2KC7A

Solution nmr structure of bacteroides fragilis protein bf1650. northeast structural genomics consortium target bfr218
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
MDQLKTIKELINQGDIENALQALEEFLQTEPVGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDILNFYNKDMYNQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of Bacteroides fragilis protein BF1650. Northeast Structural Genomics Consortium target BfR218
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords bfr218_protein
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kc7A00
3FP3A 5JJ6A 3MKRA 3PE4A 5G05C 4WUYA 4H7XA 1HXIA 2VSYA 4IN3B 2WPVA 3FWVA 4G2VA 4WNDA 5FJYA 4I1AA 3JYSA 4YNDA 3BEEA 1HZ4A 1QQEA 2J9QA 3QDNA 5D0QD 3RIBA 4AIFA 3MA5A 3Q5MA 4J8EA 3TG5A 1PC2A 4HOTA 3TG4A 3Q49B 4J8DA 4N3BA 5A7DB 3KAEA 3ULQA 3AS8A 2XGSA 5M72A 5EX0A 2UY1B 4KBQA 5ARGA 3UUXA 3VTXA 3RO3A 1TJCA 5DBKA 2PQRA 2HR2A 3GW4A 3LCAA 3URZA 4HOQA 4GA1A 2UWJG 4JA7A 4B94A 4ME2A 4GA2A 1ZU2A 1E96B 2XPIA 4F3VA 2YQ8A 5KJMA 4JA9A 3SF4A 5KJKA 3SZ7A 1OUVA 3CKCA 4I9EA 4LEUA 3CK7A 2IF4A 5LCWJ 4UI9C 2FI7A 2GW1A 3OXGA 4HOUA 1QZ2A 3ESKA 1IYGA 1A17A 4NRHB 4BT8A 4KYOB 3ASFA 3AS5A 1NA0A 2FBNA 4GYWA 1HH8A 4UI9K 3RU0A 5G05J 5A6CA 4YVOA 2C0MA 4UQZA 2VGYA 1NA3A 2YHCA 3CK9A 2C2LA 2FEZA 4GCOA 4GCNA 3CEQA 4WNGA 5EX3A 4YVQC 2XEVA 3CVLA 4AY6A 4N2SA 5EKQD 1IHGA 3MEKA 4JL0A 2JLBA 4J0UA 2WQHA 3R9AB 2VYIA 3CVPA 3QWVA 4I2ZA 4U04A 3RO2A 5KJNA 2QFCA 5LCWC 4N3CA 3ZPJA 4N3AA 1ELWA 2IFUA 4GYOA 4UQYA 4G23A 3TAXA 2VSNA 3CVNA 4GZ3A 3MV2B 3MV3B 3UPVA 3LYAA 2C0LA 2HYZA 3QOUA 5HI7A 1W3BA 1KLXA 2Y4UA 4U0UA 5HQ8A 1ZBPA 5BW8C 3K9IA 1ELRA 2R5SA 3Q4AB 3HYMB 2XCBA 2Q7FA 3S7FA 3VTYA 3ZHEB 4AY5A 4BTBA 4CGVA 3ZGQA 3U3WA 2E2EA 2KATA 2NC9A 3Q15A 4KXKB 3CVQA 3IEGA 2Y4TA 5D0OD 3RJVA 4A1SA 2AVPA 4GYYA 4RG9A 4UQXA 1KT0A 5G04J 3S7DA 3E4BA 5JJTA 3AS4A 5FZSA 3ASHA 1P5QA 4N39A 2I6HA 4HORA 3PE3A 4GA0A 3RKVA 4Y6CA 2VGXB 2PQNA 2P58C 3PDNA 4HOSA 4G25A 4I2WA 4RG6A 4WNEA 5ARFA 5C1DA 3TGOA 3OXLA 5AYWD 1WAO1 1XNFA 3QKYA 4H7YA 2V5FA 2L6JA 3CV0A 1WM5A 4XIFA 2KCLA 2VGXA 5FZQA 5FZRA 5KJLA 4I9CA 3LKUA 4WNFA 4N5CA 5FT9A 3KD7A 3GZ1A 4G24A 2PL2A 4JHRA 3ZHEA 4ABNA 4AM9A 3ASDA 4BWRA 2LSUA 4UI9J 4G26A 3S7JA 3QWPA 5BNWA 3LPZA 3ASGA 3CK8A 2KCVA 3UQ3A 5CCMA 2KCKA 4U0SA 5JJ7A 1B89A 3FFLA 4U0ZA 2ONDA 3O48A 3GYZA 5DIZA 3S7BA 4N2QA 2HO1A 3ZFWA 3WXXA 4G1TA 1YA0A 3LY7A 4O6FA 4XI0A 3GZ2A 2XCCA 1NZNA 2OOEA 5CCLA 3NF1A 4W9RA 2XGOA 4APOA 2UY1A 4EQFA 3ZN3A 4GZ6A 4Y6WA 5G04C 3OXFA 3Q47B 5CHEE 2PZIA 2LSVA 4XI9A 2VQ2A 4CDRA 3LY9A 4BTAA 4GPKA 3CKBA 4GZ5A 4CGWA 2DBAA 2FO7A 4BT9A 3EDTB 1Y8MA 4I17A 4U07A 2LNIA 3QWWA 5BT1A 3KS2A 3U4TA 1KT1A 4J8FA 2XGMA 2MHKA 2KC7A 3LY8A 3N71A 2FF4A 4NQ0A 5FTPA 2BUGA 1FCHA
chains in the Genus database with same CATH superfamily
2H6HA 1WDYA 4I1AA 1HZ4A 3RIBA 1PC2A 3L22A 4B89A 3UM0A 3BU8A 2XQ0A 1MQSA 3RO3A 1JPLA 4IULA 4JA7A 1N52A 3J5QB 2XPIA 5EILA 3B13A 4DX1A 1DCEA 3U64A 2RG8A 4OVVA 4BT8A 2AWIA 4YDYA 2CHXA 3AS5A 3JXJA 1HU3A 2C0MA 3CGHA 2EILE 3NOGD 4GCNA 4TUMA 1S70B 5LCWC 4X8QA 1SZAA 4AXHA 3CQGB 4N3AA 2EINE 4UQYA 2HYZA 4C0MA 4XKBA 2PM7A 3EHMA 5C2YA 4M7CA 2AVPA 1N95A 4BY6A 4HRNA 4N39A 3RKVA 2E0IA 1TNBA 3V2OA 1RW2A 3GZ1A 3PEUB 2IJGX 4DX7D 3LVQE 1PAQA 4XI0A 4E85A 3FH5A 1U2VG 4GTRA 4AOFA 2LO6A 1N4RA 5AJLA 4JW1A 3CKBA 2DBAA 2KXPC 3EHNA 3PREA 4JPSA 1FCHA 2V4HC 4H7XA 4G11A 3FWVA 3QDNA 2YINA 4JB8P 5M72A 3KAEA 4HXIA 4PS7A 4Q94A 5IY5E 3DWLG 4FP7A 5KJMA 3ISMC 3CKCA 2OEVA 4DI3A 4UWLA 2A5UA 4GYWA 2BTDA 2YHCA 4XKCA 4AJWA 3DPDA 1QBQA 4U96D 3I4GA 3L13A 1HO8A 3CHRA 1W3BA 2MOWA 1N94A 4BTBA 1OCRE 4GMLA 4JEUA 1BD8A 3CHSA 3D9IA 4PS3A 3UIOC 1HF8A 5AENA 5BV0A 2WXIA 4HOSA 4EECA 3ZYQA 2ETBA 4A55A 5KJLA 1E8ZA 2A5EA 1G3NB 5ITZF 3X2QE 2NYJA 2ILRA 4FLBA 3CSFA 4G8LA 1MX4A 2LXLA 2GRMA 4EHMA 4RLYA 1S64A 3CVUA 5CHEE 3DXMG 1OWLA 4U8HA 2J4DA 3LY9A 4R7LA 4CGWA 3U9WA 2AXVA 4UWFA 3W9FA 3UKRG 4WWNA 4N5QA 4HVBA 3EHQA 3FP3A 1Y6IA 5G05C 2EIME 4EBAG 3V2XA 3HXBA 3MX3A 1YYHA 1O1SA 4YDEA 4J8DA 1IQUA 3SI5A 1TJCA 2UWJG 4B94A 3PEVB 4F3VA 1OWNA 1HG2A 3CLJA 2IF4A 5HKPA 2B0OE 3OXGA 1UN9A 3FU5A 3DXKG 1TNOA 3CK9A 2B6CA 2VTBA 3I4RB 2XEEA 1OY3D 2GRQB 4FJYA 4N3CA 5LP0A 3TWSA 5AQAA 3ZYMA 3UPVA 4K5BA 2QZAA 2J49A 5HI7A 4WWPA 3VLDA 3BG1B 1ELRA 5ENNA 3FU0A 3Q4AB 5EIBE 3U3WA 2DVWA 1YCSB 2NC9A 3RJVA 2VGEA 4ANXA 1OCCE 4A3TA 1A5EA 4JZYA 2CG3A 4TUUA 4G25A 2P9PG 2PNNA 3CV0A 3SY2A 1WM5A 2GRPB 3G2UA 4HB5A 1H19A 3LPZA 2GROB 4O1OA 3ASGA 3CK8A 2KCKA 3CVWA 3GYZA 5AJDA 3ONLA 3GZ2A 3NAWA 5KBAA 4CRWA 3FTWA 3NF1A 4GPMA 4HLEA 2BKGA 5G04C 2WXRA 3QARA 1SW6A 4GZ5A 3QNKA 3T5XA 3PH0C 3SBTB 3MKRA 2RD0A 4KZ0A 2L0IA 4A3VA 3ZU7B 4CDNA 5BV1A 1SA5A 2NXPA 1TN7A 2J9QA 4I1MA 4EBAA 3HXCA 5KNHD 1QYMA 1TN8A 2WXNA 3UT7A 4GTTA 2YQ8A 3R7QA 2WQ6A 3TWTA 3JUIA 3V31A 4NRHB 1NA3A 2XPYA 4ANWA 4RVBA 3PZDA 4F1SA 4JL0A 5E76A 2WQHA 4J7WA 3BG0B 2QFCA 3SHFA 4AVXA 2DYSE 3LYAA 3KEAA 3K9IA 2BEDA 4ILIA 2LUHA 3VTYA 2MYOA 1D8EA 3CVQA 5G04J 3FULA 2ETAA 1K1BA 3OAWA 5FZSA 3JXIA 3KSQA 4Y6CA 4ANUA 4UWKA 3OXLA 3FHEA 3QKYA 2V0PA 2KCLA 1VDYA 3I5PA 2ONDA 5H7PA 5FQ7A 3MYVA 2QYJA 3VLFA 4WWOA 2H6GA 2PZIA 2Y3AA 2ZIRA 3E33A 4IRUA 2GRLA 3KS2A 3U4TA 3LJ3A 3N71A 2R05A 3UINC 5FJYA 2DZNA 1IHBA 1QQEA 1PY1A 3SFYA 4J8EA 3TG4A 1O1TA 3FUNA 3UM2A 1N54A 4HOQA 1ZU2A 3PVLA 2R17C 2DIWA 4GU5A 4UI9C 2IOLA 1E90A 2WXPA 3ZEFA 3GZSA 3TWRA 1DVPA 2I2OA 1MX2A 2C2LA 4WNGA 3D9LA 3CVLA 4Q96A 4LSZE 3CVPA 3ZYLA 2WXHA 2P9NG 4HBDA 3TAXA 2EIKE 3FTXA 4HFGA 2PM6A 2IO2C 1JCQA 2Y0BG 4APFA 4B93B 3D3MA 2Y4TA 1KT0A 3Q9UC 3L17A 1QNFA 2AW6A 2RFMA 4GA0A 2LAHA 1EYHA 1WAO1 4BERA 4N5CA 2CHWA 3DEOA 4AM9A 4G26A 1EF1C 3SD5A 2OEWA 3UQ3A 5JHBA 3AG2E 2WQ7A 3HHMA 4GZ6A 4EPZA 2F0YA 4F53A 3KEZA 3EDTB 3UX4A 1E8WA 3APDA 2LNIA 2WXJA 2MHKA 4YNDA 4XZ4A 2XGSA 3SO8A 5CMWA 3G2WA 2L6BA 3FEXA 4A1GA 3MA5A 2WXFA 3FTVA 3P1UA 4HOTA 4GTVA 2XPZA 3MKQA 1N4QA 3E30A 3ENEA 3JQ0A 4L2YA 4BSXA 3B7UX 1WY6A 1EPUA 4UQZA 3FUKA 2FEZA 3DPYA 3Q7AA 2F8YA 3OTNA 4DUIA 1IQRA 4GZ3A 3MV3B 3D9NA 3S7FA 4PS8A 2J08A 1Z6TA 4U7EB 1N0RA 4HQDA 2J4BA 1TNZA 3TWWA 3RRMB 1N9AA 3ONKA 2V5QC 3MJWA 5FT9A 4ABNA 3I3NA 5ANRA 3ASDA 4JC8A 2IQCA 3QC1A 5CCMA 3HXDA 2WB2A 3S7BA 3SFZA 4EZLA 3ZFWA 5BXOA 4HI8A 2YHEA 3AG4E 4LG6A 4OAVB 3EU9A 1OWOA 3DRAA 3ASNE 2IU1A 4U95D 3PS6A 3LY8A 1INZA 1H0AA 3TXNA 1HXIA 4IN3B 5EN5D 4KVOA 4JEHA 3UI2A 5FWQA 5AQ7A 1OCOE 3LCAA 2ZU6B 3O4ZA 4JA9A 3SZ7A 2A4ZA 1NA0A 3RU0A 4QQIA 5CBNA 3C5RA 2F8XK 2P9LG 1N0QA 1IHGA 3DSTA 4I2ZA 4LNGA 3D9OA 3CVXA 1V55E 4I6EA 2RKKA 3AAAC 3TWVA 2ZXWE 2J09A 3ZHEB 3NQPA 2AJAA 2KATA 3C72A 4GYYA 3ULEG 5ENTD 3AS4A 4ANVA 3UIPC 2R02A 2PQNA 1TR4A 1S63A 4GTQA 4RQIA 4XIFA 2L6JA 5FZQA 4YDWA 4U8VD 5HRYA 5J90A 3S7JA 4FU3A 4LRZA 1GW6A 2NSZA 2QC9A 3F6QA 3D9PA 5BPPA 4BT9A 5FQ6A 2KC7A 3TGOA 4RG6A 5DBKA 4I9CA 3RK6A 3UKUG 1DCQA 3AS8A 2I1JA 2HR2A 3GW4A 1E7VA 2WXGA 5CRUA 1SZ9A 5D66A 4B8CB 3D9JA 4K03A 5LCWJ 2GW1A 4PUCA 4CCAA 3LXUX 3G2SA 3ABME 2DZOA 3PZ4A 3CEQA 4HI9A 5EKQD 3KSLA 4U63A 4B8AA 4MS6A 3TXMA 4P29A 4DRXE 3Q9NC 3HYMB 4RSYA 3Q15A 3S7DA 4KZCA 4URKA 4FJZA 1OXJA 2X6IA 4F1PA 2I6HA 3PE3A 5BUZA 3APCA 3QJZA 2HE0A 3L08A 3V30A 3CHOA 1TJFA 4JHRA 3U66A 4MKTA 4KVMA 5CBOA 4FHKA 4XE0A 3D9HA 4YDOA 4W9RA 3SQVA 1N4SA 3LVRE 1NI1A 2XS8A 2LSVA 4ACLA 1HG5A 1OWPA 5JA4D 4BFRA 2H6IA 1LD7A 4ZFHA 4DX5D 2DWZA 5B1BE 1OCZE 1XGWA 3DSVA 3PUJA 1UJKA 3Q5MA 3EJNA 3FTUA 2V4LA 5CERB 3AG1E 2ZGGA 3SGHA 2WXOA 2R59A 3E37A 5CMYA 3ZUVB 1AP7A 1Q2ZA 3DBSA 4BEPA 4LNUD 3ESKA 3C98A 3T8KA 4Z68A 4GCOA 3MEKA 2FULA 1SA4A 4TXQA 1JUQA 1N11A 2IFUA 3AU4A 4G23A 4BESA 1N4PA 4BX9A 1MX6A 2J8SD 2L0TB 1K8KG 2XENA 5JJTA 1SQMA 3R9MA 1H2TC 1FVFA 4I1OB 2RFAA 2WMOA 1KPSB 5ARFA 1SVXA 3P2BA 3LKUA 4ILGA 3EIQC 4HRLA 2P9KG 5FQ8A 2P9IG 1B89A 1YA0A 2JABA 1HE8A 2XCCA 5CCLA 3FH8A 2UY1A 3ZN3A 2I1KA 3FUFA 5LOZA 4GPKA 4L1BA 3W9GA 3UT4A 2H6FA 4IYPA 2BUGA 4GMRA 2CFZA 3IBEA 3QB2A 3S2AA 3JYSA 4M3OA 4AIFA 4FLHA 4WAFA 2XRYA 3VLEA 5B3SE 4N3BA 3EU5A 1FVHA 3ASOE 4CYMD 3SF4A 3TL5A 4K0RA 4CT0A 2R03A 4HOUA 3SBSA 4UI9K 1HH8A 1BPOA 5ENQD 3E32A 4N2SA 1UG3A 3PZ3A 2CG2A 2VSNA 3CVNA 1E8YA 3MV2B 3IKOB 5HQ8A 3QOUA 1MZCA 3LDZA 4PDXA 1JCRA 3JCKC 4HNAD 4L2LA 3IEGA 1TYQG 5KNGA 3BQOA 4E6HA 2VGXB 3PNLB 4I2WA 2V5FA 3LJNA 3CVYA 4G24A 4JVSA 1AWCB 3TWUA 1NL4A 3ZKJA 1K3ZD 2CHZA 3WXXA 4OAUC 4O6FA 1IXVA 4GTMA 2R2LA 3G2VA 3OXFA 4AP2A 4CDRA 2CFUA 5BXUA 1IKND 1Y8MA 2LAIA 3FUDA 4L7TA 5G55A 3PE4A 1TEZA 3ABKE 3DSXA 3APFA 1BI8B 2VSYA 2WPVA 1MJ0A 3BEEA 5D0QD 5AAOA 5T3RA 5A7DB 4K5CA 2X38A 4TXRA 4GA1A 3SFXA 3RRUA 4JD2G 2GRNB 5KJKA 1HFAA 4KMOA 2JEKA 1A17A 4NIKA 3ASFA 1BU9A 2AXZA 2IONA 3L82A 4GAAA 1ZB1A 4GMJA 4L23A 4ATZD 1EDUA 2X3MA 1ELWA 1DC2A 1UJJA 3FUEA 4K5AB 5BW8C 5AQ9A 4FC8A 3ABLE 4AY5A 2EQXA 5D0OD 3Q73A 3E4BA 1O1RA 3FU6A 4XEIG 4CZ2D 2OV8A 4WNEA 5EDSA 4FADA 3LEWA 2DYRE 1BI7B 3B7RL 3CSTA 5E75A 3IHVA 5BNWA 3QWPA 3AU5A 2WXLA 4J6IA 1TNYA 4J8YA 5DIZA 5T8IA 4C48B 2Y1LE 3MZLB 5KCMA 4QFVA 2EIJE 2KBXA 5ENRD 1E8XA 4TV3A 3ZRHA 4XI9A 3B7TA 2FO7A 3LS8A 4I6JA 1X5BA 1KT1A 4V3IA 4NQ0A 5FTPA 2FF4A 3C3QA 4J8SA 1JCSA 3VTXA 2X6KA 3ML9A 3TG5A 3J5PA 2UY1B 5ARGA 3UUXA 3AG3E 4EZKA 3IV0A 3UM1A 4C9BB 3FUMA 1JWGA 3T5VA 4ATGA 3QK0A 4KYOB 1LD8A 3QAQA 4JHJA 3ZXSA 3Q7FA 2WXMA 3FTZA 3R9AB 3QWVA 3E34A 3C3OA 5AQBA 3NZUA 3PZ2A 1X81A 1MHQA 1FPPA 5CRVA 3IXEA 3CHMA 1HX8A 3D9MA 2WMNA 3ESLA 4A1SA 4LNBA 3HRAA 4CDMA 4B0ZA 4HORA 2VJ8A 5AIJA 4LERA 3L9TA 5AYWD 4KT6B 5FZRA 1OWMA 3UTMA 3FUIA 1HS6A 4EZJA 3D9KA 4DLQA 1NZNA 2OOEA 4A63B 4U8YD 4EQFA 4MRUA 1D9SA 2GRRB 1KZOA 5B1AE 5FQ4A 4BX8A 3ZIMA 3HVEB 2LXMA 3QWWA 3UXGA 2XGMA 1L5JA 3EUVA 4UWHA 4BETA 4WNDA 4CT4A 3FUHA 2M63A 3UT8A 2V8SE 3Q49B 4D10C 4JHKA 4KBQA 3Q79A 3DSSA 3PZ1A 4I9EA 3CK7A 1H6OA 2VSOE 3B95A 5A23A 2ZGDA 2BF0X 2P9UG 5EX3A 4YVQC 2XEVA 4J0UA 1Z5SC 3CHPA 4OVUA 3EHRA 3Q75A 2C0LA 1ELKA 3RAUA 2L9BA 1NFIE 5J08A 4KXKB 3ZW3A 4ILHB 1O5MA 5EIDA 3ASHA 4C0EA 1MYOA 3PDNA 2P58C 4O60A 3NOCD 3L54A 2OCCE 2I9CA 2OVFA 2OVBA 2ZISA 5CEAA 3ZHEA 3Q78A 4L9PA 1FT2A 5EYPF 2HO1A 4G1TA 1H6PA 1KZPA 3ZNGA 2YNQA 4APOA 5JMND 2P2CP 2DCPA 4DX6D 2P9SG 5EYLA 5AN8A 5G2NA 4U07A 5BT1A 2WM9A 4DK5A 5JJ6A 2KM4A 4WUYA 4ACKA 4I43A 4G2VA 2FO1E 1TN6A 4LCTA 4DPRA 5EX0A 4HLLA 5ANLA 3G2TA 3DSWA 4GB9A 1E96B 4GTPA 3NZSA 5CEDB 3PUKA 1FT1A 1V54E 4LEUA 4TRQA 4FULA 1U3DA 2XZTG 4BSZB 1RZ4A 5LFAA 5CECB 3L16A 4GZDA 2JLBA 2VYIA 3HVEA 3L6AA 2MRIA 3B7SA 3FH7A 4GYOA 3T9KA 1TNUA 4FHJA 4F7AA 4HRMB 5ENPD 4ZHBA 3FU3A 1ZBPA 3DSUA 2R5SA 2XCBA 3FTYA 2Y69E 4O1PA 3ZGQA 3JUEA 2HM8A 3B7BA 4MLPA 4DJAA 3MGBA 1P5QA 5D2MC 5C1DA 1S0PA 4H7YA 3UMVA 2XHEA 3JQ1A 4BWRA 2LSUA 2WXKA 3HDXA 5ENSD 4U0ZA 3TJPA 3HIZA 3UM3A 4DX2A 3FUJA 3Q47B 4F6RD 1YMPA 1K1AA 3ULQA 4HS2A 5JHAA 4GA2A 2X6JA 4UWGA 5FINA 4GZCA 2VSXE 3CHQA 1UN8A 3BUAA 5A6CA 3IHYA 2VGYA 3ZXPA 3PNTB 1DNPA 3CR3A 4AY6A 4MBGA 5KWDA 5LX8A 5ENOD 4CEMA 2XZDG 3FEYA 2XEHA 3FTSA 3ML8A 4G8KA 2Q7FA 4N2QA 4UQXA 4PH4B 3ZVVA 2IO3C 2X6FA 1WG0A 3EIJA 2QYUA 2IEJA 1UW4B 3KD7A 1E7UA 3TWXA 2KCVA 4U0SA 3FFLA 1OT8A 2XS1A 5T4YA 2ETCA 4TXPA 3FDHA 3C3RA 2WXQA 5FIOA 2J07A 2XGOA 3MKQB 4Y6WA 4BTAA 3ULYA 3CQCB 2VTBB 4J8FA 3ZPJA 4NACA 4FA6A 1JWFA 1Z3YA 1H6KA 4LUNU 3WG7E 3HG0D 3AJIA 4GTSA 3CIAA 1H2VC 2KZTB 2PQRA 3HXEA 3URZA 1BLXB 3ZYKA 4ME2A 3CVVA 4NURA 1OUVA 1UOHA 2FI7A 1D8DA 1QZ2A 1IYGA 2FBNA 4DI4A 5G05J 2X6HA 4YVOA 3PRZA 4AEZC 4Q69A 1H2UA 3R7RA 3RO2A 5KJNA 4U04A 3TWQA 2XRZA 3T8MA 4GTOA 1LF8A 2QY7A 1KLXA 2Y4UA 4U0UA 1Z3XA 4OYSA 4AV7A 4JXTA 3SNXA 4CGVA 2IOSA 2IY0C 2E2EA 3HXFA 2BKKB 2AXUA 4RG9A 1NP7A 5AARA 4UUCA 4XX5A 3V79K 3RSEG 3NB2A 3NBNB 4DLOA 1XNFA 1U3CA 2VGXA 4WNFA 1LTXA 2PL2A 2WVIA 4UI9J 3MCXA 2GGFA 5JJ7A 3O48A 3LY7A 3DEPA 2KZTA 3RRNB 2VQ2A 3FY4A 4I17A 2F37A 4I6GA 5HS0A
chains in the Genus database with same CATH topology
1XGWA 3PUJA 1L5JA 4UWHA 4WNDA 5FJYA 4CT4A 1UJKA 4I1AA 3FUHA 1HZ4A 1QQEA 3RIBA 1PY1A 2M63A 3Q5MA 4J8EA 1PC2A 3UT8A 2V8SE 3Q49B 3TG4A 3L22A 3EJNA 4B89A 4D10C 3FTUA 2V4LA 4JHKA 3FUNA 4KBQA 2XQ0A 1MQSA 3RO3A 1N54A 1JPLA 4IULA 4HOQA 4JA7A 1N52A 1ZU2A 3SGHA 2XPIA 2WXOA 2R59A 3PVLA 5CMYA 2R17C 2DIWA 4I9EA 3B13A 3CK7A 4GU5A 3DBSA 2VSOE 4UI9C 3U64A 2RG8A 4OVVA 3ESKA 2IOLA 1E90A 3C98A 2AWIA 2WXPA 4BT8A 2CHXA 3AS5A 5A23A 3ZEFA 1HU3A 3GZSA 2C0MA 3CGHA 1DVPA 2BF0X 2I2OA 2C2LA 4GCOA 4GCNA 4WNGA 3D9LA 4YVQC 2XEVA 3CVLA 5EX3A 5LCWC 3MEKA 4J0UA 4Q96A 2FULA 3CVPA 1JUQA 1SZAA 3ZYLA 2WXHA 4AXHA 3CHPA 3CQGB 4N3AA 4OVUA 2IFUA 3AU4A 4UQYA 4G23A 3TAXA 3FTXA 2C0LA 2HYZA 4HFGA 4XKBA 4C0MA 2PM7A 2PM6A 1ELKA 4BX9A 3EHMA 2L9BA 5C2YA 2L0TB 5J08A 4APFA 4KXKB 3ZW3A 4ILHB 3D3MA 2Y4TA 5JJTA 2AVPA 1SQMA 1KT0A 4BY6A 1H2TC 3L17A 1FVFA 4I1OB 1QNFA 3ASHA 2AW6A 4N39A 4C0EA 2WMOA 4GA0A 2LAHA 3RKVA 3PDNA 2P58C 5ARFA 3L54A 2E0IA 2I9CA 1EYHA 2OVFA 1WAO1 2OVBA 3P2BA 3LKUA 4N5CA 3GZ1A 2CHWA 4ILGA 3EIQC 3ZHEA 4AM9A 4G26A 3PEUB 1EF1C 5FQ8A 3SD5A 2IJGX 3UQ3A 1B89A 2HO1A 4G1TA 1YA0A 3LVQE 1HE8A 5JHBA 1PAQA 4XI0A 2XCCA 5CCLA 4E85A 2YNQA 3HHMA 2WQ7A 3FH8A 3FH5A 4APOA 2UY1A 3ZN3A 4AOFA 2LO6A 4GZ6A 2I1KA 4EPZA 2DCPA 3FUFA 4JW1A 5AJLA 5LOZA 4GPKA 3CKBA 4F53A 3KEZA 2DBAA 4L1BA 3EDTB 3UT4A 3UX4A 1E8WA 5G2NA 4U07A 3APDA 2LNIA 5BT1A 3EHNA 4IYPA 2WXJA 2MHKA 3PREA 4YNDA 2WM9A 4XZ4A 4JPSA 2XGSA 2BUGA 1FCHA 4DK5A 2CFZA 5JJ6A 2KM4A 3IBEA 4WUYA 4H7XA 3QB2A 5CMWA 4G11A 4ACKA 3G2WA 3FWVA 4I43A 4G2VA 3S2AA 3JYSA 3QDNA 4M3OA 3FEXA 4A1GA 4AIFA 2YINA 3MA5A 4FLHA 2WXFA 4WAFA 2XRYA 3FTVA 3P1UA 4HOTA 4LCTA 3VLEA 4N3BA 5M72A 2XPZA 3KAEA 4DPRA 4HXIA 5EX0A 3MKQA 4PS7A 5ANLA 4Q94A 1FVHA 3ENEA 3G2TA 3JQ0A 4GB9A 4L2YA 4FP7A 1E96B 5KJMA 3NZSA 3SF4A 3TL5A 3CKCA 4K0RA 3PUKA 4TRQA 4LEUA 4BSXA 4DI3A 4CT0A 4FULA 4HOUA 3B7UX 1U3DA 4UWLA 2A5UA 1WY6A 3SBSA 4UI9K 4GYWA 1HH8A 2BTDA 1EPUA 5LFAA 4UQZA 1BPOA 2YHCA 3FUKA 3L16A 2FEZA 4XKCA 4AJWA 3DPDA 4N2SA 1UG3A 4GZDA 2JLBA 2VYIA 3HVEA 3I4GA 3L6AA 2MRIA 3L13A 3B7SA 3OTNA 3FH7A 1HO8A 4GYOA 3CHRA 2CG2A 4FHJA 1IQRA 4F7AA 2VSNA 3CVNA 1E8YA 4GZ3A 3MV2B 3MV3B 3IKOB 5HQ8A 3QOUA 1W3BA 2MOWA 3D9NA 3FU3A 1ZBPA 3LDZA 4PDXA 2R5SA 3JCKC 3S7FA 2XCBA 3FTYA 4BTBA 4L2LA 3ZGQA 4PS8A 2HM8A 3IEGA 4GMLA 4JEUA 2J08A 3CHSA 3D9IA 1Z6TA 4PS3A 4MLPA 4DJAA 1HF8A 4E6HA 3MGBA 5AENA 1P5QA 2J4BA 5BV0A 2WXIA 2VGXB 3PNLB 4HOSA 4I2WA 5C1DA 4EECA 3ZYQA 3RRMB 1S0PA 4H7YA 2V5FA 4A55A 3UMVA 2XHEA 5KJLA 1E8ZA 3ONKA 3MJWA 3JQ1A 5FT9A 4ABNA 4G24A 3I3NA 5ANRA 3CVYA 4BWRA 3ASDA 4JVSA 4JC8A 2LSUA 2WXKA 3HDXA 2IQCA 3QC1A 2ILRA 5CCMA 4FLBA 3CSFA 4U0ZA 2WB2A 3S7BA 3SFZA 4EZLA 2CHZA 3TJPA 3WXXA 3ZFWA 4O6FA 2GRMA 2YHEA 3HIZA 3G2VA 3OXFA 3FUJA 3Q47B 5CHEE 3CVUA 1OWLA 4AP2A 1OWOA 2J4DA 4U8HA 3LY9A 4CDRA 4R7LA 4CGWA 2CFUA 2IU1A 3U9WA 2AXVA 1Y8MA 4UWFA 2LAIA 3PS6A 4WWNA 3FUDA 3LY8A 1INZA 4L7TA 5G55A 4HVBA 3FP3A 1Y6IA 3PE4A 1H0AA 5G05C 3TXNA 4EBAG 1TEZA 1HXIA 3APFA 2VSYA 4IN3B 2WPVA 3BEEA 5D0QD 5T3RA 3MX3A 4KVOA 4JEHA 4J8DA 1IQUA 3SI5A 5A7DB 5FWQA 3ULQA 4HS2A 2X38A 1TJCA 3LCAA 5JHAA 4GA1A 2UWJG 4B94A 4GA2A 2ZU6B 2X6JA 3O4ZA 4UWGA 3PEVB 3RRUA 4F3VA 4JA9A 5KJKA 3SZ7A 1HFAA 1OWNA 1HG2A 3CLJA 2IF4A 2A4ZA 4KMOA 3OXGA 1UN9A 4GZCA 3FU5A 2JEKA 2VSXE 3CHQA 1A17A 1UN8A 3ASFA 2AXZA 1NA0A 3RU0A 5A6CA 2IONA 3IHYA 3CK9A 2VGYA 4GAAA 3PNTB 1DNPA 4GMJA 3CR3A 4AY6A 4L23A 1IHGA 2VTBA 3I4RB 4I2ZA 1EDUA 2X3MA 3D9OA 4FJYA 4N3CA 5LP0A 1ELWA 3CVXA 5LX8A 1UJJA 3ZYMA 4I6EA 3FUEA 3UPVA 2J49A 5HI7A 4WWPA 3VLDA 4CEMA 3FEYA 3BG1B 5BW8C 3FTSA 1ELRA 3ML8A 4FC8A 2J09A 3FU0A 3Q4AB 5ENNA 2Q7FA 3ZHEB 4AY5A 3U3WA 2EQXA 3NQPA 2KATA 2NC9A 3RJVA 5D0OD 4N2QA 4GYYA 4UQXA 4ANXA 3E4BA 4PH4B 4A3TA 3ZVVA 3AS4A 2X6FA 3FU6A 4ANVA 4JZYA 2OV8A 2CG3A 2PQNA 4TUUA 4G25A 4WNEA 3EIJA 4XIFA 5EDSA 2L6JA 3CV0A 1WM5A 4FADA 5FZQA 3LEWA 1UW4B 3B7RL 3CSTA 5E75A 3IHVA 3KD7A 3G2UA 1H19A 1E7UA 5J90A 3S7JA 3QWPA 5BNWA 3AU5A 3LPZA 2WXLA 4J6IA 3ASGA 3CK8A 2KCVA 2KCKA 4U0SA 4FU3A 3CVWA 3FFLA 4LRZA 3GYZA 5AJDA 3ONLA 5DIZA 5T4YA 1GW6A 3FDHA 5T8IA 2NSZA 3MZLB 2WXQA 5KCMA 3GZ2A 3D9PA 4QFVA 4CRWA 3FTWA 3NF1A 2J07A 2XGOA 4HLEA 3MKQB 4Y6WA 1E8XA 5G04C 4TV3A 3ZRHA 2WXRA 4XI9A 5BPPA 3QARA 4BTAA 4GZ5A 3B7TA 2FO7A 3LS8A 4I6JA 4BT9A 3CQCB 5FQ6A 2VTBB 1X5BA 1KT1A 4J8FA 4V3IA 3T5XA 4NQ0A 5FTPA 2KC7A 2FF4A 4RG6A 5DBKA 3ZPJA 3PH0C 4I9CA 4NACA 3SBTB 3TGOA 3MKRA 2RD0A 4KZ0A 4J8SA 2L0IA 4A3VA 3RK6A 4CDNA 5BV1A 4FA6A 2NXPA 3VTXA 2X6KA 1JWFA 2J9QA 4I1MA 1Z3YA 3ML9A 4EBAA 3TG5A 1H6KA 4LUNU 3CIAA 3AS8A 2I1JA 2UY1B 5ARGA 1H2VC 3UUXA 2KZTB 2PQRA 2HR2A 3GW4A 3URZA 2WXNA 3ZYKA 3UT7A 4EZKA 4ME2A 3IV0A 3CVVA 1E7VA 2WXGA 4NURA 2YQ8A 1SZ9A 3R7QA 4C9BB 1OUVA 2WQ6A 4B8CB 3FUMA 3D9JA 3JUIA 4K03A 5LCWJ 1JWGA 3T5VA 2FI7A 2GW1A 1QZ2A 1IYGA 4ATGA 4NRHB 3QK0A 4PUCA 4KYOB 4CCAA 2FBNA 4DI4A 3QAQA 4JHJA 5G05J 2X6HA 4YVOA 3LXUX 3G2SA 1NA3A 2XPYA 3PRZA 4RVBA 3ZXSA 4AEZC 4ANWA 3CEQA 4Q69A 1H2UA 3PZDA 2WXMA 3FTZA 5EKQD 4F1SA 3R7RA 4JL0A 3R9AB 5E76A 2WQHA 3RO2A 3QWVA 4U63A 4U04A 5KJNA 3BG0B 2QFCA 3SHFA 2XRZA 4B8AA 3NZUA 4AVXA 3T8MA 4MS6A 1LF8A 2QY7A 3TXMA 3LYAA 1MHQA 1KLXA 2Y4UA 4U0UA 4P29A 1Z3XA 3K9IA 4OYSA 4AV7A 4JXTA 3CHMA 4ILIA 3SNXA 1HX8A 3HYMB 3VTYA 4CGVA 3D9MA 2IOSA 2WMNA 3ESLA 2E2EA 4RSYA 3Q15A 3CVQA 4A1SA 2AXUA 4RG9A 3S7DA 5G04J 3FULA 1NP7A 4KZCA 4URKA 4FJZA 2X6IA 4XX5A 3OAWA 5FZSA 4CDMA 2I6HA 4B0ZA 4HORA 3PE3A 5BUZA 3APCA 4Y6CA 3QJZA 4ANUA 2VJ8A 4DLOA 5AIJA 4LERA 4UWKA 3OXLA 5AYWD 4KT6B 1XNFA 3FHEA 3L08A 1U3CA 3QKYA 2V0PA 5FZRA 2KCLA 2VGXA 4WNFA 3CHOA 1VDYA 1TJFA 4JHRA 2PL2A 2WVIA 4UI9J 3MCXA 1OWMA 3U66A 4MKTA 2GGFA 3FUIA 4KVMA 5JJ7A 3I5PA 1HS6A 4EZJA 2ONDA 3O48A 5FQ7A 3D9KA 3MYVA 4DLQA 3LY7A 4FHKA 4XE0A 1NZNA 2OOEA 2KZTA 3RRNB 4W9RA 4EQFA 4MRUA 3LVRE 3VLFA 4WWOA 5FQ4A 2PZIA 2LSVA 4ACLA 2VQ2A 1HG5A 1OWPA 2Y3AA 3FY4A 4BX8A 4BFRA 3ZIMA 3HVEB 4I17A 4IRUA 3QWWA 2GRLA 3KS2A 3U4TA 4I6GA 3LJ3A 2XGMA 3N71A 3QNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FP3 A;  5JJ6 A;  3MKR A;  3PE4 A;  5G05 C;  4WUY A;  4H7X A;  1HXI A;  2VSY A;  4IN3 B;  2WPV A;  3FWV A;  4G2V A;  4WND A;  5FJY A;  4I1A A;  3JYS A;  4YND A;  3BEE A;  1HZ4 A;  1QQE A;  2J9Q A;  3QDN A;  5D0Q D;  3RIB A;  4AIF A;  3MA5 A;  3Q5M A;  4J8E A;  3TG5 A;  1PC2 A;  4HOT A;  3TG4 A;  3Q49 B;  4J8D A;  4N3B A;  5A7D B;  3KAE A;  3ULQ A;  3AS8 A;  2XGS A;  5M72 A;  5EX0 A;  2UY1 B;  4KBQ A;  5ARG A;  3UUX A;  3VTX A;  3RO3 A;  1TJC A;  5DBK A;  2PQR A;  2HR2 A;  3GW4 A;  3LCA A;  3URZ A;  4HOQ A;  4GA1 A;  2UWJ G;  4JA7 A;  4B94 A;  4ME2 A;  4GA2 A;  1ZU2 A;  1E96 B;  2XPI A;  4F3V A;  2YQ8 A;  5KJM A;  4JA9 A;  3SF4 A;  5KJK A;  3SZ7 A;  1OUV A;  3CKC A;  4I9E A;  4LEU A;  3CK7 A;  2IF4 A;  5LCW J;  4UI9 C;  2FI7 A;  2GW1 A;  3OXG A;  4HOU A;  1QZ2 A;  3ESK A;  1IYG A;  1A17 A;  4NRH B;  4BT8 A;  4KYO B;  3ASF A;  3AS5 A;  1NA0 A;  2FBN A;  4GYW A;  1HH8 A;  4UI9 K;  3RU0 A;  5G05 J;  5A6C A;  4YVO A;  2C0M A;  4UQZ A;  2VGY A;  1NA3 A;  2YHC A;  3CK9 A;  2C2L A;  2FEZ A;  4GCO A;  4GCN A;  3CEQ A;  4WNG A;  5EX3 A;  4YVQ C;  2XEV A;  3CVL A;  4AY6 A;  4N2S A;  5EKQ D;  1IHG A;  3MEK A;  4JL0 A;  2JLB A;  4J0U A;  2WQH A;  3R9A B;  2VYI A;  3CVP A;  3QWV A;  4I2Z A;  4U04 A;  3RO2 A;  5KJN A;  2QFC A;  5LCW C;  4N3C A;  3ZPJ A;  4N3A A;  1ELW A;  2IFU A;  4GYO A;  4UQY A;  4G23 A;  3TAX A;  2VSN A;  3CVN A;  4GZ3 A;  3MV2 B;  3MV3 B;  3UPV A;  3LYA A;  2C0L A;  2HYZ A;  3QOU A;  5HI7 A;  1W3B A;  1KLX A;  2Y4U A;  4U0U A;  5HQ8 A;  1ZBP A;  5BW8 C;  3K9I A;  1ELR A;  2R5S A;  3Q4A B;  3HYM B;  2XCB A;  2Q7F A;  3S7F A;  3VTY A;  3ZHE B;  4AY5 A;  4BTB A;  4CGV A;  3ZGQ A;  3U3W A;  2E2E A;  2KAT A;  2NC9 A;  3Q15 A;  4KXK B;  3CVQ A;  3IEG A;  2Y4T A;  5D0O D;  3RJV A;  4A1S A;  2AVP A;  4GYY A;  4RG9 A;  4UQX A;  1KT0 A;  5G04 J;  3S7D A;  3E4B A;  5JJT A;  3AS4 A;  5FZS A;  3ASH A;  1P5Q A;  4N39 A;  2I6H A;  4HOR A;  3PE3 A;  4GA0 A;  3RKV A;  4Y6C A;  2VGX B;  2PQN A;  2P58 C;  3PDN A;  4HOS A;  4G25 A;  4I2W A;  4RG6 A;  4WNE A;  5ARF A;  5C1D A;  3TGO A;  3OXL A;  5AYW D;  1WAO 1;  1XNF A;  3QKY A;  4H7Y A;  2V5F A;  2L6J A;  3CV0 A;  1WM5 A;  4XIF A;  2KCL A;  2VGX A;  5FZQ A;  5FZR A;  5KJL A;  4I9C A;  3LKU A;  4WNF A;  4N5C A;  5FT9 A;  3KD7 A;  3GZ1 A;  4G24 A;  2PL2 A;  4JHR A;  3ZHE A;  4ABN A;  4AM9 A;  3ASD A;  4BWR A;  2LSU A;  4UI9 J;  4G26 A;  3S7J A;  3QWP A;  5BNW A;  3LPZ A;  3ASG A;  3CK8 A;  2KCV A;  3UQ3 A;  5CCM A;  2KCK A;  4U0S A;  5JJ7 A;  1B89 A;  3FFL A;  4U0Z A;  2OND A;  3O48 A;  3GYZ A;  5DIZ A;  3S7B A;  4N2Q A;  2HO1 A;  3ZFW A;  3WXX A;  4G1T A;  1YA0 A;  3LY7 A;  4O6F A;  4XI0 A;  3GZ2 A;  2XCC A;  1NZN A;  2OOE A;  5CCL A;  3NF1 A;  4W9R A;  2XGO A;  4APO A;  2UY1 A;  4EQF A;  3ZN3 A;  4GZ6 A;  4Y6W A;  5G04 C;  3OXF A;  3Q47 B;  5CHE E;  2PZI A;  2LSV A;  4XI9 A;  2VQ2 A;  4CDR A;  3LY9 A;  4BTA A;  4GPK A;  3CKB A;  4GZ5 A;  4CGW A;  2DBA A;  2FO7 A;  4BT9 A;  3EDT B;  1Y8M A;  4I17 A;  4U07 A;  2LNI A;  3QWW A;  5BT1 A;  3KS2 A;  3U4T A;  1KT1 A;  4J8F A;  2XGM A;  2MHK A;  2KC7 A;  3LY8 A;  3N71 A;  2FF4 A;  4NQ0 A;  5FTP A;  2BUG A;  1FCH A; 
#chains in the Genus database with same CATH topology
 2H6H A;  1WDY A;  4I1A A;  1HZ4 A;  3RIB A;  1PC2 A;  3L22 A;  4B89 A;  3UM0 A;  3BU8 A;  2XQ0 A;  1MQS A;  3RO3 A;  1JPL A;  4IUL A;  4JA7 A;  1N52 A;  3J5Q B;  2XPI A;  5EIL A;  3B13 A;  4DX1 A;  1DCE A;  3U64 A;  2RG8 A;  4OVV A;  4BT8 A;  2AWI A;  4YDY A;  2CHX A;  3AS5 A;  3JXJ A;  1HU3 A;  2C0M A;  3CGH A;  2EIL E;  3NOG D;  4GCN A;  4TUM A;  1S70 B;  5LCW C;  4X8Q A;  1SZA A;  4AXH A;  3CQG B;  4N3A A;  2EIN E;  4UQY A;  2HYZ A;  4C0M A;  4XKB A;  2PM7 A;  3EHM A;  5C2Y A;  4M7C A;  2AVP A;  1N95 A;  4BY6 A;  4HRN A;  4N39 A;  3RKV A;  2E0I A;  1TNB A;  3V2O A;  1RW2 A;  3GZ1 A;  3PEU B;  2IJG X;  4DX7 D;  3LVQ E;  1PAQ A;  4XI0 A;  4E85 A;  3FH5 A;  1U2V G;  4GTR A;  4AOF A;  2LO6 A;  1N4R A;  5AJL A;  4JW1 A;  3CKB A;  2DBA A;  2KXP C;  3EHN A;  3PRE A;  4JPS A;  1FCH A;  2V4H C;  4H7X A;  4G11 A;  3FWV A;  3QDN A;  2YIN A;  4JB8 P;  5M72 A;  3KAE A;  4HXI A;  4PS7 A;  4Q94 A;  5IY5 E;  3DWL G;  4FP7 A;  5KJM A;  3ISM C;  3CKC A;  2OEV A;  4DI3 A;  4UWL A;  2A5U A;  4GYW A;  2BTD A;  2YHC A;  4XKC A;  4AJW A;  3DPD A;  1QBQ A;  4U96 D;  3I4G A;  3L13 A;  1HO8 A;  3CHR A;  1W3B A;  2MOW A;  1N94 A;  4BTB A;  1OCR E;  4GML A;  4JEU A;  1BD8 A;  3CHS A;  3D9I A;  4PS3 A;  3UIO C;  1HF8 A;  5AEN A;  5BV0 A;  2WXI A;  4HOS A;  4EEC A;  3ZYQ A;  2ETB A;  4A55 A;  5KJL A;  1E8Z A;  2A5E A;  1G3N B;  5ITZ F;  3X2Q E;  2NYJ A;  2ILR A;  4FLB A;  3CSF A;  4G8L A;  1MX4 A;  2LXL A;  2GRM A;  4EHM A;  4RLY A;  1S64 A;  3CVU A;  5CHE E;  3DXM G;  1OWL A;  4U8H A;  2J4D A;  3LY9 A;  4R7L A;  4CGW A;  3U9W A;  2AXV A;  4UWF A;  3W9F A;  3UKR G;  4WWN A;  4N5Q A;  4HVB A;  3EHQ A;  3FP3 A;  1Y6I A;  5G05 C;  2EIM E;  4EBA G;  3V2X A;  3HXB A;  3MX3 A;  1YYH A;  1O1S A;  4YDE A;  4J8D A;  1IQU A;  3SI5 A;  1TJC A;  2UWJ G;  4B94 A;  3PEV B;  4F3V A;  1OWN A;  1HG2 A;  3CLJ A;  2IF4 A;  5HKP A;  2B0O E;  3OXG A;  1UN9 A;  3FU5 A;  3DXK G;  1TNO A;  3CK9 A;  2B6C A;  2VTB A;  3I4R B;  2XEE A;  1OY3 D;  2GRQ B;  4FJY A;  4N3C A;  5LP0 A;  3TWS A;  5AQA A;  3ZYM A;  3UPV A;  4K5B A;  2QZA A;  2J49 A;  5HI7 A;  4WWP A;  3VLD A;  3BG1 B;  1ELR A;  5ENN A;  3FU0 A;  3Q4A B;  5EIB E;  3U3W A;  2DVW A;  1YCS B;  2NC9 A;  3RJV A;  2VGE A;  4ANX A;  1OCC E;  4A3T A;  1A5E A;  4JZY A;  2CG3 A;  4TUU A;  4G25 A;  2P9P G;  2PNN A;  3CV0 A;  3SY2 A;  1WM5 A;  2GRP B;  3G2U A;  4HB5 A;  1H19 A;  3LPZ A;  2GRO B;  4O1O A;  3ASG A;  3CK8 A;  2KCK A;  3CVW A;  3GYZ A;  5AJD A;  3ONL A;  3GZ2 A;  3NAW A;  5KBA A;  4CRW A;  3FTW A;  3NF1 A;  4GPM A;  4HLE A;  2BKG A;  5G04 C;  2WXR A;  3QAR A;  1SW6 A;  4GZ5 A;  3QNK A;  3T5X A;  3PH0 C;  3SBT B;  3MKR A;  2RD0 A;  4KZ0 A;  2L0I A;  4A3V A;  3ZU7 B;  4CDN A;  5BV1 A;  1SA5 A;  2NXP A;  1TN7 A;  2J9Q A;  4I1M A;  4EBA A;  3HXC A;  5KNH D;  1QYM A;  1TN8 A;  2WXN A;  3UT7 A;  4GTT A;  2YQ8 A;  3R7Q A;  2WQ6 A;  3TWT A;  3JUI A;  3V31 A;  4NRH B;  1NA3 A;  2XPY A;  4ANW A;  4RVB A;  3PZD A;  4F1S A;  4JL0 A;  5E76 A;  2WQH A;  4J7W A;  3BG0 B;  2QFC A;  3SHF A;  4AVX A;  2DYS E;  3LYA A;  3KEA A;  3K9I A;  2BED A;  4ILI A;  2LUH A;  3VTY A;  2MYO A;  1D8E A;  3CVQ A;  5G04 J;  3FUL A;  2ETA A;  1K1B A;  3OAW A;  5FZS A;  3JXI A;  3KSQ A;  4Y6C A;  4ANU A;  4UWK A;  3OXL A;  3FHE A;  3QKY A;  2V0P A;  2KCL A;  1VDY A;  3I5P A;  2OND A;  5H7P A;  5FQ7 A;  3MYV A;  2QYJ A;  3VLF A;  4WWO A;  2H6G A;  2PZI A;  2Y3A A;  2ZIR A;  3E33 A;  4IRU A;  2GRL A;  3KS2 A;  3U4T A;  3LJ3 A;  3N71 A;  2R05 A;  3UIN C;  5FJY A;  2DZN A;  1IHB A;  1QQE A;  1PY1 A;  3SFY A;  4J8E A;  3TG4 A;  1O1T A;  3FUN A;  3UM2 A;  1N54 A;  4HOQ A;  1ZU2 A;  3PVL A;  2R17 C;  2DIW A;  4GU5 A;  4UI9 C;  2IOL A;  1E90 A;  2WXP A;  3ZEF A;  3GZS A;  3TWR A;  1DVP A;  2I2O A;  1MX2 A;  2C2L A;  4WNG A;  3D9L A;  3CVL A;  4Q96 A;  4LSZ E;  3CVP A;  3ZYL A;  2WXH A;  2P9N G;  4HBD A;  3TAX A;  2EIK E;  3FTX A;  4HFG A;  2PM6 A;  2IO2 C;  1JCQ A;  2Y0B G;  4APF A;  4B93 B;  3D3M A;  2Y4T A;  1KT0 A;  3Q9U C;  3L17 A;  1QNF A;  2AW6 A;  2RFM A;  4GA0 A;  2LAH A;  1EYH A;  1WAO 1;  4BER A;  4N5C A;  2CHW A;  3DEO A;  4AM9 A;  4G26 A;  1EF1 C;  3SD5 A;  2OEW A;  3UQ3 A;  5JHB A;  3AG2 E;  2WQ7 A;  3HHM A;  4GZ6 A;  4EPZ A;  2F0Y A;  4F53 A;  3KEZ A;  3EDT B;  3UX4 A;  1E8W A;  3APD A;  2LNI A;  2WXJ A;  2MHK A;  4YND A;  4XZ4 A;  2XGS A;  3SO8 A;  5CMW A;  3G2W A;  2L6B A;  3FEX A;  4A1G A;  3MA5 A;  2WXF A;  3FTV A;  3P1U A;  4HOT A;  4GTV A;  2XPZ A;  3MKQ A;  1N4Q A;  3E30 A;  3ENE A;  3JQ0 A;  4L2Y A;  4BSX A;  3B7U X;  1WY6 A;  1EPU A;  4UQZ A;  3FUK A;  2FEZ A;  3DPY A;  3Q7A A;  2F8Y A;  3OTN A;  4DUI A;  1IQR A;  4GZ3 A;  3MV3 B;  3D9N A;  3S7F A;  4PS8 A;  2J08 A;  1Z6T A;  4U7E B;  1N0R A;  4HQD A;  2J4B A;  1TNZ A;  3TWW A;  3RRM B;  1N9A A;  3ONK A;  2V5Q C;  3MJW A;  5FT9 A;  4ABN A;  3I3N A;  5ANR A;  3ASD A;  4JC8 A;  2IQC A;  3QC1 A;  5CCM A;  3HXD A;  2WB2 A;  3S7B A;  3SFZ A;  4EZL A;  3ZFW A;  5BXO A;  4HI8 A;  2YHE A;  3AG4 E;  4LG6 A;  4OAV B;  3EU9 A;  1OWO A;  3DRA A;  3ASN E;  2IU1 A;  4U95 D;  3PS6 A;  3LY8 A;  1INZ A;  1H0A A;  3TXN A;  1HXI A;  4IN3 B;  5EN5 D;  4KVO A;  4JEH A;  3UI2 A;  5FWQ A;  5AQ7 A;  1OCO E;  3LCA A;  2ZU6 B;  3O4Z A;  4JA9 A;  3SZ7 A;  2A4Z A;  1NA0 A;  3RU0 A;  4QQI A;  5CBN A;  3C5R A;  2F8X K;  2P9L G;  1N0Q A;  1IHG A;  3DST A;  4I2Z A;  4LNG A;  3D9O A;  3CVX A;  1V55 E;  4I6E A;  2RKK A;  3AAA C;  3TWV A;  2ZXW E;  2J09 A;  3ZHE B;  3NQP A;  2AJA A;  2KAT A;  3C72 A;  4GYY A;  3ULE G;  5ENT D;  3AS4 A;  4ANV A;  3UIP C;  2R02 A;  2PQN A;  1TR4 A;  1S63 A;  4GTQ A;  4RQI A;  4XIF A;  2L6J A;  5FZQ A;  4YDW A;  4U8V D;  5HRY A;  5J90 A;  3S7J A;  4FU3 A;  4LRZ A;  1GW6 A;  2NSZ A;  2QC9 A;  3F6Q A;  3D9P A;  5BPP A;  4BT9 A;  5FQ6 A;  2KC7 A;  3TGO A;  4RG6 A;  5DBK A;  4I9C A;  3RK6 A;  3UKU G;  1DCQ A;  3AS8 A;  2I1J A;  2HR2 A;  3GW4 A;  1E7V A;  2WXG A;  5CRU A;  1SZ9 A;  5D66 A;  4B8C B;  3D9J A;  4K03 A;  5LCW J;  2GW1 A;  4PUC A;  4CCA A;  3LXU X;  3G2S A;  3ABM E;  2DZO A;  3PZ4 A;  3CEQ A;  4HI9 A;  5EKQ D;  3KSL A;  4U63 A;  4B8A A;  4MS6 A;  3TXM A;  4P29 A;  4DRX E;  3Q9N C;  3HYM B;  4RSY A;  3Q15 A;  3S7D A;  4KZC A;  4URK A;  4FJZ A;  1OXJ A;  2X6I A;  4F1P A;  2I6H A;  3PE3 A;  5BUZ A;  3APC A;  3QJZ A;  2HE0 A;  3L08 A;  3V30 A;  3CHO A;  1TJF A;  4JHR A;  3U66 A;  4MKT A;  4KVM A;  5CBO A;  4FHK A;  4XE0 A;  3D9H A;  4YDO A;  4W9R A;  3SQV A;  1N4S A;  3LVR E;  1NI1 A;  2XS8 A;  2LSV A;  4ACL A;  1HG5 A;  1OWP A;  5JA4 D;  4BFR A;  2H6I A;  1LD7 A;  4ZFH A;  4DX5 D;  2DWZ A;  5B1B E;  1OCZ E;  1XGW A;  3DSV A;  3PUJ A;  1UJK A;  3Q5M A;  3EJN A;  3FTU A;  2V4L A;  5CER B;  3AG1 E;  2ZGG A;  3SGH A;  2WXO A;  2R59 A;  3E37 A;  5CMY A;  3ZUV B;  1AP7 A;  1Q2Z A;  3DBS A;  4BEP A;  4LNU D;  3ESK A;  3C98 A;  3T8K A;  4Z68 A;  4GCO A;  3MEK A;  2FUL A;  1SA4 A;  4TXQ A;  1JUQ A;  1N11 A;  2IFU A;  3AU4 A;  4G23 A;  4BES A;  1N4P A;  4BX9 A;  1MX6 A;  2J8S D;  2L0T B;  1K8K G;  2XEN A;  5JJT A;  1SQM A;  3R9M A;  1H2T C;  1FVF A;  4I1O B;  2RFA A;  2WMO A;  1KPS B;  5ARF A;  1SVX A;  3P2B A;  3LKU A;  4ILG A;  3EIQ C;  4HRL A;  2P9K G;  5FQ8 A;  2P9I G;  1B89 A;  1YA0 A;  2JAB A;  1HE8 A;  2XCC A;  5CCL A;  3FH8 A;  2UY1 A;  3ZN3 A;  2I1K A;  3FUF A;  5LOZ A;  4GPK A;  4L1B A;  3W9G A;  3UT4 A;  2H6F A;  4IYP A;  2BUG A;  4GMR A;  2CFZ A;  3IBE A;  3QB2 A;  3S2A A;  3JYS A;  4M3O A;  4AIF A;  4FLH A;  4WAF A;  2XRY A;  3VLE A;  5B3S E;  4N3B A;  3EU5 A;  1FVH A;  3ASO E;  4CYM D;  3SF4 A;  3TL5 A;  4K0R A;  4CT0 A;  2R03 A;  4HOU A;  3SBS A;  4UI9 K;  1HH8 A;  1BPO A;  5ENQ D;  3E32 A;  4N2S A;  1UG3 A;  3PZ3 A;  2CG2 A;  2VSN A;  3CVN A;  1E8Y A;  3MV2 B;  3IKO B;  5HQ8 A;  3QOU A;  1MZC A;  3LDZ A;  4PDX A;  1JCR A;  3JCK C;  4HNA D;  4L2L A;  3IEG A;  1TYQ G;  5KNG A;  3BQO A;  4E6H A;  2VGX B;  3PNL B;  4I2W A;  2V5F A;  3LJN A;  3CVY A;  4G24 A;  4JVS A;  1AWC B;  3TWU A;  1NL4 A;  3ZKJ A;  1K3Z D;  2CHZ A;  3WXX A;  4OAU C;  4O6F A;  1IXV A;  4GTM A;  2R2L A;  3G2V A;  3OXF A;  4AP2 A;  4CDR A;  2CFU A;  5BXU A;  1IKN D;  1Y8M A;  2LAI A;  3FUD A;  4L7T A;  5G55 A;  3PE4 A;  1TEZ A;  3ABK E;  3DSX A;  3APF A;  1BI8 B;  2VSY A;  2WPV A;  1MJ0 A;  3BEE A;  5D0Q D;  5AAO A;  5T3R A;  5A7D B;  4K5C A;  2X38 A;  4TXR A;  4GA1 A;  3SFX A;  3RRU A;  4JD2 G;  2GRN B;  5KJK A;  1HFA A;  4KMO A;  2JEK A;  1A17 A;  4NIK A;  3ASF A;  1BU9 A;  2AXZ A;  2ION A;  3L82 A;  4GAA A;  1ZB1 A;  4GMJ A;  4L23 A;  4ATZ D;  1EDU A;  2X3M A;  1ELW A;  1DC2 A;  1UJJ A;  3FUE A;  4K5A B;  5BW8 C;  5AQ9 A;  4FC8 A;  3ABL E;  4AY5 A;  2EQX A;  5D0O D;  3Q73 A;  3E4B A;  1O1R A;  3FU6 A;  4XEI G;  4CZ2 D;  2OV8 A;  4WNE A;  5EDS A;  4FAD A;  3LEW A;  2DYR E;  1BI7 B;  3B7R L;  3CST A;  5E75 A;  3IHV A;  5BNW A;  3QWP A;  3AU5 A;  2WXL A;  4J6I A;  1TNY A;  4J8Y A;  5DIZ A;  5T8I A;  4C48 B;  2Y1L E;  3MZL B;  5KCM A;  4QFV A;  2EIJ E;  2KBX A;  5ENR D;  1E8X A;  4TV3 A;  3ZRH A;  4XI9 A;  3B7T A;  2FO7 A;  3LS8 A;  4I6J A;  1X5B A;  1KT1 A;  4V3I A;  4NQ0 A;  5FTP A;  2FF4 A;  3C3Q A;  4J8S A;  1JCS A;  3VTX A;  2X6K A;  3ML9 A;  3TG5 A;  3J5P A;  2UY1 B;  5ARG A;  3UUX A;  3AG3 E;  4EZK A;  3IV0 A;  3UM1 A;  4C9B B;  3FUM A;  1JWG A;  3T5V A;  4ATG A;  3QK0 A;  4KYO B;  1LD8 A;  3QAQ A;  4JHJ A;  3ZXS A;  3Q7F A;  2WXM A;  3FTZ A;  3R9A B;  3QWV A;  3E34 A;  3C3O A;  5AQB A;  3NZU A;  3PZ2 A;  1X81 A;  1MHQ A;  1FPP A;  5CRV A;  3IXE A;  3CHM A;  1HX8 A;  3D9M A;  2WMN A;  3ESL A;  4A1S A;  4LNB A;  3HRA A;  4CDM A;  4B0Z A;  4HOR A;  2VJ8 A;  5AIJ A;  4LER A;  3L9T A;  5AYW D;  4KT6 B;  5FZR A;  1OWM A;  3UTM A;  3FUI A;  1HS6 A;  4EZJ A;  3D9K A;  4DLQ A;  1NZN A;  2OOE A;  4A63 B;  4U8Y D;  4EQF A;  4MRU A;  1D9S A;  2GRR B;  1KZO A;  5B1A E;  5FQ4 A;  4BX8 A;  3ZIM A;  3HVE B;  2LXM A;  3QWW A;  3UXG A;  2XGM A;  1L5J A;  3EUV A;  4UWH A;  4BET A;  4WND A;  4CT4 A;  3FUH A;  2M63 A;  3UT8 A;  2V8S E;  3Q49 B;  4D10 C;  4JHK A;  4KBQ A;  3Q79 A;  3DSS A;  3PZ1 A;  4I9E A;  3CK7 A;  1H6O A;  2VSO E;  3B95 A;  5A23 A;  2ZGD A;  2BF0 X;  2P9U G;  5EX3 A;  4YVQ C;  2XEV A;  4J0U A;  1Z5S C;  3CHP A;  4OVU A;  3EHR A;  3Q75 A;  2C0L A;  1ELK A;  3RAU A;  2L9B A;  1NFI E;  5J08 A;  4KXK B;  3ZW3 A;  4ILH B;  1O5M A;  5EID A;  3ASH A;  4C0E A;  1MYO A;  3PDN A;  2P58 C;  4O60 A;  3NOC D;  3L54 A;  2OCC E;  2I9C A;  2OVF A;  2OVB A;  2ZIS A;  5CEA A;  3ZHE A;  3Q78 A;  4L9P A;  1FT2 A;  5EYP F;  2HO1 A;  4G1T A;  1H6P A;  1KZP A;  3ZNG A;  2YNQ A;  4APO A;  5JMN D;  2P2C P;  2DCP A;  4DX6 D;  2P9S G;  5EYL A;  5AN8 A;  5G2N A;  4U07 A;  5BT1 A;  2WM9 A;  4DK5 A;  5JJ6 A;  2KM4 A;  4WUY A;  4ACK A;  4I43 A;  4G2V A;  2FO1 E;  1TN6 A;  4LCT A;  4DPR A;  5EX0 A;  4HLL A;  5ANL A;  3G2T A;  3DSW A;  4GB9 A;  1E96 B;  4GTP A;  3NZS A;  5CED B;  3PUK A;  1FT1 A;  1V54 E;  4LEU A;  4TRQ A;  4FUL A;  1U3D A;  2XZT G;  4BSZ B;  1RZ4 A;  5LFA A;  5CEC B;  3L16 A;  4GZD A;  2JLB A;  2VYI A;  3HVE A;  3L6A A;  2MRI A;  3B7S A;  3FH7 A;  4GYO A;  3T9K A;  1TNU A;  4FHJ A;  4F7A A;  4HRM B;  5ENP D;  4ZHB A;  3FU3 A;  1ZBP A;  3DSU A;  2R5S A;  2XCB A;  3FTY A;  2Y69 E;  4O1P A;  3ZGQ A;  3JUE A;  2HM8 A;  3B7B A;  4MLP A;  4DJA A;  3MGB A;  1P5Q A;  5D2M C;  5C1D A;  1S0P A;  4H7Y A;  3UMV A;  2XHE A;  3JQ1 A;  4BWR A;  2LSU A;  2WXK A;  3HDX A;  5ENS D;  4U0Z A;  3TJP A;  3HIZ A;  3UM3 A;  4DX2 A;  3FUJ A;  3Q47 B;  4F6R D;  1YMP A;  1K1A A;  3ULQ A;  4HS2 A;  5JHA A;  4GA2 A;  2X6J A;  4UWG A;  5FIN A;  4GZC A;  2VSX E;  3CHQ A;  1UN8 A;  3BUA A;  5A6C A;  3IHY A;  2VGY A;  3ZXP A;  3PNT B;  1DNP A;  3CR3 A;  4AY6 A;  4MBG A;  5KWD A;  5LX8 A;  5ENO D;  4CEM A;  2XZD G;  3FEY A;  2XEH A;  3FTS A;  3ML8 A;  4G8K A;  2Q7F A;  4N2Q A;  4UQX A;  4PH4 B;  3ZVV A;  2IO3 C;  2X6F A;  1WG0 A;  3EIJ A;  2QYU A;  2IEJ A;  1UW4 B;  3KD7 A;  1E7U A;  3TWX A;  2KCV A;  4U0S A;  3FFL A;  1OT8 A;  2XS1 A;  5T4Y A;  2ETC A;  4TXP A;  3FDH A;  3C3R A;  2WXQ A;  5FIO A;  2J07 A;  2XGO A;  3MKQ B;  4Y6W A;  4BTA A;  3ULY A;  3CQC B;  2VTB B;  4J8F A;  3ZPJ A;  4NAC A;  4FA6 A;  1JWF A;  1Z3Y A;  1H6K A;  4LUN U;  3WG7 E;  3HG0 D;  3AJI A;  4GTS A;  3CIA A;  1H2V C;  2KZT B;  2PQR A;  3HXE A;  3URZ A;  1BLX B;  3ZYK A;  4ME2 A;  3CVV A;  4NUR A;  1OUV A;  1UOH A;  2FI7 A;  1D8D A;  1QZ2 A;  1IYG A;  2FBN A;  4DI4 A;  5G05 J;  2X6H A;  4YVO A;  3PRZ A;  4AEZ C;  4Q69 A;  1H2U A;  3R7R A;  3RO2 A;  5KJN A;  4U04 A;  3TWQ A;  2XRZ A;  3T8M A;  4GTO A;  1LF8 A;  2QY7 A;  1KLX A;  2Y4U A;  4U0U A;  1Z3X A;  4OYS A;  4AV7 A;  4JXT A;  3SNX A;  4CGV A;  2IOS A;  2IY0 C;  2E2E A;  3HXF A;  2BKK B;  2AXU A;  4RG9 A;  1NP7 A;  5AAR A;  4UUC A;  4XX5 A;  3V79 K;  3RSE G;  3NB2 A;  3NBN B;  4DLO A;  1XNF A;  1U3C A;  2VGX A;  4WNF A;  1LTX A;  2PL2 A;  2WVI A;  4UI9 J;  3MCX A;  2GGF A;  5JJ7 A;  3O48 A;  3LY7 A;  3DEP A;  2KZT A;  3RRN B;  2VQ2 A;  3FY4 A;  4I17 A;  2F37 A;  4I6G A;  5HS0 A; 
#chains in the Genus database with same CATH homology
 1XGW A;  3PUJ A;  1L5J A;  4UWH A;  4WND A;  5FJY A;  4CT4 A;  1UJK A;  4I1A A;  3FUH A;  1HZ4 A;  1QQE A;  3RIB A;  1PY1 A;  2M63 A;  3Q5M A;  4J8E A;  1PC2 A;  3UT8 A;  2V8S E;  3Q49 B;  3TG4 A;  3L22 A;  3EJN A;  4B89 A;  4D10 C;  3FTU A;  2V4L A;  4JHK A;  3FUN A;  4KBQ A;  2XQ0 A;  1MQS A;  3RO3 A;  1N54 A;  1JPL A;  4IUL A;  4HOQ A;  4JA7 A;  1N52 A;  1ZU2 A;  3SGH A;  2XPI A;  2WXO A;  2R59 A;  3PVL A;  5CMY A;  2R17 C;  2DIW A;  4I9E A;  3B13 A;  3CK7 A;  4GU5 A;  3DBS A;  2VSO E;  4UI9 C;  3U64 A;  2RG8 A;  4OVV A;  3ESK A;  2IOL A;  1E90 A;  3C98 A;  2AWI A;  2WXP A;  4BT8 A;  2CHX A;  3AS5 A;  5A23 A;  3ZEF A;  1HU3 A;  3GZS A;  2C0M A;  3CGH A;  1DVP A;  2BF0 X;  2I2O A;  2C2L A;  4GCO A;  4GCN A;  4WNG A;  3D9L A;  4YVQ C;  2XEV A;  3CVL A;  5EX3 A;  5LCW C;  3MEK A;  4J0U A;  4Q96 A;  2FUL A;  3CVP A;  1JUQ A;  1SZA A;  3ZYL A;  2WXH A;  4AXH A;  3CHP A;  3CQG B;  4N3A A;  4OVU A;  2IFU A;  3AU4 A;  4UQY A;  4G23 A;  3TAX A;  3FTX A;  2C0L A;  2HYZ A;  4HFG A;  4XKB A;  4C0M A;  2PM7 A;  2PM6 A;  1ELK A;  4BX9 A;  3EHM A;  2L9B A;  5C2Y A;  2L0T B;  5J08 A;  4APF A;  4KXK B;  3ZW3 A;  4ILH B;  3D3M A;  2Y4T A;  5JJT A;  2AVP A;  1SQM A;  1KT0 A;  4BY6 A;  1H2T C;  3L17 A;  1FVF A;  4I1O B;  1QNF A;  3ASH A;  2AW6 A;  4N39 A;  4C0E A;  2WMO A;  4GA0 A;  2LAH A;  3RKV A;  3PDN A;  2P58 C;  5ARF A;  3L54 A;  2E0I A;  2I9C A;  1EYH A;  2OVF A;  1WAO 1;  2OVB A;  3P2B A;  3LKU A;  4N5C A;  3GZ1 A;  2CHW A;  4ILG A;  3EIQ C;  3ZHE A;  4AM9 A;  4G26 A;  3PEU B;  1EF1 C;  5FQ8 A;  3SD5 A;  2IJG X;  3UQ3 A;  1B89 A;  2HO1 A;  4G1T A;  1YA0 A;  3LVQ E;  1HE8 A;  5JHB A;  1PAQ A;  4XI0 A;  2XCC A;  5CCL A;  4E85 A;  2YNQ A;  3HHM A;  2WQ7 A;  3FH8 A;  3FH5 A;  4APO A;  2UY1 A;  3ZN3 A;  4AOF A;  2LO6 A;  4GZ6 A;  2I1K A;  4EPZ A;  2DCP A;  3FUF A;  4JW1 A;  5AJL A;  5LOZ A;  4GPK A;  3CKB A;  4F53 A;  3KEZ A;  2DBA A;  4L1B A;  3EDT B;  3UT4 A;  3UX4 A;  1E8W A;  5G2N A;  4U07 A;  3APD A;  2LNI A;  5BT1 A;  3EHN A;  4IYP A;  2WXJ A;  2MHK A;  3PRE A;  4YND A;  2WM9 A;  4XZ4 A;  4JPS A;  2XGS A;  2BUG A;  1FCH A;  4DK5 A;  2CFZ A;  5JJ6 A;  2KM4 A;  3IBE A;  4WUY A;  4H7X A;  3QB2 A;  5CMW A;  4G11 A;  4ACK A;  3G2W A;  3FWV A;  4I43 A;  4G2V A;  3S2A A;  3JYS A;  3QDN A;  4M3O A;  3FEX A;  4A1G A;  4AIF A;  2YIN A;  3MA5 A;  4FLH A;  2WXF A;  4WAF A;  2XRY A;  3FTV A;  3P1U A;  4HOT A;  4LCT A;  3VLE A;  4N3B A;  5M72 A;  2XPZ A;  3KAE A;  4DPR A;  4HXI A;  5EX0 A;  3MKQ A;  4PS7 A;  5ANL A;  4Q94 A;  1FVH A;  3ENE A;  3G2T A;  3JQ0 A;  4GB9 A;  4L2Y A;  4FP7 A;  1E96 B;  5KJM A;  3NZS A;  3SF4 A;  3TL5 A;  3CKC A;  4K0R A;  3PUK A;  4TRQ A;  4LEU A;  4BSX A;  4DI3 A;  4CT0 A;  4FUL A;  4HOU A;  3B7U X;  1U3D A;  4UWL A;  2A5U A;  1WY6 A;  3SBS A;  4UI9 K;  4GYW A;  1HH8 A;  2BTD A;  1EPU A;  5LFA A;  4UQZ A;  1BPO A;  2YHC A;  3FUK A;  3L16 A;  2FEZ A;  4XKC A;  4AJW A;  3DPD A;  4N2S A;  1UG3 A;  4GZD A;  2JLB A;  2VYI A;  3HVE A;  3I4G A;  3L6A A;  2MRI A;  3L13 A;  3B7S A;  3OTN A;  3FH7 A;  1HO8 A;  4GYO A;  3CHR A;  2CG2 A;  4FHJ A;  1IQR A;  4F7A A;  2VSN A;  3CVN A;  1E8Y A;  4GZ3 A;  3MV2 B;  3MV3 B;  3IKO B;  5HQ8 A;  3QOU A;  1W3B A;  2MOW A;  3D9N A;  3FU3 A;  1ZBP A;  3LDZ A;  4PDX A;  2R5S A;  3JCK C;  3S7F A;  2XCB A;  3FTY A;  4BTB A;  4L2L A;  3ZGQ A;  4PS8 A;  2HM8 A;  3IEG A;  4GML A;  4JEU A;  2J08 A;  3CHS A;  3D9I A;  1Z6T A;  4PS3 A;  4MLP A;  4DJA A;  1HF8 A;  4E6H A;  3MGB A;  5AEN A;  1P5Q A;  2J4B A;  5BV0 A;  2WXI A;  2VGX B;  3PNL B;  4HOS A;  4I2W A;  5C1D A;  4EEC A;  3ZYQ A;  3RRM B;  1S0P A;  4H7Y A;  2V5F A;  4A55 A;  3UMV A;  2XHE A;  5KJL A;  1E8Z A;  3ONK A;  3MJW A;  3JQ1 A;  5FT9 A;  4ABN A;  4G24 A;  3I3N A;  5ANR A;  3CVY A;  4BWR A;  3ASD A;  4JVS A;  4JC8 A;  2LSU A;  2WXK A;  3HDX A;  2IQC A;  3QC1 A;  2ILR A;  5CCM A;  4FLB A;  3CSF A;  4U0Z A;  2WB2 A;  3S7B A;  3SFZ A;  4EZL A;  2CHZ A;  3TJP A;  3WXX A;  3ZFW A;  4O6F A;  2GRM A;  2YHE A;  3HIZ A;  3G2V A;  3OXF A;  3FUJ A;  3Q47 B;  5CHE E;  3CVU A;  1OWL A;  4AP2 A;  1OWO A;  2J4D A;  4U8H A;  3LY9 A;  4CDR A;  4R7L A;  4CGW A;  2CFU A;  2IU1 A;  3U9W A;  2AXV A;  1Y8M A;  4UWF A;  2LAI A;  3PS6 A;  4WWN A;  3FUD A;  3LY8 A;  1INZ A;  4L7T A;  5G55 A;  4HVB A;  3FP3 A;  1Y6I A;  3PE4 A;  1H0A A;  5G05 C;  3TXN A;  4EBA G;  1TEZ A;  1HXI A;  3APF A;  2VSY A;  4IN3 B;  2WPV A;  3BEE A;  5D0Q D;  5T3R A;  3MX3 A;  4KVO A;  4JEH A;  4J8D A;  1IQU A;  3SI5 A;  5A7D B;  5FWQ A;  3ULQ A;  4HS2 A;  2X38 A;  1TJC A;  3LCA A;  5JHA A;  4GA1 A;  2UWJ G;  4B94 A;  4GA2 A;  2ZU6 B;  2X6J A;  3O4Z A;  4UWG A;  3PEV B;  3RRU A;  4F3V A;  4JA9 A;  5KJK A;  3SZ7 A;  1HFA A;  1OWN A;  1HG2 A;  3CLJ A;  2IF4 A;  2A4Z A;  4KMO A;  3OXG A;  1UN9 A;  4GZC A;  3FU5 A;  2JEK A;  2VSX E;  3CHQ A;  1A17 A;  1UN8 A;  3ASF A;  2AXZ A;  1NA0 A;  3RU0 A;  5A6C A;  2ION A;  3IHY A;  3CK9 A;  2VGY A;  4GAA A;  3PNT B;  1DNP A;  4GMJ A;  3CR3 A;  4AY6 A;  4L23 A;  1IHG A;  2VTB A;  3I4R B;  4I2Z A;  1EDU A;  2X3M A;  3D9O A;  4FJY A;  4N3C A;  5LP0 A;  1ELW A;  3CVX A;  5LX8 A;  1UJJ A;  3ZYM A;  4I6E A;  3FUE A;  3UPV A;  2J49 A;  5HI7 A;  4WWP A;  3VLD A;  4CEM A;  3FEY A;  3BG1 B;  5BW8 C;  3FTS A;  1ELR A;  3ML8 A;  4FC8 A;  2J09 A;  3FU0 A;  3Q4A B;  5ENN A;  2Q7F A;  3ZHE B;  4AY5 A;  3U3W A;  2EQX A;  3NQP A;  2KAT A;  2NC9 A;  3RJV A;  5D0O D;  4N2Q A;  4GYY A;  4UQX A;  4ANX A;  3E4B A;  4PH4 B;  4A3T A;  3ZVV A;  3AS4 A;  2X6F A;  3FU6 A;  4ANV A;  4JZY A;  2OV8 A;  2CG3 A;  2PQN A;  4TUU A;  4G25 A;  4WNE A;  3EIJ A;  4XIF A;  5EDS A;  2L6J A;  3CV0 A;  1WM5 A;  4FAD A;  5FZQ A;  3LEW A;  1UW4 B;  3B7R L;  3CST A;  5E75 A;  3IHV A;  3KD7 A;  3G2U A;  1H19 A;  1E7U A;  5J90 A;  3S7J A;  3QWP A;  5BNW A;  3AU5 A;  3LPZ A;  2WXL A;  4J6I A;  3ASG A;  3CK8 A;  2KCV A;  2KCK A;  4U0S A;  4FU3 A;  3CVW A;  3FFL A;  4LRZ A;  3GYZ A;  5AJD A;  3ONL A;  5DIZ A;  5T4Y A;  1GW6 A;  3FDH A;  5T8I A;  2NSZ A;  3MZL B;  2WXQ A;  5KCM A;  3GZ2 A;  3D9P A;  4QFV A;  4CRW A;  3FTW A;  3NF1 A;  2J07 A;  2XGO A;  4HLE A;  3MKQ B;  4Y6W A;  1E8X A;  5G04 C;  4TV3 A;  3ZRH A;  2WXR A;  4XI9 A;  5BPP A;  3QAR A;  4BTA A;  4GZ5 A;  3B7T A;  2FO7 A;  3LS8 A;  4I6J A;  4BT9 A;  3CQC B;  5FQ6 A;  2VTB B;  1X5B A;  1KT1 A;  4J8F A;  4V3I A;  3T5X A;  4NQ0 A;  5FTP A;  2KC7 A;  2FF4 A;  4RG6 A;  5DBK A;  3ZPJ A;  3PH0 C;  4I9C A;  4NAC A;  3SBT B;  3TGO A;  3MKR A;  2RD0 A;  4KZ0 A;  4J8S A;  2L0I A;  4A3V A;  3RK6 A;  4CDN A;  5BV1 A;  4FA6 A;  2NXP A;  3VTX A;  2X6K A;  1JWF A;  2J9Q A;  4I1M A;  1Z3Y A;  3ML9 A;  4EBA A;  3TG5 A;  1H6K A;  4LUN U;  3CIA A;  3AS8 A;  2I1J A;  2UY1 B;  5ARG A;  1H2V C;  3UUX A;  2KZT B;  2PQR A;  2HR2 A;  3GW4 A;  3URZ A;  2WXN A;  3ZYK A;  3UT7 A;  4EZK A;  4ME2 A;  3IV0 A;  3CVV A;  1E7V A;  2WXG A;  4NUR A;  2YQ8 A;  1SZ9 A;  3R7Q A;  4C9B B;  1OUV A;  2WQ6 A;  4B8C B;  3FUM A;  3D9J A;  3JUI A;  4K03 A;  5LCW J;  1JWG A;  3T5V A;  2FI7 A;  2GW1 A;  1QZ2 A;  1IYG A;  4ATG A;  4NRH B;  3QK0 A;  4PUC A;  4KYO B;  4CCA A;  2FBN A;  4DI4 A;  3QAQ A;  4JHJ A;  5G05 J;  2X6H A;  4YVO A;  3LXU X;  3G2S A;  1NA3 A;  2XPY A;  3PRZ A;  4RVB A;  3ZXS A;  4AEZ C;  4ANW A;  3CEQ A;  4Q69 A;  1H2U A;  3PZD A;  2WXM A;  3FTZ A;  5EKQ D;  4F1S A;  3R7R A;  4JL0 A;  3R9A B;  5E76 A;  2WQH A;  3RO2 A;  3QWV A;  4U63 A;  4U04 A;  5KJN A;  3BG0 B;  2QFC A;  3SHF A;  2XRZ A;  4B8A A;  3NZU A;  4AVX A;  3T8M A;  4MS6 A;  1LF8 A;  2QY7 A;  3TXM A;  3LYA A;  1MHQ A;  1KLX A;  2Y4U A;  4U0U A;  4P29 A;  1Z3X A;  3K9I A;  4OYS A;  4AV7 A;  4JXT A;  3CHM A;  4ILI A;  3SNX A;  1HX8 A;  3HYM B;  3VTY A;  4CGV A;  3D9M A;  2IOS A;  2WMN A;  3ESL A;  2E2E A;  4RSY A;  3Q15 A;  3CVQ A;  4A1S A;  2AXU A;  4RG9 A;  3S7D A;  5G04 J;  3FUL A;  1NP7 A;  4KZC A;  4URK A;  4FJZ A;  2X6I A;  4XX5 A;  3OAW A;  5FZS A;  4CDM A;  2I6H A;  4B0Z A;  4HOR A;  3PE3 A;  5BUZ A;  3APC A;  4Y6C A;  3QJZ A;  4ANU A;  2VJ8 A;  4DLO A;  5AIJ A;  4LER A;  4UWK A;  3OXL A;  5AYW D;  4KT6 B;  1XNF A;  3FHE A;  3L08 A;  1U3C A;  3QKY A;  2V0P A;  5FZR A;  2KCL A;  2VGX A;  4WNF A;  3CHO A;  1VDY A;  1TJF A;  4JHR A;  2PL2 A;  2WVI A;  4UI9 J;  3MCX A;  1OWM A;  3U66 A;  4MKT A;  2GGF A;  3FUI A;  4KVM A;  5JJ7 A;  3I5P A;  1HS6 A;  4EZJ A;  2OND A;  3O48 A;  5FQ7 A;  3D9K A;  3MYV A;  4DLQ A;  3LY7 A;  4FHK A;  4XE0 A;  1NZN A;  2OOE A;  2KZT A;  3RRN B;  4W9R A;  4EQF A;  4MRU A;  3LVR E;  3VLF A;  4WWO A;  5FQ4 A;  2PZI A;  2LSV A;  4ACL A;  2VQ2 A;  1HG5 A;  1OWP A;  2Y3A A;  3FY4 A;  4BX8 A;  4BFR A;  3ZIM A;  3HVE B;  4I17 A;  4IRU A;  3QWW A;  2GRL A;  3KS2 A;  3U4T A;  4I6G A;  3LJ3 A;  2XGM A;  3N71 A;  3QNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...