2DZOA

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
228
Chain Sequence
MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 61
structure length 228
sequence length 228
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2dzoA00
5AQBA 3V31A 1BLXB 3TWXA 1D9SA 1MJ0A 5FINA 5ENQD 4DUIA 1BI7B 2L6BA 3LJNA 1MYOA 4N5QA 4ATZD 2ETBA 2Y1LE 3DEPA 5AQ7A 2F8YA 1MX2A 4BSZB 2Y0BG 4QQIA 1MX4A 5EYPF 4ZFHA 3ZKJA 2B0OE 3D9HA 5KNHD 3AJIA 1SW6A 5CEAA 1OY3D 2F8XK 2QC9A 1QYMA 3UI2A 4YDWA 5AARA 4HRNA 5EYLA 5EILA 3SO8A 3Q9UC 2ETCA 4GPMA 2XENA 4GMRA 3Q9NC 3T9KA 4G8KA 2A5EA 5ENTD 4DX7D 2XZTG 3JUEA 4U8YD 3TWQA 1SVXA 2DVWA 2QYJA 3HRAA 4HNAD 2V5QC 3C5RA 3J5QB 1TR4A 4NIKA 1YMPA 2RFAA 4HLLA 4TUMA 3B95A 4CYMD 1K3ZD 4HI8A 1DC2A 3JXIA 5ENOD 5JMND 3W9FA 5KBAA 5CECB 1UOHA 2F37A 4K5AB 3ZUVB 3AAAC 3EU9A 2J8SD 2KXPC 3IXEA 5AQ9A 4BEPA 1AWCB 5ITZF 1OT8A 2ZGGA 1A5EA 2HE0A 4DX2A 4DX1A 4DX6D 4F1PA 2P2CP 3ZU7B 3V30A 3TWWA 3TWTA 3DEOA 4OAVB 2JABA 3JXJA 4UUCA 5D66A 1WDYA 2ZGDA 4QFVA 3UXGA 5BXOA 4U95D 2MYOA 4U96D 3NBNB 3NOCD 1NFIE 4BETA 2NYJA 3EHQA 3NOGD 4LSZE 4HBDA 4J8YA 3TWSA 2FO1E 1K1BA 4O1OA 3UTMA 1N0QA 1IHBA 5EIDA 4U8VD 1WG0A 3ZNGA 1N0RA 5ENSD 3EHRA 5HS0A 2DZNA 3KEAA 4J7WA 4K5CA 5AAOA 5BXUA 4LNUD 4G8LA 5AN8A 4YDYA 1N11A 3TWVA 4HQDA 3TWRA 2DZOA 5ENRD 1DCQA 1YCSB 4BERA 3V2XA 5HRYA 5CEDB 1AP7A 4ZHBA 2KBXA 3T8KA 3F6QA 1BD8A 5EN5D 4O60A 5EIBE 4B93B 4HI9A 5JA4D 2BKGA 2BKKB 4A63B 4HB5A 3J5PA 2XEEA 5AQAA 5FIOA 4HRLA 1BU9A 4CZ2D 3TWUA 4JB8P 5HKPA 2V4HC 3B7BA 4K5BA 4O1PA 4RLYA 4BESA 2XZDG 2VGEA 4HRMB 5KWDA 4OAUC 3V2OA 1K1AA 5CBOA 3W9GA 1YYHA 4LG6A 5ENPD 2PNNA 1MX6A 5KNGA 5CBNA 4DX5D 3HG0D 4C48B 2AJAA 2DWZA 2ETAA 3V79K 1IKND 4DRXE 4F6RD 1IXVA 1S70B 5CERB 1BI8B 2XEHA 1G3NB 4Z68A 2RFMA
chains in the Genus database with same CATH superfamily
2P9LG 4TV3A 1NA0A 5B1BE 3UT4A 2ETBA 2VTBA 3WXXA 1OWPA 4JPSA 4JHJA 4RG6A 2IF4A 4GPKA 3MCXA 3MV3B 4CRWA 5FQ7A 1OCCE 3FTYA 4DLQA 2V5FA 2IO3C 2IO2C 3PRZA 3DXMG 2C2LA 4OVVA 1K3ZD 1H6KA 3AG1E 3IXEA 2J8SD 5CMYA 4EPZA 2CG3A 2HR2A 1O1SA 1XGWA 3TWWA 3Q4AB 2WQHA 4NRHB 5G55A 3PDNA 5C1DA 2OV8A 2NSZA 4O1OA 4DI4A 1N4PA 2FF4A 3APDA 3CSFA 1SQMA 5FQ6A 4I6JA 3CK7A 5AAOA 1E90A 1DVPA 3V2XA 1OXJA 2BKKB 5FIOA 3CHQA 5ENNA 1MHQA 3MKQB 4AV7A 1HFAA 1N4RA 3UM3A 5EX3A 3JYSA 1BPOA 1G3NB 4DX6D 3AS5A 4CDMA 2MRIA 5AYWD 2XEVA 2CHXA 2WPVA 3I5PA 4RSYA 2CG2A 5EX0A 3UMVA 5D0OD 2OOEA 5KNHD 1OY3D 4HOSA 3L13A 4KXKB 3ZHEB 3FUJA 2LNIA 5AARA 4U07A 5EILA 3ZW3A 1FVHA 4RVBA 3MEKA 3FUEA 4J8SA 3ZHEA 3D9MA 5CCLA 1QBQA 4GTMA 4GTPA 2JABA 2NC9A 4KZ0A 3NBNB 1FT1A 4V3IA 2KCVA 2CHWA 5BT1A 5FTPA 1S63A 1Z6TA 2UY1A 4KVOA 5HS0A 4U8HA 5LX8A 1OWOA 1D8DA 4KT6B 1YCSB 4LUNU 3MYVA 3CVVA 4ZHBA 3SFYA 3F6QA 5EN5D 4AXHA 4A63B 1EDUA 2HO1A 4N5CA 1OCZE 2VGEA 2XGSA 3DPYA 2XPZA 1INZA 2ZISA 4XZ4A 1N95A 2LSVA 3EIJA 5BV1A 5G2NA 3TWXA 2BF0X 3GZ2A 1BI7B 3RSEG 3BEEA 2EILE 3CV0A 4FULA 4GB9A 2WMNA 1H2UA 1O1RA 2VGXB 4E6HA 2L6JA 4JW1A 4YDWA 2WVIA 1XNFA 3D9OA 1L5JA 1EF1C 4GAAA 4AM9A 4XEIG 4LERA 4AP2A 3ASGA 2L0IA 4K03A 3FHEA 3VLFA 4DPRA 3CVYA 2VQ2A 1JWFA 1KLXA 1Y6IA 1EYHA 5ITZF 1A5EA 4JVSA 3E32A 4F1PA 2FO7A 4OAVB 1JUQA 1HH8A 4BX9A 4JHKA 3UXGA 3JQ0A 5FQ4A 1NFIE 3FUIA 3FUFA 4LSZE 2R17C 3KEZA 5ENSD 3HYMB 4CT0A 3ZYQA 4K5CA 1IQUA 2Y69E 1E7UA 3FU3A 2DZOA 3AG2E 4O60A 4UWGA 4MBGA 2XEEA 2GRLA 3FU6A 3BQOA 3I4GA 4PUCA 4U0UA 2GRPB 2E2EA 2ONDA 3O48A 4GTOA 3UKRG 3E4BA 2ETAA 5CCMA 2M63A 1S70B 3D9NA 4FU3A 3ASOE 3S7JA 3ZRHA 2IEJA 2Y1LE 2IQCA 2F8YA 5EKQD 4BSZB 2QY7A 3D9IA 5T8IA 4FA6A 3S7FA 1KT1A 2QC9A 3CVUA 3CHOA 2X3MA 3CVNA 4NACA 1OCRE 4JZYA 4GPMA 3Q9NC 3L08A 3QOUA 5C2YA 3E34A 3FY4A 5LFAA 3C5RA 2V8SE 3ZXSA 3PNLB 4HFGA 5D2MC 2J4DA 2WXLA 4GYOA 3CVPA 4L1BA 3B7RL 5KBAA 4I6GA 2I2OA 2XS8A 1DNPA 3EU9A 2KXPC 5A6CA 2WXPA 2XPIA 1S64A 3PEUB 4MKTA 1TEZA 2XQ0A 3Q7AA 3TWTA 1WY6A 2P9KG 1U3DA 3LYAA 3NOGD 4BWRA 3TWSA 3UM0A 3HXBA 3HXEA 2EINE 2R59A 3ISMC 1HZ4A 2Y3AA 2R05A 5HQ8A 3OAWA 4UWLA 4P29A 3CLJA 3CKBA 3NB2A 4E85A 4UI9C 5JA4D 3VTXA 4IRUA 3AS8A 1ELRA 4GCOA 3JCKC 2WQ7A 2AXUA 2PL2A 5FZSA 3ENEA 3QKYA 4A1SA 4G24A 2E0IA 4G26A 3ESKA 1TN6A 5LOZA 2J07A 5FINA 3ASFA 5ENQD 3AS4A 3CIAA 4N5QA 4DLOA 4YDOA 5JJ7A 3LY7A 5EYPF 2FBNA 3AJIA 2LAHA 3HVEB 3UIPC 3P2BA 3G2UA 2RD0A 2XCCA 3HXFA 4Y6WA 5LCWJ 5J08A 4JC8A 2P9IG 1QQEA 2ETCA 3PS6A 2XENA 5FWQA 3FH8A 4KZCA 3EHNA 2KC7A 2CHZA 3ZFWA 1LD8A 2GRQB 4HNAD 3BUAA 1PAQA 3R7QA 3HDXA 2RFAA 3NAWA 2DBAA 4R7LA 4ILIA 3UKUG 2AVPA 3AAAC 1E8YA 4EHMA 3CVXA 2HE0A 1TNUA 3ZU7B 3V30A 5DBKA 2X6KA 3DEOA 3SBSA 4ATGA 4WNGA 2J4BA 2J08A 3EHQA 2BTDA 2R02A 4M3OA 2WXKA 2CFUA 3R9AB 3KEAA 5BXUA 3Q73A 4LNGA 4A55A 3TWRA 1H0AA 3U4TA 3VLEA 3SI5A 2Y4TA 5HRYA 4AVXA 3TGOA 3FTZA 2RG8A 4FJYA 3FUHA 2P9SG 4GTSA 3V79K 1NP7A 3L54A 2LXLA 3FULA 3SZ7A 5CERB 5A23A 3CQCB 4JA7A 4NURA 3K9IA 4DUIA 1Z3YA 2AW6A 3PZ1A 5DIZA 3ZIMA 2VSYA 2A5UA 3SBTB 3Q47B 4BFRA 2VTBB 3Q15A 4GMRA 2WXJA 4DX7D 4U8YD 2EIJE 1SVXA 2P9NG 2F0YA 4L2YA 4GU5A 5B3SE 3B95A 5KJLA 1UOHA 4I1OB 3LVQE 4GA0A 4IN3B 4GTVA 4APFA 4L23A 4UQZA 3FH7A 2FO1E 1K1BA 4YDEA 5ARGA 3FTVA 2MHKA 3Q75A 2KZTA 4HOTA 3FUNA 3U9WA 2L9BA 3IKOB 2XPYA 4ANVA 3QB2A 2DIWA 4HS2A 3FTSA 5B1AE 2GW1A 3S7DA 3U64A 3DRAA 3VTYA 3Q78A 1BU9A 3QJZA 4K5BA 1OUVA 4CDRA 5G04C 3W9GA 4LG6A 2LAIA 3SGHA 2R5SA 4CT4A 1BLXB 4ACKA 4XI9A 3CKCA 4B8CB 5AQ7A 3R7RA 1MX4A 1ZU2A 1TNZA 4FLHA 1LD7A 3RAUA 5KCMA 3ABKE 2VYIA 2X6JA 3QAQA 3QWPA 2PZIA 2QYJA 2V4LA 4EZLA 1HX8A 4CYMD 3UINC 4H7YA 4JEUA 1E96B 1UG3A 3KSQA 4GMLA 4DX1A 3FUKA 4UWFA 2XCBA 4YNDA 4EZKA 4WAFA 4J8YA 3TAXA 3JQ1A 3L22A 2Q7FA 4NQ0A 2ZXWE 2P9PG 3D3MA 4HVBA 1N11A 3CHSA 3FEYA 4TUUA 2UY1B 2I1JA 4I2ZA 2KBXA 2WXHA 4AEZC 3DSXA 3NQPA 4JB8P 3FTXA 4MLPA 4BESA 1K8KG 1KT0A 2I9CA 3D9KA 2EIME 1D9SA 4EZJA 4I43A 4ATZD 5G05C 4GTQA 3T5VA 4FC8A 2VGYA 5KJNA 3PUKA 4BX8A 3L17A 3ZPJA 2X6IA 3B7UX 2C0MA 3FEXA 1TN8A 4MRUA 4J8EA 3GYZA 3OXFA 2I6HA 4AY5A 4HXIA 3G2SA 4FHKA 2A5EA 3ABLE 5CRVA 3HRAA 1D8EA 5FZRA 4AOFA 2WMOA 4U7EB 2J9QA 2WXMA 2B6CA 4W9RA 1RW2A 3CVWA 2R2LA 2WQ6A 1JWGA 3TG4A 1IHGA 3G2VA 2VSOE 2ZGDA 4PS3A 4I1MA 5KJMA 4U8VD 2GROB 1WG0A 4JHRA 5FT9A 1N0RA 4CGVA 1TJCA 1ZB1A 4UWHA 4YDYA 5ENRD 3LY9A 3ZVVA 3G2TA 4BERA 4JEHA 1JCQA 1AP7A 3LJ3A 2XS1A 3J5PA 4FJZA 4HRMB 2V0PA 1P5QA 4AY6A 3CQGB 3FTWA 2XGOA 5E76A 4J6IA 5M72A 4GTRA 3RO3A 3AG3E 5CHEE 4FADA 3LKUA 1UJJA 3ZYKA 3UUXA 2L6BA 4GTTA 1JPLA 1MX2A 1TNOA 4YVOA 3G2WA 4TXRA 4ZFHA 3D9HA 1HU3A 4N3BA 3L6AA 5CRUA 4GZCA 1S0PA 4DK5A 3JUEA 4HLEA 3RRUA 3C3OA 1RZ4A 3T5XA 4FHJA 5JMND 3UIOC 4HORA 4A3TA 4UI9J 1AWCB 2ZGGA 2X38A 2PQRA 4Q69A 1HS6A 4KYOB 2YINA 4OAUC 2WXRA 4QFVA 2MYOA 3EIQC 4U96D 4BETA 1PY1A 3LPZA 4G2VA 5J90A 3D9JA 3L9TA 2A4ZA 1H6PA 1OCOE 5AN8A 3PZ2A 1NL4A 4ME2A 4KBQA 2Y4UA 5AENA 1UJKA 2ZIRA 2IOSA 4XIFA 3GZSA 4N3AA 1SA4A 4WWPA 5H7PA 3HIZA 1EPUA 3DSTA 1K1AA 3PVLA 2PNNA 1MX6A 2KCKA 2VSXE 5BPPA 1E8WA 4BSXA 2H6FA 2LUHA 5AQBA 4BT9A 3UX4A 3LJNA 2IOLA 5FQ8A 3OXGA 1KZPA 4GZ3A 5A7DB 3ZKJA 4UI9K 3PUJA 4N3CA 1OWNA 3Q49B 4B89A 2C0LA 3X2QE 2FEZA 1V55E 5EYLA 2LSUA 3SO8A 3ZYMA 4G8KA 4PS7A 3RIBA 4L2LA 3LXUX 4M7CA 3OXLA 3ML9A 3URZA 4J8DA 3L16A 3U66A 1DC2A 3JXIA 5ENOD 3RJVA 3ZUVB 2AXZA 4JL0A 1QNFA 2P2CP 1DCEA 3QK0A 2GRRB 3PH0C 3ZXPA 5BXOA 4U95D 3SQVA 1U2VG 3UPVA 3ULQA 1N0QA 1IHBA 5EIDA 4N2QA 2VJ8A 5E75A 4B94A 4G23A 3KD7A 1ELKA 5JHAA 4BT8A 4F7AA 4XKCA 3EJNA 3DWLG 3PZ3A 5CEDB 3TG5A 3FFLA 3ASNE 2PM6A 1IYGA 3ULYA 4RLYA 3QNKA 5JJTA 4XKBA 4C48B 4Q94A 1IKND 2VSNA 3QC1A 2UWJG 3V31A 3RRNB 4IULA 5BNWA 3DEPA 1NI1A 2PM7A 2DYSE 3LEWA 5IY5E 3MJWA 2F8XK 5CEAA 1HG2A 2PQNA 3B7SA 4ANUA 1SZ9A 4L9PA 3S2AA 3PNTB 3Q7FA 3FU5A 2YNQA 1HG5A 4GZDA 3T9KA 5ENTD 2XZTG 2IFUA 2OCCE 4C0MA 2FULA 3FWVA 4NIKA 3APCA 3VLDA 5HI7A 5KJKA 4EQFA 2P58C 2IY0C 3LY8A 4PH4B 5ANRA 2KM4A 2EIKE 3E33A 3PE4A 5G04J 3MA5A 3RRMB 1TNBA 3UTMA 4GYYA 2RKKA 4DI3A 3EHRA 3MKRA 3EUVA 4APOA 3TWVA 4G1TA 1DCQA 2KZTB 4U04A 4IYPA 4OYSA 4LEUA 4Q96A 2LO6A 2BKGA 3U3WA 4ANWA 1UN8A 4CZ2D 4C9BB 4LNBA 3S7BA 3N71A 3KS2A 3UT8A 4DX5D 2ZU6B 2WXFA 3C72A 2J09A 1WAO1 3ASDA 5ANLA 1N54A 2P9UG 3PEVB 4ILHB 4XI0A 3DBSA 4C0EA 4QQIA 5LP0A 1SW6A 2KCLA 5JHBA 4HRNA 4ANXA 1VDYA 4EBAA 2OVBA 3C3RA 3CVLA 3SFXA 1HF8A 4BTAA 2OEVA 4TUMA 2YQ8A 2OEWA 1E8XA 2F37A 5AQ9A 3D9LA 4BEPA 1H2TC 1OT8A 4UQXA 4F53A 3QWVA 3SFZA 3NZSA 3DSUA 1FVFA 2H6GA 3JXJA 3E30A 4B0ZA 4L7TA 2IONA 3ESLA 3NOCD 1X5BA 1OWMA 3CHRA 3ZNGA 2I1KA 3GZ1A 3HXDA 3O4ZA 4CDNA 3TL5A 1ZBPA 2XHEA 5G05J 4U0ZA 1E8ZA 2XRYA 3ZYLA 1A17A 1FCHA 1NZNA 3MKQA 5FJYA 4N39A 4HI9A 5BV0A 3Q79A 3RU0A 2V4HC 3B7BA 3IHYA 1YYHA 5ENPD 4X8QA 3HG0D 4GA1A 2J49A 3CGHA 1SA5A 4F3VA 2WXNA 2WXOA 3ONLA 2Y0BG 1JCRA 4HOQA 3BG0B 4TXPA 3UM2A 1FT2A 2GGFA 2H6HA 4AIFA 3I4RB 4PS8A 4HI8A 5AJDA 4GCNA 2YHEA 1H2VC 5FZQA 5D0QD 3D9PA 1TYQG 4DX2A 3TXMA 2EQXA 3AU5A 4UUCA 5BW8C 3ZN3A 1X81A 3E37A 2WXIA 1N9AA 3FUDA 3AU4A 3OTNA 2IU1A 3B7TA 3IV0A 4LRZA 1FPPA 3ASHA 4Y6CA 3FUMA 4HB5A 1QZ2A 4KMOA 3PZDA 3IHVA 4TRQA 3LS8A 3ULEG 4F6RD 3MV2B 4FLBA 3MX3A 2RFMA 3DPDA 1N94A 2VGXA 3QDNA 5T4YA 4N2SA 3JUIA 3SD5A 3MZLB 3RK6A 3FP3A 3SF4A 4BTBA 1QYMA 5JJ6A 3WG7E 3APFA 2XRZA 3FTUA 1LTXA 4MS6A 1LF8A 4GMJA 3AG4E 3TXNA 3TJPA 3PE3A 4HOUA 1TR4A 4HLLA 3W9FA 3DSWA 5CECB 5AIJA 3DSVA 4GZ5A 1N4SA 3CEQA 1HXIA 3BG1B 1GW6A 4WNEA 4AJWA 4A3VA 3R9MA 4RQIA 1KZOA 4KVMA 3KSLA 3LDZA 5EDSA 4ACLA 2WXQA 1YA0A 1H19A 3RO2A 3UQ3A 4B8AA 4J7WA 3FH5A 4G8LA 3T8MA 2IJGX 4HQDA 3DSSA 2YHCA 5T3RA 3LVRE 4BY6A 4URKA 1V54E 4HRLA 2ILRA 3C98A 3HHMA 2R03A 4PDXA 3V2OA 2GRMA 4D10C 4DJAA 2DWZA 1TNYA 1OWLA 1Y8MA 2XEHA 4Z68A 3CVQA 4I6EA 2JLBA 4UWKA 1MJ0A 4YVQC 4I2WA 1UN9A 2DCPA 3ML8A 2H6IA 1ELWA 4G25A 3IBEA 3NF1A 4WNDA 1JCSA 3BU8A 4JXTA 4I9CA 3EU5A 3HXCA 3Q9UC 4LCTA 4I1AA 2DYRE 2XGMA 1N4QA 1WM5A 2DVWA 2V5QC 3CHMA 3J5QB 1YMPA 4K0RA 3ZGQA 3CR3A 3CK9A 3P1UA 4XX5A 2BEDA 4GZ6A 3KAEA 3DXKG 1UW4B 4FP7A 2OVFA 2WB2A 2X6HA 4WWNA 2KATA 4A1GA 4WUYA 2DZNA 2HYZA 4LNUD 2AWIA 4OVUA 2QZAA 2CFZA 4GYWA 4GA2A 3T8KA 1BD8A 4WNFA 2QYUA 4B93B 1E7VA 5EIBE 4F1SA 4WWOA 4ILGA 3TWUA 5HKPA 4O1PA 4G11A 4XE0A 1B89A 5CBNA 3UM1A 2AJAA 2MOWA 4TXQA 1BI8B 3MGBA 1MZCA 3HVEA 4RG9A 3SHFA 2LXMA 1TN7A 3Q5MA 1MYOA 1IQRA 3UT7A 2X6FA 3EHMA 2B0OE 3CSTA 5BUZA 3UI2A 1Q2ZA 2L0TB 1NA3A 1N52A 4ABNA 4UQYA 4JA9A 1O5MA 4I9EA 1W3BA 2QFCA 3PZ4A 3B13A 5ARFA 3ZEFA 5CMWA 1O1TA 3TWQA 4CCAA 3ONKA 1MQSA 1PC2A 4U0SA 4J0UA 4K5AB 3QWWA 3I3NA 1KPSB 4EECA 4O6FA 1TJFA 1Z3XA 3L82A 1U3CA 3FU0A 5D66A 3RKVA 1WDYA 2HM8A 1SZAA 2NYJA 3GW4A 4HBDA 4CEMA 5LCWC 1Z5SC 3ABME 4U63A 4EBAG 2GRNB 3CHPA 4H7XA 5AJLA 4I17A 3SNXA 2FI7A 4JD2G 3C3QA 2BUGA 3EDTB 3LCAA 1H6OA 3NZUA 3PREA 5AQAA 2WXGA 3IEGA 3SY2A 2NXPA 3CK8A 2WM9A 2XZDG 5KWDA 5CBOA 3QARA 5KNGA 3FDHA 1HO8A 4J8FA 4DRXE 1IXVA 2AXVA 4CGWA 2JEKA 1HE8A
chains in the Genus database with same CATH topology
5AQBA 3V31A 1BLXB 3TWXA 1D9SA 1MJ0A 5FINA 5ENQD 4DUIA 1BI7B 2L6BA 3LJNA 1MYOA 4N5QA 4ATZD 2ETBA 2Y1LE 3DEPA 5AQ7A 2F8YA 1MX2A 4BSZB 2Y0BG 4QQIA 1MX4A 5EYPF 4ZFHA 3ZKJA 2B0OE 3D9HA 5KNHD 3AJIA 1SW6A 5CEAA 1OY3D 2F8XK 2QC9A 1QYMA 3UI2A 4YDWA 5AARA 4HRNA 5EYLA 5EILA 3SO8A 3Q9UC 2ETCA 4GPMA 2XENA 4GMRA 3Q9NC 3T9KA 4G8KA 2A5EA 5ENTD 4DX7D 2XZTG 3JUEA 4U8YD 3TWQA 1SVXA 2DVWA 2QYJA 3HRAA 4HNAD 2V5QC 3C5RA 3J5QB 1TR4A 4NIKA 1YMPA 2RFAA 4HLLA 4TUMA 3B95A 4CYMD 1K3ZD 4HI8A 1DC2A 3JXIA 5ENOD 5JMND 3W9FA 5KBAA 5CECB 1UOHA 2F37A 4K5AB 3ZUVB 3AAAC 3EU9A 2J8SD 2KXPC 3IXEA 5AQ9A 4BEPA 1AWCB 5ITZF 1OT8A 2ZGGA 1A5EA 2HE0A 4DX2A 4DX1A 4DX6D 4F1PA 2P2CP 3ZU7B 3V30A 3TWWA 3TWTA 3DEOA 4OAVB 2JABA 3JXJA 4UUCA 5D66A 1WDYA 2ZGDA 4QFVA 3UXGA 5BXOA 4U95D 2MYOA 4U96D 3NBNB 3NOCD 1NFIE 4BETA 2NYJA 3EHQA 3NOGD 4LSZE 4HBDA 4J8YA 3TWSA 2FO1E 1K1BA 4O1OA 3UTMA 1N0QA 1IHBA 5EIDA 4U8VD 1WG0A 3ZNGA 1N0RA 5ENSD 3EHRA 5HS0A 2DZNA 3KEAA 4J7WA 4K5CA 5AAOA 5BXUA 4LNUD 4G8LA 5AN8A 4YDYA 1N11A 3TWVA 4HQDA 3TWRA 2DZOA 5ENRD 1DCQA 1YCSB 4BERA 3V2XA 5HRYA 5CEDB 1AP7A 4ZHBA 2KBXA 3T8KA 3F6QA 1BD8A 5EN5D 4O60A 5EIBE 4B93B 4HI9A 5JA4D 2BKGA 2BKKB 4A63B 4HB5A 3J5PA 2XEEA 5AQAA 5FIOA 4HRLA 1BU9A 4CZ2D 3TWUA 4JB8P 5HKPA 2V4HC 3B7BA 4K5BA 4O1PA 4RLYA 4BESA 2XZDG 2VGEA 4HRMB 5KWDA 4OAUC 3V2OA 1K1AA 5CBOA 3W9GA 1YYHA 4LG6A 5ENPD 2PNNA 1MX6A 5KNGA 5CBNA 4DX5D 3HG0D 4C48B 2AJAA 2DWZA 2ETAA 3V79K 1IKND 4DRXE 4F6RD 1IXVA 1S70B 5CERB 1BI8B 2XEHA 1G3NB 4Z68A 2RFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQB A;  3V31 A;  1BLX B;  3TWX A;  1D9S A;  1MJ0 A;  5FIN A;  5ENQ D;  4DUI A;  1BI7 B;  2L6B A;  3LJN A;  1MYO A;  4N5Q A;  4ATZ D;  2ETB A;  2Y1L E;  3DEP A;  5AQ7 A;  2F8Y A;  1MX2 A;  4BSZ B;  2Y0B G;  4QQI A;  1MX4 A;  5EYP F;  4ZFH A;  3ZKJ A;  2B0O E;  3D9H A;  5KNH D;  3AJI A;  1SW6 A;  5CEA A;  1OY3 D;  2F8X K;  2QC9 A;  1QYM A;  3UI2 A;  4YDW A;  5AAR A;  4HRN A;  5EYL A;  5EIL A;  3SO8 A;  3Q9U C;  2ETC A;  4GPM A;  2XEN A;  4GMR A;  3Q9N C;  3T9K A;  4G8K A;  2A5E A;  5ENT D;  4DX7 D;  2XZT G;  3JUE A;  4U8Y D;  3TWQ A;  1SVX A;  2DVW A;  2QYJ A;  3HRA A;  4HNA D;  2V5Q C;  3C5R A;  3J5Q B;  1TR4 A;  4NIK A;  1YMP A;  2RFA A;  4HLL A;  4TUM A;  3B95 A;  4CYM D;  1K3Z D;  4HI8 A;  1DC2 A;  3JXI A;  5ENO D;  5JMN D;  3W9F A;  5KBA A;  5CEC B;  1UOH A;  2F37 A;  4K5A B;  3ZUV B;  3AAA C;  3EU9 A;  2J8S D;  2KXP C;  3IXE A;  5AQ9 A;  4BEP A;  1AWC B;  5ITZ F;  1OT8 A;  2ZGG A;  1A5E A;  2HE0 A;  4DX2 A;  4DX1 A;  4DX6 D;  4F1P A;  2P2C P;  3ZU7 B;  3V30 A;  3TWW A;  3TWT A;  3DEO A;  4OAV B;  2JAB A;  3JXJ A;  4UUC A;  5D66 A;  1WDY A;  2ZGD A;  4QFV A;  3UXG A;  5BXO A;  4U95 D;  2MYO A;  4U96 D;  3NBN B;  3NOC D;  1NFI E;  4BET A;  2NYJ A;  3EHQ A;  3NOG D;  4LSZ E;  4HBD A;  4J8Y A;  3TWS A;  2FO1 E;  1K1B A;  4O1O A;  3UTM A;  1N0Q A;  1IHB A;  5EID A;  4U8V D;  1WG0 A;  3ZNG A;  1N0R A;  5ENS D;  3EHR A;  5HS0 A;  2DZN A;  3KEA A;  4J7W A;  4K5C A;  5AAO A;  5BXU A;  4LNU D;  4G8L A;  5AN8 A;  4YDY A;  1N11 A;  3TWV A;  4HQD A;  3TWR A;  2DZO A;  5ENR D;  1DCQ A;  1YCS B;  4BER A;  3V2X A;  5HRY A;  5CED B;  1AP7 A;  4ZHB A;  2KBX A;  3T8K A;  3F6Q A;  1BD8 A;  5EN5 D;  4O60 A;  5EIB E;  4B93 B;  4HI9 A;  5JA4 D;  2BKG A;  2BKK B;  4A63 B;  4HB5 A;  3J5P A;  2XEE A;  5AQA A;  5FIO A;  4HRL A;  1BU9 A;  4CZ2 D;  3TWU A;  4JB8 P;  5HKP A;  2V4H C;  3B7B A;  4K5B A;  4O1P A;  4RLY A;  4BES A;  2XZD G;  2VGE A;  4HRM B;  5KWD A;  4OAU C;  3V2O A;  1K1A A;  5CBO A;  3W9G A;  1YYH A;  4LG6 A;  5ENP D;  2PNN A;  1MX6 A;  5KNG A;  5CBN A;  4DX5 D;  3HG0 D;  4C48 B;  2AJA A;  2DWZ A;  2ETA A;  3V79 K;  1IKN D;  4DRX E;  4F6R D;  1IXV A;  1S70 B;  5CER B;  1BI8 B;  2XEH A;  1G3N B;  4Z68 A;  2RFM A; 
#chains in the Genus database with same CATH topology
 2P9L G;  4TV3 A;  1NA0 A;  5B1B E;  3UT4 A;  2ETB A;  2VTB A;  3WXX A;  1OWP A;  4JPS A;  4JHJ A;  4RG6 A;  2IF4 A;  4GPK A;  3MCX A;  3MV3 B;  4CRW A;  5FQ7 A;  1OCC E;  3FTY A;  4DLQ A;  2V5F A;  2IO3 C;  2IO2 C;  3PRZ A;  3DXM G;  2C2L A;  4OVV A;  1K3Z D;  1H6K A;  3AG1 E;  3IXE A;  2J8S D;  5CMY A;  4EPZ A;  2CG3 A;  2HR2 A;  1O1S A;  1XGW A;  3TWW A;  3Q4A B;  2WQH A;  4NRH B;  5G55 A;  3PDN A;  5C1D A;  2OV8 A;  2NSZ A;  4O1O A;  4DI4 A;  1N4P A;  2FF4 A;  3APD A;  3CSF A;  1SQM A;  5FQ6 A;  4I6J A;  3CK7 A;  5AAO A;  1E90 A;  1DVP A;  3V2X A;  1OXJ A;  2BKK B;  5FIO A;  3CHQ A;  5ENN A;  1MHQ A;  3MKQ B;  4AV7 A;  1HFA A;  1N4R A;  3UM3 A;  5EX3 A;  3JYS A;  1BPO A;  1G3N B;  4DX6 D;  3AS5 A;  4CDM A;  2MRI A;  5AYW D;  2XEV A;  2CHX A;  2WPV A;  3I5P A;  4RSY A;  2CG2 A;  5EX0 A;  3UMV A;  5D0O D;  2OOE A;  5KNH D;  1OY3 D;  4HOS A;  3L13 A;  4KXK B;  3ZHE B;  3FUJ A;  2LNI A;  5AAR A;  4U07 A;  5EIL A;  3ZW3 A;  1FVH A;  4RVB A;  3MEK A;  3FUE A;  4J8S A;  3ZHE A;  3D9M A;  5CCL A;  1QBQ A;  4GTM A;  4GTP A;  2JAB A;  2NC9 A;  4KZ0 A;  3NBN B;  1FT1 A;  4V3I A;  2KCV A;  2CHW A;  5BT1 A;  5FTP A;  1S63 A;  1Z6T A;  2UY1 A;  4KVO A;  5HS0 A;  4U8H A;  5LX8 A;  1OWO A;  1D8D A;  4KT6 B;  1YCS B;  4LUN U;  3MYV A;  3CVV A;  4ZHB A;  3SFY A;  3F6Q A;  5EN5 D;  4AXH A;  4A63 B;  1EDU A;  2HO1 A;  4N5C A;  1OCZ E;  2VGE A;  2XGS A;  3DPY A;  2XPZ A;  1INZ A;  2ZIS A;  4XZ4 A;  1N95 A;  2LSV A;  3EIJ A;  5BV1 A;  5G2N A;  3TWX A;  2BF0 X;  3GZ2 A;  1BI7 B;  3RSE G;  3BEE A;  2EIL E;  3CV0 A;  4FUL A;  4GB9 A;  2WMN A;  1H2U A;  1O1R A;  2VGX B;  4E6H A;  2L6J A;  4JW1 A;  4YDW A;  2WVI A;  1XNF A;  3D9O A;  1L5J A;  1EF1 C;  4GAA A;  4AM9 A;  4XEI G;  4LER A;  4AP2 A;  3ASG A;  2L0I A;  4K03 A;  3FHE A;  3VLF A;  4DPR A;  3CVY A;  2VQ2 A;  1JWF A;  1KLX A;  1Y6I A;  1EYH A;  5ITZ F;  1A5E A;  4JVS A;  3E32 A;  4F1P A;  2FO7 A;  4OAV B;  1JUQ A;  1HH8 A;  4BX9 A;  4JHK A;  3UXG A;  3JQ0 A;  5FQ4 A;  1NFI E;  3FUI A;  3FUF A;  4LSZ E;  2R17 C;  3KEZ A;  5ENS D;  3HYM B;  4CT0 A;  3ZYQ A;  4K5C A;  1IQU A;  2Y69 E;  1E7U A;  3FU3 A;  2DZO A;  3AG2 E;  4O60 A;  4UWG A;  4MBG A;  2XEE A;  2GRL A;  3FU6 A;  3BQO A;  3I4G A;  4PUC A;  4U0U A;  2GRP B;  2E2E A;  2OND A;  3O48 A;  4GTO A;  3UKR G;  3E4B A;  2ETA A;  5CCM A;  2M63 A;  1S70 B;  3D9N A;  4FU3 A;  3ASO E;  3S7J A;  3ZRH A;  2IEJ A;  2Y1L E;  2IQC A;  2F8Y A;  5EKQ D;  4BSZ B;  2QY7 A;  3D9I A;  5T8I A;  4FA6 A;  3S7F A;  1KT1 A;  2QC9 A;  3CVU A;  3CHO A;  2X3M A;  3CVN A;  4NAC A;  1OCR E;  4JZY A;  4GPM A;  3Q9N C;  3L08 A;  3QOU A;  5C2Y A;  3E34 A;  3FY4 A;  5LFA A;  3C5R A;  2V8S E;  3ZXS A;  3PNL B;  4HFG A;  5D2M C;  2J4D A;  2WXL A;  4GYO A;  3CVP A;  4L1B A;  3B7R L;  5KBA A;  4I6G A;  2I2O A;  2XS8 A;  1DNP A;  3EU9 A;  2KXP C;  5A6C A;  2WXP A;  2XPI A;  1S64 A;  3PEU B;  4MKT A;  1TEZ A;  2XQ0 A;  3Q7A A;  3TWT A;  1WY6 A;  2P9K G;  1U3D A;  3LYA A;  3NOG D;  4BWR A;  3TWS A;  3UM0 A;  3HXB A;  3HXE A;  2EIN E;  2R59 A;  3ISM C;  1HZ4 A;  2Y3A A;  2R05 A;  5HQ8 A;  3OAW A;  4UWL A;  4P29 A;  3CLJ A;  3CKB A;  3NB2 A;  4E85 A;  4UI9 C;  5JA4 D;  3VTX A;  4IRU A;  3AS8 A;  1ELR A;  4GCO A;  3JCK C;  2WQ7 A;  2AXU A;  2PL2 A;  5FZS A;  3ENE A;  3QKY A;  4A1S A;  4G24 A;  2E0I A;  4G26 A;  3ESK A;  1TN6 A;  5LOZ A;  2J07 A;  5FIN A;  3ASF A;  5ENQ D;  3AS4 A;  3CIA A;  4N5Q A;  4DLO A;  4YDO A;  5JJ7 A;  3LY7 A;  5EYP F;  2FBN A;  3AJI A;  2LAH A;  3HVE B;  3UIP C;  3P2B A;  3G2U A;  2RD0 A;  2XCC A;  3HXF A;  4Y6W A;  5LCW J;  5J08 A;  4JC8 A;  2P9I G;  1QQE A;  2ETC A;  3PS6 A;  2XEN A;  5FWQ A;  3FH8 A;  4KZC A;  3EHN A;  2KC7 A;  2CHZ A;  3ZFW A;  1LD8 A;  2GRQ B;  4HNA D;  3BUA A;  1PAQ A;  3R7Q A;  3HDX A;  2RFA A;  3NAW A;  2DBA A;  4R7L A;  4ILI A;  3UKU G;  2AVP A;  3AAA C;  1E8Y A;  4EHM A;  3CVX A;  2HE0 A;  1TNU A;  3ZU7 B;  3V30 A;  5DBK A;  2X6K A;  3DEO A;  3SBS A;  4ATG A;  4WNG A;  2J4B A;  2J08 A;  3EHQ A;  2BTD A;  2R02 A;  4M3O A;  2WXK A;  2CFU A;  3R9A B;  3KEA A;  5BXU A;  3Q73 A;  4LNG A;  4A55 A;  3TWR A;  1H0A A;  3U4T A;  3VLE A;  3SI5 A;  2Y4T A;  5HRY A;  4AVX A;  3TGO A;  3FTZ A;  2RG8 A;  4FJY A;  3FUH A;  2P9S G;  4GTS A;  3V79 K;  1NP7 A;  3L54 A;  2LXL A;  3FUL A;  3SZ7 A;  5CER B;  5A23 A;  3CQC B;  4JA7 A;  4NUR A;  3K9I A;  4DUI A;  1Z3Y A;  2AW6 A;  3PZ1 A;  5DIZ A;  3ZIM A;  2VSY A;  2A5U A;  3SBT B;  3Q47 B;  4BFR A;  2VTB B;  3Q15 A;  4GMR A;  2WXJ A;  4DX7 D;  4U8Y D;  2EIJ E;  1SVX A;  2P9N G;  2F0Y A;  4L2Y A;  4GU5 A;  5B3S E;  3B95 A;  5KJL A;  1UOH A;  4I1O B;  3LVQ E;  4GA0 A;  4IN3 B;  4GTV A;  4APF A;  4L23 A;  4UQZ A;  3FH7 A;  2FO1 E;  1K1B A;  4YDE A;  5ARG A;  3FTV A;  2MHK A;  3Q75 A;  2KZT A;  4HOT A;  3FUN A;  3U9W A;  2L9B A;  3IKO B;  2XPY A;  4ANV A;  3QB2 A;  2DIW A;  4HS2 A;  3FTS A;  5B1A E;  2GW1 A;  3S7D A;  3U64 A;  3DRA A;  3VTY A;  3Q78 A;  1BU9 A;  3QJZ A;  4K5B A;  1OUV A;  4CDR A;  5G04 C;  3W9G A;  4LG6 A;  2LAI A;  3SGH A;  2R5S A;  4CT4 A;  1BLX B;  4ACK A;  4XI9 A;  3CKC A;  4B8C B;  5AQ7 A;  3R7R A;  1MX4 A;  1ZU2 A;  1TNZ A;  4FLH A;  1LD7 A;  3RAU A;  5KCM A;  3ABK E;  2VYI A;  2X6J A;  3QAQ A;  3QWP A;  2PZI A;  2QYJ A;  2V4L A;  4EZL A;  1HX8 A;  4CYM D;  3UIN C;  4H7Y A;  4JEU A;  1E96 B;  1UG3 A;  3KSQ A;  4GML A;  4DX1 A;  3FUK A;  4UWF A;  2XCB A;  4YND A;  4EZK A;  4WAF A;  4J8Y A;  3TAX A;  3JQ1 A;  3L22 A;  2Q7F A;  4NQ0 A;  2ZXW E;  2P9P G;  3D3M A;  4HVB A;  1N11 A;  3CHS A;  3FEY A;  4TUU A;  2UY1 B;  2I1J A;  4I2Z A;  2KBX A;  2WXH A;  4AEZ C;  3DSX A;  3NQP A;  4JB8 P;  3FTX A;  4MLP A;  4BES A;  1K8K G;  1KT0 A;  2I9C A;  3D9K A;  2EIM E;  1D9S A;  4EZJ A;  4I43 A;  4ATZ D;  5G05 C;  4GTQ A;  3T5V A;  4FC8 A;  2VGY A;  5KJN A;  3PUK A;  4BX8 A;  3L17 A;  3ZPJ A;  2X6I A;  3B7U X;  2C0M A;  3FEX A;  1TN8 A;  4MRU A;  4J8E A;  3GYZ A;  3OXF A;  2I6H A;  4AY5 A;  4HXI A;  3G2S A;  4FHK A;  2A5E A;  3ABL E;  5CRV A;  3HRA A;  1D8E A;  5FZR A;  4AOF A;  2WMO A;  4U7E B;  2J9Q A;  2WXM A;  2B6C A;  4W9R A;  1RW2 A;  3CVW A;  2R2L A;  2WQ6 A;  1JWG A;  3TG4 A;  1IHG A;  3G2V A;  2VSO E;  2ZGD A;  4PS3 A;  4I1M A;  5KJM A;  4U8V D;  2GRO B;  1WG0 A;  4JHR A;  5FT9 A;  1N0R A;  4CGV A;  1TJC A;  1ZB1 A;  4UWH A;  4YDY A;  5ENR D;  3LY9 A;  3ZVV A;  3G2T A;  4BER A;  4JEH A;  1JCQ A;  1AP7 A;  3LJ3 A;  2XS1 A;  3J5P A;  4FJZ A;  4HRM B;  2V0P A;  1P5Q A;  4AY6 A;  3CQG B;  3FTW A;  2XGO A;  5E76 A;  4J6I A;  5M72 A;  4GTR A;  3RO3 A;  3AG3 E;  5CHE E;  4FAD A;  3LKU A;  1UJJ A;  3ZYK A;  3UUX A;  2L6B A;  4GTT A;  1JPL A;  1MX2 A;  1TNO A;  4YVO A;  3G2W A;  4TXR A;  4ZFH A;  3D9H A;  1HU3 A;  4N3B A;  3L6A A;  5CRU A;  4GZC A;  1S0P A;  4DK5 A;  3JUE A;  4HLE A;  3RRU A;  3C3O A;  1RZ4 A;  3T5X A;  4FHJ A;  5JMN D;  3UIO C;  4HOR A;  4A3T A;  4UI9 J;  1AWC B;  2ZGG A;  2X38 A;  2PQR A;  4Q69 A;  1HS6 A;  4KYO B;  2YIN A;  4OAU C;  2WXR A;  4QFV A;  2MYO A;  3EIQ C;  4U96 D;  4BET A;  1PY1 A;  3LPZ A;  4G2V A;  5J90 A;  3D9J A;  3L9T A;  2A4Z A;  1H6P A;  1OCO E;  5AN8 A;  3PZ2 A;  1NL4 A;  4ME2 A;  4KBQ A;  2Y4U A;  5AEN A;  1UJK A;  2ZIR A;  2IOS A;  4XIF A;  3GZS A;  4N3A A;  1SA4 A;  4WWP A;  5H7P A;  3HIZ A;  1EPU A;  3DST A;  1K1A A;  3PVL A;  2PNN A;  1MX6 A;  2KCK A;  2VSX E;  5BPP A;  1E8W A;  4BSX A;  2H6F A;  2LUH A;  5AQB A;  4BT9 A;  3UX4 A;  3LJN A;  2IOL A;  5FQ8 A;  3OXG A;  1KZP A;  4GZ3 A;  5A7D B;  3ZKJ A;  4UI9 K;  3PUJ A;  4N3C A;  1OWN A;  3Q49 B;  4B89 A;  2C0L A;  3X2Q E;  2FEZ A;  1V55 E;  5EYL A;  2LSU A;  3SO8 A;  3ZYM A;  4G8K A;  4PS7 A;  3RIB A;  4L2L A;  3LXU X;  4M7C A;  3OXL A;  3ML9 A;  3URZ A;  4J8D A;  3L16 A;  3U66 A;  1DC2 A;  3JXI A;  5ENO D;  3RJV A;  3ZUV B;  2AXZ A;  4JL0 A;  1QNF A;  2P2C P;  1DCE A;  3QK0 A;  2GRR B;  3PH0 C;  3ZXP A;  5BXO A;  4U95 D;  3SQV A;  1U2V G;  3UPV A;  3ULQ A;  1N0Q A;  1IHB A;  5EID A;  4N2Q A;  2VJ8 A;  5E75 A;  4B94 A;  4G23 A;  3KD7 A;  1ELK A;  5JHA A;  4BT8 A;  4F7A A;  4XKC A;  3EJN A;  3DWL G;  3PZ3 A;  5CED B;  3TG5 A;  3FFL A;  3ASN E;  2PM6 A;  1IYG A;  3ULY A;  4RLY A;  3QNK A;  5JJT A;  4XKB A;  4C48 B;  4Q94 A;  1IKN D;  2VSN A;  3QC1 A;  2UWJ G;  3V31 A;  3RRN B;  4IUL A;  5BNW A;  3DEP A;  1NI1 A;  2PM7 A;  2DYS E;  3LEW A;  5IY5 E;  3MJW A;  2F8X K;  5CEA A;  1HG2 A;  2PQN A;  3B7S A;  4ANU A;  1SZ9 A;  4L9P A;  3S2A A;  3PNT B;  3Q7F A;  3FU5 A;  2YNQ A;  1HG5 A;  4GZD A;  3T9K A;  5ENT D;  2XZT G;  2IFU A;  2OCC E;  4C0M A;  2FUL A;  3FWV A;  4NIK A;  3APC A;  3VLD A;  5HI7 A;  5KJK A;  4EQF A;  2P58 C;  2IY0 C;  3LY8 A;  4PH4 B;  5ANR A;  2KM4 A;  2EIK E;  3E33 A;  3PE4 A;  5G04 J;  3MA5 A;  3RRM B;  1TNB A;  3UTM A;  4GYY A;  2RKK A;  4DI3 A;  3EHR A;  3MKR A;  3EUV A;  4APO A;  3TWV A;  4G1T A;  1DCQ A;  2KZT B;  4U04 A;  4IYP A;  4OYS A;  4LEU A;  4Q96 A;  2LO6 A;  2BKG A;  3U3W A;  4ANW A;  1UN8 A;  4CZ2 D;  4C9B B;  4LNB A;  3S7B A;  3N71 A;  3KS2 A;  3UT8 A;  4DX5 D;  2ZU6 B;  2WXF A;  3C72 A;  2J09 A;  1WAO 1;  3ASD A;  5ANL A;  1N54 A;  2P9U G;  3PEV B;  4ILH B;  4XI0 A;  3DBS A;  4C0E A;  4QQI A;  5LP0 A;  1SW6 A;  2KCL A;  5JHB A;  4HRN A;  4ANX A;  1VDY A;  4EBA A;  2OVB A;  3C3R A;  3CVL A;  3SFX A;  1HF8 A;  4BTA A;  2OEV A;  4TUM A;  2YQ8 A;  2OEW A;  1E8X A;  2F37 A;  5AQ9 A;  3D9L A;  4BEP A;  1H2T C;  1OT8 A;  4UQX A;  4F53 A;  3QWV A;  3SFZ A;  3NZS A;  3DSU A;  1FVF A;  2H6G A;  3JXJ A;  3E30 A;  4B0Z A;  4L7T A;  2ION A;  3ESL A;  3NOC D;  1X5B A;  1OWM A;  3CHR A;  3ZNG A;  2I1K A;  3GZ1 A;  3HXD A;  3O4Z A;  4CDN A;  3TL5 A;  1ZBP A;  2XHE A;  5G05 J;  4U0Z A;  1E8Z A;  2XRY A;  3ZYL A;  1A17 A;  1FCH A;  1NZN A;  3MKQ A;  5FJY A;  4N39 A;  4HI9 A;  5BV0 A;  3Q79 A;  3RU0 A;  2V4H C;  3B7B A;  3IHY A;  1YYH A;  5ENP D;  4X8Q A;  3HG0 D;  4GA1 A;  2J49 A;  3CGH A;  1SA5 A;  4F3V A;  2WXN A;  2WXO A;  3ONL A;  2Y0B G;  1JCR A;  4HOQ A;  3BG0 B;  4TXP A;  3UM2 A;  1FT2 A;  2GGF A;  2H6H A;  4AIF A;  3I4R B;  4PS8 A;  4HI8 A;  5AJD A;  4GCN A;  2YHE A;  1H2V C;  5FZQ A;  5D0Q D;  3D9P A;  1TYQ G;  4DX2 A;  3TXM A;  2EQX A;  3AU5 A;  4UUC A;  5BW8 C;  3ZN3 A;  1X81 A;  3E37 A;  2WXI A;  1N9A A;  3FUD A;  3AU4 A;  3OTN A;  2IU1 A;  3B7T A;  3IV0 A;  4LRZ A;  1FPP A;  3ASH A;  4Y6C A;  3FUM A;  4HB5 A;  1QZ2 A;  4KMO A;  3PZD A;  3IHV A;  4TRQ A;  3LS8 A;  3ULE G;  4F6R D;  3MV2 B;  4FLB A;  3MX3 A;  2RFM A;  3DPD A;  1N94 A;  2VGX A;  3QDN A;  5T4Y A;  4N2S A;  3JUI A;  3SD5 A;  3MZL B;  3RK6 A;  3FP3 A;  3SF4 A;  4BTB A;  1QYM A;  5JJ6 A;  3WG7 E;  3APF A;  2XRZ A;  3FTU A;  1LTX A;  4MS6 A;  1LF8 A;  4GMJ A;  3AG4 E;  3TXN A;  3TJP A;  3PE3 A;  4HOU A;  1TR4 A;  4HLL A;  3W9F A;  3DSW A;  5CEC B;  5AIJ A;  3DSV A;  4GZ5 A;  1N4S A;  3CEQ A;  1HXI A;  3BG1 B;  1GW6 A;  4WNE A;  4AJW A;  4A3V A;  3R9M A;  4RQI A;  1KZO A;  4KVM A;  3KSL A;  3LDZ A;  5EDS A;  4ACL A;  2WXQ A;  1YA0 A;  1H19 A;  3RO2 A;  3UQ3 A;  4B8A A;  4J7W A;  3FH5 A;  4G8L A;  3T8M A;  2IJG X;  4HQD A;  3DSS A;  2YHC A;  5T3R A;  3LVR E;  4BY6 A;  4URK A;  1V54 E;  4HRL A;  2ILR A;  3C98 A;  3HHM A;  2R03 A;  4PDX A;  3V2O A;  2GRM A;  4D10 C;  4DJA A;  2DWZ A;  1TNY A;  1OWL A;  1Y8M A;  2XEH A;  4Z68 A;  3CVQ A;  4I6E A;  2JLB A;  4UWK A;  1MJ0 A;  4YVQ C;  4I2W A;  1UN9 A;  2DCP A;  3ML8 A;  2H6I A;  1ELW A;  4G25 A;  3IBE A;  3NF1 A;  4WND A;  1JCS A;  3BU8 A;  4JXT A;  4I9C A;  3EU5 A;  3HXC A;  3Q9U C;  4LCT A;  4I1A A;  2DYR E;  2XGM A;  1N4Q A;  1WM5 A;  2DVW A;  2V5Q C;  3CHM A;  3J5Q B;  1YMP A;  4K0R A;  3ZGQ A;  3CR3 A;  3CK9 A;  3P1U A;  4XX5 A;  2BED A;  4GZ6 A;  3KAE A;  3DXK G;  1UW4 B;  4FP7 A;  2OVF A;  2WB2 A;  2X6H A;  4WWN A;  2KAT A;  4A1G A;  4WUY A;  2DZN A;  2HYZ A;  4LNU D;  2AWI A;  4OVU A;  2QZA A;  2CFZ A;  4GYW A;  4GA2 A;  3T8K A;  1BD8 A;  4WNF A;  2QYU A;  4B93 B;  1E7V A;  5EIB E;  4F1S A;  4WWO A;  4ILG A;  3TWU A;  5HKP A;  4O1P A;  4G11 A;  4XE0 A;  1B89 A;  5CBN A;  3UM1 A;  2AJA A;  2MOW A;  4TXQ A;  1BI8 B;  3MGB A;  1MZC A;  3HVE A;  4RG9 A;  3SHF A;  2LXM A;  1TN7 A;  3Q5M A;  1MYO A;  1IQR A;  3UT7 A;  2X6F A;  3EHM A;  2B0O E;  3CST A;  5BUZ A;  3UI2 A;  1Q2Z A;  2L0T B;  1NA3 A;  1N52 A;  4ABN A;  4UQY A;  4JA9 A;  1O5M A;  4I9E A;  1W3B A;  2QFC A;  3PZ4 A;  3B13 A;  5ARF A;  3ZEF A;  5CMW A;  1O1T A;  3TWQ A;  4CCA A;  3ONK A;  1MQS A;  1PC2 A;  4U0S A;  4J0U A;  4K5A B;  3QWW A;  3I3N A;  1KPS B;  4EEC A;  4O6F A;  1TJF A;  1Z3X A;  3L82 A;  1U3C A;  3FU0 A;  5D66 A;  3RKV A;  1WDY A;  2HM8 A;  1SZA A;  2NYJ A;  3GW4 A;  4HBD A;  4CEM A;  5LCW C;  1Z5S C;  3ABM E;  4U63 A;  4EBA G;  2GRN B;  3CHP A;  4H7X A;  5AJL A;  4I17 A;  3SNX A;  2FI7 A;  4JD2 G;  3C3Q A;  2BUG A;  3EDT B;  3LCA A;  1H6O A;  3NZU A;  3PRE A;  5AQA A;  2WXG A;  3IEG A;  3SY2 A;  2NXP A;  3CK8 A;  2WM9 A;  2XZD G;  5KWD A;  5CBO A;  3QAR A;  5KNG A;  3FDH A;  1HO8 A;  4J8F A;  4DRX E;  1IXV A;  2AXV A;  4CGW A;  2JEK A;  1HE8 A; 
#chains in the Genus database with same CATH homology
 5AQB A;  3V31 A;  1BLX B;  3TWX A;  1D9S A;  1MJ0 A;  5FIN A;  5ENQ D;  4DUI A;  1BI7 B;  2L6B A;  3LJN A;  1MYO A;  4N5Q A;  4ATZ D;  2ETB A;  2Y1L E;  3DEP A;  5AQ7 A;  2F8Y A;  1MX2 A;  4BSZ B;  2Y0B G;  4QQI A;  1MX4 A;  5EYP F;  4ZFH A;  3ZKJ A;  2B0O E;  3D9H A;  5KNH D;  3AJI A;  1SW6 A;  5CEA A;  1OY3 D;  2F8X K;  2QC9 A;  1QYM A;  3UI2 A;  4YDW A;  5AAR A;  4HRN A;  5EYL A;  5EIL A;  3SO8 A;  3Q9U C;  2ETC A;  4GPM A;  2XEN A;  4GMR A;  3Q9N C;  3T9K A;  4G8K A;  2A5E A;  5ENT D;  4DX7 D;  2XZT G;  3JUE A;  4U8Y D;  3TWQ A;  1SVX A;  2DVW A;  2QYJ A;  3HRA A;  4HNA D;  2V5Q C;  3C5R A;  3J5Q B;  1TR4 A;  4NIK A;  1YMP A;  2RFA A;  4HLL A;  4TUM A;  3B95 A;  4CYM D;  1K3Z D;  4HI8 A;  1DC2 A;  3JXI A;  5ENO D;  5JMN D;  3W9F A;  5KBA A;  5CEC B;  1UOH A;  2F37 A;  4K5A B;  3ZUV B;  3AAA C;  3EU9 A;  2J8S D;  2KXP C;  3IXE A;  5AQ9 A;  4BEP A;  1AWC B;  5ITZ F;  1OT8 A;  2ZGG A;  1A5E A;  2HE0 A;  4DX2 A;  4DX1 A;  4DX6 D;  4F1P A;  2P2C P;  3ZU7 B;  3V30 A;  3TWW A;  3TWT A;  3DEO A;  4OAV B;  2JAB A;  3JXJ A;  4UUC A;  5D66 A;  1WDY A;  2ZGD A;  4QFV A;  3UXG A;  5BXO A;  4U95 D;  2MYO A;  4U96 D;  3NBN B;  3NOC D;  1NFI E;  4BET A;  2NYJ A;  3EHQ A;  3NOG D;  4LSZ E;  4HBD A;  4J8Y A;  3TWS A;  2FO1 E;  1K1B A;  4O1O A;  3UTM A;  1N0Q A;  1IHB A;  5EID A;  4U8V D;  1WG0 A;  3ZNG A;  1N0R A;  5ENS D;  3EHR A;  5HS0 A;  2DZN A;  3KEA A;  4J7W A;  4K5C A;  5AAO A;  5BXU A;  4LNU D;  4G8L A;  5AN8 A;  4YDY A;  1N11 A;  3TWV A;  4HQD A;  3TWR A;  2DZO A;  5ENR D;  1DCQ A;  1YCS B;  4BER A;  3V2X A;  5HRY A;  5CED B;  1AP7 A;  4ZHB A;  2KBX A;  3T8K A;  3F6Q A;  1BD8 A;  5EN5 D;  4O60 A;  5EIB E;  4B93 B;  4HI9 A;  5JA4 D;  2BKG A;  2BKK B;  4A63 B;  4HB5 A;  3J5P A;  2XEE A;  5AQA A;  5FIO A;  4HRL A;  1BU9 A;  4CZ2 D;  3TWU A;  4JB8 P;  5HKP A;  2V4H C;  3B7B A;  4K5B A;  4O1P A;  4RLY A;  4BES A;  2XZD G;  2VGE A;  4HRM B;  5KWD A;  4OAU C;  3V2O A;  1K1A A;  5CBO A;  3W9G A;  1YYH A;  4LG6 A;  5ENP D;  2PNN A;  1MX6 A;  5KNG A;  5CBN A;  4DX5 D;  3HG0 D;  4C48 B;  2AJA A;  2DWZ A;  2ETA A;  3V79 K;  1IKN D;  4DRX E;  4F6R D;  1IXV A;  1S70 B;  5CER B;  1BI8 B;  2XEH A;  1G3N B;  4Z68 A;  2RFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...