2KC7A

Solution nmr structure of bacteroides fragilis protein bf1650. northeast structural genomics consortium target bfr218
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'MDQLKTIKELINQGDIENALQALEEFLQTEPVGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDILNFYNKDMYNQLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bfr218_protein
publication title Solution NMR structure of Bacteroides fragilis protein BF1650. Northeast Structural Genomics Consortium target BfR218
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kc7A00
2NC9A 4JHRA 3S7JA 4UI9K 1IHGA 2HYZA 4UI9C 3KS2A 3U4TA 5EX3A 3VTYA 3LKUA 5ARGA 2IF4A 5ARFA 4AIFA 3WXXA 2P58C 5BW8C 3EDTB 3IEGA 4GZ3A 5BT1A 4U07A 2PL2A 4APOA 4UQYA 3RU0A 5JJTA 4GCOA 3GZ1A 3O48A 3ZPJA 5HI7A 1WAO1 3S7FA 4GA1A 1NA3A 2FF4A 4B94A 5FJYA 3CV0A 4RG9A 2VYIA 4HORA 3FWVA 3CK8A 5KJMA 3Q15A 4NQ0A 3QOUA 4I2WA 4GCNA 3GW4A 3GZ2A 4A1SA 2XGOA 2PZIA 3KAEA 3PE4A 4G26A 3RO2A 5JJ7A 5DIZA 3QWVA 4N5CA 2UY1A 1KT1A 2YHCA 2WQHA 5G04J 2KCVA 4JA7A 4GZ6A 3NF1A 3ZN3A 3KD7A 3MKRA 3QDNA 3HYMB 1PC2A 1A17A 3MV2B 5KJNA 4U0ZA 5M72A 1E96B 5FZSA 5G05J 4N39A 3CKBA 4GA2A 2OOEA 4J8FA 4UI9J 4WUYA 4EQFA 4IN3B 2E2EA 4UQZA 2FI7A 3JYSA 4GYYA 4G25A 3U3WA 2PQRA 4LEUA 1KLXA 2GW1A 4H7XA 5D0QD 3S7DA 3ASHA 3QKYA 3CVLA 4U04A 3PDNA 4U0SA 2HO1A 2C0MA 5BNWA 3AS8A 5A6CA 3ASFA 2VGXB 3QWPA 2FEZA 3ULQA 2I6HA 3ESKA 4H7YA 3LCAA 4AY5A 2VQ2A 3AS4A 4N3CA 5LCWC 1W3BA 3GYZA 2VGYA 4KXKB 3ASDA 5EKQD 3QWWA 4BTAA 1HH8A 4WNFA 4YNDA 1HZ4A 1WM5A 3CK7A 3LY7A 4G1TA 5D0OD 4I9EA 3MV3B 2MHKA 2YQ8A 2AVPA 5A7DB 5AYWD 5HQ8A 3Q47B 3R9AB 2WPVA 1QQEA 3LPZA 4HOSA 3TGOA 4BT8A 1FCHA 4GYOA 4GA0A 3Q49B 2VSYA 3TAXA 4J8EA 3TG5A 4YVOA 4GYWA 4KBQA 1OUVA 2XGMA 2FBNA 1ELRA 4G23A 2KC7A 1TJCA 4XI9A 5FZRA 4Y6WA 4HOQA 4XIFA 3URZA 2C2LA 3SF4A 1NZNA 4I1AA 4NRHB 3MEKA 4Y6CA 2V5FA 5DBKA 2R5SA 4G24A 3E4BA 5KJKA 2QFCA 1ELWA 4GPKA 3ZHEB 5C1DA 4ME2A 3VTXA 3FP3A 2XCCA 3UQ3A 2DBAA 2KCLA 3MA5A 5LCWJ 5CCLA 1KT0A 4N3AA 2XCBA 3AS5A 5FT9A 5KJLA 2XPIA 5EX0A 3RJVA 3ASGA 4AM9A 5G05C 2KATA 3CK9A 1Y8MA 1NA0A 4WNDA 2PQNA 2UWJG 4HOTA 4XI0A 3UPVA 4BTBA 4RG6A 3RO3A 3RIBA 2FO7A 4I9CA 2VGXA 2XEVA 4WNGA 4HOUA 4F3VA 2VSNA 2XGSA 4U0UA 5CCMA 2KCKA 3CKCA 2JLBA 3RKVA 3UUXA 2UY1B 4UQXA 1HXIA 2LSVA 3PE3A 5FZQA 4J0UA 4GZ5A 4JA9A 3CVQA 2HR2A 4N2QA 3CVPA 3BEEA 3N71A 3CEQA 4CGWA 2Y4UA 2J9QA 4CDRA 3Q4AB 2LNIA 2LSUA 4JL0A 2L6JA 4G2VA 3OXLA 1ZBPA 3FFLA 3SZ7A 2ONDA 3LY9A 2IFUA 4BT9A 3LYAA 4I2ZA 1B89A 2Y4TA 4AY6A 3OXGA 4WNEA 4W9RA 1ZU2A 3ZFWA 3S7BA 5G04C 3OXFA 4O6FA 1QZ2A 5CHEE 4N2SA 1IYGA 3LY8A 4YVQC 3K9IA 3CVNA 1XNFA 4BWRA 4J8DA 1P5QA 1YA0A 5FTPA 5JJ6A 2BUGA 2C0LA 4I17A 3TG4A 3ZGQA 2Q7FA 4N3BA 3Q5MA 4KYOB 4ABNA 4CGVA 3ZHEA
chains in the Genus database with same CATH superfamily
2NC9A 4NURA 4JHRA 2CHXA 3S2AA 4GAAA 3U4TA 3G2WA 3VTYA 1UJJA 4Q94A 5ENTD 3PRZA 5ARFA 4AIFA 3ZVVA 3Q79A 2H6FA 5BW8C 1N95A 2VSOE 3EDTB 3IEGA 2DZNA 1D8EA 2QYJA 3LS8A 4FLHA 5BT1A 3FH8A 4EZLA 3GZSA 4U07A 1L5JA 4UWFA 4TUMA 5FQ8A 1OCRE 1NP7A 4UQYA 3ABLE 5CECB 5LP0A 5BXUA 3EIJA 1ELKA 2FF4A 5FJYA 3NZUA 4RG9A 1NL4A 1A5EA 3IKOB 3FH7A 4CYMD 4PS8A 4A1SA 2X6HA 2XGOA 2PZIA 4A3VA 4G26A 5JHBA 3QWVA 4I6JA 4GTRA 5JMND 1FVHA 2XHEA 3EHMA 2XS8A 4AJWA 2XENA 2WXIA 2OEWA 3EHRA 4GZ6A 3OTNA 4DX7D 1OWNA 3T8MA 1U2VG 5E75A 4I43A 4G8KA 1KZOA 1SA4A 2AJAA 1A17A 3QB2A 4AP2A 1OWLA 1EDUA 2KBXA 4U0ZA 2WXLA 1E96B 1WG0A 4N5QA 5J08A 4U7EB 4N39A 3CKBA 1H19A 4HQDA 3NB2A 4UI9J 4EQFA 2E2EA 1OCCE 4GYYA 1TNBA 4G25A 1SVXA 3DSSA 4HFGA 1BPOA 2H6HA 3FULA 4JHKA 2XPYA 1V55E 1KLXA 4ANVA 4F1PA 4GB9A 2XRZA 4I1MA 3C3QA 3DXMG 3CVLA 4U8HA 1E7VA 3C72A 4CRWA 1N0QA 3PUKA 2P9PG 3ULQA 3TWUA 3ZKJA 3LCAA 4AY5A 2VQ2A 4N3CA 2DIWA 2EIME 2VGYA 3ULEG 4CZ2D 3PVLA 1INZA 1S64A 2QYUA 4G11A 3G2VA 4BTAA 2J09A 3FUDA 3EIQC 5ENNA 5ENPD 1HZ4A 3CK7A 3R7QA 4GZDA 5H7PA 4G1TA 2XZTG 1N4PA 2WXNA 3ZW3A 1Q2ZA 4UWGA 3SHFA 4EECA 1E8ZA 2YQ8A 3LXUX 5EDSA 4B89A 2F8XK 5HQ8A 4HI9A 1OWPA 3APDA 1SQMA 3PUJA 1QQEA 4PUCA 2HM8A 4GYOA 1HS6A 4KT6B 1Y6IA 3FDHA 3DSWA 4MBGA 1H6KA 3QJZA 4XZ4A 4DI3A 3ISMC 4E6HA 1ELRA 2J4BA 3ASOE 3J5PA 1K8KG 4G23A 5B1BE 3KEZA 3AG2E 5FZRA 2BEDA 3E34A 3E33A 3SF4A 1NZNA 1JWGA 1N4RA 1TNZA 4GU5A 1KPSB 4J8YA 1EF1C 4FU3A 2H6GA 4DX6D 5DBKA 4FULA 2AWIA 2P9KG 2P9LG 3LDZA 4UWHA 2ZISA 3FP3A 4LERA 3PEUB 2KCLA 3MA5A 4N3AA 4BX8A 3AS5A 4A63B 1SA5A 1EYHA 3UM2A 4JHJA 3CK9A 1NA0A 2WVIA 1MHQA 2PQNA 3FUFA 3V79K 3ZIMA 3TWVA 4BTBA 2ILRA 1E8YA 2P9SG 1UOHA 2FO7A 3FTYA 3UINC 2XEVA 1X5BA 4HOUA 3DSXA 2XZDG 4APFA 3ML9A 2WB2A 4HVBA 4K5AB 3FH5A 5FQ6A 3O4ZA 2RFMA 3HXBA 5E76A 5D66A 3SBTB 3PE3A 5D2MC 4J0UA 5BV1A 5KNGA 4HXIA 4GTTA 3DSUA 3BEEA 2GRNB 4B8CB 2X6FA 4TRQA 4FHJA 2F8YA 4U8VD 2WXOA 1E90A 2IQCA 4G2VA 4OVVA 2XEHA 3NOCD 3MX3A 3PZ1A 1DVPA 3WG7E 3EU9A 2LXLA 2KZTB 2P2CP 3JUEA 4W9RA 4XE0A 1ZU2A 3PREA 5AQ7A 2J07A 3L54A 3L08A 1QZ2A 3DBSA 3J5QB 4YDEA 5ITZF 3FUHA 1LF8A 5FTPA 5JJ6A 1MQSA 1TN6A 1FT1A 4EBAG 4F1SA 4GZCA 4JXTA 4LG6A 3B95A 4N3BA 3V31A 4BSZB 4CGVA 3T5VA 4NIKA 3B7BA 4CT4A 2HYZA 4UI9C 3TWTA 1RW2A 5EX3A 5EIDA 3LKUA 3VLFA 4EZJA 3QARA 3SFXA 2IF4A 3SGHA 5G2NA 1TEZA 3HXCA 1WY6A 3HG0D 3MYVA 3DSVA 3IHYA 4TUUA 2B6CA 4HI8A 3ZNGA 3SI5A 4CT0A 2PL2A 2R03A 4APOA 4PDXA 2Y0BG 4GCOA 4IRUA 3NQPA 5HI7A 1WAO1 3S7FA 5BUZA 1NA3A 5CRVA 2DYSE 2P9IG 2VYIA 4HORA 2MRIA 5KJMA 2CFZA 4NQ0A 3KSLA 4JW1A 4GCNA 4XX5A 2I1JA 4U96D 3BG0B 3KAEA 4GMLA 5JJ7A 4N5CA 1KT1A 5FWQA 5CBNA 3BU8A 3JXJA 4KZ0A 2KCVA 4JA7A 2DCPA 3I4GA 2XRYA 3NF1A 2R02A 1FVFA 2CHZA 3KD7A 2J8SD 3MKRA 3QDNA 3HYMB 3L82A 2AW6A 4K5CA 5ENSD 2OEVA 3PNTB 2MYOA 1TR4A 3FHEA 2VJ8A 3ZU7B 1JPLA 4GPMA 2IOLA 2OOEA 4J8FA 4DX1A 2AXUA 3T9KA 4BESA 4DLOA 3U3WA 4LEUA 4XEIG 3CHSA 4JC8A 3I5PA 4K0RA 5BXOA 3Q7AA 5D0QD 3ASHA 3ZXPA 4XKCA 1S0PA 3L13A 2L6BA 3FU5A 4PS3A 5KNHD 3TWRA 4U0SA 2Y3AA 3LVRE 3AS8A 3ASFA 2VGXB 3QWPA 2FEZA 3CVXA 3JXIA 3FUNA 4AVXA 3EU5A 2WXKA 4BERA 5EN5D 1W3BA 3UT4A 2NYJA 1U3DA 4KXKB 3D9OA 3CHQA 4HLEA 5EKQD 3P1UA 1K3ZD 1OCOE 1AP7A 2GRRB 4WNFA 3EHNA 4EHMA 1WM5A 2R17C 2Y69E 3LJNA 3D9HA 4UWLA 3JQ1A 4HS2A 4I9EA 3PZ4A 4WAFA 2EILE 4BSXA 4PS7A 2XEEA 4DK5A 1N4QA 3Q47B 4HOSA 3B7TA 1JCRA 4BT8A 3HXFA 3TAXA 4J8EA 2ZXWE 4YVOA 3DPYA 2EIKE 1IHBA 3NAWA 4V3IA 1BI8B 1TJCA 2YHEA 2A4ZA 4HNAD 4J8SA 4HOQA 1K1AA 4XIFA 2IO2C 4MLPA 2C2LA 4C48B 4BFRA 4I1AA 1O1TA 4NRHB 5AQAA 5B3SE 2X6KA 3UI2A 1X81A 3UTMA 3FTSA 4O1PA 1FT2A 4U63A 3C5RA 1WDYA 2R5SA 4G24A 3SNXA 5KWDA 3CQCB 3D9NA 3AG3E 3ABME 4C0MA 3MZLB 2RG8A 1ELWA 1MZCA 3ZHEB 5C1DA 3VTXA 3V30A 2QC9A 2XCCA 3FTWA 3V2XA 4WWNA 4ACLA 2XCBA 1HE8A 1BU9A 4P29A 3AU4A 4IULA 4RQIA 5FT9A 5KJLA 2IONA 5LX8A 2XPIA 1N11A 1PY1A 2L0TB 3CQGB 1IQRA 5T4YA 3ASGA 4HRNA 2GRMA 5B1AE 3V2OA 4F6RD 3MJWA 1Y8MA 3PH0C 3FTUA 2WXJA 3CLJA 2UWJG 4HOTA 5CMYA 4ILGA 3RO3A 3RIBA 1E8WA 1Z5SC 1MJ0A 4CDNA 2YNQA 4RLYA 2QZAA 4F3VA 4C0EA 2VSNA 2XQ0A 4U0UA 2F0YA 1TN7A 3ZYKA 4EPZA 1OCZE 2QY7A 3CR3A 3Q7FA 2JLBA 3FUIA 2UY1B 3JUIA 1HXIA 3PZ3A 5CRUA 3TWQA 4F7AA 4JA9A 3CVQA 1TNOA 3CEQA 4R7LA 2Y4UA 2X6JA 2LSUA 1UW4B 5EYPF 3OXLA 3FFLA 3SZ7A 1BLXB 3FU0A 2WXPA 1H2UA 3L22A 5IY5E 5CBOA 3DPDA 3AU5A 2IFUA 4I2ZA 1B89A 5AQBA 2Y4TA 4AY6A 3D3MA 4FLBA 4DI4A 1TNUA 3FU6A 4BEPA 4FP7A 4A1GA 4RVBA 4N2SA 1IYGA 4U95D 3DRAA 2EQXA 2I2OA 4MKTA 1XNFA 4BWRA 4J8DA 2ZGDA 1P5QA 1YA0A 5ANLA 5AJDA 4C9BB 3JQ0A 4XKBA 4GTOA 2ETCA 3B7RL 2BUGA 2EIJE 3UM0A 2WMNA 1DC2A 5CERB 1QYMA 3Q5MA 4KYOB 2V8SE 1MYOA 1OT8A 1NFIE 4UI9K 1E8XA 5HKPA 1AWCB 1VDYA 3CVYA 4J6IA 4QFVA 3WXXA 3CSTA 2P58C 2YINA 2GRQB 1GW6A 5CEDB 1RZ4A 1N52A 1HG2A 3TWWA 3AG1E 5JJTA 3RU0A 3GZ1A 3O48A 4K03A 3ZYQA 4GA1A 2P9UG 4B94A 3CV0A 3PEVB 3Q73A 3Q15A 5AAOA 4L2LA 3RRUA 4I2WA 3FEXA 4ATGA 1KZPA 4A3TA 3GW4A 3TJPA 2OV8A 3DSTA 2XPZA 5DIZA 3EJNA 3VLEA 1LD8A 3ZRHA 5G04J 1YMPA 3ML8A 4E85A 4AOFA 3TWXA 3ZN3A 3DEOA 3FTZA 1D8DA 2VTBB 3MV2B 5BPPA 4AEZC 3IHVA 4TXQA 4QQIA 5M72A 3UT8A 2X3MA 4O1OA 3ONKA 3D9MA 3PNLB 2KZTA 4GA2A 3UIOC 1D9SA 4WUYA 1O1RA 2LAIA 4UQZA 2CFUA 3JYSA 2VTBA 3ZYMA 3NBNB 2PQRA 2J4DA 3FUMA 1JUQA 4H7XA 1OWMA 3QKYA 4U04A 1OY3D 2B0OE 3HXDA 1G3NB 4EZKA 4D10C 4LNGA 2C0MA 5BNWA 1UG3A 5A6CA 3D9KA 5EIBE 1SW6A 4H7YA 5ENOD 2BKGA 2LO6A 3AS4A 4LUNU 1DCQA 3QWWA 1IQUA 4FHKA 2GROB 3EHQA 4URKA 1HH8A 1QBQA 3Q75A 3PZDA 2I1KA 5LFAA 5EYLA 5D0OD 4GTSA 1E7UA 1O1SA 4MS6A 3CHRA 3MV3B 1EPUA 1TJFA 2MHKA 3C3RA 5A7DB 2ETBA 5FQ4A 3L6AA 2LAHA 3R9AB 3LPZA 4GA0A 4DJAA 3DEPA 2VSYA 3TG5A 4YDYA 4F53A 1OUVA 3UKUG 4I6GA 2FBNA 4OVUA 4MRUA 2GGFA 2IO3C 5FIOA 2CG3A 3RRMB 4LNBA 2IU1A 3HVEB 4HRLA 4Y6WA 3RSEG 3B7SA 3URZA 1H6OA 3SO8A 3E32A 1S63A 3HIZA 2HE0A 4Y6CA 1UN9A 2R59A 4GTVA 5KJKA 2QFCA 4X8QA 3APFA 4PH4B 2M63A 4GPKA 3P2BA 3MCXA 4IYPA 2DWZA 2WXFA 2P9NG 3CHOA 5LCWJ 1KT0A 4ANUA 2LXMA 2BF0X 2JEKA 4CEMA 3UM1A 3IV0A 5BV0A 4ZFHA 5G05C 5LOZA 4ATZD 3L17A 3UX4A 4TV3A 3AJIA 2OVFA 5ANRA 4DX5D 1PAQA 2Y1LE 2JABA 3E30A 3UPVA 1IXVA 3B7UX 3FUEA 1YCSB 4LNUD 2VGXA 2WXGA 3FEYA 1IKND 4GTQA 3UKRG 3HHMA 5CCMA 4JD2G 2AXZA 4K5BA 2PNNA 3D9JA 3UUXA 3T5XA 3QK0A 4ILHB 3C98A 5AENA 4GZ5A 5HRYA 3HDXA 4L9PA 3CVPA 3FUKA 3ABKE 4TXPA 4CDRA 1XGWA 1ZB1A 4JL0A 2L6JA 2ONDA 2NXPA 4BT9A 3LYAA 4L1BA 4J7WA 3CHMA 4WNEA 3UIPC 2J49A 2I9CA 4OAVB 4FA6A 3ZFWA 1UN8A 3TL5A 3S7BA 4I1OB 5G04C 3U9WA 3OXFA 4O6FA 2LUHA 1JCQA 5CHEE 3D9LA 3LY8A 5C2YA 4YVQC 3K9IA 5FQ7A 1H0AA 1Z3YA 3ONLA 4HBDA 2C0LA 5T3RA 2IOSA 2KM4A 4TXRA 2Q7FA 2MOWA 4ABNA 5T8IA 3CSFA 3ZHEA 2VGEA 2V4HC 1NI1A 3CVUA 3S7JA 1IHGA 4Q96A 3KS2A 5CMWA 5J90A 5ARGA 4KZCA 3OAWA 3UMVA 3FTVA 2ETAA 4GZ3A 2R05A 4JB8P 1UJKA 1LD7A 1V54E 2L0IA 4L7TA 1H2VC 4FJZA 3ZPJA 3ULYA 4L23A 3X2QE 3FTXA 3FWVA 3CK8A 3UXGA 5ENRD 2IEJA 3QOUA 4KMOA 3W9FA 3ZUVB 3GZ2A 3NOGD 2V4LA 3G2TA 3UT7A 3PE4A 3RO2A 2UY1A 5AARA 2XS1A 3MKQB 3QAQA 4B93B 3SD5A 2YHCA 2FO1E 2WQHA 1DCEA 2X38A 2RFAA 4GTPA 3IBEA 5AJLA 3RRNB 4JPSA 4LSZE 1O5MA 3AG4E 1MX4A 2FULA 3JCKC 3FUJA 2A5EA 1PC2A 1JCSA 4ANXA 3BUAA 4ANWA 4DUIA 5KJNA 3MKQA 3L9TA 1BD8A 2AXVA 5ENQD 5EILA 4FJYA 3LEWA 5FZSA 4LCTA 5G05J 3ZEFA 4BX9A 2ZIRA 3Q78A 1FPPA 1U3CA 4IN3B 1SZAA 3RAUA 2FI7A 3SFYA 4DRXE 3SBSA 1Z3XA 2GW1A 3S7DA 5FINA 2CG2A 4JZYA 3PDNA 5CEAA 2HO1A 2WM9A 4I6EA 3VLDA 3CVVA 5G55A 2I6HA 2RD0A 1MX2A 3ESKA 4NACA 3C3OA 5LCWC 3GYZA 4L2YA 3CVWA 3RK6A 2WMOA 3ASDA 1TNYA 2R2LA 5AIJA 1HU3A 4BY6A 4YNDA 1N94A 1LTXA 3PS6A 1N54A 1H6PA 3PZ2A 3LY7A 4U8YD 4DLQA 3NZSA 2WXMA 4FADA 1DNPA 2AVPA 4GMRA 1HFAA 1OWOA 5AYWD 4WWOA 2WPVA 3BQOA 3KSQA 3TGOA 1FCHA 2KXPC 2BTDA 4OAUC 3Q49B 4G8LA 3FU3A 3D9PA 2RKKA 2OCCE 2X6IA 5HS0A 4GYWA 4KBQA 2XGMA 1BI7B 2CHWA 2KC7A 4HLLA 4XI9A 3CIAA 2IJGX 3B13A 1HO8A 1N4SA 3D9IA 2PM7A 2V5QC 3MEKA 1K1BA 4CDMA 3TXMA 2WXHA 2V5FA 2F37A 3E4BA 5KCMA 3HXEA 3EUVA 3MGBA 4KVOA 4ME2A 2E0IA 3HRAA 3LVQE 3CHPA 3UQ3A 2DBAA 5CCLA 3ZXSA 2NSZA 3SFZA 3APCA 4HB5A 2WXRA 1JWFA 3R9MA 2WQ7A 3U66A 4FC8A 4UWKA 5EX0A 3RJVA 3ESLA 4BETA 2WQ6A 2V0PA 3DWLG 4AM9A 5JA4D 2KATA 1TYQG 3UM3A 2DYRE 4AV7A 4DPRA 4B8AA 5A23A 2GRLA 4WNDA 4JEHA 3QC1A 3T8KA 3Q9NC 4XI0A 4ILIA 4M3OA 1SZ9A 4RG6A 3I3NA 4M7CA 4I9CA 3KEAA 1YYHA 4WNGA 3QNKA 2GRPB 1Z6TA 4JEUA 3TWSA 1H2TC 3DXKG 2XGSA 2KCKA 2BKKB 4AXHA 3CKCA 4O60A 3G2SA 4OYSA 3RKVA 4UQXA 2LSVA 5FZQA 2DVWA 3BG1B 3FY4A 3G2UA 2HR2A 4N2QA 4WWPA 4YDWA 3N71A 1QNFA 1HX8A 3L16A 5AN8A 1TN8A 1S70B 3TXNA 4CGWA 4YDOA 3R7RA 4HRMB 2J9QA 3Q4AB 2LNIA 4RSYA 1ZBPA 5JHAA 3LJ3A 3SQVA 4DX2A 2DZOA 3LY9A 4ACKA 2OVBA 3ENEA 4GTMA 2ZU6B 3E37A 5AQ9A 4JVSA 2WXQA 1N0RA 3OXGA 5KBAA 4KVMA 1HF8A 3SY2A 2EINE 3HVEA 3U64A 1MX6A 2H6IA 4CCAA 4Q69A 3I4RB 3AAAC 3IXEA 4GMJA 3CGHA 3CVNA 3Q9UC 2VSXE 1HG5A 1N9AA 2J08A 4LRZA 4Z68A 2PM6A 3ASNE 4A55A 1OXJA 4EBAA 4I17A 2IY0C 3TG4A 3ZGQA 2ZGGA 4B0ZA 2A5UA 3W9GA 4ZHBA 4UUCA 3ZYLA 2L9BA 3F6QA
chains in the Genus database with same CATH topology
2NC9A 4NURA 3CVUA 4JHRA 3S7JA 4UI9K 1E8XA 2CHXA 3S2AA 1IHGA 4CT4A 2HYZA 4Q96A 3KS2A 4GAAA 4UI9C 3U4TA 5CMWA 3G2WA 5EX3A 3VTYA 5J90A 1VDYA 3LKUA 3VLFA 4EZJA 1UJJA 3QARA 4Q94A 3CVYA 5ARGA 2IF4A 3PRZA 4J6IA 4QFVA 5ARFA 4AIFA 3SGHA 3ZVVA 3WXXA 3CSTA 2P58C 4KZCA 5G2NA 3OAWA 5BW8C 3UMVA 2YINA 3FTVA 2VSOE 3EDTB 3IEGA 1TEZA 1WY6A 4GZ3A 1GW6A 3LS8A 3MYVA 3IHYA 4FLHA 5BT1A 3FH8A 4TUUA 4EZLA 3SI5A 1N52A 3GZSA 4CT0A 4U07A 1HG2A 2PL2A 4APOA 4PDXA 1L5JA 4UWFA 1UJKA 5FQ8A 1NP7A 4UQYA 3RU0A 5JJTA 4GCOA 2L0IA 3GZ1A 3O48A 4L7TA 1H2VC 4FJZA 4IRUA 4K03A 5LP0A 3ZPJA 3NQPA 5HI7A 3ZYQA 1WAO1 3S7FA 4GA1A 5BUZA 3EIJA 1NA3A 1ELKA 2FF4A 4L23A 4B94A 5FJYA 3CV0A 3NZUA 4RG9A 2VYIA 4HORA 3PEVB 3FTXA 3FWVA 2MRIA 3CK8A 5KJMA 2CFZA 3Q15A 3IKOB 4NQ0A 3QOUA 4L2LA 3RRUA 4KMOA 4I2WA 3FEXA 4ATGA 4A3TA 3FH7A 4JW1A 4GCNA 4XX5A 3GW4A 3TJPA 2I1JA 4PS8A 3GZ2A 2OV8A 3BG0B 4A1SA 2V4LA 2X6HA 2XGOA 2PZIA 3KAEA 3G2TA 3UT7A 4GMLA 3PE4A 4A3VA 2XPZA 4G26A 3RO2A 5JJ7A 5DIZA 5JHBA 3QWVA 3EJNA 2UY1A 4N5CA 1KT1A 5FWQA 3MKQB 4I6JA 1FVHA 2XHEA 3QAQA 3SD5A 2YHCA 3EHMA 3VLEA 2WQHA 4AJWA 3ZRHA 5G04J 2WXIA 4KZ0A 2KCVA 4JA7A 2DCPA 3I4GA 2XRYA 3ML8A 4E85A 2X38A 4AOFA 4GZ6A 3NF1A 3OTNA 3ZN3A 1OWNA 1FVFA 3IBEA 5AJLA 3T8MA 3RRNB 4JPSA 5E75A 2CHZA 3FTZA 3KD7A 4I43A 3MKRA 3QDNA 3HYMB 2FULA 3JCKC 2AW6A 3FUJA 1PC2A 2VTBB 4ANXA 1A17A 3MV2B 3QB2A 4AP2A 4ANWA 5BPPA 5KJNA 4AEZC 3MKQA 3IHVA 1OWLA 1EDUA 4U0ZA 2WXLA 2AXVA 3PNTB 5M72A 3UT8A 2X3MA 1E96B 4FJYA 3FHEA 2VJ8A 1JPLA 3LEWA 5J08A 5FZSA 3ONKA 3D9MA 4LCTA 4N39A 5G05J 2IOLA 3ZEFA 4BX9A 3CKBA 3PNLB 2KZTA 4GA2A 1H19A 2OOEA 4J8FA 1U3CA 2AXUA 4UI9J 4WUYA 4EQFA 2LAIA 4IN3B 1SZAA 2E2EA 4UQZA 2CFUA 2FI7A 3JYSA 4GYYA 2VTBA 4DLOA 3ZYMA 4G25A 4HFGA 3U3WA 2PQRA 4LEUA 1BPOA 3CHSA 4JC8A 3I5PA 3FULA 2J4DA 4JHKA 3SBSA 2XPYA 1Z3XA 4K0RA 3FUMA 1KLXA 1JUQA 2GW1A 4H7XA 4ANVA 5D0QD 3S7DA 1OWMA 3ASHA 4GB9A 3QKYA 2XRZA 4I1MA 4XKCA 1S0PA 3CVLA 3L13A 2CG2A 4U04A 4JZYA 4U8HA 3FU5A 4EZKA 3PDNA 4D10C 4PS3A 1E7VA 4U0SA 2HO1A 2Y3AA 2C0MA 5BNWA 2WM9A 4I6EA 3LVRE 4CRWA 3AS8A 1UG3A 3VLDA 5A6CA 3ASFA 3D9KA 3PUKA 2VGXB 3QWPA 2FEZA 3ULQA 3CVVA 3CVXA 5G55A 2I6HA 2RD0A 3FUNA 3ESKA 4H7YA 3LCAA 4AVXA 4NACA 2WXKA 2LO6A 4AY5A 2VQ2A 3AS4A 4N3CA 5LCWC 2DIWA 1W3BA 3GYZA 3UT4A 1U3DA 4LUNU 4L2YA 3CVWA 2VGYA 4KXKB 3RK6A 2WMOA 3ASDA 3D9OA 3CHQA 3PVLA 4HLEA 1INZA 5EKQD 3P1UA 4G11A 3QWWA 5AIJA 1IQUA 3G2VA 4FHKA 4URKA 4BTAA 2J09A 1HU3A 3FUDA 1HH8A 3EIQC 4WNFA 5ENNA 4BY6A 4YNDA 3PZDA 2I1KA 3EHNA 1HZ4A 3PS6A 5LFAA 1WM5A 1N54A 3CK7A 3R7QA 2R17C 4GZDA 3LY7A 4G1TA 5D0OD 1E7UA 4MS6A 2WXNA 4DLQA 3CHRA 4UWLA 3ZW3A 3JQ1A 3NZSA 2WXMA 4HS2A 4I9EA 3MV3B 4FADA 4UWGA 3SHFA 4EECA 1DNPA 2MHKA 2YQ8A 1EPUA 1E8ZA 1TJFA 3LXUX 2AVPA 4WAFA 5A7DB 4BSXA 4PS7A 5EDSA 1HFAA 5FQ4A 4B89A 3L6AA 1OWOA 2LAHA 5AYWD 4DK5A 5HQ8A 1OWPA 3APDA 1SQMA 3Q47B 4WWOA 3R9AB 2WPVA 3PUJA 1QQEA 3LPZA 4HOSA 3B7TA 4PUCA 2HM8A 3TGOA 1FCHA 4BT8A 4GYOA 1HS6A 4GA0A 2BTDA 4KT6B 4DJAA 1Y6IA 3FDHA 3Q49B 3FU3A 3D9PA 1H6KA 2VSYA 3TAXA 3QJZA 4J8EA 3TG5A 2X6IA 4XZ4A 4GYWA 4YVOA 4F53A 4KBQA 1OUVA 2XGMA 4DI3A 4I6GA 2FBNA 4OVUA 4MRUA 4E6HA 1ELRA 2GGFA 2J4BA 2CHWA 4V3IA 2CG3A 4G23A 2KC7A 3RRMB 3KEZA 2IU1A 1TJCA 3HVEB 4XI9A 3CIAA 2IJGX 2YHEA 5FZRA 2A4ZA 4Y6WA 4J8SA 4HOQA 3B13A 4XIFA 1HO8A 3B7SA 4MLPA 3URZA 2C2LA 4BFRA 3SF4A 1NZNA 4I1AA 3D9IA 1JWGA 2PM7A 4NRHB 4GU5A 2X6KA 3MEKA 3FTSA 3HIZA 1EF1C 4CDMA 4Y6CA 3TXMA 2WXHA 4FU3A 2V5FA 4U63A 5DBKA 1UN9A 2R59A 2R5SA 4G24A 3E4BA 5KCMA 3SNXA 5KJKA 4FULA 2AWIA 2QFCA 3CQCB 3D9NA 4C0MA 3MZLB 2RG8A 3LDZA 4UWHA 3APFA 4PH4B 2M63A 1ELWA 4GPKA 3P2BA 3ZHEB 3MCXA 3MGBA 4KVOA 5C1DA 4ME2A 3VTXA 2E0IA 3FP3A 4IYPA 3LVQE 3CHPA 2WXFA 2XCCA 4LERA 3FTWA 3PEUB 3UQ3A 2DBAA 2KCLA 4WWNA 3MA5A 3CHOA 4ACLA 5CCLA 1KT0A 5LCWJ 3ZXSA 4N3AA 4BX8A 2XCBA 1HE8A 3AS5A 2NSZA 4ANUA 4P29A 3AU4A 4IULA 3SFZA 3APCA 5FT9A 2BF0X 5KJLA 2WXRA 2IONA 5LX8A 2JEKA 1JWFA 4CEMA 2WQ7A 3U66A 2XPIA 1PY1A 3IV0A 2L0TB 3CQGB 4FC8A 4UWKA 5BV0A 1IQRA 5EX0A 5T4YA 3RJVA 1EYHA 3ASGA 3ESLA 2V0PA 2WQ6A 2GRMA 4AM9A 5G05C 5LOZA 2KATA 4JHJA 3L17A 4AV7A 3CK9A 4DPRA 3MJWA 4B8AA 1Y8MA 3UX4A 5A23A 4TV3A 2GRLA 3PH0C 1NA0A 3FTUA 2WVIA 4WNDA 2OVFA 1MHQA 2PQNA 2WXJA 3FUFA 3CLJA 5ANRA 2UWJG 4JEHA 4HOTA 3ZIMA 3QC1A 1PAQA 5CMYA 4ILGA 4XI0A 4ILIA 3UPVA 4M3OA 1SZ9A 3B7UX 4BTBA 2ILRA 4RG6A 3I3NA 3RO3A 3FUEA 1E8YA 3RIBA 2FO7A 1E8WA 3FTYA 4I9CA 2VGXA 4CDNA 2WXGA 2YNQA 2XEVA 4WNGA 3QNKA 1X5BA 1Z6TA 4HOUA 4JEUA 3FEYA 1H2TC 4APFA 3ML9A 4F3VA 4C0EA 2VSNA 2XGSA 2XQ0A 3HHMA 2WB2A 4U0UA 4HVBA 5CCMA 2KCKA 3ZYKA 4AXHA 3CKCA 3FH5A 2AXZA 5FQ6A 4EPZA 3O4ZA 2QY7A 5E76A 3CR3A 2JLBA 3G2SA 4OYSA 3D9JA 3FUIA 3RKVA 2UY1B 3T5XA 3JUIA 3UUXA 3QK0A 4ILHB 4UQXA 1HXIA 3SBTB 3C98A 2LSVA 3PE3A 5FZQA 4J0UA 3BG1B 3FY4A 5BV1A 5AENA 4F7AA 4HXIA 3G2UA 4GZ5A 4JA9A 3CVQA 3HDXA 2HR2A 4N2QA 4WWPA 3CVPA 3BEEA 3N71A 1QNFA 1HX8A 3L16A 4B8CB 3CEQA 2X6FA 3FUKA 3TXNA 4R7LA 4CGWA 4TRQA 2Y4UA 4FHJA 3R7RA 2J9QA 2X6JA 4CDRA 1XGWA 2LNIA 2LSUA 2WXOA 3Q4AB 4JL0A 2L6JA 4RSYA 1UW4B 1E90A 2IQCA 4G2VA 3OXLA 1ZBPA 4OVVA 3FFLA 3SZ7A 5JHAA 3LJ3A 3FU0A 2WXPA 1H2UA 3L22A 2ONDA 3LY9A 3DPDA 2OVBA 2IFUA 2NXPA 3AU5A 3ENEA 2ZU6B 3MX3A 4ACKA 3LYAA 4I2ZA 4BT9A 1B89A 4JVSA 4L1BA 1DVPA 2WXQA 2Y4TA 2KZTB 4AY6A 3CHMA 3OXGA 4WNEA 2J49A 3D3MA 4W9RA 4XE0A 4KVMA 1HF8A 2I9CA 4FLBA 4DI4A 4FA6A 1ZU2A 3PREA 1UN8A 3ZFWA 3FU6A 3HVEA 3S7BA 3TL5A 4I1OB 3U64A 2J07A 3L54A 4CCAA 4Q69A 5G04C 3U9WA 3L08A 3OXFA 3I4RB 4FP7A 4O6FA 4A1GA 1QZ2A 4RVBA 3DBSA 5CHEE 4N2SA 4GMJA 1IYGA 3D9LA 3LY8A 5C2YA 4YVQC 3K9IA 2EQXA 3CGHA 5FQ7A 2I2OA 1H0AA 3CVNA 4MKTA 1XNFA 1Z3YA 3ONLA 2VSXE 4BWRA 4J8DA 3FUHA 1HG5A 1LF8A 1P5QA 1YA0A 5ANLA 5AJDA 4C9BB 2J08A 5FTPA 4LRZA 1MQSA 3JQ0A 4XKBA 5JJ6A 3B7RL 2BUGA 2C0LA 2PM6A 2IOSA 2KM4A 5T3RA 4A55A 4EBAG 4EBAA 4F1SA 4GZCA 4JXTA 4I17A 3TG4A 3ZGQA 2Q7FA 4B0ZA 2A5UA 4N3BA 2WMNA 3Q5MA 4KYOB 2V8SE 2MOWA 4ABNA 4CGVA 5T8IA 3T5VA 3CSFA 3ZHEA 3ZYLA 2L9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NC9 A;  4JHR A;  3S7J A;  4UI9 K;  1IHG A;  2HYZ A;  4UI9 C;  3KS2 A;  3U4T A;  5EX3 A;  3VTY A;  3LKU A;  5ARG A;  2IF4 A;  5ARF A;  4AIF A;  3WXX A;  2P58 C;  5BW8 C;  3EDT B;  3IEG A;  4GZ3 A;  5BT1 A;  4U07 A;  2PL2 A;  4APO A;  4UQY A;  3RU0 A;  5JJT A;  4GCO A;  3GZ1 A;  3O48 A;  3ZPJ A;  5HI7 A;  1WAO 1;  3S7F A;  4GA1 A;  1NA3 A;  2FF4 A;  4B94 A;  5FJY A;  3CV0 A;  4RG9 A;  2VYI A;  4HOR A;  3FWV A;  3CK8 A;  5KJM A;  3Q15 A;  4NQ0 A;  3QOU A;  4I2W A;  4GCN A;  3GW4 A;  3GZ2 A;  4A1S A;  2XGO A;  2PZI A;  3KAE A;  3PE4 A;  4G26 A;  3RO2 A;  5JJ7 A;  5DIZ A;  3QWV A;  4N5C A;  2UY1 A;  1KT1 A;  2YHC A;  2WQH A;  5G04 J;  2KCV A;  4JA7 A;  4GZ6 A;  3NF1 A;  3ZN3 A;  3KD7 A;  3MKR A;  3QDN A;  3HYM B;  1PC2 A;  1A17 A;  3MV2 B;  5KJN A;  4U0Z A;  5M72 A;  1E96 B;  5FZS A;  5G05 J;  4N39 A;  3CKB A;  4GA2 A;  2OOE A;  4J8F A;  4UI9 J;  4WUY A;  4EQF A;  4IN3 B;  2E2E A;  4UQZ A;  2FI7 A;  3JYS A;  4GYY A;  4G25 A;  3U3W A;  2PQR A;  4LEU A;  1KLX A;  2GW1 A;  4H7X A;  5D0Q D;  3S7D A;  3ASH A;  3QKY A;  3CVL A;  4U04 A;  3PDN A;  4U0S A;  2HO1 A;  2C0M A;  5BNW A;  3AS8 A;  5A6C A;  3ASF A;  2VGX B;  3QWP A;  2FEZ A;  3ULQ A;  2I6H A;  3ESK A;  4H7Y A;  3LCA A;  4AY5 A;  2VQ2 A;  3AS4 A;  4N3C A;  5LCW C;  1W3B A;  3GYZ A;  2VGY A;  4KXK B;  3ASD A;  5EKQ D;  3QWW A;  4BTA A;  1HH8 A;  4WNF A;  4YND A;  1HZ4 A;  1WM5 A;  3CK7 A;  3LY7 A;  4G1T A;  5D0O D;  4I9E A;  3MV3 B;  2MHK A;  2YQ8 A;  2AVP A;  5A7D B;  5AYW D;  5HQ8 A;  3Q47 B;  3R9A B;  2WPV A;  1QQE A;  3LPZ A;  4HOS A;  3TGO A;  4BT8 A;  1FCH A;  4GYO A;  4GA0 A;  3Q49 B;  2VSY A;  3TAX A;  4J8E A;  3TG5 A;  4YVO A;  4GYW A;  4KBQ A;  1OUV A;  2XGM A;  2FBN A;  1ELR A;  4G23 A;  2KC7 A;  1TJC A;  4XI9 A;  5FZR A;  4Y6W A;  4HOQ A;  4XIF A;  3URZ A;  2C2L A;  3SF4 A;  1NZN A;  4I1A A;  4NRH B;  3MEK A;  4Y6C A;  2V5F A;  5DBK A;  2R5S A;  4G24 A;  3E4B A;  5KJK A;  2QFC A;  1ELW A;  4GPK A;  3ZHE B;  5C1D A;  4ME2 A;  3VTX A;  3FP3 A;  2XCC A;  3UQ3 A;  2DBA A;  2KCL A;  3MA5 A;  5LCW J;  5CCL A;  1KT0 A;  4N3A A;  2XCB A;  3AS5 A;  5FT9 A;  5KJL A;  2XPI A;  5EX0 A;  3RJV A;  3ASG A;  4AM9 A;  5G05 C;  2KAT A;  3CK9 A;  1Y8M A;  1NA0 A;  4WND A;  2PQN A;  2UWJ G;  4HOT A;  4XI0 A;  3UPV A;  4BTB A;  4RG6 A;  3RO3 A;  3RIB A;  2FO7 A;  4I9C A;  2VGX A;  2XEV A;  4WNG A;  4HOU A;  4F3V A;  2VSN A;  2XGS A;  4U0U A;  5CCM A;  2KCK A;  3CKC A;  2JLB A;  3RKV A;  3UUX A;  2UY1 B;  4UQX A;  1HXI A;  2LSV A;  3PE3 A;  5FZQ A;  4J0U A;  4GZ5 A;  4JA9 A;  3CVQ A;  2HR2 A;  4N2Q A;  3CVP A;  3BEE A;  3N71 A;  3CEQ A;  4CGW A;  2Y4U A;  2J9Q A;  4CDR A;  3Q4A B;  2LNI A;  2LSU A;  4JL0 A;  2L6J A;  4G2V A;  3OXL A;  1ZBP A;  3FFL A;  3SZ7 A;  2OND A;  3LY9 A;  2IFU A;  4BT9 A;  3LYA A;  4I2Z A;  1B89 A;  2Y4T A;  4AY6 A;  3OXG A;  4WNE A;  4W9R A;  1ZU2 A;  3ZFW A;  3S7B A;  5G04 C;  3OXF A;  4O6F A;  1QZ2 A;  5CHE E;  4N2S A;  1IYG A;  3LY8 A;  4YVQ C;  3K9I A;  3CVN A;  1XNF A;  4BWR A;  4J8D A;  1P5Q A;  1YA0 A;  5FTP A;  5JJ6 A;  2BUG A;  2C0L A;  4I17 A;  3TG4 A;  3ZGQ A;  2Q7F A;  4N3B A;  3Q5M A;  4KYO B;  4ABN A;  4CGV A;  3ZHE A; 
#chains in the Genus database with same CATH topology
 2NC9 A;  4NUR A;  4JHR A;  2CHX A;  3S2A A;  4GAA A;  3U4T A;  3G2W A;  3VTY A;  1UJJ A;  4Q94 A;  5ENT D;  3PRZ A;  5ARF A;  4AIF A;  3ZVV A;  3Q79 A;  2H6F A;  5BW8 C;  1N95 A;  2VSO E;  3EDT B;  3IEG A;  2DZN A;  1D8E A;  2QYJ A;  3LS8 A;  4FLH A;  5BT1 A;  3FH8 A;  4EZL A;  3GZS A;  4U07 A;  1L5J A;  4UWF A;  4TUM A;  5FQ8 A;  1OCR E;  1NP7 A;  4UQY A;  3ABL E;  5CEC B;  5LP0 A;  5BXU A;  3EIJ A;  1ELK A;  2FF4 A;  5FJY A;  3NZU A;  4RG9 A;  1NL4 A;  1A5E A;  3IKO B;  3FH7 A;  4CYM D;  4PS8 A;  4A1S A;  2X6H A;  2XGO A;  2PZI A;  4A3V A;  4G26 A;  5JHB A;  3QWV A;  4I6J A;  4GTR A;  5JMN D;  1FVH A;  2XHE A;  3EHM A;  2XS8 A;  4AJW A;  2XEN A;  2WXI A;  2OEW A;  3EHR A;  4GZ6 A;  3OTN A;  4DX7 D;  1OWN A;  3T8M A;  1U2V G;  5E75 A;  4I43 A;  4G8K A;  1KZO A;  1SA4 A;  2AJA A;  1A17 A;  3QB2 A;  4AP2 A;  1OWL A;  1EDU A;  2KBX A;  4U0Z A;  2WXL A;  1E96 B;  1WG0 A;  4N5Q A;  5J08 A;  4U7E B;  4N39 A;  3CKB A;  1H19 A;  4HQD A;  3NB2 A;  4UI9 J;  4EQF A;  2E2E A;  1OCC E;  4GYY A;  1TNB A;  4G25 A;  1SVX A;  3DSS A;  4HFG A;  1BPO A;  2H6H A;  3FUL A;  4JHK A;  2XPY A;  1V55 E;  1KLX A;  4ANV A;  4F1P A;  4GB9 A;  2XRZ A;  4I1M A;  3C3Q A;  3DXM G;  3CVL A;  4U8H A;  1E7V A;  3C72 A;  4CRW A;  1N0Q A;  3PUK A;  2P9P G;  3ULQ A;  3TWU A;  3ZKJ A;  3LCA A;  4AY5 A;  2VQ2 A;  4N3C A;  2DIW A;  2EIM E;  2VGY A;  3ULE G;  4CZ2 D;  3PVL A;  1INZ A;  1S64 A;  2QYU A;  4G11 A;  3G2V A;  4BTA A;  2J09 A;  3FUD A;  3EIQ C;  5ENN A;  5ENP D;  1HZ4 A;  3CK7 A;  3R7Q A;  4GZD A;  5H7P A;  4G1T A;  2XZT G;  1N4P A;  2WXN A;  3ZW3 A;  1Q2Z A;  4UWG A;  3SHF A;  4EEC A;  1E8Z A;  2YQ8 A;  3LXU X;  5EDS A;  4B89 A;  2F8X K;  5HQ8 A;  4HI9 A;  1OWP A;  3APD A;  1SQM A;  3PUJ A;  1QQE A;  4PUC A;  2HM8 A;  4GYO A;  1HS6 A;  4KT6 B;  1Y6I A;  3FDH A;  3DSW A;  4MBG A;  1H6K A;  3QJZ A;  4XZ4 A;  4DI3 A;  3ISM C;  4E6H A;  1ELR A;  2J4B A;  3ASO E;  3J5P A;  1K8K G;  4G23 A;  5B1B E;  3KEZ A;  3AG2 E;  5FZR A;  2BED A;  3E34 A;  3E33 A;  3SF4 A;  1NZN A;  1JWG A;  1N4R A;  1TNZ A;  4GU5 A;  1KPS B;  4J8Y A;  1EF1 C;  4FU3 A;  2H6G A;  4DX6 D;  5DBK A;  4FUL A;  2AWI A;  2P9K G;  2P9L G;  3LDZ A;  4UWH A;  2ZIS A;  3FP3 A;  4LER A;  3PEU B;  2KCL A;  3MA5 A;  4N3A A;  4BX8 A;  3AS5 A;  4A63 B;  1SA5 A;  1EYH A;  3UM2 A;  4JHJ A;  3CK9 A;  1NA0 A;  2WVI A;  1MHQ A;  2PQN A;  3FUF A;  3V79 K;  3ZIM A;  3TWV A;  4BTB A;  2ILR A;  1E8Y A;  2P9S G;  1UOH A;  2FO7 A;  3FTY A;  3UIN C;  2XEV A;  1X5B A;  4HOU A;  3DSX A;  2XZD G;  4APF A;  3ML9 A;  2WB2 A;  4HVB A;  4K5A B;  3FH5 A;  5FQ6 A;  3O4Z A;  2RFM A;  3HXB A;  5E76 A;  5D66 A;  3SBT B;  3PE3 A;  5D2M C;  4J0U A;  5BV1 A;  5KNG A;  4HXI A;  4GTT A;  3DSU A;  3BEE A;  2GRN B;  4B8C B;  2X6F A;  4TRQ A;  4FHJ A;  2F8Y A;  4U8V D;  2WXO A;  1E90 A;  2IQC A;  4G2V A;  4OVV A;  2XEH A;  3NOC D;  3MX3 A;  3PZ1 A;  1DVP A;  3WG7 E;  3EU9 A;  2LXL A;  2KZT B;  2P2C P;  3JUE A;  4W9R A;  4XE0 A;  1ZU2 A;  3PRE A;  5AQ7 A;  2J07 A;  3L54 A;  3L08 A;  1QZ2 A;  3DBS A;  3J5Q B;  4YDE A;  5ITZ F;  3FUH A;  1LF8 A;  5FTP A;  5JJ6 A;  1MQS A;  1TN6 A;  1FT1 A;  4EBA G;  4F1S A;  4GZC A;  4JXT A;  4LG6 A;  3B95 A;  4N3B A;  3V31 A;  4BSZ B;  4CGV A;  3T5V A;  4NIK A;  3B7B A;  4CT4 A;  2HYZ A;  4UI9 C;  3TWT A;  1RW2 A;  5EX3 A;  5EID A;  3LKU A;  3VLF A;  4EZJ A;  3QAR A;  3SFX A;  2IF4 A;  3SGH A;  5G2N A;  1TEZ A;  3HXC A;  1WY6 A;  3HG0 D;  3MYV A;  3DSV A;  3IHY A;  4TUU A;  2B6C A;  4HI8 A;  3ZNG A;  3SI5 A;  4CT0 A;  2PL2 A;  2R03 A;  4APO A;  4PDX A;  2Y0B G;  4GCO A;  4IRU A;  3NQP A;  5HI7 A;  1WAO 1;  3S7F A;  5BUZ A;  1NA3 A;  5CRV A;  2DYS E;  2P9I G;  2VYI A;  4HOR A;  2MRI A;  5KJM A;  2CFZ A;  4NQ0 A;  3KSL A;  4JW1 A;  4GCN A;  4XX5 A;  2I1J A;  4U96 D;  3BG0 B;  3KAE A;  4GML A;  5JJ7 A;  4N5C A;  1KT1 A;  5FWQ A;  5CBN A;  3BU8 A;  3JXJ A;  4KZ0 A;  2KCV A;  4JA7 A;  2DCP A;  3I4G A;  2XRY A;  3NF1 A;  2R02 A;  1FVF A;  2CHZ A;  3KD7 A;  2J8S D;  3MKR A;  3QDN A;  3HYM B;  3L82 A;  2AW6 A;  4K5C A;  5ENS D;  2OEV A;  3PNT B;  2MYO A;  1TR4 A;  3FHE A;  2VJ8 A;  3ZU7 B;  1JPL A;  4GPM A;  2IOL A;  2OOE A;  4J8F A;  4DX1 A;  2AXU A;  3T9K A;  4BES A;  4DLO A;  3U3W A;  4LEU A;  4XEI G;  3CHS A;  4JC8 A;  3I5P A;  4K0R A;  5BXO A;  3Q7A A;  5D0Q D;  3ASH A;  3ZXP A;  4XKC A;  1S0P A;  3L13 A;  2L6B A;  3FU5 A;  4PS3 A;  5KNH D;  3TWR A;  4U0S A;  2Y3A A;  3LVR E;  3AS8 A;  3ASF A;  2VGX B;  3QWP A;  2FEZ A;  3CVX A;  3JXI A;  3FUN A;  4AVX A;  3EU5 A;  2WXK A;  4BER A;  5EN5 D;  1W3B A;  3UT4 A;  2NYJ A;  1U3D A;  4KXK B;  3D9O A;  3CHQ A;  4HLE A;  5EKQ D;  3P1U A;  1K3Z D;  1OCO E;  1AP7 A;  2GRR B;  4WNF A;  3EHN A;  4EHM A;  1WM5 A;  2R17 C;  2Y69 E;  3LJN A;  3D9H A;  4UWL A;  3JQ1 A;  4HS2 A;  4I9E A;  3PZ4 A;  4WAF A;  2EIL E;  4BSX A;  4PS7 A;  2XEE A;  4DK5 A;  1N4Q A;  3Q47 B;  4HOS A;  3B7T A;  1JCR A;  4BT8 A;  3HXF A;  3TAX A;  4J8E A;  2ZXW E;  4YVO A;  3DPY A;  2EIK E;  1IHB A;  3NAW A;  4V3I A;  1BI8 B;  1TJC A;  2YHE A;  2A4Z A;  4HNA D;  4J8S A;  4HOQ A;  1K1A A;  4XIF A;  2IO2 C;  4MLP A;  2C2L A;  4C48 B;  4BFR A;  4I1A A;  1O1T A;  4NRH B;  5AQA A;  5B3S E;  2X6K A;  3UI2 A;  1X81 A;  3UTM A;  3FTS A;  4O1P A;  1FT2 A;  4U63 A;  3C5R A;  1WDY A;  2R5S A;  4G24 A;  3SNX A;  5KWD A;  3CQC B;  3D9N A;  3AG3 E;  3ABM E;  4C0M A;  3MZL B;  2RG8 A;  1ELW A;  1MZC A;  3ZHE B;  5C1D A;  3VTX A;  3V30 A;  2QC9 A;  2XCC A;  3FTW A;  3V2X A;  4WWN A;  4ACL A;  2XCB A;  1HE8 A;  1BU9 A;  4P29 A;  3AU4 A;  4IUL A;  4RQI A;  5FT9 A;  5KJL A;  2ION A;  5LX8 A;  2XPI A;  1N11 A;  1PY1 A;  2L0T B;  3CQG B;  1IQR A;  5T4Y A;  3ASG A;  4HRN A;  2GRM A;  5B1A E;  3V2O A;  4F6R D;  3MJW A;  1Y8M A;  3PH0 C;  3FTU A;  2WXJ A;  3CLJ A;  2UWJ G;  4HOT A;  5CMY A;  4ILG A;  3RO3 A;  3RIB A;  1E8W A;  1Z5S C;  1MJ0 A;  4CDN A;  2YNQ A;  4RLY A;  2QZA A;  4F3V A;  4C0E A;  2VSN A;  2XQ0 A;  4U0U A;  2F0Y A;  1TN7 A;  3ZYK A;  4EPZ A;  1OCZ E;  2QY7 A;  3CR3 A;  3Q7F A;  2JLB A;  3FUI A;  2UY1 B;  3JUI A;  1HXI A;  3PZ3 A;  5CRU A;  3TWQ A;  4F7A A;  4JA9 A;  3CVQ A;  1TNO A;  3CEQ A;  4R7L A;  2Y4U A;  2X6J A;  2LSU A;  1UW4 B;  5EYP F;  3OXL A;  3FFL A;  3SZ7 A;  1BLX B;  3FU0 A;  2WXP A;  1H2U A;  3L22 A;  5IY5 E;  5CBO A;  3DPD A;  3AU5 A;  2IFU A;  4I2Z A;  1B89 A;  5AQB A;  2Y4T A;  4AY6 A;  3D3M A;  4FLB A;  4DI4 A;  1TNU A;  3FU6 A;  4BEP A;  4FP7 A;  4A1G A;  4RVB A;  4N2S A;  1IYG A;  4U95 D;  3DRA A;  2EQX A;  2I2O A;  4MKT A;  1XNF A;  4BWR A;  4J8D A;  2ZGD A;  1P5Q A;  1YA0 A;  5ANL A;  5AJD A;  4C9B B;  3JQ0 A;  4XKB A;  4GTO A;  2ETC A;  3B7R L;  2BUG A;  2EIJ E;  3UM0 A;  2WMN A;  1DC2 A;  5CER B;  1QYM A;  3Q5M A;  4KYO B;  2V8S E;  1MYO A;  1OT8 A;  1NFI E;  4UI9 K;  1E8X A;  5HKP A;  1AWC B;  1VDY A;  3CVY A;  4J6I A;  4QFV A;  3WXX A;  3CST A;  2P58 C;  2YIN A;  2GRQ B;  1GW6 A;  5CED B;  1RZ4 A;  1N52 A;  1HG2 A;  3TWW A;  3AG1 E;  5JJT A;  3RU0 A;  3GZ1 A;  3O48 A;  4K03 A;  3ZYQ A;  4GA1 A;  2P9U G;  4B94 A;  3CV0 A;  3PEV B;  3Q73 A;  3Q15 A;  5AAO A;  4L2L A;  3RRU A;  4I2W A;  3FEX A;  4ATG A;  1KZP A;  4A3T A;  3GW4 A;  3TJP A;  2OV8 A;  3DST A;  2XPZ A;  5DIZ A;  3EJN A;  3VLE A;  1LD8 A;  3ZRH A;  5G04 J;  1YMP A;  3ML8 A;  4E85 A;  4AOF A;  3TWX A;  3ZN3 A;  3DEO A;  3FTZ A;  1D8D A;  2VTB B;  3MV2 B;  5BPP A;  4AEZ C;  3IHV A;  4TXQ A;  4QQI A;  5M72 A;  3UT8 A;  2X3M A;  4O1O A;  3ONK A;  3D9M A;  3PNL B;  2KZT A;  4GA2 A;  3UIO C;  1D9S A;  4WUY A;  1O1R A;  2LAI A;  4UQZ A;  2CFU A;  3JYS A;  2VTB A;  3ZYM A;  3NBN B;  2PQR A;  2J4D A;  3FUM A;  1JUQ A;  4H7X A;  1OWM A;  3QKY A;  4U04 A;  1OY3 D;  2B0O E;  3HXD A;  1G3N B;  4EZK A;  4D10 C;  4LNG A;  2C0M A;  5BNW A;  1UG3 A;  5A6C A;  3D9K A;  5EIB E;  1SW6 A;  4H7Y A;  5ENO D;  2BKG A;  2LO6 A;  3AS4 A;  4LUN U;  1DCQ A;  3QWW A;  1IQU A;  4FHK A;  2GRO B;  3EHQ A;  4URK A;  1HH8 A;  1QBQ A;  3Q75 A;  3PZD A;  2I1K A;  5LFA A;  5EYL A;  5D0O D;  4GTS A;  1E7U A;  1O1S A;  4MS6 A;  3CHR A;  3MV3 B;  1EPU A;  1TJF A;  2MHK A;  3C3R A;  5A7D B;  2ETB A;  5FQ4 A;  3L6A A;  2LAH A;  3R9A B;  3LPZ A;  4GA0 A;  4DJA A;  3DEP A;  2VSY A;  3TG5 A;  4YDY A;  4F53 A;  1OUV A;  3UKU G;  4I6G A;  2FBN A;  4OVU A;  4MRU A;  2GGF A;  2IO3 C;  5FIO A;  2CG3 A;  3RRM B;  4LNB A;  2IU1 A;  3HVE B;  4HRL A;  4Y6W A;  3RSE G;  3B7S A;  3URZ A;  1H6O A;  3SO8 A;  3E32 A;  1S63 A;  3HIZ A;  2HE0 A;  4Y6C A;  1UN9 A;  2R59 A;  4GTV A;  5KJK A;  2QFC A;  4X8Q A;  3APF A;  4PH4 B;  2M63 A;  4GPK A;  3P2B A;  3MCX A;  4IYP A;  2DWZ A;  2WXF A;  2P9N G;  3CHO A;  5LCW J;  1KT0 A;  4ANU A;  2LXM A;  2BF0 X;  2JEK A;  4CEM A;  3UM1 A;  3IV0 A;  5BV0 A;  4ZFH A;  5G05 C;  5LOZ A;  4ATZ D;  3L17 A;  3UX4 A;  4TV3 A;  3AJI A;  2OVF A;  5ANR A;  4DX5 D;  1PAQ A;  2Y1L E;  2JAB A;  3E30 A;  3UPV A;  1IXV A;  3B7U X;  3FUE A;  1YCS B;  4LNU D;  2VGX A;  2WXG A;  3FEY A;  1IKN D;  4GTQ A;  3UKR G;  3HHM A;  5CCM A;  4JD2 G;  2AXZ A;  4K5B A;  2PNN A;  3D9J A;  3UUX A;  3T5X A;  3QK0 A;  4ILH B;  3C98 A;  5AEN A;  4GZ5 A;  5HRY A;  3HDX A;  4L9P A;  3CVP A;  3FUK A;  3ABK E;  4TXP A;  4CDR A;  1XGW A;  1ZB1 A;  4JL0 A;  2L6J A;  2OND A;  2NXP A;  4BT9 A;  3LYA A;  4L1B A;  4J7W A;  3CHM A;  4WNE A;  3UIP C;  2J49 A;  2I9C A;  4OAV B;  4FA6 A;  3ZFW A;  1UN8 A;  3TL5 A;  3S7B A;  4I1O B;  5G04 C;  3U9W A;  3OXF A;  4O6F A;  2LUH A;  1JCQ A;  5CHE E;  3D9L A;  3LY8 A;  5C2Y A;  4YVQ C;  3K9I A;  5FQ7 A;  1H0A A;  1Z3Y A;  3ONL A;  4HBD A;  2C0L A;  5T3R A;  2IOS A;  2KM4 A;  4TXR A;  2Q7F A;  2MOW A;  4ABN A;  5T8I A;  3CSF A;  3ZHE A;  2VGE A;  2V4H C;  1NI1 A;  3CVU A;  3S7J A;  1IHG A;  4Q96 A;  3KS2 A;  5CMW A;  5J90 A;  5ARG A;  4KZC A;  3OAW A;  3UMV A;  3FTV A;  2ETA A;  4GZ3 A;  2R05 A;  4JB8 P;  1UJK A;  1LD7 A;  1V54 E;  2L0I A;  4L7T A;  1H2V C;  4FJZ A;  3ZPJ A;  3ULY A;  4L23 A;  3X2Q E;  3FTX A;  3FWV A;  3CK8 A;  3UXG A;  5ENR D;  2IEJ A;  3QOU A;  4KMO A;  3W9F A;  3ZUV B;  3GZ2 A;  3NOG D;  2V4L A;  3G2T A;  3UT7 A;  3PE4 A;  3RO2 A;  2UY1 A;  5AAR A;  2XS1 A;  3MKQ B;  3QAQ A;  4B93 B;  3SD5 A;  2YHC A;  2FO1 E;  2WQH A;  1DCE A;  2X38 A;  2RFA A;  4GTP A;  3IBE A;  5AJL A;  3RRN B;  4JPS A;  4LSZ E;  1O5M A;  3AG4 E;  1MX4 A;  2FUL A;  3JCK C;  3FUJ A;  2A5E A;  1PC2 A;  1JCS A;  4ANX A;  3BUA A;  4ANW A;  4DUI A;  5KJN A;  3MKQ A;  3L9T A;  1BD8 A;  2AXV A;  5ENQ D;  5EIL A;  4FJY A;  3LEW A;  5FZS A;  4LCT A;  5G05 J;  3ZEF A;  4BX9 A;  2ZIR A;  3Q78 A;  1FPP A;  1U3C A;  4IN3 B;  1SZA A;  3RAU A;  2FI7 A;  3SFY A;  4DRX E;  3SBS A;  1Z3X A;  2GW1 A;  3S7D A;  5FIN A;  2CG2 A;  4JZY A;  3PDN A;  5CEA A;  2HO1 A;  2WM9 A;  4I6E A;  3VLD A;  3CVV A;  5G55 A;  2I6H A;  2RD0 A;  1MX2 A;  3ESK A;  4NAC A;  3C3O A;  5LCW C;  3GYZ A;  4L2Y A;  3CVW A;  3RK6 A;  2WMO A;  3ASD A;  1TNY A;  2R2L A;  5AIJ A;  1HU3 A;  4BY6 A;  4YND A;  1N94 A;  1LTX A;  3PS6 A;  1N54 A;  1H6P A;  3PZ2 A;  3LY7 A;  4U8Y D;  4DLQ A;  3NZS A;  2WXM A;  4FAD A;  1DNP A;  2AVP A;  4GMR A;  1HFA A;  1OWO A;  5AYW D;  4WWO A;  2WPV A;  3BQO A;  3KSQ A;  3TGO A;  1FCH A;  2KXP C;  2BTD A;  4OAU C;  3Q49 B;  4G8L A;  3FU3 A;  3D9P A;  2RKK A;  2OCC E;  2X6I A;  5HS0 A;  4GYW A;  4KBQ A;  2XGM A;  1BI7 B;  2CHW A;  2KC7 A;  4HLL A;  4XI9 A;  3CIA A;  2IJG X;  3B13 A;  1HO8 A;  1N4S A;  3D9I A;  2PM7 A;  2V5Q C;  3MEK A;  1K1B A;  4CDM A;  3TXM A;  2WXH A;  2V5F A;  2F37 A;  3E4B A;  5KCM A;  3HXE A;  3EUV A;  3MGB A;  4KVO A;  4ME2 A;  2E0I A;  3HRA A;  3LVQ E;  3CHP A;  3UQ3 A;  2DBA A;  5CCL A;  3ZXS A;  2NSZ A;  3SFZ A;  3APC A;  4HB5 A;  2WXR A;  1JWF A;  3R9M A;  2WQ7 A;  3U66 A;  4FC8 A;  4UWK A;  5EX0 A;  3RJV A;  3ESL A;  4BET A;  2WQ6 A;  2V0P A;  3DWL G;  4AM9 A;  5JA4 D;  2KAT A;  1TYQ G;  3UM3 A;  2DYR E;  4AV7 A;  4DPR A;  4B8A A;  5A23 A;  2GRL A;  4WND A;  4JEH A;  3QC1 A;  3T8K A;  3Q9N C;  4XI0 A;  4ILI A;  4M3O A;  1SZ9 A;  4RG6 A;  3I3N A;  4M7C A;  4I9C A;  3KEA A;  1YYH A;  4WNG A;  3QNK A;  2GRP B;  1Z6T A;  4JEU A;  3TWS A;  1H2T C;  3DXK G;  2XGS A;  2KCK A;  2BKK B;  4AXH A;  3CKC A;  4O60 A;  3G2S A;  4OYS A;  3RKV A;  4UQX A;  2LSV A;  5FZQ A;  2DVW A;  3BG1 B;  3FY4 A;  3G2U A;  2HR2 A;  4N2Q A;  4WWP A;  4YDW A;  3N71 A;  1QNF A;  1HX8 A;  3L16 A;  5AN8 A;  1TN8 A;  1S70 B;  3TXN A;  4CGW A;  4YDO A;  3R7R A;  4HRM B;  2J9Q A;  3Q4A B;  2LNI A;  4RSY A;  1ZBP A;  5JHA A;  3LJ3 A;  3SQV A;  4DX2 A;  2DZO A;  3LY9 A;  4ACK A;  2OVB A;  3ENE A;  4GTM A;  2ZU6 B;  3E37 A;  5AQ9 A;  4JVS A;  2WXQ A;  1N0R A;  3OXG A;  5KBA A;  4KVM A;  1HF8 A;  3SY2 A;  2EIN E;  3HVE A;  3U64 A;  1MX6 A;  2H6I A;  4CCA A;  4Q69 A;  3I4R B;  3AAA C;  3IXE A;  4GMJ A;  3CGH A;  3CVN A;  3Q9U C;  2VSX E;  1HG5 A;  1N9A A;  2J08 A;  4LRZ A;  4Z68 A;  2PM6 A;  3ASN E;  4A55 A;  1OXJ A;  4EBA A;  4I17 A;  2IY0 C;  3TG4 A;  3ZGQ A;  2ZGG A;  4B0Z A;  2A5U A;  3W9G A;  4ZHB A;  4UUC A;  3ZYL A;  2L9B A;  3F6Q A; 
#chains in the Genus database with same CATH homology
 2NC9 A;  4NUR A;  3CVU A;  4JHR A;  3S7J A;  4UI9 K;  1E8X A;  2CHX A;  3S2A A;  1IHG A;  4CT4 A;  2HYZ A;  4Q96 A;  3KS2 A;  4GAA A;  4UI9 C;  3U4T A;  5CMW A;  3G2W A;  5EX3 A;  3VTY A;  5J90 A;  1VDY A;  3LKU A;  3VLF A;  4EZJ A;  1UJJ A;  3QAR A;  4Q94 A;  3CVY A;  5ARG A;  2IF4 A;  3PRZ A;  4J6I A;  4QFV A;  5ARF A;  4AIF A;  3SGH A;  3ZVV A;  3WXX A;  3CST A;  2P58 C;  4KZC A;  5G2N A;  3OAW A;  5BW8 C;  3UMV A;  2YIN A;  3FTV A;  2VSO E;  3EDT B;  3IEG A;  1TEZ A;  1WY6 A;  4GZ3 A;  1GW6 A;  3LS8 A;  3MYV A;  3IHY A;  4FLH A;  5BT1 A;  3FH8 A;  4TUU A;  4EZL A;  3SI5 A;  1N52 A;  3GZS A;  4CT0 A;  4U07 A;  1HG2 A;  2PL2 A;  4APO A;  4PDX A;  1L5J A;  4UWF A;  1UJK A;  5FQ8 A;  1NP7 A;  4UQY A;  3RU0 A;  5JJT A;  4GCO A;  2L0I A;  3GZ1 A;  3O48 A;  4L7T A;  1H2V C;  4FJZ A;  4IRU A;  4K03 A;  5LP0 A;  3ZPJ A;  3NQP A;  5HI7 A;  3ZYQ A;  1WAO 1;  3S7F A;  4GA1 A;  5BUZ A;  3EIJ A;  1NA3 A;  1ELK A;  2FF4 A;  4L23 A;  4B94 A;  5FJY A;  3CV0 A;  3NZU A;  4RG9 A;  2VYI A;  4HOR A;  3PEV B;  3FTX A;  3FWV A;  2MRI A;  3CK8 A;  5KJM A;  2CFZ A;  3Q15 A;  3IKO B;  4NQ0 A;  3QOU A;  4L2L A;  3RRU A;  4KMO A;  4I2W A;  3FEX A;  4ATG A;  4A3T A;  3FH7 A;  4JW1 A;  4GCN A;  4XX5 A;  3GW4 A;  3TJP A;  2I1J A;  4PS8 A;  3GZ2 A;  2OV8 A;  3BG0 B;  4A1S A;  2V4L A;  2X6H A;  2XGO A;  2PZI A;  3KAE A;  3G2T A;  3UT7 A;  4GML A;  3PE4 A;  4A3V A;  2XPZ A;  4G26 A;  3RO2 A;  5JJ7 A;  5DIZ A;  5JHB A;  3QWV A;  3EJN A;  2UY1 A;  4N5C A;  1KT1 A;  5FWQ A;  3MKQ B;  4I6J A;  1FVH A;  2XHE A;  3QAQ A;  3SD5 A;  2YHC A;  3EHM A;  3VLE A;  2WQH A;  4AJW A;  3ZRH A;  5G04 J;  2WXI A;  4KZ0 A;  2KCV A;  4JA7 A;  2DCP A;  3I4G A;  2XRY A;  3ML8 A;  4E85 A;  2X38 A;  4AOF A;  4GZ6 A;  3NF1 A;  3OTN A;  3ZN3 A;  1OWN A;  1FVF A;  3IBE A;  5AJL A;  3T8M A;  3RRN B;  4JPS A;  5E75 A;  2CHZ A;  3FTZ A;  3KD7 A;  4I43 A;  3MKR A;  3QDN A;  3HYM B;  2FUL A;  3JCK C;  2AW6 A;  3FUJ A;  1PC2 A;  2VTB B;  4ANX A;  1A17 A;  3MV2 B;  3QB2 A;  4AP2 A;  4ANW A;  5BPP A;  5KJN A;  4AEZ C;  3MKQ A;  3IHV A;  1OWL A;  1EDU A;  4U0Z A;  2WXL A;  2AXV A;  3PNT B;  5M72 A;  3UT8 A;  2X3M A;  1E96 B;  4FJY A;  3FHE A;  2VJ8 A;  1JPL A;  3LEW A;  5J08 A;  5FZS A;  3ONK A;  3D9M A;  4LCT A;  4N39 A;  5G05 J;  2IOL A;  3ZEF A;  4BX9 A;  3CKB A;  3PNL B;  2KZT A;  4GA2 A;  1H19 A;  2OOE A;  4J8F A;  1U3C A;  2AXU A;  4UI9 J;  4WUY A;  4EQF A;  2LAI A;  4IN3 B;  1SZA A;  2E2E A;  4UQZ A;  2CFU A;  2FI7 A;  3JYS A;  4GYY A;  2VTB A;  4DLO A;  3ZYM A;  4G25 A;  4HFG A;  3U3W A;  2PQR A;  4LEU A;  1BPO A;  3CHS A;  4JC8 A;  3I5P A;  3FUL A;  2J4D A;  4JHK A;  3SBS A;  2XPY A;  1Z3X A;  4K0R A;  3FUM A;  1KLX A;  1JUQ A;  2GW1 A;  4H7X A;  4ANV A;  5D0Q D;  3S7D A;  1OWM A;  3ASH A;  4GB9 A;  3QKY A;  2XRZ A;  4I1M A;  4XKC A;  1S0P A;  3CVL A;  3L13 A;  2CG2 A;  4U04 A;  4JZY A;  4U8H A;  3FU5 A;  4EZK A;  3PDN A;  4D10 C;  4PS3 A;  1E7V A;  4U0S A;  2HO1 A;  2Y3A A;  2C0M A;  5BNW A;  2WM9 A;  4I6E A;  3LVR E;  4CRW A;  3AS8 A;  1UG3 A;  3VLD A;  5A6C A;  3ASF A;  3D9K A;  3PUK A;  2VGX B;  3QWP A;  2FEZ A;  3ULQ A;  3CVV A;  3CVX A;  5G55 A;  2I6H A;  2RD0 A;  3FUN A;  3ESK A;  4H7Y A;  3LCA A;  4AVX A;  4NAC A;  2WXK A;  2LO6 A;  4AY5 A;  2VQ2 A;  3AS4 A;  4N3C A;  5LCW C;  2DIW A;  1W3B A;  3GYZ A;  3UT4 A;  1U3D A;  4LUN U;  4L2Y A;  3CVW A;  2VGY A;  4KXK B;  3RK6 A;  2WMO A;  3ASD A;  3D9O A;  3CHQ A;  3PVL A;  4HLE A;  1INZ A;  5EKQ D;  3P1U A;  4G11 A;  3QWW A;  5AIJ A;  1IQU A;  3G2V A;  4FHK A;  4URK A;  4BTA A;  2J09 A;  1HU3 A;  3FUD A;  1HH8 A;  3EIQ C;  4WNF A;  5ENN A;  4BY6 A;  4YND A;  3PZD A;  2I1K A;  3EHN A;  1HZ4 A;  3PS6 A;  5LFA A;  1WM5 A;  1N54 A;  3CK7 A;  3R7Q A;  2R17 C;  4GZD A;  3LY7 A;  4G1T A;  5D0O D;  1E7U A;  4MS6 A;  2WXN A;  4DLQ A;  3CHR A;  4UWL A;  3ZW3 A;  3JQ1 A;  3NZS A;  2WXM A;  4HS2 A;  4I9E A;  3MV3 B;  4FAD A;  4UWG A;  3SHF A;  4EEC A;  1DNP A;  2MHK A;  2YQ8 A;  1EPU A;  1E8Z A;  1TJF A;  3LXU X;  2AVP A;  4WAF A;  5A7D B;  4BSX A;  4PS7 A;  5EDS A;  1HFA A;  5FQ4 A;  4B89 A;  3L6A A;  1OWO A;  2LAH A;  5AYW D;  4DK5 A;  5HQ8 A;  1OWP A;  3APD A;  1SQM A;  3Q47 B;  4WWO A;  3R9A B;  2WPV A;  3PUJ A;  1QQE A;  3LPZ A;  4HOS A;  3B7T A;  4PUC A;  2HM8 A;  3TGO A;  1FCH A;  4BT8 A;  4GYO A;  1HS6 A;  4GA0 A;  2BTD A;  4KT6 B;  4DJA A;  1Y6I A;  3FDH A;  3Q49 B;  3FU3 A;  3D9P A;  1H6K A;  2VSY A;  3TAX A;  3QJZ A;  4J8E A;  3TG5 A;  2X6I A;  4XZ4 A;  4GYW A;  4YVO A;  4F53 A;  4KBQ A;  1OUV A;  2XGM A;  4DI3 A;  4I6G A;  2FBN A;  4OVU A;  4MRU A;  4E6H A;  1ELR A;  2GGF A;  2J4B A;  2CHW A;  4V3I A;  2CG3 A;  4G23 A;  2KC7 A;  3RRM B;  3KEZ A;  2IU1 A;  1TJC A;  3HVE B;  4XI9 A;  3CIA A;  2IJG X;  2YHE A;  5FZR A;  2A4Z A;  4Y6W A;  4J8S A;  4HOQ A;  3B13 A;  4XIF A;  1HO8 A;  3B7S A;  4MLP A;  3URZ A;  2C2L A;  4BFR A;  3SF4 A;  1NZN A;  4I1A A;  3D9I A;  1JWG A;  2PM7 A;  4NRH B;  4GU5 A;  2X6K A;  3MEK A;  3FTS A;  3HIZ A;  1EF1 C;  4CDM A;  4Y6C A;  3TXM A;  2WXH A;  4FU3 A;  2V5F A;  4U63 A;  5DBK A;  1UN9 A;  2R59 A;  2R5S A;  4G24 A;  3E4B A;  5KCM A;  3SNX A;  5KJK A;  4FUL A;  2AWI A;  2QFC A;  3CQC B;  3D9N A;  4C0M A;  3MZL B;  2RG8 A;  3LDZ A;  4UWH A;  3APF A;  4PH4 B;  2M63 A;  1ELW A;  4GPK A;  3P2B A;  3ZHE B;  3MCX A;  3MGB A;  4KVO A;  5C1D A;  4ME2 A;  3VTX A;  2E0I A;  3FP3 A;  4IYP A;  3LVQ E;  3CHP A;  2WXF A;  2XCC A;  4LER A;  3FTW A;  3PEU B;  3UQ3 A;  2DBA A;  2KCL A;  4WWN A;  3MA5 A;  3CHO A;  4ACL A;  5CCL A;  1KT0 A;  5LCW J;  3ZXS A;  4N3A A;  4BX8 A;  2XCB A;  1HE8 A;  3AS5 A;  2NSZ A;  4ANU A;  4P29 A;  3AU4 A;  4IUL A;  3SFZ A;  3APC A;  5FT9 A;  2BF0 X;  5KJL A;  2WXR A;  2ION A;  5LX8 A;  2JEK A;  1JWF A;  4CEM A;  2WQ7 A;  3U66 A;  2XPI A;  1PY1 A;  3IV0 A;  2L0T B;  3CQG B;  4FC8 A;  4UWK A;  5BV0 A;  1IQR A;  5EX0 A;  5T4Y A;  3RJV A;  1EYH A;  3ASG A;  3ESL A;  2V0P A;  2WQ6 A;  2GRM A;  4AM9 A;  5G05 C;  5LOZ A;  2KAT A;  4JHJ A;  3L17 A;  4AV7 A;  3CK9 A;  4DPR A;  3MJW A;  4B8A A;  1Y8M A;  3UX4 A;  5A23 A;  4TV3 A;  2GRL A;  3PH0 C;  1NA0 A;  3FTU A;  2WVI A;  4WND A;  2OVF A;  1MHQ A;  2PQN A;  2WXJ A;  3FUF A;  3CLJ A;  5ANR A;  2UWJ G;  4JEH A;  4HOT A;  3ZIM A;  3QC1 A;  1PAQ A;  5CMY A;  4ILG A;  4XI0 A;  4ILI A;  3UPV A;  4M3O A;  1SZ9 A;  3B7U X;  4BTB A;  2ILR A;  4RG6 A;  3I3N A;  3RO3 A;  3FUE A;  1E8Y A;  3RIB A;  2FO7 A;  1E8W A;  3FTY A;  4I9C A;  2VGX A;  4CDN A;  2WXG A;  2YNQ A;  2XEV A;  4WNG A;  3QNK A;  1X5B A;  1Z6T A;  4HOU A;  4JEU A;  3FEY A;  1H2T C;  4APF A;  3ML9 A;  4F3V A;  4C0E A;  2VSN A;  2XGS A;  2XQ0 A;  3HHM A;  2WB2 A;  4U0U A;  4HVB A;  5CCM A;  2KCK A;  3ZYK A;  4AXH A;  3CKC A;  3FH5 A;  2AXZ A;  5FQ6 A;  4EPZ A;  3O4Z A;  2QY7 A;  5E76 A;  3CR3 A;  2JLB A;  3G2S A;  4OYS A;  3D9J A;  3FUI A;  3RKV A;  2UY1 B;  3T5X A;  3JUI A;  3UUX A;  3QK0 A;  4ILH B;  4UQX A;  1HXI A;  3SBT B;  3C98 A;  2LSV A;  3PE3 A;  5FZQ A;  4J0U A;  3BG1 B;  3FY4 A;  5BV1 A;  5AEN A;  4F7A A;  4HXI A;  3G2U A;  4GZ5 A;  4JA9 A;  3CVQ A;  3HDX A;  2HR2 A;  4N2Q A;  4WWP A;  3CVP A;  3BEE A;  3N71 A;  1QNF A;  1HX8 A;  3L16 A;  4B8C B;  3CEQ A;  2X6F A;  3FUK A;  3TXN A;  4R7L A;  4CGW A;  4TRQ A;  2Y4U A;  4FHJ A;  3R7R A;  2J9Q A;  2X6J A;  4CDR A;  1XGW A;  2LNI A;  2LSU A;  2WXO A;  3Q4A B;  4JL0 A;  2L6J A;  4RSY A;  1UW4 B;  1E90 A;  2IQC A;  4G2V A;  3OXL A;  1ZBP A;  4OVV A;  3FFL A;  3SZ7 A;  5JHA A;  3LJ3 A;  3FU0 A;  2WXP A;  1H2U A;  3L22 A;  2OND A;  3LY9 A;  3DPD A;  2OVB A;  2IFU A;  2NXP A;  3AU5 A;  3ENE A;  2ZU6 B;  3MX3 A;  4ACK A;  3LYA A;  4I2Z A;  4BT9 A;  1B89 A;  4JVS A;  4L1B A;  1DVP A;  2WXQ A;  2Y4T A;  2KZT B;  4AY6 A;  3CHM A;  3OXG A;  4WNE A;  2J49 A;  3D3M A;  4W9R A;  4XE0 A;  4KVM A;  1HF8 A;  2I9C A;  4FLB A;  4DI4 A;  4FA6 A;  1ZU2 A;  3PRE A;  1UN8 A;  3ZFW A;  3FU6 A;  3HVE A;  3S7B A;  3TL5 A;  4I1O B;  3U64 A;  2J07 A;  3L54 A;  4CCA A;  4Q69 A;  5G04 C;  3U9W A;  3L08 A;  3OXF A;  3I4R B;  4FP7 A;  4O6F A;  4A1G A;  1QZ2 A;  4RVB A;  3DBS A;  5CHE E;  4N2S A;  4GMJ A;  1IYG A;  3D9L A;  3LY8 A;  5C2Y A;  4YVQ C;  3K9I A;  2EQX A;  3CGH A;  5FQ7 A;  2I2O A;  1H0A A;  3CVN A;  4MKT A;  1XNF A;  1Z3Y A;  3ONL A;  2VSX E;  4BWR A;  4J8D A;  3FUH A;  1HG5 A;  1LF8 A;  1P5Q A;  1YA0 A;  5ANL A;  5AJD A;  4C9B B;  2J08 A;  5FTP A;  4LRZ A;  1MQS A;  3JQ0 A;  4XKB A;  5JJ6 A;  3B7R L;  2BUG A;  2C0L A;  2PM6 A;  2IOS A;  2KM4 A;  5T3R A;  4A55 A;  4EBA G;  4EBA A;  4F1S A;  4GZC A;  4JXT A;  4I17 A;  3TG4 A;  3ZGQ A;  2Q7F A;  4B0Z A;  2A5U A;  4N3B A;  2WMN A;  3Q5M A;  4KYO B;  2V8S E;  2MOW A;  4ABN A;  4CGV A;  5T8I A;  3T5V A;  3CSF A;  3ZHE A;  3ZYL A;  2L9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...