2KC7A

Solution nmr structure of bacteroides fragilis protein bf1650. northeast structural genomics consortium target bfr218
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
MDQLKTIKELINQGDIENALQALEEFLQTEPVGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDILNFYNKDMYNQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of Bacteroides fragilis protein BF1650. Northeast Structural Genomics Consortium target BfR218
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords bfr218_protein
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kc7A00
4JL0A 1E96B 3KAEA 3MV3B 2XGSA 2C0MA 3FP3A 4J8EA 2DBAA 4Y6CA 1NZNA 2WPVA 5EKQD 5BNWA 4G25A 4ABNA 5ARFA 5KJMA 3S7JA 1WAO1 3S7DA 2VGXA 4NQ0A 4WUYA 4KXKB 5LCWC 5HQ8A 3Q5MA 3RO3A 2XEVA 3AS8A 3ASGA 3CKCA 4GYYA 4CGWA 3Q4AB 4N3BA 3QKYA 3WXXA 2IF4A 3LCAA 3LKUA 4HOQA 5DIZA 5A6CA 4N2QA 3UQ3A 3CK7A 2VYIA 3K9IA 2L6JA 3MKRA 5HI7A 3CVQA 2PL2A 1QZ2A 4H7XA 4Y6WA 3RJVA 4B94A 4HOTA 2BUGA 2IFUA 2UY1A 4G24A 4CDRA 2VGYA 4I1AA 4N3AA 4GCOA 5FZQA 3SF4A 3ESKA 3CEQA 5JJ6A 4GA0A 2KC7A 3Q47B 1TJCA 4BT8A 1NA0A 3IEGA 3JYSA 2KCLA 3U4TA 4I9EA 1ZU2A 2UWJG 4YNDA 4U0ZA 5M72A 5D0QD 3CKBA 3FFLA 3LYAA 3S7FA 3Q15A 3S7BA 1ELRA 4H7YA 2VSNA 3Q49B 4JHRA 3BEEA 3LY8A 4UI9J 4WNEA 1OUVA 5G04J 4GZ3A 3VTYA 3PE4A 5JJTA 2Q7FA 3OXFA 5C1DA 2JLBA 3KS2A 3O48A 3QOUA 3QWVA 4GZ6A 4GZ5A 4UI9K 1A17A 4YVQC 5FTPA 4G23A 5AYWD 2P58C 4CGVA 5LCWJ 5BW8C 4I2ZA 1XNFA 3ASDA 1PC2A 1KT0A 3SZ7A 2XGOA 4AY6A 4U0SA 4WNGA 4O6FA 4APOA 3CVLA 4BWRA 2KCKA 3MEKA 2PQNA 3ASHA 4HOUA 4GPKA 3URZA 3CV0A 4KBQA 3QWPA 4GA1A 4UQZA 3U3WA 4HOSA 2MHKA 2C2LA 4KYOB 5EX3A 2HO1A 3ULQA 3ZN3A 5CHEE 3CVNA 5CCMA 5FJYA 2NC9A 4UI9C 1P5QA 4AY5A 1B89A 4N2SA 3MA5A 4GYOA 5KJNA 2VSYA 3CK9A 2ONDA 4BTBA 3CVPA 3ZHEA 1KT1A 3GYZA 4BT9A 2PQRA 4HORA 4U04A 4YVOA 2AVPA 2QFCA 4GYWA 3GW4A 2Y4TA 3N71A 4NRHB 2GW1A 4U0UA 4J8DA 5FZRA 3ASFA 4LEUA 5G05J 2XCCA 4UQYA 3RU0A 3TAXA 3UPVA 3TGOA 4A1SA 4WNFA 1YA0A 3R9AB 3RO2A 3QWWA 3TG5A 4F3VA 3GZ2A 2FEZA 2KCVA 2PZIA 4N5CA 1NA3A 5G05C 4JA7A 3FWVA 1HH8A 1IHGA 2VQ2A 4BTAA 3PE3A 3NF1A 5A7DB 4WNDA 1ELWA 5KJLA 3LPZA 2OOEA 2LSUA 5BT1A 2FBNA 2R5SA 3ZGQA 4EQFA 5KJKA 2YHCA 4GCNA 3E4BA 3OXLA 1KLXA 2FF4A 3TG4A 4N39A 4AIFA 5FT9A 2FO7A 3KD7A 4W9RA 2LNIA 4J8FA 4AM9A 1W3BA 2V5FA 3ZHEB 2E2EA 3CK8A 4XI9A 2XGMA 2FI7A 3HYMB 5CCLA 4I2WA 3RIBA 4RG9A 2XCBA 3QDNA 2C0LA 4GA2A 4ME2A 4N3CA 2XPIA 2YQ8A 4G2VA 4J0UA 4RG6A 4U07A 4UQXA 5JJ7A 1ZBPA 3PDNA 3AS5A 2J9QA 4JA9A 3ZPJA 1WM5A 3LY9A 3ZFWA 1HZ4A 2HR2A 5FZSA 3UUXA 1QQEA 3GZ1A 2I6HA 2Y4UA 4IN3B 3AS4A 4XI0A 1HXIA 2VGXB 2HYZA 1Y8MA 3RKVA 3VTXA 3LY7A 2WQHA 4I9CA 5D0OD 2LSVA 3MV2B 3EDTB 4G26A 5EX0A 5G04C 4I17A 2UY1B 4G1TA 1IYGA 2KATA 4XIFA 1FCHA 3OXGA 5DBKA 5ARGA
chains in the Genus database with same CATH superfamily
3CVWA 4R7LA 3PH0C 4PS3A 4GMJA 4ATZD 2LO6A 3G2WA 4URKA 4WWPA 4Q96A 3TWSA 4J8YA 4RQIA 4UWHA 4BSXA 3HVEA 3D9JA 4Y6WA 2GRPB 2DYRE 5EIDA 4GCOA 3RK6A 4K5AB 1IQRA 2WMNA 3UKUG 2R17C 1HO8A 1ZU2A 3MKQA 2P9LG 4I43A 5FINA 5G04J 2OVBA 3DEPA 5LOZA 3JUIA 4GZ6A 4GZ5A 4GZCA 2Y0BG 1XNFA 1N9AA 3SZ7A 4U0SA 2EINE 2KCKA 3B7RL 4UWFA 3URZA 3DXKG 2KZTA 4AY5A 4GYOA 1LF8A 2WXKA 2WVIA 4HORA 4I6EA 1V54E 2XS8A 2AVPA 4YDWA 2GW1A 4LEUA 4U7EB 3FUFA 2LUHA 1N95A 1JWGA 3EU9A 4J7WA 3IXEA 1BU9A 3B7UX 3CR3A 3IKOB 1U3DA 4RG6A 3CVXA 2X6FA 2AXZA 3OTNA 1WM5A 3ZFWA 4XI0A 4F1SA 2XZTG 3LY7A 5G55A 5CEDB 3TWVA 4GTRA 3P1UA 3JXJA 3L13A 3KEZA 1SZAA 3O4ZA 5A6CA 3K9IA 1H0AA 3FUIA 3SNXA 1MQSA 2J08A 3EHMA 3F6QA 4A3TA 5M72A 3CKBA 3SI5A 2L9BA 1LD8A 1N0RA 1N94A 5AN8A 3MCXA 3Q75A 4GA1A 4AEZC 4EBAG 3CVNA 4KMOA 3NQPA 2OEWA 1OWOA 3SQVA 1LD7A 4ATGA 1S0PA 1Z3YA 1DVPA 5FIOA 1S63A 2XCCA 1YYHA 3TAXA 2RG8A 3GZ2A 4WWNA 5G05C 3E33A 4JHKA 3FWVA 4TRQA 3FTWA 3TG4A 1H2TC 3ISMC 4ILGA 1UN8A 3FUNA 3FUKA 1TR4A 2H6FA 3HYMB 1OT8A 4I2WA 4CYMD 1UN9A 3QDNA 1FPPA 3AS5A 2I1KA 4HQDA 2WXJA 2Y4UA 3VTXA 4HLLA 2WPVA 2B0OE 3L22A 2X6HA 3E37A 3U66A 4CGWA 3TXNA 3QKYA 3LCAA 3GZSA 3LKUA 4GPMA 4OVUA 1NI1A 3D9NA 3ABLE 1H6KA 3R7RA 4X8QA 1DNPA 4OAUC 1G3NB 3Q79A 4CDMA 2UWJG 3HXEA 1OUVA 4GZDA 1O1TA 3KS2A 3VLFA 5AENA 3B13A 4O6FA 1K3ZD 4EBAA 4KBQA 3UT4A 2A5EA 5CCMA 4UI9C 1LTXA 2RKKA 2I9CA 4F1PA 1JUQA 1WG0A 5AIJA 5G05J 3PREA 5AQ9A 2PNNA 4HRLA 3LDZA 1IQUA 4PDXA 3CVVA 3TXMA 1ELWA 1FVFA 3D9OA 3FY4A 4FLHA 2FF4A 3T9KA 4N39A 4DUIA 2V5FA 4AJWA 2J8SD 3FH7A 3L82A 2WM9A 5B3SE 3B95A 4KVMA 3RIBA 2DWZA 3DRAA 3S7BA 2E0IA 1HU3A 5CRVA 2DZOA 2C0MA 4MKTA 3ZEFA 2WXPA 1NZNA 2EQXA 2WQ7A 4A55A 5FQ7A 2P9KG 1YCSB 4EPZA 4FC8A 3ZVVA 3AS8A 2LXLA 2AW6A 1INZA 2P9SG 1QZ2A 4FP7A 5KWDA 2VGYA 3SF4A 5ANLA 3TWTA 1MX4A 4BT8A 4L7TA 2CFZA 5ENPD 2GGFA 1H6PA 3LYAA 3QK0A 4UWKA 1UG3A 3CVYA 3EIJA 3OXFA 3QOUA 4BX8A 3ZIMA 3FULA 4U8YD 4APOA 4EZKA 3HRAA 4EZLA 3J5PA 1TN8A 3UT7A 3T8MA 2H6HA 3ZHEA 4BT9A 1OWNA 4J8SA 2Y69E 4U04A 1D9SA 2P9IG 1AWCB 1FT2A 4FJZA 5FQ8A 4PS8A 3RO2A 1JPLA 5CEAA 3PE3A 1BD8A 3HHMA 1KLXA 4HLEA 5CCLA 3ONLA 3LVRE 4RG9A 4ME2A 5JJ7A 4J0UA 3ONKA 3UM2A 1ZBPA 1EPUA 4BSZB 2EIJE 1QQEA 2EILE 3EHNA 3EDTB 2KATA 4G11A 1E96B 3KAEA 2IY0C 2NXPA 4UWGA 4Y6CA 2NYJA 1H2VC 4GTOA 3JXIA 1HF8A 4N3BA 3CHQA 3UQ3A 1IKND 2VYIA 5E76A 2IQCA 4N3AA 4P29A 3EIQC 3IEGA 5EYLA 5D0QD 3RRUA 2H6GA 2R59A 5ITZF 4ANXA 3Q9NC 3PE4A 3W9FA 3I4GA 2X6JA 1KT0A 2XGOA 2VGEA 2PQNA 1N4QA 4N5QA 3QWPA 5J08A 1BPOA 2HO1A 1IXVA 4BEPA 4N2SA 3S2AA 3CK9A 2PQRA 3UX4A 4M7CA 4AOFA 1OCZE 4L23A 3FTZA 3ZRHA 1N52A 3Q7FA 2BTDA 2V8SE 1OCCE 1BLXB 1TJFA 1DCQA 1JCSA 1TN7A 2WMOA 2KXPC 2IONA 3SO8A 2JABA 4BTAA 1H2UA 2VQ2A 3EU5A 4ANUA 4ZFHA 2R5SA 3ZGQA 5KJKA 3MYVA 3FUDA 3FU5A 3BQOA 5LP0A 4JA9A 3FEYA 2L6BA 3GZ1A 5BV1A 5D2MC 4G26A 5EX0A 5CECB 2F37A 5ARGA 4JL0A 2CG2A 3MV3B 1V55E 2WXNA 4MRUA 3NZSA 4NACA 1E8XA 4KZCA 3SGHA 2MRIA 4LCTA 4EECA 1FT1A 1NP7A 1MZCA 3I3NA 1RW2A 2BUGA 1QBQA 3V79K 4KT6B 4ANWA 5T3RA 3BEEA 4WNEA 3VTYA 1X81A 3CGHA 2Q7FA 2JLBA 5AYWD 5BW8C 5LFAA 3Q78A 1HE8A 1OXJA 3DPYA 4HOSA 3B7TA 2BKKB 2P2CP 1KT1A 1SZ9A 3Q7AA 3AG3E 2R05A 3VLEA 3HDXA 1QYMA 2RFAA 1O1RA 3R9AB 2WXFA 4MLPA 2KBXA 4YDYA 3LJNA 3L54A 2ILRA 2I2OA 2OOEA 4DX7D 2LSUA 3AJIA 4GCNA 4C0EA 2LNIA 4O60A 4K0RA 3KSQA 3UTMA 3SFXA 3NAWA 2XPIA 3IBEA 2LAHA 2J9QA 4IRUA 4HFGA 2J4BA 1IYGA 1Y6IA 4GTPA 4GTSA 3PEUB 4WUYA 3ENEA 3FTSA 2ZU6B 2GRLA 2XEVA 4A1GA 4FLBA 2GRRB 1TEZA 1MHQA 4HOTA 2YNQA 1FVHA 1N0QA 3Q47B 5EN5D 1TJCA 2CFUA 4K5CA 3U4TA 4PUCA 3Q15A 5EYPF 1EYHA 4DI4A 3KEAA 3QWVA 4UI9K 2P58C 5HRYA 4IYPA 3L17A 3NBNB 3ZN3A 1L5JA 3JQ0A 3JUEA 2Y1LE 4BTBA 3DWLG 3P2BA 2CHXA 4OAVB 4L1BA 4EZJA 3MJWA 3B7BA 4G8LA 3LPZA 5JA4D 2FBNA 3L9TA 3QC1A 4F6RD 5KCMA 3ZHEB 3DSXA 2A5UA 5ANRA 4U07A 3V30A 3LVQE 2XENA 2XRZA 3SHFA 5KNHD 2DCPA 3UINC 1JCRA 5CERB 5FQ6A 2WXGA 2VGXA 5AAOA 3RO3A 5DIZA 4J6IA 4TUMA 4HS2A 3U64A 4DX6D 2CG3A 3CVQA 3SFZA 4JXTA 1TNOA 4ANVA 5JJ6A 3FUJA 3UM1A 2F0YA 4PH4B 3FTXA 1O1SA 1TNZA 4GMRA 3ZU7B 3D9KA 2KM4A 3CV0A 4HRMB 4XKBA 3C72A 4DPRA 4A3VA 5B1BE 5FJYA 4Q94A 4L2YA 1KZPA 5AQBA 3ASFA 4WNFA 1YA0A 4JB8P 4AXHA 4F3VA 2WXQA 3UM0A 4AVXA 4TXQA 4HB5A 3ASOE 4HBDA 3NF1A 3ZXPA 2BF0X 2FO1E 4ILHB 3KD7A 5H7PA 3TWXA 3CK8A 1E7UA 3IHYA 2L0IA 4GTMA 5G2NA 2XS1A 4XE0A 3V2XA 1DC2A 3AS4A 2XZDG 3BU8A 4A1SA 3ZUVB 2WQHA 3T8KA 3UI2A 1H6OA 5BUZA 3PUKA 4ABNA 2IJGX 3UT8A 2ZIRA 4NURA 2WXOA 3ULYA 2HE0A 2BKGA 3TJPA 2ZGDA 3AU4A 1UJKA 1KZOA 4H7XA 1A5EA 4LUNU 3EJNA 3FUEA 3LS8A 2OV8A 3CEQA 5EIBE 3W9GA 2GROB 2WXHA 2IO2C 3AG4E 1N54A 2IU1A 1Z3XA 4U8HA 3ASDA 4BESA 3MKQB 2MHKA 3G2SA 4JC8A 4B93B 2XPZA 3ASNE 4AP2A 2RD0A 4DRXE 1Q2ZA 2Y4TA 3N71A 4J8DA 3ZW3A 3RU0A 3QWWA 3Q9UC 4N5CA 4GAAA 3FH5A 3TWQA 1E8ZA 4WNDA 4DLOA 4A63B 3OXLA 3APCA 2FO7A 2F8XK 3TWRA 3PZDA 1WY6A 2V0PA 2YQ8A 4UUCA 3RAUA 5C1DA 2VGXB 4I9CA 4RSYA 5G04C 4JPSA 4G1TA 4FHJA 3FP3A 5BNWA 1U2VG 4HVBA 1E8YA 3D3MA 3EHRA 4JHJA 2LAIA 1K8KG 3ASGA 3AAAC 3MGBA 2ZGGA 2OCCE 3CQGB 4ACLA 1EF1C 2WXRA 2VSXE 5BXOA 5IY5E 3LJ3A 4H7YA 3T5XA 3D9PA 4CZ2D 3SBSA 5JJTA 2R02A 5FWQA 4I2ZA 1PC2A 2ZXWE 4BWRA 2XQ0A 3ASHA 5EILA 3U3WA 4KYOB 2QZAA 3PVLA 1AP7A 4CT0A 4V3IA 2ETCA 1K1AA 4DX1A 3CVPA 3BG1B 2MOWA 3FTVA 4JVSA 3U9WA 3GW4A 2QC9A 3Q73A 2QYJA 4JD2G 2WXIA 2FEZA 2KCVA 2PZIA 5ENQD 2NSZA 3CHRA 3FTYA 5A7DB 4L2LA 2WXMA 4F7AA 3G2TA 4UWLA 3DEOA 2CHZA 1TNBA 3V31A 4J8FA 1MJ0A 2MYOA 3ZPJA 3T5VA 1HZ4A 2R03A 4OVVA 4GMLA 5FZSA 2I6HA 3MV2B 4KVOA 1EDUA 4F53A 2XGSA 4I1OB 3OAWA 4LNBA 3PEVB 3PNTB 5LX8A 3Q5MA 3R7QA 3E34A 4MBGA 4HI8A 4CRWA 3D9HA 2PL2A 1S64A 2EIME 4AV7A 4U63A 3JYSA 1SA4A 4K03A 3APDA 3IHVA 3B7SA 3Q49B 4JHRA 3LY8A 3C98A 3SD5A 4BY6A 3DBSA 4CGVA 2P9PG 4LSZE 3CVLA 3ML8A 4HRNA 4DJAA 3PZ2A 2X6IA 2C2LA 4TV3A 5EX3A 3BUAA 3DSVA 2F8YA 1DCEA 2X3MA 4FU3A 1BI8B 4DX2A 3GYZA 2I1JA 1SW6A 4NRHB 4XX5A 3CQCB 3FDHA 3FU3A 1Z5SC 2B6CA 3ZYMA 5KJLA 1MX6A 2XGMA 4GA2A 4N3CA 1PAQA 4UQXA 1HG5A 3PDNA 2M63A 4FULA 1N4PA 3PS6A 1HS6A 1Y8MA 5J90A 2UY1B 5CMYA 5ENOD 1NL4A 3G2VA 1VDYA 4I1MA 4C9BB 1RZ4A 4FJYA 3KSLA 2ETBA 1O5MA 4DK5A 5AJLA 2HM8A 3WXXA 3IV0A 4HOQA 4C0MA 4GTQA 2GRMA 2BEDA 2GRNB 4CDRA 5FZQA 3HXCA 2KCLA 2XRYA 5CBNA 2V5QC 3L16A 3ESLA 3ULEG 3C3QA 1OWLA 1E7VA 5CMWA 4GTVA 1KPSB 4UQZA 3QAQA 5T8IA 3ULQA 2OEVA 5CHEE 3V2OA 1P5QA 3DPDA 3MA5A 3RSEG 2ZISA 3EHQA 4YVOA 4FA6A 2QFCA 4GYWA 2AXUA 1WDYA 4JEUA 4U8VD 4XKCA 3HXBA 1JCQA 3I4RB 1NA3A 4JA7A 4O1OA 2IOSA 1IHBA 4KZ0A 5BT1A 3CHOA 4EQFA 2L0TB 2YHCA 2XEEA 1NFIE 5AARA 4W9RA 4AM9A 2IO3C 2E2EA 4XI9A 2RFMA 4LERA 3TWWA 3X2QE 3JCKC 5KBAA 2FULA 3RKVA 2HYZA 4U95D 3PZ4A 5D0OD 1HX8A 4ILIA 4XIFA 3LEWA 1N4SA 2VJ8A 3DSUA 5ARFA 3AG2E 4NQ0A 2XEHA 5BPPA 4GYYA 4QFVA 4N2QA 1YMPA 3MKRA 1U3CA 3RJVA 1N11A 2IFUA 4G24A 2IEJA 3ZKJA 3ESKA 4GB9A 3VLDA 2KC7A 2IOLA 2P9UG 4YNDA 2Y3AA 2QY7A 4UI9J 2VSNA 4GZ3A 2J09A 3JQ1A 5FTPA 1A17A 4ACKA 5BV0A 4G23A 3PZ1A 2EIKE 2H6IA 4TXRA 1D8EA 3PUJA 4HOUA 4JW1A 3FU0A 1TYQG 3UIPC 2NC9A 3D9LA 3HIZA 3L08A 2J4DA 4CEMA 4Z68A 3LXUX 4U0UA 2QYUA 5FZRA 4G8KA 5E75A 3RRMB 1IHGA 5JHAA 1XGWA 3QNKA 4AIFA 3QB2A 3CHMA 5EDSA 1QNFA 4FADA 3APFA 4L9PA 5HI7A 4OYSA 2HR2A 4IN3B 1K1BA 3UPVA 4WAFA 4YDOA 2WQ6A 5BXUA 2DYSE 4I17A 4CDNA 1FCHA 3I5PA 3MX3A 1TN6A 4J8EA 4CCAA 2DZNA 4O1PA 1JWFA 5EKQD 2AWIA 4LNUD 3CSTA 1WAO1 4KXKB 1MYOA 5LCWC 4U96D 5KNGA 3Q4AB 4D10C 4B89A 2YINA 3FU6A 2DVWA 3AG1E 2L6JA 3CHSA 2ETAA 5A23A 2DIWA 3CLJA 2VTBA 2J49A 4XZ4A 4TXPA 1TNYA 4U0ZA 5HS0A 3FFLA 4IULA 3S7FA 3PRZA 3CHPA 4YVQC 3SBTB 2V4LA 4MS6A 4GPKA 1OCOE 1SVXA 3C3OA 3WG7E 2JEKA 3L6AA 1MX2A 5AQ7A 4E6HA 2PM7A 3AU5A 3TWUA 3RRNB 5C2YA 5ENNA 5B1AE 3ZYKA 5AQAA 2WXLA 5AJDA 5JMND 1GW6A 4PS7A 4EHMA 5ENSD 1E8WA 4APFA 2AXVA 3ZXSA 4B8AA 2OVFA 4BFRA 3LY9A 3G2UA 3QARA 3UUXA 2A4ZA 4LNGA 4I6GA 3UMVA 4GU5A 1UJJA 3SFYA 2J07A 1OCRE 5DBKA 4ZHBA 4Q69A 2DBAA 4DX5D 4FHKA 3S7JA 3HXDA 3S7DA 4DLQA 3CKCA 5ENRD 3ZYQA 2IF4A 3CK7A 2CHWA 1HFAA 3C3RA 1OY3D 1PY1A 2UY1A 3EUVA 2YHEA 4HI9A 1UOHA 2AJAA 1N4RA 3UKRG 3MZLB 3D9MA 3PZ3A 4RLYA 5CBOA 4E85A 1H19A 3ABME 3FHEA 5LCWJ 4WNGA 3E30A 3MEKA 3DSSA 4GTTA 3R9MA 3UXGA 1D8DA 3CSFA 3HG0D 5KJNA 2ONDA 3DXMG 3FH8A 1Z6TA 2P9NG 4UQYA 2XPYA 2KZTB 4C48B 3SY2A 3TG5A 1OWMA 4XEIG 1HH8A 3J5QB 4B0ZA 3TL5A 5JHBA 3E4BA 3D9IA 5FT9A 1W3BA 3NZUA 4G2VA 3PNLB 1SQMA 4B8CB 3NOCD 1ZB1A 3ML9A 1HG2A 4YDEA 1X5BA 4G25A 4LG6A 5KJMA 3UIOC 5HQ8A 2GRQB 3UM3A 1ELKA 1S70B 5T4YA 1UW4B 2XHEA 3DSTA 2X6KA 4B94A 4I1AA 4BETA 1OWPA 3E32A 4QQIA 4GA0A 1NA0A 4I9EA 3QJZA 2VTBB 1ELRA 4HXIA 5FQ4A 3DSWA 3O48A 2PM6A 3CIAA 4NIKA 4JEHA 4AY6A 3HXFA 3FUHA 4BERA 4K5BA 3ABKE 2LXMA 4CT4A 4DI3A 1B89A 2VSYA 2VSOE 4HNAD 3C5RA 2X38A 4TUUA 4WWOA 4I6JA 3BG0B 1BI7B 3TGOA 2V4HC 3FUMA 3FEXA 1TNUA 2WB2A 3CVUA 3NB2A 3NOGD 4M3OA 5CRUA 3ZYLA 4RVBA 3HVEB 5D66A 2R2LA 4BX9A 2FI7A 4JZYA 4LRZA 2XCBA 5HKPA 2C0LA 1E90A 5ENTD 3FTUA 1SA5A 1HXIA 2LSVA 3ZNGA 3OXGA
chains in the Genus database with same CATH topology
5BUZA 1E96B 3KAEA 4R7LA 3CVWA 2NXPA 4UWGA 3PH0C 4Y6CA 2VJ8A 3PUKA 4PS3A 4GMJA 4ABNA 1H2VC 2IJGX 5ARFA 4NQ0A 3UT8A 2LO6A 3G2WA 4URKA 4WWPA 4Q96A 4NURA 5BPPA 1HF8A 2WXOA 4GYYA 4N3BA 3CHQA 4QFVA 4UWHA 3TJPA 4BSXA 4N2QA 3UQ3A 3HVEA 3AU4A 2VYIA 1UJKA 3D9JA 3MKRA 1U3CA 4Y6WA 4H7XA 3RJVA 2IFUA 4G24A 4LUNU 3EJNA 3FUEA 3LS8A 5E76A 2IQCA 3CVVA 4N3AA 4GCOA 2OV8A 3ESKA 3CEQA 4GB9A 3RK6A 1IQRA 2KC7A 3EIQC 4P29A 3VLDA 2IOLA 2WMNA 3IEGA 2R17C 1HO8A 1ZU2A 4YNDA 3MKQA 2WXHA 5D0QD 3RRUA 2Y3AA 4I43A 2QY7A 2R59A 4ANXA 4UI9J 2VSNA 5G04J 4GZ3A 2OVBA 1N54A 2IU1A 3PE4A 2J09A 3JUIA 5LOZA 4GZ6A 4GZ5A 3JQ1A 4GZCA 5FTPA 3I4GA 1A17A 2X6JA 4ACKA 4G23A 5BV0A 1Z3XA 4U8HA 1XNFA 3ASDA 1KT0A 3SZ7A 2XGOA 4U0SA 3PUJA 2KCKA 2PQNA 4HOUA 4JW1A 3B7RL 4UWFA 3URZA 3QWPA 3MKQB 3FU0A 2MHKA 5J08A 1BPOA 2HO1A 3G2SA 4JC8A 2NC9A 2KZTA 2XPZA 3D9LA 4AY5A 4N2SA 3S2AA 4AP2A 4GYOA 3CK9A 1LF8A 2WXKA 2RD0A 3HIZA 3L08A 2PQRA 2WVIA 3UX4A 2J4DA 4AOFA 4CEMA 4HORA 4I6EA 3LXUX 2AVPA 4L23A 3FTZA 4U0UA 3ZRHA 2Y4TA 3N71A 5FZRA 2GW1A 1N52A 4J8DA 4LEUA 3ZW3A 2BTDA 2V8SE 3FUFA 5E75A 3RU0A 3RRMB 1TJFA 1JWGA 2WMOA 3QWWA 4N5CA 2IONA 3B7UX 3CR3A 3IKOB 1IHGA 1H2UA 2VQ2A 4GAAA 3FH5A 4BTAA 5JHAA 1E8ZA 4WNDA 4ANUA 4DLOA 1XGWA 2R5SA 3QNKA 3ZGQA 5KJKA 3MYVA 3OXLA 3FUDA 3APCA 4AIFA 3FU5A 3QB2A 2FO7A 1U3DA 3CHMA 1QNFA 5EDSA 4FADA 3PZDA 1WY6A 2V0PA 3APFA 4RG6A 5HI7A 2YQ8A 3CVXA 5LP0A 2X6FA 2AXZA 3FEYA 3OTNA 4JA9A 1WM5A 4OYSA 3ZFWA 2HR2A 3GZ1A 4XI0A 4F1SA 4IN3B 5C1DA 5BV1A 2VGXB 3LY7A 4I9CA 4RSYA 4WAFA 5G04C 4G26A 4JPSA 5EX0A 5G55A 3UPVA 4I17A 4G1TA 4CDNA 1FCHA 4FHJA 3I5PA 5ARGA 3MX3A 4JL0A 2CG2A 4J8EA 3MV3B 3FP3A 3P1UA 4CCAA 2WXNA 1JWFA 5EKQD 2AWIA 3L13A 5BNWA 3KEZA 4MRUA 4HVBA 1E8YA 3D3MA 3NZSA 3CSTA 1WAO1 1SZAA 4KXKB 5LCWC 3O4ZA 4JHJA 2LAIA 4NACA 1E8XA 4KZCA 3ASGA 3SGHA 3Q4AB 2MRIA 4D10C 4LCTA 4B89A 5A6CA 2YINA 3MGBA 3FU6A 4EECA 1NP7A 3K9IA 3I3NA 2L6JA 3CHSA 3CQGB 1H0AA 2BUGA 5A23A 2DIWA 3FUIA 3CLJA 3SNXA 1MQSA 2VTBA 2J08A 3EHMA 4ACLA 2J49A 4XZ4A 1EF1C 2WXRA 4A3TA 4KT6B 4ANWA 2VSXE 4U0ZA 5T3RA 5M72A 3CKBA 3SI5A 3FFLA 4IULA 3S7FA 3LJ3A 2L9BA 4H7YA 3T5XA 3BEEA 3PRZA 4WNEA 3VTYA 3CGHA 3D9PA 3SBSA 5JJTA 2Q7FA 2JLBA 3CHPA 4YVQC 5AYWD 5FWQA 5BW8C 4I2ZA 3SBTB 1PC2A 5LFAA 2V4LA 1HE8A 4BWRA 2XQ0A 4MS6A 3ASHA 4GPKA 4HOSA 3MCXA 4GA1A 4AEZC 3B7TA 3U3WA 4KYOB 3PVLA 4EBAG 4CT0A 4V3IA 3CVNA 4KMOA 3NQPA 3CVPA 1KT1A 3BG1B 1OWOA 1SZ9A 4ATGA 2MOWA 3FTVA 2JEKA 1S0PA 3L6AA 4JVSA 3U9WA 1Z3YA 3VLEA 3GW4A 1DVPA 3HDXA 4E6HA 2XCCA 3TAXA 2PM7A 3AU5A 2WXIA 3RRNB 5C2YA 2WQ6A 2RG8A 3R9AB 2WXFA 4MLPA 5ENNA 3GZ2A 4WWNA 2FEZA 2KCVA 2PZIA 3ZYKA 5G05C 2WXLA 4JHKA 5AJDA 3FWVA 1GW6A 3L54A 2NSZA 3CHRA 4TRQA 2ILRA 3FTYA 5A7DB 3FTWA 4L2LA 2I2OA 2OOEA 4PS7A 2LSUA 2WXMA 4GCNA 3TG4A 4F7AA 1H2TC 4ILGA 1UN8A 3G2TA 4UWLA 3FUNA 2CHZA 4C0EA 2LNIA 4J8FA 4K0RA 3FUKA 1E8WA 4APFA 2AXVA 3HYMB 4I2WA 3ZXSA 1UN9A 4B8AA 2OVFA 3QDNA 2XPIA 3IBEA 2LAHA 3ZPJA 3AS5A 2J9QA 4IRUA 4BFRA 2I1KA 3LY9A 3T5VA 1HZ4A 3G2UA 4HFGA 3QARA 4GMLA 4OVVA 2A4ZA 5FZSA 2WXJA 2I6HA 2Y4UA 4I6GA 3UMVA 3UUXA 3VTXA 2J4BA 4GU5A 1UJJA 3MV2B 4KVOA 2J07A 1IYGA 5DBKA 1EDUA 1Y6IA 4Q69A 4F53A 2XGSA 4I1OB 2DBAA 2WPVA 3PEUB 4FHKA 3S7JA 3L22A 3OAWA 3S7DA 3PEVB 3PNTB 3ENEA 4WUYA 3FTSA 2X6HA 2ZU6B 2GRLA 3Q5MA 5LX8A 2XEVA 3R7QA 4A1GA 4DLQA 3U66A 3CKCA 4FLBA 4CGWA 3TXNA 3ZYQA 3QKYA 2IF4A 3LCAA 3GZSA 3LKUA 4OVUA 3CK7A 3D9NA 4CRWA 1H6KA 2CHWA 1HFAA 1TEZA 3R7RA 1MHQA 2PL2A 4HOTA 1PY1A 2YNQA 1FVHA 2UY1A 2YHEA 1DNPA 4AV7A 3Q47B 4U63A 1TJCA 2CFUA 3JYSA 3U4TA 4CDMA 2UWJG 4K03A 3APDA 4PUCA 3IHVA 3Q15A 3B7SA 3MZLB 3Q49B 4JHRA 3LY8A 3D9MA 1OUVA 1EYHA 4GZDA 3C98A 3SD5A 4BY6A 4DI4A 4E85A 3KS2A 3QWVA 3VLFA 4UI9K 3DBSA 1H19A 4CGVA 3FHEA 2P58C 3OXGA 5LCWJ 5AENA 3B13A 4WNGA 4IYPA 4O6FA 3CVLA 3ML8A 4DJAA 3MEKA 4EBAA 3L17A 4KBQA 3UT4A 2X6IA 2C2LA 4TV3A 5EX3A 3ZN3A 1L5JA 5CCMA 3JQ0A 3CSFA 4UI9C 5KJNA 2X3MA 4FU3A 2ONDA 4BTBA 3GYZA 2I1JA 3FH8A 3P2BA 1Z6TA 2I9CA 2CHXA 1JUQA 4NRHB 4L1BA 5AIJA 4XX5A 3CQCB 5G05J 3MJWA 4UQYA 2XPYA 4EZJA 3FDHA 2KZTB 3PREA 3FU3A 3TG5A 3LDZA 1OWMA 1HH8A 4B0ZA 1IQUA 4PDXA 3TXMA 1ELWA 3TL5A 1FVFA 3D9OA 3FY4A 3LPZA 4FLHA 3ZYMA 5JHBA 2FBNA 3E4BA 3QC1A 2FF4A 4N39A 3D9IA 5FT9A 5KCMA 1W3BA 2V5FA 3ZHEB 4AJWA 2A5UA 2XGMA 3FH7A 5ANRA 3NZUA 4GA2A 4N3CA 1PAQA 2WM9A 3PNLB 4G2VA 4U07A 4UQXA 1HG5A 3PDNA 2M63A 4FULA 3LVQE 3PS6A 1SQMA 4B8CB 1HS6A 1Y8MA 4KVMA 2XRZA 3SHFA 3RIBA 3S7BA 5J90A 3ML9A 2UY1B 2E0IA 5CMYA 2DCPA 1HU3A 1HG2A 5KJLA 5FQ6A 3G2VA 1VDYA 4I1MA 2WXGA 2C0MA 1X5BA 4MKTA 3ZEFA 4C9BB 2WXPA 1NZNA 4G25A 2EQXA 2WQ7A 4A55A 5FQ7A 5KJMA 4FJYA 4EPZA 2VGXA 4FC8A 5HQ8A 3ZVVA 4DK5A 3RO3A 3AS8A 5AJLA 2AW6A 1INZA 2HM8A 3WXXA 3IV0A 4HOQA 5DIZA 1ELKA 4J6IA 4C0MA 4HS2A 5T4YA 1UW4B 3U64A 2GRMA 2CG3A 2XHEA 3CVQA 1QZ2A 2X6KA 4FP7A 4B94A 3SFZA 4JXTA 4CDRA 2VGYA 4I1AA 3SF4A 4ANVA 5FZQA 1OWPA 5JJ6A 5ANLA 3FUJA 4GA0A 4BT8A 1NA0A 2KCLA 4PH4B 2XRYA 3FTXA 2CFZA 4I9EA 4L7TA 2GGFA 3QJZA 3LYAA 2VTBB 3L16A 1ELRA 3QK0A 4UWKA 1UG3A 3ESLA 4HXIA 3CVYA 3EIJA 3OXFA 5FQ4A 3O48A 3QOUA 3D9KA 4BX8A 2PM6A 1OWLA 3ZIMA 1E7VA 3CIAA 5CMWA 4JEHA 3FULA 4AY6A 3FUHA 2KM4A 4APOA 4EZKA 3CV0A 3QAQA 4UQZA 4XKBA 4DPRA 5T8IA 4A3VA 3ULQA 5CHEE 4EZLA 4CT4A 5FJYA 3UT7A 4DI3A 1P5QA 3DPDA 3T8MA 1B89A 3MA5A 2VSYA 2VSOE 3ZHEA 4BT9A 4Q94A 1OWNA 4L2YA 4J8SA 4U04A 4YVOA 4FA6A 2QFCA 4GYWA 2X38A 4TUUA 4WWOA 2AXUA 4I6JA 3ASFA 4JEUA 3BG0B 4XKCA 3TGOA 4FJZA 5FQ8A 4PS8A 1YA0A 4WNFA 3RO2A 4AXHA 4F3VA 3FUMA 3I4RB 1JPLA 2WXQA 3FEXA 1NA3A 4AVXA 2WB2A 4JA7A 3CVUA 3PE3A 3NF1A 4M3OA 2IOSA 2BF0X 4KZ0A 3ZYLA 5BT1A 3CHOA 4EQFA 2L0TB 2YHCA 3HHMA 4ILHB 1KLXA 4HLEA 3KD7A 4RVBA 4W9RA 3HVEB 4AM9A 4BX9A 2E2EA 3CK8A 1E7UA 3IHYA 4XI9A 2FI7A 4JZYA 4LERA 3ONLA 5CCLA 3LVRE 4LRZA 2XCBA 2L0IA 4RG9A 2C0LA 1E90A 4ME2A 5JJ7A 4J0UA 3ONKA 3JCKC 1ZBPA 1EPUA 5G2NA 3FTUA 4XE0A 1QQEA 3EHNA 2FULA 3AS4A 3RKVA 1HXIA 2HYZA 4A1SA 2WQHA 5D0OD 2LSVA 3EDTB 1HX8A 4ILIA 2KATA 4XIFA 3LEWA 4G11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JL0 A;  1E96 B;  3KAE A;  3MV3 B;  2XGS A;  2C0M A;  3FP3 A;  4J8E A;  2DBA A;  4Y6C A;  1NZN A;  2WPV A;  5EKQ D;  5BNW A;  4G25 A;  4ABN A;  5ARF A;  5KJM A;  3S7J A;  1WAO 1;  3S7D A;  2VGX A;  4NQ0 A;  4WUY A;  4KXK B;  5LCW C;  5HQ8 A;  3Q5M A;  3RO3 A;  2XEV A;  3AS8 A;  3ASG A;  3CKC A;  4GYY A;  4CGW A;  3Q4A B;  4N3B A;  3QKY A;  3WXX A;  2IF4 A;  3LCA A;  3LKU A;  4HOQ A;  5DIZ A;  5A6C A;  4N2Q A;  3UQ3 A;  3CK7 A;  2VYI A;  3K9I A;  2L6J A;  3MKR A;  5HI7 A;  3CVQ A;  2PL2 A;  1QZ2 A;  4H7X A;  4Y6W A;  3RJV A;  4B94 A;  4HOT A;  2BUG A;  2IFU A;  2UY1 A;  4G24 A;  4CDR A;  2VGY A;  4I1A A;  4N3A A;  4GCO A;  5FZQ A;  3SF4 A;  3ESK A;  3CEQ A;  5JJ6 A;  4GA0 A;  2KC7 A;  3Q47 B;  1TJC A;  4BT8 A;  1NA0 A;  3IEG A;  3JYS A;  2KCL A;  3U4T A;  4I9E A;  1ZU2 A;  2UWJ G;  4YND A;  4U0Z A;  5M72 A;  5D0Q D;  3CKB A;  3FFL A;  3LYA A;  3S7F A;  3Q15 A;  3S7B A;  1ELR A;  4H7Y A;  2VSN A;  3Q49 B;  4JHR A;  3BEE A;  3LY8 A;  4UI9 J;  4WNE A;  1OUV A;  5G04 J;  4GZ3 A;  3VTY A;  3PE4 A;  5JJT A;  2Q7F A;  3OXF A;  5C1D A;  2JLB A;  3KS2 A;  3O48 A;  3QOU A;  3QWV A;  4GZ6 A;  4GZ5 A;  4UI9 K;  1A17 A;  4YVQ C;  5FTP A;  4G23 A;  5AYW D;  2P58 C;  4CGV A;  5LCW J;  5BW8 C;  4I2Z A;  1XNF A;  3ASD A;  1PC2 A;  1KT0 A;  3SZ7 A;  2XGO A;  4AY6 A;  4U0S A;  4WNG A;  4O6F A;  4APO A;  3CVL A;  4BWR A;  2KCK A;  3MEK A;  2PQN A;  3ASH A;  4HOU A;  4GPK A;  3URZ A;  3CV0 A;  4KBQ A;  3QWP A;  4GA1 A;  4UQZ A;  3U3W A;  4HOS A;  2MHK A;  2C2L A;  4KYO B;  5EX3 A;  2HO1 A;  3ULQ A;  3ZN3 A;  5CHE E;  3CVN A;  5CCM A;  5FJY A;  2NC9 A;  4UI9 C;  1P5Q A;  4AY5 A;  1B89 A;  4N2S A;  3MA5 A;  4GYO A;  5KJN A;  2VSY A;  3CK9 A;  2OND A;  4BTB A;  3CVP A;  3ZHE A;  1KT1 A;  3GYZ A;  4BT9 A;  2PQR A;  4HOR A;  4U04 A;  4YVO A;  2AVP A;  2QFC A;  4GYW A;  3GW4 A;  2Y4T A;  3N71 A;  4NRH B;  2GW1 A;  4U0U A;  4J8D A;  5FZR A;  3ASF A;  4LEU A;  5G05 J;  2XCC A;  4UQY A;  3RU0 A;  3TAX A;  3UPV A;  3TGO A;  4A1S A;  4WNF A;  1YA0 A;  3R9A B;  3RO2 A;  3QWW A;  3TG5 A;  4F3V A;  3GZ2 A;  2FEZ A;  2KCV A;  2PZI A;  4N5C A;  1NA3 A;  5G05 C;  4JA7 A;  3FWV A;  1HH8 A;  1IHG A;  2VQ2 A;  4BTA A;  3PE3 A;  3NF1 A;  5A7D B;  4WND A;  1ELW A;  5KJL A;  3LPZ A;  2OOE A;  2LSU A;  5BT1 A;  2FBN A;  2R5S A;  3ZGQ A;  4EQF A;  5KJK A;  2YHC A;  4GCN A;  3E4B A;  3OXL A;  1KLX A;  2FF4 A;  3TG4 A;  4N39 A;  4AIF A;  5FT9 A;  2FO7 A;  3KD7 A;  4W9R A;  2LNI A;  4J8F A;  4AM9 A;  1W3B A;  2V5F A;  3ZHE B;  2E2E A;  3CK8 A;  4XI9 A;  2XGM A;  2FI7 A;  3HYM B;  5CCL A;  4I2W A;  3RIB A;  4RG9 A;  2XCB A;  3QDN A;  2C0L A;  4GA2 A;  4ME2 A;  4N3C A;  2XPI A;  2YQ8 A;  4G2V A;  4J0U A;  4RG6 A;  4U07 A;  4UQX A;  5JJ7 A;  1ZBP A;  3PDN A;  3AS5 A;  2J9Q A;  4JA9 A;  3ZPJ A;  1WM5 A;  3LY9 A;  3ZFW A;  1HZ4 A;  2HR2 A;  5FZS A;  3UUX A;  1QQE A;  3GZ1 A;  2I6H A;  2Y4U A;  4IN3 B;  3AS4 A;  4XI0 A;  1HXI A;  2VGX B;  2HYZ A;  1Y8M A;  3RKV A;  3VTX A;  3LY7 A;  2WQH A;  4I9C A;  5D0O D;  2LSV A;  3MV2 B;  3EDT B;  4G26 A;  5EX0 A;  5G04 C;  4I17 A;  2UY1 B;  4G1T A;  1IYG A;  2KAT A;  4XIF A;  1FCH A;  3OXG A;  5DBK A;  5ARG A; 
#chains in the Genus database with same CATH topology
 3CVW A;  4R7L A;  3PH0 C;  4PS3 A;  4GMJ A;  4ATZ D;  2LO6 A;  3G2W A;  4URK A;  4WWP A;  4Q96 A;  3TWS A;  4J8Y A;  4RQI A;  4UWH A;  4BSX A;  3HVE A;  3D9J A;  4Y6W A;  2GRP B;  2DYR E;  5EID A;  4GCO A;  3RK6 A;  4K5A B;  1IQR A;  2WMN A;  3UKU G;  2R17 C;  1HO8 A;  1ZU2 A;  3MKQ A;  2P9L G;  4I43 A;  5FIN A;  5G04 J;  2OVB A;  3DEP A;  5LOZ A;  3JUI A;  4GZ6 A;  4GZ5 A;  4GZC A;  2Y0B G;  1XNF A;  1N9A A;  3SZ7 A;  4U0S A;  2EIN E;  2KCK A;  3B7R L;  4UWF A;  3URZ A;  3DXK G;  2KZT A;  4AY5 A;  4GYO A;  1LF8 A;  2WXK A;  2WVI A;  4HOR A;  4I6E A;  1V54 E;  2XS8 A;  2AVP A;  4YDW A;  2GW1 A;  4LEU A;  4U7E B;  3FUF A;  2LUH A;  1N95 A;  1JWG A;  3EU9 A;  4J7W A;  3IXE A;  1BU9 A;  3B7U X;  3CR3 A;  3IKO B;  1U3D A;  4RG6 A;  3CVX A;  2X6F A;  2AXZ A;  3OTN A;  1WM5 A;  3ZFW A;  4XI0 A;  4F1S A;  2XZT G;  3LY7 A;  5G55 A;  5CED B;  3TWV A;  4GTR A;  3P1U A;  3JXJ A;  3L13 A;  3KEZ A;  1SZA A;  3O4Z A;  5A6C A;  3K9I A;  1H0A A;  3FUI A;  3SNX A;  1MQS A;  2J08 A;  3EHM A;  3F6Q A;  4A3T A;  5M72 A;  3CKB A;  3SI5 A;  2L9B A;  1LD8 A;  1N0R A;  1N94 A;  5AN8 A;  3MCX A;  3Q75 A;  4GA1 A;  4AEZ C;  4EBA G;  3CVN A;  4KMO A;  3NQP A;  2OEW A;  1OWO A;  3SQV A;  1LD7 A;  4ATG A;  1S0P A;  1Z3Y A;  1DVP A;  5FIO A;  1S63 A;  2XCC A;  1YYH A;  3TAX A;  2RG8 A;  3GZ2 A;  4WWN A;  5G05 C;  3E33 A;  4JHK A;  3FWV A;  4TRQ A;  3FTW A;  3TG4 A;  1H2T C;  3ISM C;  4ILG A;  1UN8 A;  3FUN A;  3FUK A;  1TR4 A;  2H6F A;  3HYM B;  1OT8 A;  4I2W A;  4CYM D;  1UN9 A;  3QDN A;  1FPP A;  3AS5 A;  2I1K A;  4HQD A;  2WXJ A;  2Y4U A;  3VTX A;  4HLL A;  2WPV A;  2B0O E;  3L22 A;  2X6H A;  3E37 A;  3U66 A;  4CGW A;  3TXN A;  3QKY A;  3LCA A;  3GZS A;  3LKU A;  4GPM A;  4OVU A;  1NI1 A;  3D9N A;  3ABL E;  1H6K A;  3R7R A;  4X8Q A;  1DNP A;  4OAU C;  1G3N B;  3Q79 A;  4CDM A;  2UWJ G;  3HXE A;  1OUV A;  4GZD A;  1O1T A;  3KS2 A;  3VLF A;  5AEN A;  3B13 A;  4O6F A;  1K3Z D;  4EBA A;  4KBQ A;  3UT4 A;  2A5E A;  5CCM A;  4UI9 C;  1LTX A;  2RKK A;  2I9C A;  4F1P A;  1JUQ A;  1WG0 A;  5AIJ A;  5G05 J;  3PRE A;  5AQ9 A;  2PNN A;  4HRL A;  3LDZ A;  1IQU A;  4PDX A;  3CVV A;  3TXM A;  1ELW A;  1FVF A;  3D9O A;  3FY4 A;  4FLH A;  2FF4 A;  3T9K A;  4N39 A;  4DUI A;  2V5F A;  4AJW A;  2J8S D;  3FH7 A;  3L82 A;  2WM9 A;  5B3S E;  3B95 A;  4KVM A;  3RIB A;  2DWZ A;  3DRA A;  3S7B A;  2E0I A;  1HU3 A;  5CRV A;  2DZO A;  2C0M A;  4MKT A;  3ZEF A;  2WXP A;  1NZN A;  2EQX A;  2WQ7 A;  4A55 A;  5FQ7 A;  2P9K G;  1YCS B;  4EPZ A;  4FC8 A;  3ZVV A;  3AS8 A;  2LXL A;  2AW6 A;  1INZ A;  2P9S G;  1QZ2 A;  4FP7 A;  5KWD A;  2VGY A;  3SF4 A;  5ANL A;  3TWT A;  1MX4 A;  4BT8 A;  4L7T A;  2CFZ A;  5ENP D;  2GGF A;  1H6P A;  3LYA A;  3QK0 A;  4UWK A;  1UG3 A;  3CVY A;  3EIJ A;  3OXF A;  3QOU A;  4BX8 A;  3ZIM A;  3FUL A;  4U8Y D;  4APO A;  4EZK A;  3HRA A;  4EZL A;  3J5P A;  1TN8 A;  3UT7 A;  3T8M A;  2H6H A;  3ZHE A;  4BT9 A;  1OWN A;  4J8S A;  2Y69 E;  4U04 A;  1D9S A;  2P9I G;  1AWC B;  1FT2 A;  4FJZ A;  5FQ8 A;  4PS8 A;  3RO2 A;  1JPL A;  5CEA A;  3PE3 A;  1BD8 A;  3HHM A;  1KLX A;  4HLE A;  5CCL A;  3ONL A;  3LVR E;  4RG9 A;  4ME2 A;  5JJ7 A;  4J0U A;  3ONK A;  3UM2 A;  1ZBP A;  1EPU A;  4BSZ B;  2EIJ E;  1QQE A;  2EIL E;  3EHN A;  3EDT B;  2KAT A;  4G11 A;  1E96 B;  3KAE A;  2IY0 C;  2NXP A;  4UWG A;  4Y6C A;  2NYJ A;  1H2V C;  4GTO A;  3JXI A;  1HF8 A;  4N3B A;  3CHQ A;  3UQ3 A;  1IKN D;  2VYI A;  5E76 A;  2IQC A;  4N3A A;  4P29 A;  3EIQ C;  3IEG A;  5EYL A;  5D0Q D;  3RRU A;  2H6G A;  2R59 A;  5ITZ F;  4ANX A;  3Q9N C;  3PE4 A;  3W9F A;  3I4G A;  2X6J A;  1KT0 A;  2XGO A;  2VGE A;  2PQN A;  1N4Q A;  4N5Q A;  3QWP A;  5J08 A;  1BPO A;  2HO1 A;  1IXV A;  4BEP A;  4N2S A;  3S2A A;  3CK9 A;  2PQR A;  3UX4 A;  4M7C A;  4AOF A;  1OCZ E;  4L23 A;  3FTZ A;  3ZRH A;  1N52 A;  3Q7F A;  2BTD A;  2V8S E;  1OCC E;  1BLX B;  1TJF A;  1DCQ A;  1JCS A;  1TN7 A;  2WMO A;  2KXP C;  2ION A;  3SO8 A;  2JAB A;  4BTA A;  1H2U A;  2VQ2 A;  3EU5 A;  4ANU A;  4ZFH A;  2R5S A;  3ZGQ A;  5KJK A;  3MYV A;  3FUD A;  3FU5 A;  3BQO A;  5LP0 A;  4JA9 A;  3FEY A;  2L6B A;  3GZ1 A;  5BV1 A;  5D2M C;  4G26 A;  5EX0 A;  5CEC B;  2F37 A;  5ARG A;  4JL0 A;  2CG2 A;  3MV3 B;  1V55 E;  2WXN A;  4MRU A;  3NZS A;  4NAC A;  1E8X A;  4KZC A;  3SGH A;  2MRI A;  4LCT A;  4EEC A;  1FT1 A;  1NP7 A;  1MZC A;  3I3N A;  1RW2 A;  2BUG A;  1QBQ A;  3V79 K;  4KT6 B;  4ANW A;  5T3R A;  3BEE A;  4WNE A;  3VTY A;  1X81 A;  3CGH A;  2Q7F A;  2JLB A;  5AYW D;  5BW8 C;  5LFA A;  3Q78 A;  1HE8 A;  1OXJ A;  3DPY A;  4HOS A;  3B7T A;  2BKK B;  2P2C P;  1KT1 A;  1SZ9 A;  3Q7A A;  3AG3 E;  2R05 A;  3VLE A;  3HDX A;  1QYM A;  2RFA A;  1O1R A;  3R9A B;  2WXF A;  4MLP A;  2KBX A;  4YDY A;  3LJN A;  3L54 A;  2ILR A;  2I2O A;  2OOE A;  4DX7 D;  2LSU A;  3AJI A;  4GCN A;  4C0E A;  2LNI A;  4O60 A;  4K0R A;  3KSQ A;  3UTM A;  3SFX A;  3NAW A;  2XPI A;  3IBE A;  2LAH A;  2J9Q A;  4IRU A;  4HFG A;  2J4B A;  1IYG A;  1Y6I A;  4GTP A;  4GTS A;  3PEU B;  4WUY A;  3ENE A;  3FTS A;  2ZU6 B;  2GRL A;  2XEV A;  4A1G A;  4FLB A;  2GRR B;  1TEZ A;  1MHQ A;  4HOT A;  2YNQ A;  1FVH A;  1N0Q A;  3Q47 B;  5EN5 D;  1TJC A;  2CFU A;  4K5C A;  3U4T A;  4PUC A;  3Q15 A;  5EYP F;  1EYH A;  4DI4 A;  3KEA A;  3QWV A;  4UI9 K;  2P58 C;  5HRY A;  4IYP A;  3L17 A;  3NBN B;  3ZN3 A;  1L5J A;  3JQ0 A;  3JUE A;  2Y1L E;  4BTB A;  3DWL G;  3P2B A;  2CHX A;  4OAV B;  4L1B A;  4EZJ A;  3MJW A;  3B7B A;  4G8L A;  3LPZ A;  5JA4 D;  2FBN A;  3L9T A;  3QC1 A;  4F6R D;  5KCM A;  3ZHE B;  3DSX A;  2A5U A;  5ANR A;  4U07 A;  3V30 A;  3LVQ E;  2XEN A;  2XRZ A;  3SHF A;  5KNH D;  2DCP A;  3UIN C;  1JCR A;  5CER B;  5FQ6 A;  2WXG A;  2VGX A;  5AAO A;  3RO3 A;  5DIZ A;  4J6I A;  4TUM A;  4HS2 A;  3U64 A;  4DX6 D;  2CG3 A;  3CVQ A;  3SFZ A;  4JXT A;  1TNO A;  4ANV A;  5JJ6 A;  3FUJ A;  3UM1 A;  2F0Y A;  4PH4 B;  3FTX A;  1O1S A;  1TNZ A;  4GMR A;  3ZU7 B;  3D9K A;  2KM4 A;  3CV0 A;  4HRM B;  4XKB A;  3C72 A;  4DPR A;  4A3V A;  5B1B E;  5FJY A;  4Q94 A;  4L2Y A;  1KZP A;  5AQB A;  3ASF A;  4WNF A;  1YA0 A;  4JB8 P;  4AXH A;  4F3V A;  2WXQ A;  3UM0 A;  4AVX A;  4TXQ A;  4HB5 A;  3ASO E;  4HBD A;  3NF1 A;  3ZXP A;  2BF0 X;  2FO1 E;  4ILH B;  3KD7 A;  5H7P A;  3TWX A;  3CK8 A;  1E7U A;  3IHY A;  2L0I A;  4GTM A;  5G2N A;  2XS1 A;  4XE0 A;  3V2X A;  1DC2 A;  3AS4 A;  2XZD G;  3BU8 A;  4A1S A;  3ZUV B;  2WQH A;  3T8K A;  3UI2 A;  1H6O A;  5BUZ A;  3PUK A;  4ABN A;  2IJG X;  3UT8 A;  2ZIR A;  4NUR A;  2WXO A;  3ULY A;  2HE0 A;  2BKG A;  3TJP A;  2ZGD A;  3AU4 A;  1UJK A;  1KZO A;  4H7X A;  1A5E A;  4LUN U;  3EJN A;  3FUE A;  3LS8 A;  2OV8 A;  3CEQ A;  5EIB E;  3W9G A;  2GRO B;  2WXH A;  2IO2 C;  3AG4 E;  1N54 A;  2IU1 A;  1Z3X A;  4U8H A;  3ASD A;  4BES A;  3MKQ B;  2MHK A;  3G2S A;  4JC8 A;  4B93 B;  2XPZ A;  3ASN E;  4AP2 A;  2RD0 A;  4DRX E;  1Q2Z A;  2Y4T A;  3N71 A;  4J8D A;  3ZW3 A;  3RU0 A;  3QWW A;  3Q9U C;  4N5C A;  4GAA A;  3FH5 A;  3TWQ A;  1E8Z A;  4WND A;  4DLO A;  4A63 B;  3OXL A;  3APC A;  2FO7 A;  2F8X K;  3TWR A;  3PZD A;  1WY6 A;  2V0P A;  2YQ8 A;  4UUC A;  3RAU A;  5C1D A;  2VGX B;  4I9C A;  4RSY A;  5G04 C;  4JPS A;  4G1T A;  4FHJ A;  3FP3 A;  5BNW A;  1U2V G;  4HVB A;  1E8Y A;  3D3M A;  3EHR A;  4JHJ A;  2LAI A;  1K8K G;  3ASG A;  3AAA C;  3MGB A;  2ZGG A;  2OCC E;  3CQG B;  4ACL A;  1EF1 C;  2WXR A;  2VSX E;  5BXO A;  5IY5 E;  3LJ3 A;  4H7Y A;  3T5X A;  3D9P A;  4CZ2 D;  3SBS A;  5JJT A;  2R02 A;  5FWQ A;  4I2Z A;  1PC2 A;  2ZXW E;  4BWR A;  2XQ0 A;  3ASH A;  5EIL A;  3U3W A;  4KYO B;  2QZA A;  3PVL A;  1AP7 A;  4CT0 A;  4V3I A;  2ETC A;  1K1A A;  4DX1 A;  3CVP A;  3BG1 B;  2MOW A;  3FTV A;  4JVS A;  3U9W A;  3GW4 A;  2QC9 A;  3Q73 A;  2QYJ A;  4JD2 G;  2WXI A;  2FEZ A;  2KCV A;  2PZI A;  5ENQ D;  2NSZ A;  3CHR A;  3FTY A;  5A7D B;  4L2L A;  2WXM A;  4F7A A;  3G2T A;  4UWL A;  3DEO A;  2CHZ A;  1TNB A;  3V31 A;  4J8F A;  1MJ0 A;  2MYO A;  3ZPJ A;  3T5V A;  1HZ4 A;  2R03 A;  4OVV A;  4GML A;  5FZS A;  2I6H A;  3MV2 B;  4KVO A;  1EDU A;  4F53 A;  2XGS A;  4I1O B;  3OAW A;  4LNB A;  3PEV B;  3PNT B;  5LX8 A;  3Q5M A;  3R7Q A;  3E34 A;  4MBG A;  4HI8 A;  4CRW A;  3D9H A;  2PL2 A;  1S64 A;  2EIM E;  4AV7 A;  4U63 A;  3JYS A;  1SA4 A;  4K03 A;  3APD A;  3IHV A;  3B7S A;  3Q49 B;  4JHR A;  3LY8 A;  3C98 A;  3SD5 A;  4BY6 A;  3DBS A;  4CGV A;  2P9P G;  4LSZ E;  3CVL A;  3ML8 A;  4HRN A;  4DJA A;  3PZ2 A;  2X6I A;  2C2L A;  4TV3 A;  5EX3 A;  3BUA A;  3DSV A;  2F8Y A;  1DCE A;  2X3M A;  4FU3 A;  1BI8 B;  4DX2 A;  3GYZ A;  2I1J A;  1SW6 A;  4NRH B;  4XX5 A;  3CQC B;  3FDH A;  3FU3 A;  1Z5S C;  2B6C A;  3ZYM A;  5KJL A;  1MX6 A;  2XGM A;  4GA2 A;  4N3C A;  1PAQ A;  4UQX A;  1HG5 A;  3PDN A;  2M63 A;  4FUL A;  1N4P A;  3PS6 A;  1HS6 A;  1Y8M A;  5J90 A;  2UY1 B;  5CMY A;  5ENO D;  1NL4 A;  3G2V A;  1VDY A;  4I1M A;  4C9B B;  1RZ4 A;  4FJY A;  3KSL A;  2ETB A;  1O5M A;  4DK5 A;  5AJL A;  2HM8 A;  3WXX A;  3IV0 A;  4HOQ A;  4C0M A;  4GTQ A;  2GRM A;  2BED A;  2GRN B;  4CDR A;  5FZQ A;  3HXC A;  2KCL A;  2XRY A;  5CBN A;  2V5Q C;  3L16 A;  3ESL A;  3ULE G;  3C3Q A;  1OWL A;  1E7V A;  5CMW A;  4GTV A;  1KPS B;  4UQZ A;  3QAQ A;  5T8I A;  3ULQ A;  2OEV A;  5CHE E;  3V2O A;  1P5Q A;  3DPD A;  3MA5 A;  3RSE G;  2ZIS A;  3EHQ A;  4YVO A;  4FA6 A;  2QFC A;  4GYW A;  2AXU A;  1WDY A;  4JEU A;  4U8V D;  4XKC A;  3HXB A;  1JCQ A;  3I4R B;  1NA3 A;  4JA7 A;  4O1O A;  2IOS A;  1IHB A;  4KZ0 A;  5BT1 A;  3CHO A;  4EQF A;  2L0T B;  2YHC A;  2XEE A;  1NFI E;  5AAR A;  4W9R A;  4AM9 A;  2IO3 C;  2E2E A;  4XI9 A;  2RFM A;  4LER A;  3TWW A;  3X2Q E;  3JCK C;  5KBA A;  2FUL A;  3RKV A;  2HYZ A;  4U95 D;  3PZ4 A;  5D0O D;  1HX8 A;  4ILI A;  4XIF A;  3LEW A;  1N4S A;  2VJ8 A;  3DSU A;  5ARF A;  3AG2 E;  4NQ0 A;  2XEH A;  5BPP A;  4GYY A;  4QFV A;  4N2Q A;  1YMP A;  3MKR A;  1U3C A;  3RJV A;  1N11 A;  2IFU A;  4G24 A;  2IEJ A;  3ZKJ A;  3ESK A;  4GB9 A;  3VLD A;  2KC7 A;  2IOL A;  2P9U G;  4YND A;  2Y3A A;  2QY7 A;  4UI9 J;  2VSN A;  4GZ3 A;  2J09 A;  3JQ1 A;  5FTP A;  1A17 A;  4ACK A;  5BV0 A;  4G23 A;  3PZ1 A;  2EIK E;  2H6I A;  4TXR A;  1D8E A;  3PUJ A;  4HOU A;  4JW1 A;  3FU0 A;  1TYQ G;  3UIP C;  2NC9 A;  3D9L A;  3HIZ A;  3L08 A;  2J4D A;  4CEM A;  4Z68 A;  3LXU X;  4U0U A;  2QYU A;  5FZR A;  4G8K A;  5E75 A;  3RRM B;  1IHG A;  5JHA A;  1XGW A;  3QNK A;  4AIF A;  3QB2 A;  3CHM A;  5EDS A;  1QNF A;  4FAD A;  3APF A;  4L9P A;  5HI7 A;  4OYS A;  2HR2 A;  4IN3 B;  1K1B A;  3UPV A;  4WAF A;  4YDO A;  2WQ6 A;  5BXU A;  2DYS E;  4I17 A;  4CDN A;  1FCH A;  3I5P A;  3MX3 A;  1TN6 A;  4J8E A;  4CCA A;  2DZN A;  4O1P A;  1JWF A;  5EKQ D;  2AWI A;  4LNU D;  3CST A;  1WAO 1;  4KXK B;  1MYO A;  5LCW C;  4U96 D;  5KNG A;  3Q4A B;  4D10 C;  4B89 A;  2YIN A;  3FU6 A;  2DVW A;  3AG1 E;  2L6J A;  3CHS A;  2ETA A;  5A23 A;  2DIW A;  3CLJ A;  2VTB A;  2J49 A;  4XZ4 A;  4TXP A;  1TNY A;  4U0Z A;  5HS0 A;  3FFL A;  4IUL A;  3S7F A;  3PRZ A;  3CHP A;  4YVQ C;  3SBT B;  2V4L A;  4MS6 A;  4GPK A;  1OCO E;  1SVX A;  3C3O A;  3WG7 E;  2JEK A;  3L6A A;  1MX2 A;  5AQ7 A;  4E6H A;  2PM7 A;  3AU5 A;  3TWU A;  3RRN B;  5C2Y A;  5ENN A;  5B1A E;  3ZYK A;  5AQA A;  2WXL A;  5AJD A;  5JMN D;  1GW6 A;  4PS7 A;  4EHM A;  5ENS D;  1E8W A;  4APF A;  2AXV A;  3ZXS A;  4B8A A;  2OVF A;  4BFR A;  3LY9 A;  3G2U A;  3QAR A;  3UUX A;  2A4Z A;  4LNG A;  4I6G A;  3UMV A;  4GU5 A;  1UJJ A;  3SFY A;  2J07 A;  1OCR E;  5DBK A;  4ZHB A;  4Q69 A;  2DBA A;  4DX5 D;  4FHK A;  3S7J A;  3HXD A;  3S7D A;  4DLQ A;  3CKC A;  5ENR D;  3ZYQ A;  2IF4 A;  3CK7 A;  2CHW A;  1HFA A;  3C3R A;  1OY3 D;  1PY1 A;  2UY1 A;  3EUV A;  2YHE A;  4HI9 A;  1UOH A;  2AJA A;  1N4R A;  3UKR G;  3MZL B;  3D9M A;  3PZ3 A;  4RLY A;  5CBO A;  4E85 A;  1H19 A;  3ABM E;  3FHE A;  5LCW J;  4WNG A;  3E30 A;  3MEK A;  3DSS A;  4GTT A;  3R9M A;  3UXG A;  1D8D A;  3CSF A;  3HG0 D;  5KJN A;  2OND A;  3DXM G;  3FH8 A;  1Z6T A;  2P9N G;  4UQY A;  2XPY A;  2KZT B;  4C48 B;  3SY2 A;  3TG5 A;  1OWM A;  4XEI G;  1HH8 A;  3J5Q B;  4B0Z A;  3TL5 A;  5JHB A;  3E4B A;  3D9I A;  5FT9 A;  1W3B A;  3NZU A;  4G2V A;  3PNL B;  1SQM A;  4B8C B;  3NOC D;  1ZB1 A;  3ML9 A;  1HG2 A;  4YDE A;  1X5B A;  4G25 A;  4LG6 A;  5KJM A;  3UIO C;  5HQ8 A;  2GRQ B;  3UM3 A;  1ELK A;  1S70 B;  5T4Y A;  1UW4 B;  2XHE A;  3DST A;  2X6K A;  4B94 A;  4I1A A;  4BET A;  1OWP A;  3E32 A;  4QQI A;  4GA0 A;  1NA0 A;  4I9E A;  3QJZ A;  2VTB B;  1ELR A;  4HXI A;  5FQ4 A;  3DSW A;  3O48 A;  2PM6 A;  3CIA A;  4NIK A;  4JEH A;  4AY6 A;  3HXF A;  3FUH A;  4BER A;  4K5B A;  3ABK E;  2LXM A;  4CT4 A;  4DI3 A;  1B89 A;  2VSY A;  2VSO E;  4HNA D;  3C5R A;  2X38 A;  4TUU A;  4WWO A;  4I6J A;  3BG0 B;  1BI7 B;  3TGO A;  2V4H C;  3FUM A;  3FEX A;  1TNU A;  2WB2 A;  3CVU A;  3NB2 A;  3NOG D;  4M3O A;  5CRU A;  3ZYL A;  4RVB A;  3HVE B;  5D66 A;  2R2L A;  4BX9 A;  2FI7 A;  4JZY A;  4LRZ A;  2XCB A;  5HKP A;  2C0L A;  1E90 A;  5ENT D;  3FTU A;  1SA5 A;  1HXI A;  2LSV A;  3ZNG A;  3OXG A; 
#chains in the Genus database with same CATH homology
 5BUZ A;  1E96 B;  3KAE A;  4R7L A;  3CVW A;  2NXP A;  4UWG A;  3PH0 C;  4Y6C A;  2VJ8 A;  3PUK A;  4PS3 A;  4GMJ A;  4ABN A;  1H2V C;  2IJG X;  5ARF A;  4NQ0 A;  3UT8 A;  2LO6 A;  3G2W A;  4URK A;  4WWP A;  4Q96 A;  4NUR A;  5BPP A;  1HF8 A;  2WXO A;  4GYY A;  4N3B A;  3CHQ A;  4QFV A;  4UWH A;  3TJP A;  4BSX A;  4N2Q A;  3UQ3 A;  3HVE A;  3AU4 A;  2VYI A;  1UJK A;  3D9J A;  3MKR A;  1U3C A;  4Y6W A;  4H7X A;  3RJV A;  2IFU A;  4G24 A;  4LUN U;  3EJN A;  3FUE A;  3LS8 A;  5E76 A;  2IQC A;  3CVV A;  4N3A A;  4GCO A;  2OV8 A;  3ESK A;  3CEQ A;  4GB9 A;  3RK6 A;  1IQR A;  2KC7 A;  3EIQ C;  4P29 A;  3VLD A;  2IOL A;  2WMN A;  3IEG A;  2R17 C;  1HO8 A;  1ZU2 A;  4YND A;  3MKQ A;  2WXH A;  5D0Q D;  3RRU A;  2Y3A A;  4I43 A;  2QY7 A;  2R59 A;  4ANX A;  4UI9 J;  2VSN A;  5G04 J;  4GZ3 A;  2OVB A;  1N54 A;  2IU1 A;  3PE4 A;  2J09 A;  3JUI A;  5LOZ A;  4GZ6 A;  4GZ5 A;  3JQ1 A;  4GZC A;  5FTP A;  3I4G A;  1A17 A;  2X6J A;  4ACK A;  4G23 A;  5BV0 A;  1Z3X A;  4U8H A;  1XNF A;  3ASD A;  1KT0 A;  3SZ7 A;  2XGO A;  4U0S A;  3PUJ A;  2KCK A;  2PQN A;  4HOU A;  4JW1 A;  3B7R L;  4UWF A;  3URZ A;  3QWP A;  3MKQ B;  3FU0 A;  2MHK A;  5J08 A;  1BPO A;  2HO1 A;  3G2S A;  4JC8 A;  2NC9 A;  2KZT A;  2XPZ A;  3D9L A;  4AY5 A;  4N2S A;  3S2A A;  4AP2 A;  4GYO A;  3CK9 A;  1LF8 A;  2WXK A;  2RD0 A;  3HIZ A;  3L08 A;  2PQR A;  2WVI A;  3UX4 A;  2J4D A;  4AOF A;  4CEM A;  4HOR A;  4I6E A;  3LXU X;  2AVP A;  4L23 A;  3FTZ A;  4U0U A;  3ZRH A;  2Y4T A;  3N71 A;  5FZR A;  2GW1 A;  1N52 A;  4J8D A;  4LEU A;  3ZW3 A;  2BTD A;  2V8S E;  3FUF A;  5E75 A;  3RU0 A;  3RRM B;  1TJF A;  1JWG A;  2WMO A;  3QWW A;  4N5C A;  2ION A;  3B7U X;  3CR3 A;  3IKO B;  1IHG A;  1H2U A;  2VQ2 A;  4GAA A;  3FH5 A;  4BTA A;  5JHA A;  1E8Z A;  4WND A;  4ANU A;  4DLO A;  1XGW A;  2R5S A;  3QNK A;  3ZGQ A;  5KJK A;  3MYV A;  3OXL A;  3FUD A;  3APC A;  4AIF A;  3FU5 A;  3QB2 A;  2FO7 A;  1U3D A;  3CHM A;  1QNF A;  5EDS A;  4FAD A;  3PZD A;  1WY6 A;  2V0P A;  3APF A;  4RG6 A;  5HI7 A;  2YQ8 A;  3CVX A;  5LP0 A;  2X6F A;  2AXZ A;  3FEY A;  3OTN A;  4JA9 A;  1WM5 A;  4OYS A;  3ZFW A;  2HR2 A;  3GZ1 A;  4XI0 A;  4F1S A;  4IN3 B;  5C1D A;  5BV1 A;  2VGX B;  3LY7 A;  4I9C A;  4RSY A;  4WAF A;  5G04 C;  4G26 A;  4JPS A;  5EX0 A;  5G55 A;  3UPV A;  4I17 A;  4G1T A;  4CDN A;  1FCH A;  4FHJ A;  3I5P A;  5ARG A;  3MX3 A;  4JL0 A;  2CG2 A;  4J8E A;  3MV3 B;  3FP3 A;  3P1U A;  4CCA A;  2WXN A;  1JWF A;  5EKQ D;  2AWI A;  3L13 A;  5BNW A;  3KEZ A;  4MRU A;  4HVB A;  1E8Y A;  3D3M A;  3NZS A;  3CST A;  1WAO 1;  1SZA A;  4KXK B;  5LCW C;  3O4Z A;  4JHJ A;  2LAI A;  4NAC A;  1E8X A;  4KZC A;  3ASG A;  3SGH A;  3Q4A B;  2MRI A;  4D10 C;  4LCT A;  4B89 A;  5A6C A;  2YIN A;  3MGB A;  3FU6 A;  4EEC A;  1NP7 A;  3K9I A;  3I3N A;  2L6J A;  3CHS A;  3CQG B;  1H0A A;  2BUG A;  5A23 A;  2DIW A;  3FUI A;  3CLJ A;  3SNX A;  1MQS A;  2VTB A;  2J08 A;  3EHM A;  4ACL A;  2J49 A;  4XZ4 A;  1EF1 C;  2WXR A;  4A3T A;  4KT6 B;  4ANW A;  2VSX E;  4U0Z A;  5T3R A;  5M72 A;  3CKB A;  3SI5 A;  3FFL A;  4IUL A;  3S7F A;  3LJ3 A;  2L9B A;  4H7Y A;  3T5X A;  3BEE A;  3PRZ A;  4WNE A;  3VTY A;  3CGH A;  3D9P A;  3SBS A;  5JJT A;  2Q7F A;  2JLB A;  3CHP A;  4YVQ C;  5AYW D;  5FWQ A;  5BW8 C;  4I2Z A;  3SBT B;  1PC2 A;  5LFA A;  2V4L A;  1HE8 A;  4BWR A;  2XQ0 A;  4MS6 A;  3ASH A;  4GPK A;  4HOS A;  3MCX A;  4GA1 A;  4AEZ C;  3B7T A;  3U3W A;  4KYO B;  3PVL A;  4EBA G;  4CT0 A;  4V3I A;  3CVN A;  4KMO A;  3NQP A;  3CVP A;  1KT1 A;  3BG1 B;  1OWO A;  1SZ9 A;  4ATG A;  2MOW A;  3FTV A;  2JEK A;  1S0P A;  3L6A A;  4JVS A;  3U9W A;  1Z3Y A;  3VLE A;  3GW4 A;  1DVP A;  3HDX A;  4E6H A;  2XCC A;  3TAX A;  2PM7 A;  3AU5 A;  2WXI A;  3RRN B;  5C2Y A;  2WQ6 A;  2RG8 A;  3R9A B;  2WXF A;  4MLP A;  5ENN A;  3GZ2 A;  4WWN A;  2FEZ A;  2KCV A;  2PZI A;  3ZYK A;  5G05 C;  2WXL A;  4JHK A;  5AJD A;  3FWV A;  1GW6 A;  3L54 A;  2NSZ A;  3CHR A;  4TRQ A;  2ILR A;  3FTY A;  5A7D B;  3FTW A;  4L2L A;  2I2O A;  2OOE A;  4PS7 A;  2LSU A;  2WXM A;  4GCN A;  3TG4 A;  4F7A A;  1H2T C;  4ILG A;  1UN8 A;  3G2T A;  4UWL A;  3FUN A;  2CHZ A;  4C0E A;  2LNI A;  4J8F A;  4K0R A;  3FUK A;  1E8W A;  4APF A;  2AXV A;  3HYM B;  4I2W A;  3ZXS A;  1UN9 A;  4B8A A;  2OVF A;  3QDN A;  2XPI A;  3IBE A;  2LAH A;  3ZPJ A;  3AS5 A;  2J9Q A;  4IRU A;  4BFR A;  2I1K A;  3LY9 A;  3T5V A;  1HZ4 A;  3G2U A;  4HFG A;  3QAR A;  4GML A;  4OVV A;  2A4Z A;  5FZS A;  2WXJ A;  2I6H A;  2Y4U A;  4I6G A;  3UMV A;  3UUX A;  3VTX A;  2J4B A;  4GU5 A;  1UJJ A;  3MV2 B;  4KVO A;  2J07 A;  1IYG A;  5DBK A;  1EDU A;  1Y6I A;  4Q69 A;  4F53 A;  2XGS A;  4I1O B;  2DBA A;  2WPV A;  3PEU B;  4FHK A;  3S7J A;  3L22 A;  3OAW A;  3S7D A;  3PEV B;  3PNT B;  3ENE A;  4WUY A;  3FTS A;  2X6H A;  2ZU6 B;  2GRL A;  3Q5M A;  5LX8 A;  2XEV A;  3R7Q A;  4A1G A;  4DLQ A;  3U66 A;  3CKC A;  4FLB A;  4CGW A;  3TXN A;  3ZYQ A;  3QKY A;  2IF4 A;  3LCA A;  3GZS A;  3LKU A;  4OVU A;  3CK7 A;  3D9N A;  4CRW A;  1H6K A;  2CHW A;  1HFA A;  1TEZ A;  3R7R A;  1MHQ A;  2PL2 A;  4HOT A;  1PY1 A;  2YNQ A;  1FVH A;  2UY1 A;  2YHE A;  1DNP A;  4AV7 A;  3Q47 B;  4U63 A;  1TJC A;  2CFU A;  3JYS A;  3U4T A;  4CDM A;  2UWJ G;  4K03 A;  3APD A;  4PUC A;  3IHV A;  3Q15 A;  3B7S A;  3MZL B;  3Q49 B;  4JHR A;  3LY8 A;  3D9M A;  1OUV A;  1EYH A;  4GZD A;  3C98 A;  3SD5 A;  4BY6 A;  4DI4 A;  4E85 A;  3KS2 A;  3QWV A;  3VLF A;  4UI9 K;  3DBS A;  1H19 A;  4CGV A;  3FHE A;  2P58 C;  3OXG A;  5LCW J;  5AEN A;  3B13 A;  4WNG A;  4IYP A;  4O6F A;  3CVL A;  3ML8 A;  4DJA A;  3MEK A;  4EBA A;  3L17 A;  4KBQ A;  3UT4 A;  2X6I A;  2C2L A;  4TV3 A;  5EX3 A;  3ZN3 A;  1L5J A;  5CCM A;  3JQ0 A;  3CSF A;  4UI9 C;  5KJN A;  2X3M A;  4FU3 A;  2OND A;  4BTB A;  3GYZ A;  2I1J A;  3FH8 A;  3P2B A;  1Z6T A;  2I9C A;  2CHX A;  1JUQ A;  4NRH B;  4L1B A;  5AIJ A;  4XX5 A;  3CQC B;  5G05 J;  3MJW A;  4UQY A;  2XPY A;  4EZJ A;  3FDH A;  2KZT B;  3PRE A;  3FU3 A;  3TG5 A;  3LDZ A;  1OWM A;  1HH8 A;  4B0Z A;  1IQU A;  4PDX A;  3TXM A;  1ELW A;  3TL5 A;  1FVF A;  3D9O A;  3FY4 A;  3LPZ A;  4FLH A;  3ZYM A;  5JHB A;  2FBN A;  3E4B A;  3QC1 A;  2FF4 A;  4N39 A;  3D9I A;  5FT9 A;  5KCM A;  1W3B A;  2V5F A;  3ZHE B;  4AJW A;  2A5U A;  2XGM A;  3FH7 A;  5ANR A;  3NZU A;  4GA2 A;  4N3C A;  1PAQ A;  2WM9 A;  3PNL B;  4G2V A;  4U07 A;  4UQX A;  1HG5 A;  3PDN A;  2M63 A;  4FUL A;  3LVQ E;  3PS6 A;  1SQM A;  4B8C B;  1HS6 A;  1Y8M A;  4KVM A;  2XRZ A;  3SHF A;  3RIB A;  3S7B A;  5J90 A;  3ML9 A;  2UY1 B;  2E0I A;  5CMY A;  2DCP A;  1HU3 A;  1HG2 A;  5KJL A;  5FQ6 A;  3G2V A;  1VDY A;  4I1M A;  2WXG A;  2C0M A;  1X5B A;  4MKT A;  3ZEF A;  4C9B B;  2WXP A;  1NZN A;  4G25 A;  2EQX A;  2WQ7 A;  4A55 A;  5FQ7 A;  5KJM A;  4FJY A;  4EPZ A;  2VGX A;  4FC8 A;  5HQ8 A;  3ZVV A;  4DK5 A;  3RO3 A;  3AS8 A;  5AJL A;  2AW6 A;  1INZ A;  2HM8 A;  3WXX A;  3IV0 A;  4HOQ A;  5DIZ A;  1ELK A;  4J6I A;  4C0M A;  4HS2 A;  5T4Y A;  1UW4 B;  3U64 A;  2GRM A;  2CG3 A;  2XHE A;  3CVQ A;  1QZ2 A;  2X6K A;  4FP7 A;  4B94 A;  3SFZ A;  4JXT A;  4CDR A;  2VGY A;  4I1A A;  3SF4 A;  4ANV A;  5FZQ A;  1OWP A;  5JJ6 A;  5ANL A;  3FUJ A;  4GA0 A;  4BT8 A;  1NA0 A;  2KCL A;  4PH4 B;  2XRY A;  3FTX A;  2CFZ A;  4I9E A;  4L7T A;  2GGF A;  3QJZ A;  3LYA A;  2VTB B;  3L16 A;  1ELR A;  3QK0 A;  4UWK A;  1UG3 A;  3ESL A;  4HXI A;  3CVY A;  3EIJ A;  3OXF A;  5FQ4 A;  3O48 A;  3QOU A;  3D9K A;  4BX8 A;  2PM6 A;  1OWL A;  3ZIM A;  1E7V A;  3CIA A;  5CMW A;  4JEH A;  3FUL A;  4AY6 A;  3FUH A;  2KM4 A;  4APO A;  4EZK A;  3CV0 A;  3QAQ A;  4UQZ A;  4XKB A;  4DPR A;  5T8I A;  4A3V A;  3ULQ A;  5CHE E;  4EZL A;  4CT4 A;  5FJY A;  3UT7 A;  4DI3 A;  1P5Q A;  3DPD A;  3T8M A;  1B89 A;  3MA5 A;  2VSY A;  2VSO E;  3ZHE A;  4BT9 A;  4Q94 A;  1OWN A;  4L2Y A;  4J8S A;  4U04 A;  4YVO A;  4FA6 A;  2QFC A;  4GYW A;  2X38 A;  4TUU A;  4WWO A;  2AXU A;  4I6J A;  3ASF A;  4JEU A;  3BG0 B;  4XKC A;  3TGO A;  4FJZ A;  5FQ8 A;  4PS8 A;  1YA0 A;  4WNF A;  3RO2 A;  4AXH A;  4F3V A;  3FUM A;  3I4R B;  1JPL A;  2WXQ A;  3FEX A;  1NA3 A;  4AVX A;  2WB2 A;  4JA7 A;  3CVU A;  3PE3 A;  3NF1 A;  4M3O A;  2IOS A;  2BF0 X;  4KZ0 A;  3ZYL A;  5BT1 A;  3CHO A;  4EQF A;  2L0T B;  2YHC A;  3HHM A;  4ILH B;  1KLX A;  4HLE A;  3KD7 A;  4RVB A;  4W9R A;  3HVE B;  4AM9 A;  4BX9 A;  2E2E A;  3CK8 A;  1E7U A;  3IHY A;  4XI9 A;  2FI7 A;  4JZY A;  4LER A;  3ONL A;  5CCL A;  3LVR E;  4LRZ A;  2XCB A;  2L0I A;  4RG9 A;  2C0L A;  1E90 A;  4ME2 A;  5JJ7 A;  4J0U A;  3ONK A;  3JCK C;  1ZBP A;  1EPU A;  5G2N A;  3FTU A;  4XE0 A;  1QQE A;  3EHN A;  2FUL A;  3AS4 A;  3RKV A;  1HXI A;  2HYZ A;  4A1S A;  2WQH A;  5D0O D;  2LSV A;  3EDT B;  1HX8 A;  4ILI A;  2KAT A;  4XIF A;  3LEW A;  4G11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...