2DZOA

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
228
Chain Sequence
MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
total genus 61
structure length 228
sequence length 228
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2dzoA00
5CBOA 5EIDA 3ZUVB 1K1BA 1N11A 1IHBA 4HI8A 3HG0D 4DX5D 2V5QC 3V31A 3SO8A 4DX7D 2KXPC 5HRYA 3TWVA 5JA4D 4HB5A 2F8YA 2JABA 4K5AB 1BI8B 4DX6D 1BU9A 5EYPF 4RLYA 1TR4A 4F6RD 2ETCA 3TWRA 4U96D 4OAVB 1BI7B 2ZGDA 3JXIA 2HE0A 3V2OA 3TWUA 5AN8A 3IXEA 3JXJA 4GMRA 4BETA 1G3NB 3UI2A 1MJ0A 1AP7A 4OAUC 1IKND 5ENOD 4U8VD 3DEOA 4HI9A 3ZKJA 1K3ZD 3HRAA 4O60A 2PNNA 5ENTD 3W9FA 1A5EA 5FINA 3J5QB 1AWCB 3TWSA 4BERA 4UUCA 5BXUA 2QYJA 1SVXA 2XZTG 2XEHA 3JUEA 2J8SD 3TWXA 3UXGA 5EYLA 2ZGGA 3EHRA 5KNHD 4HQDA 1WG0A 5ENPD 4QQIA 4K5BA 3D9HA 1MX6A 1NFIE 3T9KA 5AQ7A 5HS0A 2DZOA 3V79K 2XEEA 4TUMA 4DUIA 4LG6A 2Y0BG 1S70B 4B93B 4G8KA 4O1OA 3V30A 1WDYA 2Y1LE 4ATZD 3DEPA 4HBDA 2MYOA 1UOHA 2BKKB 5AQAA 1D9SA 5AQ9A 4HRLA 2DWZA 3KEAA 5ITZF 4DRXE 2F37A 5AQBA 4Z68A 2BKGA 1OY3D 5FIOA 5AARA 4F1PA 1MX2A 4K5CA 3EU9A 2XENA 4DX1A 5CERB 1MX4A 5CEAA 1DCQA 4GPMA 3T8KA 3NOCD 2RFMA 1MYOA 5EIBE 4C48B 3B95A 4DX2A 4U95D 4HRNA 2AJAA 2ETBA 3AJIA 3F6QA 4J7WA 4LNUD 4U8YD 3B7BA 3C5RA 4YDYA 4NIKA 3ZU7B 3TWQA 1DC2A 5JMND 4O1PA 1K1AA 1YMPA 4HNAD 4ZFHA 1N0QA 3LJNA 2DVWA 5D66A 4CZ2D 1BLXB 4QFVA 5EN5D 4BEPA 4JB8P 5ENRD 5BXOA 4YDWA 1QYMA 3J5PA 2RFAA 4ZHBA 2NYJA 3NBNB 3AAAC 2QC9A 4A63B 2XZDG 4G8LA 3TWTA 4CYMD 1BD8A 1YYHA 4J8YA 3V2XA 2A5EA 1OT8A 1IXVA 3ZNGA 3TWWA 4BESA 5KBAA 2F8XK 2V4HC 3Q9NC 5CEDB 4N5QA 2KBXA 5EILA 5HKPA 5CECB 5ENQD 5KWDA 3Q9UC 5AAOA 4HLLA 2VGEA 2ETAA 3W9GA 1YCSB 2P2CP 5KNGA 3EHQA 2DZNA 2L6BA 1SW6A 4BSZB 2B0OE 5ENSD 1N0RA 3UTMA 4HRMB 5CBNA 3NOGD 4LSZE 2FO1E
chains in the Genus database with same CATH superfamily
4F3VA 3CHMA 4DX7D 3FEYA 1HS6A 1H2UA 1KZOA 3ZVVA 2RG8A 3V2OA 3U4TA 4MS6A 3HIZA 2YINA 1G3NB 2L9BA 2M63A 4U8VD 3KSQA 5ENTD 2IY0C 3J5QB 3C3QA 4GYYA 1NA3A 3CQCB 3CVNA 1H19A 1DVPA 2ZGGA 3HXDA 4FP7A 5AQ7A 2R02A 2XEEA 1S70B 4G8KA 3NAWA 3R9MA 4DRXE 3DPYA 5M72A 4CRWA 4GTVA 3MV3B 1MYOA 4JA9A 2C0MA 2VGXB 4GTQA 3TXNA 1YA0A 4APOA 4B8AA 3BG0B 2IONA 1YMPA 4JD2G 5BV1A 3LKUA 4U7EB 4YDWA 4G26A 1TNZA 4J8YA 3ZYMA 4WWPA 4RG9A 2VTBB 3DSTA 1V55E 2V4HC 5FJYA 1L5JA 2XQ0A 2VSNA 1N4PA 3ISMC 2Q7FA 3Q9UC 4GAAA 4C0EA 1YCSB 3E34A 1HXIA 2XEVA 2LSUA 4CDNA 3B13A 5JJTA 4I9CA 3GZSA 2V8SE 5AJDA 2JABA 4XEIG 4I2ZA 5CRUA 3TWRA 1BI7B 2L0TB 2FULA 3R7QA 4PS8A 1E8XA 3KD7A 4KVMA 2WXLA 1SZAA 2A4ZA 3I3NA 3SBTB 2OCCE 4NRHB 3UIPC 1U3DA 3LEWA 2I1KA 5D0OD 4GB9A 3RRNB 4JHJA 2J4BA 2MYOA 4XI9A 1OWPA 2BKGA 3MZLB 3QKYA 4G24A 4XIFA 4DLOA 5HQ8A 2YHCA 2IEJA 3NQPA 2P9UG 2AJAA 2KCVA 3WG7E 4LNUD 3GZ2A 4YDYA 4Q94A 1DC2A 5JMND 4FJZA 4O1PA 1K1AA 2J08A 4A1SA 1IQUA 1BLXB 1HX8A 5BXOA 3VLEA 3MEKA 4CYMD 3FUFA 3CSFA 1E8ZA 2R2LA 5EILA 2GGFA 2VGEA 2ETAA 2L6BA 4B0ZA 3Q78A 2C0LA 3ESLA 5J90A 4GTTA 3TWVA 3DSWA 2F8YA 3Q47B 4KXKB 5EDSA 1E96B 2B6CA 4U96D 5G04C 5AYWD 5G05C 2J07A 5AN8A 3C3RA 3PZ4A 2XPYA 1N54A 5C1DA 4OAUC 5ENOD 3KEZA 3QC1A 4ANUA 3SFXA 5BXUA 2H6IA 2HYZA 3VTYA 4C9BB 2P9PG 1TYQG 3EHRA 1S63A 2Y69E 4DUIA 3FH7A 3QB2A 3OTNA 5AENA 2KATA 1FVFA 2X38A 1OCCE 4EECA 3FH8A 4BSXA 2RFMA 1JCQA 3QOUA 2EINE 3ABLE 3TJPA 5BT1A 4CGVA 4NIKA 4Y6CA 3UMVA 4PH4B 1WY6A 3N71A 4XKCA 3IV0A 2JLBA 4JEHA 4BY6A 3DSSA 2CHZA 1QYMA 3J5PA 2WPVA 4G8LA 2WVIA 4JA7A 3Q15A 1MZCA 3HVEB 3CVQA 2KBXA 2P9KG 3FP3A 1KZPA 5JJ6A 2IF4A 3CKBA 2LXMA 3ASNE 1N11A 4HI8A 3HG0D 1ELWA 2OVBA 2X6KA 3Q5MA 3ULYA 2ZXWE 3D9JA 4P29A 3JXIA 5LP0A 1O1RA 4DJAA 3S7FA 2BEDA 1X81A 2H6GA 3CHQA 3U64A 4EZJA 3LDZA 1RW2A 2X6IA 1LF8A 3VTXA 4ATGA 5CCMA 3TG4A 4WNDA 1D9SA 2QYUA 4FLHA 2H6FA 2H6HA 3ML9A 3AG3E 1DCQA 3T8MA 2PM6A 3APFA 3RIBA 4OYSA 2VTBA 5ARGA 2XGOA 3APDA 3FDHA 4HLEA 1IYGA 1YYHA 4CT0A 2VSXE 1H6PA 1LD8A 4EBAG 3U9WA 1TJCA 2I9CA 3SGHA 5A6CA 2UY1A 4E6HA 4DI4A 2J4DA 2P2CP 3ZYKA 2I2OA 3CGHA 4MBGA 4N3AA 3EU5A 4U0UA 3LS8A 4APFA 4FADA 4AJWA 3O48A 1TNYA 1OUVA 5CBOA 3L82A 5FQ6A 4N5CA 3RRMB 4HB5A 4AXHA 1NI1A 4K5AB 3APCA 5DIZA 4ABNA 3URZA 4F6RD 1OWLA 4BTAA 2HR2A 5G04J 2CHXA 4GZ3A 4A55A 3L16A 1IKND 4HOSA 3RO2A 5JHAA 4DPRA 4YNDA 3FUHA 2LUHA 3E37A 2DBAA 1IQRA 3ABME 1WG0A 4QQIA 4K5BA 3V79K 2QZAA 1NP7A 4PDXA 3MGBA 3ASOE 3RRUA 3DRAA 5AQ9A 1ZB1A 5KJNA 3KEAA 3UM1A 5ITZF 3CVXA 4Z68A 1OY3D 5AARA 4L1BA 4JXTA 1JWGA 1H2TC 4PS3A 4EHMA 5EIBE 2P9NG 2OEVA 4NURA 3ASFA 1FVHA 2X6FA 4N39A 2WQHA 2X6JA 2Y4TA 3EIQC 3IEGA 1EF1C 3ASGA 3FTVA 3L22A 1JWFA 4JB8P 4Q96A 4CT4A 5G55A 3AG1E 5BPPA 1TNOA 3QWPA 1N9AA 3Q7AA 3V2XA 1OT8A 1UW4B 1N4SA 3TL5A 4U0ZA 5HKPA 4TXQA 3FUDA 3SFYA 4L2YA 1Z3YA 1TNBA 3EUVA 3UQ3A 1IHBA 3V31A 3PH0C 5JA4D 1H0AA 1BU9A 4GA1A 2L6JA 2VSOE 3UPVA 3R7RA 3PE3A 3E33A 3Q49B 2EIJE 3FU0A 1QNFA 2MHKA 4EZLA 3SHFA 2PQNA 2VGXA 3CVYA 5FZSA 4BERA 4UUCA 2QY7A 4KVOA 3ESKA 5EYLA 2BF0X 3DPDA 3HXCA 1NFIE 3Q75A 4PUCA 3V30A 4E85A 2CHWA 3CK8A 3FWVA 3MKRA 4JEUA 4LERA 2R59A 4DX1A 3CVUA 1E90A 3HXBA 3Q4AB 2ZISA 3FUIA 3IHVA 1A17A 4G11A 3UM0A 3JUIA 4AY5A 4ZFHA 1UN9A 4ANXA 1N95A 2DVWA 1FT2A 5BV0A 3FUMA 3RO3A 3RK6A 2V4LA 4BESA 2AWIA 2ZU6B 4N5QA 4HLLA 1H2VC 2JEKA 2IO3C 2GW1A 3CHSA 3OXLA 2GRRB 4YVOA 5CBNA 2FO1E 3B7RL 4GZCA 3FH5A 4DX5D 2V5QC 3OXFA 1O1TA 1OWMA 4LNBA 3ZXSA 3AS8A 4J0UA 4LRZA 4UWHA 3UKRG 1KLXA 2WXRA 3FEXA 5A7DB 3JXJA 4N3BA 4HS2A 4G25A 2GROB 4GZ6A 2FEZA 2QYJA 5KJMA 2XEHA 2P9SG 3PUJA 3PZ3A 4F1SA 4GU5A 2V5FA 1QBQA 1TN7A 5ENPD 4WNGA 4UQYA 4O1OA 4HBDA 5AQAA 4UQXA 4B94A 4CDRA 5IY5E 3L9TA 1MX4A 3GZ1A 4C48B 2LNIA 4F7AA 3GW4A 2A5UA 1INZA 1OCZE 3TWQA 1TEZA 3LXUX 4YDOA 2IOLA 1NA0A 5E75A 3SZ7A 1MQSA 3PUKA 1TN6A 4UWLA 2A5EA 3ULQA 4G23A 5BNWA 3MKQA 3DXMG 2BTDA 3D9KA 4LNGA 5D2MC 1HH8A 2WXFA 3QJZA 2XRYA 3L13A 4KZCA 4ILIA 4XI0A 2WXIA 2NSZA 4U0SA 3FFLA 5EKQD 2KXPC 5LCWJ 4FU3A 4ILGA 3QK0A 3FTUA 5EYPF 3QARA 3UT8A 2E0IA 4WWNA 3R9AB 2ZGDA 5BUZA 4R7LA 3IXEA 4GMRA 4BETA 2OVFA 3SNXA 4M7CA 3PE4A 3DEOA 2XCBA 3W9FA 3TWSA 2WXNA 2I1JA 5B1AE 1SVXA 2KZTA 1TNUA 3JQ0A 4GTSA 2R03A 3EDTB 3UINC 4I17A 2IJGX 3AU5A 4B93B 3S7JA 2GRMA 5FWQA 4F1PA 5EX0A 2J09A 4GPMA 4U8HA 4U95D 3FUEA 1NL4A 2ETBA 3AJIA 1E7UA 4JZYA 3C5RA 5LOZA 4ACLA 4CEMA 3UM3A 2RKKA 1HO8A 4IRUA 3Q79A 3KAEA 4URKA 4BEPA 3CKCA 2VJ8A 1FCHA 4L2LA 3AAAC 1E8YA 3CK9A 3UUXA 3T5VA 4HOUA 3AG4E 3DBSA 1LTXA 1HE8A 2P9LG 4JHKA 2BUGA 2VYIA 3P2BA 3TG5A 2HO1A 3D9LA 5ENQD 2AXUA 5AAOA 5LCWC 4J8SA 3PEUB 2IFUA 4J8EA 4AV7A 2GRPB 2XPIA 2EIKE 1K1BA 1KPSB 4A1GA 1Y6IA 3CR3A 2ETCA 2HE0A 3CQGB 2EIME 1B89A 1UJJA 2R5SA 1AP7A 1V54E 4JHRA 4HQDA 5HS0A 3ENEA 2YHEA 3L6AA 4I6EA 2E2EA 1JCSA 4DK5A 3PS6A 2DWZA 3RAUA 3FUNA 3DXKG 2F37A 3CHPA 2WXPA 3UT4A 5AJLA 3ZYLA 3NOCD 2GRNB 2OV8A 3FUKA 3IKOB 2CG2A 4L7TA 3EIJA 3VLFA 4CZ2D 5C2YA 3LPZA 2NXPA 1XGWA 3ONKA 4KYOB 2DIWA 5KWDA 3MV2B 1O5MA 2WXKA 5J08A 5KNGA 2LXLA 2B0OE 2CG3A 2PM7A 3I5PA 4GTMA 3FTWA 4LSZE 2FI7A 5KJKA 1JCRA 4M3OA 4AIFA 3DSUA 5FTPA 2GRLA 3VLDA 2X3MA 4GCOA 4G2VA 4RLYA 5KJLA 4BT9A 3ZFWA 4HI9A 4YVQC 1K3ZD 3DSXA 1A5EA 2VGYA 3ZRHA 3AU4A 3X2QE 4ANWA 3T5XA 3JUEA 3LY9A 4XKBA 4BT8A 1MX6A 2C2LA 4N2SA 1TJFA 4HRLA 4HORA 5FIOA 5CERB 3UX4A 4I9EA 5H7PA 3NZUA 1S0PA 4DI3A 2WMOA 1HG2A 4OVVA 4XZ4A 3ZU7B 1K8KG 1JPLA 4UI9K 5B1BE 3MCXA 2WXQA 3HXEA 3L17A 1Z5SC 2IU1A 3QDNA 3E4BA 5ENRD 3HYMB 4GTRA 1N4QA 3LVQE 1UN8A 1WAO1 2IO2C 4XX5A 4AOFA 5CECB 5ANRA 5A23A 4KT6B 2Y3AA 4WNEA 1D8EA 4GTOA 1PC2A 1UJKA 1QQEA 4Y6WA 4GTPA 4DX6D 4GA0A 3FTZA 3BUAA 4NACA 4GA2A 2KZTB 3TWUA 4MRUA 3C72A 1KT1A 1MJ0A 1ELRA 3O4ZA 1N52A 3FU6A 3UT7A 3ULEG 2XZTG 2J8SD 3PREA 2J49A 2QFCA 5G05J 4HOTA 2MRIA 3T9KA 5BW8C 2Y1LE 4I1AA 1Z3XA 4W9RA 5HI7A 4HXIA 4UWFA 4N2QA 4K5CA 5JHBA 1DCEA 3HHMA 4CCAA 4HRNA 4U8YD 4NQ0A 3UM2A 1HF8A 1OXJA 1U2VG 3BG1B 3EHMA 3S2AA 1ELKA 5EN5D 3RSEG 3Q7FA 3PZ2A 5AIJA 3NB2A 3G2TA 4O6FA 2XZDG 3DSVA 4BWRA 4OVUA 2CFZA 3GYZA 5KBAA 1EPUA 3Q9NC 4KZ0A 5ENNA 4UWKA 3W9GA 1FPPA 4LUNU 4UQZA 3NBNB 1QZ2A 4IULA 2XCCA 4FA6A 2F0YA 4MKTA 4B89A 3ASHA 2FO7A 5HRYA 2WXJA 2LAIA 1WM5A 2Y4UA 1GW6A 3CIAA 3ZGQA 3LY8A 1TR4A 3D3MA 4UI9J 1W3BA 2YQ8A 2ILRA 3D9NA 3Q73A 4KBQA 3U3WA 4K03A 4B8CB 4O60A 5LFAA 1HFAA 1MHQA 2GRQB 4FULA 3ZPJA 3UXGA 3SQVA 1DNPA 3QAQA 3SD5A 3ONLA 2XRZA 3CVPA 1UOHA 2BKKB 3ABKE 4U63A 4JW1A 5AQBA 3C98A 3ASDA 2FBNA 4J8FA 4I1OB 3CV0A 3MA5A 4FJYA 1LD7A 2WB2A 2AXVA 4HVBA 2NC9A 4N3CA 2R17C 4HNAD 4GYOA 1N0QA 3LJNA 3JYSA 3E32A 1O1SA 4I6GA 4ME2A 4L23A 3HXFA 4JPSA 4JL0A 4FC8A 4DLQA 4AP2A 1U3CA 3CVWA 2XS8A 4PS7A 1SW6A 4EPZA 5ENSD 2XS1A 1D8DA 2LAHA 4L9PA 3KS2A 3LVRE 3CHOA 2ONDA 1P5QA 3NZSA 2KCKA 4OAVB 1EYHA 4TXPA 3PVLA 3ZYQA 4EBAA 1SQMA 1HU3A 1E7VA 4KMOA 1PY1A 4V3IA 1Y8MA 5E76A 3QNKA 3FTXA 3MX3A 2WQ6A 2FF4A 4EQFA 4JVSA 3D9HA 3PEVB 2F8XK 1ZU2A 5T4YA 4Q69A 2LO6A 4F53A 3FULA 2X6HA 1MX2A 2XENA 3B7TA 5CEAA 5FQ7A 4WNFA 3B95A 2RD0A 5D0QD 1OWOA 2UWJG 3S7BA 3G2VA 4LCTA 3UKUG 1XNFA 3IBEA 5CHEE 3LYAA 1SZ9A 5FT9A 5KCMA 2RFAA 4BTBA 4GZ5A 4G1TA 3TWTA 1BD8A 3CHRA 3RJVA 4BFRA 3LJ3A 1UG3A 3UIOC 2L0IA 4FHKA 5B3SE 4H7XA 3SF4A 2P9IG 2XHEA 1N4RA 2V0PA 3L54A 3EHQA 5FZRA 3P1UA 4FHJA 4I6JA 1S64A 1E8WA 3OAWA 3C3OA 3MJWA 3BEEA 1RZ4A 3SO8A 4YDEA 4H7YA 1X5BA 4HOQA 4AY6A 3QWWA 5CRVA 4D10C 4I43A 4RVBA 3LY7A 2IQCA 3UI2A 3SY2A 3BQOA 5KNHD 1KT0A 5DBKA 1H6KA 4CGWA 3D9MA 2DZOA 4TUMA 2XPZA 4JC8A 4ACKA 4ATZD 2UY1B 1PAQA 5ARFA 2WMNA 3TAXA 1EDUA 2PL2A 3F6QA 2EILE 3B7BA 4UI9C 5T8IA 3SI5A 3TXMA 3EHNA 4RQIA 5CMWA 4WAFA 5D66A 1Q2ZA 2PZIA 2YNQA 1BPOA 4QFVA 1HG5A 3KSLA 4ZHBA 2NYJA 3CEQA 2QC9A 3ZNGA 3ZXPA 3U66A 4U04A 4HFGA 4J8DA 3DWLG 4TUUA 5G2NA 5EX3A 4AEZC 3CVLA 1N0RA 2WM9A 4EZKA 2DCPA 4GMLA 4I1MA 1HZ4A 2I6HA 3B7UX 3ZUVB 3WXXA 4GZDA 2XGSA 4A3VA 4AM9A 5ANLA 3ML8A 5CCLA 1BI8B 5FQ4A 4X8QA 3HDXA 1OCOE 3K9IA 5FZQA 4WUYA 3FY4A 3FU3A 4AVXA 3HVEA 4J6IA 4IYPA 4I2WA 3L08A 4C0MA 4RG6A 3HRAA 5FINA 1SA5A 1AWCB 5CMYA 3MYVA 2R05A 4XE0A 3AS5A 3CSTA 3PZDA 3RU0A 3CLJA 2ZIRA 4MLPA 2AW6A 2P58C 3ZHEB 4LG6A 4TXRA 2Y0BG 1WDYA 3DEPA 4GPKA 3TGOA 2XGMA 4CDMA 3EU9A 3ZW3A 2KM4A 3T8KA 3AS4A 5FQ8A 4J7WA 2KC7A 4GMJA 1VDYA 3ZHEA 4U07A 3FU5A 3S7DA 3I4RB 4ANVA 1IXVA 2EQXA 3NF1A 5CEDB 3D9PA 4GCNA 4BX8A 3CVVA 4WWOA 4A3TA 4BSZB 3D9IA 2OEWA 4HRMB 4BX9A 2WQ7A 3NOGD 4LEUA 4K0RA 5EIDA 2WXOA 3MKQB 4TRQA 1Z6TA 3FTYA 3EJNA 2AVPA 5T3RA 3IHYA 2J9QA 3BU8A 5LX8A 3ZKJA 4FLBA 2PNNA 1FT1A 3OXGA 3TWXA 4RSYA 2DYSE 2LSVA 4TV3A 3B7SA 1ZBPA 3FHEA 1TN8A 2MOWA 1JUQA 2KCLA 4UWGA 3FUJA 2WXGA 4IN3B 3PZ1A 3G2SA 2PQRA 1H6OA 4DX2A 2OOEA 3FTSA 3PNTB 3G2WA 3LCAA 3PRZA 2WXMA 3E30A 3G2UA 2VSYA 5JJ7A 3CK7A 3ZIMA 2HM8A 3AG2E 3QWVA 2WXHA 3JQ1A 4A63B 1NZNA 3D9OA 1N94A 4GYWA 1IHGA 3TWWA 1OWNA 3RKVA 3SFZA 3ZEFA 2CFUA 1SA4A 3JCKC 2IOSA 3ZN3A 3PNLB 2VQ2A 4ILHB 2DYRE 2DZNA 1OCRE 3PDNA 3UTMA 3SBSA 2AXZA 3I4GA
chains in the Genus database with same CATH topology
5CBOA 5EIDA 3ZUVB 1K1BA 1N11A 1IHBA 4HI8A 3HG0D 4DX5D 2V5QC 3V31A 3SO8A 4DX7D 2KXPC 5HRYA 3TWVA 5JA4D 4HB5A 2F8YA 2JABA 4K5AB 1BI8B 4DX6D 1BU9A 5EYPF 4RLYA 1TR4A 4F6RD 2ETCA 3TWRA 4U96D 4OAVB 1BI7B 2ZGDA 3JXIA 2HE0A 3V2OA 3TWUA 5AN8A 3IXEA 3JXJA 4GMRA 4BETA 1G3NB 3UI2A 1MJ0A 1AP7A 4OAUC 1IKND 5ENOD 4U8VD 3DEOA 4HI9A 3ZKJA 1K3ZD 3HRAA 4O60A 2PNNA 5ENTD 3W9FA 1A5EA 5FINA 3J5QB 1AWCB 3TWSA 4BERA 4UUCA 5BXUA 2QYJA 1SVXA 2XZTG 2XEHA 3JUEA 2J8SD 3TWXA 3UXGA 5EYLA 2ZGGA 3EHRA 5KNHD 4HQDA 1WG0A 5ENPD 4QQIA 4K5BA 3D9HA 1MX6A 1NFIE 3T9KA 5AQ7A 5HS0A 2DZOA 3V79K 2XEEA 4TUMA 4DUIA 4LG6A 2Y0BG 1S70B 4B93B 4G8KA 4O1OA 3V30A 1WDYA 2Y1LE 4ATZD 3DEPA 4HBDA 2MYOA 1UOHA 2BKKB 5AQAA 1D9SA 5AQ9A 4HRLA 2DWZA 3KEAA 5ITZF 4DRXE 2F37A 5AQBA 4Z68A 2BKGA 1OY3D 5FIOA 5AARA 4F1PA 1MX2A 4K5CA 3EU9A 2XENA 4DX1A 5CERB 1MX4A 5CEAA 1DCQA 4GPMA 3T8KA 3NOCD 2RFMA 1MYOA 5EIBE 4C48B 3B95A 4DX2A 4U95D 4HRNA 2AJAA 2ETBA 3AJIA 3F6QA 4J7WA 4LNUD 4U8YD 3B7BA 3C5RA 4YDYA 4NIKA 3ZU7B 3TWQA 1DC2A 5JMND 4O1PA 1K1AA 1YMPA 4HNAD 4ZFHA 1N0QA 3LJNA 2DVWA 5D66A 4CZ2D 1BLXB 4QFVA 5EN5D 4BEPA 4JB8P 5ENRD 5BXOA 4YDWA 1QYMA 3J5PA 2RFAA 4ZHBA 2NYJA 3NBNB 3AAAC 2QC9A 4A63B 2XZDG 4G8LA 3TWTA 4CYMD 1BD8A 1YYHA 4J8YA 3V2XA 2A5EA 1OT8A 1IXVA 3ZNGA 3TWWA 4BESA 5KBAA 2F8XK 2V4HC 3Q9NC 5CEDB 4N5QA 2KBXA 5EILA 5HKPA 5CECB 5ENQD 5KWDA 3Q9UC 5AAOA 4HLLA 2VGEA 2ETAA 3W9GA 1YCSB 2P2CP 5KNGA 3EHQA 2DZNA 2L6BA 1SW6A 4BSZB 2B0OE 5ENSD 1N0RA 3UTMA 4HRMB 5CBNA 3NOGD 4LSZE 2FO1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBO A;  5EID A;  3ZUV B;  1K1B A;  1N11 A;  1IHB A;  4HI8 A;  3HG0 D;  4DX5 D;  2V5Q C;  3V31 A;  3SO8 A;  4DX7 D;  2KXP C;  5HRY A;  3TWV A;  5JA4 D;  4HB5 A;  2F8Y A;  2JAB A;  4K5A B;  1BI8 B;  4DX6 D;  1BU9 A;  5EYP F;  4RLY A;  1TR4 A;  4F6R D;  2ETC A;  3TWR A;  4U96 D;  4OAV B;  1BI7 B;  2ZGD A;  3JXI A;  2HE0 A;  3V2O A;  3TWU A;  5AN8 A;  3IXE A;  3JXJ A;  4GMR A;  4BET A;  1G3N B;  3UI2 A;  1MJ0 A;  1AP7 A;  4OAU C;  1IKN D;  5ENO D;  4U8V D;  3DEO A;  4HI9 A;  3ZKJ A;  1K3Z D;  3HRA A;  4O60 A;  2PNN A;  5ENT D;  3W9F A;  1A5E A;  5FIN A;  3J5Q B;  1AWC B;  3TWS A;  4BER A;  4UUC A;  5BXU A;  2QYJ A;  1SVX A;  2XZT G;  2XEH A;  3JUE A;  2J8S D;  3TWX A;  3UXG A;  5EYL A;  2ZGG A;  3EHR A;  5KNH D;  4HQD A;  1WG0 A;  5ENP D;  4QQI A;  4K5B A;  3D9H A;  1MX6 A;  1NFI E;  3T9K A;  5AQ7 A;  5HS0 A;  2DZO A;  3V79 K;  2XEE A;  4TUM A;  4DUI A;  4LG6 A;  2Y0B G;  1S70 B;  4B93 B;  4G8K A;  4O1O A;  3V30 A;  1WDY A;  2Y1L E;  4ATZ D;  3DEP A;  4HBD A;  2MYO A;  1UOH A;  2BKK B;  5AQA A;  1D9S A;  5AQ9 A;  4HRL A;  2DWZ A;  3KEA A;  5ITZ F;  4DRX E;  2F37 A;  5AQB A;  4Z68 A;  2BKG A;  1OY3 D;  5FIO A;  5AAR A;  4F1P A;  1MX2 A;  4K5C A;  3EU9 A;  2XEN A;  4DX1 A;  5CER B;  1MX4 A;  5CEA A;  1DCQ A;  4GPM A;  3T8K A;  3NOC D;  2RFM A;  1MYO A;  5EIB E;  4C48 B;  3B95 A;  4DX2 A;  4U95 D;  4HRN A;  2AJA A;  2ETB A;  3AJI A;  3F6Q A;  4J7W A;  4LNU D;  4U8Y D;  3B7B A;  3C5R A;  4YDY A;  4NIK A;  3ZU7 B;  3TWQ A;  1DC2 A;  5JMN D;  4O1P A;  1K1A A;  1YMP A;  4HNA D;  4ZFH A;  1N0Q A;  3LJN A;  2DVW A;  5D66 A;  4CZ2 D;  1BLX B;  4QFV A;  5EN5 D;  4BEP A;  4JB8 P;  5ENR D;  5BXO A;  4YDW A;  1QYM A;  3J5P A;  2RFA A;  4ZHB A;  2NYJ A;  3NBN B;  3AAA C;  2QC9 A;  4A63 B;  2XZD G;  4G8L A;  3TWT A;  4CYM D;  1BD8 A;  1YYH A;  4J8Y A;  3V2X A;  2A5E A;  1OT8 A;  1IXV A;  3ZNG A;  3TWW A;  4BES A;  5KBA A;  2F8X K;  2V4H C;  3Q9N C;  5CED B;  4N5Q A;  2KBX A;  5EIL A;  5HKP A;  5CEC B;  5ENQ D;  5KWD A;  3Q9U C;  5AAO A;  4HLL A;  2VGE A;  2ETA A;  3W9G A;  1YCS B;  2P2C P;  5KNG A;  3EHQ A;  2DZN A;  2L6B A;  1SW6 A;  4BSZ B;  2B0O E;  5ENS D;  1N0R A;  3UTM A;  4HRM B;  5CBN A;  3NOG D;  4LSZ E;  2FO1 E; 
#chains in the Genus database with same CATH topology
 4F3V A;  3CHM A;  4DX7 D;  3FEY A;  1HS6 A;  1H2U A;  1KZO A;  3ZVV A;  2RG8 A;  3V2O A;  3U4T A;  4MS6 A;  3HIZ A;  2YIN A;  1G3N B;  2L9B A;  2M63 A;  4U8V D;  3KSQ A;  5ENT D;  2IY0 C;  3J5Q B;  3C3Q A;  4GYY A;  1NA3 A;  3CQC B;  3CVN A;  1H19 A;  1DVP A;  2ZGG A;  3HXD A;  4FP7 A;  5AQ7 A;  2R02 A;  2XEE A;  1S70 B;  4G8K A;  3NAW A;  3R9M A;  4DRX E;  3DPY A;  5M72 A;  4CRW A;  4GTV A;  3MV3 B;  1MYO A;  4JA9 A;  2C0M A;  2VGX B;  4GTQ A;  3TXN A;  1YA0 A;  4APO A;  4B8A A;  3BG0 B;  2ION A;  1YMP A;  4JD2 G;  5BV1 A;  3LKU A;  4U7E B;  4YDW A;  4G26 A;  1TNZ A;  4J8Y A;  3ZYM A;  4WWP A;  4RG9 A;  2VTB B;  3DST A;  1V55 E;  2V4H C;  5FJY A;  1L5J A;  2XQ0 A;  2VSN A;  1N4P A;  3ISM C;  2Q7F A;  3Q9U C;  4GAA A;  4C0E A;  1YCS B;  3E34 A;  1HXI A;  2XEV A;  2LSU A;  4CDN A;  3B13 A;  5JJT A;  4I9C A;  3GZS A;  2V8S E;  5AJD A;  2JAB A;  4XEI G;  4I2Z A;  5CRU A;  3TWR A;  1BI7 B;  2L0T B;  2FUL A;  3R7Q A;  4PS8 A;  1E8X A;  3KD7 A;  4KVM A;  2WXL A;  1SZA A;  2A4Z A;  3I3N A;  3SBT B;  2OCC E;  4NRH B;  3UIP C;  1U3D A;  3LEW A;  2I1K A;  5D0O D;  4GB9 A;  3RRN B;  4JHJ A;  2J4B A;  2MYO A;  4XI9 A;  1OWP A;  2BKG A;  3MZL B;  3QKY A;  4G24 A;  4XIF A;  4DLO A;  5HQ8 A;  2YHC A;  2IEJ A;  3NQP A;  2P9U G;  2AJA A;  2KCV A;  3WG7 E;  4LNU D;  3GZ2 A;  4YDY A;  4Q94 A;  1DC2 A;  5JMN D;  4FJZ A;  4O1P A;  1K1A A;  2J08 A;  4A1S A;  1IQU A;  1BLX B;  1HX8 A;  5BXO A;  3VLE A;  3MEK A;  4CYM D;  3FUF A;  3CSF A;  1E8Z A;  2R2L A;  5EIL A;  2GGF A;  2VGE A;  2ETA A;  2L6B A;  4B0Z A;  3Q78 A;  2C0L A;  3ESL A;  5J90 A;  4GTT A;  3TWV A;  3DSW A;  2F8Y A;  3Q47 B;  4KXK B;  5EDS A;  1E96 B;  2B6C A;  4U96 D;  5G04 C;  5AYW D;  5G05 C;  2J07 A;  5AN8 A;  3C3R A;  3PZ4 A;  2XPY A;  1N54 A;  5C1D A;  4OAU C;  5ENO D;  3KEZ A;  3QC1 A;  4ANU A;  3SFX A;  5BXU A;  2H6I A;  2HYZ A;  3VTY A;  4C9B B;  2P9P G;  1TYQ G;  3EHR A;  1S63 A;  2Y69 E;  4DUI A;  3FH7 A;  3QB2 A;  3OTN A;  5AEN A;  2KAT A;  1FVF A;  2X38 A;  1OCC E;  4EEC A;  3FH8 A;  4BSX A;  2RFM A;  1JCQ A;  3QOU A;  2EIN E;  3ABL E;  3TJP A;  5BT1 A;  4CGV A;  4NIK A;  4Y6C A;  3UMV A;  4PH4 B;  1WY6 A;  3N71 A;  4XKC A;  3IV0 A;  2JLB A;  4JEH A;  4BY6 A;  3DSS A;  2CHZ A;  1QYM A;  3J5P A;  2WPV A;  4G8L A;  2WVI A;  4JA7 A;  3Q15 A;  1MZC A;  3HVE B;  3CVQ A;  2KBX A;  2P9K G;  3FP3 A;  1KZP A;  5JJ6 A;  2IF4 A;  3CKB A;  2LXM A;  3ASN E;  1N11 A;  4HI8 A;  3HG0 D;  1ELW A;  2OVB A;  2X6K A;  3Q5M A;  3ULY A;  2ZXW E;  3D9J A;  4P29 A;  3JXI A;  5LP0 A;  1O1R A;  4DJA A;  3S7F A;  2BED A;  1X81 A;  2H6G A;  3CHQ A;  3U64 A;  4EZJ A;  3LDZ A;  1RW2 A;  2X6I A;  1LF8 A;  3VTX A;  4ATG A;  5CCM A;  3TG4 A;  4WND A;  1D9S A;  2QYU A;  4FLH A;  2H6F A;  2H6H A;  3ML9 A;  3AG3 E;  1DCQ A;  3T8M A;  2PM6 A;  3APF A;  3RIB A;  4OYS A;  2VTB A;  5ARG A;  2XGO A;  3APD A;  3FDH A;  4HLE A;  1IYG A;  1YYH A;  4CT0 A;  2VSX E;  1H6P A;  1LD8 A;  4EBA G;  3U9W A;  1TJC A;  2I9C A;  3SGH A;  5A6C A;  2UY1 A;  4E6H A;  4DI4 A;  2J4D A;  2P2C P;  3ZYK A;  2I2O A;  3CGH A;  4MBG A;  4N3A A;  3EU5 A;  4U0U A;  3LS8 A;  4APF A;  4FAD A;  4AJW A;  3O48 A;  1TNY A;  1OUV A;  5CBO A;  3L82 A;  5FQ6 A;  4N5C A;  3RRM B;  4HB5 A;  4AXH A;  1NI1 A;  4K5A B;  3APC A;  5DIZ A;  4ABN A;  3URZ A;  4F6R D;  1OWL A;  4BTA A;  2HR2 A;  5G04 J;  2CHX A;  4GZ3 A;  4A55 A;  3L16 A;  1IKN D;  4HOS A;  3RO2 A;  5JHA A;  4DPR A;  4YND A;  3FUH A;  2LUH A;  3E37 A;  2DBA A;  1IQR A;  3ABM E;  1WG0 A;  4QQI A;  4K5B A;  3V79 K;  2QZA A;  1NP7 A;  4PDX A;  3MGB A;  3ASO E;  3RRU A;  3DRA A;  5AQ9 A;  1ZB1 A;  5KJN A;  3KEA A;  3UM1 A;  5ITZ F;  3CVX A;  4Z68 A;  1OY3 D;  5AAR A;  4L1B A;  4JXT A;  1JWG A;  1H2T C;  4PS3 A;  4EHM A;  5EIB E;  2P9N G;  2OEV A;  4NUR A;  3ASF A;  1FVH A;  2X6F A;  4N39 A;  2WQH A;  2X6J A;  2Y4T A;  3EIQ C;  3IEG A;  1EF1 C;  3ASG A;  3FTV A;  3L22 A;  1JWF A;  4JB8 P;  4Q96 A;  4CT4 A;  5G55 A;  3AG1 E;  5BPP A;  1TNO A;  3QWP A;  1N9A A;  3Q7A A;  3V2X A;  1OT8 A;  1UW4 B;  1N4S A;  3TL5 A;  4U0Z A;  5HKP A;  4TXQ A;  3FUD A;  3SFY A;  4L2Y A;  1Z3Y A;  1TNB A;  3EUV A;  3UQ3 A;  1IHB A;  3V31 A;  3PH0 C;  5JA4 D;  1H0A A;  1BU9 A;  4GA1 A;  2L6J A;  2VSO E;  3UPV A;  3R7R A;  3PE3 A;  3E33 A;  3Q49 B;  2EIJ E;  3FU0 A;  1QNF A;  2MHK A;  4EZL A;  3SHF A;  2PQN A;  2VGX A;  3CVY A;  5FZS A;  4BER A;  4UUC A;  2QY7 A;  4KVO A;  3ESK A;  5EYL A;  2BF0 X;  3DPD A;  3HXC A;  1NFI E;  3Q75 A;  4PUC A;  3V30 A;  4E85 A;  2CHW A;  3CK8 A;  3FWV A;  3MKR A;  4JEU A;  4LER A;  2R59 A;  4DX1 A;  3CVU A;  1E90 A;  3HXB A;  3Q4A B;  2ZIS A;  3FUI A;  3IHV A;  1A17 A;  4G11 A;  3UM0 A;  3JUI A;  4AY5 A;  4ZFH A;  1UN9 A;  4ANX A;  1N95 A;  2DVW A;  1FT2 A;  5BV0 A;  3FUM A;  3RO3 A;  3RK6 A;  2V4L A;  4BES A;  2AWI A;  2ZU6 B;  4N5Q A;  4HLL A;  1H2V C;  2JEK A;  2IO3 C;  2GW1 A;  3CHS A;  3OXL A;  2GRR B;  4YVO A;  5CBN A;  2FO1 E;  3B7R L;  4GZC A;  3FH5 A;  4DX5 D;  2V5Q C;  3OXF A;  1O1T A;  1OWM A;  4LNB A;  3ZXS A;  3AS8 A;  4J0U A;  4LRZ A;  4UWH A;  3UKR G;  1KLX A;  2WXR A;  3FEX A;  5A7D B;  3JXJ A;  4N3B A;  4HS2 A;  4G25 A;  2GRO B;  4GZ6 A;  2FEZ A;  2QYJ A;  5KJM A;  2XEH A;  2P9S G;  3PUJ A;  3PZ3 A;  4F1S A;  4GU5 A;  2V5F A;  1QBQ A;  1TN7 A;  5ENP D;  4WNG A;  4UQY A;  4O1O A;  4HBD A;  5AQA A;  4UQX A;  4B94 A;  4CDR A;  5IY5 E;  3L9T A;  1MX4 A;  3GZ1 A;  4C48 B;  2LNI A;  4F7A A;  3GW4 A;  2A5U A;  1INZ A;  1OCZ E;  3TWQ A;  1TEZ A;  3LXU X;  4YDO A;  2IOL A;  1NA0 A;  5E75 A;  3SZ7 A;  1MQS A;  3PUK A;  1TN6 A;  4UWL A;  2A5E A;  3ULQ A;  4G23 A;  5BNW A;  3MKQ A;  3DXM G;  2BTD A;  3D9K A;  4LNG A;  5D2M C;  1HH8 A;  2WXF A;  3QJZ A;  2XRY A;  3L13 A;  4KZC A;  4ILI A;  4XI0 A;  2WXI A;  2NSZ A;  4U0S A;  3FFL A;  5EKQ D;  2KXP C;  5LCW J;  4FU3 A;  4ILG A;  3QK0 A;  3FTU A;  5EYP F;  3QAR A;  3UT8 A;  2E0I A;  4WWN A;  3R9A B;  2ZGD A;  5BUZ A;  4R7L A;  3IXE A;  4GMR A;  4BET A;  2OVF A;  3SNX A;  4M7C A;  3PE4 A;  3DEO A;  2XCB A;  3W9F A;  3TWS A;  2WXN A;  2I1J A;  5B1A E;  1SVX A;  2KZT A;  1TNU A;  3JQ0 A;  4GTS A;  2R03 A;  3EDT B;  3UIN C;  4I17 A;  2IJG X;  3AU5 A;  4B93 B;  3S7J A;  2GRM A;  5FWQ A;  4F1P A;  5EX0 A;  2J09 A;  4GPM A;  4U8H A;  4U95 D;  3FUE A;  1NL4 A;  2ETB A;  3AJI A;  1E7U A;  4JZY A;  3C5R A;  5LOZ A;  4ACL A;  4CEM A;  3UM3 A;  2RKK A;  1HO8 A;  4IRU A;  3Q79 A;  3KAE A;  4URK A;  4BEP A;  3CKC A;  2VJ8 A;  1FCH A;  4L2L A;  3AAA C;  1E8Y A;  3CK9 A;  3UUX A;  3T5V A;  4HOU A;  3AG4 E;  3DBS A;  1LTX A;  1HE8 A;  2P9L G;  4JHK A;  2BUG A;  2VYI A;  3P2B A;  3TG5 A;  2HO1 A;  3D9L A;  5ENQ D;  2AXU A;  5AAO A;  5LCW C;  4J8S A;  3PEU B;  2IFU A;  4J8E A;  4AV7 A;  2GRP B;  2XPI A;  2EIK E;  1K1B A;  1KPS B;  4A1G A;  1Y6I A;  3CR3 A;  2ETC A;  2HE0 A;  3CQG B;  2EIM E;  1B89 A;  1UJJ A;  2R5S A;  1AP7 A;  1V54 E;  4JHR A;  4HQD A;  5HS0 A;  3ENE A;  2YHE A;  3L6A A;  4I6E A;  2E2E A;  1JCS A;  4DK5 A;  3PS6 A;  2DWZ A;  3RAU A;  3FUN A;  3DXK G;  2F37 A;  3CHP A;  2WXP A;  3UT4 A;  5AJL A;  3ZYL A;  3NOC D;  2GRN B;  2OV8 A;  3FUK A;  3IKO B;  2CG2 A;  4L7T A;  3EIJ A;  3VLF A;  4CZ2 D;  5C2Y A;  3LPZ A;  2NXP A;  1XGW A;  3ONK A;  4KYO B;  2DIW A;  5KWD A;  3MV2 B;  1O5M A;  2WXK A;  5J08 A;  5KNG A;  2LXL A;  2B0O E;  2CG3 A;  2PM7 A;  3I5P A;  4GTM A;  3FTW A;  4LSZ E;  2FI7 A;  5KJK A;  1JCR A;  4M3O A;  4AIF A;  3DSU A;  5FTP A;  2GRL A;  3VLD A;  2X3M A;  4GCO A;  4G2V A;  4RLY A;  5KJL A;  4BT9 A;  3ZFW A;  4HI9 A;  4YVQ C;  1K3Z D;  3DSX A;  1A5E A;  2VGY A;  3ZRH A;  3AU4 A;  3X2Q E;  4ANW A;  3T5X A;  3JUE A;  3LY9 A;  4XKB A;  4BT8 A;  1MX6 A;  2C2L A;  4N2S A;  1TJF A;  4HRL A;  4HOR A;  5FIO A;  5CER B;  3UX4 A;  4I9E A;  5H7P A;  3NZU A;  1S0P A;  4DI3 A;  2WMO A;  1HG2 A;  4OVV A;  4XZ4 A;  3ZU7 B;  1K8K G;  1JPL A;  4UI9 K;  5B1B E;  3MCX A;  2WXQ A;  3HXE A;  3L17 A;  1Z5S C;  2IU1 A;  3QDN A;  3E4B A;  5ENR D;  3HYM B;  4GTR A;  1N4Q A;  3LVQ E;  1UN8 A;  1WAO 1;  2IO2 C;  4XX5 A;  4AOF A;  5CEC B;  5ANR A;  5A23 A;  4KT6 B;  2Y3A A;  4WNE A;  1D8E A;  4GTO A;  1PC2 A;  1UJK A;  1QQE A;  4Y6W A;  4GTP A;  4DX6 D;  4GA0 A;  3FTZ A;  3BUA A;  4NAC A;  4GA2 A;  2KZT B;  3TWU A;  4MRU A;  3C72 A;  1KT1 A;  1MJ0 A;  1ELR A;  3O4Z A;  1N52 A;  3FU6 A;  3UT7 A;  3ULE G;  2XZT G;  2J8S D;  3PRE A;  2J49 A;  2QFC A;  5G05 J;  4HOT A;  2MRI A;  3T9K A;  5BW8 C;  2Y1L E;  4I1A A;  1Z3X A;  4W9R A;  5HI7 A;  4HXI A;  4UWF A;  4N2Q A;  4K5C A;  5JHB A;  1DCE A;  3HHM A;  4CCA A;  4HRN A;  4U8Y D;  4NQ0 A;  3UM2 A;  1HF8 A;  1OXJ A;  1U2V G;  3BG1 B;  3EHM A;  3S2A A;  1ELK A;  5EN5 D;  3RSE G;  3Q7F A;  3PZ2 A;  5AIJ A;  3NB2 A;  3G2T A;  4O6F A;  2XZD G;  3DSV A;  4BWR A;  4OVU A;  2CFZ A;  3GYZ A;  5KBA A;  1EPU A;  3Q9N C;  4KZ0 A;  5ENN A;  4UWK A;  3W9G A;  1FPP A;  4LUN U;  4UQZ A;  3NBN B;  1QZ2 A;  4IUL A;  2XCC A;  4FA6 A;  2F0Y A;  4MKT A;  4B89 A;  3ASH A;  2FO7 A;  5HRY A;  2WXJ A;  2LAI A;  1WM5 A;  2Y4U A;  1GW6 A;  3CIA A;  3ZGQ A;  3LY8 A;  1TR4 A;  3D3M A;  4UI9 J;  1W3B A;  2YQ8 A;  2ILR A;  3D9N A;  3Q73 A;  4KBQ A;  3U3W A;  4K03 A;  4B8C B;  4O60 A;  5LFA A;  1HFA A;  1MHQ A;  2GRQ B;  4FUL A;  3ZPJ A;  3UXG A;  3SQV A;  1DNP A;  3QAQ A;  3SD5 A;  3ONL A;  2XRZ A;  3CVP A;  1UOH A;  2BKK B;  3ABK E;  4U63 A;  4JW1 A;  5AQB A;  3C98 A;  3ASD A;  2FBN A;  4J8F A;  4I1O B;  3CV0 A;  3MA5 A;  4FJY A;  1LD7 A;  2WB2 A;  2AXV A;  4HVB A;  2NC9 A;  4N3C A;  2R17 C;  4HNA D;  4GYO A;  1N0Q A;  3LJN A;  3JYS A;  3E32 A;  1O1S A;  4I6G A;  4ME2 A;  4L23 A;  3HXF A;  4JPS A;  4JL0 A;  4FC8 A;  4DLQ A;  4AP2 A;  1U3C A;  3CVW A;  2XS8 A;  4PS7 A;  1SW6 A;  4EPZ A;  5ENS D;  2XS1 A;  1D8D A;  2LAH A;  4L9P A;  3KS2 A;  3LVR E;  3CHO A;  2OND A;  1P5Q A;  3NZS A;  2KCK A;  4OAV B;  1EYH A;  4TXP A;  3PVL A;  3ZYQ A;  4EBA A;  1SQM A;  1HU3 A;  1E7V A;  4KMO A;  1PY1 A;  4V3I A;  1Y8M A;  5E76 A;  3QNK A;  3FTX A;  3MX3 A;  2WQ6 A;  2FF4 A;  4EQF A;  4JVS A;  3D9H A;  3PEV B;  2F8X K;  1ZU2 A;  5T4Y A;  4Q69 A;  2LO6 A;  4F53 A;  3FUL A;  2X6H A;  1MX2 A;  2XEN A;  3B7T A;  5CEA A;  5FQ7 A;  4WNF A;  3B95 A;  2RD0 A;  5D0Q D;  1OWO A;  2UWJ G;  3S7B A;  3G2V A;  4LCT A;  3UKU G;  1XNF A;  3IBE A;  5CHE E;  3LYA A;  1SZ9 A;  5FT9 A;  5KCM A;  2RFA A;  4BTB A;  4GZ5 A;  4G1T A;  3TWT A;  1BD8 A;  3CHR A;  3RJV A;  4BFR A;  3LJ3 A;  1UG3 A;  3UIO C;  2L0I A;  4FHK A;  5B3S E;  4H7X A;  3SF4 A;  2P9I G;  2XHE A;  1N4R A;  2V0P A;  3L54 A;  3EHQ A;  5FZR A;  3P1U A;  4FHJ A;  4I6J A;  1S64 A;  1E8W A;  3OAW A;  3C3O A;  3MJW A;  3BEE A;  1RZ4 A;  3SO8 A;  4YDE A;  4H7Y A;  1X5B A;  4HOQ A;  4AY6 A;  3QWW A;  5CRV A;  4D10 C;  4I43 A;  4RVB A;  3LY7 A;  2IQC A;  3UI2 A;  3SY2 A;  3BQO A;  5KNH D;  1KT0 A;  5DBK A;  1H6K A;  4CGW A;  3D9M A;  2DZO A;  4TUM A;  2XPZ A;  4JC8 A;  4ACK A;  4ATZ D;  2UY1 B;  1PAQ A;  5ARF A;  2WMN A;  3TAX A;  1EDU A;  2PL2 A;  3F6Q A;  2EIL E;  3B7B A;  4UI9 C;  5T8I A;  3SI5 A;  3TXM A;  3EHN A;  4RQI A;  5CMW A;  4WAF A;  5D66 A;  1Q2Z A;  2PZI A;  2YNQ A;  1BPO A;  4QFV A;  1HG5 A;  3KSL A;  4ZHB A;  2NYJ A;  3CEQ A;  2QC9 A;  3ZNG A;  3ZXP A;  3U66 A;  4U04 A;  4HFG A;  4J8D A;  3DWL G;  4TUU A;  5G2N A;  5EX3 A;  4AEZ C;  3CVL A;  1N0R A;  2WM9 A;  4EZK A;  2DCP A;  4GML A;  4I1M A;  1HZ4 A;  2I6H A;  3B7U X;  3ZUV B;  3WXX A;  4GZD A;  2XGS A;  4A3V A;  4AM9 A;  5ANL A;  3ML8 A;  5CCL A;  1BI8 B;  5FQ4 A;  4X8Q A;  3HDX A;  1OCO E;  3K9I A;  5FZQ A;  4WUY A;  3FY4 A;  3FU3 A;  4AVX A;  3HVE A;  4J6I A;  4IYP A;  4I2W A;  3L08 A;  4C0M A;  4RG6 A;  3HRA A;  5FIN A;  1SA5 A;  1AWC B;  5CMY A;  3MYV A;  2R05 A;  4XE0 A;  3AS5 A;  3CST A;  3PZD A;  3RU0 A;  3CLJ A;  2ZIR A;  4MLP A;  2AW6 A;  2P58 C;  3ZHE B;  4LG6 A;  4TXR A;  2Y0B G;  1WDY A;  3DEP A;  4GPK A;  3TGO A;  2XGM A;  4CDM A;  3EU9 A;  3ZW3 A;  2KM4 A;  3T8K A;  3AS4 A;  5FQ8 A;  4J7W A;  2KC7 A;  4GMJ A;  1VDY A;  3ZHE A;  4U07 A;  3FU5 A;  3S7D A;  3I4R B;  4ANV A;  1IXV A;  2EQX A;  3NF1 A;  5CED B;  3D9P A;  4GCN A;  4BX8 A;  3CVV A;  4WWO A;  4A3T A;  4BSZ B;  3D9I A;  2OEW A;  4HRM B;  4BX9 A;  2WQ7 A;  3NOG D;  4LEU A;  4K0R A;  5EID A;  2WXO A;  3MKQ B;  4TRQ A;  1Z6T A;  3FTY A;  3EJN A;  2AVP A;  5T3R A;  3IHY A;  2J9Q A;  3BU8 A;  5LX8 A;  3ZKJ A;  4FLB A;  2PNN A;  1FT1 A;  3OXG A;  3TWX A;  4RSY A;  2DYS E;  2LSV A;  4TV3 A;  3B7S A;  1ZBP A;  3FHE A;  1TN8 A;  2MOW A;  1JUQ A;  2KCL A;  4UWG A;  3FUJ A;  2WXG A;  4IN3 B;  3PZ1 A;  3G2S A;  2PQR A;  1H6O A;  4DX2 A;  2OOE A;  3FTS A;  3PNT B;  3G2W A;  3LCA A;  3PRZ A;  2WXM A;  3E30 A;  3G2U A;  2VSY A;  5JJ7 A;  3CK7 A;  3ZIM A;  2HM8 A;  3AG2 E;  3QWV A;  2WXH A;  3JQ1 A;  4A63 B;  1NZN A;  3D9O A;  1N94 A;  4GYW A;  1IHG A;  3TWW A;  1OWN A;  3RKV A;  3SFZ A;  3ZEF A;  2CFU A;  1SA4 A;  3JCK C;  2IOS A;  3ZN3 A;  3PNL B;  2VQ2 A;  4ILH B;  2DYR E;  2DZN A;  1OCR E;  3PDN A;  3UTM A;  3SBS A;  2AXZ A;  3I4G A; 
#chains in the Genus database with same CATH homology
 5CBO A;  5EID A;  3ZUV B;  1K1B A;  1N11 A;  1IHB A;  4HI8 A;  3HG0 D;  4DX5 D;  2V5Q C;  3V31 A;  3SO8 A;  4DX7 D;  2KXP C;  5HRY A;  3TWV A;  5JA4 D;  4HB5 A;  2F8Y A;  2JAB A;  4K5A B;  1BI8 B;  4DX6 D;  1BU9 A;  5EYP F;  4RLY A;  1TR4 A;  4F6R D;  2ETC A;  3TWR A;  4U96 D;  4OAV B;  1BI7 B;  2ZGD A;  3JXI A;  2HE0 A;  3V2O A;  3TWU A;  5AN8 A;  3IXE A;  3JXJ A;  4GMR A;  4BET A;  1G3N B;  3UI2 A;  1MJ0 A;  1AP7 A;  4OAU C;  1IKN D;  5ENO D;  4U8V D;  3DEO A;  4HI9 A;  3ZKJ A;  1K3Z D;  3HRA A;  4O60 A;  2PNN A;  5ENT D;  3W9F A;  1A5E A;  5FIN A;  3J5Q B;  1AWC B;  3TWS A;  4BER A;  4UUC A;  5BXU A;  2QYJ A;  1SVX A;  2XZT G;  2XEH A;  3JUE A;  2J8S D;  3TWX A;  3UXG A;  5EYL A;  2ZGG A;  3EHR A;  5KNH D;  4HQD A;  1WG0 A;  5ENP D;  4QQI A;  4K5B A;  3D9H A;  1MX6 A;  1NFI E;  3T9K A;  5AQ7 A;  5HS0 A;  2DZO A;  3V79 K;  2XEE A;  4TUM A;  4DUI A;  4LG6 A;  2Y0B G;  1S70 B;  4B93 B;  4G8K A;  4O1O A;  3V30 A;  1WDY A;  2Y1L E;  4ATZ D;  3DEP A;  4HBD A;  2MYO A;  1UOH A;  2BKK B;  5AQA A;  1D9S A;  5AQ9 A;  4HRL A;  2DWZ A;  3KEA A;  5ITZ F;  4DRX E;  2F37 A;  5AQB A;  4Z68 A;  2BKG A;  1OY3 D;  5FIO A;  5AAR A;  4F1P A;  1MX2 A;  4K5C A;  3EU9 A;  2XEN A;  4DX1 A;  5CER B;  1MX4 A;  5CEA A;  1DCQ A;  4GPM A;  3T8K A;  3NOC D;  2RFM A;  1MYO A;  5EIB E;  4C48 B;  3B95 A;  4DX2 A;  4U95 D;  4HRN A;  2AJA A;  2ETB A;  3AJI A;  3F6Q A;  4J7W A;  4LNU D;  4U8Y D;  3B7B A;  3C5R A;  4YDY A;  4NIK A;  3ZU7 B;  3TWQ A;  1DC2 A;  5JMN D;  4O1P A;  1K1A A;  1YMP A;  4HNA D;  4ZFH A;  1N0Q A;  3LJN A;  2DVW A;  5D66 A;  4CZ2 D;  1BLX B;  4QFV A;  5EN5 D;  4BEP A;  4JB8 P;  5ENR D;  5BXO A;  4YDW A;  1QYM A;  3J5P A;  2RFA A;  4ZHB A;  2NYJ A;  3NBN B;  3AAA C;  2QC9 A;  4A63 B;  2XZD G;  4G8L A;  3TWT A;  4CYM D;  1BD8 A;  1YYH A;  4J8Y A;  3V2X A;  2A5E A;  1OT8 A;  1IXV A;  3ZNG A;  3TWW A;  4BES A;  5KBA A;  2F8X K;  2V4H C;  3Q9N C;  5CED B;  4N5Q A;  2KBX A;  5EIL A;  5HKP A;  5CEC B;  5ENQ D;  5KWD A;  3Q9U C;  5AAO A;  4HLL A;  2VGE A;  2ETA A;  3W9G A;  1YCS B;  2P2C P;  5KNG A;  3EHQ A;  2DZN A;  2L6B A;  1SW6 A;  4BSZ B;  2B0O E;  5ENS D;  1N0R A;  3UTM A;  4HRM B;  5CBN A;  3NOG D;  4LSZ E;  2FO1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...