2DZOA

Crystal structure analysis of yeast nas6p complexed with the proteasome subunit, rpt3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
228
structure length
228
Chain Sequence
MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Probable 26S proteasome regulatory subunit p28
publication title Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
rcsb
source organism Saccharomyces cerevisiae
total genus 61
structure length 228
sequence length 228
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2dzoA00
1BI7B 3B7BA 2NYJA 5BXOA 1TR4A 5FINA 4G8KA 3V31A 2XEHA 1WDYA 2JABA 3J5PA 1QYMA 3T8KA 4LSZE 1S70B 1BU9A 1N11A 1MYOA 2ETCA 5AQ7A 2Y1LE 3DEOA 4DUIA 2QYJA 3Q9UC 4G8LA 4CZ2D 1IHBA 2ETBA 1BI8B 4C48B 4DX1A 4U8VD 1DC2A 3TWWA 4HLLA 2V4HC 3W9GA 3V30A 1MX6A 3V2XA 1IXVA 3ZUVB 4NIKA 5EYLA 3DEPA 5AAOA 5ENTD 4U95D 2DVWA 2L6BA 2VGEA 2DWZA 2P2CP 4OAVB 2AJAA 5CBOA 3JXIA 3KEAA 2DZOA 3LJNA 4LG6A 5EN5D 3ZKJA 1K1AA 3TWVA 2F8XK 4F6RD 4ZHBA 5HKPA 3Q9NC 5KBAA 4DRXE 5EIDA 5AQBA 2FO1E 2BKKB 1D9SA 4QFVA 4QQIA 5ENRD 2BKGA 4DX6D 3JUEA 1AWCB 4B93B 4BEPA 1UOHA 5ENOD 5HRYA 3UTMA 3B95A 5CBNA 1IKND 2QC9A 4YDWA 5HS0A 4K5CA 5EILA 3JXJA 5ENPD 5ENSD 3EHRA 3ZNGA 4HRMB 3HG0D 3D9HA 2J8SD 3SO8A 4DX2A 1OY3D 5KNHD 5CECB 3AJIA 2RFAA 3C5RA 4ATZD 3EHQA 4LNUD 5KNGA 3TWQA 1G3NB 4GMRA 3NBNB 5ENQD 1YMPA 5ITZF 5CERB 4HI9A 2XENA 5AN8A 1N0RA 4RLYA 3T9KA 4CYMD 5FIOA 3NOGD 4HI8A 4O1PA 5EYPF 4BETA 4YDYA 1AP7A 3IXEA 1NFIE 1K3ZD 3ZU7B 1YCSB 4GPMA 4UUCA 2Y0BG 3TWUA 4U96D 5AARA 1BD8A 3UI2A 3V2OA 4HQDA 4BERA 4F1PA 4HNAD 4HB5A 1A5EA 1SW6A 2RFMA 1K1BA 4DX7D 2ETAA 1MX2A 4N5QA 4O1OA 3W9FA 2F8YA 3TWXA 4J8YA 1N0QA 4HRNA 2KBXA 5CEAA 4HBDA 2A5EA 1MJ0A 2V5QC 3F6QA 4J7WA 2DZNA 2ZGGA 3HRAA 4HRLA 2XZDG 1OT8A 1BLXB 2B0OE 5JMND 5JA4D 3NOCD 1DCQA 3TWTA 5BXUA 5D66A 4DX5D 4ZFHA 2ZGDA 2XZTG 2PNNA 3EU9A 5AQ9A 1SVXA 4A63B 4JB8P 3TWRA 3J5QB 1YYHA 3UXGA 3V79K 2HE0A 5CEDB 2XEEA 4Z68A 4TUMA 5AQAA 5EIBE 5KWDA 2F37A 4O60A 4K5AB 2KXPC 4OAUC 4U8YD 1MX4A 4K5BA 4BSZB 1WG0A 3AAAC 3TWSA 4BESA 2MYOA
chains in the Genus database with same CATH superfamily
1OWLA 2J49A 2XEHA 4JPSA 3GZ1A 3KSLA 3ZXPA 4RG9A 3BG1B 2OOEA 2LAHA 2Y69E 1MX6A 2WM9A 4X8QA 2KC7A 2MHKA 2VGEA 4G1TA 2GGFA 3KEAA 2F8XK 4F6RD 5JJ7A 5FQ4A 2XCCA 4L7TA 2GRLA 2WXIA 3PRZA 3ASNE 3MZLB 3ESKA 1KPSB 5BT1A 3HG0D 3CSTA 5A23A 2RFAA 2M63A 2XGSA 4GZDA 4ANWA 3FY4A 3IXEA 3UIPC 4N3AA 4UWLA 4U0ZA 3TWUA 3PEUB 1QBQA 5AARA 1FT2A 3BG0B 4HB5A 1SW6A 1U3DA 3FU5A 3EHMA 4I1OB 2OEWA 3UM3A 4GTVA 2C0LA 2FO7A 1OT8A 1V55E 4AIFA 1ZU2A 1WM5A 3RO2A 2FI7A 4GYOA 3CVNA 4ME2A 5KWDA 2YHEA 2XGMA 3R9AB 2R02A 4K5BA 3UM2A 2I1JA 5ANRA 3U4TA 5BXOA 1V54E 1E8ZA 2JABA 1HO8A 4GZ3A 4Q69A 3T8KA 2HO1A 5G2NA 2QYJA 1HE8A 2V5FA 3NZUA 3OXGA 4GTTA 5EYLA 4FLBA 1O5MA 3ASOE 4KXKB 3LXUX 4CGVA 3EIQC 3JUIA 2XRYA 1LD7A 1Z6TA 2WB2A 4DLQA 2CFUA 4A3TA 2F0YA 4CT4A 3MGBA 3TG5A 3HXFA 3S7DA 1N52A 3CHRA 3UUXA 3D9LA 3OXFA 4JHKA 3APCA 1SZAA 3C3OA 5AN8A 4J0UA 4RLYA 2OVBA 2VGXB 2J9QA 2DIWA 1NFIE 3I4GA 1OCOE 1DVPA 3V2OA 1N4SA 1PC2A 3CVWA 3UT8A 2ONDA 2VSXE 4AM9A 2GRNB 3ASHA 4CDRA 1Y6IA 3KAEA 4J8EA 2VJ8A 4F7AA 1N4RA 2WXLA 5KJLA 3C98A 4W9RA 3SGHA 3U9WA 4TUUA 4CGWA 3T5VA 3KD7A 5AJDA 3CVUA 4BSZB 1WG0A 2HYZA 4N39A 4H7XA 4WAFA 3E34A 4LSZE 3I3NA 1UW4B 1N11A 2X6FA 3EDTB 4LCTA 4DJAA 5HQ8A 2P9PG 4XX5A 3MCXA 5D2MC 2MOWA 2GRMA 4B0ZA 4JA7A 5ENTD 2L6BA 1UN8A 1Z5SC 5ENNA 1TYQG 3RK6A 2HM8A 5EIDA 5EKQD 2BKKB 2KCLA 4QFVA 1D9SA 4DX6D 3JUEA 4LNBA 2IY0C 1TNUA 4FLHA 3ZNGA 1A17A 4EZJA 3EHQA 1G3NB 3RRNB 4A1GA 3FTSA 2FULA 3IBEA 4L9PA 1AP7A 2B6CA 4ILGA 3CVPA 2IFUA 1X5BA 2DYSE 3C3QA 1TJCA 1S64A 4GU5A 5AENA 1N9AA 3HRAA 3PUKA 3ZXSA 5J90A 2P9SG 1E96B 4UWKA 4D10C 2XCBA 3FUFA 2HR2A 1MQSA 4ILHB 2A5UA 3B13A 2WXOA 3U66A 4XE0A 3HXEA 3ZVVA 1TR4A 3MYVA 4TRQA 3OXLA 3SFZA 2J08A 2Y1LE 3O4ZA 3AU5A 3RJVA 4BTBA 3V2XA 3DEPA 1JWGA 3PZ2A 3PUJA 4OYSA 3VTYA 1NP7A 3K9IA 4GTSA 3TWVA 3DBSA 3C72A 4CCAA 5HKPA 4G24A 1IQRA 4KZ0A 2CHWA 2ZIRA 3AG1E 1U2VG 4BEPA 3UTMA 2WQ6A 1RZ4A 5ENSD 4LNGA 4PDXA 3PVLA 2DCPA 4WWOA 4GMRA 4XZ4A 2WXJA 2IO3C 3AS5A 3MA5A 4M3OA 3CVXA 2I1KA 4RVBA 2R59A 3ULQA 1K3ZD 3ML8A 3ZYLA 3DSTA 1JCSA 3FH5A 1N4PA 3E37A 2XEVA 1EPUA 4K03A 5EX0A 3HVEA 1UJKA 2CG2A 1D8EA 1N0QA 3P2BA 5CEAA 3G2WA 3Q79A 3ZW3A 2XZDG 4FJYA 3NOCD 1XGWA 3FFLA 4C9BB 3S7FA 3ABKE 4U0SA 1NA0A 2WXFA 1SZ9A 2PNNA 3FEYA 3FULA 4L2YA 5G04C 2HE0A 5CEDB 4KT6B 3I5PA 4I9EA 3FDHA 3TJPA 2V4LA 3CKBA 1LF8A 4DI3A 4EZKA 3CGHA 4FULA 4CEMA 4JVSA 2XHEA 4JXTA 4U8VD 3B7UX 3E4BA 3IHYA 2QFCA 5LFAA 4N2QA 4LG6A 3E33A 5JJTA 2AXZA 4B94A 3NB2A 3TG4A 3AU4A 1HX8A 3LPZA 4N2SA 3DRAA 3RRMB 2EQXA 3EU5A 2VQ2A 5EILA 3CLJA 2Q7FA 3UM0A 2EIJE 2J8SD 5ANLA 5KNHD 3LEWA 1JPLA 4A55A 4ANXA 2UY1A 5EYPF 2H6FA 4F3VA 3LY7A 3D9MA 4HOUA 2RFMA 1K1BA 3LYAA 3NZSA 1OCRE 4EECA 3ZFWA 1E7VA 3CHQA 2DZNA 2J09A 3E30A 4M7CA 5T8IA 2XGOA 3DPDA 3FU3A 3Q75A 3ZHEA 3O48A 2UWJG 3NF1A 3ZYKA 4J6IA 3LS8A 4CDMA 4GPKA 4JB8P 1KT0A 3Q7AA 2RKKA 5D0QD 3P1UA 5FZSA 4BESA 1OWOA 4DI4A 4I43A 1OXJA 3MKRA 4ATGA 2X3MA 3D9PA 4EBAG 1OCZE 3Q9UC 2OCCE 1IHBA 5G04J 2YQ8A 4C48B 4DX1A 2PQRA 1TEZA 1TNBA 4YVQC 4DLOA 2DWZA 3ZRHA 4UI9J 5CBOA 2EIKE 3LJNA 1JCRA 3HVEB 1H6PA 4ZHBA 1SA5A 3PE4A 4DRXE 1K8KG 4UI9K 5ENRD 1X81A 4XIFA 4HFGA 5ENOD 2FEZA 4R7LA 5ENPD 4PS8A 2X6HA 3NBNB 2XQ0A 4HS2A 5FIOA 4GYYA 1OUVA 1YCSB 1FT1A 4U96D 1BD8A 3SQVA 4ILIA 4JA9A 3PNTB 2R5SA 4F1PA 4L1BA 1IHGA 3JQ1A 4OVVA 2I9CA 5DBKA 3QAQA 4I9CA 3TWXA 1HFAA 2KBXA 5A7DB 2BEDA 5C1DA 4K0RA 4AY6A 3D9NA 3EIJA 4J8SA 3CQCB 3L9TA 3J5QB 4KZCA 3TWRA 2XEEA 2WMOA 2I6HA 3UKUG 4IYPA 4UWGA 1SA4A 3QDNA 5LP0A 3TWSA 4A1SA 2X6IA 2VTBA 3CSFA 3KS2A 2CG3A 2P9IG 4B89A 1XNFA 2WXGA 4GCOA 3VLEA 1NI1A 2PQNA 3CK8A 1O1RA 3T5XA 3PH0C 4I2WA 3RO3A 1IYGA 4I2ZA 4XI9A 5AAOA 4WNGA 2UY1B 3G2SA 4ACLA 2AJAA 2IF4A 4C0EA 3TXNA 4E6HA 4LEUA 3UINC 5E76A 2X6KA 4BT9A 5FWQA 3CKCA 1INZA 1AWCB 4B93B 4U8HA 3L54A 3OTNA 2KCVA 3ZHEB 3C5RA 2IJGX 1E90A 3TWQA 5ENQD 2WQ7A 5CMWA 5LOZA 1E8XA 1E8YA 2XENA 1FVFA 5EDSA 2XS1A 4O1PA 3JYSA 4JL0A 1O1SA 3S7JA 3PZ1A 2E0IA 5ARGA 3EUVA 3VTXA 4DX7D 4O1OA 3RU0A 4FA6A 2R17C 3R7QA 2A5EA 4BTAA 2ZGGA 4G26A 4PH4B 3GZ2A 1ELKA 1DCQA 1O1TA 2XZTG 4ABNA 2GRPB 4LERA 3FH8A 2LO6A 5BUZA 1FCHA 4C0MA 4K5AB 4RSYA 4Y6WA 4IRUA 1Z3XA 1N4QA 2LXMA 3G2UA 3ZYMA 3RIBA 2WPVA 3J5PA 1E8WA 1B89A 4Q94A 2H6IA 3DEOA 4G23A 2YINA 4CRWA 4YDEA 2V4HC 2LNIA 2Y4TA 3ISMC 4WUYA 2ZISA 3IV0A 3DSXA 3JXIA 3SBTB 5CRVA 4KVOA 3Q73A 2C0MA 3UM1A 4ACKA 3QARA 3B7RL 4GA0A 1L5JA 3HIZA 4YDWA 3ZPJA 3TL5A 2PM7A 3EHRA 4XEIG 3D9HA 3PE3A 4I17A 4NACA 4GZ6A 2GW1A 4KVMA 3FUKA 4BETA 4YDYA 5FZQA 4NRHB 2WXNA 5A6CA 4NQ0A 2VTBB 3ZGQA 1MZCA 4MRUA 3ULYA 5BV0A 4F53A 4RQIA 1S0PA 3SD5A 4B8AA 2Y3AA 3TGOA 4GB9A 2KM4A 3ASDA 5BXUA 3ULEG 4E85A 2QY7A 4APFA 2WQHA 3CHOA 5AIJA 4PS7A 3FUIA 3PREA 4O60A 2RG8A 1ZBPA 5CCLA 3G2TA 2CHZA 3DSVA 5G05J 1QQEA 3CHMA 4XI0A 1BI7B 3B7BA 3L16A 3V31A 4HOTA 1ELRA 2XPIA 3QK0A 4GCNA 5AQ7A 4HXIA 3UT7A 3D9KA 2ETBA 5AJLA 4JW1A 3V30A 1H19A 3LY9A 2EIME 4GTPA 2WXKA 3HYMB 2L0IA 1LTXA 3Q9NC 2FO1E 5KJMA 2DBAA 3PZ3A 1UOHA 4MKTA 3DSWA 2LAIA 5HS0A 3S7BA 3HXCA 4BWRA 3L82A 2RD0A 4U63A 3TAXA 2P9KG 3B7SA 5H7PA 5KJNA 1N0RA 4APOA 4EPZA 5C2YA 3D9IA 1NA3A 3CVYA 3BU8A 4N5QA 4JZYA 1TN7A 4HBDA 5CHEE 5JMND 2B0OE 5DIZA 5BPPA 4G25A 1HS6A 3T8MA 2IOSA 3Q5MA 5BNWA 3MKQA 1YYHA 5LCWC 2KATA 5AQAA 3QNKA 5IY5E 3CHSA 3Q4AB 2KXPC 2VSYA 4U8YD 3AAAC 1KT1A 2NYJA 4EHMA 5FINA 5B1AE 1Q2ZA 2WVIA 3APFA 4AY5A 4GTMA 1UG3A 3SF4A 3L13A 1MHQA 3ONLA 4UI9C 2DZOA 3X2QE 5EN5D 2AW6A 1K1AA 5JHAA 1ZB1A 3RKVA 3Q49B 4J8DA 2VYIA 3PDNA 3GZSA 1IKND 1FPPA 4HRMB 3FTVA 2JEKA 5CECB 3QKYA 3ESLA 3E32A 3CR3A 4U04A 4WNEA 3SFXA 4GTOA 3R7RA 3JQ0A 4GPMA 3LVRE 3UI2A 2ZXWE 3PEVB 2ETAA 4TXQA 4HLEA 5JJ6A 3W9FA 5FQ7A 3PZ4A 2V5QC 3F6QA 1NL4A 1QZ2A 3D9JA 3FEXA 2ZGDA 5D0OD 1N54A 3QJZA 4JEHA 4ANVA 2WXRA 5FJYA 4U7EB 4AEZC 2EINE 2VSOE 2LSVA 2QZAA 3SHFA 2L9BA 2KZTA 4H7YA 4WNDA 2AXUA 2V8SE 2PL2A 4KMOA 4J8FA 1U3CA 5LCWJ 3ABLE 1DC2A 2LUHA 4FHKA 1IXVA 3RSEG 4NIKA 1DNPA 3FTZA 3EJNA 4N5CA 3ZKJA 4RG6A 5KBAA 3KSQA 2KCKA 4TV3A 4I1AA 4YNDA 5CMYA 4AVXA 4GMJA 1JWFA 3AJIA 3FTUA 3ML9A 4XKCA 5KNGA 5ITZF 1YA0A 3MKQB 2H6GA 1UJJA 2A4ZA 4HI8A 2X6JA 1H6OA 2PM6A 4L23A 1HZ4A 3CEQA 2YNQA 3RAUA 3CVQA 1HG5A 1H6KA 3Q7FA 3CHPA 3U64A 3ENEA 3L17A 3ZYQA 2WXPA 1FVHA 4GTRA 4ZFHA 4UQXA 1PAQA 3VLDA 4F1SA 3SY2A 3ASFA 3HXDA 5FQ8A 4GA2A 3DXMG 1JCQA 2IEJA 3FTWA 4HOQA 1MX4A 2V0PA 5JHBA 1IQUA 1N95A 2WXHA 3RRUA 1QYMA 2R03A 4CZ2D 3MX3A 4HLLA 4EQFA 2P58C 2DVWA 4G11A 3UT4A 4HOSA 4LRZA 2GROB 3WXXA 1UN9A 2XRZA 4UWFA 2GRQB 3WG7E 3LJ3A 3UIOC 2NSZA 4QQIA 4EBAA 3Q15A 1HXIA 2QC9A 3UPVA 1NZNA 1DCEA 4GYWA 3SO8A 3G2VA 4ATZD 5B3SE 3MV3B 4MLPA 2BTDA 2J07A 4XKBA 5T3RA 3LKUA 3ZU7B 1HH8A 1TN6A 3ABME 4BY6A 3IEGA 2OVFA 3SI5A 4KYOB 2IOLA 2LSUA 2KZTB 2F8YA 3FWVA 2X38A 4Y6CA 3VLFA 5KCMA 3TWTA 3BQOA 3N71A 3AS4A 2NC9A 4BSXA 3FP3A 3QWPA 2J4DA 3EU9A 3QWWA 2AXVA 1GW6A 4PUCA 3V79K 5EIBE 2XPZA 1H0AA 2LXLA 2BUGA 5G05C 2MRIA 4HVBA 4OVUA 3ZEFA 3SBSA 1BI8B 2GRRB 4GAAA 4GZ5A 1TNOA 3CQGB 1HG2A 3Q47B 3CVVA 3FHEA 4B8CB 4KBQA 1TNYA 1OWPA 5T4YA 2BKGA 2J4BA 4Q96A 2Y4UA 4N3CA 5HRYA 3B95A 3NQPA 1OY3D 2XPYA 4AP2A 2IU1A 2WXMA 5CCMA 3AS8A 3JCKC 3URZA 3NAWA 3QB2A 3AG3E 4PS3A 3ASGA 2NXPA 4HQDA 4HNAD 5M72A 1H2UA 4L2LA 4BX8A 3HXBA 3LY8A 4HRNA 1BPOA 4WWPA 3HDXA 2WMNA 2YHCA 4U0UA 1N94A 1LD8A 1HF8A 3UX4A 5AQ9A 4A3VA 4G2VA 4AXHA 3QC1A 4TUMA 3ONKA 2F37A 4FJZA 4TXPA 2E2EA 2I2OA 4IN3B 2VGYA 3CK9A 3B7TA 3SFYA 1MYOA 4GZCA 4I1MA 2R05A 3FUDA 3TWWA 3MV2B 3ZUVB 1W3BA 3FTXA 3IHVA 1S63A 3SZ7A 3UMVA 3UQ3A 4BFRA 1TJFA 2BF0X 3KEZA 4JHRA 1TN8A 4DPRA 2FF4A 3LCAA 4URKA 5AQBA 3GYZA 5EX3A 3APDA 4JC8A 2P9UG 5CBNA 1EYHA 5BW8C 4NURA 4LNUD 5ARFA 1YMPA 3QWVA 4P29A 2ILRA 3DXKG 4GTQA 2Y0BG 5FT9A 4FHJA 1P5QA 5FTPA 4DK5A 4BERA 3UKRG 5FQ6A 4BT8A 4WNFA 3GW4A 5JA4D 1BLXB 3L6AA 2P9NG 5E75A 4AOFA 1RW2A 1Z3YA 3L22A 2H6HA 4BX9A 1WY6A 3U3WA 2IO2C 2MYOA 1WDYA 5AYWD 3DSSA 4FP7A 2ETCA 4JD2G 4MBGA 4DUIA 1TNZA 5KJKA 3BUAA 4JEUA 3W9GA 4U95D 2DYRE 2P2CP 4OAVB 4MS6A 3MEKA 3D9OA 2EILE 1PY1A 3LVQE 3FUMA 2IONA 3DSUA 2L6JA 1SQMA 4CT0A 1Y8MA 1ELWA 1OWNA 3TXMA 4FC8A 3IKOB 4HI9A 5CRUA 3T9KA 4CYMD 3NOGD 1H2TC 3CIAA 2CFZA 3FUJA 3D3MA 1JUQA 3PNLB 3FUNA 3HHMA 1A5EA 1QNFA 3OAWA 3LDZA 3BEEA 4I6EA 1OCCE 4HORA 3CK7A 1H2VC 5BV1A 4DX5D 3L08A 3EHNA 1KZPA 1WAO1 1OWMA 5G55A 2WXQA 3UXGA 3S2AA 4Z68A 1EDUA 3I4RB 4EZLA 4JHJA 1E7UA 4UWHA 1HU3A 4UQYA 3DPYA 2PZIA 2CHXA 4YDOA 4G8KA 3FU0A 2OEVA 4CDNA 1S70B 1BU9A 4G8LA 4ANUA 3DWLG 4N3BA 4AV7A 2P9LG 3ZIMA 3ZN3A 4UQZA 3CVLA 3CV0A 3MJWA 5J08A 4LUNU 3FU6A 4WWNA 2L0TB 4FU3A 4GMLA 2FBNA 3PS6A 4AJWA 4V3IA 3AG2E 4IULA 3AG4E 2JLBA 2IQCA 3R9MA 2VSNA 2OV8A 4K5CA 3JXJA 4DX2A 2C2LA 2R2LA 2ZU6B 4U07A 5CERB 3C3RA 3SNXA 5LX8A 4TXRA 1KLXA 4I6JA 3QOUA 4UUCA 5HI7A 1VDYA 3FUEA 4I6GA 5FZRA 2AWIA 4FADA 1MX2A 3PZDA 4O6FA 3FTYA 1EF1C 4J8YA 3FUHA 3FH7A 3Q78A 1MJ0A 4J7WA 4HRLA 1KZOA 5D66A 1SVXA 2AVPA 4A63B 2VGXA 5B1BE 2XS8A 2QYUA 4GA1A 4OAUC 4YVOA 1D8DA
chains in the Genus database with same CATH topology
1BI7B 3B7BA 2NYJA 5BXOA 1TR4A 5FINA 4G8KA 3V31A 2XEHA 1WDYA 2JABA 3J5PA 1QYMA 3T8KA 4LSZE 1S70B 1BU9A 1N11A 1MYOA 2ETCA 5AQ7A 2Y1LE 3DEOA 4DUIA 2QYJA 3Q9UC 4G8LA 4CZ2D 1IHBA 2ETBA 1BI8B 4C48B 4DX1A 4U8VD 1DC2A 3TWWA 4HLLA 2V4HC 3W9GA 3V30A 1MX6A 3V2XA 1IXVA 3ZUVB 4NIKA 5EYLA 3DEPA 5AAOA 5ENTD 4U95D 2DVWA 2L6BA 2VGEA 2DWZA 2P2CP 4OAVB 2AJAA 5CBOA 3JXIA 3KEAA 2DZOA 3LJNA 4LG6A 5EN5D 3ZKJA 1K1AA 3TWVA 2F8XK 4F6RD 4ZHBA 5HKPA 3Q9NC 5KBAA 4DRXE 5EIDA 5AQBA 2FO1E 2BKKB 1D9SA 4QFVA 4QQIA 5ENRD 2BKGA 4DX6D 3JUEA 1AWCB 4B93B 4BEPA 1UOHA 5ENOD 5HRYA 3UTMA 3B95A 5CBNA 1IKND 2QC9A 4YDWA 5HS0A 4K5CA 5EILA 3JXJA 5ENPD 5ENSD 3EHRA 3ZNGA 4HRMB 3HG0D 3D9HA 2J8SD 3SO8A 4DX2A 1OY3D 5KNHD 5CECB 3AJIA 2RFAA 3C5RA 4ATZD 3EHQA 4LNUD 5KNGA 3TWQA 1G3NB 4GMRA 3NBNB 5ENQD 1YMPA 5ITZF 5CERB 4HI9A 2XENA 5AN8A 1N0RA 4RLYA 3T9KA 4CYMD 5FIOA 3NOGD 4HI8A 4O1PA 5EYPF 4BETA 4YDYA 1AP7A 3IXEA 1NFIE 1K3ZD 3ZU7B 1YCSB 4GPMA 4UUCA 2Y0BG 3TWUA 4U96D 5AARA 1BD8A 3UI2A 3V2OA 4HQDA 4BERA 4F1PA 4HNAD 4HB5A 1A5EA 1SW6A 2RFMA 1K1BA 4DX7D 2ETAA 1MX2A 4N5QA 4O1OA 3W9FA 2F8YA 3TWXA 4J8YA 1N0QA 4HRNA 2KBXA 5CEAA 4HBDA 2A5EA 1MJ0A 2V5QC 3F6QA 4J7WA 2DZNA 2ZGGA 3HRAA 4HRLA 2XZDG 1OT8A 1BLXB 2B0OE 5JMND 5JA4D 3NOCD 1DCQA 3TWTA 5BXUA 5D66A 4DX5D 4ZFHA 2ZGDA 2XZTG 2PNNA 3EU9A 5AQ9A 1SVXA 4A63B 4JB8P 3TWRA 3J5QB 1YYHA 3UXGA 3V79K 2HE0A 5CEDB 2XEEA 4Z68A 4TUMA 5AQAA 5EIBE 5KWDA 2F37A 4O60A 4K5AB 2KXPC 4OAUC 4U8YD 1MX4A 4K5BA 4BSZB 1WG0A 3AAAC 3TWSA 4BESA 2MYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI7 B;  3B7B A;  2NYJ A;  5BXO A;  1TR4 A;  5FIN A;  4G8K A;  3V31 A;  2XEH A;  1WDY A;  2JAB A;  3J5P A;  1QYM A;  3T8K A;  4LSZ E;  1S70 B;  1BU9 A;  1N11 A;  1MYO A;  2ETC A;  5AQ7 A;  2Y1L E;  3DEO A;  4DUI A;  2QYJ A;  3Q9U C;  4G8L A;  4CZ2 D;  1IHB A;  2ETB A;  1BI8 B;  4C48 B;  4DX1 A;  4U8V D;  1DC2 A;  3TWW A;  4HLL A;  2V4H C;  3W9G A;  3V30 A;  1MX6 A;  3V2X A;  1IXV A;  3ZUV B;  4NIK A;  5EYL A;  3DEP A;  5AAO A;  5ENT D;  4U95 D;  2DVW A;  2L6B A;  2VGE A;  2DWZ A;  2P2C P;  4OAV B;  2AJA A;  5CBO A;  3JXI A;  3KEA A;  2DZO A;  3LJN A;  4LG6 A;  5EN5 D;  3ZKJ A;  1K1A A;  3TWV A;  2F8X K;  4F6R D;  4ZHB A;  5HKP A;  3Q9N C;  5KBA A;  4DRX E;  5EID A;  5AQB A;  2FO1 E;  2BKK B;  1D9S A;  4QFV A;  4QQI A;  5ENR D;  2BKG A;  4DX6 D;  3JUE A;  1AWC B;  4B93 B;  4BEP A;  1UOH A;  5ENO D;  5HRY A;  3UTM A;  3B95 A;  5CBN A;  1IKN D;  2QC9 A;  4YDW A;  5HS0 A;  4K5C A;  5EIL A;  3JXJ A;  5ENP D;  5ENS D;  3EHR A;  3ZNG A;  4HRM B;  3HG0 D;  3D9H A;  2J8S D;  3SO8 A;  4DX2 A;  1OY3 D;  5KNH D;  5CEC B;  3AJI A;  2RFA A;  3C5R A;  4ATZ D;  3EHQ A;  4LNU D;  5KNG A;  3TWQ A;  1G3N B;  4GMR A;  3NBN B;  5ENQ D;  1YMP A;  5ITZ F;  5CER B;  4HI9 A;  2XEN A;  5AN8 A;  1N0R A;  4RLY A;  3T9K A;  4CYM D;  5FIO A;  3NOG D;  4HI8 A;  4O1P A;  5EYP F;  4BET A;  4YDY A;  1AP7 A;  3IXE A;  1NFI E;  1K3Z D;  3ZU7 B;  1YCS B;  4GPM A;  4UUC A;  2Y0B G;  3TWU A;  4U96 D;  5AAR A;  1BD8 A;  3UI2 A;  3V2O A;  4HQD A;  4BER A;  4F1P A;  4HNA D;  4HB5 A;  1A5E A;  1SW6 A;  2RFM A;  1K1B A;  4DX7 D;  2ETA A;  1MX2 A;  4N5Q A;  4O1O A;  3W9F A;  2F8Y A;  3TWX A;  4J8Y A;  1N0Q A;  4HRN A;  2KBX A;  5CEA A;  4HBD A;  2A5E A;  1MJ0 A;  2V5Q C;  3F6Q A;  4J7W A;  2DZN A;  2ZGG A;  3HRA A;  4HRL A;  2XZD G;  1OT8 A;  1BLX B;  2B0O E;  5JMN D;  5JA4 D;  3NOC D;  1DCQ A;  3TWT A;  5BXU A;  5D66 A;  4DX5 D;  4ZFH A;  2ZGD A;  2XZT G;  2PNN A;  3EU9 A;  5AQ9 A;  1SVX A;  4A63 B;  4JB8 P;  3TWR A;  3J5Q B;  1YYH A;  3UXG A;  3V79 K;  2HE0 A;  5CED B;  2XEE A;  4Z68 A;  4TUM A;  5AQA A;  5EIB E;  5KWD A;  2F37 A;  4O60 A;  4K5A B;  2KXP C;  4OAU C;  4U8Y D;  1MX4 A;  4K5B A;  4BSZ B;  1WG0 A;  3AAA C;  3TWS A;  4BES A;  2MYO A; 
#chains in the Genus database with same CATH topology
 1OWL A;  2J49 A;  2XEH A;  4JPS A;  3GZ1 A;  3KSL A;  3ZXP A;  4RG9 A;  3BG1 B;  2OOE A;  2LAH A;  2Y69 E;  1MX6 A;  2WM9 A;  4X8Q A;  2KC7 A;  2MHK A;  2VGE A;  4G1T A;  2GGF A;  3KEA A;  2F8X K;  4F6R D;  5JJ7 A;  5FQ4 A;  2XCC A;  4L7T A;  2GRL A;  2WXI A;  3PRZ A;  3ASN E;  3MZL B;  3ESK A;  1KPS B;  5BT1 A;  3HG0 D;  3CST A;  5A23 A;  2RFA A;  2M63 A;  2XGS A;  4GZD A;  4ANW A;  3FY4 A;  3IXE A;  3UIP C;  4N3A A;  4UWL A;  4U0Z A;  3TWU A;  3PEU B;  1QBQ A;  5AAR A;  1FT2 A;  3BG0 B;  4HB5 A;  1SW6 A;  1U3D A;  3FU5 A;  3EHM A;  4I1O B;  2OEW A;  3UM3 A;  4GTV A;  2C0L A;  2FO7 A;  1OT8 A;  1V55 E;  4AIF A;  1ZU2 A;  1WM5 A;  3RO2 A;  2FI7 A;  4GYO A;  3CVN A;  4ME2 A;  5KWD A;  2YHE A;  2XGM A;  3R9A B;  2R02 A;  4K5B A;  3UM2 A;  2I1J A;  5ANR A;  3U4T A;  5BXO A;  1V54 E;  1E8Z A;  2JAB A;  1HO8 A;  4GZ3 A;  4Q69 A;  3T8K A;  2HO1 A;  5G2N A;  2QYJ A;  1HE8 A;  2V5F A;  3NZU A;  3OXG A;  4GTT A;  5EYL A;  4FLB A;  1O5M A;  3ASO E;  4KXK B;  3LXU X;  4CGV A;  3EIQ C;  3JUI A;  2XRY A;  1LD7 A;  1Z6T A;  2WB2 A;  4DLQ A;  2CFU A;  4A3T A;  2F0Y A;  4CT4 A;  3MGB A;  3TG5 A;  3HXF A;  3S7D A;  1N52 A;  3CHR A;  3UUX A;  3D9L A;  3OXF A;  4JHK A;  3APC A;  1SZA A;  3C3O A;  5AN8 A;  4J0U A;  4RLY A;  2OVB A;  2VGX B;  2J9Q A;  2DIW A;  1NFI E;  3I4G A;  1OCO E;  1DVP A;  3V2O A;  1N4S A;  1PC2 A;  3CVW A;  3UT8 A;  2OND A;  2VSX E;  4AM9 A;  2GRN B;  3ASH A;  4CDR A;  1Y6I A;  3KAE A;  4J8E A;  2VJ8 A;  4F7A A;  1N4R A;  2WXL A;  5KJL A;  3C98 A;  4W9R A;  3SGH A;  3U9W A;  4TUU A;  4CGW A;  3T5V A;  3KD7 A;  5AJD A;  3CVU A;  4BSZ B;  1WG0 A;  2HYZ A;  4N39 A;  4H7X A;  4WAF A;  3E34 A;  4LSZ E;  3I3N A;  1UW4 B;  1N11 A;  2X6F A;  3EDT B;  4LCT A;  4DJA A;  5HQ8 A;  2P9P G;  4XX5 A;  3MCX A;  5D2M C;  2MOW A;  2GRM A;  4B0Z A;  4JA7 A;  5ENT D;  2L6B A;  1UN8 A;  1Z5S C;  5ENN A;  1TYQ G;  3RK6 A;  2HM8 A;  5EID A;  5EKQ D;  2BKK B;  2KCL A;  4QFV A;  1D9S A;  4DX6 D;  3JUE A;  4LNB A;  2IY0 C;  1TNU A;  4FLH A;  3ZNG A;  1A17 A;  4EZJ A;  3EHQ A;  1G3N B;  3RRN B;  4A1G A;  3FTS A;  2FUL A;  3IBE A;  4L9P A;  1AP7 A;  2B6C A;  4ILG A;  3CVP A;  2IFU A;  1X5B A;  2DYS E;  3C3Q A;  1TJC A;  1S64 A;  4GU5 A;  5AEN A;  1N9A A;  3HRA A;  3PUK A;  3ZXS A;  5J90 A;  2P9S G;  1E96 B;  4UWK A;  4D10 C;  2XCB A;  3FUF A;  2HR2 A;  1MQS A;  4ILH B;  2A5U A;  3B13 A;  2WXO A;  3U66 A;  4XE0 A;  3HXE A;  3ZVV A;  1TR4 A;  3MYV A;  4TRQ A;  3OXL A;  3SFZ A;  2J08 A;  2Y1L E;  3O4Z A;  3AU5 A;  3RJV A;  4BTB A;  3V2X A;  3DEP A;  1JWG A;  3PZ2 A;  3PUJ A;  4OYS A;  3VTY A;  1NP7 A;  3K9I A;  4GTS A;  3TWV A;  3DBS A;  3C72 A;  4CCA A;  5HKP A;  4G24 A;  1IQR A;  4KZ0 A;  2CHW A;  2ZIR A;  3AG1 E;  1U2V G;  4BEP A;  3UTM A;  2WQ6 A;  1RZ4 A;  5ENS D;  4LNG A;  4PDX A;  3PVL A;  2DCP A;  4WWO A;  4GMR A;  4XZ4 A;  2WXJ A;  2IO3 C;  3AS5 A;  3MA5 A;  4M3O A;  3CVX A;  2I1K A;  4RVB A;  2R59 A;  3ULQ A;  1K3Z D;  3ML8 A;  3ZYL A;  3DST A;  1JCS A;  3FH5 A;  1N4P A;  3E37 A;  2XEV A;  1EPU A;  4K03 A;  5EX0 A;  3HVE A;  1UJK A;  2CG2 A;  1D8E A;  1N0Q A;  3P2B A;  5CEA A;  3G2W A;  3Q79 A;  3ZW3 A;  2XZD G;  4FJY A;  3NOC D;  1XGW A;  3FFL A;  4C9B B;  3S7F A;  3ABK E;  4U0S A;  1NA0 A;  2WXF A;  1SZ9 A;  2PNN A;  3FEY A;  3FUL A;  4L2Y A;  5G04 C;  2HE0 A;  5CED B;  4KT6 B;  3I5P A;  4I9E A;  3FDH A;  3TJP A;  2V4L A;  3CKB A;  1LF8 A;  4DI3 A;  4EZK A;  3CGH A;  4FUL A;  4CEM A;  4JVS A;  2XHE A;  4JXT A;  4U8V D;  3B7U X;  3E4B A;  3IHY A;  2QFC A;  5LFA A;  4N2Q A;  4LG6 A;  3E33 A;  5JJT A;  2AXZ A;  4B94 A;  3NB2 A;  3TG4 A;  3AU4 A;  1HX8 A;  3LPZ A;  4N2S A;  3DRA A;  3RRM B;  2EQX A;  3EU5 A;  2VQ2 A;  5EIL A;  3CLJ A;  2Q7F A;  3UM0 A;  2EIJ E;  2J8S D;  5ANL A;  5KNH D;  3LEW A;  1JPL A;  4A55 A;  4ANX A;  2UY1 A;  5EYP F;  2H6F A;  4F3V A;  3LY7 A;  3D9M A;  4HOU A;  2RFM A;  1K1B A;  3LYA A;  3NZS A;  1OCR E;  4EEC A;  3ZFW A;  1E7V A;  3CHQ A;  2DZN A;  2J09 A;  3E30 A;  4M7C A;  5T8I A;  2XGO A;  3DPD A;  3FU3 A;  3Q75 A;  3ZHE A;  3O48 A;  2UWJ G;  3NF1 A;  3ZYK A;  4J6I A;  3LS8 A;  4CDM A;  4GPK A;  4JB8 P;  1KT0 A;  3Q7A A;  2RKK A;  5D0Q D;  3P1U A;  5FZS A;  4BES A;  1OWO A;  4DI4 A;  4I43 A;  1OXJ A;  3MKR A;  4ATG A;  2X3M A;  3D9P A;  4EBA G;  1OCZ E;  3Q9U C;  2OCC E;  1IHB A;  5G04 J;  2YQ8 A;  4C48 B;  4DX1 A;  2PQR A;  1TEZ A;  1TNB A;  4YVQ C;  4DLO A;  2DWZ A;  3ZRH A;  4UI9 J;  5CBO A;  2EIK E;  3LJN A;  1JCR A;  3HVE B;  1H6P A;  4ZHB A;  1SA5 A;  3PE4 A;  4DRX E;  1K8K G;  4UI9 K;  5ENR D;  1X81 A;  4XIF A;  4HFG A;  5ENO D;  2FEZ A;  4R7L A;  5ENP D;  4PS8 A;  2X6H A;  3NBN B;  2XQ0 A;  4HS2 A;  5FIO A;  4GYY A;  1OUV A;  1YCS B;  1FT1 A;  4U96 D;  1BD8 A;  3SQV A;  4ILI A;  4JA9 A;  3PNT B;  2R5S A;  4F1P A;  4L1B A;  1IHG A;  3JQ1 A;  4OVV A;  2I9C A;  5DBK A;  3QAQ A;  4I9C A;  3TWX A;  1HFA A;  2KBX A;  5A7D B;  2BED A;  5C1D A;  4K0R A;  4AY6 A;  3D9N A;  3EIJ A;  4J8S A;  3CQC B;  3L9T A;  3J5Q B;  4KZC A;  3TWR A;  2XEE A;  2WMO A;  2I6H A;  3UKU G;  4IYP A;  4UWG A;  1SA4 A;  3QDN A;  5LP0 A;  3TWS A;  4A1S A;  2X6I A;  2VTB A;  3CSF A;  3KS2 A;  2CG3 A;  2P9I G;  4B89 A;  1XNF A;  2WXG A;  4GCO A;  3VLE A;  1NI1 A;  2PQN A;  3CK8 A;  1O1R A;  3T5X A;  3PH0 C;  4I2W A;  3RO3 A;  1IYG A;  4I2Z A;  4XI9 A;  5AAO A;  4WNG A;  2UY1 B;  3G2S A;  4ACL A;  2AJA A;  2IF4 A;  4C0E A;  3TXN A;  4E6H A;  4LEU A;  3UIN C;  5E76 A;  2X6K A;  4BT9 A;  5FWQ A;  3CKC A;  1INZ A;  1AWC B;  4B93 B;  4U8H A;  3L54 A;  3OTN A;  2KCV A;  3ZHE B;  3C5R A;  2IJG X;  1E90 A;  3TWQ A;  5ENQ D;  2WQ7 A;  5CMW A;  5LOZ A;  1E8X A;  1E8Y A;  2XEN A;  1FVF A;  5EDS A;  2XS1 A;  4O1P A;  3JYS A;  4JL0 A;  1O1S A;  3S7J A;  3PZ1 A;  2E0I A;  5ARG A;  3EUV A;  3VTX A;  4DX7 D;  4O1O A;  3RU0 A;  4FA6 A;  2R17 C;  3R7Q A;  2A5E A;  4BTA A;  2ZGG A;  4G26 A;  4PH4 B;  3GZ2 A;  1ELK A;  1DCQ A;  1O1T A;  2XZT G;  4ABN A;  2GRP B;  4LER A;  3FH8 A;  2LO6 A;  5BUZ A;  1FCH A;  4C0M A;  4K5A B;  4RSY A;  4Y6W A;  4IRU A;  1Z3X A;  1N4Q A;  2LXM A;  3G2U A;  3ZYM A;  3RIB A;  2WPV A;  3J5P A;  1E8W A;  1B89 A;  4Q94 A;  2H6I A;  3DEO A;  4G23 A;  2YIN A;  4CRW A;  4YDE A;  2V4H C;  2LNI A;  2Y4T A;  3ISM C;  4WUY A;  2ZIS A;  3IV0 A;  3DSX A;  3JXI A;  3SBT B;  5CRV A;  4KVO A;  3Q73 A;  2C0M A;  3UM1 A;  4ACK A;  3QAR A;  3B7R L;  4GA0 A;  1L5J A;  3HIZ A;  4YDW A;  3ZPJ A;  3TL5 A;  2PM7 A;  3EHR A;  4XEI G;  3D9H A;  3PE3 A;  4I17 A;  4NAC A;  4GZ6 A;  2GW1 A;  4KVM A;  3FUK A;  4BET A;  4YDY A;  5FZQ A;  4NRH B;  2WXN A;  5A6C A;  4NQ0 A;  2VTB B;  3ZGQ A;  1MZC A;  4MRU A;  3ULY A;  5BV0 A;  4F53 A;  4RQI A;  1S0P A;  3SD5 A;  4B8A A;  2Y3A A;  3TGO A;  4GB9 A;  2KM4 A;  3ASD A;  5BXU A;  3ULE G;  4E85 A;  2QY7 A;  4APF A;  2WQH A;  3CHO A;  5AIJ A;  4PS7 A;  3FUI A;  3PRE A;  4O60 A;  2RG8 A;  1ZBP A;  5CCL A;  3G2T A;  2CHZ A;  3DSV A;  5G05 J;  1QQE A;  3CHM A;  4XI0 A;  1BI7 B;  3B7B A;  3L16 A;  3V31 A;  4HOT A;  1ELR A;  2XPI A;  3QK0 A;  4GCN A;  5AQ7 A;  4HXI A;  3UT7 A;  3D9K A;  2ETB A;  5AJL A;  4JW1 A;  3V30 A;  1H19 A;  3LY9 A;  2EIM E;  4GTP A;  2WXK A;  3HYM B;  2L0I A;  1LTX A;  3Q9N C;  2FO1 E;  5KJM A;  2DBA A;  3PZ3 A;  1UOH A;  4MKT A;  3DSW A;  2LAI A;  5HS0 A;  3S7B A;  3HXC A;  4BWR A;  3L82 A;  2RD0 A;  4U63 A;  3TAX A;  2P9K G;  3B7S A;  5H7P A;  5KJN A;  1N0R A;  4APO A;  4EPZ A;  5C2Y A;  3D9I A;  1NA3 A;  3CVY A;  3BU8 A;  4N5Q A;  4JZY A;  1TN7 A;  4HBD A;  5CHE E;  5JMN D;  2B0O E;  5DIZ A;  5BPP A;  4G25 A;  1HS6 A;  3T8M A;  2IOS A;  3Q5M A;  5BNW A;  3MKQ A;  1YYH A;  5LCW C;  2KAT A;  5AQA A;  3QNK A;  5IY5 E;  3CHS A;  3Q4A B;  2KXP C;  2VSY A;  4U8Y D;  3AAA C;  1KT1 A;  2NYJ A;  4EHM A;  5FIN A;  5B1A E;  1Q2Z A;  2WVI A;  3APF A;  4AY5 A;  4GTM A;  1UG3 A;  3SF4 A;  3L13 A;  1MHQ A;  3ONL A;  4UI9 C;  2DZO A;  3X2Q E;  5EN5 D;  2AW6 A;  1K1A A;  5JHA A;  1ZB1 A;  3RKV A;  3Q49 B;  4J8D A;  2VYI A;  3PDN A;  3GZS A;  1IKN D;  1FPP A;  4HRM B;  3FTV A;  2JEK A;  5CEC B;  3QKY A;  3ESL A;  3E32 A;  3CR3 A;  4U04 A;  4WNE A;  3SFX A;  4GTO A;  3R7R A;  3JQ0 A;  4GPM A;  3LVR E;  3UI2 A;  2ZXW E;  3PEV B;  2ETA A;  4TXQ A;  4HLE A;  5JJ6 A;  3W9F A;  5FQ7 A;  3PZ4 A;  2V5Q C;  3F6Q A;  1NL4 A;  1QZ2 A;  3D9J A;  3FEX A;  2ZGD A;  5D0O D;  1N54 A;  3QJZ A;  4JEH A;  4ANV A;  2WXR A;  5FJY A;  4U7E B;  4AEZ C;  2EIN E;  2VSO E;  2LSV A;  2QZA A;  3SHF A;  2L9B A;  2KZT A;  4H7Y A;  4WND A;  2AXU A;  2V8S E;  2PL2 A;  4KMO A;  4J8F A;  1U3C A;  5LCW J;  3ABL E;  1DC2 A;  2LUH A;  4FHK A;  1IXV A;  3RSE G;  4NIK A;  1DNP A;  3FTZ A;  3EJN A;  4N5C A;  3ZKJ A;  4RG6 A;  5KBA A;  3KSQ A;  2KCK A;  4TV3 A;  4I1A A;  4YND A;  5CMY A;  4AVX A;  4GMJ A;  1JWF A;  3AJI A;  3FTU A;  3ML9 A;  4XKC A;  5KNG A;  5ITZ F;  1YA0 A;  3MKQ B;  2H6G A;  1UJJ A;  2A4Z A;  4HI8 A;  2X6J A;  1H6O A;  2PM6 A;  4L23 A;  1HZ4 A;  3CEQ A;  2YNQ A;  3RAU A;  3CVQ A;  1HG5 A;  1H6K A;  3Q7F A;  3CHP A;  3U64 A;  3ENE A;  3L17 A;  3ZYQ A;  2WXP A;  1FVH A;  4GTR A;  4ZFH A;  4UQX A;  1PAQ A;  3VLD A;  4F1S A;  3SY2 A;  3ASF A;  3HXD A;  5FQ8 A;  4GA2 A;  3DXM G;  1JCQ A;  2IEJ A;  3FTW A;  4HOQ A;  1MX4 A;  2V0P A;  5JHB A;  1IQU A;  1N95 A;  2WXH A;  3RRU A;  1QYM A;  2R03 A;  4CZ2 D;  3MX3 A;  4HLL A;  4EQF A;  2P58 C;  2DVW A;  4G11 A;  3UT4 A;  4HOS A;  4LRZ A;  2GRO B;  3WXX A;  1UN9 A;  2XRZ A;  4UWF A;  2GRQ B;  3WG7 E;  3LJ3 A;  3UIO C;  2NSZ A;  4QQI A;  4EBA A;  3Q15 A;  1HXI A;  2QC9 A;  3UPV A;  1NZN A;  1DCE A;  4GYW A;  3SO8 A;  3G2V A;  4ATZ D;  5B3S E;  3MV3 B;  4MLP A;  2BTD A;  2J07 A;  4XKB A;  5T3R A;  3LKU A;  3ZU7 B;  1HH8 A;  1TN6 A;  3ABM E;  4BY6 A;  3IEG A;  2OVF A;  3SI5 A;  4KYO B;  2IOL A;  2LSU A;  2KZT B;  2F8Y A;  3FWV A;  2X38 A;  4Y6C A;  3VLF A;  5KCM A;  3TWT A;  3BQO A;  3N71 A;  3AS4 A;  2NC9 A;  4BSX A;  3FP3 A;  3QWP A;  2J4D A;  3EU9 A;  3QWW A;  2AXV A;  1GW6 A;  4PUC A;  3V79 K;  5EIB E;  2XPZ A;  1H0A A;  2LXL A;  2BUG A;  5G05 C;  2MRI A;  4HVB A;  4OVU A;  3ZEF A;  3SBS A;  1BI8 B;  2GRR B;  4GAA A;  4GZ5 A;  1TNO A;  3CQG B;  1HG2 A;  3Q47 B;  3CVV A;  3FHE A;  4B8C B;  4KBQ A;  1TNY A;  1OWP A;  5T4Y A;  2BKG A;  2J4B A;  4Q96 A;  2Y4U A;  4N3C A;  5HRY A;  3B95 A;  3NQP A;  1OY3 D;  2XPY A;  4AP2 A;  2IU1 A;  2WXM A;  5CCM A;  3AS8 A;  3JCK C;  3URZ A;  3NAW A;  3QB2 A;  3AG3 E;  4PS3 A;  3ASG A;  2NXP A;  4HQD A;  4HNA D;  5M72 A;  1H2U A;  4L2L A;  4BX8 A;  3HXB A;  3LY8 A;  4HRN A;  1BPO A;  4WWP A;  3HDX A;  2WMN A;  2YHC A;  4U0U A;  1N94 A;  1LD8 A;  1HF8 A;  3UX4 A;  5AQ9 A;  4A3V A;  4G2V A;  4AXH A;  3QC1 A;  4TUM A;  3ONK A;  2F37 A;  4FJZ A;  4TXP A;  2E2E A;  2I2O A;  4IN3 B;  2VGY A;  3CK9 A;  3B7T A;  3SFY A;  1MYO A;  4GZC A;  4I1M A;  2R05 A;  3FUD A;  3TWW A;  3MV2 B;  3ZUV B;  1W3B A;  3FTX A;  3IHV A;  1S63 A;  3SZ7 A;  3UMV A;  3UQ3 A;  4BFR A;  1TJF A;  2BF0 X;  3KEZ A;  4JHR A;  1TN8 A;  4DPR A;  2FF4 A;  3LCA A;  4URK A;  5AQB A;  3GYZ A;  5EX3 A;  3APD A;  4JC8 A;  2P9U G;  5CBN A;  1EYH A;  5BW8 C;  4NUR A;  4LNU D;  5ARF A;  1YMP A;  3QWV A;  4P29 A;  2ILR A;  3DXK G;  4GTQ A;  2Y0B G;  5FT9 A;  4FHJ A;  1P5Q A;  5FTP A;  4DK5 A;  4BER A;  3UKR G;  5FQ6 A;  4BT8 A;  4WNF A;  3GW4 A;  5JA4 D;  1BLX B;  3L6A A;  2P9N G;  5E75 A;  4AOF A;  1RW2 A;  1Z3Y A;  3L22 A;  2H6H A;  4BX9 A;  1WY6 A;  3U3W A;  2IO2 C;  2MYO A;  1WDY A;  5AYW D;  3DSS A;  4FP7 A;  2ETC A;  4JD2 G;  4MBG A;  4DUI A;  1TNZ A;  5KJK A;  3BUA A;  4JEU A;  3W9G A;  4U95 D;  2DYR E;  2P2C P;  4OAV B;  4MS6 A;  3MEK A;  3D9O A;  2EIL E;  1PY1 A;  3LVQ E;  3FUM A;  2ION A;  3DSU A;  2L6J A;  1SQM A;  4CT0 A;  1Y8M A;  1ELW A;  1OWN A;  3TXM A;  4FC8 A;  3IKO B;  4HI9 A;  5CRU A;  3T9K A;  4CYM D;  3NOG D;  1H2T C;  3CIA A;  2CFZ A;  3FUJ A;  3D3M A;  1JUQ A;  3PNL B;  3FUN A;  3HHM A;  1A5E A;  1QNF A;  3OAW A;  3LDZ A;  3BEE A;  4I6E A;  1OCC E;  4HOR A;  3CK7 A;  1H2V C;  5BV1 A;  4DX5 D;  3L08 A;  3EHN A;  1KZP A;  1WAO 1;  1OWM A;  5G55 A;  2WXQ A;  3UXG A;  3S2A A;  4Z68 A;  1EDU A;  3I4R B;  4EZL A;  4JHJ A;  1E7U A;  4UWH A;  1HU3 A;  4UQY A;  3DPY A;  2PZI A;  2CHX A;  4YDO A;  4G8K A;  3FU0 A;  2OEV A;  4CDN A;  1S70 B;  1BU9 A;  4G8L A;  4ANU A;  3DWL G;  4N3B A;  4AV7 A;  2P9L G;  3ZIM A;  3ZN3 A;  4UQZ A;  3CVL A;  3CV0 A;  3MJW A;  5J08 A;  4LUN U;  3FU6 A;  4WWN A;  2L0T B;  4FU3 A;  4GML A;  2FBN A;  3PS6 A;  4AJW A;  4V3I A;  3AG2 E;  4IUL A;  3AG4 E;  2JLB A;  2IQC A;  3R9M A;  2VSN A;  2OV8 A;  4K5C A;  3JXJ A;  4DX2 A;  2C2L A;  2R2L A;  2ZU6 B;  4U07 A;  5CER B;  3C3R A;  3SNX A;  5LX8 A;  4TXR A;  1KLX A;  4I6J A;  3QOU A;  4UUC A;  5HI7 A;  1VDY A;  3FUE A;  4I6G A;  5FZR A;  2AWI A;  4FAD A;  1MX2 A;  3PZD A;  4O6F A;  3FTY A;  1EF1 C;  4J8Y A;  3FUH A;  3FH7 A;  3Q78 A;  1MJ0 A;  4J7W A;  4HRL A;  1KZO A;  5D66 A;  1SVX A;  2AVP A;  4A63 B;  2VGX A;  5B1B E;  2XS8 A;  2QYU A;  4GA1 A;  4OAU C;  4YVO A;  1D8D A; 
#chains in the Genus database with same CATH homology
 1BI7 B;  3B7B A;  2NYJ A;  5BXO A;  1TR4 A;  5FIN A;  4G8K A;  3V31 A;  2XEH A;  1WDY A;  2JAB A;  3J5P A;  1QYM A;  3T8K A;  4LSZ E;  1S70 B;  1BU9 A;  1N11 A;  1MYO A;  2ETC A;  5AQ7 A;  2Y1L E;  3DEO A;  4DUI A;  2QYJ A;  3Q9U C;  4G8L A;  4CZ2 D;  1IHB A;  2ETB A;  1BI8 B;  4C48 B;  4DX1 A;  4U8V D;  1DC2 A;  3TWW A;  4HLL A;  2V4H C;  3W9G A;  3V30 A;  1MX6 A;  3V2X A;  1IXV A;  3ZUV B;  4NIK A;  5EYL A;  3DEP A;  5AAO A;  5ENT D;  4U95 D;  2DVW A;  2L6B A;  2VGE A;  2DWZ A;  2P2C P;  4OAV B;  2AJA A;  5CBO A;  3JXI A;  3KEA A;  2DZO A;  3LJN A;  4LG6 A;  5EN5 D;  3ZKJ A;  1K1A A;  3TWV A;  2F8X K;  4F6R D;  4ZHB A;  5HKP A;  3Q9N C;  5KBA A;  4DRX E;  5EID A;  5AQB A;  2FO1 E;  2BKK B;  1D9S A;  4QFV A;  4QQI A;  5ENR D;  2BKG A;  4DX6 D;  3JUE A;  1AWC B;  4B93 B;  4BEP A;  1UOH A;  5ENO D;  5HRY A;  3UTM A;  3B95 A;  5CBN A;  1IKN D;  2QC9 A;  4YDW A;  5HS0 A;  4K5C A;  5EIL A;  3JXJ A;  5ENP D;  5ENS D;  3EHR A;  3ZNG A;  4HRM B;  3HG0 D;  3D9H A;  2J8S D;  3SO8 A;  4DX2 A;  1OY3 D;  5KNH D;  5CEC B;  3AJI A;  2RFA A;  3C5R A;  4ATZ D;  3EHQ A;  4LNU D;  5KNG A;  3TWQ A;  1G3N B;  4GMR A;  3NBN B;  5ENQ D;  1YMP A;  5ITZ F;  5CER B;  4HI9 A;  2XEN A;  5AN8 A;  1N0R A;  4RLY A;  3T9K A;  4CYM D;  5FIO A;  3NOG D;  4HI8 A;  4O1P A;  5EYP F;  4BET A;  4YDY A;  1AP7 A;  3IXE A;  1NFI E;  1K3Z D;  3ZU7 B;  1YCS B;  4GPM A;  4UUC A;  2Y0B G;  3TWU A;  4U96 D;  5AAR A;  1BD8 A;  3UI2 A;  3V2O A;  4HQD A;  4BER A;  4F1P A;  4HNA D;  4HB5 A;  1A5E A;  1SW6 A;  2RFM A;  1K1B A;  4DX7 D;  2ETA A;  1MX2 A;  4N5Q A;  4O1O A;  3W9F A;  2F8Y A;  3TWX A;  4J8Y A;  1N0Q A;  4HRN A;  2KBX A;  5CEA A;  4HBD A;  2A5E A;  1MJ0 A;  2V5Q C;  3F6Q A;  4J7W A;  2DZN A;  2ZGG A;  3HRA A;  4HRL A;  2XZD G;  1OT8 A;  1BLX B;  2B0O E;  5JMN D;  5JA4 D;  3NOC D;  1DCQ A;  3TWT A;  5BXU A;  5D66 A;  4DX5 D;  4ZFH A;  2ZGD A;  2XZT G;  2PNN A;  3EU9 A;  5AQ9 A;  1SVX A;  4A63 B;  4JB8 P;  3TWR A;  3J5Q B;  1YYH A;  3UXG A;  3V79 K;  2HE0 A;  5CED B;  2XEE A;  4Z68 A;  4TUM A;  5AQA A;  5EIB E;  5KWD A;  2F37 A;  4O60 A;  4K5A B;  2KXP C;  4OAU C;  4U8Y D;  1MX4 A;  4K5B A;  4BSZ B;  1WG0 A;  3AAA C;  3TWS A;  4BES A;  2MYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...