2KC7A

Solution nmr structure of bacteroides fragilis protein bf1650. northeast structural genomics consortium target bfr218
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
MDQLKTIKELINQGDIENALQALEEFLQTEPVGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDILNFYNKDMYNQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords bfr218_protein
publication title Solution NMR structure of Bacteroides fragilis protein BF1650. Northeast Structural Genomics Consortium target BfR218
rcsb
source organism Bacteroides fragilis
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kc7A00
2JLBA 2YHCA 4I9CA 2WQHA 2C2LA 4UQZA 3CVPA 3CK8A 2QFCA 3LPZA 5CCMA 3TG5A 3ASDA 3S7FA 4H7XA 3UQ3A 2XGMA 2KCVA 2UY1B 3Q47B 1OUVA 4UI9J 3VTXA 4GA1A 5DIZA 5BT1A 4XI0A 1B89A 1HH8A 3ZHEA 4UI9C 5D0QD 2WPVA 1ELRA 3CK7A 4KXKB 2VSNA 5EKQD 4GPKA 4JA9A 4GCOA 1HXIA 4WNGA 5EX0A 3PE3A 4J0UA 4G25A 5KJLA 5G05J 5D0OD 4GZ3A 3ZN3A 4KYOB 4G24A 5LCWJ 5G05C 3PE4A 1W3BA 4AY5A 3E4BA 2FBNA 4APOA 1A17A 2OOEA 5FZSA 3MKRA 3OXFA 5LCWC 4J8FA 4UQYA 3RKVA 2VQ2A 2FEZA 4HOSA 3MEKA 2Q7FA 4N5CA 3Q4AB 4Y6WA 4I9EA 4BWRA 4Y6CA 3Q15A 2XCBA 5FT9A 4GA2A 2PQRA 4WUYA 2XGOA 4XI9A 3QWVA 4BT9A 3LY8A 3ZGQA 2LSVA 4J8EA 4YVQC 4U0UA 3AS8A 3LKUA 3UUXA 3LYAA 4HOUA 3ASFA 3FFLA 1PC2A 2VGYA 2VSYA 2HYZA 2XGSA 4N3CA 3PDNA 1FCHA 2P58C 3ZPJA 4N3BA 3FWVA 2VYIA 4GYYA 4GZ6A 3NF1A 4JHRA 3KS2A 4AY6A 2V5FA 3LY9A 3TG4A 4A1SA 3SF4A 1IHGA 1KLXA 4HOQA 1E96B 5JJ6A 4AM9A 3ASGA 1ZBPA 3UPVA 1KT1A 3TAXA 2AVPA 2Y4TA 4NRHB 5AYWD 4N39A 4WNDA 5FZQA 4N2SA 3LY7A 3MV3B 1WM5A 3O48A 5A7DB 3GW4A 4CGVA 3QOUA 3OXLA 3QWWA 5A6CA 5HI7A 4G1TA 1HZ4A 3RO2A 5KJKA 2YQ8A 4UQXA 5FTPA 3MV2B 2UWJG 4AIFA 3CK9A 1KT0A 5HQ8A 2UY1A 1Y8MA 1IYGA 4ABNA 4BT8A 4U04A 3K9IA 1QQEA 3SZ7A 3ZHEB 2BUGA 3RO3A 5BNWA 5FZRA 3QKYA 1NA3A 3QDNA 3U4TA 3ULQA 2Y4UA 2KCKA 2DBAA 4IN3B 3CVNA 2C0MA 3ASHA 1YA0A 5KJNA 2PZIA 3IEGA 4HORA 3Q5MA 5JJTA 2IF4A 4BTAA 1P5QA 2KATA 4U07A 2MHKA 3CVQA 4BTBA 3JYSA 3KD7A 3CKCA 3ESKA 4H7YA 4B94A 3LCAA 3CVLA 5G04J 3Q49B 3FP3A 1NA0A 3AS4A 1ZU2A 2NC9A 4JA7A 2PQNA 2VGXA 3WXXA 5G04C 4CDRA 5CHEE 1WAO1 5CCLA 5C1DA 4I2WA 1QZ2A 4LEUA 2XEVA 2ONDA 4YNDA 2XPIA 4N3AA 2LSUA 1TJCA 4GYWA 4WNFA 2I6HA 2GW1A 2XCCA 3HYMB 3CV0A 4UI9K 4J8DA 3AS5A 2HO1A 3URZA 3VTYA 5ARGA 2C0LA 3ZFWA 5FJYA 3GZ1A 3RU0A 2J9QA 4O6FA 4U0ZA 4I17A 3GZ2A 3QWPA 4YVOA 5DBKA 4JL0A 4N2QA 3RIBA 1ELWA 1NZNA 4RG6A 1XNFA 4I2ZA 4GA0A 3S7BA 2E2EA 2FO7A 3TGOA 3KAEA 5JJ7A 3U3WA 2R5SA 4G26A 2PL2A 4CGWA 3EDTB 2VGXB 4GZ5A 4U0SA 5EX3A 2FF4A 2HR2A 4I1AA 2IFUA 4W9RA 3CKBA 3OXGA 5M72A 4NQ0A 2LNIA 3S7JA 3S7DA 4RG9A 4GYOA 3BEEA 5KJMA 3N71A 4HOTA 4G23A 3RJVA 3MA5A 4WNEA 2L6JA 4EQFA 3CEQA 3GYZA 5ARFA 4GCNA 5BW8C 3R9AB 4ME2A 2KC7A 2FI7A 4KBQA 2KCLA 4G2VA 4F3VA 4XIFA
chains in the Genus database with same CATH superfamily
2JLBA 1H6OA 3ZYKA 3CVPA 3LPZA 2GRLA 3ASDA 2IOSA 4DX7D 3EUVA 1YCSB 2UY1B 4FHJA 2L9BA 2BKGA 3FU6A 5D2MC 4EECA 3ENEA 5BT1A 3X2QE 3MYVA 4HI8A 5ENTD 4HRMB 2WPVA 4I1OB 3CK7A 5EILA 2VSNA 2OVFA 4GPKA 2XHEA 3DWLG 1WG0A 1HXIA 2R02A 4UWGA 1TJFA 3PE3A 4DUIA 4ANVA 4UWKA 3AU5A 3HG0D 4FA6A 5D0OD 4A3TA 3EHMA 1FT2A 3ZN3A 1BD8A 4G24A 2EINE 4L7TA 1IQRA 1EPUA 2VJ8A 4PDXA 5G05C 3PE4A 1W3BA 3PUJA 4AY5A 3UM1A 1O5MA 2ETBA 2RFAA 3MKRA 5LCWC 2LO6A 3JUIA 4HOSA 2XRYA 3EU9A 1N9AA 2EQXA 2MOWA 3CVVA 3R9MA 1U2VG 4BWRA 3FUKA 3UX4A 1OWOA 2F8XK 3PZDA 2PQRA 4WUYA 4HS2A 3PREA 1Z3YA 4K5AB 4O60A 4N5QA 5FQ4A 2DZOA 2IU1A 2ZU6B 1E8YA 4FADA 3TWTA 4KT6B 4HBDA 2LAIA 3UUXA 3ESLA 3LYAA 3FUHA 4A55A 2B0OE 4TRQA 3ABME 4EBAA 1MYOA 3U66A 3PDNA 1LD7A 4HLLA 4AVXA 4GTSA 2OEVA 3T8MA 4AOFA 1D9SA 4GZ6A 3W9FA 4ILGA 1N52A 4AY6A 3FUDA 4DX6D 2P9PG 3TG4A 5FQ8A 3SF4A 2V4HC 2F8YA 3I5PA 2CHZA 5JHBA 1K8KG 1H2TC 2NXPA 2X6FA 3TWVA 4QQIA 4APFA 3IKOB 4A1GA 4XX5A 1NL4A 4KMOA 4KZ0A 4NRHB 1E7UA 3L08A 4DX2A 3LY7A 3PH0C 3FTWA 1S70B 4F53A 1Y6IA 5KBAA 3GW4A 3NB2A 3CVXA 5H7PA 4Q94A 3TL5A 3IHVA 3LEWA 4Z68A 4G1TA 3NOCD 3Q9NC 4UQXA 3CK9A 4CCAA 5CEAA 3KEAA 2LUHA 4J8YA 3B7UX 2DYSE 3SZ7A 3E32A 3CR3A 5AJDA 3ZHEB 1V54E 4LERA 3HXBA 4FJZA 2EIJE 1HU3A 1OWNA 4JHKA 5CECB 1NA3A 3DSVA 1MQSA 4GTVA 3D3MA 2YNQA 3C3RA 4Q69A 3B7SA 1Z5SC 2Y1LE 3V2OA 4IN3B 3E30A 2R05A 5BUZA 4FU3A 3CVNA 2BEDA 4K03A 1E8XA 3IEGA 1P5QA 2KATA 1O1RA 3CVQA 2GRNB 5KNGA 1HX8A 3SBTB 1SW6A 4B94A 1NA0A 1OCZE 4JEHA 5BXOA 4BETA 1ZU2A 3EIJA 4JA7A 5BV0A 5IY5E 3JCKC 3FUNA 2J07A 3FTYA 2AWIA 4XEIG 3UKRG 2RKKA 4I2WA 1TNUA 4IYPA 2DIWA 1QYMA 1OWPA 3EHRA 4FLBA 3BG1B 2WXJA 1FVFA 2LSUA 4KVMA 3IBEA 4XKBA 1U3CA 3ZYLA 5ARGA 5FJYA 3GZ1A 1QNFA 4U0ZA 1O1TA 3QWPA 4I6JA 3TWXA 2A4ZA 1ELWA 1NZNA 3FU3A 4I2ZA 4K5CA 3SBSA 2E2EA 3UIOC 3TGOA 3KAEA 3DSWA 5JJ7A 3MX3A 3SFZA 2R5SA 3SO8A 3D9NA 3L54A 1UG3A 4LNGA 3CKBA 3OXGA 1VDYA 1TNOA 4KZCA 3ZYQA 4RG9A 2L6BA 3BEEA 4HOTA 4G23A 3MA5A 4WNEA 3CSTA 3DXMG 4U63A 2L6JA 4EQFA 1S0PA 2WMOA 5J90A 3UKUG 3SY2A 4GCNA 1SA4A 3SGHA 2ZIRA 3L9TA 4ZHBA 3DSTA 3JXIA 4FLHA 2FI7A 2KCLA 4F3VA 2V0PA 1SZ9A 2YHCA 4I9CA 2A5EA 2IO2C 3ZW3A 3CK8A 1Z3XA 2QC9A 3S7FA 4H7XA 3B13A 4UI9J 2ZISA 4J7WA 4XI0A 1B89A 3ZU7B 3PZ4A 3ULYA 1N94A 4KXKB 3ZVVA 1DVPA 2DYRE 2X6JA 1V55E 2LXMA 5EKQD 1Q2ZA 5B1BE 4JA9A 1K1BA 4GCOA 4JC8A 4V3IA 2GROB 4WNGA 5EX0A 2J49A 4GAAA 4QFVA 1TYQG 3BUAA 2L0TB 3UI2A 2OV8A 3DSSA 2P9NG 1D8DA 4KVOA 2KM4A 2FBNA 2OOEA 4LSZE 5HKPA 3L6AA 3OXFA 2WQ7A 3KSQA 3NAWA 4UQYA 1N0RA 3DEOA 4YDWA 3UT8A 3BG0B 2Q7FA 2DWZA 1H19A 3Q4AB 2XRZA 2I1KA 4FC8A 4Y6WA 4XE0A 3B7BA 4HXIA 5ANLA 3L17A 3I3NA 4O1PA 1OT8A 4Y6CA 4YDEA 4GTOA 3Q15A 2XCBA 5FT9A 2ETCA 4CT0A 5A23A 1WY6A 2XGOA 3ZXSA 2R59A 4XI9A 3MZLB 3G2WA 3QWVA 5LX8A 3JUEA 4PUCA 2GRRB 3ZGQA 2LSVA 2WQ6A 1LTXA 1TR4A 4M7CA 4GMJA 1BU9A 1BI7B 3QJZA 4HOUA 3TWQA 2VGYA 4U96D 2VSYA 3JXJA 4GTRA 1FCHA 1BPOA 2P58C 3HIZA 3AAAC 3HXDA 2PNNA 3ZPJA 3FWVA 3NF1A 4HLEA 4OYSA 1HO8A 3KS2A 3W9GA 2XPZA 4A1SA 2ILRA 2WXMA 3D9MA 4JB8P 5JJ6A 2J8SD 1E8WA 4AM9A 2F37A 4I6GA 1ZBPA 5EYLA 2Y3AA 5AYWD 3HXFA 5FQ6A 1TNBA 5FZQA 4ATZD 2ZXWE 5KWDA 3MV3B 2AW6A 1JCQA 4OAVB 1H2VC 3AU4A 4LRZA 1GW6A 4OVVA 4BEPA 3OXLA 5AJLA 1TN7A 1N4RA 3J5PA 2BKKB 5A6CA 3UM0A 4DI4A 3O4ZA 1HZ4A 3RO2A 4R7LA 3FUFA 5FTPA 1FT1A 4FULA 2ZGDA 4NACA 4BSXA 2UY1A 3CGHA 2KZTA 4BT8A 1XGWA 1EF1C 3DPYA 3C72A 2QYUA 2BUGA 3DSUA 3R7QA 3UT4A 5EYPF 5G2NA 3CHRA 3G2VA 5FZRA 3QKYA 5FINA 5AQ7A 5FQ7A 2X38A 2Y4UA 1ELKA 1AP7A 4BX9A 4MBGA 4ZFHA 4Q96A 4XZ4A 5CERB 3ASHA 3FHEA 3P2BA 2V4LA 2F0YA 1YA0A 5B1AE 4GU5A 5JJTA 3UINC 5ENQD 4BTBA 2MHKA 4CDNA 3UTMA 3NZSA 3MKQA 3ZNGA 1S64A 3JYSA 2Y0BG 2J4DA 3DXKG 3ESKA 2XS8A 4CEMA 3CVLA 2X6HA 4JXTA 3FP3A 3SNXA 2NC9A 3QK0A 2VGXA 4OVUA 5G04C 4M3OA 2XZTG 2CFZA 2YINA 5CCLA 2IONA 3PEUB 4TV3A 4BX8A 2P9LG 4YNDA 1OWMA 4GZDA 1JWGA 1TJCA 4GYWA 4WNFA 5AN8A 2FO1E 2XCCA 3CV0A 2AXUA 4L23A 1U3DA 4URKA 3URZA 2WXRA 3VTYA 3FUMA 3CHSA 3HDXA 2PM6A 4O6FA 1IHBA 4JL0A 4B8CB 2OEWA 4N2QA 3P1UA 2OCCE 4PS3A 4RG6A 2CG3A 3S7BA 2P9KG 3AG3E 1X5BA 2WXPA 2J08A 2MYOA 3UM3A 3U3WA 1MHQA 4GZ5A 4U0SA 5EX3A 1HFAA 2JABA 1H6PA 4I1MA 2WXOA 3G2TA 4E6HA 4W9RA 5CMWA 2JEKA 4NQ0A 2LNIA 3TWSA 2ZGGA 3RJVA 4U8HA 2KXPC 4UWLA 3GYZA 5B3SE 1OCRE 5CEDB 5ARFA 4GZCA 4AEZC 4RQIA 1SQMA 1E8ZA 3F6QA 2BF0X 3JQ0A 4B8AA 3PNTB 2KC7A 4NIKA 3D9JA 4BFRA 2C2LA 2QY7A 4L2LA 4UQZA 5CBOA 2QFCA 3APCA 4ANXA 5G55A 3VLEA 3UQ3A 2XGMA 5E76A 1WDYA 3FUIA 5LP0A 1OUVA 2WB2A 4GA1A 5DIZA 4HNAD 3ZHEA 1K1AA 1ELRA 4GMLA 3CIAA 1UW4B 2IQCA 2V5QC 4NURA 4U7EB 3L13A 1MX4A 4J0UA 5G05J 2QZAA 3C3QA 1FPPA 3ML9A 4MRUA 5LCWJ 2HM8A 1OWLA 1MX2A 3E4BA 3CHMA 4B89A 4APOA 1A17A 3E33A 3PS6A 4ATGA 1TEZA 4J8FA 3FTXA 1JCRA 3RKVA 2YHEA 5KNHD 1KZPA 3DEPA 1HF8A 5JHAA 3RRUA 3LDZA 3FUJA 2GRQB 5ENPD 3MEKA 4N5CA 4I9EA 3DPDA 3HVEA 3NBNB 2XEHA 4GA2A 1EYHA 1SZAA 4JZYA 3NZUA 4YVQC 2P9IG 4F6RD 4U0UA 1UJKA 3BU8A 3RK6A 2WXHA 3CVYA 4CDMA 3LKUA 1UN9A 4ACKA 5LFAA 4PH4B 1PC2A 3FH7A 1IQUA 2V8SE 3SFXA 3D9IA 2HYZA 5BXUA 1DNPA 4F7AA 3CHOA 1JPLA 1LD8A 4HB5A 4XKCA 3CVUA 2XPYA 3ULEG 2VGEA 3TWUA 3NQPA 3EJNA 3D9HA 3Q79A 1OCCE 3PZ3A 5BPPA 3U64A 3ZRHA 4TUUA 4N3BA 4IULA 2VYIA 4DI3A 4JHRA 1HS6A 4JPSA 5ITZF 2V5FA 3UT7A 1IHGA 4O1OA 3Q75A 4HOQA 2XENA 3CHPA 3DSXA 5ENRD 3SD5A 2J09A 3D9OA 1KT1A 3C5RA 1OCOE 5D66A 2H6GA 4N39A 3CLJA 4N2SA 2A5UA 3U9WA 5T3RA 5AENA 4CGVA 1N11A 4DK5A 1MZCA 1JCSA 2R03A 3Q7FA 4TUMA 5HI7A 3FEXA 2WXFA 4MKTA 4BESA 4DPRA 1O1SA 5KJKA 4JD2G 2H6HA 2IJGX 4RLYA 1KT0A 4AXHA 4DRXE 1Y8MA 4U04A 3K9IA 4BERA 3Q7AA 4K0RA 1OY3D 4LNBA 2VTBA 2H6FA 3UM2A 1X81A 3FY4A 1N4SA 4B93B 2PM7A 3T9KA 3FTVA 3U4TA 4HVBA 2KCKA 3J5QB 3FTZA 2FULA 3FU0A 4L9PA 1DC2A 4BSZB 3ONKA 1H2UA 1N4QA 5AQBA 2RD0A 4L1BA 4EZJA 4HORA 4UWHA 3FEYA 2IF4A 4FJYA 4U07A 2DVWA 2XEEA 3EIQC 2NSZA 4H7YA 5ANRA 2AJAA 3APDA 3ASNE 4I6EA 3D9PA 3AS4A 2PQNA 4J6IA 5CHEE 3AG2E 1OXJA 1BI8B 2KZTB 2P2CP 5C1DA 3ABLE 1KPSB 1QZ2A 2I1JA 2ONDA 4ILIA 1N0QA 2XPIA 4N3AA 4GTQA 3NOGD 1E7VA 4DLQA 3QAQA 4EZKA 3ZKJA 3HYMB 4UI9K 4IRUA 3LJ3A 3AS5A 5FIOA 4CT4A 1SA5A 2C0LA 3ZIMA 3RU0A 2J9QA 1UOHA 4F1SA 3GZ2A 5CRUA 4I43A 3B7TA 3SFYA 3LXUX 3MKQB 3E37A 3RIBA 5HS0A 3ZXPA 1XNFA 3LVQE 4GA0A 3EU5A 4JEUA 1Z6TA 1RZ4A 3B7RL 1N54A 3DRAA 2I9CA 3KEZA 2WVIA 3KSLA 4G8KA 4LG6A 4G26A 2IO3C 2PL2A 2XZDG 2VGXB 2HR2A 4I1AA 2M63A 1TNYA 1S63A 4G8LA 3AG1E 2AXZA 5M72A 3MGBA 4AP2A 4CYMD 4RVBA 5CMYA 3S7DA 3L16A 4TXRA 3N71A 3C3OA 4EZLA 3FH8A 1MX6A 3SHFA 1LF8A 3LS8A 5AIJA 5BW8C 4CRWA 5JA4D 4ME2A 3LJNA 3G2SA 1PY1A 4G2VA 4XIFA 2Y69E 3RRNB 2WQHA 4FHKA 3E34A 5CCMA 3TG5A 4A63B 3L82A 2KCVA 2VSOE 1K3ZD 4HRNA 3Q47B 3PNLB 4WWOA 3RSEG 1N95A 3MCXA 3VTXA 4AJWA 3IXEA 3B95A 3HXCA 1HH8A 1JWFA 4P29A 4UI9C 5D0QD 4DX1A 2EILE 3Q78A 3UXGA 4EBAG 3PEVB 3IHYA 3PRZA 4WWPA 4J8SA 5AQAA 2B6CA 5T8IA 3AJIA 4G25A 5KJLA 4MLPA 2XS1A 4GZ3A 4KYOB 1EDUA 3CHQA 2DCPA 5AARA 1DCEA 2P9SG 4HQDA 5FZSA 2EIKE 4FP7A 2VQ2A 2FEZA 3LVRE 4LNUD 3TWWA 2R2LA 2WXQA 3EHNA 3QB2A 2E0IA 2WXIA 5T4YA 4K5BA 2CHXA 3AG4E 3FTSA 5FWQA 2GRPB 3MJWA 4GTPA 3RAUA 4PS7A 4UWFA 2GGFA 4WAFA 4C0MA 4HRLA 3TWRA 4BT9A 3CSFA 3T8KA 3V2XA 3LY8A 4DLOA 4J8EA 3Q9UC 3C98A 3ZEFA 3AS8A 2IOLA 4A3VA 2RFMA 1A5EA 3ASFA 3FFLA 4YDOA 3CVWA 4U8YD 5J08A 5C2YA 2XGSA 4N3CA 3SQVA 1UN8A 3TXNA 2VSXE 4LCTA 1MJ0A 4F1PA 3L22A 5JMND 3D9LA 3OTNA 4GYYA 1D8EA 1QBQA 1ZB1A 3S2AA 2CHWA 2QYJA 1IKND 5ENOD 4ANWA 3SI5A 3T5VA 4DX5D 3HVEB 3HHMA 3LY9A 4CZ2D 2XQ0A 2HE0A 4UUCA 1KLXA 1E96B 4L2YA 4DJAA 5KCMA 1AWCB 3ASGA 1FVHA 3JQ1A 2LXLA 1TNZA 3I4GA 3UPVA 4E85A 3TAXA 4EHMA 2AVPA 2Y4TA 3UMVA 4MS6A 4WNDA 3QARA 5AAOA 2X3MA 1WM5A 3O48A 2RG8A 3PUKA 3T5XA 5A7DB 5AQ9A 3ONLA 2P9UG 1JUQA 3QOUA 1H0AA 4PS8A 1YYHA 3DBSA 3PVLA 1G3NB 3V30A 3QWWA 3FU5A 3PZ1A 2WMNA 3OAWA 3TXMA 3VLDA 4G11A 1L5JA 3QC1A 4ANUA 4GPMA 2YQ8A 3FUEA 3MV2B 2UWJG 4AIFA 3ZUVB 2L0IA 5HQ8A 1IYGA 4ABNA 1QQEA 3G2UA 4RSYA 3RO3A 4GTTA 5BNWA 3FH5A 2IEJA 1NP7A 3QDNA 3CQGB 5EN5D 1UJJA 3ULQA 4GB9A 4X8QA 2DBAA 4JHJA 4JVSA 3ISMC 2CG2A 1INZA 2C0MA 3FDHA 4C0EA 5KJNA 4GMRA 2PZIA 4GTMA 3Q5MA 3I4RB 4BTAA 1N4PA 3V79K 3KD7A 2WXLA 5EDSA 2J4BA 1TN8A 1PAQA 3CKCA 2MRIA 1HG2A 2KBXA 1BLXB 3LCAA 5G04J 3Q49B 2NYJA 5ENSD 4D10C 3FULA 2X6IA 2DZNA 4HI9A 2WXNA 5CBNA 3WXXA 4CDRA 2BTDA 1TN6A 3UIPC 4AV7A 3V31A 1WAO1 1SVXA 3Q73A 1RW2A 2I2OA 4LEUA 5ENNA 2XEVA 1YMPA 3VLFA 2X6KA 2VTBB 3QNKA 4ACLA 2I6HA 2GW1A 3ML8A 3TJPA 4JW1A 4J8DA 2AXVA 3IV0A 3PZ2A 4TXPA 2HO1A 4WWNA 3ZFWA 2OVBA 3FTUA 4I17A 3APFA 4YVOA 3RRMB 1HE8A 4LUNU 5DBKA 4B0ZA 3HXEA 2H6IA 2WM9A 5BV1A 5CRVA 4YDYA 2R17C 3D9KA 1IXVA 1DCQA 5EIBE 2FO7A 4EPZA 4OAUC 3EHQA 3ZYMA 3BQOA 4CGWA 3ASOE 1NI1A 3EDTB 2CFUA 4ILHB 4U95D 2FF4A 4TXQA 5LOZA 2IFUA 3GZSA 3ABKE 5EIDA 2GRMA 2WXKA 4C48B 5E75A 2ETAA 2IY0C 4HFGA 1HG5A 3R7RA 3S7JA 3WG7E 4GYOA 1E90A 5KJMA 2EIME 4C9BB 3CEQA 1H6KA 3CQCB 4U8VD 2WXGA 3R9AB 5HRYA 2LAHA 1KZOA 4BY6A 4KBQA 3HRAA 1NFIE
chains in the Genus database with same CATH topology
3D9JA 2JLBA 2YHCA 4I9CA 4BFRA 3ZYKA 3RRNB 2WQHA 2C2LA 2QY7A 3ZW3A 4L2LA 4UQZA 4FHKA 3CVPA 3CK8A 2QFCA 3LPZA 1Z3XA 2GRLA 3APCA 3TG5A 3ASDA 4ANXA 5AENA 5CCMA 5BV0A 5G55A 3VLEA 2IOSA 3S7FA 4H7XA 3UQ3A 3B13A 2XGMA 2KCVA 5E76A 2VSOE 3FUIA 2UY1B 3Q47B 3PNLB 4FHJA 2L9BA 5LP0A 1OUVA 4UI9J 4WWOA 3FU6A 3MCXA 3VTXA 2WB2A 4AJWA 4EECA 4GA1A 5DIZA 3ENEA 5BT1A 4XI0A 1B89A 3MYVA 1HH8A 1JWFA 4P29A 4UI9C 5D0QD 2WPVA 3ZHEA 4I1OB 1ELRA 3CK7A 4KXKB 3ZVVA 1DVPA 4EBAG 2X6JA 4GMLA 2VSNA 3PEVB 5EKQD 2OVFA 3CIAA 4GPKA 2XHEA 4JA9A 1UW4B 4GCOA 1HXIA 2IQCA 4JC8A 3IHYA 4NURA 4V3IA 3PRZA 3L13A 4UWGA 4WNGA 1TJFA 4WWPA 5EX0A 3PE3A 2J49A 4J8SA 4ANVA 4UWKA 3AU5A 4GAAA 4QFVA 5T8IA 4FA6A 4J0UA 4G25A 5KJLA 5G05J 5D0OD 4MLPA 4A3TA 4GZ3A 2L0TB 3EHMA 2OV8A 3ZN3A 4KYOB 1EDUA 3CHQA 4G24A 2DCPA 4L7TA 3ML9A 4MRUA 5LCWJ 1IQRA 1EPUA 2VJ8A 4PDXA 4KVOA 5G05C 2HM8A 1OWLA 2KM4A 3PE4A 1W3BA 3PUJA 4AY5A 3E4BA 2FBNA 3CHMA 4B89A 4APOA 1A17A 2OOEA 5FZSA 3L6AA 3MKRA 3OXFA 3PS6A 5LCWC 2WQ7A 4ATGA 1TEZA 4J8FA 3FTXA 4UQYA 2YHEA 2LO6A 4FP7A 3RKVA 2VQ2A 2FEZA 3JUIA 1HF8A 4HOSA 5JHAA 3RRUA 3LDZA 3LVRE 3FUJA 2XRYA 3UT8A 3BG0B 3MEKA 2Q7FA 1H19A 4N5CA 3Q4AB 2EQXA 2MOWA 2XRZA 3CVVA 2I1KA 4FC8A 4Y6WA 4XE0A 2WXQA 3EHNA 3QB2A 2E0IA 4HXIA 2WXIA 3L17A 4I9EA 5ANLA 5T4YA 4BWRA 3DPDA 3FUKA 3HVEA 3I3NA 4Y6CA 3UX4A 1OWOA 3Q15A 2XCBA 5FT9A 2CHXA 3FTSA 4GA2A 5FWQA 4CT0A 3PZDA 5A23A 2PQRA 4WUYA 4HS2A 1WY6A 1EYHA 3MJWA 3PREA 2XGOA 1Z3YA 4PS7A 4UWFA 3ZXSA 2R59A 2GGFA 4XI9A 3MZLB 4WAFA 3G2WA 4C0MA 3QWVA 1SZAA 5LX8A 4JZYA 4PUCA 4BT9A 3CSFA 5FQ4A 3LY8A 3ZGQA 2IU1A 2LSVA 4J8EA 4DLOA 2ZU6B 3ZRHA 3NZUA 4YVQC 2WQ6A 1E8YA 4U0UA 1UJKA 3C98A 3ZEFA 4FADA 3RK6A 3AS8A 2WXHA 3CVYA 2IOLA 4CDMA 4A3VA 4KT6B 4GMJA 3LKUA 1UN9A 4ACKA 2LAIA 3UUXA 5LFAA 4PH4B 3ESLA 3QJZA 3LYAA 3FUHA 4HOUA 4A55A 3ASFA 3FFLA 1PC2A 3FH7A 1IQUA 2V8SE 4TRQA 3CVWA 5J08A 2VGYA 2VSYA 5C2YA 3D9IA 2HYZA 4EBAA 2XGSA 1DNPA 4N3CA 4F7AA 3CHOA 1JPLA 3U66A 3PDNA 4XKCA 3CVUA 2XPYA 1FCHA 1BPOA 2P58C 3HIZA 3EJNA 1UN8A 3NQPA 3TXNA 2VSXE 4LCTA 3L22A 5BPPA 4AVXA 3U64A 4TUUA 3D9LA 3T8MA 3ZPJA 3OTNA 4IULA 4N3BA 3FWVA 2VYIA 4GYYA 4AOFA 4GZ6A 4DI3A 3NF1A 4HLEA 4JHRA 4OYSA 3S2AA 4ILGA 2CHWA 1N52A 1HO8A 1HS6A 3KS2A 4JPSA 4ANWA 3SI5A 4AY6A 3FUDA 2V5FA 3UT7A 2XPZA 3T5VA 3HVEB 3HHMA 3LY9A 3TG4A 4A1SA 2ILRA 2WXMA 5FQ8A 3SF4A 1IHGA 2XQ0A 1KLXA 3I5PA 3D9MA 2CHZA 5JHBA 4HOQA 1E96B 4L2YA 3CHPA 5JJ6A 1E8WA 3SD5A 4AM9A 1H2TC 4DJAA 2NXPA 2X6FA 4I6GA 5KCMA 3ASGA 1FVHA 1ZBPA 3JQ1A 2J09A 3D9OA 4APFA 3I4GA 3UPVA 4E85A 3IKOB 1KT1A 3TAXA 4A1GA 2AVPA 4XX5A 2Y4TA 3UMVA 2Y3AA 4KMOA 4KZ0A 4NRHB 1E7UA 5AYWD 4N39A 3L08A 5FQ6A 4MS6A 4WNDA 5FZQA 3CLJA 4N2SA 2A5UA 3LY7A 3PH0C 3U9WA 3MV3B 3QARA 3FTWA 2AW6A 5T3RA 2X3MA 3AU4A 1H2VC 1WM5A 2RG8A 3O48A 3PUKA 1Y6IA 4LRZA 5A7DB 3T5XA 3GW4A 4F53A 4CGVA 1GW6A 4OVVA 3ONLA 4DK5A 1JUQA 3CVXA 3QOUA 1H0AA 3OXLA 4PS8A 3DBSA 5AJLA 3PVLA 3QWWA 4Q94A 5A6CA 3FU5A 5HI7A 3IHVA 3TL5A 3FEXA 3LEWA 4DI4A 2WMNA 2WXFA 4G1TA 3OAWA 3O4ZA 3TXMA 3VLDA 4G11A 4MKTA 1L5JA 3QC1A 4ANUA 1HZ4A 4DPRA 3RO2A 4R7LA 5KJKA 2YQ8A 3FUEA 3FUFA 4UQXA 5FTPA 4FULA 3MV2B 2UWJG 4AIFA 3CK9A 4NACA 2IJGX 4BSXA 4CCAA 1KT0A 2L0IA 4AXHA 5HQ8A 2UY1A 1Y8MA 1IYGA 4ABNA 3B7UX 2KZTA 3CGHA 1XGWA 4BT8A 1EF1C 4U04A 3K9IA 1QQEA 3G2UA 3SZ7A 3ZHEB 2BUGA 3CR3A 4RSYA 5AJDA 3R7QA 3UT4A 4K0RA 4LERA 4FJZA 3RO3A 1HU3A 1OWNA 5G2NA 5BNWA 2VTBA 3CHRA 3G2VA 3FH5A 3QKYA 4JHKA 1NA3A 5FZRA 1NP7A 3FY4A 3QDNA 5FQ7A 1MQSA 2PM7A 3CQGB 3D3MA 2YNQA 2X38A 3FTVA 1UJJA 3U4TA 4GB9A 3ULQA 2Y4UA 4HVBA 2KCKA 4Q69A 1ELKA 4BX9A 3FTZA 3B7SA 2FULA 2DBAA 4JHJA 3FU0A 4JVSA 2CG2A 4IN3B 3ONKA 5BUZA 1H2UA 4FU3A 3CVNA 2RD0A 4Q96A 1INZA 4K03A 4XZ4A 2C0MA 1E8XA 3ASHA 3FDHA 3FHEA 2V4LA 3P2BA 4C0EA 4L1BA 1YA0A 4EZJA 5KJNA 2PZIA 3IEGA 4GU5A 4UWHA 4HORA 3Q5MA 3FEYA 3I4RB 5JJTA 2IF4A 4BTAA 4FJYA 1P5QA 2KATA 4U07A 2MHKA 3CVQA 4BTBA 4CDNA 3NZSA 3MKQA 3JYSA 3KD7A 2WXLA 5EDSA 2J4BA 1PAQA 3EIQC 2J4DA 2MRIA 3CKCA 1HG2A 1HX8A 3ESKA 3SBTB 2NSZA 4H7YA 5ANRA 4B94A 4CEMA 3LCAA 3CVLA 5G04J 3APDA 3Q49B 2X6HA 4JXTA 3FP3A 4I6EA 3SNXA 1NA0A 4D10C 4JEHA 3D9PA 3FULA 3AS4A 1ZU2A 2X6IA 2NC9A 2WXNA 3EIJA 2PQNA 2VGXA 3QK0A 4JA7A 4OVUA 3JCKC 3FUNA 5G04C 4J6IA 4M3OA 2BTDA 5CHEE 3WXXA 4AV7A 4CDRA 2J07A 2KZTB 3FTYA 1WAO1 2AWIA 2CFZA 2YINA 5CCLA 2IONA 3PEUB 4TV3A 4I2WA 5C1DA 4IYPA 4BX8A 1QZ2A 2DIWA 1OWPA 2I2OA 4LEUA 5ENNA 2I1JA 2ONDA 2XEVA 4ILIA 4FLBA 3VLFA 2X6KA 3BG1B 4YNDA 1OWMA 2WXJA 2XPIA 2VTBB 4GZDA 4N3AA 1FVFA 2LSUA 4KVMA 1JWGA 3QNKA 1TJCA 4GYWA 4WNFA 4ACLA 2I6HA 1E7VA 3IBEA 4DLQA 3QAQA 4XKBA 4EZKA 2GW1A 2XCCA 3HYMB 3ML8A 3TJPA 3CV0A 4JW1A 4UI9K 4J8DA 2AXUA 4L23A 1U3DA 4IRUA 3LJ3A 1U3CA 2AXVA 3AS5A 3IV0A 4URKA 4CT4A 3ZYLA 2HO1A 3URZA 2WXRA 3VTYA 5ARGA 3FUMA 4WWNA 2C0LA 3ZFWA 2OVBA 3CHSA 5FJYA 3HDXA 3GZ1A 3ZIMA 3RU0A 1QNFA 2J9QA 3FTUA 2PM6A 4O6FA 4F1SA 4U0ZA 4I17A 3GZ2A 3APFA 3QWPA 4I43A 1HE8A 4I6JA 4LUNU 4YVOA 3RRMB 5DBKA 3B7TA 3LXUX 4B0ZA 4JL0A 4B8CB 3MKQB 4N2QA 2WM9A 5BV1A 3P1UA 2A4ZA 2R17C 3RIBA 1ELWA 1NZNA 4PS3A 4RG6A 3D9KA 1XNFA 3FU3A 3LVQE 4I2ZA 4GA0A 2CG3A 4JEUA 1Z6TA 3S7BA 3SBSA 3B7RL 1X5BA 1N54A 2E2EA 2WXPA 2FO7A 4EPZA 3TGOA 3KAEA 2I9CA 3KEZA 2J08A 5JJ7A 3MX3A 2WVIA 3SFZA 3ZYMA 3U3WA 2R5SA 4G26A 2PL2A 4CGWA 1MHQA 3EDTB 3D9NA 2CFUA 2VGXB 4GZ5A 4U0SA 3L54A 5EX3A 4ILHB 2FF4A 2HR2A 1HFAA 4I1AA 2M63A 1UG3A 4I1MA 2WXOA 5LOZA 2IFUA 3G2TA 4E6HA 4W9RA 3CKBA 3GZSA 3OXGA 5CMWA 2GRMA 1VDYA 2AXZA 2WXKA 5M72A 3MGBA 4AP2A 2JEKA 4KZCA 2LNIA 4NQ0A 5E75A 3ZYQA 4RVBA 4HFGA 3R7RA 1HG5A 5CMYA 3S7JA 3S7DA 4RG9A 4GYOA 3BEEA 1E90A 3L16A 5KJMA 3N71A 4HOTA 4G23A 3RJVA 3MA5A 4U8HA 4WNEA 3CSTA 4U63A 2L6JA 4C9BB 4EQFA 1S0PA 3CEQA 4UWLA 3GYZA 4EZLA 1H6KA 2WMOA 3FH8A 5ARFA 3SHFA 4GZCA 1LF8A 5J90A 4AEZC 3CQCB 3LS8A 4GCNA 2WXGA 3SGHA 1SQMA 5BW8C 3R9AB 5AIJA 1E8ZA 2LAHA 4CRWA 2BF0X 3JQ0A 4B8AA 4ME2A 4BY6A 3PNTB 4FLHA 2KC7A 3G2SA 1PY1A 2FI7A 2KCLA 4KBQA 4G2VA 4F3VA 2V0PA 4XIFA 1SZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JLB A;  2YHC A;  4I9C A;  2WQH A;  2C2L A;  4UQZ A;  3CVP A;  3CK8 A;  2QFC A;  3LPZ A;  5CCM A;  3TG5 A;  3ASD A;  3S7F A;  4H7X A;  3UQ3 A;  2XGM A;  2KCV A;  2UY1 B;  3Q47 B;  1OUV A;  4UI9 J;  3VTX A;  4GA1 A;  5DIZ A;  5BT1 A;  4XI0 A;  1B89 A;  1HH8 A;  3ZHE A;  4UI9 C;  5D0Q D;  2WPV A;  1ELR A;  3CK7 A;  4KXK B;  2VSN A;  5EKQ D;  4GPK A;  4JA9 A;  4GCO A;  1HXI A;  4WNG A;  5EX0 A;  3PE3 A;  4J0U A;  4G25 A;  5KJL A;  5G05 J;  5D0O D;  4GZ3 A;  3ZN3 A;  4KYO B;  4G24 A;  5LCW J;  5G05 C;  3PE4 A;  1W3B A;  4AY5 A;  3E4B A;  2FBN A;  4APO A;  1A17 A;  2OOE A;  5FZS A;  3MKR A;  3OXF A;  5LCW C;  4J8F A;  4UQY A;  3RKV A;  2VQ2 A;  2FEZ A;  4HOS A;  3MEK A;  2Q7F A;  4N5C A;  3Q4A B;  4Y6W A;  4I9E A;  4BWR A;  4Y6C A;  3Q15 A;  2XCB A;  5FT9 A;  4GA2 A;  2PQR A;  4WUY A;  2XGO A;  4XI9 A;  3QWV A;  4BT9 A;  3LY8 A;  3ZGQ A;  2LSV A;  4J8E A;  4YVQ C;  4U0U A;  3AS8 A;  3LKU A;  3UUX A;  3LYA A;  4HOU A;  3ASF A;  3FFL A;  1PC2 A;  2VGY A;  2VSY A;  2HYZ A;  2XGS A;  4N3C A;  3PDN A;  1FCH A;  2P58 C;  3ZPJ A;  4N3B A;  3FWV A;  2VYI A;  4GYY A;  4GZ6 A;  3NF1 A;  4JHR A;  3KS2 A;  4AY6 A;  2V5F A;  3LY9 A;  3TG4 A;  4A1S A;  3SF4 A;  1IHG A;  1KLX A;  4HOQ A;  1E96 B;  5JJ6 A;  4AM9 A;  3ASG A;  1ZBP A;  3UPV A;  1KT1 A;  3TAX A;  2AVP A;  2Y4T A;  4NRH B;  5AYW D;  4N39 A;  4WND A;  5FZQ A;  4N2S A;  3LY7 A;  3MV3 B;  1WM5 A;  3O48 A;  5A7D B;  3GW4 A;  4CGV A;  3QOU A;  3OXL A;  3QWW A;  5A6C A;  5HI7 A;  4G1T A;  1HZ4 A;  3RO2 A;  5KJK A;  2YQ8 A;  4UQX A;  5FTP A;  3MV2 B;  2UWJ G;  4AIF A;  3CK9 A;  1KT0 A;  5HQ8 A;  2UY1 A;  1Y8M A;  1IYG A;  4ABN A;  4BT8 A;  4U04 A;  3K9I A;  1QQE A;  3SZ7 A;  3ZHE B;  2BUG A;  3RO3 A;  5BNW A;  5FZR A;  3QKY A;  1NA3 A;  3QDN A;  3U4T A;  3ULQ A;  2Y4U A;  2KCK A;  2DBA A;  4IN3 B;  3CVN A;  2C0M A;  3ASH A;  1YA0 A;  5KJN A;  2PZI A;  3IEG A;  4HOR A;  3Q5M A;  5JJT A;  2IF4 A;  4BTA A;  1P5Q A;  2KAT A;  4U07 A;  2MHK A;  3CVQ A;  4BTB A;  3JYS A;  3KD7 A;  3CKC A;  3ESK A;  4H7Y A;  4B94 A;  3LCA A;  3CVL A;  5G04 J;  3Q49 B;  3FP3 A;  1NA0 A;  3AS4 A;  1ZU2 A;  2NC9 A;  4JA7 A;  2PQN A;  2VGX A;  3WXX A;  5G04 C;  4CDR A;  5CHE E;  1WAO 1;  5CCL A;  5C1D A;  4I2W A;  1QZ2 A;  4LEU A;  2XEV A;  2OND A;  4YND A;  2XPI A;  4N3A A;  2LSU A;  1TJC A;  4GYW A;  4WNF A;  2I6H A;  2GW1 A;  2XCC A;  3HYM B;  3CV0 A;  4UI9 K;  4J8D A;  3AS5 A;  2HO1 A;  3URZ A;  3VTY A;  5ARG A;  2C0L A;  3ZFW A;  5FJY A;  3GZ1 A;  3RU0 A;  2J9Q A;  4O6F A;  4U0Z A;  4I17 A;  3GZ2 A;  3QWP A;  4YVO A;  5DBK A;  4JL0 A;  4N2Q A;  3RIB A;  1ELW A;  1NZN A;  4RG6 A;  1XNF A;  4I2Z A;  4GA0 A;  3S7B A;  2E2E A;  2FO7 A;  3TGO A;  3KAE A;  5JJ7 A;  3U3W A;  2R5S A;  4G26 A;  2PL2 A;  4CGW A;  3EDT B;  2VGX B;  4GZ5 A;  4U0S A;  5EX3 A;  2FF4 A;  2HR2 A;  4I1A A;  2IFU A;  4W9R A;  3CKB A;  3OXG A;  5M72 A;  4NQ0 A;  2LNI A;  3S7J A;  3S7D A;  4RG9 A;  4GYO A;  3BEE A;  5KJM A;  3N71 A;  4HOT A;  4G23 A;  3RJV A;  3MA5 A;  4WNE A;  2L6J A;  4EQF A;  3CEQ A;  3GYZ A;  5ARF A;  4GCN A;  5BW8 C;  3R9A B;  4ME2 A;  2KC7 A;  2FI7 A;  4KBQ A;  2KCL A;  4G2V A;  4F3V A;  4XIF A; 
#chains in the Genus database with same CATH topology
 2JLB A;  1H6O A;  3ZYK A;  3CVP A;  3LPZ A;  2GRL A;  3ASD A;  2IOS A;  4DX7 D;  3EUV A;  1YCS B;  2UY1 B;  4FHJ A;  2L9B A;  2BKG A;  3FU6 A;  5D2M C;  4EEC A;  3ENE A;  5BT1 A;  3X2Q E;  3MYV A;  4HI8 A;  5ENT D;  4HRM B;  2WPV A;  4I1O B;  3CK7 A;  5EIL A;  2VSN A;  2OVF A;  4GPK A;  2XHE A;  3DWL G;  1WG0 A;  1HXI A;  2R02 A;  4UWG A;  1TJF A;  3PE3 A;  4DUI A;  4ANV A;  4UWK A;  3AU5 A;  3HG0 D;  4FA6 A;  5D0O D;  4A3T A;  3EHM A;  1FT2 A;  3ZN3 A;  1BD8 A;  4G24 A;  2EIN E;  4L7T A;  1IQR A;  1EPU A;  2VJ8 A;  4PDX A;  5G05 C;  3PE4 A;  1W3B A;  3PUJ A;  4AY5 A;  3UM1 A;  1O5M A;  2ETB A;  2RFA A;  3MKR A;  5LCW C;  2LO6 A;  3JUI A;  4HOS A;  2XRY A;  3EU9 A;  1N9A A;  2EQX A;  2MOW A;  3CVV A;  3R9M A;  1U2V G;  4BWR A;  3FUK A;  3UX4 A;  1OWO A;  2F8X K;  3PZD A;  2PQR A;  4WUY A;  4HS2 A;  3PRE A;  1Z3Y A;  4K5A B;  4O60 A;  4N5Q A;  5FQ4 A;  2DZO A;  2IU1 A;  2ZU6 B;  1E8Y A;  4FAD A;  3TWT A;  4KT6 B;  4HBD A;  2LAI A;  3UUX A;  3ESL A;  3LYA A;  3FUH A;  4A55 A;  2B0O E;  4TRQ A;  3ABM E;  4EBA A;  1MYO A;  3U66 A;  3PDN A;  1LD7 A;  4HLL A;  4AVX A;  4GTS A;  2OEV A;  3T8M A;  4AOF A;  1D9S A;  4GZ6 A;  3W9F A;  4ILG A;  1N52 A;  4AY6 A;  3FUD A;  4DX6 D;  2P9P G;  3TG4 A;  5FQ8 A;  3SF4 A;  2V4H C;  2F8Y A;  3I5P A;  2CHZ A;  5JHB A;  1K8K G;  1H2T C;  2NXP A;  2X6F A;  3TWV A;  4QQI A;  4APF A;  3IKO B;  4A1G A;  4XX5 A;  1NL4 A;  4KMO A;  4KZ0 A;  4NRH B;  1E7U A;  3L08 A;  4DX2 A;  3LY7 A;  3PH0 C;  3FTW A;  1S70 B;  4F53 A;  1Y6I A;  5KBA A;  3GW4 A;  3NB2 A;  3CVX A;  5H7P A;  4Q94 A;  3TL5 A;  3IHV A;  3LEW A;  4Z68 A;  4G1T A;  3NOC D;  3Q9N C;  4UQX A;  3CK9 A;  4CCA A;  5CEA A;  3KEA A;  2LUH A;  4J8Y A;  3B7U X;  2DYS E;  3SZ7 A;  3E32 A;  3CR3 A;  5AJD A;  3ZHE B;  1V54 E;  4LER A;  3HXB A;  4FJZ A;  2EIJ E;  1HU3 A;  1OWN A;  4JHK A;  5CEC B;  1NA3 A;  3DSV A;  1MQS A;  4GTV A;  3D3M A;  2YNQ A;  3C3R A;  4Q69 A;  3B7S A;  1Z5S C;  2Y1L E;  3V2O A;  4IN3 B;  3E30 A;  2R05 A;  5BUZ A;  4FU3 A;  3CVN A;  2BED A;  4K03 A;  1E8X A;  3IEG A;  1P5Q A;  2KAT A;  1O1R A;  3CVQ A;  2GRN B;  5KNG A;  1HX8 A;  3SBT B;  1SW6 A;  4B94 A;  1NA0 A;  1OCZ E;  4JEH A;  5BXO A;  4BET A;  1ZU2 A;  3EIJ A;  4JA7 A;  5BV0 A;  5IY5 E;  3JCK C;  3FUN A;  2J07 A;  3FTY A;  2AWI A;  4XEI G;  3UKR G;  2RKK A;  4I2W A;  1TNU A;  4IYP A;  2DIW A;  1QYM A;  1OWP A;  3EHR A;  4FLB A;  3BG1 B;  2WXJ A;  1FVF A;  2LSU A;  4KVM A;  3IBE A;  4XKB A;  1U3C A;  3ZYL A;  5ARG A;  5FJY A;  3GZ1 A;  1QNF A;  4U0Z A;  1O1T A;  3QWP A;  4I6J A;  3TWX A;  2A4Z A;  1ELW A;  1NZN A;  3FU3 A;  4I2Z A;  4K5C A;  3SBS A;  2E2E A;  3UIO C;  3TGO A;  3KAE A;  3DSW A;  5JJ7 A;  3MX3 A;  3SFZ A;  2R5S A;  3SO8 A;  3D9N A;  3L54 A;  1UG3 A;  4LNG A;  3CKB A;  3OXG A;  1VDY A;  1TNO A;  4KZC A;  3ZYQ A;  4RG9 A;  2L6B A;  3BEE A;  4HOT A;  4G23 A;  3MA5 A;  4WNE A;  3CST A;  3DXM G;  4U63 A;  2L6J A;  4EQF A;  1S0P A;  2WMO A;  5J90 A;  3UKU G;  3SY2 A;  4GCN A;  1SA4 A;  3SGH A;  2ZIR A;  3L9T A;  4ZHB A;  3DST A;  3JXI A;  4FLH A;  2FI7 A;  2KCL A;  4F3V A;  2V0P A;  1SZ9 A;  2YHC A;  4I9C A;  2A5E A;  2IO2 C;  3ZW3 A;  3CK8 A;  1Z3X A;  2QC9 A;  3S7F A;  4H7X A;  3B13 A;  4UI9 J;  2ZIS A;  4J7W A;  4XI0 A;  1B89 A;  3ZU7 B;  3PZ4 A;  3ULY A;  1N94 A;  4KXK B;  3ZVV A;  1DVP A;  2DYR E;  2X6J A;  1V55 E;  2LXM A;  5EKQ D;  1Q2Z A;  5B1B E;  4JA9 A;  1K1B A;  4GCO A;  4JC8 A;  4V3I A;  2GRO B;  4WNG A;  5EX0 A;  2J49 A;  4GAA A;  4QFV A;  1TYQ G;  3BUA A;  2L0T B;  3UI2 A;  2OV8 A;  3DSS A;  2P9N G;  1D8D A;  4KVO A;  2KM4 A;  2FBN A;  2OOE A;  4LSZ E;  5HKP A;  3L6A A;  3OXF A;  2WQ7 A;  3KSQ A;  3NAW A;  4UQY A;  1N0R A;  3DEO A;  4YDW A;  3UT8 A;  3BG0 B;  2Q7F A;  2DWZ A;  1H19 A;  3Q4A B;  2XRZ A;  2I1K A;  4FC8 A;  4Y6W A;  4XE0 A;  3B7B A;  4HXI A;  5ANL A;  3L17 A;  3I3N A;  4O1P A;  1OT8 A;  4Y6C A;  4YDE A;  4GTO A;  3Q15 A;  2XCB A;  5FT9 A;  2ETC A;  4CT0 A;  5A23 A;  1WY6 A;  2XGO A;  3ZXS A;  2R59 A;  4XI9 A;  3MZL B;  3G2W A;  3QWV A;  5LX8 A;  3JUE A;  4PUC A;  2GRR B;  3ZGQ A;  2LSV A;  2WQ6 A;  1LTX A;  1TR4 A;  4M7C A;  4GMJ A;  1BU9 A;  1BI7 B;  3QJZ A;  4HOU A;  3TWQ A;  2VGY A;  4U96 D;  2VSY A;  3JXJ A;  4GTR A;  1FCH A;  1BPO A;  2P58 C;  3HIZ A;  3AAA C;  3HXD A;  2PNN A;  3ZPJ A;  3FWV A;  3NF1 A;  4HLE A;  4OYS A;  1HO8 A;  3KS2 A;  3W9G A;  2XPZ A;  4A1S A;  2ILR A;  2WXM A;  3D9M A;  4JB8 P;  5JJ6 A;  2J8S D;  1E8W A;  4AM9 A;  2F37 A;  4I6G A;  1ZBP A;  5EYL A;  2Y3A A;  5AYW D;  3HXF A;  5FQ6 A;  1TNB A;  5FZQ A;  4ATZ D;  2ZXW E;  5KWD A;  3MV3 B;  2AW6 A;  1JCQ A;  4OAV B;  1H2V C;  3AU4 A;  4LRZ A;  1GW6 A;  4OVV A;  4BEP A;  3OXL A;  5AJL A;  1TN7 A;  1N4R A;  3J5P A;  2BKK B;  5A6C A;  3UM0 A;  4DI4 A;  3O4Z A;  1HZ4 A;  3RO2 A;  4R7L A;  3FUF A;  5FTP A;  1FT1 A;  4FUL A;  2ZGD A;  4NAC A;  4BSX A;  2UY1 A;  3CGH A;  2KZT A;  4BT8 A;  1XGW A;  1EF1 C;  3DPY A;  3C72 A;  2QYU A;  2BUG A;  3DSU A;  3R7Q A;  3UT4 A;  5EYP F;  5G2N A;  3CHR A;  3G2V A;  5FZR A;  3QKY A;  5FIN A;  5AQ7 A;  5FQ7 A;  2X38 A;  2Y4U A;  1ELK A;  1AP7 A;  4BX9 A;  4MBG A;  4ZFH A;  4Q96 A;  4XZ4 A;  5CER B;  3ASH A;  3FHE A;  3P2B A;  2V4L A;  2F0Y A;  1YA0 A;  5B1A E;  4GU5 A;  5JJT A;  3UIN C;  5ENQ D;  4BTB A;  2MHK A;  4CDN A;  3UTM A;  3NZS A;  3MKQ A;  3ZNG A;  1S64 A;  3JYS A;  2Y0B G;  2J4D A;  3DXK G;  3ESK A;  2XS8 A;  4CEM A;  3CVL A;  2X6H A;  4JXT A;  3FP3 A;  3SNX A;  2NC9 A;  3QK0 A;  2VGX A;  4OVU A;  5G04 C;  4M3O A;  2XZT G;  2CFZ A;  2YIN A;  5CCL A;  2ION A;  3PEU B;  4TV3 A;  4BX8 A;  2P9L G;  4YND A;  1OWM A;  4GZD A;  1JWG A;  1TJC A;  4GYW A;  4WNF A;  5AN8 A;  2FO1 E;  2XCC A;  3CV0 A;  2AXU A;  4L23 A;  1U3D A;  4URK A;  3URZ A;  2WXR A;  3VTY A;  3FUM A;  3CHS A;  3HDX A;  2PM6 A;  4O6F A;  1IHB A;  4JL0 A;  4B8C B;  2OEW A;  4N2Q A;  3P1U A;  2OCC E;  4PS3 A;  4RG6 A;  2CG3 A;  3S7B A;  2P9K G;  3AG3 E;  1X5B A;  2WXP A;  2J08 A;  2MYO A;  3UM3 A;  3U3W A;  1MHQ A;  4GZ5 A;  4U0S A;  5EX3 A;  1HFA A;  2JAB A;  1H6P A;  4I1M A;  2WXO A;  3G2T A;  4E6H A;  4W9R A;  5CMW A;  2JEK A;  4NQ0 A;  2LNI A;  3TWS A;  2ZGG A;  3RJV A;  4U8H A;  2KXP C;  4UWL A;  3GYZ A;  5B3S E;  1OCR E;  5CED B;  5ARF A;  4GZC A;  4AEZ C;  4RQI A;  1SQM A;  1E8Z A;  3F6Q A;  2BF0 X;  3JQ0 A;  4B8A A;  3PNT B;  2KC7 A;  4NIK A;  3D9J A;  4BFR A;  2C2L A;  2QY7 A;  4L2L A;  4UQZ A;  5CBO A;  2QFC A;  3APC A;  4ANX A;  5G55 A;  3VLE A;  3UQ3 A;  2XGM A;  5E76 A;  1WDY A;  3FUI A;  5LP0 A;  1OUV A;  2WB2 A;  4GA1 A;  5DIZ A;  4HNA D;  3ZHE A;  1K1A A;  1ELR A;  4GML A;  3CIA A;  1UW4 B;  2IQC A;  2V5Q C;  4NUR A;  4U7E B;  3L13 A;  1MX4 A;  4J0U A;  5G05 J;  2QZA A;  3C3Q A;  1FPP A;  3ML9 A;  4MRU A;  5LCW J;  2HM8 A;  1OWL A;  1MX2 A;  3E4B A;  3CHM A;  4B89 A;  4APO A;  1A17 A;  3E33 A;  3PS6 A;  4ATG A;  1TEZ A;  4J8F A;  3FTX A;  1JCR A;  3RKV A;  2YHE A;  5KNH D;  1KZP A;  3DEP A;  1HF8 A;  5JHA A;  3RRU A;  3LDZ A;  3FUJ A;  2GRQ B;  5ENP D;  3MEK A;  4N5C A;  4I9E A;  3DPD A;  3HVE A;  3NBN B;  2XEH A;  4GA2 A;  1EYH A;  1SZA A;  4JZY A;  3NZU A;  4YVQ C;  2P9I G;  4F6R D;  4U0U A;  1UJK A;  3BU8 A;  3RK6 A;  2WXH A;  3CVY A;  4CDM A;  3LKU A;  1UN9 A;  4ACK A;  5LFA A;  4PH4 B;  1PC2 A;  3FH7 A;  1IQU A;  2V8S E;  3SFX A;  3D9I A;  2HYZ A;  5BXU A;  1DNP A;  4F7A A;  3CHO A;  1JPL A;  1LD8 A;  4HB5 A;  4XKC A;  3CVU A;  2XPY A;  3ULE G;  2VGE A;  3TWU A;  3NQP A;  3EJN A;  3D9H A;  3Q79 A;  1OCC E;  3PZ3 A;  5BPP A;  3U64 A;  3ZRH A;  4TUU A;  4N3B A;  4IUL A;  2VYI A;  4DI3 A;  4JHR A;  1HS6 A;  4JPS A;  5ITZ F;  2V5F A;  3UT7 A;  1IHG A;  4O1O A;  3Q75 A;  4HOQ A;  2XEN A;  3CHP A;  3DSX A;  5ENR D;  3SD5 A;  2J09 A;  3D9O A;  1KT1 A;  3C5R A;  1OCO E;  5D66 A;  2H6G A;  4N39 A;  3CLJ A;  4N2S A;  2A5U A;  3U9W A;  5T3R A;  5AEN A;  4CGV A;  1N11 A;  4DK5 A;  1MZC A;  1JCS A;  2R03 A;  3Q7F A;  4TUM A;  5HI7 A;  3FEX A;  2WXF A;  4MKT A;  4BES A;  4DPR A;  1O1S A;  5KJK A;  4JD2 G;  2H6H A;  2IJG X;  4RLY A;  1KT0 A;  4AXH A;  4DRX E;  1Y8M A;  4U04 A;  3K9I A;  4BER A;  3Q7A A;  4K0R A;  1OY3 D;  4LNB A;  2VTB A;  2H6F A;  3UM2 A;  1X81 A;  3FY4 A;  1N4S A;  4B93 B;  2PM7 A;  3T9K A;  3FTV A;  3U4T A;  4HVB A;  2KCK A;  3J5Q B;  3FTZ A;  2FUL A;  3FU0 A;  4L9P A;  1DC2 A;  4BSZ B;  3ONK A;  1H2U A;  1N4Q A;  5AQB A;  2RD0 A;  4L1B A;  4EZJ A;  4HOR A;  4UWH A;  3FEY A;  2IF4 A;  4FJY A;  4U07 A;  2DVW A;  2XEE A;  3EIQ C;  2NSZ A;  4H7Y A;  5ANR A;  2AJA A;  3APD A;  3ASN E;  4I6E A;  3D9P A;  3AS4 A;  2PQN A;  4J6I A;  5CHE E;  3AG2 E;  1OXJ A;  1BI8 B;  2KZT B;  2P2C P;  5C1D A;  3ABL E;  1KPS B;  1QZ2 A;  2I1J A;  2OND A;  4ILI A;  1N0Q A;  2XPI A;  4N3A A;  4GTQ A;  3NOG D;  1E7V A;  4DLQ A;  3QAQ A;  4EZK A;  3ZKJ A;  3HYM B;  4UI9 K;  4IRU A;  3LJ3 A;  3AS5 A;  5FIO A;  4CT4 A;  1SA5 A;  2C0L A;  3ZIM A;  3RU0 A;  2J9Q A;  1UOH A;  4F1S A;  3GZ2 A;  5CRU A;  4I43 A;  3B7T A;  3SFY A;  3LXU X;  3MKQ B;  3E37 A;  3RIB A;  5HS0 A;  3ZXP A;  1XNF A;  3LVQ E;  4GA0 A;  3EU5 A;  4JEU A;  1Z6T A;  1RZ4 A;  3B7R L;  1N54 A;  3DRA A;  2I9C A;  3KEZ A;  2WVI A;  3KSL A;  4G8K A;  4LG6 A;  4G26 A;  2IO3 C;  2PL2 A;  2XZD G;  2VGX B;  2HR2 A;  4I1A A;  2M63 A;  1TNY A;  1S63 A;  4G8L A;  3AG1 E;  2AXZ A;  5M72 A;  3MGB A;  4AP2 A;  4CYM D;  4RVB A;  5CMY A;  3S7D A;  3L16 A;  4TXR A;  3N71 A;  3C3O A;  4EZL A;  3FH8 A;  1MX6 A;  3SHF A;  1LF8 A;  3LS8 A;  5AIJ A;  5BW8 C;  4CRW A;  5JA4 D;  4ME2 A;  3LJN A;  3G2S A;  1PY1 A;  4G2V A;  4XIF A;  2Y69 E;  3RRN B;  2WQH A;  4FHK A;  3E34 A;  5CCM A;  3TG5 A;  4A63 B;  3L82 A;  2KCV A;  2VSO E;  1K3Z D;  4HRN A;  3Q47 B;  3PNL B;  4WWO A;  3RSE G;  1N95 A;  3MCX A;  3VTX A;  4AJW A;  3IXE A;  3B95 A;  3HXC A;  1HH8 A;  1JWF A;  4P29 A;  4UI9 C;  5D0Q D;  4DX1 A;  2EIL E;  3Q78 A;  3UXG A;  4EBA G;  3PEV B;  3IHY A;  3PRZ A;  4WWP A;  4J8S A;  5AQA A;  2B6C A;  5T8I A;  3AJI A;  4G25 A;  5KJL A;  4MLP A;  2XS1 A;  4GZ3 A;  4KYO B;  1EDU A;  3CHQ A;  2DCP A;  5AAR A;  1DCE A;  2P9S G;  4HQD A;  5FZS A;  2EIK E;  4FP7 A;  2VQ2 A;  2FEZ A;  3LVR E;  4LNU D;  3TWW A;  2R2L A;  2WXQ A;  3EHN A;  3QB2 A;  2E0I A;  2WXI A;  5T4Y A;  4K5B A;  2CHX A;  3AG4 E;  3FTS A;  5FWQ A;  2GRP B;  3MJW A;  4GTP A;  3RAU A;  4PS7 A;  4UWF A;  2GGF A;  4WAF A;  4C0M A;  4HRL A;  3TWR A;  4BT9 A;  3CSF A;  3T8K A;  3V2X A;  3LY8 A;  4DLO A;  4J8E A;  3Q9U C;  3C98 A;  3ZEF A;  3AS8 A;  2IOL A;  4A3V A;  2RFM A;  1A5E A;  3ASF A;  3FFL A;  4YDO A;  3CVW A;  4U8Y D;  5J08 A;  5C2Y A;  2XGS A;  4N3C A;  3SQV A;  1UN8 A;  3TXN A;  2VSX E;  4LCT A;  1MJ0 A;  4F1P A;  3L22 A;  5JMN D;  3D9L A;  3OTN A;  4GYY A;  1D8E A;  1QBQ A;  1ZB1 A;  3S2A A;  2CHW A;  2QYJ A;  1IKN D;  5ENO D;  4ANW A;  3SI5 A;  3T5V A;  4DX5 D;  3HVE B;  3HHM A;  3LY9 A;  4CZ2 D;  2XQ0 A;  2HE0 A;  4UUC A;  1KLX A;  1E96 B;  4L2Y A;  4DJA A;  5KCM A;  1AWC B;  3ASG A;  1FVH A;  3JQ1 A;  2LXL A;  1TNZ A;  3I4G A;  3UPV A;  4E85 A;  3TAX A;  4EHM A;  2AVP A;  2Y4T A;  3UMV A;  4MS6 A;  4WND A;  3QAR A;  5AAO A;  2X3M A;  1WM5 A;  3O48 A;  2RG8 A;  3PUK A;  3T5X A;  5A7D B;  5AQ9 A;  3ONL A;  2P9U G;  1JUQ A;  3QOU A;  1H0A A;  4PS8 A;  1YYH A;  3DBS A;  3PVL A;  1G3N B;  3V30 A;  3QWW A;  3FU5 A;  3PZ1 A;  2WMN A;  3OAW A;  3TXM A;  3VLD A;  4G11 A;  1L5J A;  3QC1 A;  4ANU A;  4GPM A;  2YQ8 A;  3FUE A;  3MV2 B;  2UWJ G;  4AIF A;  3ZUV B;  2L0I A;  5HQ8 A;  1IYG A;  4ABN A;  1QQE A;  3G2U A;  4RSY A;  3RO3 A;  4GTT A;  5BNW A;  3FH5 A;  2IEJ A;  1NP7 A;  3QDN A;  3CQG B;  5EN5 D;  1UJJ A;  3ULQ A;  4GB9 A;  4X8Q A;  2DBA A;  4JHJ A;  4JVS A;  3ISM C;  2CG2 A;  1INZ A;  2C0M A;  3FDH A;  4C0E A;  5KJN A;  4GMR A;  2PZI A;  4GTM A;  3Q5M A;  3I4R B;  4BTA A;  1N4P A;  3V79 K;  3KD7 A;  2WXL A;  5EDS A;  2J4B A;  1TN8 A;  1PAQ A;  3CKC A;  2MRI A;  1HG2 A;  2KBX A;  1BLX B;  3LCA A;  5G04 J;  3Q49 B;  2NYJ A;  5ENS D;  4D10 C;  3FUL A;  2X6I A;  2DZN A;  4HI9 A;  2WXN A;  5CBN A;  3WXX A;  4CDR A;  2BTD A;  1TN6 A;  3UIP C;  4AV7 A;  3V31 A;  1WAO 1;  1SVX A;  3Q73 A;  1RW2 A;  2I2O A;  4LEU A;  5ENN A;  2XEV A;  1YMP A;  3VLF A;  2X6K A;  2VTB B;  3QNK A;  4ACL A;  2I6H A;  2GW1 A;  3ML8 A;  3TJP A;  4JW1 A;  4J8D A;  2AXV A;  3IV0 A;  3PZ2 A;  4TXP A;  2HO1 A;  4WWN A;  3ZFW A;  2OVB A;  3FTU A;  4I17 A;  3APF A;  4YVO A;  3RRM B;  1HE8 A;  4LUN U;  5DBK A;  4B0Z A;  3HXE A;  2H6I A;  2WM9 A;  5BV1 A;  5CRV A;  4YDY A;  2R17 C;  3D9K A;  1IXV A;  1DCQ A;  5EIB E;  2FO7 A;  4EPZ A;  4OAU C;  3EHQ A;  3ZYM A;  3BQO A;  4CGW A;  3ASO E;  1NI1 A;  3EDT B;  2CFU A;  4ILH B;  4U95 D;  2FF4 A;  4TXQ A;  5LOZ A;  2IFU A;  3GZS A;  3ABK E;  5EID A;  2GRM A;  2WXK A;  4C48 B;  5E75 A;  2ETA A;  2IY0 C;  4HFG A;  1HG5 A;  3R7R A;  3S7J A;  3WG7 E;  4GYO A;  1E90 A;  5KJM A;  2EIM E;  4C9B B;  3CEQ A;  1H6K A;  3CQC B;  4U8V D;  2WXG A;  3R9A B;  5HRY A;  2LAH A;  1KZO A;  4BY6 A;  4KBQ A;  3HRA A;  1NFI E; 
#chains in the Genus database with same CATH homology
 3D9J A;  2JLB A;  2YHC A;  4I9C A;  4BFR A;  3ZYK A;  3RRN B;  2WQH A;  2C2L A;  2QY7 A;  3ZW3 A;  4L2L A;  4UQZ A;  4FHK A;  3CVP A;  3CK8 A;  2QFC A;  3LPZ A;  1Z3X A;  2GRL A;  3APC A;  3TG5 A;  3ASD A;  4ANX A;  5AEN A;  5CCM A;  5BV0 A;  5G55 A;  3VLE A;  2IOS A;  3S7F A;  4H7X A;  3UQ3 A;  3B13 A;  2XGM A;  2KCV A;  5E76 A;  2VSO E;  3FUI A;  2UY1 B;  3Q47 B;  3PNL B;  4FHJ A;  2L9B A;  5LP0 A;  1OUV A;  4UI9 J;  4WWO A;  3FU6 A;  3MCX A;  3VTX A;  2WB2 A;  4AJW A;  4EEC A;  4GA1 A;  5DIZ A;  3ENE A;  5BT1 A;  4XI0 A;  1B89 A;  3MYV A;  1HH8 A;  1JWF A;  4P29 A;  4UI9 C;  5D0Q D;  2WPV A;  3ZHE A;  4I1O B;  1ELR A;  3CK7 A;  4KXK B;  3ZVV A;  1DVP A;  4EBA G;  2X6J A;  4GML A;  2VSN A;  3PEV B;  5EKQ D;  2OVF A;  3CIA A;  4GPK A;  2XHE A;  4JA9 A;  1UW4 B;  4GCO A;  1HXI A;  2IQC A;  4JC8 A;  3IHY A;  4NUR A;  4V3I A;  3PRZ A;  3L13 A;  4UWG A;  4WNG A;  1TJF A;  4WWP A;  5EX0 A;  3PE3 A;  2J49 A;  4J8S A;  4ANV A;  4UWK A;  3AU5 A;  4GAA A;  4QFV A;  5T8I A;  4FA6 A;  4J0U A;  4G25 A;  5KJL A;  5G05 J;  5D0O D;  4MLP A;  4A3T A;  4GZ3 A;  2L0T B;  3EHM A;  2OV8 A;  3ZN3 A;  4KYO B;  1EDU A;  3CHQ A;  4G24 A;  2DCP A;  4L7T A;  3ML9 A;  4MRU A;  5LCW J;  1IQR A;  1EPU A;  2VJ8 A;  4PDX A;  4KVO A;  5G05 C;  2HM8 A;  1OWL A;  2KM4 A;  3PE4 A;  1W3B A;  3PUJ A;  4AY5 A;  3E4B A;  2FBN A;  3CHM A;  4B89 A;  4APO A;  1A17 A;  2OOE A;  5FZS A;  3L6A A;  3MKR A;  3OXF A;  3PS6 A;  5LCW C;  2WQ7 A;  4ATG A;  1TEZ A;  4J8F A;  3FTX A;  4UQY A;  2YHE A;  2LO6 A;  4FP7 A;  3RKV A;  2VQ2 A;  2FEZ A;  3JUI A;  1HF8 A;  4HOS A;  5JHA A;  3RRU A;  3LDZ A;  3LVR E;  3FUJ A;  2XRY A;  3UT8 A;  3BG0 B;  3MEK A;  2Q7F A;  1H19 A;  4N5C A;  3Q4A B;  2EQX A;  2MOW A;  2XRZ A;  3CVV A;  2I1K A;  4FC8 A;  4Y6W A;  4XE0 A;  2WXQ A;  3EHN A;  3QB2 A;  2E0I A;  4HXI A;  2WXI A;  3L17 A;  4I9E A;  5ANL A;  5T4Y A;  4BWR A;  3DPD A;  3FUK A;  3HVE A;  3I3N A;  4Y6C A;  3UX4 A;  1OWO A;  3Q15 A;  2XCB A;  5FT9 A;  2CHX A;  3FTS A;  4GA2 A;  5FWQ A;  4CT0 A;  3PZD A;  5A23 A;  2PQR A;  4WUY A;  4HS2 A;  1WY6 A;  1EYH A;  3MJW A;  3PRE A;  2XGO A;  1Z3Y A;  4PS7 A;  4UWF A;  3ZXS A;  2R59 A;  2GGF A;  4XI9 A;  3MZL B;  4WAF A;  3G2W A;  4C0M A;  3QWV A;  1SZA A;  5LX8 A;  4JZY A;  4PUC A;  4BT9 A;  3CSF A;  5FQ4 A;  3LY8 A;  3ZGQ A;  2IU1 A;  2LSV A;  4J8E A;  4DLO A;  2ZU6 B;  3ZRH A;  3NZU A;  4YVQ C;  2WQ6 A;  1E8Y A;  4U0U A;  1UJK A;  3C98 A;  3ZEF A;  4FAD A;  3RK6 A;  3AS8 A;  2WXH A;  3CVY A;  2IOL A;  4CDM A;  4A3V A;  4KT6 B;  4GMJ A;  3LKU A;  1UN9 A;  4ACK A;  2LAI A;  3UUX A;  5LFA A;  4PH4 B;  3ESL A;  3QJZ A;  3LYA A;  3FUH A;  4HOU A;  4A55 A;  3ASF A;  3FFL A;  1PC2 A;  3FH7 A;  1IQU A;  2V8S E;  4TRQ A;  3CVW A;  5J08 A;  2VGY A;  2VSY A;  5C2Y A;  3D9I A;  2HYZ A;  4EBA A;  2XGS A;  1DNP A;  4N3C A;  4F7A A;  3CHO A;  1JPL A;  3U66 A;  3PDN A;  4XKC A;  3CVU A;  2XPY A;  1FCH A;  1BPO A;  2P58 C;  3HIZ A;  3EJN A;  1UN8 A;  3NQP A;  3TXN A;  2VSX E;  4LCT A;  3L22 A;  5BPP A;  4AVX A;  3U64 A;  4TUU A;  3D9L A;  3T8M A;  3ZPJ A;  3OTN A;  4IUL A;  4N3B A;  3FWV A;  2VYI A;  4GYY A;  4AOF A;  4GZ6 A;  4DI3 A;  3NF1 A;  4HLE A;  4JHR A;  4OYS A;  3S2A A;  4ILG A;  2CHW A;  1N52 A;  1HO8 A;  1HS6 A;  3KS2 A;  4JPS A;  4ANW A;  3SI5 A;  4AY6 A;  3FUD A;  2V5F A;  3UT7 A;  2XPZ A;  3T5V A;  3HVE B;  3HHM A;  3LY9 A;  3TG4 A;  4A1S A;  2ILR A;  2WXM A;  5FQ8 A;  3SF4 A;  1IHG A;  2XQ0 A;  1KLX A;  3I5P A;  3D9M A;  2CHZ A;  5JHB A;  4HOQ A;  1E96 B;  4L2Y A;  3CHP A;  5JJ6 A;  1E8W A;  3SD5 A;  4AM9 A;  1H2T C;  4DJA A;  2NXP A;  2X6F A;  4I6G A;  5KCM A;  3ASG A;  1FVH A;  1ZBP A;  3JQ1 A;  2J09 A;  3D9O A;  4APF A;  3I4G A;  3UPV A;  4E85 A;  3IKO B;  1KT1 A;  3TAX A;  4A1G A;  2AVP A;  4XX5 A;  2Y4T A;  3UMV A;  2Y3A A;  4KMO A;  4KZ0 A;  4NRH B;  1E7U A;  5AYW D;  4N39 A;  3L08 A;  5FQ6 A;  4MS6 A;  4WND A;  5FZQ A;  3CLJ A;  4N2S A;  2A5U A;  3LY7 A;  3PH0 C;  3U9W A;  3MV3 B;  3QAR A;  3FTW A;  2AW6 A;  5T3R A;  2X3M A;  3AU4 A;  1H2V C;  1WM5 A;  2RG8 A;  3O48 A;  3PUK A;  1Y6I A;  4LRZ A;  5A7D B;  3T5X A;  3GW4 A;  4F53 A;  4CGV A;  1GW6 A;  4OVV A;  3ONL A;  4DK5 A;  1JUQ A;  3CVX A;  3QOU A;  1H0A A;  3OXL A;  4PS8 A;  3DBS A;  5AJL A;  3PVL A;  3QWW A;  4Q94 A;  5A6C A;  3FU5 A;  5HI7 A;  3IHV A;  3TL5 A;  3FEX A;  3LEW A;  4DI4 A;  2WMN A;  2WXF A;  4G1T A;  3OAW A;  3O4Z A;  3TXM A;  3VLD A;  4G11 A;  4MKT A;  1L5J A;  3QC1 A;  4ANU A;  1HZ4 A;  4DPR A;  3RO2 A;  4R7L A;  5KJK A;  2YQ8 A;  3FUE A;  3FUF A;  4UQX A;  5FTP A;  4FUL A;  3MV2 B;  2UWJ G;  4AIF A;  3CK9 A;  4NAC A;  2IJG X;  4BSX A;  4CCA A;  1KT0 A;  2L0I A;  4AXH A;  5HQ8 A;  2UY1 A;  1Y8M A;  1IYG A;  4ABN A;  3B7U X;  2KZT A;  3CGH A;  1XGW A;  4BT8 A;  1EF1 C;  4U04 A;  3K9I A;  1QQE A;  3G2U A;  3SZ7 A;  3ZHE B;  2BUG A;  3CR3 A;  4RSY A;  5AJD A;  3R7Q A;  3UT4 A;  4K0R A;  4LER A;  4FJZ A;  3RO3 A;  1HU3 A;  1OWN A;  5G2N A;  5BNW A;  2VTB A;  3CHR A;  3G2V A;  3FH5 A;  3QKY A;  4JHK A;  1NA3 A;  5FZR A;  1NP7 A;  3FY4 A;  3QDN A;  5FQ7 A;  1MQS A;  2PM7 A;  3CQG B;  3D3M A;  2YNQ A;  2X38 A;  3FTV A;  1UJJ A;  3U4T A;  4GB9 A;  3ULQ A;  2Y4U A;  4HVB A;  2KCK A;  4Q69 A;  1ELK A;  4BX9 A;  3FTZ A;  3B7S A;  2FUL A;  2DBA A;  4JHJ A;  3FU0 A;  4JVS A;  2CG2 A;  4IN3 B;  3ONK A;  5BUZ A;  1H2U A;  4FU3 A;  3CVN A;  2RD0 A;  4Q96 A;  1INZ A;  4K03 A;  4XZ4 A;  2C0M A;  1E8X A;  3ASH A;  3FDH A;  3FHE A;  2V4L A;  3P2B A;  4C0E A;  4L1B A;  1YA0 A;  4EZJ A;  5KJN A;  2PZI A;  3IEG A;  4GU5 A;  4UWH A;  4HOR A;  3Q5M A;  3FEY A;  3I4R B;  5JJT A;  2IF4 A;  4BTA A;  4FJY A;  1P5Q A;  2KAT A;  4U07 A;  2MHK A;  3CVQ A;  4BTB A;  4CDN A;  3NZS A;  3MKQ A;  3JYS A;  3KD7 A;  2WXL A;  5EDS A;  2J4B A;  1PAQ A;  3EIQ C;  2J4D A;  2MRI A;  3CKC A;  1HG2 A;  1HX8 A;  3ESK A;  3SBT B;  2NSZ A;  4H7Y A;  5ANR A;  4B94 A;  4CEM A;  3LCA A;  3CVL A;  5G04 J;  3APD A;  3Q49 B;  2X6H A;  4JXT A;  3FP3 A;  4I6E A;  3SNX A;  1NA0 A;  4D10 C;  4JEH A;  3D9P A;  3FUL A;  3AS4 A;  1ZU2 A;  2X6I A;  2NC9 A;  2WXN A;  3EIJ A;  2PQN A;  2VGX A;  3QK0 A;  4JA7 A;  4OVU A;  3JCK C;  3FUN A;  5G04 C;  4J6I A;  4M3O A;  2BTD A;  5CHE E;  3WXX A;  4AV7 A;  4CDR A;  2J07 A;  2KZT B;  3FTY A;  1WAO 1;  2AWI A;  2CFZ A;  2YIN A;  5CCL A;  2ION A;  3PEU B;  4TV3 A;  4I2W A;  5C1D A;  4IYP A;  4BX8 A;  1QZ2 A;  2DIW A;  1OWP A;  2I2O A;  4LEU A;  5ENN A;  2I1J A;  2OND A;  2XEV A;  4ILI A;  4FLB A;  3VLF A;  2X6K A;  3BG1 B;  4YND A;  1OWM A;  2WXJ A;  2XPI A;  2VTB B;  4GZD A;  4N3A A;  1FVF A;  2LSU A;  4KVM A;  1JWG A;  3QNK A;  1TJC A;  4GYW A;  4WNF A;  4ACL A;  2I6H A;  1E7V A;  3IBE A;  4DLQ A;  3QAQ A;  4XKB A;  4EZK A;  2GW1 A;  2XCC A;  3HYM B;  3ML8 A;  3TJP A;  3CV0 A;  4JW1 A;  4UI9 K;  4J8D A;  2AXU A;  4L23 A;  1U3D A;  4IRU A;  3LJ3 A;  1U3C A;  2AXV A;  3AS5 A;  3IV0 A;  4URK A;  4CT4 A;  3ZYL A;  2HO1 A;  3URZ A;  2WXR A;  3VTY A;  5ARG A;  3FUM A;  4WWN A;  2C0L A;  3ZFW A;  2OVB A;  3CHS A;  5FJY A;  3HDX A;  3GZ1 A;  3ZIM A;  3RU0 A;  1QNF A;  2J9Q A;  3FTU A;  2PM6 A;  4O6F A;  4F1S A;  4U0Z A;  4I17 A;  3GZ2 A;  3APF A;  3QWP A;  4I43 A;  1HE8 A;  4I6J A;  4LUN U;  4YVO A;  3RRM B;  5DBK A;  3B7T A;  3LXU X;  4B0Z A;  4JL0 A;  4B8C B;  3MKQ B;  4N2Q A;  2WM9 A;  5BV1 A;  3P1U A;  2A4Z A;  2R17 C;  3RIB A;  1ELW A;  1NZN A;  4PS3 A;  4RG6 A;  3D9K A;  1XNF A;  3FU3 A;  3LVQ E;  4I2Z A;  4GA0 A;  2CG3 A;  4JEU A;  1Z6T A;  3S7B A;  3SBS A;  3B7R L;  1X5B A;  1N54 A;  2E2E A;  2WXP A;  2FO7 A;  4EPZ A;  3TGO A;  3KAE A;  2I9C A;  3KEZ A;  2J08 A;  5JJ7 A;  3MX3 A;  2WVI A;  3SFZ A;  3ZYM A;  3U3W A;  2R5S A;  4G26 A;  2PL2 A;  4CGW A;  1MHQ A;  3EDT B;  3D9N A;  2CFU A;  2VGX B;  4GZ5 A;  4U0S A;  3L54 A;  5EX3 A;  4ILH B;  2FF4 A;  2HR2 A;  1HFA A;  4I1A A;  2M63 A;  1UG3 A;  4I1M A;  2WXO A;  5LOZ A;  2IFU A;  3G2T A;  4E6H A;  4W9R A;  3CKB A;  3GZS A;  3OXG A;  5CMW A;  2GRM A;  1VDY A;  2AXZ A;  2WXK A;  5M72 A;  3MGB A;  4AP2 A;  2JEK A;  4KZC A;  2LNI A;  4NQ0 A;  5E75 A;  3ZYQ A;  4RVB A;  4HFG A;  3R7R A;  1HG5 A;  5CMY A;  3S7J A;  3S7D A;  4RG9 A;  4GYO A;  3BEE A;  1E90 A;  3L16 A;  5KJM A;  3N71 A;  4HOT A;  4G23 A;  3RJV A;  3MA5 A;  4U8H A;  4WNE A;  3CST A;  4U63 A;  2L6J A;  4C9B B;  4EQF A;  1S0P A;  3CEQ A;  4UWL A;  3GYZ A;  4EZL A;  1H6K A;  2WMO A;  3FH8 A;  5ARF A;  3SHF A;  4GZC A;  1LF8 A;  5J90 A;  4AEZ C;  3CQC B;  3LS8 A;  4GCN A;  2WXG A;  3SGH A;  1SQM A;  5BW8 C;  3R9A B;  5AIJ A;  1E8Z A;  2LAH A;  4CRW A;  2BF0 X;  3JQ0 A;  4B8A A;  4ME2 A;  4BY6 A;  3PNT B;  4FLH A;  2KC7 A;  3G2S A;  1PY1 A;  2FI7 A;  2KCL A;  4KBQ A;  4G2V A;  4F3V A;  2V0P A;  4XIF A;  1SZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...