2DZOA

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
228
Chain Sequence
MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
total genus 61
structure length 228
sequence length 228
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2dzoA00
2JABA 2Y0BG 1YCSB 1BI7B 4J7WA 4K5CA 2FO1E 1DC2A 2QYJA 4DX2A 1SVXA 3NOCD 1OT8A 5EIDA 2ETAA 3ZNGA 5AAOA 2KXPC 2L6BA 5JMND 4BERA 2XEEA 1IXVA 1BLXB 4DX1A 2Y1LE 4BEPA 1BD8A 1YYHA 5KNHD 4A63B 4DUIA 4GMRA 4YDWA 2XEHA 4ZHBA 5ITZF 3TWXA 5AN8A 3EHQA 4U95D 2A5EA 3SO8A 2ETBA 4O1OA 1MX6A 3V31A 3LJNA 5CEAA 5HS0A 4OAVB 5ENRD 4HI9A 4N5QA 5KWDA 2F8XK 1OY3D 3V79K 1MYOA 1MX2A 1SW6A 3EHRA 3HG0D 3Q9UC 1BI8B 3C5RA 3KEAA 5EYLA 4HRNA 1S70B 5FINA 3EU9A 4BSZB 1MJ0A 5HKPA 4HI8A 3DEOA 5AQBA 3F6QA 3J5PA 2ZGGA 4B93B 1WDYA 3UXGA 5FIOA 4C48B 2NYJA 4O60A 2HE0A 5EIBE 4UUCA 3TWSA 4F1PA 4J8YA 1K1AA 1N0RA 2ZGDA 1D9SA 2V4HC 3HRAA 2AJAA 4HB5A 3JXIA 4HQDA 4YDYA 3V30A 4NIKA 3AJIA 4LNUD 2DWZA 1DCQA 4HLLA 3NOGD 4BETA 3JXJA 3W9GA 5EN5D 3V2OA 5CBOA 4HRLA 2BKGA 1A5EA 1AP7A 4G8LA 5ENSD 5AQ9A 2MYOA 4HNAD 2BKKB 2XZDG 5AARA 3NBNB 2J8SD 4K5AB 4TUMA 3ZKJA 1N11A 4U8VD 5KBAA 1BU9A 1IKND 3AAAC 2V5QC 4ZFHA 5BXOA 2RFAA 3T9KA 5CERB 5ENTD 5CECB 4OAUC 1UOHA 5AQ7A 5JA4D 4DRXE 3W9FA 2XZTG 4DX5D 5CBNA 3B7BA 3TWUA 2VGEA 4K5BA 3ZU7B 1AWCB 5ENQD 3D9HA 4CYMD 5BXUA 1K3ZD 3TWRA 1G3NB 2PNNA 3JUEA 5ENOD 3V2XA 4Z68A 4QFVA 2F37A 2F8YA 3UI2A 3DEPA 4DX6D 5AQAA 2ETCA 4ATZD 4F6RD 4U96D 1N0QA 1TR4A 1QYMA 5EYPF 3IXEA 1WG0A 3TWWA 5KNGA 4JB8P 4BESA 1NFIE 4G8KA 1K1BA 4O1PA 1IHBA 4U8YD 5D66A 3TWTA 4DX7D 5EILA 3ZUVB 4QQIA 3J5QB 4GPMA 5HRYA 2RFMA 2B0OE 3Q9NC 1MX4A 4CZ2D 2DZNA 2P2CP 2XENA 5ENPD 3TWQA 2QC9A 3TWVA 4LSZE 5CEDB 4LG6A 4HRMB 4HBDA 1YMPA 3T8KA 2DZOA 4RLYA 2KBXA 3B95A 2DVWA 3UTMA
chains in the Genus database with same CATH superfamily
1GW6A 3EU5A 4GA0A 3QOUA 5EX0A 2IF4A 2KXPC 4F3VA 3E33A 2XQ0A 4DUIA 1H6KA 4JD2G 4G23A 1NZNA 1OY3D 3EHRA 4R7LA 3VLEA 1H19A 5FINA 3EU9A 3RAUA 3DBSA 4J6IA 3UXGA 2IU1A 3NZSA 3I4GA 3ZRHA 4BX9A 3CVUA 2XRYA 4IN3B 4G1TA 4CGWA 4H7YA 3QJZA 3LVQE 4GYOA 1OCRE 3HXBA 1PY1A 3QWPA 2NC9A 5JA4D 4JW1A 5HI7A 3ULQA 4AXHA 4YDEA 3TWUA 2I2OA 3CK8A 1Y8MA 2PQRA 3ZYQA 1D8DA 4M3OA 3EHMA 4F7AA 2F8YA 3UI2A 2ETCA 4WNGA 3X2QE 5KNGA 4I17A 5DIZA 3ZEFA 5IY5E 3ABLE 1WM5A 3TG5A 2AW6A 4AY6A 5HQ8A 5LCWJ 2V0PA 2YQ8A 4I1OB 3PUJA 3ONLA 4LNGA 5ARFA 2M63A 2NXPA 4AIFA 2X3MA 3DPDA 2HM8A 2WXPA 3D9OA 4JA7A 1S70B 1PAQA 2WM9A 5AJLA 4JVSA 1WDYA 4A1GA 1A17A 1K1AA 3KEZA 4J8YA 1L5JA 3HRAA 5B1BE 1DCQA 4DJAA 1JWFA 3V2OA 2BKKB 5ARGA 4BWRA 3ZYLA 4ILHB 3ML9A 2P9LG 3UT8A 4XE0A 2RFAA 3ASFA 1LTXA 3D9LA 3CSFA 4U0ZA 3FFLA 3FU6A 4N2SA 3R7QA 3PRZA 4YVOA 2QZAA 3EHNA 1H2TC 5CMWA 4U0SA 4NRHB 3ZHEA 2CHXA 4DX6D 2OOEA 4DLQA 1QYMA 3MKRA 3ML8A 3CV0A 3VTXA 3HXFA 3QDNA 1KLXA 4J8SA 4WUYA 5G2NA 3FWVA 4V3IA 5EKQD 2WXJA 3UT4A 3EUVA 4CCAA 2ILRA 1O1TA 4RG9A 3HXCA 1BLXB 4F1SA 3FHEA 3CHMA 3MJWA 4YDWA 2L9BA 4L2LA 2WXMA 5EX3A 5HS0A 3Q49B 2C0MA 1TNBA 4UQXA 4HRNA 3UMVA 2LNIA 2BTDA 4GA1A 5H7PA 4YDYA 4KZ0A 4NIKA 2R02A 1W3BA 3JXJA 4AJWA 4UQYA 1SZ9A 5AQ9A 5FZSA 3E37A 4IYPA 4I6GA 3L17A 5AJDA 2VSNA 2L0TB 1TNZA 2XRZA 1INZA 4DRXE 3E34A 1AWCB 3P1UA 3FY4A 2VGXA 4I2WA 3PZ1A 3Q75A 2OVFA 2OEWA 1S63A 1Z3XA 2GROB 3DXKG 1E8ZA 3IHVA 4U63A 5A23A 1N4PA 4WAFA 3G2SA 3OXFA 4UI9J 4BY6A 3GZ2A 4GPMA 2GRMA 5FQ6A 4CRWA 3MV2B 4UQZA 2P2CP 2VSOE 3Q47B 1FVFA 4B0ZA 1QNFA 4TXQA 3DWLG 5ANLA 2R05A 2H6GA 1IXVA 4HOQA 4KT6B 2I1JA 3MCXA 4L9PA 4DPRA 3PNTB 5CCMA 1OWNA 1HO8A 5KWDA 3UINC 3C5RA 3CVPA 3R9AB 4B8AA 1MJ0A 3ZVVA 4ATGA 2VJ8A 2WXIA 1ELWA 4W9RA 2AJAA 4UWGA 3QARA 2ONDA 4U8HA 3SFZA 2EIME 5T4YA 4BETA 3TJPA 1A5EA 2BKGA 2ZIRA 3ISMC 4G8LA 3FUFA 2WXRA 5FT9A 4TUMA 3ZKJA 1DNPA 3LPZA 3NAWA 2DYRE 4Q94A 3MGBA 3AU5A 3PE4A 3SHFA 4FU3A 5T8IA 3TWRA 2XPZA 1OCCE 2AXVA 3LJ3A 3V2XA 3I5PA 3ULYA 5JHAA 2DIWA 1N0QA 3IXEA 3TWWA 2VSXE 3L22A 1IHBA 5A7DB 1WAO1 3LDZA 2IONA 3D9PA 4CEMA 2OVBA 2WQHA 4JHRA 3RRUA 4I6EA 2HYZA 3ASDA 3HDXA 4FLBA 3KSQA 5KJMA 1SVXA 3BUAA 3S7JA 4TXRA 2XEEA 4FADA 4APOA 1FCHA 2J4BA 2QYUA 2IEJA 1OWMA 3Q7FA 5CEAA 2R17C 4F53A 1MX2A 4GCNA 4BSZB 3C3QA 2YINA 2AWIA 1D8EA 2AVPA 2NYJA 2DCPA 2VGYA 4UI9C 3CHOA 3ESKA 3TWSA 4F1PA 5BV1A 2V4HC 5FTPA 5FWQA 3V30A 4OVUA 4LNUD 3S7DA 3FUDA 3L54A 3PZDA 4GYYA 4HRLA 3PVLA 1E8XA 3NBNB 4GTRA 3HYMB 2Q7FA 2WVIA 2YNQA 4GZDA 4M7CA 3DSWA 3TL5A 3SFYA 2Y4TA 1HXIA 1XNFA 1K3ZD 5J90A 4Y6CA 4HLEA 3D9NA 2GRPB 4L7TA 3FDHA 4JB8P 4G8KA 4DX7D 4GAAA 3QWVA 1MX4A 3Q4AB 4Y6WA 4A1SA 4GMLA 4DK5A 3E32A 4LSZE 3ZW3A 3B7RL 3T8KA 2FO7A 3APFA 5BW8C 1YA0A 3ENEA 3RSEG 3E4BA 3PNLB 2DBAA 3FTWA 2PL2A 1BD8A 4CGVA 4A63B 5AN8A 2HR2A 4CT4A 2ETBA 2EINE 3LJNA 3FH8A 3DSXA 1TN8A 3D9MA 1JCQA 1WY6A 4FJYA 1E7UA 2BF0X 1OWOA 3DEOA 3PH0C 4EPZA 4O60A 4UUCA 4HB5A 2DWZA 5EN5D 3CQCB 2V8SE 4C0MA 3D9KA 2J8SD 4WNEA 4A3TA 3I4RB 1N11A 2WXHA 2JEKA 3ASGA 1HF8A 2PM7A 4JHJA 3ZGQA 5CBNA 3D9HA 3CK7A 1FVHA 1KZOA 1UJKA 1U3CA 2GRNB 4FP7A 1OCZE 2H6FA 5FZQA 3AG4E 5KJNA 1RW2A 2LXMA 3Q73A 4AP2A 5CCLA 4A55A 2FI7A 4OYSA 1U3DA 5CMYA 4JPSA 1HG2A 2CHZA 5EILA 3PZ3A 4E85A 3QWWA 3TWXA 4AM9A 3FP3A 2L6BA 2WXOA 3CGHA 3LVRE 3ZYMA 3UQ3A 5ITZF 4CDNA 1E90A 3KSLA 4O1OA 1MX6A 4GCOA 2LSVA 2VTBB 2KM4A 4N5QA 1TN6A 1HE8A 2PM6A 3L82A 5D2MC 4PS8A 3FEXA 1OUVA 3J5PA 2WQ6A 3CKBA 5KJLA 4AVXA 3CHSA 1N0RA 5E76A 3CLJA 3LY9A 4AY5A 2LO6A 3QNKA 4EZKA 4K5AB 4ANVA 3SZ7A 3CVQA 5ANRA 4H7XA 2XCBA 2CFUA 1ZU2A 4BX8A 4G26A 1N4QA 3MX3A 3UIPC 1SA5A 2HO1A 5ENOD 1ZB1A 4EBAG 3FUIA 5C1DA 1HS6A 5D0OD 2IFUA 3CVVA 4PUCA 2XGSA 1X5BA 5T3RA 4C9BB 3ZXPA 2KCVA 3ZUVB 4JZYA 2P9IG 2B0OE 2MOWA 4RSYA 2J9QA 2XENA 1ELKA 4GU5A 1KPSB 1RZ4A 1OT8A 1TNYA 5D0QD 5AAOA 3RU0A 4FA6A 1JCRA 1YYHA 3T8MA 4KVMA 2CG3A 3WG7E 4I9EA 2A5EA 2X6JA 3T5XA 1BPOA 3SO8A 3TXMA 1DCEA 3KD7A 2GRQB 3F6QA 4B93B 1N4SA 4AOFA 4MS6A 3Q79A 3UT7A 5JHBA 2KCKA 3RRMB 3C3RA 1IYGA 3PE3A 3FULA 5G05J 3DSVA 2P9SG 5ENTD 2NSZA 1KT1A 2FULA 1MQSA 2XZTG 3ZYKA 3URZA 4HOTA 1JPLA 5ENQD 3CVWA 3MA5A 2J09A 4WNDA 1TR4A 2L0IA 4JEHA 5B3SE 5E75A 2ZU6B 3B7UX 2BEDA 3DRAA 1E96B 3JQ0A 2P9KG 3RO2A 5CEDB 4LG6A 3MEKA 5EDSA 3ZHEB 3KS2A 3D9IA 3VLDA 2KBXA 4XKBA 2FO1E 4J7WA 3L9TA 4D10C 2A5UA 2LXLA 2E2EA 3GZ1A 4DX1A 5G05C 4J8FA 4C0EA 4BFRA 4FLHA 3SF4A 4GMJA 1E7VA 3Q9UC 1BI8B 3KEAA 4NURA 1P5QA 3SQVA 5HKPA 4HI8A 5AQBA 3ASHA 2OCCE 3GYZA 4I43A 3VLFA 2UWJG 4X8QA 1IQRA 3SI5A 1SZAA 3IV0A 4YDOA 3ZFWA 1OXJA 3FUKA 3PS6A 3UX4A 2UY1A 3MV3B 1UN9A 3FUEA 1IKND 4EHMA 2XHEA 4DX5D 4BTAA 2VGEA 2R03A 4K5BA 3TGOA 3D3MA 3CSTA 4N39A 4G11A 5LCWC 3JUEA 4FC8A 1IQUA 3TXNA 3TG4A 3U64A 3L08A 2R5SA 2X6IA 4F6RD 4WWOA 3IEGA 1HX8A 4HVBA 5D66A 4GYWA 1DVPA 3ULEG 1OCOE 3MKQB 3QKYA 3FUMA 2QC9A 5A6CA 3QK0A 3QAQA 4HBDA 2C2LA 3DSUA 4P29A 3B95A 2RD0A 3ESLA 4GTMA 1TYQG 2PQNA 4BERA 4MBGA 4WWNA 3S7FA 3CVXA 4ZHBA 2IO3C 1ELRA 5JJ7A 4G24A 4L2YA 3SNXA 4ILGA 2P58C 4UI9K 1TNOA 4N3CA 2ZGGA 4XI0A 2VQ2A 3SBTB 4ACLA 1UG3A 2ZGDA 5ENNA 1D9SA 1B89A 3AJIA 4MKTA 3NOGD 3OTNA 1H6OA 3LEWA 3LXUX 4NQ0A 3FTUA 2WXNA 4EZJA 4I9CA 4U8VD 1QBQA 5KBAA 3MZLB 5G04J 1O1RA 5LFAA 3P2BA 3B7BA 5BUZA 2WMOA 2J07A 1O5MA 2MRIA 3JYSA 4CDMA 2PZIA 2IJGX 3DEPA 5AQAA 4XIFA 1UN8A 4O1PA 5B1AE 2ZXWE 1NA0A 4GTTA 5ENPD 4HXIA 4HRMB 4U0UA 1MZCA 2J49A 1N94A 4RLYA 2DVWA 4AEZC 1YCSB 4J0UA 2QYJA 4ME2A 3ZNGA 5FQ7A 4TXPA 1SQMA 3UUXA 1NP7A 2WQ7A 3UM0A 2Y1LE 3FTSA 1JWGA 4OAVB 3VTYA 4K03A 4GPKA 2ZISA 3FU3A 1E8WA 4KYOB 3B13A 2EIJE 1TNUA 5CHEE 3EJNA 3B7TA 5LX8A 2QY7A 5FZRA 5AYWD 4EBAA 2YHEA 4HNAD 5AARA 2EIKE 3AAAC 2V5QC 5BXOA 5JJTA 4OVVA 4PS7A 3I3NA 2XEVA 1U2VG 4MLPA 4UWFA 1X81A 4CYMD 2WXFA 4APFA 4BTBA 3SY2A 3HHMA 2EQXA 3U4TA 4QFVA 2XGOA 5DBKA 3KAEA 3OAWA 2XPYA 3R9MA 4KVOA 3O4ZA 3C72A 3ZPJA 1LF8A 3TWTA 1XGWA 4YVQC 4DLOA 2I9CA 3AG1E 5HRYA 3Q9NC 4CZ2D 4FHJA 2CG2A 3FU5A 1YMPA 2IQCA 4GTPA 3B7SA 3N71A 4IULA 4K5CA 2V4LA 4NACA 2RG8A 3NOCD 2R2LA 3SFXA 3BG1B 5J08A 4BEPA 2CHWA 4GMRA 2LAHA 3DXMG 3CKCA 1HG5A 4L23A 2Y4UA 1OWLA 4G25A 2F8XK 3V79K 1MYOA 4LRZA 2VSYA 4YNDA 3GW4A 3AU4A 4U04A 2BUGA 3AS5A 4U07A 3PEVB 2HE0A 3G2VA 3OXLA 5KCMA 2H6HA 5BPPA 4GB9A 1EPUA 1FT2A 4AV7A 2WXKA 4TUUA 2P9PG 4UWLA 3G2TA 4B94A 4J8EA 2QFCA 2AXUA 2KC7A 3LYAA 3PDNA 3R7RA 4GA2A 3FH5A 4ABNA 2WXGA 4WNFA 3ZXSA 2KZTA 1Z3YA 3CHRA 2XCCA 2KZTB 4XKCA 5FJYA 3PEUB 4N5CA 4XI9A 2XS8A 2XS1A 2WXLA 4BT8A 3NF1A 5BV0A 3HXEA 4ACKA 1JUQA 2X38A 1H6PA 1WG0A 4I6JA 4A3VA 3HVEB 4B89A 1TJCA 3J5QB 4LEUA 4PH4B 1EDUA 3DPYA 3TWQA 3Q5MA 2VTBA 3S2AA 2Y0BG 1DC2A 4XEIG 4N3AA 2ETAA 2X6KA 2GGFA 3DSSA 3AG2E 3NQPA 5KNHD 4U95D 5AENA 1Y6IA 4ILIA 5EYLA 3U66A 3E30A 3IKOB 1SA4A 3DSTA 3FU0A 1OWPA 3UIOC 4C48B 2J08A 5LP0A 4L1BA 2MHKA 4TRQA 3LCAA 4HLLA 4URKA 4EQFA 5CBOA 1VDYA 3NB2A 4IRUA 4GTSA 3UPVA 4RG6A 3ASOE 1KT0A 5G55A 1BU9A 3MYVA 5CRVA 4LNBA 5CECB 1UOHA 4KZCA 1H2UA 3Q15A 4HOUA 2A4ZA 3EDTB 3ZU7B 3D9JA 3MKQA 1LD8A 3NZUA 4BSXA 4ATZD 4U96D 4O6FA 3QC1A 4N2QA 1UW4B 4BESA 1NFIE 3L6AA 4DI4A 1K1BA 2GW1A 3Q7AA 4U8YD 3BG0B 2X6FA 3UM3A 2AXZA 3LS8A 2WPVA 2RFMA 3EIJA 3LY8A 4JHKA 3HXDA 3ABME 3TWVA 3K9IA 3UM1A 3GZSA 3CQGB 3IBEA 2FBNA 2Y69E 4DX2A 5BNWA 2EILE 1N52A 3RIBA 3BQOA 1IHGA 1Q2ZA 4KXKB 4I1MA 2RKKA 2KATA 3JCKC 3ABKE 5ENRD 3JUIA 2H6IA 3APCA 2Y3AA 3O48A 1HFAA 3RJVA 5FIOA 3FUNA 5EIBE 5CRUA 3CR3A 3LKUA 1KZPA 4UWHA 2L6JA 4HQDA 3RRNB 1PC2A 1AP7A 5ENSD 4DI3A 2MYOA 2IY0C 3CVLA 2VYIA 4GZCA 1HZ4A 4HS2A 1V54E 2LSUA 4N3BA 4ZFHA 4ANXA 3UKRG 3ZN3A 3CEQA 3L13A 1V55E 4G2VA 5FQ4A 3JQ1A 5FQ8A 1S64A 4FULA 3C98A 1EF1C 1QZ2A 2YHCA 5JJ6A 4KBQA 1H2VC 4E6HA 5EYPF 3BEEA 2OV8A 5C2YA 4JEUA 3U3WA 3ASNE 3HVEA 1Z6TA 3FUHA 3CHPA 1E8YA 2GRLA 4J8DA 3EIQC 1N54A 3UTMA 5BT1A 5EIDA 4UWKA 3Q78A 4GZ5A 2B6CA 3PZ4A 5JMND 1TJFA 3FH7A 3CK9A 2V5FA 2WB2A 3EHQA 2P9UG 3UM2A 3BU8A 2C0LA 4GZ6A 4HI9A 3HG0D 3RO3A 4MRUA 2X6HA 4U7EB 1LD7A 4JC8A 1K8KG 5KJKA 4JXTA 3U9WA 4Q69A 1QQEA 2XGMA 2E0IA 3W9GA 3AS8A 4PS3A 3FEYA 2XZDG 2F0YA 4Q96A 4ANUA 5G04C 3CIAA 4HFGA 3T9KA 1NA3A 3PREA 4OAUC 1EYHA 4HORA 3CHQA 1FT1A 2WXQA 4CT0A 3QB2A 1G3NB 3CVNA 3SBSA 2I6HA 4Z68A 4LERA 4JL0A 3SD5A 2F37A 4GTOA 3FUJA 4K0RA 4GZ3A 3HIZA 3APDA 2FF4A 2DYSE 5M72A 3FTXA 4HOSA 4FHKA 2OEVA 3WXXA 3OXGA 3FTYA 1NI1A 2DZOA 4LUNU 2JABA 1S0PA 3ZIMA 1BI7B 1TEZA 4XX5A 3FTZA 3L16A 2I1KA 4CDRA 1NL4A 2IO2C 2XEHA 3ONKA 3V31A 1Z5SC 2IOSA 1SW6A 4JA9A 2VGXB 1UJJA 1N95A 3IHYA 3G2WA 3RK6A 3TAXA 5LOZA 4I2ZA 2LAIA 3JXIA 4EECA 4ANWA 4RQIA 3PZ2A 1HH8A 2UY1B 3PUKA 4B8CB 1HU3A 3FTVA 4GTQA 1H0AA 4BT9A 5CERB 4KMOA 4I1AA 5AQ7A 3W9FA 5AIJA 2KCLA 2JLBA 2P9NG 4WWPA 5BXUA 4PDXA 2PNNA 1MHQA 2GRRB 3G2UA 3UKUG 1N9AA 3AG3E 3S7BA 4RVBA 3RKVA 3T5VA 3CVYA 1FPPA 1ZBPA 4EZLA 4TV3A 2LUHA 3SGHA 2FEZA 4GTVA 2R59A 1TN7A 2XPIA 3AS4A 3C3OA 2WMNA 4FJZA 2J4DA 4XZ4A 4QQIA 1N4RA 2IOLA 4LCTA 3LY7A 2DZNA 2CFZA 1JCSA 1O1SA
chains in the Genus database with same CATH topology
2JABA 2Y0BG 1YCSB 1BI7B 4J7WA 4K5CA 2FO1E 1DC2A 2QYJA 4DX2A 1SVXA 3NOCD 1OT8A 5EIDA 2ETAA 3ZNGA 5AAOA 2KXPC 2L6BA 5JMND 4BERA 2XEEA 1IXVA 1BLXB 4DX1A 2Y1LE 4BEPA 1BD8A 1YYHA 5KNHD 4A63B 4DUIA 4GMRA 4YDWA 2XEHA 4ZHBA 5ITZF 3TWXA 5AN8A 3EHQA 4U95D 2A5EA 3SO8A 2ETBA 4O1OA 1MX6A 3V31A 3LJNA 5CEAA 5HS0A 4OAVB 5ENRD 4HI9A 4N5QA 5KWDA 2F8XK 1OY3D 3V79K 1MYOA 1MX2A 1SW6A 3EHRA 3HG0D 3Q9UC 1BI8B 3C5RA 3KEAA 5EYLA 4HRNA 1S70B 5FINA 3EU9A 4BSZB 1MJ0A 5HKPA 4HI8A 3DEOA 5AQBA 3F6QA 3J5PA 2ZGGA 4B93B 1WDYA 3UXGA 5FIOA 4C48B 2NYJA 4O60A 2HE0A 5EIBE 4UUCA 3TWSA 4F1PA 4J8YA 1K1AA 1N0RA 2ZGDA 1D9SA 2V4HC 3HRAA 2AJAA 4HB5A 3JXIA 4HQDA 4YDYA 3V30A 4NIKA 3AJIA 4LNUD 2DWZA 1DCQA 4HLLA 3NOGD 4BETA 3JXJA 3W9GA 5EN5D 3V2OA 5CBOA 4HRLA 2BKGA 1A5EA 1AP7A 4G8LA 5ENSD 5AQ9A 2MYOA 4HNAD 2BKKB 2XZDG 5AARA 3NBNB 2J8SD 4K5AB 4TUMA 3ZKJA 1N11A 4U8VD 5KBAA 1BU9A 1IKND 3AAAC 2V5QC 4ZFHA 5BXOA 2RFAA 3T9KA 5CERB 5ENTD 5CECB 4OAUC 1UOHA 5AQ7A 5JA4D 4DRXE 3W9FA 2XZTG 4DX5D 5CBNA 3B7BA 3TWUA 2VGEA 4K5BA 3ZU7B 1AWCB 5ENQD 3D9HA 4CYMD 5BXUA 1K3ZD 3TWRA 1G3NB 2PNNA 3JUEA 5ENOD 3V2XA 4Z68A 4QFVA 2F37A 2F8YA 3UI2A 3DEPA 4DX6D 5AQAA 2ETCA 4ATZD 4F6RD 4U96D 1N0QA 1TR4A 1QYMA 5EYPF 3IXEA 1WG0A 3TWWA 5KNGA 4JB8P 4BESA 1NFIE 4G8KA 1K1BA 4O1PA 1IHBA 4U8YD 5D66A 3TWTA 4DX7D 5EILA 3ZUVB 4QQIA 3J5QB 4GPMA 5HRYA 2RFMA 2B0OE 3Q9NC 1MX4A 4CZ2D 2DZNA 2P2CP 2XENA 5ENPD 3TWQA 2QC9A 3TWVA 4LSZE 5CEDB 4LG6A 4HRMB 4HBDA 1YMPA 3T8KA 2DZOA 4RLYA 2KBXA 3B95A 2DVWA 3UTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAB A;  2Y0B G;  1YCS B;  1BI7 B;  4J7W A;  4K5C A;  2FO1 E;  1DC2 A;  2QYJ A;  4DX2 A;  1SVX A;  3NOC D;  1OT8 A;  5EID A;  2ETA A;  3ZNG A;  5AAO A;  2KXP C;  2L6B A;  5JMN D;  4BER A;  2XEE A;  1IXV A;  1BLX B;  4DX1 A;  2Y1L E;  4BEP A;  1BD8 A;  1YYH A;  5KNH D;  4A63 B;  4DUI A;  4GMR A;  4YDW A;  2XEH A;  4ZHB A;  5ITZ F;  3TWX A;  5AN8 A;  3EHQ A;  4U95 D;  2A5E A;  3SO8 A;  2ETB A;  4O1O A;  1MX6 A;  3V31 A;  3LJN A;  5CEA A;  5HS0 A;  4OAV B;  5ENR D;  4HI9 A;  4N5Q A;  5KWD A;  2F8X K;  1OY3 D;  3V79 K;  1MYO A;  1MX2 A;  1SW6 A;  3EHR A;  3HG0 D;  3Q9U C;  1BI8 B;  3C5R A;  3KEA A;  5EYL A;  4HRN A;  1S70 B;  5FIN A;  3EU9 A;  4BSZ B;  1MJ0 A;  5HKP A;  4HI8 A;  3DEO A;  5AQB A;  3F6Q A;  3J5P A;  2ZGG A;  4B93 B;  1WDY A;  3UXG A;  5FIO A;  4C48 B;  2NYJ A;  4O60 A;  2HE0 A;  5EIB E;  4UUC A;  3TWS A;  4F1P A;  4J8Y A;  1K1A A;  1N0R A;  2ZGD A;  1D9S A;  2V4H C;  3HRA A;  2AJA A;  4HB5 A;  3JXI A;  4HQD A;  4YDY A;  3V30 A;  4NIK A;  3AJI A;  4LNU D;  2DWZ A;  1DCQ A;  4HLL A;  3NOG D;  4BET A;  3JXJ A;  3W9G A;  5EN5 D;  3V2O A;  5CBO A;  4HRL A;  2BKG A;  1A5E A;  1AP7 A;  4G8L A;  5ENS D;  5AQ9 A;  2MYO A;  4HNA D;  2BKK B;  2XZD G;  5AAR A;  3NBN B;  2J8S D;  4K5A B;  4TUM A;  3ZKJ A;  1N11 A;  4U8V D;  5KBA A;  1BU9 A;  1IKN D;  3AAA C;  2V5Q C;  4ZFH A;  5BXO A;  2RFA A;  3T9K A;  5CER B;  5ENT D;  5CEC B;  4OAU C;  1UOH A;  5AQ7 A;  5JA4 D;  4DRX E;  3W9F A;  2XZT G;  4DX5 D;  5CBN A;  3B7B A;  3TWU A;  2VGE A;  4K5B A;  3ZU7 B;  1AWC B;  5ENQ D;  3D9H A;  4CYM D;  5BXU A;  1K3Z D;  3TWR A;  1G3N B;  2PNN A;  3JUE A;  5ENO D;  3V2X A;  4Z68 A;  4QFV A;  2F37 A;  2F8Y A;  3UI2 A;  3DEP A;  4DX6 D;  5AQA A;  2ETC A;  4ATZ D;  4F6R D;  4U96 D;  1N0Q A;  1TR4 A;  1QYM A;  5EYP F;  3IXE A;  1WG0 A;  3TWW A;  5KNG A;  4JB8 P;  4BES A;  1NFI E;  4G8K A;  1K1B A;  4O1P A;  1IHB A;  4U8Y D;  5D66 A;  3TWT A;  4DX7 D;  5EIL A;  3ZUV B;  4QQI A;  3J5Q B;  4GPM A;  5HRY A;  2RFM A;  2B0O E;  3Q9N C;  1MX4 A;  4CZ2 D;  2DZN A;  2P2C P;  2XEN A;  5ENP D;  3TWQ A;  2QC9 A;  3TWV A;  4LSZ E;  5CED B;  4LG6 A;  4HRM B;  4HBD A;  1YMP A;  3T8K A;  2DZO A;  4RLY A;  2KBX A;  3B95 A;  2DVW A;  3UTM A; 
#chains in the Genus database with same CATH topology
 1GW6 A;  3EU5 A;  4GA0 A;  3QOU A;  5EX0 A;  2IF4 A;  2KXP C;  4F3V A;  3E33 A;  2XQ0 A;  4DUI A;  1H6K A;  4JD2 G;  4G23 A;  1NZN A;  1OY3 D;  3EHR A;  4R7L A;  3VLE A;  1H19 A;  5FIN A;  3EU9 A;  3RAU A;  3DBS A;  4J6I A;  3UXG A;  2IU1 A;  3NZS A;  3I4G A;  3ZRH A;  4BX9 A;  3CVU A;  2XRY A;  4IN3 B;  4G1T A;  4CGW A;  4H7Y A;  3QJZ A;  3LVQ E;  4GYO A;  1OCR E;  3HXB A;  1PY1 A;  3QWP A;  2NC9 A;  5JA4 D;  4JW1 A;  5HI7 A;  3ULQ A;  4AXH A;  4YDE A;  3TWU A;  2I2O A;  3CK8 A;  1Y8M A;  2PQR A;  3ZYQ A;  1D8D A;  4M3O A;  3EHM A;  4F7A A;  2F8Y A;  3UI2 A;  2ETC A;  4WNG A;  3X2Q E;  5KNG A;  4I17 A;  5DIZ A;  3ZEF A;  5IY5 E;  3ABL E;  1WM5 A;  3TG5 A;  2AW6 A;  4AY6 A;  5HQ8 A;  5LCW J;  2V0P A;  2YQ8 A;  4I1O B;  3PUJ A;  3ONL A;  4LNG A;  5ARF A;  2M63 A;  2NXP A;  4AIF A;  2X3M A;  3DPD A;  2HM8 A;  2WXP A;  3D9O A;  4JA7 A;  1S70 B;  1PAQ A;  2WM9 A;  5AJL A;  4JVS A;  1WDY A;  4A1G A;  1A17 A;  1K1A A;  3KEZ A;  4J8Y A;  1L5J A;  3HRA A;  5B1B E;  1DCQ A;  4DJA A;  1JWF A;  3V2O A;  2BKK B;  5ARG A;  4BWR A;  3ZYL A;  4ILH B;  3ML9 A;  2P9L G;  3UT8 A;  4XE0 A;  2RFA A;  3ASF A;  1LTX A;  3D9L A;  3CSF A;  4U0Z A;  3FFL A;  3FU6 A;  4N2S A;  3R7Q A;  3PRZ A;  4YVO A;  2QZA A;  3EHN A;  1H2T C;  5CMW A;  4U0S A;  4NRH B;  3ZHE A;  2CHX A;  4DX6 D;  2OOE A;  4DLQ A;  1QYM A;  3MKR A;  3ML8 A;  3CV0 A;  3VTX A;  3HXF A;  3QDN A;  1KLX A;  4J8S A;  4WUY A;  5G2N A;  3FWV A;  4V3I A;  5EKQ D;  2WXJ A;  3UT4 A;  3EUV A;  4CCA A;  2ILR A;  1O1T A;  4RG9 A;  3HXC A;  1BLX B;  4F1S A;  3FHE A;  3CHM A;  3MJW A;  4YDW A;  2L9B A;  4L2L A;  2WXM A;  5EX3 A;  5HS0 A;  3Q49 B;  2C0M A;  1TNB A;  4UQX A;  4HRN A;  3UMV A;  2LNI A;  2BTD A;  4GA1 A;  5H7P A;  4YDY A;  4KZ0 A;  4NIK A;  2R02 A;  1W3B A;  3JXJ A;  4AJW A;  4UQY A;  1SZ9 A;  5AQ9 A;  5FZS A;  3E37 A;  4IYP A;  4I6G A;  3L17 A;  5AJD A;  2VSN A;  2L0T B;  1TNZ A;  2XRZ A;  1INZ A;  4DRX E;  3E34 A;  1AWC B;  3P1U A;  3FY4 A;  2VGX A;  4I2W A;  3PZ1 A;  3Q75 A;  2OVF A;  2OEW A;  1S63 A;  1Z3X A;  2GRO B;  3DXK G;  1E8Z A;  3IHV A;  4U63 A;  5A23 A;  1N4P A;  4WAF A;  3G2S A;  3OXF A;  4UI9 J;  4BY6 A;  3GZ2 A;  4GPM A;  2GRM A;  5FQ6 A;  4CRW A;  3MV2 B;  4UQZ A;  2P2C P;  2VSO E;  3Q47 B;  1FVF A;  4B0Z A;  1QNF A;  4TXQ A;  3DWL G;  5ANL A;  2R05 A;  2H6G A;  1IXV A;  4HOQ A;  4KT6 B;  2I1J A;  3MCX A;  4L9P A;  4DPR A;  3PNT B;  5CCM A;  1OWN A;  1HO8 A;  5KWD A;  3UIN C;  3C5R A;  3CVP A;  3R9A B;  4B8A A;  1MJ0 A;  3ZVV A;  4ATG A;  2VJ8 A;  2WXI A;  1ELW A;  4W9R A;  2AJA A;  4UWG A;  3QAR A;  2OND A;  4U8H A;  3SFZ A;  2EIM E;  5T4Y A;  4BET A;  3TJP A;  1A5E A;  2BKG A;  2ZIR A;  3ISM C;  4G8L A;  3FUF A;  2WXR A;  5FT9 A;  4TUM A;  3ZKJ A;  1DNP A;  3LPZ A;  3NAW A;  2DYR E;  4Q94 A;  3MGB A;  3AU5 A;  3PE4 A;  3SHF A;  4FU3 A;  5T8I A;  3TWR A;  2XPZ A;  1OCC E;  2AXV A;  3LJ3 A;  3V2X A;  3I5P A;  3ULY A;  5JHA A;  2DIW A;  1N0Q A;  3IXE A;  3TWW A;  2VSX E;  3L22 A;  1IHB A;  5A7D B;  1WAO 1;  3LDZ A;  2ION A;  3D9P A;  4CEM A;  2OVB A;  2WQH A;  4JHR A;  3RRU A;  4I6E A;  2HYZ A;  3ASD A;  3HDX A;  4FLB A;  3KSQ A;  5KJM A;  1SVX A;  3BUA A;  3S7J A;  4TXR A;  2XEE A;  4FAD A;  4APO A;  1FCH A;  2J4B A;  2QYU A;  2IEJ A;  1OWM A;  3Q7F A;  5CEA A;  2R17 C;  4F53 A;  1MX2 A;  4GCN A;  4BSZ B;  3C3Q A;  2YIN A;  2AWI A;  1D8E A;  2AVP A;  2NYJ A;  2DCP A;  2VGY A;  4UI9 C;  3CHO A;  3ESK A;  3TWS A;  4F1P A;  5BV1 A;  2V4H C;  5FTP A;  5FWQ A;  3V30 A;  4OVU A;  4LNU D;  3S7D A;  3FUD A;  3L54 A;  3PZD A;  4GYY A;  4HRL A;  3PVL A;  1E8X A;  3NBN B;  4GTR A;  3HYM B;  2Q7F A;  2WVI A;  2YNQ A;  4GZD A;  4M7C A;  3DSW A;  3TL5 A;  3SFY A;  2Y4T A;  1HXI A;  1XNF A;  1K3Z D;  5J90 A;  4Y6C A;  4HLE A;  3D9N A;  2GRP B;  4L7T A;  3FDH A;  4JB8 P;  4G8K A;  4DX7 D;  4GAA A;  3QWV A;  1MX4 A;  3Q4A B;  4Y6W A;  4A1S A;  4GML A;  4DK5 A;  3E32 A;  4LSZ E;  3ZW3 A;  3B7R L;  3T8K A;  2FO7 A;  3APF A;  5BW8 C;  1YA0 A;  3ENE A;  3RSE G;  3E4B A;  3PNL B;  2DBA A;  3FTW A;  2PL2 A;  1BD8 A;  4CGV A;  4A63 B;  5AN8 A;  2HR2 A;  4CT4 A;  2ETB A;  2EIN E;  3LJN A;  3FH8 A;  3DSX A;  1TN8 A;  3D9M A;  1JCQ A;  1WY6 A;  4FJY A;  1E7U A;  2BF0 X;  1OWO A;  3DEO A;  3PH0 C;  4EPZ A;  4O60 A;  4UUC A;  4HB5 A;  2DWZ A;  5EN5 D;  3CQC B;  2V8S E;  4C0M A;  3D9K A;  2J8S D;  4WNE A;  4A3T A;  3I4R B;  1N11 A;  2WXH A;  2JEK A;  3ASG A;  1HF8 A;  2PM7 A;  4JHJ A;  3ZGQ A;  5CBN A;  3D9H A;  3CK7 A;  1FVH A;  1KZO A;  1UJK A;  1U3C A;  2GRN B;  4FP7 A;  1OCZ E;  2H6F A;  5FZQ A;  3AG4 E;  5KJN A;  1RW2 A;  2LXM A;  3Q73 A;  4AP2 A;  5CCL A;  4A55 A;  2FI7 A;  4OYS A;  1U3D A;  5CMY A;  4JPS A;  1HG2 A;  2CHZ A;  5EIL A;  3PZ3 A;  4E85 A;  3QWW A;  3TWX A;  4AM9 A;  3FP3 A;  2L6B A;  2WXO A;  3CGH A;  3LVR E;  3ZYM A;  3UQ3 A;  5ITZ F;  4CDN A;  1E90 A;  3KSL A;  4O1O A;  1MX6 A;  4GCO A;  2LSV A;  2VTB B;  2KM4 A;  4N5Q A;  1TN6 A;  1HE8 A;  2PM6 A;  3L82 A;  5D2M C;  4PS8 A;  3FEX A;  1OUV A;  3J5P A;  2WQ6 A;  3CKB A;  5KJL A;  4AVX A;  3CHS A;  1N0R A;  5E76 A;  3CLJ A;  3LY9 A;  4AY5 A;  2LO6 A;  3QNK A;  4EZK A;  4K5A B;  4ANV A;  3SZ7 A;  3CVQ A;  5ANR A;  4H7X A;  2XCB A;  2CFU A;  1ZU2 A;  4BX8 A;  4G26 A;  1N4Q A;  3MX3 A;  3UIP C;  1SA5 A;  2HO1 A;  5ENO D;  1ZB1 A;  4EBA G;  3FUI A;  5C1D A;  1HS6 A;  5D0O D;  2IFU A;  3CVV A;  4PUC A;  2XGS A;  1X5B A;  5T3R A;  4C9B B;  3ZXP A;  2KCV A;  3ZUV B;  4JZY A;  2P9I G;  2B0O E;  2MOW A;  4RSY A;  2J9Q A;  2XEN A;  1ELK A;  4GU5 A;  1KPS B;  1RZ4 A;  1OT8 A;  1TNY A;  5D0Q D;  5AAO A;  3RU0 A;  4FA6 A;  1JCR A;  1YYH A;  3T8M A;  4KVM A;  2CG3 A;  3WG7 E;  4I9E A;  2A5E A;  2X6J A;  3T5X A;  1BPO A;  3SO8 A;  3TXM A;  1DCE A;  3KD7 A;  2GRQ B;  3F6Q A;  4B93 B;  1N4S A;  4AOF A;  4MS6 A;  3Q79 A;  3UT7 A;  5JHB A;  2KCK A;  3RRM B;  3C3R A;  1IYG A;  3PE3 A;  3FUL A;  5G05 J;  3DSV A;  2P9S G;  5ENT D;  2NSZ A;  1KT1 A;  2FUL A;  1MQS A;  2XZT G;  3ZYK A;  3URZ A;  4HOT A;  1JPL A;  5ENQ D;  3CVW A;  3MA5 A;  2J09 A;  4WND A;  1TR4 A;  2L0I A;  4JEH A;  5B3S E;  5E75 A;  2ZU6 B;  3B7U X;  2BED A;  3DRA A;  1E96 B;  3JQ0 A;  2P9K G;  3RO2 A;  5CED B;  4LG6 A;  3MEK A;  5EDS A;  3ZHE B;  3KS2 A;  3D9I A;  3VLD A;  2KBX A;  4XKB A;  2FO1 E;  4J7W A;  3L9T A;  4D10 C;  2A5U A;  2LXL A;  2E2E A;  3GZ1 A;  4DX1 A;  5G05 C;  4J8F A;  4C0E A;  4BFR A;  4FLH A;  3SF4 A;  4GMJ A;  1E7V A;  3Q9U C;  1BI8 B;  3KEA A;  4NUR A;  1P5Q A;  3SQV A;  5HKP A;  4HI8 A;  5AQB A;  3ASH A;  2OCC E;  3GYZ A;  4I43 A;  3VLF A;  2UWJ G;  4X8Q A;  1IQR A;  3SI5 A;  1SZA A;  3IV0 A;  4YDO A;  3ZFW A;  1OXJ A;  3FUK A;  3PS6 A;  3UX4 A;  2UY1 A;  3MV3 B;  1UN9 A;  3FUE A;  1IKN D;  4EHM A;  2XHE A;  4DX5 D;  4BTA A;  2VGE A;  2R03 A;  4K5B A;  3TGO A;  3D3M A;  3CST A;  4N39 A;  4G11 A;  5LCW C;  3JUE A;  4FC8 A;  1IQU A;  3TXN A;  3TG4 A;  3U64 A;  3L08 A;  2R5S A;  2X6I A;  4F6R D;  4WWO A;  3IEG A;  1HX8 A;  4HVB A;  5D66 A;  4GYW A;  1DVP A;  3ULE G;  1OCO E;  3MKQ B;  3QKY A;  3FUM A;  2QC9 A;  5A6C A;  3QK0 A;  3QAQ A;  4HBD A;  2C2L A;  3DSU A;  4P29 A;  3B95 A;  2RD0 A;  3ESL A;  4GTM A;  1TYQ G;  2PQN A;  4BER A;  4MBG A;  4WWN A;  3S7F A;  3CVX A;  4ZHB A;  2IO3 C;  1ELR A;  5JJ7 A;  4G24 A;  4L2Y A;  3SNX A;  4ILG A;  2P58 C;  4UI9 K;  1TNO A;  4N3C A;  2ZGG A;  4XI0 A;  2VQ2 A;  3SBT B;  4ACL A;  1UG3 A;  2ZGD A;  5ENN A;  1D9S A;  1B89 A;  3AJI A;  4MKT A;  3NOG D;  3OTN A;  1H6O A;  3LEW A;  3LXU X;  4NQ0 A;  3FTU A;  2WXN A;  4EZJ A;  4I9C A;  4U8V D;  1QBQ A;  5KBA A;  3MZL B;  5G04 J;  1O1R A;  5LFA A;  3P2B A;  3B7B A;  5BUZ A;  2WMO A;  2J07 A;  1O5M A;  2MRI A;  3JYS A;  4CDM A;  2PZI A;  2IJG X;  3DEP A;  5AQA A;  4XIF A;  1UN8 A;  4O1P A;  5B1A E;  2ZXW E;  1NA0 A;  4GTT A;  5ENP D;  4HXI A;  4HRM B;  4U0U A;  1MZC A;  2J49 A;  1N94 A;  4RLY A;  2DVW A;  4AEZ C;  1YCS B;  4J0U A;  2QYJ A;  4ME2 A;  3ZNG A;  5FQ7 A;  4TXP A;  1SQM A;  3UUX A;  1NP7 A;  2WQ7 A;  3UM0 A;  2Y1L E;  3FTS A;  1JWG A;  4OAV B;  3VTY A;  4K03 A;  4GPK A;  2ZIS A;  3FU3 A;  1E8W A;  4KYO B;  3B13 A;  2EIJ E;  1TNU A;  5CHE E;  3EJN A;  3B7T A;  5LX8 A;  2QY7 A;  5FZR A;  5AYW D;  4EBA A;  2YHE A;  4HNA D;  5AAR A;  2EIK E;  3AAA C;  2V5Q C;  5BXO A;  5JJT A;  4OVV A;  4PS7 A;  3I3N A;  2XEV A;  1U2V G;  4MLP A;  4UWF A;  1X81 A;  4CYM D;  2WXF A;  4APF A;  4BTB A;  3SY2 A;  3HHM A;  2EQX A;  3U4T A;  4QFV A;  2XGO A;  5DBK A;  3KAE A;  3OAW A;  2XPY A;  3R9M A;  4KVO A;  3O4Z A;  3C72 A;  3ZPJ A;  1LF8 A;  3TWT A;  1XGW A;  4YVQ C;  4DLO A;  2I9C A;  3AG1 E;  5HRY A;  3Q9N C;  4CZ2 D;  4FHJ A;  2CG2 A;  3FU5 A;  1YMP A;  2IQC A;  4GTP A;  3B7S A;  3N71 A;  4IUL A;  4K5C A;  2V4L A;  4NAC A;  2RG8 A;  3NOC D;  2R2L A;  3SFX A;  3BG1 B;  5J08 A;  4BEP A;  2CHW A;  4GMR A;  2LAH A;  3DXM G;  3CKC A;  1HG5 A;  4L23 A;  2Y4U A;  1OWL A;  4G25 A;  2F8X K;  3V79 K;  1MYO A;  4LRZ A;  2VSY A;  4YND A;  3GW4 A;  3AU4 A;  4U04 A;  2BUG A;  3AS5 A;  4U07 A;  3PEV B;  2HE0 A;  3G2V A;  3OXL A;  5KCM A;  2H6H A;  5BPP A;  4GB9 A;  1EPU A;  1FT2 A;  4AV7 A;  2WXK A;  4TUU A;  2P9P G;  4UWL A;  3G2T A;  4B94 A;  4J8E A;  2QFC A;  2AXU A;  2KC7 A;  3LYA A;  3PDN A;  3R7R A;  4GA2 A;  3FH5 A;  4ABN A;  2WXG A;  4WNF A;  3ZXS A;  2KZT A;  1Z3Y A;  3CHR A;  2XCC A;  2KZT B;  4XKC A;  5FJY A;  3PEU B;  4N5C A;  4XI9 A;  2XS8 A;  2XS1 A;  2WXL A;  4BT8 A;  3NF1 A;  5BV0 A;  3HXE A;  4ACK A;  1JUQ A;  2X38 A;  1H6P A;  1WG0 A;  4I6J A;  4A3V A;  3HVE B;  4B89 A;  1TJC A;  3J5Q B;  4LEU A;  4PH4 B;  1EDU A;  3DPY A;  3TWQ A;  3Q5M A;  2VTB A;  3S2A A;  2Y0B G;  1DC2 A;  4XEI G;  4N3A A;  2ETA A;  2X6K A;  2GGF A;  3DSS A;  3AG2 E;  3NQP A;  5KNH D;  4U95 D;  5AEN A;  1Y6I A;  4ILI A;  5EYL A;  3U66 A;  3E30 A;  3IKO B;  1SA4 A;  3DST A;  3FU0 A;  1OWP A;  3UIO C;  4C48 B;  2J08 A;  5LP0 A;  4L1B A;  2MHK A;  4TRQ A;  3LCA A;  4HLL A;  4URK A;  4EQF A;  5CBO A;  1VDY A;  3NB2 A;  4IRU A;  4GTS A;  3UPV A;  4RG6 A;  3ASO E;  1KT0 A;  5G55 A;  1BU9 A;  3MYV A;  5CRV A;  4LNB A;  5CEC B;  1UOH A;  4KZC A;  1H2U A;  3Q15 A;  4HOU A;  2A4Z A;  3EDT B;  3ZU7 B;  3D9J A;  3MKQ A;  1LD8 A;  3NZU A;  4BSX A;  4ATZ D;  4U96 D;  4O6F A;  3QC1 A;  4N2Q A;  1UW4 B;  4BES A;  1NFI E;  3L6A A;  4DI4 A;  1K1B A;  2GW1 A;  3Q7A A;  4U8Y D;  3BG0 B;  2X6F A;  3UM3 A;  2AXZ A;  3LS8 A;  2WPV A;  2RFM A;  3EIJ A;  3LY8 A;  4JHK A;  3HXD A;  3ABM E;  3TWV A;  3K9I A;  3UM1 A;  3GZS A;  3CQG B;  3IBE A;  2FBN A;  2Y69 E;  4DX2 A;  5BNW A;  2EIL E;  1N52 A;  3RIB A;  3BQO A;  1IHG A;  1Q2Z A;  4KXK B;  4I1M A;  2RKK A;  2KAT A;  3JCK C;  3ABK E;  5ENR D;  3JUI A;  2H6I A;  3APC A;  2Y3A A;  3O48 A;  1HFA A;  3RJV A;  5FIO A;  3FUN A;  5EIB E;  5CRU A;  3CR3 A;  3LKU A;  1KZP A;  4UWH A;  2L6J A;  4HQD A;  3RRN B;  1PC2 A;  1AP7 A;  5ENS D;  4DI3 A;  2MYO A;  2IY0 C;  3CVL A;  2VYI A;  4GZC A;  1HZ4 A;  4HS2 A;  1V54 E;  2LSU A;  4N3B A;  4ZFH A;  4ANX A;  3UKR G;  3ZN3 A;  3CEQ A;  3L13 A;  1V55 E;  4G2V A;  5FQ4 A;  3JQ1 A;  5FQ8 A;  1S64 A;  4FUL A;  3C98 A;  1EF1 C;  1QZ2 A;  2YHC A;  5JJ6 A;  4KBQ A;  1H2V C;  4E6H A;  5EYP F;  3BEE A;  2OV8 A;  5C2Y A;  4JEU A;  3U3W A;  3ASN E;  3HVE A;  1Z6T A;  3FUH A;  3CHP A;  1E8Y A;  2GRL A;  4J8D A;  3EIQ C;  1N54 A;  3UTM A;  5BT1 A;  5EID A;  4UWK A;  3Q78 A;  4GZ5 A;  2B6C A;  3PZ4 A;  5JMN D;  1TJF A;  3FH7 A;  3CK9 A;  2V5F A;  2WB2 A;  3EHQ A;  2P9U G;  3UM2 A;  3BU8 A;  2C0L A;  4GZ6 A;  4HI9 A;  3HG0 D;  3RO3 A;  4MRU A;  2X6H A;  4U7E B;  1LD7 A;  4JC8 A;  1K8K G;  5KJK A;  4JXT A;  3U9W A;  4Q69 A;  1QQE A;  2XGM A;  2E0I A;  3W9G A;  3AS8 A;  4PS3 A;  3FEY A;  2XZD G;  2F0Y A;  4Q96 A;  4ANU A;  5G04 C;  3CIA A;  4HFG A;  3T9K A;  1NA3 A;  3PRE A;  4OAU C;  1EYH A;  4HOR A;  3CHQ A;  1FT1 A;  2WXQ A;  4CT0 A;  3QB2 A;  1G3N B;  3CVN A;  3SBS A;  2I6H A;  4Z68 A;  4LER A;  4JL0 A;  3SD5 A;  2F37 A;  4GTO A;  3FUJ A;  4K0R A;  4GZ3 A;  3HIZ A;  3APD A;  2FF4 A;  2DYS E;  5M72 A;  3FTX A;  4HOS A;  4FHK A;  2OEV A;  3WXX A;  3OXG A;  3FTY A;  1NI1 A;  2DZO A;  4LUN U;  2JAB A;  1S0P A;  3ZIM A;  1BI7 B;  1TEZ A;  4XX5 A;  3FTZ A;  3L16 A;  2I1K A;  4CDR A;  1NL4 A;  2IO2 C;  2XEH A;  3ONK A;  3V31 A;  1Z5S C;  2IOS A;  1SW6 A;  4JA9 A;  2VGX B;  1UJJ A;  1N95 A;  3IHY A;  3G2W A;  3RK6 A;  3TAX A;  5LOZ A;  4I2Z A;  2LAI A;  3JXI A;  4EEC A;  4ANW A;  4RQI A;  3PZ2 A;  1HH8 A;  2UY1 B;  3PUK A;  4B8C B;  1HU3 A;  3FTV A;  4GTQ A;  1H0A A;  4BT9 A;  5CER B;  4KMO A;  4I1A A;  5AQ7 A;  3W9F A;  5AIJ A;  2KCL A;  2JLB A;  2P9N G;  4WWP A;  5BXU A;  4PDX A;  2PNN A;  1MHQ A;  2GRR B;  3G2U A;  3UKU G;  1N9A A;  3AG3 E;  3S7B A;  4RVB A;  3RKV A;  3T5V A;  3CVY A;  1FPP A;  1ZBP A;  4EZL A;  4TV3 A;  2LUH A;  3SGH A;  2FEZ A;  4GTV A;  2R59 A;  1TN7 A;  2XPI A;  3AS4 A;  3C3O A;  2WMN A;  4FJZ A;  2J4D A;  4XZ4 A;  4QQI A;  1N4R A;  2IOL A;  4LCT A;  3LY7 A;  2DZN A;  2CFZ A;  1JCS A;  1O1S A; 
#chains in the Genus database with same CATH homology
 2JAB A;  2Y0B G;  1YCS B;  1BI7 B;  4J7W A;  4K5C A;  2FO1 E;  1DC2 A;  2QYJ A;  4DX2 A;  1SVX A;  3NOC D;  1OT8 A;  5EID A;  2ETA A;  3ZNG A;  5AAO A;  2KXP C;  2L6B A;  5JMN D;  4BER A;  2XEE A;  1IXV A;  1BLX B;  4DX1 A;  2Y1L E;  4BEP A;  1BD8 A;  1YYH A;  5KNH D;  4A63 B;  4DUI A;  4GMR A;  4YDW A;  2XEH A;  4ZHB A;  5ITZ F;  3TWX A;  5AN8 A;  3EHQ A;  4U95 D;  2A5E A;  3SO8 A;  2ETB A;  4O1O A;  1MX6 A;  3V31 A;  3LJN A;  5CEA A;  5HS0 A;  4OAV B;  5ENR D;  4HI9 A;  4N5Q A;  5KWD A;  2F8X K;  1OY3 D;  3V79 K;  1MYO A;  1MX2 A;  1SW6 A;  3EHR A;  3HG0 D;  3Q9U C;  1BI8 B;  3C5R A;  3KEA A;  5EYL A;  4HRN A;  1S70 B;  5FIN A;  3EU9 A;  4BSZ B;  1MJ0 A;  5HKP A;  4HI8 A;  3DEO A;  5AQB A;  3F6Q A;  3J5P A;  2ZGG A;  4B93 B;  1WDY A;  3UXG A;  5FIO A;  4C48 B;  2NYJ A;  4O60 A;  2HE0 A;  5EIB E;  4UUC A;  3TWS A;  4F1P A;  4J8Y A;  1K1A A;  1N0R A;  2ZGD A;  1D9S A;  2V4H C;  3HRA A;  2AJA A;  4HB5 A;  3JXI A;  4HQD A;  4YDY A;  3V30 A;  4NIK A;  3AJI A;  4LNU D;  2DWZ A;  1DCQ A;  4HLL A;  3NOG D;  4BET A;  3JXJ A;  3W9G A;  5EN5 D;  3V2O A;  5CBO A;  4HRL A;  2BKG A;  1A5E A;  1AP7 A;  4G8L A;  5ENS D;  5AQ9 A;  2MYO A;  4HNA D;  2BKK B;  2XZD G;  5AAR A;  3NBN B;  2J8S D;  4K5A B;  4TUM A;  3ZKJ A;  1N11 A;  4U8V D;  5KBA A;  1BU9 A;  1IKN D;  3AAA C;  2V5Q C;  4ZFH A;  5BXO A;  2RFA A;  3T9K A;  5CER B;  5ENT D;  5CEC B;  4OAU C;  1UOH A;  5AQ7 A;  5JA4 D;  4DRX E;  3W9F A;  2XZT G;  4DX5 D;  5CBN A;  3B7B A;  3TWU A;  2VGE A;  4K5B A;  3ZU7 B;  1AWC B;  5ENQ D;  3D9H A;  4CYM D;  5BXU A;  1K3Z D;  3TWR A;  1G3N B;  2PNN A;  3JUE A;  5ENO D;  3V2X A;  4Z68 A;  4QFV A;  2F37 A;  2F8Y A;  3UI2 A;  3DEP A;  4DX6 D;  5AQA A;  2ETC A;  4ATZ D;  4F6R D;  4U96 D;  1N0Q A;  1TR4 A;  1QYM A;  5EYP F;  3IXE A;  1WG0 A;  3TWW A;  5KNG A;  4JB8 P;  4BES A;  1NFI E;  4G8K A;  1K1B A;  4O1P A;  1IHB A;  4U8Y D;  5D66 A;  3TWT A;  4DX7 D;  5EIL A;  3ZUV B;  4QQI A;  3J5Q B;  4GPM A;  5HRY A;  2RFM A;  2B0O E;  3Q9N C;  1MX4 A;  4CZ2 D;  2DZN A;  2P2C P;  2XEN A;  5ENP D;  3TWQ A;  2QC9 A;  3TWV A;  4LSZ E;  5CED B;  4LG6 A;  4HRM B;  4HBD A;  1YMP A;  3T8K A;  2DZO A;  4RLY A;  2KBX A;  3B95 A;  2DVW A;  3UTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...