2IEJA

Human protein farnesyltransferase complexed with inhibitor compound stn-48 and fpp analog at 1.8a resolution
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Resistance mutations at the lipid substrate binding site of Plasmodium falciparum protein farnesyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 127
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2iejA00
4YDOA 1MZCA 2BEDA 1JCRA 2IEJA 2H6FA 4YDEA 1DCEA 4GTTA 3SFYA 3DSSA 1KZPA 4LNGA 1S64A 3KSLA 1TNOA 1FT2A 1N95A 1TNYA 3E33A 1N4SA 4GTSA 1TNBA 4GTQA 1LTXA 3KSQA 3DSVA 3PZ1A 1D8DA 3Q78A 3PZ2A 3DSTA 2R2LA 3Q7AA 4LNBA 3HXCA 1O1SA 1SA4A 3DRAA 3EUVA 1TNUA 1LD7A 3EU5A 2ZIRA 3E30A 3SFXA 1O5MA 3DPYA 1QBQA 3E37A 1FT1A 4L9PA 3Q79A 3DSXA 4GTOA 3Q75A 3PZ3A 1N4RA 3HXEA 1TN8A 1X81A 1N4PA 1JCQA 2ZISA 1N9AA 1FPPA 3C72A 4EHMA 4GTMA 1O1TA 3DSWA 3Q73A 2F0YA 1N4QA 3DSUA 1N94A 1TNZA 3Q7FA 4GTPA 1NI1A 1S63A 1O1RA 1TN6A 1NL4A 3PZ4A 4MBGA 1LD8A 3HXBA 4GTVA 2H6GA 1SA5A 1TN7A 1KZOA 3E32A 1JCSA 2H6HA 3HXFA 4GTRA 3E34A 3HXDA 1D8EA 2H6IA
chains in the Genus database with same CATH superfamily
2P2CP 4C0MA 4TXRA 3D9HA 3MKRA 4K0RA 1HXIA 1S64A 3KSLA 1S0PA 2WXJA 3GZ1A 1ELKA 4BT8A 3LY8A 2VGXB 3SGHA 3Q9UC 3MV2B 3NZUA 4UQYA 4XEIG 1MX4A 3ABLE 2KCLA 2WQHA 3QKYA 4DX2A 1XNFA 2JLBA 1HX8A 4ME2A 4LUNU 4J8DA 1YMPA 3L13A 5FQ6A 3Q78A 5FZQA 1UG3A 3RO2A 3QJZA 4GZ6A 4OYSA 3OXFA 3TWUA 2KM4A 2NC9A 2R5SA 4JHJA 1W3BA 2HE0A 3JYSA 3Q5MA 1BD8A 5KWDA 4TRQA 1V54E 4CDNA 3FTYA 3KD7A 3URZA 3SFXA 1LF8A 4G11A 2XEEA 3U64A 5FIOA 3NZSA 1H2TC 4MKTA 3U3WA 3AG1E 4N2SA 4GMRA 3FU3A 2EIKE 3Q15A 4LNUD 4ANVA 3F6QA 1NP7A 2FO7A 3VLFA 5IY5E 1Z6TA 4DI4A 1S63A 1E8ZA 3LY9A 3OAWA 1DC2A 1LD8A 1OXJA 5CCMA 4NQ0A 3TWWA 1EDUA 4J8EA 4F7AA 2XENA 2BKGA 3DPDA 3CKCA 3UI2A 3HDXA 5JJ7A 4GMJA 1DCEA 3EIJA 5AARA 3AG2E 2YNQA 4HOQA 3RRNB 5CRUA 1N4SA 3UM2A 5BV1A 3VLDA 3ONKA 3PZDA 3DSVA 1BI8B 4WWOA 2X6HA 4AXHA 2R2LA 2XPIA 3FTZA 5EILA 2CG2A 4O6FA 3SBSA 3U4TA 2BF0X 4TUMA 5HQ8A 2KBXA 3RO3A 1IKND 3QOUA 1H6KA 5ARFA 1H0AA 2B0OE 4DX5D 2VGYA 3LJNA 2Y3AA 4GYOA 5BV0A 4HLEA 1NFIE 3ASDA 4GZDA 4Y6CA 2R59A 1H2UA 2P9PG 2AXVA 3CHPA 5CBOA 3BU8A 4UWFA 4HVBA 4BX8A 3NOCD 4KVMA 5ARGA 3RAUA 3ESLA 1MYOA 4DLQA 1SZ9A 4A63B 3TWSA 3MKQA 3PNLB 2GRPB 1JCSA 2H6HA 3WXXA 4V3IA 2FI7A 4CZ2D 5CRVA 2YINA 2RKKA 4DK5A 4APFA 3EHRA 4YDYA 2IJGX 3BEEA 3FUHA 1AWCB 1IHGA 3T8KA 3LEWA 3Q4AB 3GYZA 4GZ3A 3SNXA 4HNAD 2LXMA 1G3NB 3CGHA 5HKPA 2XRYA 1ZU2A 3JXJA 3FULA 3ZPJA 1WDYA 4AEZC 3V31A 4J8YA 1D8DA 5CECB 3CVWA 2QY7A 3IBEA 2RD0A 3PRZA 3FUJA 3W9GA 3QARA 3EU5A 3U9WA 4APOA 4JHKA 3DPYA 4GCNA 3UT7A 1V55E 3PDNA 3UXGA 2DCPA 3J5QB 4JPSA 1RZ4A 5JJ6A 4TV3A 5KCMA 5B1AE 5AJDA 2P9KG 1QYMA 2WM9A 5G05C 4UI9K 5AN8A 1QZ2A 3E4BA 4HRNA 1HZ4A 2VGEA 3MCXA 3AG4E 1N94A 4EZLA 4GTPA 1OWNA 2J09A 3TWTA 1NI1A 3ZFWA 3ZHEB 2BKKB 2VSNA 4O60A 2JEKA 5ENQD 2R05A 3B7UX 2Y4UA 3HVEA 3HXFA 2EIME 5AQAA 4CDRA 4N5CA 1JCRA 2NYJA 3ESKA 4H7XA 4JXTA 2Y69E 4O1OA 4N3AA 5H7PA 3HG0D 3BQOA 2L6JA 3FUNA 3RK6A 1FT2A 3CQCB 4F6RD 4BTBA 3D9IA 3KEAA 4GMLA 3TWXA 4XX5A 3G2VA 2X3MA 1MX2A 2KATA 2OV8A 3TXNA 2LAIA 3PZ1A 2E2EA 1TJFA 3ASFA 3APCA 5ENRD 3Q7AA 3UM1A 3SHFA 3EDTB 3CHMA 5JHBA 4GYYA 3BG1B 5ENTD 3UIPC 4XI9A 2P9NG 1OCCE 5BPPA 5D66A 2IF4A 3I4RB 4YVOA 5FWQA 3SD5A 3MV3B 3KAEA 3S7FA 3DWLG 4GTMA 4XKCA 3R9AB 1O1TA 3T9KA 3CVLA 4BFRA 2C0MA 4B0ZA 3IKOB 4YDWA 3L08A 3T5XA 3MJWA 1N0QA 3VLEA 2WQ6A 3UPVA 4DUIA 2CG3A 4L2LA 4GTRA 5JHAA 2RG8A 3ML9A 4NIKA 3QNKA 2H6FA 2FO1E 1KLXA 5AYWD 4LNGA 1SZAA 3EHNA 3GZ2A 2X6IA 2IO3C 4UWKA 5J90A 1E8YA 2XZDG 3RRMB 2XGMA 4FHJA 4JEUA 3ZYMA 4U0ZA 2EIJE 2LO6A 3DRAA 2DIWA 2J4BA 4N3BA 4BY6A 4RG9A 3UT4A 2RFMA 4ZFHA 4IN3B 3E37A 3ENEA 3FTVA 2EQXA 3EHMA 4YVQC 3UUXA 2OVFA 3ZGQA 2ZGGA 2ZU6B 3PZ3A 1N4RA 5M72A 2IONA 2MRIA 3EJNA 3CVPA 3S7JA 4J8FA 3ZN3A 4CYMD 3FU5A 4ZHBA 5CERB 3FTWA 4R7LA 4G8KA 1TNZA 3I5PA 3Q7FA 4ACKA 1SQMA 1H2VC 3SF4A 4GTVA 4ILGA 2AXUA 1KT0A 2J4DA 5FTPA 1HS6A 4PS3A 2HM8A 3LVRE 1D8EA 5FQ8A 4C48B 2BEDA 1NZNA 1JWFA 2YHEA 4KVOA 4HRLA 2XS1A 2A5EA 3HYMB 4CGVA 3K9IA 3X2QE 3CVUA 2OCCE 4IRUA 3AJIA 4DJAA 5EKQD 5EX3A 2L0IA 2AJAA 3FH7A 1HO8A 4I1MA 2RFAA 4HB5A 3NB2A 4M3OA 3AAAC 2LNIA 2UY1B 1EYHA 1UN9A 4I17A 5D0OD 5ENNA 3AU4A 3D9PA 3IHYA 2ZXWE 1U3CA 3MEKA 3D9OA 2WXOA 2DYRE 3ZRHA 4LERA 3E30A 3PE4A 4BESA 2WXGA 3TWQA 4JZYA 4QQIA 3CVQA 3CVNA 3RKVA 3ZKJA 3TWVA 2EILE 3P1UA 2ETCA 2VGXA 3VTXA 4K5BA 5AIJA 2XGOA 1IHBA 4EHMA 2VQ2A 3PUJA 1Z5SC 3Q73A 4DI3A 4B94A 2DBAA 3DSUA 3ZIMA 3QK0A 4OVVA 3CEQA 3FUDA 1U3DA 1PAQA 2LAHA 3L9TA 3V2OA 2C2LA 2QZAA 1DNPA 3JUIA 5LP0A 5AENA 1MX6A 2J8SD 5ITZF 5D0QD 3NF1A 3AS4A 2H6IA 4JHRA 3CK9A 2IEJA 4YDEA 4G8LA 4O1PA 1WAO1 1E7VA 5FQ4A 3ZYQA 4U07A 4G25A 3L17A 3JCKC 3QC1A 4LEUA 4EZKA 4JEHA 3RJVA 4MLPA 5JMND 2F37A 4CEMA 4DX6D 4N3CA 5CCLA 4JB8P 2WXKA 4PH4B 3CHQA 2V0PA 1K1BA 1VDYA 4GCOA 3FUMA 4W9RA 3TG5A 4KMOA 1YYHA 2FULA 3D9NA 1X5BA 2L9BA 4GYWA 5CEAA 5ANLA 3Q79A 4HORA 2OEVA 4P29A 3C72A 3MA5A 4BSXA 4A55A 2B6CA 1E8WA 5A6CA 1BI7B 2PM6A 4U95D 1MJ0A 2CHXA 4TXQA 4Y6WA 3OXGA 4UI9J 3UX4A 3FUIA 2P9SG 3V79K 1JWGA 2C0LA 1B89A 2GGFA 1U2VG 3W9FA 2ONDA 2WXLA 4KXKB 3FWVA 3HXDA 2VYIA 3ABKE 4J8SA 4GAAA 1OWPA 4GTTA 3SFYA 3DSSA 5EDSA 1RW2A 3G2TA 4GZCA 5CEDB 1N95A 4LCTA 3UINC 3FUEA 3UKRG 3QB2A 4HLLA 1Z3XA 2L6BA 5B1BE 3CKBA 2PZIA 3NAWA 3B95A 4G26A 2V4HC 3DSTA 2ETAA 4I43A 1AP7A 4L23A 1SA4A 2WXMA 1UN8A 3HRAA 3TXMA 4A3VA 3ZU7B 3QWWA 3APFA 4AY6A 4A1GA 1TN8A 5KJLA 2ILRA 5BUZA 1N9AA 3SBTB 4ATZD 2LSVA 2E0IA 4MS6A 3ZYLA 3ML8A 3SY2A 2WPVA 4XKBA 1OCRE 2IU1A 3MYVA 2DZNA 5HI7A 3ZUVB 3LDZA 3FTXA 3JQ1A 3R9MA 1FVFA 3B7BA 1TN7A 1HG2A 1N52A 4UWHA 3E32A 3BG0B 3TAXA 3TWRA 3ZVVA 2FF4A 5AJLA 1PY1A 1KZPA 2XS8A 3CV0A 2V8SE 5A7DB 3PNTB 2VJ8A 4A3TA 4RQIA 1E8XA 1ELRA 2V5FA 3C3OA 3ZHEA 2LXLA 3CQGB 1XGWA 2DVWA 2FBNA 4U8YD 4PS8A 2XCCA 4K03A 3D9MA 3HHMA 2M63A 4FA6A 4WWPA 1LD7A 2WB2A 4BX9A 2Q7FA 3PREA 4HOSA 3ZYKA 1O5MA 2DYSE 2GRLA 1TEZA 2X6JA 2I2OA 2Y4TA 3DSXA 3DEOA 3BUAA 4AVXA 3PEVB 4HS2A 4WAFA 5T3RA 1KT1A 3FU0A 3J5PA 4FADA 4CT0A 4FP7A 4JL0A 3DSWA 3C98A 3LS8A 4G2VA 1OUVA 3S7BA 4F1SA 4FC8A 3SO8A 4OAVB 1H6OA 4OVUA 4WUYA 2KC7A 3QDNA 3GW4A 1O1RA 3LPZA 3P2BA 4RVBA 5LCWC 4IYPA 2LUHA 4FHKA 4KZCA 2F8YA 4I2WA 2XPZA 3L22A 2GRRB 5LX8A 3FTUA 2Y1LE 4E85A 3ABME 1IQRA 1NA0A 1E96B 3DBSA 2IFUA 3LXUX 3B13A 2P9IG 2P58C 2XZTG 4HXIA 3PEUB 2PM7A 3R7QA 4DLOA 1WG0A 2AXZA 1H6PA 1TNBA 1MHQA 3ZXPA 4GPMA 1YCSB 4XZ4A 4KT6B 4ILHB 3NQPA 5J08A 2AWIA 3B7SA 2XEHA 2I1JA 4A1SA 4I9EA 3ZEFA 1K8KG 3D9KA 3TGOA 4Q69A 1OT8A 3U66A 3AS5A 3ZNGA 1N0RA 2R17C 4J7WA 3SQVA 3PE3A 3T5VA 3PUKA 3NOGD 4KZ0A 4U7EB 4DX7D 1ZBPA 3I4GA 5BW8C 4HOTA 3JUEA 3L6AA 3T8MA 2WXRA 4I6EA 4UQZA 2CHWA 3UMVA 5LFAA 2OEWA 5B3SE 3UM0A 4XE0A 2Y0BG 3PZ4A 2A4ZA 3C3RA 1WM5A 3AS8A 2H6GA 4FLHA 4AY5A 2HYZA 2QC9A 5HRYA 4GB9A 4HBDA 1EF1C 5EIDA 4ANUA 2P9LG 4UI9C 3ZW3A 2LSUA 2KCVA 1INZA 5CHEE 1MQSA 4URKA 1NA3A 5EYLA 4I6GA 4Z68A 2PNNA 1ELWA 1TNYA 2XCBA 5HS0A 3B7RL 2X6KA 4U96D 4BT9A 2WXFA 4KBQA 4JVSA 5CMWA 3KSQA 2GW1A 3QWPA 3FEYA 2WXHA 3PZ2A 3O48A 4JD2G 1BPOA 4LNBA 1HFAA 4FLBA 4K5CA 4EBAA 4M7CA 4I2ZA 4G24A 3B7TA 2R03A 3CSTA 2MOWA 3FFLA 2KCKA 2VSXE 1HH8A 5ENPD 3FHEA 3HXEA 4WNFA 5FT9A 2JABA 1JCQA 4WNDA 4KYOB 2HO1A 3CLJA 2A5UA 4ACLA 4EQFA 3TJPA 2UY1A 2MHKA 4HFGA 4DRXE 4JA7A 3V2XA 5C2YA 2VSYA 1NL4A 3V30A 3LVQE 3HXBA 4HOUA 1OWLA 1D9SA 1KZOA 3IEGA 5FZRA 5LCWJ 5A23A 2I9CA 1JPLA 1SVXA 4L1BA 3ISMC 3QAQA 4I6JA 2V4LA 2IO2C 4NACA 2IY0C 1QQEA 3LY7A 3VTYA 1E90A 4HI8A 4RG6A 2DWZA 4GTQA 3C5RA 5E75A 3S2AA 3ULQA 2IQCA 5KBAA 1L5JA 3ONLA 5FINA 3UIOC 4F53A 4L2YA 4EECA 5EIBE 3L16A 3EUVA 1OY3D 4H7YA 5KJNA 4C9BB 2QYUA 4U04A 4J6IA 4UQXA 3PVLA 4FJYA 5FZSA 1FPPA 1Z3YA 3D9JA 5ANRA 4Q96A 3FEXA 4BSZB 1SW6A 3LKUA 4EPZA 1N4QA 2GRQB 1K3ZD 4ABNA 4CGWA 3FY4A 3WG7E 1A17A 4B8CB 4AM9A 1IYGA 3L54A 2KXPC 2WMOA 4RSYA 1TJCA 3CHSA 4JW1A 4X8QA 1TNOA 4GA0A 4B89A 2XRZA 3OTNA 2EINE 2X38A 1WY6A 4N2QA 1KPSB 3E33A 4B8AA 5DIZA 2BTDA 5BXUA 1TYQG 1OCZE 1OWOA 1LTXA 3QWVA 3DXKG 1HG5A 4C0EA 4UWLA 3ASNE 4EZJA 1OCOE 4HI9A 4FULA 3Q47B 3CVXA 1O1SA 2CFZA 4U0SA 4UUCA 3FTSA 3MKQB 2FEZA 2P9UG 3APDA 4WWNA 1UJJA 2IOLA 4K5AB 4BTAA 4U8VD 2VTBB 5G55A 2X6FA 5AQ7A 2HR2A 1N4PA 3Q49B 4LG6A 4GA1A 5DBKA 3R7RA 5AAOA 2VTBA 3PS6A 3UKUG 3JXIA 1UW4B 2GRNB 3EHQA 2QYJA 4MBGA 3ZXSA 1FVHA 2ZGDA 4PUCA 3MGBA 1ZB1A 2IOSA 2J9QA 1S70B 1OWMA 5C1DA 4ANXA 3FH8A 2J08A 3LYAA 4D10C 3O4ZA 1K1AA 4G23A 2WVIA 2XPYA 4N5QA 4U0UA 5E76A 2XEVA 4I1OB 3RU0A 1HE8A 1Y6IA 3CSFA 4GPKA 2UWJG 2PQNA 5ENOD 1H19A 1BU9A 1N11A 3IXEA 3ASHA 2YHCA 3UT8A 3CVVA 3MX3A 3CHRA 2J07A 5G04C 3CVYA 2ZIRA 3FU6A 4AP2A 2GROB 1QBQA 4L7TA 2AVPA 3HVEB 1FT1A 3EIQC 4CCAA 4JA9A 4CT4A 3Q75A 4PDXA 4NURA 2OOEA 2ZISA 1FCHA 2GRMA 1DCQA 3G2UA 3FH5A 5ENSD 5BNWA 3SI5A 3IHVA 4GZ5A 2XGSA 1GW6A 1TN6A 4AOFA 3I3NA 3N71A 4F1PA 4DPRA 5T4YA 4B93B 5CMYA 1SA5A 2WXNA 4CDMA 4I9CA 5T8IA 3FUFA 2WXQA 3AG3E 3CK8A 4BEPA 3DXMG 4YDOA 1MZCA 4JC8A 1Q2ZA 4BETA 2KZTB 4UWGA 4N39A 5FQ7A 3ULYA 2XHEA 1Y8MA 4NRHB 5LOZA 3G2WA 5BXOA 1DVPA 5BT1A 5CBNA 2KZTA 4DX1A 4GTSA 1IQUA 2WQ7A 5AQBA 4CRWA 2I6HA 2YQ8A 2CHZA 3RRUA 2WMNA 3LJ3A 3ULEG 3CK7A 2CFUA 3TL5A 4BERA 2V5QC 2PL2A 1TNUA 2WXIA 4AV7A 1P5QA 4QFVA 4U63A 3ASGA 4L9PA 4TUUA 4TXPA 3IV0A 3UQ3A 3RSEG 1HF8A 2F8XK 4AJWA 5KJKA 1IXVA 2PQRA 1YA0A 1UOHA 3EU9A 5AQ9A 5FJYA 4MRUA 2J49A 1E7UA 3CHOA 3FUKA 5JJTA 4OAUC 4ILIA 5KJMA 5D2MC 4FJZA 3PH0C 4EBAG 3FP3A 5G2NA 3E34A 4FU3A 3NBNB 3SFZA 3HIZA 1BLXB 2QFCA 3D3MA 3C3QA 3Q9NC 4WNEA 4F3VA 4U8HA 2L0TB 4ATGA 5EYPF 3RIBA 3SZ7A 4YNDA 2OVBA 5KNGA 5KNHD 2R02A 4Q94A 4XI0A 3AU5A 1PC2A 3CIAA 1TR4A 4LSZE 4PS7A 4RLYA 3HXCA 4AIFA 3G2SA 3S7DA 4ANWA 2ETBA 2BUGA 2AW6A 2WXPA 4XIFA 3FDHA 3ASOE 5G05J 3TG4A 2XQ0A 2DZOA 5G04J 3KS2A 3D9LA 4GTOA 3L82A 1QNFA 1JUQA 1X81A 2MYOA 3DEPA 3UTMA 3OXLA 4GA2A 3GZSA 1N54A 3KEZA 4E6HA 5JA4D 3MZLB 3UM3A 4I1AA 1EPUA 2I1KA 4LRZA 2NSZA 1HU3A 1A5EA 4IULA 2F0YA 4G1TA 4HRMB 1UJKA 4WNGA 5EX0A 3CR3A 5EN5D 2NXPA 4GU5A 4J0UA 4BWRA 4HQDA 3LCAA 2VSOE 3JQ0A
chains in the Genus database with same CATH topology
4YDOA 1MZCA 2BEDA 1JCRA 2IEJA 2H6FA 4YDEA 1DCEA 4GTTA 3SFYA 3DSSA 1KZPA 4LNGA 1S64A 3KSLA 1TNOA 1FT2A 1N95A 1TNYA 3E33A 1N4SA 4GTSA 1TNBA 4GTQA 1LTXA 3KSQA 3DSVA 3PZ1A 1D8DA 3Q78A 3PZ2A 3DSTA 2R2LA 3Q7AA 4LNBA 3HXCA 1O1SA 1SA4A 3DRAA 3EUVA 1TNUA 1LD7A 3EU5A 2ZIRA 3E30A 3SFXA 1O5MA 3DPYA 1QBQA 3E37A 1FT1A 4L9PA 3Q79A 3DSXA 4GTOA 3Q75A 3PZ3A 1N4RA 3HXEA 1TN8A 1X81A 1N4PA 1JCQA 2ZISA 1N9AA 1FPPA 3C72A 4EHMA 4GTMA 1O1TA 3DSWA 3Q73A 2F0YA 1N4QA 3DSUA 1N94A 1TNZA 3Q7FA 4GTPA 1NI1A 1S63A 1O1RA 1TN6A 1NL4A 3PZ4A 4MBGA 1LD8A 3HXBA 4GTVA 2H6GA 1SA5A 1TN7A 1KZOA 3E32A 1JCSA 2H6HA 3HXFA 4GTRA 3E34A 3HXDA 1D8EA 2H6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDO A;  1MZC A;  2BED A;  1JCR A;  2IEJ A;  2H6F A;  4YDE A;  1DCE A;  4GTT A;  3SFY A;  3DSS A;  1KZP A;  4LNG A;  1S64 A;  3KSL A;  1TNO A;  1FT2 A;  1N95 A;  1TNY A;  3E33 A;  1N4S A;  4GTS A;  1TNB A;  4GTQ A;  1LTX A;  3KSQ A;  3DSV A;  3PZ1 A;  1D8D A;  3Q78 A;  3PZ2 A;  3DST A;  2R2L A;  3Q7A A;  4LNB A;  3HXC A;  1O1S A;  1SA4 A;  3DRA A;  3EUV A;  1TNU A;  1LD7 A;  3EU5 A;  2ZIR A;  3E30 A;  3SFX A;  1O5M A;  3DPY A;  1QBQ A;  3E37 A;  1FT1 A;  4L9P A;  3Q79 A;  3DSX A;  4GTO A;  3Q75 A;  3PZ3 A;  1N4R A;  3HXE A;  1TN8 A;  1X81 A;  1N4P A;  1JCQ A;  2ZIS A;  1N9A A;  1FPP A;  3C72 A;  4EHM A;  4GTM A;  1O1T A;  3DSW A;  3Q73 A;  2F0Y A;  1N4Q A;  3DSU A;  1N94 A;  1TNZ A;  3Q7F A;  4GTP A;  1NI1 A;  1S63 A;  1O1R A;  1TN6 A;  1NL4 A;  3PZ4 A;  4MBG A;  1LD8 A;  3HXB A;  4GTV A;  2H6G A;  1SA5 A;  1TN7 A;  1KZO A;  3E32 A;  1JCS A;  2H6H A;  3HXF A;  4GTR A;  3E34 A;  3HXD A;  1D8E A;  2H6I A; 
#chains in the Genus database with same CATH topology
 2P2C P;  4C0M A;  4TXR A;  3D9H A;  3MKR A;  4K0R A;  1HXI A;  1S64 A;  3KSL A;  1S0P A;  2WXJ A;  3GZ1 A;  1ELK A;  4BT8 A;  3LY8 A;  2VGX B;  3SGH A;  3Q9U C;  3MV2 B;  3NZU A;  4UQY A;  4XEI G;  1MX4 A;  3ABL E;  2KCL A;  2WQH A;  3QKY A;  4DX2 A;  1XNF A;  2JLB A;  1HX8 A;  4ME2 A;  4LUN U;  4J8D A;  1YMP A;  3L13 A;  5FQ6 A;  3Q78 A;  5FZQ A;  1UG3 A;  3RO2 A;  3QJZ A;  4GZ6 A;  4OYS A;  3OXF A;  3TWU A;  2KM4 A;  2NC9 A;  2R5S A;  4JHJ A;  1W3B A;  2HE0 A;  3JYS A;  3Q5M A;  1BD8 A;  5KWD A;  4TRQ A;  1V54 E;  4CDN A;  3FTY A;  3KD7 A;  3URZ A;  3SFX A;  1LF8 A;  4G11 A;  2XEE A;  3U64 A;  5FIO A;  3NZS A;  1H2T C;  4MKT A;  3U3W A;  3AG1 E;  4N2S A;  4GMR A;  3FU3 A;  2EIK E;  3Q15 A;  4LNU D;  4ANV A;  3F6Q A;  1NP7 A;  2FO7 A;  3VLF A;  5IY5 E;  1Z6T A;  4DI4 A;  1S63 A;  1E8Z A;  3LY9 A;  3OAW A;  1DC2 A;  1LD8 A;  1OXJ A;  5CCM A;  4NQ0 A;  3TWW A;  1EDU A;  4J8E A;  4F7A A;  2XEN A;  2BKG A;  3DPD A;  3CKC A;  3UI2 A;  3HDX A;  5JJ7 A;  4GMJ A;  1DCE A;  3EIJ A;  5AAR A;  3AG2 E;  2YNQ A;  4HOQ A;  3RRN B;  5CRU A;  1N4S A;  3UM2 A;  5BV1 A;  3VLD A;  3ONK A;  3PZD A;  3DSV A;  1BI8 B;  4WWO A;  2X6H A;  4AXH A;  2R2L A;  2XPI A;  3FTZ A;  5EIL A;  2CG2 A;  4O6F A;  3SBS A;  3U4T A;  2BF0 X;  4TUM A;  5HQ8 A;  2KBX A;  3RO3 A;  1IKN D;  3QOU A;  1H6K A;  5ARF A;  1H0A A;  2B0O E;  4DX5 D;  2VGY A;  3LJN A;  2Y3A A;  4GYO A;  5BV0 A;  4HLE A;  1NFI E;  3ASD A;  4GZD A;  4Y6C A;  2R59 A;  1H2U A;  2P9P G;  2AXV A;  3CHP A;  5CBO A;  3BU8 A;  4UWF A;  4HVB A;  4BX8 A;  3NOC D;  4KVM A;  5ARG A;  3RAU A;  3ESL A;  1MYO A;  4DLQ A;  1SZ9 A;  4A63 B;  3TWS A;  3MKQ A;  3PNL B;  2GRP B;  1JCS A;  2H6H A;  3WXX A;  4V3I A;  2FI7 A;  4CZ2 D;  5CRV A;  2YIN A;  2RKK A;  4DK5 A;  4APF A;  3EHR A;  4YDY A;  2IJG X;  3BEE A;  3FUH A;  1AWC B;  1IHG A;  3T8K A;  3LEW A;  3Q4A B;  3GYZ A;  4GZ3 A;  3SNX A;  4HNA D;  2LXM A;  1G3N B;  3CGH A;  5HKP A;  2XRY A;  1ZU2 A;  3JXJ A;  3FUL A;  3ZPJ A;  1WDY A;  4AEZ C;  3V31 A;  4J8Y A;  1D8D A;  5CEC B;  3CVW A;  2QY7 A;  3IBE A;  2RD0 A;  3PRZ A;  3FUJ A;  3W9G A;  3QAR A;  3EU5 A;  3U9W A;  4APO A;  4JHK A;  3DPY A;  4GCN A;  3UT7 A;  1V55 E;  3PDN A;  3UXG A;  2DCP A;  3J5Q B;  4JPS A;  1RZ4 A;  5JJ6 A;  4TV3 A;  5KCM A;  5B1A E;  5AJD A;  2P9K G;  1QYM A;  2WM9 A;  5G05 C;  4UI9 K;  5AN8 A;  1QZ2 A;  3E4B A;  4HRN A;  1HZ4 A;  2VGE A;  3MCX A;  3AG4 E;  1N94 A;  4EZL A;  4GTP A;  1OWN A;  2J09 A;  3TWT A;  1NI1 A;  3ZFW A;  3ZHE B;  2BKK B;  2VSN A;  4O60 A;  2JEK A;  5ENQ D;  2R05 A;  3B7U X;  2Y4U A;  3HVE A;  3HXF A;  2EIM E;  5AQA A;  4CDR A;  4N5C A;  1JCR A;  2NYJ A;  3ESK A;  4H7X A;  4JXT A;  2Y69 E;  4O1O A;  4N3A A;  5H7P A;  3HG0 D;  3BQO A;  2L6J A;  3FUN A;  3RK6 A;  1FT2 A;  3CQC B;  4F6R D;  4BTB A;  3D9I A;  3KEA A;  4GML A;  3TWX A;  4XX5 A;  3G2V A;  2X3M A;  1MX2 A;  2KAT A;  2OV8 A;  3TXN A;  2LAI A;  3PZ1 A;  2E2E A;  1TJF A;  3ASF A;  3APC A;  5ENR D;  3Q7A A;  3UM1 A;  3SHF A;  3EDT B;  3CHM A;  5JHB A;  4GYY A;  3BG1 B;  5ENT D;  3UIP C;  4XI9 A;  2P9N G;  1OCC E;  5BPP A;  5D66 A;  2IF4 A;  3I4R B;  4YVO A;  5FWQ A;  3SD5 A;  3MV3 B;  3KAE A;  3S7F A;  3DWL G;  4GTM A;  4XKC A;  3R9A B;  1O1T A;  3T9K A;  3CVL A;  4BFR A;  2C0M A;  4B0Z A;  3IKO B;  4YDW A;  3L08 A;  3T5X A;  3MJW A;  1N0Q A;  3VLE A;  2WQ6 A;  3UPV A;  4DUI A;  2CG3 A;  4L2L A;  4GTR A;  5JHA A;  2RG8 A;  3ML9 A;  4NIK A;  3QNK A;  2H6F A;  2FO1 E;  1KLX A;  5AYW D;  4LNG A;  1SZA A;  3EHN A;  3GZ2 A;  2X6I A;  2IO3 C;  4UWK A;  5J90 A;  1E8Y A;  2XZD G;  3RRM B;  2XGM A;  4FHJ A;  4JEU A;  3ZYM A;  4U0Z A;  2EIJ E;  2LO6 A;  3DRA A;  2DIW A;  2J4B A;  4N3B A;  4BY6 A;  4RG9 A;  3UT4 A;  2RFM A;  4ZFH A;  4IN3 B;  3E37 A;  3ENE A;  3FTV A;  2EQX A;  3EHM A;  4YVQ C;  3UUX A;  2OVF A;  3ZGQ A;  2ZGG A;  2ZU6 B;  3PZ3 A;  1N4R A;  5M72 A;  2ION A;  2MRI A;  3EJN A;  3CVP A;  3S7J A;  4J8F A;  3ZN3 A;  4CYM D;  3FU5 A;  4ZHB A;  5CER B;  3FTW A;  4R7L A;  4G8K A;  1TNZ A;  3I5P A;  3Q7F A;  4ACK A;  1SQM A;  1H2V C;  3SF4 A;  4GTV A;  4ILG A;  2AXU A;  1KT0 A;  2J4D A;  5FTP A;  1HS6 A;  4PS3 A;  2HM8 A;  3LVR E;  1D8E A;  5FQ8 A;  4C48 B;  2BED A;  1NZN A;  1JWF A;  2YHE A;  4KVO A;  4HRL A;  2XS1 A;  2A5E A;  3HYM B;  4CGV A;  3K9I A;  3X2Q E;  3CVU A;  2OCC E;  4IRU A;  3AJI A;  4DJA A;  5EKQ D;  5EX3 A;  2L0I A;  2AJA A;  3FH7 A;  1HO8 A;  4I1M A;  2RFA A;  4HB5 A;  3NB2 A;  4M3O A;  3AAA C;  2LNI A;  2UY1 B;  1EYH A;  1UN9 A;  4I17 A;  5D0O D;  5ENN A;  3AU4 A;  3D9P A;  3IHY A;  2ZXW E;  1U3C A;  3MEK A;  3D9O A;  2WXO A;  2DYR E;  3ZRH A;  4LER A;  3E30 A;  3PE4 A;  4BES A;  2WXG A;  3TWQ A;  4JZY A;  4QQI A;  3CVQ A;  3CVN A;  3RKV A;  3ZKJ A;  3TWV A;  2EIL E;  3P1U A;  2ETC A;  2VGX A;  3VTX A;  4K5B A;  5AIJ A;  2XGO A;  1IHB A;  4EHM A;  2VQ2 A;  3PUJ A;  1Z5S C;  3Q73 A;  4DI3 A;  4B94 A;  2DBA A;  3DSU A;  3ZIM A;  3QK0 A;  4OVV A;  3CEQ A;  3FUD A;  1U3D A;  1PAQ A;  2LAH A;  3L9T A;  3V2O A;  2C2L A;  2QZA A;  1DNP A;  3JUI A;  5LP0 A;  5AEN A;  1MX6 A;  2J8S D;  5ITZ F;  5D0Q D;  3NF1 A;  3AS4 A;  2H6I A;  4JHR A;  3CK9 A;  2IEJ A;  4YDE A;  4G8L A;  4O1P A;  1WAO 1;  1E7V A;  5FQ4 A;  3ZYQ A;  4U07 A;  4G25 A;  3L17 A;  3JCK C;  3QC1 A;  4LEU A;  4EZK A;  4JEH A;  3RJV A;  4MLP A;  5JMN D;  2F37 A;  4CEM A;  4DX6 D;  4N3C A;  5CCL A;  4JB8 P;  2WXK A;  4PH4 B;  3CHQ A;  2V0P A;  1K1B A;  1VDY A;  4GCO A;  3FUM A;  4W9R A;  3TG5 A;  4KMO A;  1YYH A;  2FUL A;  3D9N A;  1X5B A;  2L9B A;  4GYW A;  5CEA A;  5ANL A;  3Q79 A;  4HOR A;  2OEV A;  4P29 A;  3C72 A;  3MA5 A;  4BSX A;  4A55 A;  2B6C A;  1E8W A;  5A6C A;  1BI7 B;  2PM6 A;  4U95 D;  1MJ0 A;  2CHX A;  4TXQ A;  4Y6W A;  3OXG A;  4UI9 J;  3UX4 A;  3FUI A;  2P9S G;  3V79 K;  1JWG A;  2C0L A;  1B89 A;  2GGF A;  1U2V G;  3W9F A;  2OND A;  2WXL A;  4KXK B;  3FWV A;  3HXD A;  2VYI A;  3ABK E;  4J8S A;  4GAA A;  1OWP A;  4GTT A;  3SFY A;  3DSS A;  5EDS A;  1RW2 A;  3G2T A;  4GZC A;  5CED B;  1N95 A;  4LCT A;  3UIN C;  3FUE A;  3UKR G;  3QB2 A;  4HLL A;  1Z3X A;  2L6B A;  5B1B E;  3CKB A;  2PZI A;  3NAW A;  3B95 A;  4G26 A;  2V4H C;  3DST A;  2ETA A;  4I43 A;  1AP7 A;  4L23 A;  1SA4 A;  2WXM A;  1UN8 A;  3HRA A;  3TXM A;  4A3V A;  3ZU7 B;  3QWW A;  3APF A;  4AY6 A;  4A1G A;  1TN8 A;  5KJL A;  2ILR A;  5BUZ A;  1N9A A;  3SBT B;  4ATZ D;  2LSV A;  2E0I A;  4MS6 A;  3ZYL A;  3ML8 A;  3SY2 A;  2WPV A;  4XKB A;  1OCR E;  2IU1 A;  3MYV A;  2DZN A;  5HI7 A;  3ZUV B;  3LDZ A;  3FTX A;  3JQ1 A;  3R9M A;  1FVF A;  3B7B A;  1TN7 A;  1HG2 A;  1N52 A;  4UWH A;  3E32 A;  3BG0 B;  3TAX A;  3TWR A;  3ZVV A;  2FF4 A;  5AJL A;  1PY1 A;  1KZP A;  2XS8 A;  3CV0 A;  2V8S E;  5A7D B;  3PNT B;  2VJ8 A;  4A3T A;  4RQI A;  1E8X A;  1ELR A;  2V5F A;  3C3O A;  3ZHE A;  2LXL A;  3CQG B;  1XGW A;  2DVW A;  2FBN A;  4U8Y D;  4PS8 A;  2XCC A;  4K03 A;  3D9M A;  3HHM A;  2M63 A;  4FA6 A;  4WWP A;  1LD7 A;  2WB2 A;  4BX9 A;  2Q7F A;  3PRE A;  4HOS A;  3ZYK A;  1O5M A;  2DYS E;  2GRL A;  1TEZ A;  2X6J A;  2I2O A;  2Y4T A;  3DSX A;  3DEO A;  3BUA A;  4AVX A;  3PEV B;  4HS2 A;  4WAF A;  5T3R A;  1KT1 A;  3FU0 A;  3J5P A;  4FAD A;  4CT0 A;  4FP7 A;  4JL0 A;  3DSW A;  3C98 A;  3LS8 A;  4G2V A;  1OUV A;  3S7B A;  4F1S A;  4FC8 A;  3SO8 A;  4OAV B;  1H6O A;  4OVU A;  4WUY A;  2KC7 A;  3QDN A;  3GW4 A;  1O1R A;  3LPZ A;  3P2B A;  4RVB A;  5LCW C;  4IYP A;  2LUH A;  4FHK A;  4KZC A;  2F8Y A;  4I2W A;  2XPZ A;  3L22 A;  2GRR B;  5LX8 A;  3FTU A;  2Y1L E;  4E85 A;  3ABM E;  1IQR A;  1NA0 A;  1E96 B;  3DBS A;  2IFU A;  3LXU X;  3B13 A;  2P9I G;  2P58 C;  2XZT G;  4HXI A;  3PEU B;  2PM7 A;  3R7Q A;  4DLO A;  1WG0 A;  2AXZ A;  1H6P A;  1TNB A;  1MHQ A;  3ZXP A;  4GPM A;  1YCS B;  4XZ4 A;  4KT6 B;  4ILH B;  3NQP A;  5J08 A;  2AWI A;  3B7S A;  2XEH A;  2I1J A;  4A1S A;  4I9E A;  3ZEF A;  1K8K G;  3D9K A;  3TGO A;  4Q69 A;  1OT8 A;  3U66 A;  3AS5 A;  3ZNG A;  1N0R A;  2R17 C;  4J7W A;  3SQV A;  3PE3 A;  3T5V A;  3PUK A;  3NOG D;  4KZ0 A;  4U7E B;  4DX7 D;  1ZBP A;  3I4G A;  5BW8 C;  4HOT A;  3JUE A;  3L6A A;  3T8M A;  2WXR A;  4I6E A;  4UQZ A;  2CHW A;  3UMV A;  5LFA A;  2OEW A;  5B3S E;  3UM0 A;  4XE0 A;  2Y0B G;  3PZ4 A;  2A4Z A;  3C3R A;  1WM5 A;  3AS8 A;  2H6G A;  4FLH A;  4AY5 A;  2HYZ A;  2QC9 A;  5HRY A;  4GB9 A;  4HBD A;  1EF1 C;  5EID A;  4ANU A;  2P9L G;  4UI9 C;  3ZW3 A;  2LSU A;  2KCV A;  1INZ A;  5CHE E;  1MQS A;  4URK A;  1NA3 A;  5EYL A;  4I6G A;  4Z68 A;  2PNN A;  1ELW A;  1TNY A;  2XCB A;  5HS0 A;  3B7R L;  2X6K A;  4U96 D;  4BT9 A;  2WXF A;  4KBQ A;  4JVS A;  5CMW A;  3KSQ A;  2GW1 A;  3QWP A;  3FEY A;  2WXH A;  3PZ2 A;  3O48 A;  4JD2 G;  1BPO A;  4LNB A;  1HFA A;  4FLB A;  4K5C A;  4EBA A;  4M7C A;  4I2Z A;  4G24 A;  3B7T A;  2R03 A;  3CST A;  2MOW A;  3FFL A;  2KCK A;  2VSX E;  1HH8 A;  5ENP D;  3FHE A;  3HXE A;  4WNF A;  5FT9 A;  2JAB A;  1JCQ A;  4WND A;  4KYO B;  2HO1 A;  3CLJ A;  2A5U A;  4ACL A;  4EQF A;  3TJP A;  2UY1 A;  2MHK A;  4HFG A;  4DRX E;  4JA7 A;  3V2X A;  5C2Y A;  2VSY A;  1NL4 A;  3V30 A;  3LVQ E;  3HXB A;  4HOU A;  1OWL A;  1D9S A;  1KZO A;  3IEG A;  5FZR A;  5LCW J;  5A23 A;  2I9C A;  1JPL A;  1SVX A;  4L1B A;  3ISM C;  3QAQ A;  4I6J A;  2V4L A;  2IO2 C;  4NAC A;  2IY0 C;  1QQE A;  3LY7 A;  3VTY A;  1E90 A;  4HI8 A;  4RG6 A;  2DWZ A;  4GTQ A;  3C5R A;  5E75 A;  3S2A A;  3ULQ A;  2IQC A;  5KBA A;  1L5J A;  3ONL A;  5FIN A;  3UIO C;  4F53 A;  4L2Y A;  4EEC A;  5EIB E;  3L16 A;  3EUV A;  1OY3 D;  4H7Y A;  5KJN A;  4C9B B;  2QYU A;  4U04 A;  4J6I A;  4UQX A;  3PVL A;  4FJY A;  5FZS A;  1FPP A;  1Z3Y A;  3D9J A;  5ANR A;  4Q96 A;  3FEX A;  4BSZ B;  1SW6 A;  3LKU A;  4EPZ A;  1N4Q A;  2GRQ B;  1K3Z D;  4ABN A;  4CGW A;  3FY4 A;  3WG7 E;  1A17 A;  4B8C B;  4AM9 A;  1IYG A;  3L54 A;  2KXP C;  2WMO A;  4RSY A;  1TJC A;  3CHS A;  4JW1 A;  4X8Q A;  1TNO A;  4GA0 A;  4B89 A;  2XRZ A;  3OTN A;  2EIN E;  2X38 A;  1WY6 A;  4N2Q A;  1KPS B;  3E33 A;  4B8A A;  5DIZ A;  2BTD A;  5BXU A;  1TYQ G;  1OCZ E;  1OWO A;  1LTX A;  3QWV A;  3DXK G;  1HG5 A;  4C0E A;  4UWL A;  3ASN E;  4EZJ A;  1OCO E;  4HI9 A;  4FUL A;  3Q47 B;  3CVX A;  1O1S A;  2CFZ A;  4U0S A;  4UUC A;  3FTS A;  3MKQ B;  2FEZ A;  2P9U G;  3APD A;  4WWN A;  1UJJ A;  2IOL A;  4K5A B;  4BTA A;  4U8V D;  2VTB B;  5G55 A;  2X6F A;  5AQ7 A;  2HR2 A;  1N4P A;  3Q49 B;  4LG6 A;  4GA1 A;  5DBK A;  3R7R A;  5AAO A;  2VTB A;  3PS6 A;  3UKU G;  3JXI A;  1UW4 B;  2GRN B;  3EHQ A;  2QYJ A;  4MBG A;  3ZXS A;  1FVH A;  2ZGD A;  4PUC A;  3MGB A;  1ZB1 A;  2IOS A;  2J9Q A;  1S70 B;  1OWM A;  5C1D A;  4ANX A;  3FH8 A;  2J08 A;  3LYA A;  4D10 C;  3O4Z A;  1K1A A;  4G23 A;  2WVI A;  2XPY A;  4N5Q A;  4U0U A;  5E76 A;  2XEV A;  4I1O B;  3RU0 A;  1HE8 A;  1Y6I A;  3CSF A;  4GPK A;  2UWJ G;  2PQN A;  5ENO D;  1H19 A;  1BU9 A;  1N11 A;  3IXE A;  3ASH A;  2YHC A;  3UT8 A;  3CVV A;  3MX3 A;  3CHR A;  2J07 A;  5G04 C;  3CVY A;  2ZIR A;  3FU6 A;  4AP2 A;  2GRO B;  1QBQ A;  4L7T A;  2AVP A;  3HVE B;  1FT1 A;  3EIQ C;  4CCA A;  4JA9 A;  4CT4 A;  3Q75 A;  4PDX A;  4NUR A;  2OOE A;  2ZIS A;  1FCH A;  2GRM A;  1DCQ A;  3G2U A;  3FH5 A;  5ENS D;  5BNW A;  3SI5 A;  3IHV A;  4GZ5 A;  2XGS A;  1GW6 A;  1TN6 A;  4AOF A;  3I3N A;  3N71 A;  4F1P A;  4DPR A;  5T4Y A;  4B93 B;  5CMY A;  1SA5 A;  2WXN A;  4CDM A;  4I9C A;  5T8I A;  3FUF A;  2WXQ A;  3AG3 E;  3CK8 A;  4BEP A;  3DXM G;  4YDO A;  1MZC A;  4JC8 A;  1Q2Z A;  4BET A;  2KZT B;  4UWG A;  4N39 A;  5FQ7 A;  3ULY A;  2XHE A;  1Y8M A;  4NRH B;  5LOZ A;  3G2W A;  5BXO A;  1DVP A;  5BT1 A;  5CBN A;  2KZT A;  4DX1 A;  4GTS A;  1IQU A;  2WQ7 A;  5AQB A;  4CRW A;  2I6H A;  2YQ8 A;  2CHZ A;  3RRU A;  2WMN A;  3LJ3 A;  3ULE G;  3CK7 A;  2CFU A;  3TL5 A;  4BER A;  2V5Q C;  2PL2 A;  1TNU A;  2WXI A;  4AV7 A;  1P5Q A;  4QFV A;  4U63 A;  3ASG A;  4L9P A;  4TUU A;  4TXP A;  3IV0 A;  3UQ3 A;  3RSE G;  1HF8 A;  2F8X K;  4AJW A;  5KJK A;  1IXV A;  2PQR A;  1YA0 A;  1UOH A;  3EU9 A;  5AQ9 A;  5FJY A;  4MRU A;  2J49 A;  1E7U A;  3CHO A;  3FUK A;  5JJT A;  4OAU C;  4ILI A;  5KJM A;  5D2M C;  4FJZ A;  3PH0 C;  4EBA G;  3FP3 A;  5G2N A;  3E34 A;  4FU3 A;  3NBN B;  3SFZ A;  3HIZ A;  1BLX B;  2QFC A;  3D3M A;  3C3Q A;  3Q9N C;  4WNE A;  4F3V A;  4U8H A;  2L0T B;  4ATG A;  5EYP F;  3RIB A;  3SZ7 A;  4YND A;  2OVB A;  5KNG A;  5KNH D;  2R02 A;  4Q94 A;  4XI0 A;  3AU5 A;  1PC2 A;  3CIA A;  1TR4 A;  4LSZ E;  4PS7 A;  4RLY A;  3HXC A;  4AIF A;  3G2S A;  3S7D A;  4ANW A;  2ETB A;  2BUG A;  2AW6 A;  2WXP A;  4XIF A;  3FDH A;  3ASO E;  5G05 J;  3TG4 A;  2XQ0 A;  2DZO A;  5G04 J;  3KS2 A;  3D9L A;  4GTO A;  3L82 A;  1QNF A;  1JUQ A;  1X81 A;  2MYO A;  3DEP A;  3UTM A;  3OXL A;  4GA2 A;  3GZS A;  1N54 A;  3KEZ A;  4E6H A;  5JA4 D;  3MZL B;  3UM3 A;  4I1A A;  1EPU A;  2I1K A;  4LRZ A;  2NSZ A;  1HU3 A;  1A5E A;  4IUL A;  2F0Y A;  4G1T A;  4HRM B;  1UJK A;  4WNG A;  5EX0 A;  3CR3 A;  5EN5 D;  2NXP A;  4GU5 A;  4J0U A;  4BWR A;  4HQD A;  3LCA A;  2VSO E;  3JQ0 A; 
#chains in the Genus database with same CATH homology
 4YDO A;  1MZC A;  2BED A;  1JCR A;  2IEJ A;  2H6F A;  4YDE A;  1DCE A;  4GTT A;  3SFY A;  3DSS A;  1KZP A;  4LNG A;  1S64 A;  3KSL A;  1TNO A;  1FT2 A;  1N95 A;  1TNY A;  3E33 A;  1N4S A;  4GTS A;  1TNB A;  4GTQ A;  1LTX A;  3KSQ A;  3DSV A;  3PZ1 A;  1D8D A;  3Q78 A;  3PZ2 A;  3DST A;  2R2L A;  3Q7A A;  4LNB A;  3HXC A;  1O1S A;  1SA4 A;  3DRA A;  3EUV A;  1TNU A;  1LD7 A;  3EU5 A;  2ZIR A;  3E30 A;  3SFX A;  1O5M A;  3DPY A;  1QBQ A;  3E37 A;  1FT1 A;  4L9P A;  3Q79 A;  3DSX A;  4GTO A;  3Q75 A;  3PZ3 A;  1N4R A;  3HXE A;  1TN8 A;  1X81 A;  1N4P A;  1JCQ A;  2ZIS A;  1N9A A;  1FPP A;  3C72 A;  4EHM A;  4GTM A;  1O1T A;  3DSW A;  3Q73 A;  2F0Y A;  1N4Q A;  3DSU A;  1N94 A;  1TNZ A;  3Q7F A;  4GTP A;  1NI1 A;  1S63 A;  1O1R A;  1TN6 A;  1NL4 A;  3PZ4 A;  4MBG A;  1LD8 A;  3HXB A;  4GTV A;  2H6G A;  1SA5 A;  1TN7 A;  1KZO A;  3E32 A;  1JCS A;  2H6H A;  3HXF A;  4GTR A;  3E34 A;  3HXD A;  1D8E A;  2H6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...