4QFVA 3AS8A 4GMLA 4BERA 3LDZA 5FZRA 3CHQA 3L82A 3PZ1A 3JXJA 2R02A 2X6JA 2WXKA 4PS3A 2GRMA 1W3BA 5FQ6A 4CDMA 3E34A 5JHAA 3EUVA 3R9MA 4YVQC 4TV3A 3SF4A 3ZNGA 4LEUA 3SHFA 4FA6A 3UXGA 4I1AA 4Y6WA 4BX8A 5HQ8A 1MX2A 4GYYA 4BESA 2HO1A 4OAUC 3I5PA 2ZISA 3V2XA 4UI9C 5D0OD 5D0QD 4YVOA 1FCHA 4CDRA 2R5SA 3F6QA 5FWQA 2DZNA 3MJWA 3ZHEA 2VTBB 4CEMA 2BEDA 5CEAA 1S0PA 4PS8A 4R7LA 3CHRA 2XGMA 2R17C 3PUKA 4PDXA 2P9PG 3KAEA 4HVBA 1MX4A 2XEEA 4C0MA 3BQOA 3D9IA 4IYPA 2RG8A 3FDHA 4J8SA 2WQHA 1INZA 2XZDG 1OT8A 3U4TA 4N5QA 1IQUA 3UUXA 5CCMA 2E2EA 3LJ3A 2UY1A 3CVQA 3CVWA 2X6FA 3PE4A 4WNEA 3NZUA 4I6GA 4AV7A 3QC1A 2MRIA 4ILGA 3SFXA 1NFIE 4UWGA 3CK8A 4YDYA 3UINC 2KZTB 4NURA 4FP7A 2H6HA 5HS0A 1DVPA 2DCPA 3L08A 5ITZF 3RAUA 2WXIA 3QWVA 1KT1A 3RK6A 3AU5A 3TG4A 2IY0C 3FU0A 3FP3A 3D9HA 2OOEA 2L6JA 3AG2E 2PM6A 5HI7A 2CG2A 2WXQA 3VTXA 2VSNA 5EYPF 3Q78A 1H2VC 3ULYA 4Z68A 2ZIRA 3T5XA 4GAAA 2J9QA 5CRVA 3L6AA 2KBXA 2XHEA 3AU4A 1OWLA 4KYOB 4L7TA 2XS8A 2P58C 1JCQA 4B8AA 4GZ3A 2EQXA 2I6HA 4DLQA 2P9SG 4J8DA 1PAQA 1HF8A 3HIZA 3JQ0A 2AJAA 4F7AA 3WXXA 3PREA 1O5MA 3B7BA 1LF8A 3ASDA 3KS2A 4F1PA 3SGHA 4ACKA 3HRAA 1N9AA 4FLHA 4O1PA 4AJWA 4NRHB 1UJJA 4XE0A 4JEUA 1JCSA 2I2OA 4N3CA 3LJNA 4AP2A 3CKBA 4ME2A 3BG0B 1UJKA 3LKUA 3PVLA 3CSFA 4ATGA 1H6PA 3IXEA 2J4BA 3S7JA 1OUVA 2LXLA 3TL5A 3HXCA 1G3NB 2ETBA 5EKQD 4GTTA 1WM5A 4I9EA 1E8WA 2WXJA 5JMND 3RRMB 3HXDA 5BT1A 1U3CA 2VSYA 4UWKA 2QFCA 3C3OA 2ETAA 4HI8A 3FEXA 4IULA 2X38A 2CFZA 1OWMA 1AWCB 5BXOA 3CHSA 3FEYA 3DPYA 1QNFA 4WNDA 2CFUA 4JZYA 3SFZA 3DWLG 1MX6A 3LS8A 3C98A 3EIQC 2RD0A 1SVXA 4AXHA 4ACLA 5ENQD 4I1MA 3PRZA 5KNHD 4GTVA 4GTOA 3FHEA 4UUCA 1QQEA 2IONA 3Q5MA 4HB5A 5FIOA 4B89A 4DI3A 4CYMD 3EHMA 3UKRG 2J08A 1N95A 3Q15A 4GA0A 4UQZA 1OCCE 2AXVA 3B7SA 4BX9A 2R03A 5AAOA 1NA3A 1N4SA 1EDUA 4WUYA 4B93B 2KM4A 5ENRD 4HRNA 2IOLA 2J09A 4BSXA 3HVEB 2GRRB 2VTBA 2CG3A 2PQNA 1L5JA 1BD8A 1MQSA 4U8HA 3S7DA 2F8XK 5AQ7A 5EN5D 4GTPA 3HHMA 1EPUA 3FUFA 2P9IG 3ESLA 4AM9A 1HZ4A 4MKTA 3D9KA 3ULQA 3ML8A 3GW4A 1EF1C 4Q94A 5C2YA 2XPYA 2YINA 3URZA 3KSLA 3QARA 1HXIA 2FF4A 3DEOA 2UWJG 3FTUA 1HH8A 2IQCA 1BU9A 3FUNA 3FU5A 1DC2A 2Q7FA 4HOUA 1LTXA 5BPPA 3CVXA 2KZTA 2RFAA 2WM9A 3FU6A 5KJLA 4QQIA 2FULA 3AAAC 4BT8A 3B7UX 2L6BA 5KCMA 3FUJA 1Z3XA 1NP7A 5J08A 4HI9A 2IU1A 1K1AA 2ZGGA 5LP0A 4EHMA 4YDWA 4LNUD 2H6FA 3ZW3A 3D9PA 4C9BB 1WDYA 5LCWJ 3CHOA 3Q4AB 3EJNA 3EU5A 4GYWA 1MZCA 5G05J 3D3MA 3TXNA 2GW1A 5DBKA 2B6CA 4HS2A 3ZIMA 3ZXSA 2J4DA 3CK9A 1X81A 2XRZA 3FUMA 2XPZA 3TXMA 4I43A 4RLYA 3HXFA 4DPRA 3APDA 2VGXB 3L17A 1TNUA 3APCA 4U07A 1UN9A 1ZB1A 1GW6A 1YMPA 2X6IA 3QAQA 3ZU7B 2F37A 4JPSA 1H19A 2C0LA 4XI9A 4LERA 3FUKA 4J8EA 3JUIA 5KNGA 1KLXA 2WMOA 1IXVA 2AVPA 1TNBA 2MYOA 1Z6TA 5BUZA 1QYMA 2XGSA 2P9NG 3NOCD 2VSOE 4KBQA 1B89A 1N0RA 1HX8A 3ESKA 1TN6A 3UT7A 2PNNA 3UM0A 3JCKC 3SD5A 2XS1A 3ZGQA 3HYMB 4WWOA 3HXEA 4PUCA 4A1SA 3ASNE 4CRWA 2LSVA 3CVYA 1H2UA 3BG1B 4GPMA 3OTNA 4ABNA 5ENNA 3PZ2A 5ANLA 2PQRA 3DBSA 3NF1A 3EHRA 3FUIA 4G25A 1Q2ZA 1TN8A 5ARFA 3C72A 5EX3A 1JWGA 4XZ4A 1JUQA 2AXUA 2GROB 5CMWA 3OXFA 4L9PA 1OWOA 1OWNA 1MYOA 4L23A 3D9JA 3CVLA 1HO8A 2WB2A 4NQ0A 2DYSE 4XKBA 3TWTA 3MGBA 2OVFA 3FUEA 3ULEG 3SBTB 2E0IA 4JA7A 4IRUA 4RQIA 2RKKA 4TXPA 2LNIA 4FC8A 1K3ZD 1P5QA 3S7BA 1AP7A 1FT1A 3SNXA 4WWNA 5AJDA 4XIFA 3SI5A 2VQ2A 2YHEA 1VDYA 1NA0A 2QYUA 1HU3A 2OVBA 2XCCA 4K5BA 4BWRA 4U0ZA 1KPSB 4N5CA 2JABA 2QC9A 4HORA 4LRZA 1K1BA 2BF0X 4O1OA 3QWWA 4LNGA 3JQ1A 4CGVA 1IHGA 1N4PA 3TWXA 4GCOA 4XKCA 3QNKA 3ZYQA 1N4RA 2X6HA 1N54A 3PNLB 3X2QE 1UN8A 3HVEA 3SZ7A 1NI1A 4Q69A 3FULA 3RO3A 1XGWA 2YNQA 4JXTA 5B3SE 4GMJA 4YDOA 2DZOA 4I6JA 4G8KA 5AIJA 4M7CA 3K9IA 4J6IA 3LVRE 3FH5A 2XRYA 2Y0BG 1S64A 3PDNA 2XCBA 4F6RD 2DVWA 2KC7A 5FZSA 4BSZB 2C0MA 1DNPA 3RRUA 2QZAA 1TJFA 4LG6A 3MV3B 3NOGD 4J8FA 3KD7A 3RRNB 4BTAA 4U8YD 3TWRA 3CGHA 3FTYA 5HKPA 3CVNA 3UM1A 4BY6A 4GTQA 2WMNA 2H6IA 4ZHBA 2CHWA 3PNTB 1TR4A 2L9BA 1IKND 3ZUVB 2OEVA 3AS5A 3ASOE 2B0OE 2KCVA 2IEJA 2FO7A 1O1RA 3D9MA 5EX0A 3CHPA 4KT6B 3LYAA 3EHNA 4EZJA 1S70B 4A3VA 3B13A 4IN3B 4HOSA 4I17A 3L22A 3TWVA 4DI4A 1OXJA 5CHEE 4N39A 4APFA 5EYLA 1TEZA 2HR2A 5T8IA 4G2VA 2VGXA 4GZCA 3V31A 4G23A 2HYZA 1O1SA 2OCCE 2V4HC 4KVMA 1FVHA 4UQXA 4M3OA 3MEKA 3EHQA 4AOFA 3BU8A 3QB2A 3CVUA 3UTMA 3LY9A 3CVPA 1BI8B 1MJ0A 4KMOA 4UWLA 3FH7A 2EIKE 3FTZA 3GYZA 3KEAA 4DK5A 3V30A 5FTPA 2WXOA 5LOZA 4HRLA 3L54A 4AEZC 3B7RL 3QOUA 5H7PA 3V2OA 5FT9A 4N3BA 4WWPA 3Q7FA 1MHQA 1FPPA 2ZGDA 3MA5A 1SZ9A 2BTDA 3I4GA 3IV0A 3BEEA 2WPVA 5ANRA 4AIFA 1KZPA 4FLBA 5CCLA 4D10C 2J49A 4EBAG 3J5QB 3ZPJA 1YYHA 3Q9NC 3Q75A 1OCZE 3EU9A 3UIOC 5JHBA 2XGOA 3QK0A 4U04A 3PZ4A 3PEUB 3CV0A 5EIDA 3D9NA 2QY7A 5CMYA 1E8YA 1LD7A 3C3QA 2FEZA 4J7WA 4GCNA 3UM2A 4E85A 3L16A 5B1BE 2PM7A 5D2MC 2A5EA 1WY6A 1NZNA 4I9CA 3MV2B 1D9SA 1EYHA 5CRUA 2AW6A 4ANVA 3PZDA 1N52A 1Y8MA 1UG3A 5LX8A 4G1TA 1QBQA 3ML9A 2V8SE 4EZKA 4FJYA 2DIWA 1QZ2A 3D9LA 2BUGA 4JC8A 1E8ZA 5G04J 3TGOA 5E76A 3DEPA 1X5BA 2ETCA 2RFMA 3MX3A 3TWUA 5CBNA 3GZSA 3MZLB 3AS4A 5D66A 2R2LA 2I1JA 3AG4E 4O6FA 5KBAA 3RKVA 1IYGA 4MBGA 3RJVA 4I2ZA 2IF4A 2DWZA 4WNGA 2WXNA 1E90A 4FJZA 3MKQB 4BETA 1SQMA 3O4ZA 2VSXE 4ZFHA 4FADA 4B94A 4GZDA 3TWWA 2DBAA 3PE3A 1U2VG 5M72A 4DUIA 3AG1E 2YHCA 1JWFA 4Y6CA 3LPZA 4BT9A 2FO1E 1H2TC 3R7RA 3I3NA 1V55E 3MKRA 3CIAA 3SQVA 4ILIA 2VYIA 3CQGB 4C48B 4GMRA 4F1SA 1FVFA 2JEKA 1KZOA 2XQ0A 2LAHA 4GZ6A 4APOA 3APFA 1XNFA 2IOSA 4BTBA 4TXQA 3TJPA 2F8YA 3RO2A 5ENTD 1OWPA 4F53A 3UMVA 5FZQA 4WNFA 3CQCB 4P29A 1V54E 2C2LA 2LO6A 4NIKA 4GTMA 4G8LA 1N4QA 4U7EB 4LUNU 4G26A 4B8CB 3QKYA 2WXHA 2IO2C 2XEHA 5CBOA 3T5VA 5ENSD 3SY2A 3FUHA 4I1OB 4CGWA 3IHYA 3VLEA 2NC9A 1NL4A 3V79K 3FTXA 2GRPB 4CT0A 1D8DA 2VGYA 1H6KA 4HLEA 3ZN3A 3CKCA 5ENPD 4HBDA 3G2WA 5EIBE 4EQFA 2BKGA 4JHRA 4Q96A 3SO8A 1KT0A 4U0UA 3L13A 4OYSA 4K03A 3DSSA 3DXMG 3RSEG 1H0AA 4FHKA 4JHJA 5EDSA 3PEVB 4CDNA 4DX1A 3IEGA 4EECA 3NAWA 5BXUA 2GGFA 1HE8A 2QYJA 4HNAD 3EIJA 3ZYMA 4U0SA 2WXGA 4YNDA 3RIBA 4GB9A 1OCRE 4JL0A 4K5AB 2AXZA 2KCKA 3ZFWA 3QDNA 2MOWA 3QJZA 4N2SA 3UM3A 4GYOA 3B7TA 1OY3D 3ABKE 4AVXA 1E8XA 4URKA 2XPIA 5JA4D 4DX6D 4RVBA 3G2VA 4HLLA 5AARA 4JB8P 4KXKB 3B95A 3Q7AA 4NACA 3DXKG 4G24A 5KJKA 4EBAA 4HQDA 3HDXA 2M63A 5AQBA 4N2QA 3MYVA 3TWQA 2ZXWE 4RG9A 3E37A 5LCWC 3W9GA 3FH8A 4I2WA 1IHBA 2P9LG 3ZVVA 3CLJA 4TUUA 5G05C 4LCTA 4HRMB 1ELKA 3Q79A 2Y1LE 3FTSA 5FQ4A 4GA2A 5ARGA 4HOQA 3KEZA 5B1AE 3SFYA 4OVVA 2XZTG 3U9WA 2NYJA 2VJ8A 1ZU2A 4UI9K 4CT4A 3FFLA 4DX2A 1FT2A 1H6OA 3J5PA 2J8SD 3AG3E 4TXRA 5EILA 4ANWA 2P9UG 4HFGA 2IO3C 4H7YA 1SA5A 4H7XA 3Q73A 2X6KA 3I4RB 3HXBA 5A23A 2FI7A 1HS6A 1TN7A 4G11A 4AY6A 5FQ8A 1O1TA 3CEQA 2KXPC 2IFUA 3UT4A 2CHZA 3ZRHA 4YDEA 4AY5A 4LNBA 3TAXA 4GTRA 2A4ZA 3DSVA 3ASGA 4ATZD 4EZLA 2WQ6A 2WXRA 2LSUA 3FU3A 3DRAA 1UOHA 1SW6A 4XX5A 4TRQA 4PS7A 2CHXA 4FU3A 2LXMA 5FQ7A 1WAO1 3ABME 5AQAA 3NB2A 3N71A 4JD2G 3LEWA 3MKQA 1TNYA 4FULA 2HE0A 3PZ3A 3UX4A 1BI7B 3JUEA 5LFAA 4E6HA 4UWFA 3U3WA 4MRUA 5DIZA 5ENOD 2MHKA 4HOTA 2V0PA 5BW8C 4N3AA 2P9KG 3LVQE 3IBEA 4JW1A 4KVOA 2WXLA 2P2CP 2V5QC 3IKOB 2KATA 2H6GA 2ONDA 1DCEA 1RW2A 4A55A 5KWDA 1U3DA 5BV0A 1BLXB 3Q47B 4GTSA 2NSZA 1TJCA 3ASHA 5IY5E 4L2YA 3LY8A 1TNZA 3FTWA 3LXUX 3FTVA 4EPZA 1PY1A 4XI0A 2IJGX 1JPLA 5HRYA 3UT8A 2R59A 2LAIA 2X3MA 1HG5A 3R9AB 3ZEFA 4B0ZA 4J8YA 4L2LA 1N11A 2XENA 1Z3YA 1K8KG 3E30A 1YA0A 5AQ9A 1ELWA 1A17A 3ZXPA 3UI2A 5KJNA 2V5FA 3FUDA 3WG7E 4XEIG 3RU0A 1IQRA 4OAVB 2F0YA 4LSZE 3CHMA 3DSWA 1TYQG 4GA1A 5AN8A 2WXFA 4DX5D 3OAWA 1D8EA 1A5EA 1LD8A 4ILHB 4FHJA 1JCRA 5CEDB 2Y4UA 4JHKA 2R05A 3DSTA 5FINA 3VTYA 2WVIA 5G55A 3Q9UC 2J07A 5G2NA 3R7QA 3BUAA 2WXPA 3ZHEB 2AWIA 2BKKB 2WQ7A 3FY4A 2L0TB 4PH4B 5AYWD 2I9CA 5A7DB 3ENEA 3OXLA 4L1BA 3CR3A 3W9FA 5BNWA 5E75A 1OCOE 3ABLE 4WAFA 5T4YA 3LCAA 1E7UA 4K0RA 3S2AA 4K5CA 3CVVA 3DPDA 3FWVA 5JJTA 1E96B 1WG0A 3VLFA 3NQPA 2GRLA 2Y4TA 2UY1B 3MCXA 4I6EA 3ZKJA 1SA4A 3OXGA 4CZ2D 4JEHA 3QWPA 3T8KA 5KJMA 3CK7A 4U63A 4KZ0A 4GU5A
chains in the Genus database with same CATH topology
1TN6A 4MBGA 3E32A 4EHMA 1TNYA 1N95A 1S63A 3E37A 3PZ3A 2F0YA 1NL4A 3HXEA 4LNGA 2H6FA 3DSWA 1N4PA 1KZPA 3HXCA 2IEJA 2ZISA 1D8EA 1D8DA 1LD8A 1N4SA 1JCRA 3PZ2A 3Q79A 1O1RA 3EU5A 3DSTA 1MZCA 3Q78A 1N4RA 3KSQA 3Q75A 1TN8A 4GTTA 2ZIRA 3C72A 1NI1A 3PZ4A 3DSSA 1N94A 3SFYA 2BEDA 1LD7A 2H6GA 3HXDA 1X81A 1TNOA 4YDOA 1JCQA 1DCEA 1FT2A 4L9PA 4GTSA 4GTPA 3HXFA 1SA5A 1O1SA 1TNUA 3Q73A 3HXBA 1TNZA 1TN7A 3DPYA 1S64A 3DSUA 1KZOA 1O1TA 1O5MA 1QBQA 4YDEA 3KSLA 4LNBA 3E33A 4GTRA 3DSVA 3DRAA 1FT1A 3SFXA 1SA4A 1N9AA 4GTVA 1LTXA 1TNBA 3PZ1A 4GTOA 4GTQA 2H6HA 2H6IA 4GTMA 3E30A 1N4QA 3Q7FA 2R2LA 1JCSA 3DSXA 3E34A 3Q7AA 3EUVA 1FPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN6 A;  4MBG A;  3E32 A;  4EHM A;  1TNY A;  1N95 A;  1S63 A;  3E37 A;  3PZ3 A;  2F0Y A;  1NL4 A;  3HXE A;  4LNG A;  2H6F A;  3DSW A;  1N4P A;  1KZP A;  3HXC A;  2IEJ A;  2ZIS A;  1D8E A;  1D8D A;  1LD8 A;  1N4S A;  1JCR A;  3PZ2 A;  3Q79 A;  1O1R A;  3EU5 A;  3DST A;  1MZC A;  3Q78 A;  1N4R A;  3KSQ A;  3Q75 A;  1TN8 A;  4GTT A;  2ZIR A;  3C72 A;  1NI1 A;  3PZ4 A;  3DSS A;  1N94 A;  3SFY A;  2BED A;  1LD7 A;  2H6G A;  3HXD A;  1X81 A;  1TNO A;  4YDO A;  1JCQ A;  1DCE A;  1FT2 A;  4L9P A;  4GTS A;  4GTP A;  3HXF A;  1SA5 A;  1O1S A;  1TNU A;  3Q73 A;  3HXB A;  1TNZ A;  1TN7 A;  3DPY A;  1S64 A;  3DSU A;  1KZO A;  1O1T A;  1O5M A;  1QBQ A;  4YDE A;  3KSL A;  4LNB A;  3E33 A;  4GTR A;  3DSV A;  3DRA A;  1FT1 A;  3SFX A;  1SA4 A;  1N9A A;  4GTV A;  1LTX A;  1TNB A;  3PZ1 A;  4GTO A;  4GTQ A;  2H6H A;  2H6I A;  4GTM A;  3E30 A;  1N4Q A;  3Q7F A;  2R2L A;  1JCS A;  3DSX A;  3E34 A;  3Q7A A;  3EUV A;  1FPP A; 
#chains in the Genus database with same CATH topology
 5FJY A;  3T9K A;  3C5R A;  2ZU6 B;  5CEC B;  1BPO A;  5A6C A;  1S63 A;  2LUH A;  1Z5S C;  3PS6 A;  3U66 A;  4ANU A;  3G2U A;  2JLB A;  4UWH A;  3C3R A;  1RZ4 A;  2VGE A;  3NZS A;  4J0U A;  2EIJ E;  3S7F A;  3KSQ A;  1N0Q A;  4U8V D;  2XEV A;  2KCL A;  1N94 A;  4DLO A;  5AEN A;  4BFR A;  4W9R A;  2Y69 E;  3Q49 B;  5JJ6 A;  5C1D A;  2A5U A;  4UI9 J;  4DX7 D;  2EIL E;  4RSY A;  3DSU A;  4ANX A;  4GPK A;  2HM8 A;  4C0E A;  4DRX E;  2Y3A A;  4MLP A;  4HXI A;  3G2S A;  4JA9 A;  3TWS A;  4U95 D;  3EDT B;  3PUJ A;  3GZ1 A;  4MS6 A;  4GZ5 A;  4A63 B;  4A1G A;  5J90 A;  3TG5 A;  1Y6I A;  4CCA A;  2GRQ B;  3VLD A;  4DJA A;  2OV8 A;  1ELR A;  3G2T A;  3DSX A;  2I1K A;  3ASF A;  1YCS B;  3E4B A;  3U64 A;  5BV1 A;  3ZYL A;  3HG0 D;  3E32 A;  3ZYK A;  1UW4 B;  3L9T A;  3IHV A;  2NXP A;  3ISM C;  1DCQ A;  3ONL A;  2DYR E;  3D9O A;  3CST A;  5T3R A;  3SBS A;  5CER B;  2L0I A;  4OVU A;  4V3I A;  1SZA A;  2V4L A;  3T8M A;  2PZI A;  4A3T A;  1E7V A;  4TUM A;  2PL2 A;  3ONK A;  2FBN A;  4UQY A;  3P1U A;  3JXI A;  2YQ8 A;  3UQ3 A;  1TNO A;  4JVS A;  5JJ7 A;  2EIM E;  4F3V A;  3UPV A;  3NBN B;  3LY7 A;  4BEP A;  5AJL A;  4O60 A;  2OEW A;  1HFA A;  4U96 D;  3UKU G;  2EIN E;  2ILR A;  1ZBP A;  3PH0 C;  4X8Q A;  3JYS A;  1HG2 A;  3AJI A;  4RG6 A;  4KZC A;  3GZ2 A;  1PC2 A;  2GRN B;  2WXM A;  3UIP C;  3E33 A;  3P2B A;  5G04 C;  3O48 A;  4QFV A;  3AS8 A;  4GML A;  4BER A;  3LDZ A;  5FZR A;  3CHQ A;  3L82 A;  3PZ1 A;  3JXJ A;  2R02 A;  2X6J A;  2WXK A;  4PS3 A;  2GRM A;  1W3B A;  5FQ6 A;  4CDM A;  3E34 A;  5JHA A;  3EUV A;  3R9M A;  4YVQ C;  4TV3 A;  3SF4 A;  3ZNG A;  4LEU A;  3SHF A;  4FA6 A;  3UXG A;  4I1A A;  4Y6W A;  4BX8 A;  5HQ8 A;  1MX2 A;  4GYY A;  4BES A;  2HO1 A;  4OAU C;  3I5P A;  2ZIS A;  3V2X A;  4UI9 C;  5D0O D;  5D0Q D;  4YVO A;  1FCH A;  4CDR A;  2R5S A;  3F6Q A;  5FWQ A;  2DZN A;  3MJW A;  3ZHE A;  2VTB B;  4CEM A;  2BED A;  5CEA A;  1S0P A;  4PS8 A;  4R7L A;  3CHR A;  2XGM A;  2R17 C;  3PUK A;  4PDX A;  2P9P G;  3KAE A;  4HVB A;  1MX4 A;  2XEE A;  4C0M A;  3BQO A;  3D9I A;  4IYP A;  2RG8 A;  3FDH A;  4J8S A;  2WQH A;  1INZ A;  2XZD G;  1OT8 A;  3U4T A;  4N5Q A;  1IQU A;  3UUX A;  5CCM A;  2E2E A;  3LJ3 A;  2UY1 A;  3CVQ A;  3CVW A;  2X6F A;  3PE4 A;  4WNE A;  3NZU A;  4I6G A;  4AV7 A;  3QC1 A;  2MRI A;  4ILG A;  3SFX A;  1NFI E;  4UWG A;  3CK8 A;  4YDY A;  3UIN C;  2KZT B;  4NUR A;  4FP7 A;  2H6H A;  5HS0 A;  1DVP A;  2DCP A;  3L08 A;  5ITZ F;  3RAU A;  2WXI A;  3QWV A;  1KT1 A;  3RK6 A;  3AU5 A;  3TG4 A;  2IY0 C;  3FU0 A;  3FP3 A;  3D9H A;  2OOE A;  2L6J A;  3AG2 E;  2PM6 A;  5HI7 A;  2CG2 A;  2WXQ A;  3VTX A;  2VSN A;  5EYP F;  3Q78 A;  1H2V C;  3ULY A;  4Z68 A;  2ZIR A;  3T5X A;  4GAA A;  2J9Q A;  5CRV A;  3L6A A;  2KBX A;  2XHE A;  3AU4 A;  1OWL A;  4KYO B;  4L7T A;  2XS8 A;  2P58 C;  1JCQ A;  4B8A A;  4GZ3 A;  2EQX A;  2I6H A;  4DLQ A;  2P9S G;  4J8D A;  1PAQ A;  1HF8 A;  3HIZ A;  3JQ0 A;  2AJA A;  4F7A A;  3WXX A;  3PRE A;  1O5M A;  3B7B A;  1LF8 A;  3ASD A;  3KS2 A;  4F1P A;  3SGH A;  4ACK A;  3HRA A;  1N9A A;  4FLH A;  4O1P A;  4AJW A;  4NRH B;  1UJJ A;  4XE0 A;  4JEU A;  1JCS A;  2I2O A;  4N3C A;  3LJN A;  4AP2 A;  3CKB A;  4ME2 A;  3BG0 B;  1UJK A;  3LKU A;  3PVL A;  3CSF A;  4ATG A;  1H6P A;  3IXE A;  2J4B A;  3S7J A;  1OUV A;  2LXL A;  3TL5 A;  3HXC A;  1G3N B;  2ETB A;  5EKQ D;  4GTT A;  1WM5 A;  4I9E A;  1E8W A;  2WXJ A;  5JMN D;  3RRM B;  3HXD A;  5BT1 A;  1U3C A;  2VSY A;  4UWK A;  2QFC A;  3C3O A;  2ETA A;  4HI8 A;  3FEX A;  4IUL A;  2X38 A;  2CFZ A;  1OWM A;  1AWC B;  5BXO A;  3CHS A;  3FEY A;  3DPY A;  1QNF A;  4WND A;  2CFU A;  4JZY A;  3SFZ A;  3DWL G;  1MX6 A;  3LS8 A;  3C98 A;  3EIQ C;  2RD0 A;  1SVX A;  4AXH A;  4ACL A;  5ENQ D;  4I1M A;  3PRZ A;  5KNH D;  4GTV A;  4GTO A;  3FHE A;  4UUC A;  1QQE A;  2ION A;  3Q5M A;  4HB5 A;  5FIO A;  4B89 A;  4DI3 A;  4CYM D;  3EHM A;  3UKR G;  2J08 A;  1N95 A;  3Q15 A;  4GA0 A;  4UQZ A;  1OCC E;  2AXV A;  3B7S A;  4BX9 A;  2R03 A;  5AAO A;  1NA3 A;  1N4S A;  1EDU A;  4WUY A;  4B93 B;  2KM4 A;  5ENR D;  4HRN A;  2IOL A;  2J09 A;  4BSX A;  3HVE B;  2GRR B;  2VTB A;  2CG3 A;  2PQN A;  1L5J A;  1BD8 A;  1MQS A;  4U8H A;  3S7D A;  2F8X K;  5AQ7 A;  5EN5 D;  4GTP A;  3HHM A;  1EPU A;  3FUF A;  2P9I G;  3ESL A;  4AM9 A;  1HZ4 A;  4MKT A;  3D9K A;  3ULQ A;  3ML8 A;  3GW4 A;  1EF1 C;  4Q94 A;  5C2Y A;  2XPY A;  2YIN A;  3URZ A;  3KSL A;  3QAR A;  1HXI A;  2FF4 A;  3DEO A;  2UWJ G;  3FTU A;  1HH8 A;  2IQC A;  1BU9 A;  3FUN A;  3FU5 A;  1DC2 A;  2Q7F A;  4HOU A;  1LTX A;  5BPP A;  3CVX A;  2KZT A;  2RFA A;  2WM9 A;  3FU6 A;  5KJL A;  4QQI A;  2FUL A;  3AAA C;  4BT8 A;  3B7U X;  2L6B A;  5KCM A;  3FUJ A;  1Z3X A;  1NP7 A;  5J08 A;  4HI9 A;  2IU1 A;  1K1A A;  2ZGG A;  5LP0 A;  4EHM A;  4YDW A;  4LNU D;  2H6F A;  3ZW3 A;  3D9P A;  4C9B B;  1WDY A;  5LCW J;  3CHO A;  3Q4A B;  3EJN A;  3EU5 A;  4GYW A;  1MZC A;  5G05 J;  3D3M A;  3TXN A;  2GW1 A;  5DBK A;  2B6C A;  4HS2 A;  3ZIM A;  3ZXS A;  2J4D A;  3CK9 A;  1X81 A;  2XRZ A;  3FUM A;  2XPZ A;  3TXM A;  4I43 A;  4RLY A;  3HXF A;  4DPR A;  3APD A;  2VGX B;  3L17 A;  1TNU A;  3APC A;  4U07 A;  1UN9 A;  1ZB1 A;  1GW6 A;  1YMP A;  2X6I A;  3QAQ A;  3ZU7 B;  2F37 A;  4JPS A;  1H19 A;  2C0L A;  4XI9 A;  4LER A;  3FUK A;  4J8E A;  3JUI A;  5KNG A;  1KLX A;  2WMO A;  1IXV A;  2AVP A;  1TNB A;  2MYO A;  1Z6T A;  5BUZ A;  1QYM A;  2XGS A;  2P9N G;  3NOC D;  2VSO E;  4KBQ A;  1B89 A;  1N0R A;  1HX8 A;  3ESK A;  1TN6 A;  3UT7 A;  2PNN A;  3UM0 A;  3JCK C;  3SD5 A;  2XS1 A;  3ZGQ A;  3HYM B;  4WWO A;  3HXE A;  4PUC A;  4A1S A;  3ASN E;  4CRW A;  2LSV A;  3CVY A;  1H2U A;  3BG1 B;  4GPM A;  3OTN A;  4ABN A;  5ENN A;  3PZ2 A;  5ANL A;  2PQR A;  3DBS A;  3NF1 A;  3EHR A;  3FUI A;  4G25 A;  1Q2Z A;  1TN8 A;  5ARF A;  3C72 A;  5EX3 A;  1JWG A;  4XZ4 A;  1JUQ A;  2AXU A;  2GRO B;  5CMW A;  3OXF A;  4L9P A;  1OWO A;  1OWN A;  1MYO A;  4L23 A;  3D9J A;  3CVL A;  1HO8 A;  2WB2 A;  4NQ0 A;  2DYS E;  4XKB A;  3TWT A;  3MGB A;  2OVF A;  3FUE A;  3ULE G;  3SBT B;  2E0I A;  4JA7 A;  4IRU A;  4RQI A;  2RKK A;  4TXP A;  2LNI A;  4FC8 A;  1K3Z D;  1P5Q A;  3S7B A;  1AP7 A;  1FT1 A;  3SNX A;  4WWN A;  5AJD A;  4XIF A;  3SI5 A;  2VQ2 A;  2YHE A;  1VDY A;  1NA0 A;  2QYU A;  1HU3 A;  2OVB A;  2XCC A;  4K5B A;  4BWR A;  4U0Z A;  1KPS B;  4N5C A;  2JAB A;  2QC9 A;  4HOR A;  4LRZ A;  1K1B A;  2BF0 X;  4O1O A;  3QWW A;  4LNG A;  3JQ1 A;  4CGV A;  1IHG A;  1N4P A;  3TWX A;  4GCO A;  4XKC A;  3QNK A;  3ZYQ A;  1N4R A;  2X6H A;  1N54 A;  3PNL B;  3X2Q E;  1UN8 A;  3HVE A;  3SZ7 A;  1NI1 A;  4Q69 A;  3FUL A;  3RO3 A;  1XGW A;  2YNQ A;  4JXT A;  5B3S E;  4GMJ A;  4YDO A;  2DZO A;  4I6J A;  4G8K A;  5AIJ A;  4M7C A;  3K9I A;  4J6I A;  3LVR E;  3FH5 A;  2XRY A;  2Y0B G;  1S64 A;  3PDN A;  2XCB A;  4F6R D;  2DVW A;  2KC7 A;  5FZS A;  4BSZ B;  2C0M A;  1DNP A;  3RRU A;  2QZA A;  1TJF A;  4LG6 A;  3MV3 B;  3NOG D;  4J8F A;  3KD7 A;  3RRN B;  4BTA A;  4U8Y D;  3TWR A;  3CGH A;  3FTY A;  5HKP A;  3CVN A;  3UM1 A;  4BY6 A;  4GTQ A;  2WMN A;  2H6I A;  4ZHB A;  2CHW A;  3PNT B;  1TR4 A;  2L9B A;  1IKN D;  3ZUV B;  2OEV A;  3AS5 A;  3ASO E;  2B0O E;  2KCV A;  2IEJ A;  2FO7 A;  1O1R A;  3D9M A;  5EX0 A;  3CHP A;  4KT6 B;  3LYA A;  3EHN A;  4EZJ A;  1S70 B;  4A3V A;  3B13 A;  4IN3 B;  4HOS A;  4I17 A;  3L22 A;  3TWV A;  4DI4 A;  1OXJ A;  5CHE E;  4N39 A;  4APF A;  5EYL A;  1TEZ A;  2HR2 A;  5T8I A;  4G2V A;  2VGX A;  4GZC A;  3V31 A;  4G23 A;  2HYZ A;  1O1S A;  2OCC E;  2V4H C;  4KVM A;  1FVH A;  4UQX A;  4M3O A;  3MEK A;  3EHQ A;  4AOF A;  3BU8 A;  3QB2 A;  3CVU A;  3UTM A;  3LY9 A;  3CVP A;  1BI8 B;  1MJ0 A;  4KMO A;  4UWL A;  3FH7 A;  2EIK E;  3FTZ A;  3GYZ A;  3KEA A;  4DK5 A;  3V30 A;  5FTP A;  2WXO A;  5LOZ A;  4HRL A;  3L54 A;  4AEZ C;  3B7R L;  3QOU A;  5H7P A;  3V2O A;  5FT9 A;  4N3B A;  4WWP A;  3Q7F A;  1MHQ A;  1FPP A;  2ZGD A;  3MA5 A;  1SZ9 A;  2BTD A;  3I4G A;  3IV0 A;  3BEE A;  2WPV A;  5ANR A;  4AIF A;  1KZP A;  4FLB A;  5CCL A;  4D10 C;  2J49 A;  4EBA G;  3J5Q B;  3ZPJ A;  1YYH A;  3Q9N C;  3Q75 A;  1OCZ E;  3EU9 A;  3UIO C;  5JHB A;  2XGO A;  3QK0 A;  4U04 A;  3PZ4 A;  3PEU B;  3CV0 A;  5EID A;  3D9N A;  2QY7 A;  5CMY A;  1E8Y A;  1LD7 A;  3C3Q A;  2FEZ A;  4J7W A;  4GCN A;  3UM2 A;  4E85 A;  3L16 A;  5B1B E;  2PM7 A;  5D2M C;  2A5E A;  1WY6 A;  1NZN A;  4I9C A;  3MV2 B;  1D9S A;  1EYH A;  5CRU A;  2AW6 A;  4ANV A;  3PZD A;  1N52 A;  1Y8M A;  1UG3 A;  5LX8 A;  4G1T A;  1QBQ A;  3ML9 A;  2V8S E;  4EZK A;  4FJY A;  2DIW A;  1QZ2 A;  3D9L A;  2BUG A;  4JC8 A;  1E8Z A;  5G04 J;  3TGO A;  5E76 A;  3DEP A;  1X5B A;  2ETC A;  2RFM A;  3MX3 A;  3TWU A;  5CBN A;  3GZS A;  3MZL B;  3AS4 A;  5D66 A;  2R2L A;  2I1J A;  3AG4 E;  4O6F A;  5KBA A;  3RKV A;  1IYG A;  4MBG A;  3RJV A;  4I2Z A;  2IF4 A;  2DWZ A;  4WNG A;  2WXN A;  1E90 A;  4FJZ A;  3MKQ B;  4BET A;  1SQM A;  3O4Z A;  2VSX E;  4ZFH A;  4FAD A;  4B94 A;  4GZD A;  3TWW A;  2DBA A;  3PE3 A;  1U2V G;  5M72 A;  4DUI A;  3AG1 E;  2YHC A;  1JWF A;  4Y6C A;  3LPZ A;  4BT9 A;  2FO1 E;  1H2T C;  3R7R A;  3I3N A;  1V55 E;  3MKR A;  3CIA A;  3SQV A;  4ILI A;  2VYI A;  3CQG B;  4C48 B;  4GMR A;  4F1S A;  1FVF A;  2JEK A;  1KZO A;  2XQ0 A;  2LAH A;  4GZ6 A;  4APO A;  3APF A;  1XNF A;  2IOS A;  4BTB A;  4TXQ A;  3TJP A;  2F8Y A;  3RO2 A;  5ENT D;  1OWP A;  4F53 A;  3UMV A;  5FZQ A;  4WNF A;  3CQC B;  4P29 A;  1V54 E;  2C2L A;  2LO6 A;  4NIK A;  4GTM A;  4G8L A;  1N4Q A;  4U7E B;  4LUN U;  4G26 A;  4B8C B;  3QKY A;  2WXH A;  2IO2 C;  2XEH A;  5CBO A;  3T5V A;  5ENS D;  3SY2 A;  3FUH A;  4I1O B;  4CGW A;  3IHY A;  3VLE A;  2NC9 A;  1NL4 A;  3V79 K;  3FTX A;  2GRP B;  4CT0 A;  1D8D A;  2VGY A;  1H6K A;  4HLE A;  3ZN3 A;  3CKC A;  5ENP D;  4HBD A;  3G2W A;  5EIB E;  4EQF A;  2BKG A;  4JHR A;  4Q96 A;  3SO8 A;  1KT0 A;  4U0U A;  3L13 A;  4OYS A;  4K03 A;  3DSS A;  3DXM G;  3RSE G;  1H0A A;  4FHK A;  4JHJ A;  5EDS A;  3PEV B;  4CDN A;  4DX1 A;  3IEG A;  4EEC A;  3NAW A;  5BXU A;  2GGF A;  1HE8 A;  2QYJ A;  4HNA D;  3EIJ A;  3ZYM A;  4U0S A;  2WXG A;  4YND A;  3RIB A;  4GB9 A;  1OCR E;  4JL0 A;  4K5A B;  2AXZ A;  2KCK A;  3ZFW A;  3QDN A;  2MOW A;  3QJZ A;  4N2S A;  3UM3 A;  4GYO A;  3B7T A;  1OY3 D;  3ABK E;  4AVX A;  1E8X A;  4URK A;  2XPI A;  5JA4 D;  4DX6 D;  4RVB A;  3G2V A;  4HLL A;  5AAR A;  4JB8 P;  4KXK B;  3B95 A;  3Q7A A;  4NAC A;  3DXK G;  4G24 A;  5KJK A;  4EBA A;  4HQD A;  3HDX A;  2M63 A;  5AQB A;  4N2Q A;  3MYV A;  3TWQ A;  2ZXW E;  4RG9 A;  3E37 A;  5LCW C;  3W9G A;  3FH8 A;  4I2W A;  1IHB A;  2P9L G;  3ZVV A;  3CLJ A;  4TUU A;  5G05 C;  4LCT A;  4HRM B;  1ELK A;  3Q79 A;  2Y1L E;  3FTS A;  5FQ4 A;  4GA2 A;  5ARG A;  4HOQ A;  3KEZ A;  5B1A E;  3SFY A;  4OVV A;  2XZT G;  3U9W A;  2NYJ A;  2VJ8 A;  1ZU2 A;  4UI9 K;  4CT4 A;  3FFL A;  4DX2 A;  1FT2 A;  1H6O A;  3J5P A;  2J8S D;  3AG3 E;  4TXR A;  5EIL A;  4ANW A;  2P9U G;  4HFG A;  2IO3 C;  4H7Y A;  1SA5 A;  4H7X A;  3Q73 A;  2X6K A;  3I4R B;  3HXB A;  5A23 A;  2FI7 A;  1HS6 A;  1TN7 A;  4G11 A;  4AY6 A;  5FQ8 A;  1O1T A;  3CEQ A;  2KXP C;  2IFU A;  3UT4 A;  2CHZ A;  3ZRH A;  4YDE A;  4AY5 A;  4LNB A;  3TAX A;  4GTR A;  2A4Z A;  3DSV A;  3ASG A;  4ATZ D;  4EZL A;  2WQ6 A;  2WXR A;  2LSU A;  3FU3 A;  3DRA A;  1UOH A;  1SW6 A;  4XX5 A;  4TRQ A;  4PS7 A;  2CHX A;  4FU3 A;  2LXM A;  5FQ7 A;  1WAO 1;  3ABM E;  5AQA A;  3NB2 A;  3N71 A;  4JD2 G;  3LEW A;  3MKQ A;  1TNY A;  4FUL A;  2HE0 A;  3PZ3 A;  3UX4 A;  1BI7 B;  3JUE A;  5LFA A;  4E6H A;  4UWF A;  3U3W A;  4MRU A;  5DIZ A;  5ENO D;  2MHK A;  4HOT A;  2V0P A;  5BW8 C;  4N3A A;  2P9K G;  3LVQ E;  3IBE A;  4JW1 A;  4KVO A;  2WXL A;  2P2C P;  2V5Q C;  3IKO B;  2KAT A;  2H6G A;  2OND A;  1DCE A;  1RW2 A;  4A55 A;  5KWD A;  1U3D A;  5BV0 A;  1BLX B;  3Q47 B;  4GTS A;  2NSZ A;  1TJC A;  3ASH A;  5IY5 E;  4L2Y A;  3LY8 A;  1TNZ A;  3FTW A;  3LXU X;  3FTV A;  4EPZ A;  1PY1 A;  4XI0 A;  2IJG X;  1JPL A;  5HRY A;  3UT8 A;  2R59 A;  2LAI A;  2X3M A;  1HG5 A;  3R9A B;  3ZEF A;  4B0Z A;  4J8Y A;  4L2L A;  1N11 A;  2XEN A;  1Z3Y A;  1K8K G;  3E30 A;  1YA0 A;  5AQ9 A;  1ELW A;  1A17 A;  3ZXP A;  3UI2 A;  5KJN A;  2V5F A;  3FUD A;  3WG7 E;  4XEI G;  3RU0 A;  1IQR A;  4OAV B;  2F0Y A;  4LSZ E;  3CHM A;  3DSW A;  1TYQ G;  4GA1 A;  5AN8 A;  2WXF A;  4DX5 D;  3OAW A;  1D8E A;  1A5E A;  1LD8 A;  4ILH B;  4FHJ A;  1JCR A;  5CED B;  2Y4U A;  4JHK A;  2R05 A;  3DST A;  5FIN A;  3VTY A;  2WVI A;  5G55 A;  3Q9U C;  2J07 A;  5G2N A;  3R7Q A;  3BUA A;  2WXP A;  3ZHE B;  2AWI A;  2BKK B;  2WQ7 A;  3FY4 A;  2L0T B;  4PH4 B;  5AYW D;  2I9C A;  5A7D B;  3ENE A;  3OXL A;  4L1B A;  3CR3 A;  3W9F A;  5BNW A;  5E75 A;  1OCO E;  3ABL E;  4WAF A;  5T4Y A;  3LCA A;  1E7U A;  4K0R A;  3S2A A;  4K5C A;  3CVV A;  3DPD A;  3FWV A;  5JJT A;  1E96 B;  1WG0 A;  3VLF A;  3NQP A;  2GRL A;  2Y4T A;  2UY1 B;  3MCX A;  4I6E A;  3ZKJ A;  1SA4 A;  3OXG A;  4CZ2 D;  4JEH A;  3QWP A;  3T8K A;  5KJM A;  3CK7 A;  4U63 A;  4KZ0 A;  4GU5 A; 
#chains in the Genus database with same CATH homology
 1TN6 A;  4MBG A;  3E32 A;  4EHM A;  1TNY A;  1N95 A;  1S63 A;  3E37 A;  3PZ3 A;  2F0Y A;  1NL4 A;  3HXE A;  4LNG A;  2H6F A;  3DSW A;  1N4P A;  1KZP A;  3HXC A;  2IEJ A;  2ZIS A;  1D8E A;  1D8D A;  1LD8 A;  1N4S A;  1JCR A;  3PZ2 A;  3Q79 A;  1O1R A;  3EU5 A;  3DST A;  1MZC A;  3Q78 A;  1N4R A;  3KSQ A;  3Q75 A;  1TN8 A;  4GTT A;  2ZIR A;  3C72 A;  1NI1 A;  3PZ4 A;  3DSS A;  1N94 A;  3SFY A;  2BED A;  1LD7 A;  2H6G A;  3HXD A;  1X81 A;  1TNO A;  4YDO A;  1JCQ A;  1DCE A;  1FT2 A;  4L9P A;  4GTS A;  4GTP A;  3HXF A;  1SA5 A;  1O1S A;  1TNU A;  3Q73 A;  3HXB A;  1TNZ A;  1TN7 A;  3DPY A;  1S64 A;  3DSU A;  1KZO A;  1O1T A;  1O5M A;  1QBQ A;  4YDE A;  3KSL A;  4LNB A;  3E33 A;  4GTR A;  3DSV A;  3DRA A;  1FT1 A;  3SFX A;  1SA4 A;  1N9A A;  4GTV A;  1LTX A;  1TNB A;  3PZ1 A;  4GTO A;  4GTQ A;  2H6H A;  2H6I A;  4GTM A;  3E30 A;  1N4Q A;  3Q7F A;  2R2L A;  1JCS A;  3DSX A;  3E34 A;  3Q7A A;  3EUV A;  1FPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...