2DZOA

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
228
Chain Sequence
b'MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 61
structure length 228
sequence length 228
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2dzoA00
2F37A 4JB8P 2J8SD 4DX1A 5CEDB 2KXPC 3LJNA 3F6QA 2ZGDA 2F8YA 3TWWA 3J5PA 5HKPA 4OAUC 5ENQD 5AQ7A 5ENTD 5EYLA 5HRYA 1BLXB 1MX2A 3Q9NC 3J5QB 5ENSD 2RFAA 2ETAA 3AAAC 3JUEA 4OAVB 5CBNA 3V2XA 4BERA 4LSZE 4U95D 3C5RA 1G3NB 3HRAA 4TUMA 5HS0A 2DZOA 3TWUA 4DX6D 5BXUA 4A63B 4DX2A 4O60A 1K3ZD 1DC2A 1N0QA 3DEPA 5EIDA 4DX7D 4QFVA 1SVXA 2F8XK 4BESA 5AARA 2V4HC 5FIOA 2XENA 1BI7B 4YDYA 4K5AB 1K1BA 3EHRA 4ZFHA 5JMND 2RFMA 1A5EA 4HQDA 2QC9A 4F1PA 3B95A 2VGEA 4BETA 1SW6A 4BSZB 3SO8A 1OT8A 3UXGA 2ZGGA 1AWCB 4Z68A 1BU9A 1QYMA 3DEOA 4CYMD 4F6RD 2DWZA 1N11A 1YMPA 3V31A 3D9HA 5AQAA 3IXEA 2L6BA 3UI2A 2NYJA 4U8VD 2DZNA 2ETBA 5ENRD 5KWDA 3ZKJA 4ZHBA 1BI8B 4GPMA 1UOHA 3TWVA 1K1AA 2HE0A 4NIKA 5EIBE 3V79K 4LNUD 4U96D 1YCSB 4HRMB 2XEEA 2P2CP 3T8KA 3TWQA 1S70B 4HBDA 3EU9A 4ATZD 5AAOA 5KBAA 1IHBA 2Y0BG 5AQBA 1DCQA 4UUCA 3TWSA 3TWXA 5BXOA 4LG6A 5EYPF 5CEAA 5ITZF 1AP7A 4J8YA 5ENPD 1OY3D 3B7BA 3NBNB 4K5BA 2AJAA 4HI8A 3T9KA 5CBOA 4HI9A 4DRXE 1D9SA 2KBXA 3Q9UC 1N0RA 3ZNGA 2ETCA 1TR4A 3JXIA 2A5EA 5EILA 3JXJA 4YDWA 2V5QC 3V30A 3ZU7B 2PNNA 3NOCD 4RLYA 2XZTG 4QQIA 3TWRA 5CECB 3TWTA 4BEPA 4DX5D 4B93B 2FO1E 2B0OE 2DVWA 4HRLA 3W9FA 4N5QA 4G8LA 2QYJA 3HG0D 4J7WA 2MYOA 2XZDG 1IXVA 5KNHD 5JA4D 5D66A 3ZUVB 1BD8A 5EN5D 5CERB 4U8YD 5ENOD 3AJIA 1MJ0A 3EHQA 2BKGA 4GMRA 1YYHA 2JABA 1NFIE 3W9GA 4C48B 4HLLA 5AN8A 2XEHA 4O1PA 4HB5A 3UTMA 3KEAA 5AQ9A 1IKND 3V2OA 3NOGD 4CZ2D 5KNGA 2Y1LE 1MYOA 1MX4A 1WG0A 4K5CA 4DUIA 4O1OA 4HRNA 1WDYA 2BKKB 1MX6A 5FINA 4HNAD 4G8KA
chains in the Genus database with same CATH superfamily
4I1AA 3LJNA 5BW8C 4MLPA 3TWWA 5CRVA 4YVOA 4L2YA 2P9SG 3LVQE 3Q9NC 2P9UG 3TAXA 4L23A 2FULA 2P9KG 3DEPA 5EIDA 3ASGA 4BESA 1FT1A 3FEXA 5JMND 3CHPA 1A5EA 4G26A 1ELWA 3L17A 2WXMA 4OVUA 1ELKA 1UOHA 3GZSA 4JHKA 5LCWJ 4LNUD 1H6PA 2XS8A 3QJZA 2LO6A 4V3IA 1IQUA 5KBAA 1IHBA 1DCQA 2DIWA 2IJGX 3B7UX 3SI5A 3QARA 5FZQA 1N0RA 4N39A 4UWGA 5E75A 2XZTG 4EZKA 1H6KA 4CGVA 4U0ZA 3OAWA 4U63A 3O48A 4Q94A 3LPZA 4AY6A 3CK8A 1TNYA 4HB5A 2OVFA 1MX4A 3HHMA 2Y69E 2J07A 3MX3A 4B8CB 4R7LA 3U4TA 5ANLA 1JCRA 5HKPA 4PS3A 1MX2A 3J5QB 2YHEA 2V4LA 2XPZA 2IF4A 3DWLG 3C5RA 3EHMA 3Q78A 5C1DA 3EIJA 1DC2A 5EX3A 5CHEE 5FIOA 3PZ3A 4GTTA 3G2VA 2CHXA 2VGEA 4UQXA 5CMYA 2VSYA 2KCLA 4C0MA 3X2QE 5BNWA 2L0IA 3UMVA 2GROB 4I1MA 3UT7A 3CVXA 2XEVA 3JCKC 4JA7A 2DZNA 2EIJE 3Q73A 1HG5A 1E7VA 2FO7A 2I1JA 1UN9A 5LX8A 5M72A 4ILGA 3HXBA 3TWQA 5AJLA 4ATZD 3PRZA 3CLJA 1TYQG 5EYPF 4AXHA 2AXVA 3B7BA 4MS6A 3T9KA 3LKUA 1O1SA 2KBXA 3VLEA 4EHMA 4UI9J 2XQ0A 2WXQA 3ZU7B 1HS6A 4APFA 4QQIA 5KJMA 4GAAA 1N54A 1BPOA 2B0OE 4CDRA 3JQ0A 4ILHB 1S0PA 4J7WA 5JA4D 1V54E 3ESLA 5FJYA 4PS8A 4UQYA 4XIFA 2J4BA 1NFIE 5AN8A 4KVMA 3NF1A 3WG7E 1NP7A 4A3TA 2V0PA 3NZSA 1H2TC 1H6OA 4N3CA 5A7DB 5IY5E 4NQ0A 1Z3YA 2F37A 3D9MA 2IU1A 3QNKA 3AS4A 2R05A 3TGOA 2RG8A 5JJ6A 2I6HA 4EPZA 5ARFA 4WNEA 4BX8A 4CT0A 4DX2A 4GCOA 1P5QA 5J08A 2WXPA 4PS7A 1BI7B 4P29A 3HYMB 3SBTB 3HXFA 1QBQA 3CK7A 1OT8A 3DSUA 3C72A 4HOUA 2WB2A 3C3RA 1N11A 3E30A 2VGXA 3ABKE 1FT2A 1Z6TA 3FP3A 3I4GA 3T5XA 2WM9A 4PDXA 4OVVA 1OWNA 3G2SA 3Q49B 4NIKA 3V79K 4BTBA 4GTMA 4JXTA 3BUAA 3FTUA 5KJKA 4GZ5A 4I43A 1K8KG 1A17A 4J8YA 1UG3A 4K5BA 4ANUA 3FHEA 4CRWA 4EECA 2R03A 4HFGA 3TXNA 2R02A 3TWTA 3APCA 2QYJA 3QDNA 4J8FA 4N5CA 3SNXA 4JC8A 2X6KA 2J9QA 1OWPA 3AJIA 1MJ0A 3PZ1A 2I9CA 2KZTB 2BKGA 3HDXA 4C48B 3UIOC 3WXXA 5AQ9A 1RW2A 3GZ1A 4A3VA 4B0ZA 3ZGQA 1X5BA 3KSQA 4G25A 5B3SE 3J5PA 3FY4A 3SD5A 5DIZA 4DLQA 2AXUA 1JPLA 2BEDA 4DX6D 3FUJA 4WNGA 5BXUA 3P2BA 4J0UA 3FUFA 2X6HA 2P9LG 1SVXA 4N2QA 3VLFA 4G1TA 1KLXA 4LCTA 1FVFA 3BG1B 4I6JA 1QYMA 4J8EA 4CYMD 2DWZA 3I3NA 3L54A 3ULYA 4JHJA 3CKCA 3NQPA 1BI8B 1D8EA 3G2TA 5AJDA 2ONDA 3AG2E 1OWLA 2MOWA 3AG3E 4N3AA 4KXKB 3IBEA 3RSEG 1OY3D 3PEUB 5CBOA 4HI8A 2Y4TA 4DRXE 3Q9UC 4I6EA 1SZAA 2V5QC 2YQ8A 3MGBA 3S7FA 4BEPA 4N5QA 3BU8A 4C9BB 2WXJA 4U8YD 3URZA 5D2MC 2I1KA 4AJWA 5JHAA 3PNTB 2CHWA 3KAEA 4IULA 4O1PA 3ZVVA 4FLBA 1OUVA 3RK6A 4CZ2D 1KZPA 3SBSA 4MBGA 2IO3C 2E2EA 3ONKA 3P1UA 3CVLA 3SFXA 2RKKA 1FPPA 3F6QA 2DYSE 3U3WA 4OAUC 5ENQD 3OTNA 2IEJA 1PY1A 4XZ4A 4DJAA 2WMOA 4LSZE 1MZCA 1G3NB 4A1SA 5BT1A 3FH7A 4GTSA 3ZEFA 5G04J 1LTXA 4HS2A 3PE4A 1JCSA 3ZFWA 3ZYMA 4B8AA 3FFLA 3ABME 1BU9A 1AWCB 3UIPC 2L9BA 1E7UA 1OWOA 2LUHA 3OXFA 3NZUA 4Q96A 2C0LA 2J4DA 1NZNA 2CG3A 2XEEA 4A1GA 4CT4A 5AAOA 4NRHB 3TWXA 3G2WA 2XPYA 2WXKA 5DBKA 1TNOA 2EINE 4JZYA 1H2VC 3NOCD 3KEZA 4YDEA 5B1BE 4HOQA 3ULQA 4GYWA 3ENEA 4KBQA 4F53A 3MA5A 2PM6A 4Y6CA 2XEHA 3GYZA 3PZDA 3UT8A 5FQ6A 3KEAA 5BV1A 2YINA 3FUDA 1KPSB 5BV0A 2DCPA 4FU3A 4CGWA 3TG5A 2F8YA 4LNGA 1OCZE 4CDNA 4WUYA 4F3VA 3TWUA 3E4BA 3UKUG 2AXZA 5JJ7A 2UWJG 2C0MA 3PUKA 1SA5A 2ZGGA 3UM2A 2EILE 2H6HA 3D9HA 3RJVA 3ZHEB 4XKCA 3DRAA 3ZKJA 1GW6A 2V8SE 1TN7A 4HOSA 5BUZA 3VTYA 3EHNA 5EIBE 3KD7A 4HLEA 3EUVA 3T8KA 3QK0A 1FVHA 3FU0A 1W3BA 1Q2ZA 4N2SA 5G05C 5FQ4A 2AJAA 3HVEB 1HO8A 4XEIG 3JXJA 3V30A 1B89A 1ZB1A 1NI1A 3CV0A 2DVWA 3DSTA 3MYVA 1HU3A 3UM3A 4JEHA 5G55A 5T3RA 2VGYA 3ZRHA 2IOSA 1IKND 1NL4A 3CVWA 5KNGA 3CGHA 4J8DA 2NC9A 1MX6A 1EYHA 1S64A 1YA0A 2KXPC 4XX5A 2BTDA 1N4QA 3CQGB 4FLHA 4GA2A 4FC8A 2XGOA 4ILIA 2ZISA 4U95D 2EQXA 1U3CA 2HR2A 5HS0A 2NSZA 4BT8A 5JJTA 3Q75A 1N0QA 2IOLA 3LS8A 3CVVA 3QC1A 3D9LA 1LF8A 4HQDA 3I4RB 5FQ8A 3KSLA 1INZA 3SO8A 1JCQA 2KM4A 3JUIA 4F6RD 2VSNA 3IV0A 1OCCE 3CHMA 3C3OA 4YNDA 3VLDA 1KT0A 2H6GA 3ZXSA 2WXNA 3APFA 5G04C 4I9CA 2OOEA 4IYPA 4I2WA 4U07A 3ZNGA 4JVSA 2NXPA 4RLYA 4X8QA 2GRQB 3Q7FA 4HRLA 5EX0A 3GW4A 3ZYKA 2OCCE 2MYOA 5KNHD 2WPVA 3RU0A 5CERB 2IONA 2GRNB 2WXIA 3DSVA 1E8YA 2WQ7A 2P9PG 2A5UA 3D9JA 3UUXA 1N9AA 4HNAD 4G8KA 3OXLA 3LEWA 2J8SD 3DXMG 3ZYLA 3SFYA 3AAAC 2VJ8A 2R17C 3D9PA 2DZOA 3RRNB 3CK9A 2XCBA 3RRMB 1Z3XA 4YDYA 4EBAA 3ISMC 1HXIA 3NAWA 2X6FA 4BETA 2QYUA 4LNBA 2YHCA 2PQNA 2BUGA 4GTVA 3V31A 2OVBA 3E33A 3UI2A 1KZOA 2WXRA 2WXFA 4Q69A 4GPMA 1HH8A 3T8MA 3TWVA 4JHRA 2HE0A 4HRMB 3B7TA 4G2VA 3R9MA 2CG2A 3FTXA 4J8SA 3TWSA 2XHEA 1AP7A 4TXRA 1QZ2A 2LSVA 4GTRA 2MRIA 3MV3B 2FO1E 4Y6WA 1Z5SC 1TJFA 4G8LA 1XGWA 1H2UA 4KYOB 1BD8A 4HXIA 2V5FA 2KATA 2L6JA 5EKQD 4K0RA 2FEZA 2P58C 4WWPA 3ASDA 2OV8A 5EYLA 5HRYA 3PS6A 5ENSD 3R7RA 5CCMA 3RO3A 4GA0A 3HRAA 2XCCA 5ARGA 2WVIA 4U7EB 2HYZA 2X6JA 5JHBA 4YVQC 3IKOB 4DX7D 2LSUA 3CHOA 3L82A 3RIBA 3MEKA 3DEOA 4GYYA 4U8VD 4IN3B 2ETBA 3EIQC 3SFZA 2ILRA 2OEVA 3FUIA 2L0TB 4GPKA 1K1AA 2EIME 1NA3A 5G05J 3ZPJA 2JEKA 3CHRA 1ZU2A 2VSXE 4GZ3A 4N3BA 3SHFA 3NBNB 1EPUA 4GCNA 2ETCA 3BQOA 4XI0A 3LXUX 4XKBA 5EDSA 1V55E 3EDTB 3ZN3A 4GTPA 4EBAG 2RD0A 2GRLA 3W9GA 5ENNA 4HLLA 3L6AA 3ZW3A 4H7YA 3TG4A 2FF4A 3UM1A 4ACKA 4UI9K 2ZGDA 2IQCA 4JA9A 4DLOA 5AQ7A 1E8ZA 4AM9A 3DSXA 3JQ1A 4JL0A 1UN8A 4A63B 3N71A 5FQ7A 4G11A 2LXLA 1N4PA 1DCEA 3R7QA 3HXDA 4W9RA 3B95A 1PAQA 3S2AA 4BSZB 4E85A 3LCAA 3PDNA 4O6FA 3S7BA 1QNFA 4MRUA 4L1BA 4JD2G 3RRUA 1IHGA 3MKQB 1DNPA 2J49A 1ELRA 4RG6A 2FBNA 4D10C 3CVUA 5AQBA 3R9AB 3LVRE 3GZ2A 5A6CA 3MJWA 3FTWA 2A5EA 3JXIA 3L9TA 3UT4A 2FI7A 3PVLA 4B93B 4AV7A 3ZYQA 3Q7AA 3CHQA 1WY6A 3PNLB 3D9OA 3PREA 2XZDG 2LNIA 3CVNA 3ZUVB 2PM7A 5ENOD 3FDHA 4B89A 2IFUA 3UPVA 3ASNE 3QWVA 1EDUA 2DYRE 3TL5A 3AG1E 3V2OA 2Y1LE 3CQCB 4K5CA 3IHVA 4I17A 4F1SA 2BKKB 1HFAA 4JB8P 3S7JA 3E37A 4AIFA 4KZ0A 5HI7A 4AEZC 4URKA 3EU5A 5HQ8A 4ACLA 4KMOA 4OAVB 3UQ3A 3V2XA 2CFUA 3UM0A 3S7DA 2IY0C 1HG2A 1HX8A 1IYGA 2WXGA 2C2LA 1Y6IA 1YMPA 3IXEA 4APOA 3FUHA 3PZ4A 4GU5A 2AW6A 2GRRB 3AG4E 3FU5A 3CIAA 2J08A 2ZU6B 3UX4A 4AOFA 1MHQA 3Q47B 3PE3A 2A4ZA 3CSFA 1O1RA 2CFZA 3CR3A 2Y0BG 5LP0A 3TJPA 3Q5MA 3E32A 5D0QD 3BG0B 3QKYA 3QWPA 4GZ6A 1HE8A 3QB2A 3DSSA 1LD8A 2KZTA 1D8DA 4DX5D 1JUQA 3B13A 1H19A 4IRUA 5FZSA 2Y3AA 4K03A 1KT1A 4UWLA 5EN5D 3ONLA 4U0UA 4EZLA 3QWWA 3DPYA 1EF1C 1SZ9A 3ULEG 3LY7A 4O1OA 2Y4UA 4LEUA 1IQRA 4DX1A 1ZBPA 4B94A 5CMWA 1TEZA 4U8HA 3FUEA 3PZ2A 5D0OD 3ZIMA 4TRQA 4O60A 3CSTA 5AENA 4LUNU 2XGSA 4WWNA 3DXKG 3UINC 3HXEA 2QFCA 4BT9A 3CKBA 3ASFA 2XS1A 5AQAA 3UKRG 2NYJA 2X3MA 5ENRD 4YDOA 2WXOA 1PC2A 3PUJA 5FWQA 3FUMA 2VYIA 1N4RA 3MKRA 3LY8A 2WQ6A 5ENPD 4C0EA 2GRPB 2VSOE 3D9KA 1FCHA 3ML9A 4M7CA 3W9FA 3O4ZA 4GYOA 5D66A 4LRZA 2HM8A 3C98A 3FWVA 3FEYA 4BFRA 3D3MA 3L22A 1OCOE 5FTPA 4HRNA 4ABNA 4U04A 1HF8A 5AIJA 3MKQA 1BLXB 5CCLA 3FUNA 3JUEA 5CBNA 3K9IA 4DI3A 2WMNA 2CHZA 4ATGA 5BPPA 3HIZA 1MQSA 2H6IA 3ZXPA 4TUUA 3ABLE 3LDZA 2I2OA 2GW1A 4QFVA 2PQRA 2P9IG 1WM5A 4CCAA 3EHRA 4UWFA 4UQZA 2XPIA 3I5PA 3ASHA 4GMJA 4I6GA 3FTVA 4Z68A 2LAHA 5G2NA 2HO1A 4LERA 1N95A 2ZXWE 1Y8MA 3RO2A 2VTBB 4ANWA 3OXGA 1YCSB 1OWMA 2P2CP 2ZIRA 5J90A 1S70B 2XRZA 4JEUA 3EU9A 4WAFA 5A23A 3IEGA 4FULA 5BXOA 5CEAA 4GMLA 5T8IA 3AU5A 2GRMA 1QQEA 3DSWA 3SZ7A 4YDWA 2PNNA 3APDA 1UJKA 1JWFA 3QAQA 2X6IA 2F0YA 4AP2A 2KCVA 3CVPA 4BY6A 2R59A 2UY1B 4GMRA 4AVXA 1YYHA 3FH8A 2JLBA 2KCKA 3NOGD 3T5VA 4UWHA 1E96B 4DK5A 1WDYA 4U0SA 4L2LA 1L5JA 4XE0A 3PEVB 1LD7A 2VQ2A 1WAO1 3TXMA 3D9IA 2WXLA 2WXHA 5ENTD 4WNFA 4CEMA 4UWKA 1UJJA 4NACA 2H6FA 1E90A 3ESKA 4FP7A 1SQMA 3FTZA 4G24A 2F8XK 1JWGA 4FJZA 2EIKE 2M63A 2RFMA 3ZHEA 4F1PA 4J6IA 4BWRA 4FADA 2QY7A 4RG9A 3VTXA 4GA1A 3CVYA 4ZHBA 1HZ4A 2XGMA 4FA6A 3HVEA 2LXMA 3MZLB 3D9NA 3AU4A 5LCWC 2J09A 1TN8A 2R2LA 3B7SA 2GGFA 3FU3A 4FJYA 4LG6A 4H7XA 5ITZF 3AS5A 4HI9A 3LY9A 1TR4A 5EILA 1TJCA 4F7AA 4L7TA 3JYSA 2R5SA 3HG0D 5E76A 1IXVA 3HXCA 3BEEA 5B1AE 4CDMA 4MKTA 3EHQA 1X81A 3FTYA 5FT9A 1MYOA 1WG0A 1N4SA 4EQFA 3U64A 5CEDB 3AS8A 3Q79A 4E6HA 2PZIA 1VDYA 4OYSA 2ETAA 1OCRE 2WQHA 4BERA 4EZJA 1K3ZD 3RAUA 1S63A 1UW4B 3KS2A 5AARA 1K1BA 3SQVA 4L9PA 5KJLA 4ANXA 5FZRA 3Q4AB 2B6CA 3UXGA 1RZ4A 4PH4B 2IO2C 4HORA 5KJNA 3SGHA 3L08A 4ANVA 2PL2A 4I9EA 4HVBA 4KT6B 4PUCA 2P9NG 2LAIA 3DBSA 4HBDA 1O1TA 4JW1A 4KZCA 4BSXA 4UUCA 4GB9A 2MHKA 4WWOA 3E34A 4A55A 4ME2A 3G2UA 5ANRA 2Q7FA 1D9SA 1U3DA 3DPDA 1NA0A 3L16A 1H0AA 3FH5A 4UI9C 2X38A 3U9WA 1E8XA 5AYWD 3C3QA 4M3OA 3MCXA 3FUKA 3L13A 2JABA 4GZDA 1O5MA 3B7RL 4DUIA 3ML8A 4I2ZA 3LJ3A 5FINA 3Q15A 3RKVA 1TNBA 2DBAA 2KC7A 4RVBA 2QZAA 2VTBA 1E8WA 4AY5A 4GTQA 2RFAA 5LOZA 4BX9A 4JPSA 1OXJA 4WNDA 4TUMA 4XI9A 4DI4A 3MV2B 4KVOA 4TV3A 2V4HC 4RQIA 2XENA 4K5AB 4ZFHA 1DVPA 2QC9A 4I1OB 5CRUA 3SY2A 4FHKA 1SW6A 3ASOE 4NURA 3QOUA 3PH0C 5H7PA 2AVPA 3SF4A 2L6BA 4BTAA 5KWDA 3CVQA 4GZCA 4RSYA 2UY1A 3CEQA 4U96D 3CHSA 1TNZA 1TNUA 3FTSA 5T4YA 4TXQA 3FULA 4FHJA 4TXPA 3U66A 3FU6A 4DPRA 3TWRA 5CECB 2BF0X 5KCMA 4G23A 2E0IA 5LFAA 2OEWA 1N94A 2VGXB 5C2YA 1U2VG 3NB2A 4GTOA 4HOTA 2AWIA 3UTMA 1SA4A 3EJNA 2XRYA 1N52A 2YNQA 3IHYA 1XNFA 3LYAA 1TN6A
chains in the Genus database with same CATH topology
2F37A 4JB8P 2J8SD 4DX1A 5CEDB 2KXPC 3LJNA 3F6QA 2ZGDA 2F8YA 3TWWA 3J5PA 5HKPA 4OAUC 5ENQD 5AQ7A 5ENTD 5EYLA 5HRYA 1BLXB 1MX2A 3Q9NC 3J5QB 5ENSD 2RFAA 2ETAA 3AAAC 3JUEA 4OAVB 5CBNA 3V2XA 4BERA 4LSZE 4U95D 3C5RA 1G3NB 3HRAA 4TUMA 5HS0A 2DZOA 3TWUA 4DX6D 5BXUA 4A63B 4DX2A 4O60A 1K3ZD 1DC2A 1N0QA 3DEPA 5EIDA 4DX7D 4QFVA 1SVXA 2F8XK 4BESA 5AARA 2V4HC 5FIOA 2XENA 1BI7B 4YDYA 4K5AB 1K1BA 3EHRA 4ZFHA 5JMND 2RFMA 1A5EA 4HQDA 2QC9A 4F1PA 3B95A 2VGEA 4BETA 1SW6A 4BSZB 3SO8A 1OT8A 3UXGA 2ZGGA 1AWCB 4Z68A 1BU9A 1QYMA 3DEOA 4CYMD 4F6RD 2DWZA 1N11A 1YMPA 3V31A 3D9HA 5AQAA 3IXEA 2L6BA 3UI2A 2NYJA 4U8VD 2DZNA 2ETBA 5ENRD 5KWDA 3ZKJA 4ZHBA 1BI8B 4GPMA 1UOHA 3TWVA 1K1AA 2HE0A 4NIKA 5EIBE 3V79K 4LNUD 4U96D 1YCSB 4HRMB 2XEEA 2P2CP 3T8KA 3TWQA 1S70B 4HBDA 3EU9A 4ATZD 5AAOA 5KBAA 1IHBA 2Y0BG 5AQBA 1DCQA 4UUCA 3TWSA 3TWXA 5BXOA 4LG6A 5EYPF 5CEAA 5ITZF 1AP7A 4J8YA 5ENPD 1OY3D 3B7BA 3NBNB 4K5BA 2AJAA 4HI8A 3T9KA 5CBOA 4HI9A 4DRXE 1D9SA 2KBXA 3Q9UC 1N0RA 3ZNGA 2ETCA 1TR4A 3JXIA 2A5EA 5EILA 3JXJA 4YDWA 2V5QC 3V30A 3ZU7B 2PNNA 3NOCD 4RLYA 2XZTG 4QQIA 3TWRA 5CECB 3TWTA 4BEPA 4DX5D 4B93B 2FO1E 2B0OE 2DVWA 4HRLA 3W9FA 4N5QA 4G8LA 2QYJA 3HG0D 4J7WA 2MYOA 2XZDG 1IXVA 5KNHD 5JA4D 5D66A 3ZUVB 1BD8A 5EN5D 5CERB 4U8YD 5ENOD 3AJIA 1MJ0A 3EHQA 2BKGA 4GMRA 1YYHA 2JABA 1NFIE 3W9GA 4C48B 4HLLA 5AN8A 2XEHA 4O1PA 4HB5A 3UTMA 3KEAA 5AQ9A 1IKND 3V2OA 3NOGD 4CZ2D 5KNGA 2Y1LE 1MYOA 1MX4A 1WG0A 4K5CA 4DUIA 4O1OA 4HRNA 1WDYA 2BKKB 1MX6A 5FINA 4HNAD 4G8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F37 A;  4JB8 P;  2J8S D;  4DX1 A;  5CED B;  2KXP C;  3LJN A;  3F6Q A;  2ZGD A;  2F8Y A;  3TWW A;  3J5P A;  5HKP A;  4OAU C;  5ENQ D;  5AQ7 A;  5ENT D;  5EYL A;  5HRY A;  1BLX B;  1MX2 A;  3Q9N C;  3J5Q B;  5ENS D;  2RFA A;  2ETA A;  3AAA C;  3JUE A;  4OAV B;  5CBN A;  3V2X A;  4BER A;  4LSZ E;  4U95 D;  3C5R A;  1G3N B;  3HRA A;  4TUM A;  5HS0 A;  2DZO A;  3TWU A;  4DX6 D;  5BXU A;  4A63 B;  4DX2 A;  4O60 A;  1K3Z D;  1DC2 A;  1N0Q A;  3DEP A;  5EID A;  4DX7 D;  4QFV A;  1SVX A;  2F8X K;  4BES A;  5AAR A;  2V4H C;  5FIO A;  2XEN A;  1BI7 B;  4YDY A;  4K5A B;  1K1B A;  3EHR A;  4ZFH A;  5JMN D;  2RFM A;  1A5E A;  4HQD A;  2QC9 A;  4F1P A;  3B95 A;  2VGE A;  4BET A;  1SW6 A;  4BSZ B;  3SO8 A;  1OT8 A;  3UXG A;  2ZGG A;  1AWC B;  4Z68 A;  1BU9 A;  1QYM A;  3DEO A;  4CYM D;  4F6R D;  2DWZ A;  1N11 A;  1YMP A;  3V31 A;  3D9H A;  5AQA A;  3IXE A;  2L6B A;  3UI2 A;  2NYJ A;  4U8V D;  2DZN A;  2ETB A;  5ENR D;  5KWD A;  3ZKJ A;  4ZHB A;  1BI8 B;  4GPM A;  1UOH A;  3TWV A;  1K1A A;  2HE0 A;  4NIK A;  5EIB E;  3V79 K;  4LNU D;  4U96 D;  1YCS B;  4HRM B;  2XEE A;  2P2C P;  3T8K A;  3TWQ A;  1S70 B;  4HBD A;  3EU9 A;  4ATZ D;  5AAO A;  5KBA A;  1IHB A;  2Y0B G;  5AQB A;  1DCQ A;  4UUC A;  3TWS A;  3TWX A;  5BXO A;  4LG6 A;  5EYP F;  5CEA A;  5ITZ F;  1AP7 A;  4J8Y A;  5ENP D;  1OY3 D;  3B7B A;  3NBN B;  4K5B A;  2AJA A;  4HI8 A;  3T9K A;  5CBO A;  4HI9 A;  4DRX E;  1D9S A;  2KBX A;  3Q9U C;  1N0R A;  3ZNG A;  2ETC A;  1TR4 A;  3JXI A;  2A5E A;  5EIL A;  3JXJ A;  4YDW A;  2V5Q C;  3V30 A;  3ZU7 B;  2PNN A;  3NOC D;  4RLY A;  2XZT G;  4QQI A;  3TWR A;  5CEC B;  3TWT A;  4BEP A;  4DX5 D;  4B93 B;  2FO1 E;  2B0O E;  2DVW A;  4HRL A;  3W9F A;  4N5Q A;  4G8L A;  2QYJ A;  3HG0 D;  4J7W A;  2MYO A;  2XZD G;  1IXV A;  5KNH D;  5JA4 D;  5D66 A;  3ZUV B;  1BD8 A;  5EN5 D;  5CER B;  4U8Y D;  5ENO D;  3AJI A;  1MJ0 A;  3EHQ A;  2BKG A;  4GMR A;  1YYH A;  2JAB A;  1NFI E;  3W9G A;  4C48 B;  4HLL A;  5AN8 A;  2XEH A;  4O1P A;  4HB5 A;  3UTM A;  3KEA A;  5AQ9 A;  1IKN D;  3V2O A;  3NOG D;  4CZ2 D;  5KNG A;  2Y1L E;  1MYO A;  1MX4 A;  1WG0 A;  4K5C A;  4DUI A;  4O1O A;  4HRN A;  1WDY A;  2BKK B;  1MX6 A;  5FIN A;  4HNA D;  4G8K A; 
#chains in the Genus database with same CATH topology
 4I1A A;  3LJN A;  5BW8 C;  4MLP A;  3TWW A;  5CRV A;  4YVO A;  4L2Y A;  2P9S G;  3LVQ E;  3Q9N C;  2P9U G;  3TAX A;  4L23 A;  2FUL A;  2P9K G;  3DEP A;  5EID A;  3ASG A;  4BES A;  1FT1 A;  3FEX A;  5JMN D;  3CHP A;  1A5E A;  4G26 A;  1ELW A;  3L17 A;  2WXM A;  4OVU A;  1ELK A;  1UOH A;  3GZS A;  4JHK A;  5LCW J;  4LNU D;  1H6P A;  2XS8 A;  3QJZ A;  2LO6 A;  4V3I A;  1IQU A;  5KBA A;  1IHB A;  1DCQ A;  2DIW A;  2IJG X;  3B7U X;  3SI5 A;  3QAR A;  5FZQ A;  1N0R A;  4N39 A;  4UWG A;  5E75 A;  2XZT G;  4EZK A;  1H6K A;  4CGV A;  4U0Z A;  3OAW A;  4U63 A;  3O48 A;  4Q94 A;  3LPZ A;  4AY6 A;  3CK8 A;  1TNY A;  4HB5 A;  2OVF A;  1MX4 A;  3HHM A;  2Y69 E;  2J07 A;  3MX3 A;  4B8C B;  4R7L A;  3U4T A;  5ANL A;  1JCR A;  5HKP A;  4PS3 A;  1MX2 A;  3J5Q B;  2YHE A;  2V4L A;  2XPZ A;  2IF4 A;  3DWL G;  3C5R A;  3EHM A;  3Q78 A;  5C1D A;  3EIJ A;  1DC2 A;  5EX3 A;  5CHE E;  5FIO A;  3PZ3 A;  4GTT A;  3G2V A;  2CHX A;  2VGE A;  4UQX A;  5CMY A;  2VSY A;  2KCL A;  4C0M A;  3X2Q E;  5BNW A;  2L0I A;  3UMV A;  2GRO B;  4I1M A;  3UT7 A;  3CVX A;  2XEV A;  3JCK C;  4JA7 A;  2DZN A;  2EIJ E;  3Q73 A;  1HG5 A;  1E7V A;  2FO7 A;  2I1J A;  1UN9 A;  5LX8 A;  5M72 A;  4ILG A;  3HXB A;  3TWQ A;  5AJL A;  4ATZ D;  3PRZ A;  3CLJ A;  1TYQ G;  5EYP F;  4AXH A;  2AXV A;  3B7B A;  4MS6 A;  3T9K A;  3LKU A;  1O1S A;  2KBX A;  3VLE A;  4EHM A;  4UI9 J;  2XQ0 A;  2WXQ A;  3ZU7 B;  1HS6 A;  4APF A;  4QQI A;  5KJM A;  4GAA A;  1N54 A;  1BPO A;  2B0O E;  4CDR A;  3JQ0 A;  4ILH B;  1S0P A;  4J7W A;  5JA4 D;  1V54 E;  3ESL A;  5FJY A;  4PS8 A;  4UQY A;  4XIF A;  2J4B A;  1NFI E;  5AN8 A;  4KVM A;  3NF1 A;  3WG7 E;  1NP7 A;  4A3T A;  2V0P A;  3NZS A;  1H2T C;  1H6O A;  4N3C A;  5A7D B;  5IY5 E;  4NQ0 A;  1Z3Y A;  2F37 A;  3D9M A;  2IU1 A;  3QNK A;  3AS4 A;  2R05 A;  3TGO A;  2RG8 A;  5JJ6 A;  2I6H A;  4EPZ A;  5ARF A;  4WNE A;  4BX8 A;  4CT0 A;  4DX2 A;  4GCO A;  1P5Q A;  5J08 A;  2WXP A;  4PS7 A;  1BI7 B;  4P29 A;  3HYM B;  3SBT B;  3HXF A;  1QBQ A;  3CK7 A;  1OT8 A;  3DSU A;  3C72 A;  4HOU A;  2WB2 A;  3C3R A;  1N11 A;  3E30 A;  2VGX A;  3ABK E;  1FT2 A;  1Z6T A;  3FP3 A;  3I4G A;  3T5X A;  2WM9 A;  4PDX A;  4OVV A;  1OWN A;  3G2S A;  3Q49 B;  4NIK A;  3V79 K;  4BTB A;  4GTM A;  4JXT A;  3BUA A;  3FTU A;  5KJK A;  4GZ5 A;  4I43 A;  1K8K G;  1A17 A;  4J8Y A;  1UG3 A;  4K5B A;  4ANU A;  3FHE A;  4CRW A;  4EEC A;  2R03 A;  4HFG A;  3TXN A;  2R02 A;  3TWT A;  3APC A;  2QYJ A;  3QDN A;  4J8F A;  4N5C A;  3SNX A;  4JC8 A;  2X6K A;  2J9Q A;  1OWP A;  3AJI A;  1MJ0 A;  3PZ1 A;  2I9C A;  2KZT B;  2BKG A;  3HDX A;  4C48 B;  3UIO C;  3WXX A;  5AQ9 A;  1RW2 A;  3GZ1 A;  4A3V A;  4B0Z A;  3ZGQ A;  1X5B A;  3KSQ A;  4G25 A;  5B3S E;  3J5P A;  3FY4 A;  3SD5 A;  5DIZ A;  4DLQ A;  2AXU A;  1JPL A;  2BED A;  4DX6 D;  3FUJ A;  4WNG A;  5BXU A;  3P2B A;  4J0U A;  3FUF A;  2X6H A;  2P9L G;  1SVX A;  4N2Q A;  3VLF A;  4G1T A;  1KLX A;  4LCT A;  1FVF A;  3BG1 B;  4I6J A;  1QYM A;  4J8E A;  4CYM D;  2DWZ A;  3I3N A;  3L54 A;  3ULY A;  4JHJ A;  3CKC A;  3NQP A;  1BI8 B;  1D8E A;  3G2T A;  5AJD A;  2OND A;  3AG2 E;  1OWL A;  2MOW A;  3AG3 E;  4N3A A;  4KXK B;  3IBE A;  3RSE G;  1OY3 D;  3PEU B;  5CBO A;  4HI8 A;  2Y4T A;  4DRX E;  3Q9U C;  4I6E A;  1SZA A;  2V5Q C;  2YQ8 A;  3MGB A;  3S7F A;  4BEP A;  4N5Q A;  3BU8 A;  4C9B B;  2WXJ A;  4U8Y D;  3URZ A;  5D2M C;  2I1K A;  4AJW A;  5JHA A;  3PNT B;  2CHW A;  3KAE A;  4IUL A;  4O1P A;  3ZVV A;  4FLB A;  1OUV A;  3RK6 A;  4CZ2 D;  1KZP A;  3SBS A;  4MBG A;  2IO3 C;  2E2E A;  3ONK A;  3P1U A;  3CVL A;  3SFX A;  2RKK A;  1FPP A;  3F6Q A;  2DYS E;  3U3W A;  4OAU C;  5ENQ D;  3OTN A;  2IEJ A;  1PY1 A;  4XZ4 A;  4DJA A;  2WMO A;  4LSZ E;  1MZC A;  1G3N B;  4A1S A;  5BT1 A;  3FH7 A;  4GTS A;  3ZEF A;  5G04 J;  1LTX A;  4HS2 A;  3PE4 A;  1JCS A;  3ZFW A;  3ZYM A;  4B8A A;  3FFL A;  3ABM E;  1BU9 A;  1AWC B;  3UIP C;  2L9B A;  1E7U A;  1OWO A;  2LUH A;  3OXF A;  3NZU A;  4Q96 A;  2C0L A;  2J4D A;  1NZN A;  2CG3 A;  2XEE A;  4A1G A;  4CT4 A;  5AAO A;  4NRH B;  3TWX A;  3G2W A;  2XPY A;  2WXK A;  5DBK A;  1TNO A;  2EIN E;  4JZY A;  1H2V C;  3NOC D;  3KEZ A;  4YDE A;  5B1B E;  4HOQ A;  3ULQ A;  4GYW A;  3ENE A;  4KBQ A;  4F53 A;  3MA5 A;  2PM6 A;  4Y6C A;  2XEH A;  3GYZ A;  3PZD A;  3UT8 A;  5FQ6 A;  3KEA A;  5BV1 A;  2YIN A;  3FUD A;  1KPS B;  5BV0 A;  2DCP A;  4FU3 A;  4CGW A;  3TG5 A;  2F8Y A;  4LNG A;  1OCZ E;  4CDN A;  4WUY A;  4F3V A;  3TWU A;  3E4B A;  3UKU G;  2AXZ A;  5JJ7 A;  2UWJ G;  2C0M A;  3PUK A;  1SA5 A;  2ZGG A;  3UM2 A;  2EIL E;  2H6H A;  3D9H A;  3RJV A;  3ZHE B;  4XKC A;  3DRA A;  3ZKJ A;  1GW6 A;  2V8S E;  1TN7 A;  4HOS A;  5BUZ A;  3VTY A;  3EHN A;  5EIB E;  3KD7 A;  4HLE A;  3EUV A;  3T8K A;  3QK0 A;  1FVH A;  3FU0 A;  1W3B A;  1Q2Z A;  4N2S A;  5G05 C;  5FQ4 A;  2AJA A;  3HVE B;  1HO8 A;  4XEI G;  3JXJ A;  3V30 A;  1B89 A;  1ZB1 A;  1NI1 A;  3CV0 A;  2DVW A;  3DST A;  3MYV A;  1HU3 A;  3UM3 A;  4JEH A;  5G55 A;  5T3R A;  2VGY A;  3ZRH A;  2IOS A;  1IKN D;  1NL4 A;  3CVW A;  5KNG A;  3CGH A;  4J8D A;  2NC9 A;  1MX6 A;  1EYH A;  1S64 A;  1YA0 A;  2KXP C;  4XX5 A;  2BTD A;  1N4Q A;  3CQG B;  4FLH A;  4GA2 A;  4FC8 A;  2XGO A;  4ILI A;  2ZIS A;  4U95 D;  2EQX A;  1U3C A;  2HR2 A;  5HS0 A;  2NSZ A;  4BT8 A;  5JJT A;  3Q75 A;  1N0Q A;  2IOL A;  3LS8 A;  3CVV A;  3QC1 A;  3D9L A;  1LF8 A;  4HQD A;  3I4R B;  5FQ8 A;  3KSL A;  1INZ A;  3SO8 A;  1JCQ A;  2KM4 A;  3JUI A;  4F6R D;  2VSN A;  3IV0 A;  1OCC E;  3CHM A;  3C3O A;  4YND A;  3VLD A;  1KT0 A;  2H6G A;  3ZXS A;  2WXN A;  3APF A;  5G04 C;  4I9C A;  2OOE A;  4IYP A;  4I2W A;  4U07 A;  3ZNG A;  4JVS A;  2NXP A;  4RLY A;  4X8Q A;  2GRQ B;  3Q7F A;  4HRL A;  5EX0 A;  3GW4 A;  3ZYK A;  2OCC E;  2MYO A;  5KNH D;  2WPV A;  3RU0 A;  5CER B;  2ION A;  2GRN B;  2WXI A;  3DSV A;  1E8Y A;  2WQ7 A;  2P9P G;  2A5U A;  3D9J A;  3UUX A;  1N9A A;  4HNA D;  4G8K A;  3OXL A;  3LEW A;  2J8S D;  3DXM G;  3ZYL A;  3SFY A;  3AAA C;  2VJ8 A;  2R17 C;  3D9P A;  2DZO A;  3RRN B;  3CK9 A;  2XCB A;  3RRM B;  1Z3X A;  4YDY A;  4EBA A;  3ISM C;  1HXI A;  3NAW A;  2X6F A;  4BET A;  2QYU A;  4LNB A;  2YHC A;  2PQN A;  2BUG A;  4GTV A;  3V31 A;  2OVB A;  3E33 A;  3UI2 A;  1KZO A;  2WXR A;  2WXF A;  4Q69 A;  4GPM A;  1HH8 A;  3T8M A;  3TWV A;  4JHR A;  2HE0 A;  4HRM B;  3B7T A;  4G2V A;  3R9M A;  2CG2 A;  3FTX A;  4J8S A;  3TWS A;  2XHE A;  1AP7 A;  4TXR A;  1QZ2 A;  2LSV A;  4GTR A;  2MRI A;  3MV3 B;  2FO1 E;  4Y6W A;  1Z5S C;  1TJF A;  4G8L A;  1XGW A;  1H2U A;  4KYO B;  1BD8 A;  4HXI A;  2V5F A;  2KAT A;  2L6J A;  5EKQ D;  4K0R A;  2FEZ A;  2P58 C;  4WWP A;  3ASD A;  2OV8 A;  5EYL A;  5HRY A;  3PS6 A;  5ENS D;  3R7R A;  5CCM A;  3RO3 A;  4GA0 A;  3HRA A;  2XCC A;  5ARG A;  2WVI A;  4U7E B;  2HYZ A;  2X6J A;  5JHB A;  4YVQ C;  3IKO B;  4DX7 D;  2LSU A;  3CHO A;  3L82 A;  3RIB A;  3MEK A;  3DEO A;  4GYY A;  4U8V D;  4IN3 B;  2ETB A;  3EIQ C;  3SFZ A;  2ILR A;  2OEV A;  3FUI A;  2L0T B;  4GPK A;  1K1A A;  2EIM E;  1NA3 A;  5G05 J;  3ZPJ A;  2JEK A;  3CHR A;  1ZU2 A;  2VSX E;  4GZ3 A;  4N3B A;  3SHF A;  3NBN B;  1EPU A;  4GCN A;  2ETC A;  3BQO A;  4XI0 A;  3LXU X;  4XKB A;  5EDS A;  1V55 E;  3EDT B;  3ZN3 A;  4GTP A;  4EBA G;  2RD0 A;  2GRL A;  3W9G A;  5ENN A;  4HLL A;  3L6A A;  3ZW3 A;  4H7Y A;  3TG4 A;  2FF4 A;  3UM1 A;  4ACK A;  4UI9 K;  2ZGD A;  2IQC A;  4JA9 A;  4DLO A;  5AQ7 A;  1E8Z A;  4AM9 A;  3DSX A;  3JQ1 A;  4JL0 A;  1UN8 A;  4A63 B;  3N71 A;  5FQ7 A;  4G11 A;  2LXL A;  1N4P A;  1DCE A;  3R7Q A;  3HXD A;  4W9R A;  3B95 A;  1PAQ A;  3S2A A;  4BSZ B;  4E85 A;  3LCA A;  3PDN A;  4O6F A;  3S7B A;  1QNF A;  4MRU A;  4L1B A;  4JD2 G;  3RRU A;  1IHG A;  3MKQ B;  1DNP A;  2J49 A;  1ELR A;  4RG6 A;  2FBN A;  4D10 C;  3CVU A;  5AQB A;  3R9A B;  3LVR E;  3GZ2 A;  5A6C A;  3MJW A;  3FTW A;  2A5E A;  3JXI A;  3L9T A;  3UT4 A;  2FI7 A;  3PVL A;  4B93 B;  4AV7 A;  3ZYQ A;  3Q7A A;  3CHQ A;  1WY6 A;  3PNL B;  3D9O A;  3PRE A;  2XZD G;  2LNI A;  3CVN A;  3ZUV B;  2PM7 A;  5ENO D;  3FDH A;  4B89 A;  2IFU A;  3UPV A;  3ASN E;  3QWV A;  1EDU A;  2DYR E;  3TL5 A;  3AG1 E;  3V2O A;  2Y1L E;  3CQC B;  4K5C A;  3IHV A;  4I17 A;  4F1S A;  2BKK B;  1HFA A;  4JB8 P;  3S7J A;  3E37 A;  4AIF A;  4KZ0 A;  5HI7 A;  4AEZ C;  4URK A;  3EU5 A;  5HQ8 A;  4ACL A;  4KMO A;  4OAV B;  3UQ3 A;  3V2X A;  2CFU A;  3UM0 A;  3S7D A;  2IY0 C;  1HG2 A;  1HX8 A;  1IYG A;  2WXG A;  2C2L A;  1Y6I A;  1YMP A;  3IXE A;  4APO A;  3FUH A;  3PZ4 A;  4GU5 A;  2AW6 A;  2GRR B;  3AG4 E;  3FU5 A;  3CIA A;  2J08 A;  2ZU6 B;  3UX4 A;  4AOF A;  1MHQ A;  3Q47 B;  3PE3 A;  2A4Z A;  3CSF A;  1O1R A;  2CFZ A;  3CR3 A;  2Y0B G;  5LP0 A;  3TJP A;  3Q5M A;  3E32 A;  5D0Q D;  3BG0 B;  3QKY A;  3QWP A;  4GZ6 A;  1HE8 A;  3QB2 A;  3DSS A;  1LD8 A;  2KZT A;  1D8D A;  4DX5 D;  1JUQ A;  3B13 A;  1H19 A;  4IRU A;  5FZS A;  2Y3A A;  4K03 A;  1KT1 A;  4UWL A;  5EN5 D;  3ONL A;  4U0U A;  4EZL A;  3QWW A;  3DPY A;  1EF1 C;  1SZ9 A;  3ULE G;  3LY7 A;  4O1O A;  2Y4U A;  4LEU A;  1IQR A;  4DX1 A;  1ZBP A;  4B94 A;  5CMW A;  1TEZ A;  4U8H A;  3FUE A;  3PZ2 A;  5D0O D;  3ZIM A;  4TRQ A;  4O60 A;  3CST A;  5AEN A;  4LUN U;  2XGS A;  4WWN A;  3DXK G;  3UIN C;  3HXE A;  2QFC A;  4BT9 A;  3CKB A;  3ASF A;  2XS1 A;  5AQA A;  3UKR G;  2NYJ A;  2X3M A;  5ENR D;  4YDO A;  2WXO A;  1PC2 A;  3PUJ A;  5FWQ A;  3FUM A;  2VYI A;  1N4R A;  3MKR A;  3LY8 A;  2WQ6 A;  5ENP D;  4C0E A;  2GRP B;  2VSO E;  3D9K A;  1FCH A;  3ML9 A;  4M7C A;  3W9F A;  3O4Z A;  4GYO A;  5D66 A;  4LRZ A;  2HM8 A;  3C98 A;  3FWV A;  3FEY A;  4BFR A;  3D3M A;  3L22 A;  1OCO E;  5FTP A;  4HRN A;  4ABN A;  4U04 A;  1HF8 A;  5AIJ A;  3MKQ A;  1BLX B;  5CCL A;  3FUN A;  3JUE A;  5CBN A;  3K9I A;  4DI3 A;  2WMN A;  2CHZ A;  4ATG A;  5BPP A;  3HIZ A;  1MQS A;  2H6I A;  3ZXP A;  4TUU A;  3ABL E;  3LDZ A;  2I2O A;  2GW1 A;  4QFV A;  2PQR A;  2P9I G;  1WM5 A;  4CCA A;  3EHR A;  4UWF A;  4UQZ A;  2XPI A;  3I5P A;  3ASH A;  4GMJ A;  4I6G A;  3FTV A;  4Z68 A;  2LAH A;  5G2N A;  2HO1 A;  4LER A;  1N95 A;  2ZXW E;  1Y8M A;  3RO2 A;  2VTB B;  4ANW A;  3OXG A;  1YCS B;  1OWM A;  2P2C P;  2ZIR A;  5J90 A;  1S70 B;  2XRZ A;  4JEU A;  3EU9 A;  4WAF A;  5A23 A;  3IEG A;  4FUL A;  5BXO A;  5CEA A;  4GML A;  5T8I A;  3AU5 A;  2GRM A;  1QQE A;  3DSW A;  3SZ7 A;  4YDW A;  2PNN A;  3APD A;  1UJK A;  1JWF A;  3QAQ A;  2X6I A;  2F0Y A;  4AP2 A;  2KCV A;  3CVP A;  4BY6 A;  2R59 A;  2UY1 B;  4GMR A;  4AVX A;  1YYH A;  3FH8 A;  2JLB A;  2KCK A;  3NOG D;  3T5V A;  4UWH A;  1E96 B;  4DK5 A;  1WDY A;  4U0S A;  4L2L A;  1L5J A;  4XE0 A;  3PEV B;  1LD7 A;  2VQ2 A;  1WAO 1;  3TXM A;  3D9I A;  2WXL A;  2WXH A;  5ENT D;  4WNF A;  4CEM A;  4UWK A;  1UJJ A;  4NAC A;  2H6F A;  1E90 A;  3ESK A;  4FP7 A;  1SQM A;  3FTZ A;  4G24 A;  2F8X K;  1JWG A;  4FJZ A;  2EIK E;  2M63 A;  2RFM A;  3ZHE A;  4F1P A;  4J6I A;  4BWR A;  4FAD A;  2QY7 A;  4RG9 A;  3VTX A;  4GA1 A;  3CVY A;  4ZHB A;  1HZ4 A;  2XGM A;  4FA6 A;  3HVE A;  2LXM A;  3MZL B;  3D9N A;  3AU4 A;  5LCW C;  2J09 A;  1TN8 A;  2R2L A;  3B7S A;  2GGF A;  3FU3 A;  4FJY A;  4LG6 A;  4H7X A;  5ITZ F;  3AS5 A;  4HI9 A;  3LY9 A;  1TR4 A;  5EIL A;  1TJC A;  4F7A A;  4L7T A;  3JYS A;  2R5S A;  3HG0 D;  5E76 A;  1IXV A;  3HXC A;  3BEE A;  5B1A E;  4CDM A;  4MKT A;  3EHQ A;  1X81 A;  3FTY A;  5FT9 A;  1MYO A;  1WG0 A;  1N4S A;  4EQF A;  3U64 A;  5CED B;  3AS8 A;  3Q79 A;  4E6H A;  2PZI A;  1VDY A;  4OYS A;  2ETA A;  1OCR E;  2WQH A;  4BER A;  4EZJ A;  1K3Z D;  3RAU A;  1S63 A;  1UW4 B;  3KS2 A;  5AAR A;  1K1B A;  3SQV A;  4L9P A;  5KJL A;  4ANX A;  5FZR A;  3Q4A B;  2B6C A;  3UXG A;  1RZ4 A;  4PH4 B;  2IO2 C;  4HOR A;  5KJN A;  3SGH A;  3L08 A;  4ANV A;  2PL2 A;  4I9E A;  4HVB A;  4KT6 B;  4PUC A;  2P9N G;  2LAI A;  3DBS A;  4HBD A;  1O1T A;  4JW1 A;  4KZC A;  4BSX A;  4UUC A;  4GB9 A;  2MHK A;  4WWO A;  3E34 A;  4A55 A;  4ME2 A;  3G2U A;  5ANR A;  2Q7F A;  1D9S A;  1U3D A;  3DPD A;  1NA0 A;  3L16 A;  1H0A A;  3FH5 A;  4UI9 C;  2X38 A;  3U9W A;  1E8X A;  5AYW D;  3C3Q A;  4M3O A;  3MCX A;  3FUK A;  3L13 A;  2JAB A;  4GZD A;  1O5M A;  3B7R L;  4DUI A;  3ML8 A;  4I2Z A;  3LJ3 A;  5FIN A;  3Q15 A;  3RKV A;  1TNB A;  2DBA A;  2KC7 A;  4RVB A;  2QZA A;  2VTB A;  1E8W A;  4AY5 A;  4GTQ A;  2RFA A;  5LOZ A;  4BX9 A;  4JPS A;  1OXJ A;  4WND A;  4TUM A;  4XI9 A;  4DI4 A;  3MV2 B;  4KVO A;  4TV3 A;  2V4H C;  4RQI A;  2XEN A;  4K5A B;  4ZFH A;  1DVP A;  2QC9 A;  4I1O B;  5CRU A;  3SY2 A;  4FHK A;  1SW6 A;  3ASO E;  4NUR A;  3QOU A;  3PH0 C;  5H7P A;  2AVP A;  3SF4 A;  2L6B A;  4BTA A;  5KWD A;  3CVQ A;  4GZC A;  4RSY A;  2UY1 A;  3CEQ A;  4U96 D;  3CHS A;  1TNZ A;  1TNU A;  3FTS A;  5T4Y A;  4TXQ A;  3FUL A;  4FHJ A;  4TXP A;  3U66 A;  3FU6 A;  4DPR A;  3TWR A;  5CEC B;  2BF0 X;  5KCM A;  4G23 A;  2E0I A;  5LFA A;  2OEW A;  1N94 A;  2VGX B;  5C2Y A;  1U2V G;  3NB2 A;  4GTO A;  4HOT A;  2AWI A;  3UTM A;  1SA4 A;  3EJN A;  2XRY A;  1N52 A;  2YNQ A;  3IHY A;  1XNF A;  3LYA A;  1TN6 A; 
#chains in the Genus database with same CATH homology
 2F37 A;  4JB8 P;  2J8S D;  4DX1 A;  5CED B;  2KXP C;  3LJN A;  3F6Q A;  2ZGD A;  2F8Y A;  3TWW A;  3J5P A;  5HKP A;  4OAU C;  5ENQ D;  5AQ7 A;  5ENT D;  5EYL A;  5HRY A;  1BLX B;  1MX2 A;  3Q9N C;  3J5Q B;  5ENS D;  2RFA A;  2ETA A;  3AAA C;  3JUE A;  4OAV B;  5CBN A;  3V2X A;  4BER A;  4LSZ E;  4U95 D;  3C5R A;  1G3N B;  3HRA A;  4TUM A;  5HS0 A;  2DZO A;  3TWU A;  4DX6 D;  5BXU A;  4A63 B;  4DX2 A;  4O60 A;  1K3Z D;  1DC2 A;  1N0Q A;  3DEP A;  5EID A;  4DX7 D;  4QFV A;  1SVX A;  2F8X K;  4BES A;  5AAR A;  2V4H C;  5FIO A;  2XEN A;  1BI7 B;  4YDY A;  4K5A B;  1K1B A;  3EHR A;  4ZFH A;  5JMN D;  2RFM A;  1A5E A;  4HQD A;  2QC9 A;  4F1P A;  3B95 A;  2VGE A;  4BET A;  1SW6 A;  4BSZ B;  3SO8 A;  1OT8 A;  3UXG A;  2ZGG A;  1AWC B;  4Z68 A;  1BU9 A;  1QYM A;  3DEO A;  4CYM D;  4F6R D;  2DWZ A;  1N11 A;  1YMP A;  3V31 A;  3D9H A;  5AQA A;  3IXE A;  2L6B A;  3UI2 A;  2NYJ A;  4U8V D;  2DZN A;  2ETB A;  5ENR D;  5KWD A;  3ZKJ A;  4ZHB A;  1BI8 B;  4GPM A;  1UOH A;  3TWV A;  1K1A A;  2HE0 A;  4NIK A;  5EIB E;  3V79 K;  4LNU D;  4U96 D;  1YCS B;  4HRM B;  2XEE A;  2P2C P;  3T8K A;  3TWQ A;  1S70 B;  4HBD A;  3EU9 A;  4ATZ D;  5AAO A;  5KBA A;  1IHB A;  2Y0B G;  5AQB A;  1DCQ A;  4UUC A;  3TWS A;  3TWX A;  5BXO A;  4LG6 A;  5EYP F;  5CEA A;  5ITZ F;  1AP7 A;  4J8Y A;  5ENP D;  1OY3 D;  3B7B A;  3NBN B;  4K5B A;  2AJA A;  4HI8 A;  3T9K A;  5CBO A;  4HI9 A;  4DRX E;  1D9S A;  2KBX A;  3Q9U C;  1N0R A;  3ZNG A;  2ETC A;  1TR4 A;  3JXI A;  2A5E A;  5EIL A;  3JXJ A;  4YDW A;  2V5Q C;  3V30 A;  3ZU7 B;  2PNN A;  3NOC D;  4RLY A;  2XZT G;  4QQI A;  3TWR A;  5CEC B;  3TWT A;  4BEP A;  4DX5 D;  4B93 B;  2FO1 E;  2B0O E;  2DVW A;  4HRL A;  3W9F A;  4N5Q A;  4G8L A;  2QYJ A;  3HG0 D;  4J7W A;  2MYO A;  2XZD G;  1IXV A;  5KNH D;  5JA4 D;  5D66 A;  3ZUV B;  1BD8 A;  5EN5 D;  5CER B;  4U8Y D;  5ENO D;  3AJI A;  1MJ0 A;  3EHQ A;  2BKG A;  4GMR A;  1YYH A;  2JAB A;  1NFI E;  3W9G A;  4C48 B;  4HLL A;  5AN8 A;  2XEH A;  4O1P A;  4HB5 A;  3UTM A;  3KEA A;  5AQ9 A;  1IKN D;  3V2O A;  3NOG D;  4CZ2 D;  5KNG A;  2Y1L E;  1MYO A;  1MX4 A;  1WG0 A;  4K5C A;  4DUI A;  4O1O A;  4HRN A;  1WDY A;  2BKK B;  1MX6 A;  5FIN A;  4HNA D;  4G8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...