2KC7A

Solution nmr structure of bacteroides fragilis protein bf1650. northeast structural genomics consortium target bfr218
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
MDQLKTIKELINQGDIENALQALEEFLQTEPVGKDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMDILNFYNKDMYNQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bfr218_protein
publication title Solution NMR structure of Bacteroides fragilis protein BF1650. Northeast Structural Genomics Consortium target BfR218
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kc7A00
2YQ8A 4AY6A 4G26A 3PE4A 4UQZA 2HYZA 2BUGA 3U4TA 3JYSA 3GZ2A 1W3BA 3O48A 5HI7A 2PQRA 3FWVA 4U04A 3CVQA 3LYAA 2J9QA 3RO2A 3GZ1A 3ZPJA 4O6FA 3MEKA 2QFCA 3RKVA 2XPIA 4HOQA 5FTPA 4GZ5A 3OXFA 4A1SA 2XCCA 3RO3A 2V5FA 4NQ0A 2FEZA 5KJNA 4I2ZA 3TG4A 3LY9A 4G24A 4W9RA 5FZQA 3K9IA 3RIBA 3LCAA 4GCNA 3MV3B 3KS2A 3TGOA 4UI9K 4YVOA 3S7FA 3ZN3A 2P58C 4I9EA 3QWVA 2KCLA 1P5QA 4XIFA 3Q49B 4B94A 4JHRA 5FZRA 4IN3B 4YNDA 2YHCA 1XNFA 3OXGA 4H7YA 3VTXA 4AIFA 5EX3A 5D0OD 3GYZA 2VGXA 2KATA 2KCKA 5D0QD 3ZFWA 5M72A 1Y8MA 4H7XA 2FBNA 3LY7A 3CV0A 3QDNA 4XI9A 5CCMA 3Q5MA 3S7DA 2E2EA 1WAO1 3FFLA 2LNIA 1NA3A 3CKCA 2PQNA 4N2SA 5JJ6A 4Y6CA 4GZ6A 1B89A 4I17A 3SF4A 2XGOA 4BT8A 3UUXA 4UQXA 2VSNA 1A17A 2I6HA 4CGWA 3SZ7A 3BEEA 1QQEA 2VGXB 3RU0A 5FZSA 5A6CA 3QKYA 2C2LA 3U3WA 3ESKA 4GA0A 4KYOB 2XCBA 2UWJG 4WNDA 3WXXA 2VGYA 3CK7A 5DBKA 1KLXA 5A7DB 1HH8A 3LPZA 4BT9A 4WNGA 4WUYA 4RG6A 2JLBA 4U07A 2FI7A 3ASGA 1ELRA 2PL2A 2ONDA 3AS5A 3R9AB 3NF1A 3PDNA 4Y6WA 2PZIA 2XEVA 3MKRA 2IFUA 5HQ8A 3UPVA 5ARFA 3AS8A 5G05J 3N71A 4BTBA 4APOA 5EX0A 4HOUA 5LCWJ 4J8DA 3ZGQA 4JA7A 5C1DA 3CVLA 4BWRA 3Q4AB 3QOUA 2XGSA 5BNWA 2WQHA 4AM9A 1ZBPA 1HXIA 4G25A 5G04J 4YVQC 5KJMA 1PC2A 2R5SA 2HR2A 3S7BA 4HORA 4U0UA 4GA1A 3UQ3A 4XI0A 3KAEA 2OOEA 4HOTA 2MHKA 1IHGA 2GW1A 4G1TA 4N3AA 2HO1A 4GA2A 5KJKA 2Y4UA 4WNFA 3QWWA 3KD7A 3CEQA 4LEUA 3MA5A 1QZ2A 3AS4A 1ZU2A 1E96B 4AY5A 3CKBA 2LSUA 4J8EA 3URZA 3ASDA 4WNEA 4F3VA 3MV2B 5DIZA 5AYWD 2VQ2A 1FCHA 3TAXA 4GYWA 4G23A 4I2WA 2KC7A 4U0SA 4CDRA 4BTAA 2FO7A 3ULQA 2VYIA 3Q47B 4ME2A 3ASHA 4GYOA 4JL0A 3S7JA 3QWPA 3E4BA 2XGMA 3ZHEA 1HZ4A 2KCVA 2FF4A 4CGVA 3LKUA 2UY1A 3TG5A 4UI9J 5CCLA 1KT1A 4I9CA 5JJTA 2L6JA 5BT1A 4GYYA 4N3BA 4N2QA 5FJYA 4UI9C 3PE3A 3FP3A 1NZNA 1IYGA 1OUVA 3RJVA 3VTYA 5G05C 3CK9A 3ZHEB 1KT0A 4ABNA 4UQYA 4N5CA 3EDTB 2LSVA 1TJCA 5JJ7A 4N39A 4GPKA 5LCWC 4U0ZA 5ARGA 2UY1B 3LY8A 4NRHB 4EQFA 2WPVA 4J0UA 5FT9A 4JA9A 4I1AA 4GCOA 1WM5A 1ELWA 3CVPA 4HOSA 2IF4A 4KBQA 5G04C 3CK8A 3GW4A 2AVPA 5CHEE 4GZ3A 3Q15A 2NC9A 2Q7FA 2Y4TA 2DBAA 4RG9A 4N3CA 2C0MA 2C0LA 3HYMB 4G2VA 5EKQD 5BW8C 1NA0A 3OXLA 1YA0A 4J8FA 4KXKB 2VSYA 3CVNA 3IEGA 3ASFA 5KJLA
chains in the Genus database with same CATH superfamily
3ASNE 3LXUX 3D9NA 4AY6A 1BU9A 1JCQA 1X81A 2LO6A 3WG7E 3KSQA 3D9KA 1S0PA 3DSUA 3PEVB 2PQRA 2E0IA 1TEZA 3SHFA 2IU1A 1E8XA 4U04A 4GMJA 4PS3A 5ANRA 1K8KG 2J9QA 3GZ1A 4L2LA 3ZPJA 2OVBA 1OWPA 3RK6A 2AW6A 2RFMA 3NB2A 2R2LA 4F53A 4JVSA 4GZ5A 3LY9A 2Y69E 3JCKC 5IY5E 1KZPA 2FULA 3DRAA 3RIBA 3L17A 5KNHD 3LCAA 3TGOA 3B7SA 2DZOA 4KMOA 2OV8A 3QK0A 3SFYA 2ETCA 1LF8A 3I4RB 5ENSD 1TR4A 3DSVA 4Q96A 3VLEA 2WXLA 4I1MA 1H2TC 4B94A 2JEKA 4FLHA 3ZUVB 2PM7A 4IN3B 4BX8A 3C5RA 1JUQA 1LD7A 2WXQA 2P9KG 4G8LA 4WAFA 3VTXA 2CFZA 5BV1A 3APCA 3ML9A 2KATA 2GGFA 5D0QD 4H7XA 3LDZA 3LY7A 3QDNA 4XI9A 4CT4A 3Q9UC 3TXNA 4EZJA 1E8ZA 5CMYA 3FFLA 1NA3A 2PQNA 4YDYA 2EIME 5JJ6A 2LXLA 2KZTB 2Y3AA 3P1UA 3FU6A 1Q2ZA 4J8SA 3QNKA 4GAAA 3SF4A 4HNAD 5E75A 4LERA 3F6QA 4OVVA 3UUXA 3PZ1A 4UQXA 1TYQG 1A17A 4EZLA 2DZNA 3SZ7A 1HO8A 3IHYA 1OCRE 2H6GA 1QQEA 4X8QA 3EHQA 5FZSA 3ESLA 3L54A 3APDA 3T9KA 3C3QA 2WXGA 3L16A 2LXMA 1VDYA 2C2LA 1K1AA 3MZLB 1TNOA 2XCBA 3G2SA 5T8IA 2MYOA 5B1BE 4TUMA 3J5PA 2RKKA 2VGYA 4B8CB 1KLXA 3UMVA 3FU5A 3LPZA 2IOLA 3UINC 3SO8A 4WUYA 1U3CA 4RG6A 1SA4A 4U07A 4PS7A 2FI7A 4FP7A 5ANLA 2ZXWE 2ZGGA 4OAVB 4Y6WA 1N11A 3MKRA 2GROB 2AWIA 4BTBA 4APOA 4FJZA 2ZIRA 1QBQA 3FTVA 4J8YA 5J90A 5BXOA 3FTUA 3AG3E 4JPSA 5C1DA 3B13A 5KNGA 3QB2A 3CVXA 1YCSB 2KXPC 4V3IA 4UUCA 3NZSA 3UT7A 2WQHA 4AM9A 3FULA 4G25A 2FO1E 3CSTA 4AEZC 1Z5SC 1OY3D 3IBEA 5C2YA 1EYHA 5ENRD 3S7BA 3TWQA 3JQ1A 4XI0A 3KAEA 2OOEA 4U95D 3BG1B 5AAOA 1DNPA 1MYOA 1UG3A 4GMLA 4HFGA 3IXEA 3FU3A 4DRXE 2Y4UA 1N52A 3EHMA 3UT8A 3PUJA 5CBOA 4UWLA 3MA5A 3DXMG 4BETA 3AS4A 4GB9A 1UOHA 4K0RA 4HLEA 1E96B 1JPLA 2LSUA 4WNEA 4HRNA 3MV2B 3PH0C 1MJ0A 2L6BA 2M63A 1K3ZD 1FCHA 1SQMA 2XEEA 2LAHA 3TAXA 3Q7FA 4HVBA 3TWTA 2FO7A 2GRMA 1UJKA 4GYOA 4U8HA 2OCCE 4DLOA 3LS8A 1RZ4A 5AJDA 5JHBA 1FVFA 2A5UA 3V2XA 1HZ4A 4O1OA 2AXZA 4UWGA 4ANWA 3UI2A 3LKUA 2L9BA 3C3OA 2V4HC 3UM3A 5EIBE 4A1GA 2WXOA 5AQAA 3CSFA 2L6JA 4ACKA 5BT1A 5BV0A 3C72A 3SY2A 2XZDG 3FP3A 4LNGA 5EIDA 3C98A 4TV3A 3VLFA 1EPUA 5G05C 1S64A 3LVQE 2LSVA 1TJCA 4N39A 4GPKA 3ZVVA 5LCWC 4U0ZA 5ARGA 2IONA 2V5QC 4L2YA 1N94A 2WPVA 3SD5A 3AJIA 3DSXA 4GCOA 4XKBA 3JUEA 4HOSA 4KBQA 3MKQA 1H6PA 5G04C 2KBXA 3CVWA 3PZDA 2V4LA 3FH8A 2DBAA 4RG9A 2XRYA 2C0MA 2VSXE 1UN8A 2H6FA 4I6JA 4CDNA 4O1PA 4DX6D 5BW8C 4KXKB 4JHKA 5LP0A 3ASFA 5KJLA 3E32A 1OWNA 3D3MA 3CVYA 2EILE 5FINA 3SFZA 3ZXPA 3T8KA 4XEIG 1H19A 4JW1A 4J7WA 4FHKA 4GTOA 3CVUA 3JYSA 3CIAA 2WXPA 3O48A 4JB8P 4GTTA 2L0TB 3FWVA 2OVFA 3D9PA 3IKOB 2EIJE 4O6FA 1NL4A 1DCEA 3UIOC 1DCQA 5FTPA 4EECA 4ILHB 5FQ6A 3ML8A 2P9LG 2R02A 3ZKJA 1GW6A 4W9RA 2GRQB 1S63A 1BD8A 1D8DA 3JUIA 3R7QA 3LJNA 2ZGDA 3L08A 4GCNA 5FWQA 1FT1A 1N0RA 3ZYMA 4YVOA 4RVBA 1FT2A 2WM9A 2XS8A 1JWFA 3S7FA 3QC1A 3QWVA 4AJWA 4BEPA 3PVLA 5ENNA 4B89A 1E7UA 3EU9A 3G2VA 3FH5A 2IO2C 4HRLA 4F7AA 3FUJA 1HS6A 5AIJA 2H6HA 1H6KA 3OXGA 3JQ0A 5EX3A 3TL5A 3GYZA 5B3SE 4F1PA 3UM0A 5M72A 1SA5A 2J07A 5CCMA 3B7UX 2VTBA 3S7DA 1WAO1 3MCXA 4NACA 3PNTB 2AXVA 1MHQA 5ENTD 5KBAA 3B95A 2GRPB 2XGOA 3DPDA 1S70B 1JCSA 2I6HA 4CGWA 4CRWA 2J08A 3EUVA 3RU0A 4LG6A 3FEYA 5A6CA 2HE0A 1K1BA 3RAUA 4A63B 1TN8A 3HXBA 2ILRA 3QKYA 3NZUA 1ELKA 3ESKA 4GA0A 5BUZA 2VTBB 3B7BA 4HRMB 4JD2G 3FH7A 1INZA 4FHJA 4I6EA 1FVHA 3RRNB 2JABA 2AXUA 2R17C 5CMWA 2V8SE 3RRUA 1V54E 4C48B 1N95A 4WNGA 4G8KA 1TN7A 4HQDA 2F37A 3NAWA 3PZ3A 2PL2A 3R9AB 3NF1A 4CCAA 3QARA 3FUDA 2VSOE 3UKUG 5HQ8A 3UPVA 5ARFA 3U66A 4EZKA 3ZYQA 4YDOA 1H0AA 2V0PA 4G11A 4XE0A 4C0MA 4XKCA 1O1TA 3ZGQA 3SGHA 4BX9A 2J4DA 4JEHA 3EHRA 2XGSA 4LSZE 5KWDA 5BNWA 3C3RA 3AG1E 4TUUA 1ZBPA 2P9NG 3D9OA 4ILGA 4JEUA 4BFRA 5KJMA 1PC2A 4MKTA 2R03A 3UQ3A 3TWUA 2MHKA 3TWVA 2GW1A 1N4SA 2BKKB 4FADA 2HO1A 2WQ6A 5EN5D 2CG2A 3KD7A 4FULA 4A55A 1TNZA 4U96D 3PNLB 3MX3A 1Y6IA 1ZU2A 3CQCB 3L22A 4AY5A 4F3VA 3SI5A 2ZISA 2AJAA 2VQ2A 1UJJA 2ETAA 3O4ZA 2I2OA 3ULYA 4CDRA 4BTAA 3U64A 2VYIA 3APFA 3S7JA 3MGBA 4LRZA 3E4BA 4GTQA 2KCVA 4D10C 2FF4A 3P2BA 4AXHA 4CDMA 2WXMA 4L9PA 1U3DA 2KM4A 2BKGA 1KT1A 4I9CA 4BY6A 4GYYA 3ONLA 3PE3A 1NZNA 3TWXA 4DUIA 4U63A 4GTRA 1DC2A 3EHNA 2QY7A 2Y1LE 2DYRE 3EDTB 4UWFA 3LY8A 3DWLG 3ZXSA 1MX2A 2P9UG 4EQFA 5E76A 4P29A 5T4YA 1MX6A 2PNNA 4JA9A 3D9MA 2CFUA 4I1AA 1WM5A 1ELWA 3PZ4A 5CHEE 3Q15A 1RW2A 2Y4TA 1H6OA 3PZ2A 3L82A 1HFAA 3HYMB 4ANUA 3PUKA 1H2VC 3Q7AA 3ZIMA 4MS6A 3CVNA 1BI8B 5T3RA 2A4ZA 1H2UA 2YQ8A 3UX4A 4DK5A 3NOCD 3CLJA 3ABME 3LJ3A 1SVXA 3V2OA 2BUGA 1G3NB 1HU3A 4LNUD 3R7RA 4IRUA 2X6KA 5HI7A 3LYAA 3HVEA 1AWCB 4A3VA 2RG8A 2WXIA 3RO2A 3UM1A 3DEPA 2QFCA 3RKVA 3FY4A 3Q9NC 4HOQA 1JWGA 3HRAA 1D9SA 3OXFA 3SFXA 3KEAA 4J6IA 4K5BA 4NQ0A 3DSWA 2FEZA 3G2UA 1HG5A 3TG4A 4CEMA 5HRYA 3TWRA 4G24A 4PH4B 5FZQA 3K9IA 2IY0C 3BU8A 4UWHA 4OAUC 3FEXA 4PS8A 5CRUA 3KEZA 2IO3C 2EQXA 4HI8A 3ASOE 4EBAG 3GZSA 3MYVA 3KS2A 4UI9K 5AJLA 2BF0X 3FTXA 1N4RA 1E8WA 3ENEA 5G55A 2P58C 3AG2E 4EPZA 1OXJA 2KCLA 3NQPA 4K5AB 1XGWA 4ANVA 3NBNB 5FZRA 1BLXB 4DJAA 2YHCA 3FUHA 1HE8A 1E8YA 3AU5A 3DBSA 4H7YA 4L1BA 4R7LA 4U8YD 5D0OD 2VGXA 2KCKA 3CHOA 4YDEA 4ANXA 2FBNA 3CV0A 3LVRE 2P9IG 4ATZD 3Q5MA 1EF1C 2E2EA 2LNIA 2MRIA 3CKCA 4AV7A 5J08A 2OEWA 3R9MA 5BPPA 4GZDA 4GZ6A 3UIPC 4I17A 4EHMA 1N0QA 3CHQA 4B8AA 3MKQB 2DIWA 4JZYA 1TJFA 2P9SG 3G2WA 3HHMA 3RRMB 5JHAA 2VGXB 1MX4A 3ZYKA 1IQUA 1TN6A 3BUAA 3T5XA 2XPZA 4KYOB 5HKPA 5AQ7A 1HF8A 4WWNA 4HLLA 2XPYA 4APFA 1OCCE 2PM6A 4PDXA 2Y0BG 2B0OE 3CK7A 5DBKA 5A7DB 1HH8A 1UN9A 4I43A 4MLPA 2JLBA 3E37A 3ASGA 1ELRA 3B7RL 3CHMA 2X6HA 3AS5A 4YDWA 4HS2A 2XEVA 2X6JA 2J4BA 2IFUA 5G05J 1IXVA 4E6HA 3CGHA 3ZNGA 2OEVA 1TNBA 4MBGA 4FC8A 2VJ8A 5LCWJ 3UT4A 1L5JA 4DI4A 4JA7A 4GPMA 3CVLA 2XS1A 4BWRA 2XENA 1MZCA 1SZ9A 5G04J 3DSSA 2X3MA 3EIJA 2XRZA 2YNQA 5AQ9A 2QZAA 2R5SA 1LD8A 4HXIA 3E34A 1SZAA 3PS6A 4HORA 3FUEA 4ATGA 1QNFA 4OYSA 4U8VD 4AOFA 4HOTA 2B6CA 4N3AA 3HXFA 4TXQA 4GA2A 4RSYA 4K5CA 5CEAA 4WNFA 4JC8A 2EIKE 4URKA 4BSZB 3CEQA 4LEUA 5AN8A 2GRRB 3QJZA 1NFIE 3UTMA 2WXKA 5CRVA 4KZCA 3CKBA 4J8EA 1O1RA 3HXDA 3Q79A 5AENA 5AYWD 3SQVA 1Z6TA 4DX1A 4CYMD 4DLQA 4GZCA 4GYWA 2F8YA 2KC7A 3DPYA 4ZFHA 4LCTA 2XZTG 3FUNA 3S2AA 3EJNA 3W9FA 3PREA 3D9JA 3ASHA 1QYMA 2LUHA 1UW4B 3FTYA 5D66A 1Z3YA 4CGVA 4DX7D 5LX8A 4JHJA 5CBNA 3J5QB 4TXRA 5FQ8A 2ETBA 5EILA 3Q73A 3ZYLA 4UI9J 4B0ZA 3V31A 5CCLA 5H7PA 4DX2A 5A23A 2F8XK 5JJTA 5BXUA 4N3BA 4N2QA 5FJYA 3Q75A 1IYGA 2F0YA 2NXPA 2CG3A 3VTYA 1HX8A 4RQIA 3CK9A 3I5PA 2YINA 4ABNA 3SNXA 3UXGA 5JJ7A 2WB2A 3FTSA 3KSLA 4FA6A 2WXHA 3V79K 2DWZA 1PY1A 1O5MA 2KZTA 4J0UA 2LAIA 2CHWA 4O60A 2P9PG 4Q94A 5LOZA 2IF4A 4FLBA 4M7CA 2IEJA 4Z68A 2NC9A 4L7TA 4QQIA 4OVUA 4GTVA 2XEHA 4G2VA 3FUMA 3JXJA 4ZHBA 2L0IA 1YA0A 1OWLA 2NSZA 3B7TA 3IEGA 4RLYA 1FPPA 1AP7A 2H6IA 1D8EA 4IULA 1BPOA 4G26A 4GTPA 2WQ7A 1ZB1A 4CT0A 3PE4A 4UQZA 4BERA 2HYZA 2WVIA 3U4TA 5CECB 3D9IA 3GZ2A 4XX5A 1W3BA 1SW6A 3MJWA 4E85A 4A3TA 3CVQA 4MRUA 4Q69A 1JCRA 2YHEA 4KZ0A 3MEKA 1TNYA 2XPIA 3HIZA 3L9TA 2R05A 4NURA 2RFAA 3FTWA 4AP2A 3ISMC 4A1SA 2XCCA 3RO3A 2V5FA 5KJNA 4I2ZA 4L23A 4IYPA 4WWOA 4BESA 1IHBA 2I1JA 2BEDA 1BI7B 2VGEA 1OCZE 2GRNB 3W9GA 3CHSA 3MV3B 4HBDA 2CHXA 1DVPA 3TJPA 3U9WA 4WWPA 4LNBA 4NIKA 2WMNA 1U2VG 1KPSB 3ZN3A 4I9EA 3JXIA 4PUCA 1WY6A 1IQRA 3Q78A 1P5QA 3FUIA 4XIFA 3Q49B 3ULEG 3PRZA 4JHRA 3SBTB 4HB5A 2IQCA 4YNDA 5LFAA 1XNFA 3ABKE 2RD0A 3AAAC 2J8SD 4AIFA 3CVVA 3ONKA 2WXRA 1YYHA 1NP7A 3ZFWA 1Z3XA 1Y8MA 4DX5D 2CHZA 3IV0A 2WXJA 4FJYA 1WDYA 1WG0A 4N2SA 4HI9A 4KVMA 4Y6CA 5G2NA 3FU0A 1B89A 4JXTA 1A5EA 3TWSA 4BT8A 2VSNA 1NI1A 1YMPA 5CERB 3ZEFA 3BEEA 2IOSA 3LEWA 3G2TA 3OTNA 4C0EA 5JMND 4KT6B 4ILIA 1OWOA 3SBSA 3BG0B 3UM2A 4GTSA 3U3WA 2MOWA 2QYUA 4AVXA 2UWJG 2IJGX 1N4PA 2DYSE 4WNDA 3HG0D 5CEDB 3CHPA 2A5EA 3WXXA 1TNUA 2X6FA 3RSEG 3FDHA 4BT9A 3ZW3A 5AARA 1LTXA 3CHRA 3HVEB 2R59A 2ONDA 2J09A 3PDNA 5ENPD 1KZOA 2PZIA 3PEUB 3AG4E 3AS8A 3N71A 5EYLA 3BQOA 5EX0A 4DI3A 3T8MA 4HOUA 2NYJA 1OT8A 4J8DA 4U7EB 3Q4AB 3QOUA 5ENOD 1O1SA 4UWKA 1HXIA 2GRLA 2J49A 4YVQC 1OCOE 3FUFA 2QYJA 3HXEA 2HR2A 3CQGB 2XQ0A 3DXKG 3ZU7B 4U0UA 4GA1A 1IHGA 3FUKA 3ABLE 4G1TA 4F6RD 3OAWA 2BTDA 5AQBA 1OWMA 4TXPA 5KJKA 3QWWA 5FQ4A 2X6IA 1E7VA 5FIOA 2DCPA 4GU5A 1QZ2A 2XHEA 3EIQC 1N4QA 3FTZA 3DSTA 1IKND 3URZA 3ASDA 5DIZA 3D9LA 3AU4A 4C9BB 2WMOA 3E33A 4G23A 4N5QA 4I2WA 3IHVA 4I1OB 4U0SA 3TWWA 4CZ2D 1N9AA 3E30A 3I4GA 2I9CA 4GMRA 3ULQA 3Q47B 4ME2A 4KVOA 4I6GA 3UKRG 4ACLA 4JL0A 3QWPA 2QC9A 5ENQD 3EU5A 3QAQA 2XGMA 3ZHEA 5JA4D 2WXFA 3L6AA 2UY1A 4B93B 3HXCA 3TG5A 3NOGD 1MQSA 2X38A 3TXMA 1PAQA 5KCMA 3DEOA 4UI9C 1OUVA 4K03A 3D9HA 1N54A 3RJVA 4LUNU 5EDSA 3ZHEB 1KT0A 4UQYA 4N5CA 3ZRHA 4F1SA 1E90A 4QFVA 2UY1B 2WXNA 3L13A 2P2CP 5FQ7A 3V30A 2EINE 4NRHB 5B1AE 4M3OA 4BSXA 4TRQA 3HDXA 5FT9A 5EYPF 3CVPA 3VLDA 1X5BA 2HM8A 2ZU6B 3CK8A 3I3NA 3GW4A 1HG2A 4XZ4A 4DPRA 4FU3A 3FHEA 2AVPA 5ITZF 2DVWA 4GZ3A 5D2MC 2Q7FA 4N3CA 3CR3A 1EDUA 4GTMA 2C0LA 5HS0A 3X2QE 5EKQD 4EBAA 1NA0A 3OXLA 3T5VA 4J8FA 2VSYA 2I1KA 1V55E
chains in the Genus database with same CATH topology
5T3RA 2A4ZA 3LXUX 1H2UA 3D9NA 2YQ8A 4AY6A 4IULA 1OWNA 1BPOA 3D3MA 4G26A 3UX4A 4DK5A 2WQ7A 3CVYA 3CLJA 2LO6A 4CT0A 3SFZA 3PE4A 4UQZA 3LJ3A 2HYZA 2WVIA 2BUGA 1H19A 4JW1A 1HU3A 4FHKA 3U4TA 3D9KA 3R7RA 3CVUA 3D9IA 3JYSA 3CIAA 3GZ2A 4IRUA 2X6KA 1W3BA 2WXPA 4XX5A 1S0PA 3O48A 3MJWA 3PEVB 5HI7A 2PQRA 2E0IA 1TEZA 3SHFA 2IU1A 4A3TA 2L0TB 3FWVA 4E85A 1E8XA 3CVQA 3LYAA 4GMJA 4MRUA 3HVEA 4U04A 4PS3A 5ANRA 2RG8A 4A3VA 4Q69A 2YHEA 2WXIA 2J9QA 3RO2A 2OVFA 3D9PA 3GZ1A 4L2LA 3IKOB 3ZPJA 4KZ0A 2OVBA 3MEKA 4O6FA 2QFCA 1OWPA 3RKVA 3RK6A 2XPIA 3HIZA 3FY4A 2AW6A 4NURA 4HOQA 5FTPA 4EECA 4ILHB 5FQ6A 4F53A 4JVSA 1JWGA 3FTWA 4AP2A 4GZ5A 3ML8A 3OXFA 4A1SA 2XCCA 3RO3A 2V5FA 4J6IA 4NQ0A 2FEZA 3G2UA 5KJNA 1HG5A 4I2ZA 3TG4A 4CEMA 3LY9A 4G24A 4PH4B 1GW6A 4L23A 4W9RA 4IYPA 4WWOA 3JCKC 2I1JA 5FZQA 3K9IA 2FULA 3JUIA 3R7QA 4UWHA 3FEXA 4PS8A 3KEZA 3RIBA 3L17A 2EQXA 3LCAA 4EBAG 3L08A 4GCNA 5FWQA 3GZSA 3MYVA 3CHSA 3MV3B 3KS2A 3ZYMA 4UI9K 4YVOA 3TGOA 5AJLA 2BF0X 3B7SA 3FTXA 4RVBA 4KMOA 2CHXA 2WM9A 1DVPA 1E8WA 3TJPA 3U9WA 4WWPA 2OV8A 3ENEA 5G55A 2WMNA 1JWFA 3S7FA 3QK0A 3ZN3A 2P58C 3QC1A 3QWVA 4I9EA 4PUCA 4EPZA 1LF8A 4AJWA 3I4RB 2KCLA 1WY6A 3NQPA 1IQRA 1P5QA 3FUIA 4XIFA 3PVLA 1XGWA 3Q49B 4Q96A 3VLEA 2WXLA 5ENNA 4B89A 3PRZA 1H2TC 4I1MA 1E7UA 4B94A 2JEKA 4FLHA 3G2VA 4JHRA 3SBTB 5FZRA 4ANVA 3FH5A 4DJAA 2PM7A 4IN3B 4BX8A 1JUQA 4F7AA 2IQCA 2YHCA 3FUJA 4YNDA 5LFAA 3FUHA 1HE8A 1XNFA 2WXQA 1E8YA 1HS6A 5AIJA 1H6KA 3OXGA 3JQ0A 2RD0A 3AU5A 3DBSA 4H7YA 4WAFA 3VTXA 4L1BA 4R7LA 4AIFA 5EX3A 3TL5A 3CVVA 2CFZA 5D0OD 5BV1A 3APCA 3ONKA 3GYZA 2WXRA 2VGXA 1NP7A 3ML9A 2KATA 2GGFA 2KCKA 3CHOA 4ANXA 5D0QD 1Z3XA 3ZFWA 1Y8MA 4H7XA 5M72A 2FBNA 2J07A 3LDZA 3LY7A 3CV0A 3LVRE 3QDNA 4XI9A 2CHZA 3B7UX 4CT4A 5CCMA 3IV0A 2WXJA 3Q5MA 3TXNA 4EZJA 2VTBA 3S7DA 1EF1C 1E8ZA 2E2EA 4FJYA 1WAO1 5CMYA 3FFLA 3MCXA 2LNIA 1NA3A 4NACA 2MRIA 3CKCA 4AV7A 5J08A 2PQNA 4N2SA 3PNTB 5JJ6A 4KVMA 4Y6CA 2AXVA 2KZTB 2Y3AA 3P1UA 1MHQA 3FU6A 5G2NA 5BPPA 3FU0A 4GZDA 4GZ6A 1B89A 4J8SA 3QNKA 4GAAA 4I17A 4JXTA 3SF4A 3CHQA 4B8AA 2XGOA 4LERA 5E75A 4BT8A 4OVVA 3MKQB 2DIWA 3DPDA 3UUXA 4UQXA 2VSNA 1A17A 2I6HA 4JZYA 4EZLA 1TJFA 3G2WA 4CRWA 4CGWA 3ZEFA 2J08A 3SZ7A 3HHMA 3BEEA 1HO8A 3IHYA 2IOSA 3RRMB 3LEWA 3G2TA 5JHAA 1QQEA 2VGXB 3RU0A 3OTNA 4C0EA 3FEYA 5FZSA 3ESLA 5A6CA 3L54A 4KT6B 3APDA 4ILIA 1OWOA 2WXGA 3SBSA 3L16A 3BG0B 2ILRA 1IQUA 3QKYA 3ZYKA 1VDYA 2C2LA 3T5XA 3U3WA 3NZUA 1ELKA 2MOWA 3ESKA 4GA0A 2XPZA 4KYOB 5BUZA 2VTBB 3FH7A 1INZA 3MZLB 4AVXA 2XCBA 4FHJA 1HF8A 3G2SA 4I6EA 4WWNA 1FVHA 3RRNB 2UWJG 2AXUA 2XPYA 2IJGX 4APFA 4WNDA 2PM6A 5T8IA 4PDXA 2R17C 3CHPA 5CMWA 3WXXA 2V8SE 2VGYA 3RRUA 2X6FA 3CK7A 5DBKA 1KLXA 3UMVA 4B8CB 5A7DB 1HH8A 1UN9A 3FU5A 3FDHA 3LPZA 2IOLA 4I43A 4BT9A 4WNGA 4WUYA 1U3CA 3ZW3A 4MLPA 4RG6A 3CHRA 2JLBA 3HVEB 4U07A 4PS7A 2FI7A 3ASGA 1ELRA 3B7RL 2R59A 4FP7A 3CHMA 2PL2A 5ANLA 2ONDA 2X6HA 3AS5A 3R9AB 3NF1A 2J09A 3PDNA 4HS2A 4Y6WA 4CCAA 2PZIA 3QARA 2XEVA 3MKRA 2X6JA 3FUDA 3PEUB 2VSOE 2J4BA 2IFUA 5HQ8A 3UPVA 5ARFA 3AS8A 5G05J 3U66A 3N71A 2AWIA 4BTBA 4EZKA 4E6HA 3CGHA 3ZYQA 4APOA 1H0AA 4FJZA 5EX0A 4DI3A 2V0PA 3FTVA 3T8MA 4G11A 4HOUA 4FC8A 5J90A 3FTUA 4XE0A 2VJ8A 4C0MA 5LCWJ 3UT4A 4J8DA 4XKCA 1L5JA 4DI4A 3ZGQA 4JA7A 4JPSA 5C1DA 3SGHA 3B13A 3CVXA 3QB2A 4BX9A 3CVLA 4BWRA 3Q4AB 2J4DA 3QOUA 4JEHA 2XGSA 4V3IA 3UT7A 3NZSA 5BNWA 2WQHA 1SZ9A 4AM9A 3FULA 4UWKA 4TUUA 1ZBPA 1HXIA 4G25A 2GRLA 5G04J 2J49A 3CSTA 4AEZC 4YVQC 2X3MA 3D9OA 4ILGA 3EIJA 4JEUA 2XRZA 2YNQA 4BFRA 5KJMA 1PC2A 2R5SA 3FUFA 3IBEA 4MKTA 5C2YA 4HXIA 1EYHA 2HR2A 3CQGB 2XQ0A 1SZAA 3PS6A 3S7BA 4HORA 3FUEA 4ATGA 4U0UA 4GA1A 3UQ3A 1QNFA 3JQ1A 4OYSA 4XI0A 3KAEA 2OOEA 4AOFA 4HOTA 2MHKA 1IHGA 3FUKA 3BG1B 2GW1A 1DNPA 4G1TA 4N3AA 4FADA 3OAWA 2HO1A 2BTDA 1UG3A 4GMLA 4HFGA 2WQ6A 1OWMA 2CG2A 4GA2A 3FU3A 4RSYA 5KJKA 2Y4UA 1N52A 4WNFA 3QWWA 4JC8A 2X6IA 5FQ4A 1E7VA 3EHMA 3KD7A 3PUJA 3CEQA 4FULA 3UT8A 4URKA 4UWLA 4LEUA 3MA5A 2DCPA 4GU5A 4A55A 3QJZA 1QZ2A 2XHEA 3PNLB 3EIQC 3MX3A 3AS4A 4GB9A 4K0RA 1Y6IA 1ZU2A 4HLEA 2WXKA 1E96B 3CQCB 1JPLA 3L22A 4AY5A 4KZCA 3FTZA 3CKBA 2LSUA 4J8EA 3URZA 3ASDA 5AENA 4WNEA 4F3VA 3MV2B 3PH0C 5DIZA 5AYWD 1Z6TA 3D9LA 3SI5A 2M63A 3AU4A 4C9BB 2WMOA 2VQ2A 1UJJA 1SQMA 1FCHA 4DLQA 2LAHA 3TAXA 4GZCA 4GYWA 4G23A 3O4ZA 2I2OA 4I2WA 2KC7A 3IHVA 4LCTA 4I1OB 4U0SA 3FUNA 3S2AA 4BTAA 4CDRA 3U64A 3I4GA 4HVBA 2FO7A 2I9CA 3EJNA 3PREA 2GRMA 3ULQA 2VYIA 3Q47B 4ME2A 3D9JA 4KVOA 4I6GA 3APFA 4ACLA 1UJKA 3ASHA 4GYOA 4JL0A 4U8HA 3S7JA 3MGBA 3QWPA 4LRZA 4DLOA 3LS8A 3E4BA 5AJDA 5JHBA 3QAQA 2XGMA 3ZHEA 1FVFA 2A5UA 1HZ4A 1UW4B 2KCVA 3FTYA 2AXZA 1Z3YA 4UWGA 4D10C 2FF4A 3P2BA 4ANWA 4CGVA 2WXFA 4AXHA 3L6AA 4CDMA 3LKUA 5LX8A 4JHJA 2WXMA 2L9BA 2UY1A 5FQ8A 1U3DA 3TG5A 3ZYLA 4UI9J 4A1GA 4B0ZA 2KM4A 5CCLA 1KT1A 2WXOA 4I9CA 5A23A 1MQSA 3CSFA 5JJTA 2X38A 3TXMA 2L6JA 1PAQA 4ACKA 4BY6A 5BT1A 5BV0A 4GYYA 4N3BA 3ONLA 5FJYA 5KCMA 4N2QA 4UI9C 3PE3A 3FP3A 1NZNA 1IYGA 1OUVA 4K03A 1N54A 3RJVA 3C98A 4TV3A 3VLFA 4LUNU 4U63A 2NXPA 5EDSA 2CG3A 3VTYA 1EPUA 1HX8A 5G05C 3CK9A 3EHNA 3I5PA 2YINA 3ZHEB 1KT0A 4ABNA 2QY7A 4UQYA 4N5CA 3EDTB 3LVQE 2LSVA 3ZRHA 3SNXA 1TJCA 4UWFA 5JJ7A 4F1SA 4N39A 1E90A 4GPKA 2WB2A 3ZVVA 5LCWC 4QFVA 3FTSA 4U0ZA 5ARGA 2UY1B 4FA6A 3LY8A 2WXNA 3L13A 2WXHA 5FQ7A 3ZXSA 2IONA 4L2YA 4NRHB 1PY1A 2KZTA 4M3OA 4BSXA 4TRQA 4EQFA 2WPVA 4J0UA 3HDXA 5E76A 2LAIA 4P29A 5FT9A 2CHWA 5T4YA 4Q94A 3SD5A 4JA9A 3D9MA 2CFUA 4I1AA 4GCOA 1WM5A 4XKBA 5LOZA 1ELWA 3CVPA 4HOSA 2IF4A 3MKQA 1X5BA 2HM8A 4FLBA 4KBQA 5G04C 3VLDA 2ZU6B 3CK8A 3I3NA 3GW4A 1HG2A 4XZ4A 3CVWA 4DPRA 4FU3A 3FHEA 2AVPA 3PZDA 2V4LA 5CHEE 4GZ3A 3Q15A 3FH8A 2NC9A 2Q7FA 2Y4TA 2DBAA 4RG9A 2XRYA 4L7TA 4N3CA 2C0MA 2VSXE 3CR3A 1UN8A 4I6JA 1EDUA 4OVUA 1HFAA 2C0LA 3HYMB 4CDNA 4G2VA 4ANUA 3FUMA 5EKQD 5BW8C 4EBAA 1NA0A 3OXLA 2L0IA 3T5VA 1YA0A 1OWLA 3PUKA 4J8FA 1H2VC 4JHKA 4KXKB 2NSZA 2VSYA 4MS6A 3ZIMA 3B7TA 3CVNA 2I1KA 3IEGA 5LP0A 3ASFA 5KJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQ8 A;  4AY6 A;  4G26 A;  3PE4 A;  4UQZ A;  2HYZ A;  2BUG A;  3U4T A;  3JYS A;  3GZ2 A;  1W3B A;  3O48 A;  5HI7 A;  2PQR A;  3FWV A;  4U04 A;  3CVQ A;  3LYA A;  2J9Q A;  3RO2 A;  3GZ1 A;  3ZPJ A;  4O6F A;  3MEK A;  2QFC A;  3RKV A;  2XPI A;  4HOQ A;  5FTP A;  4GZ5 A;  3OXF A;  4A1S A;  2XCC A;  3RO3 A;  2V5F A;  4NQ0 A;  2FEZ A;  5KJN A;  4I2Z A;  3TG4 A;  3LY9 A;  4G24 A;  4W9R A;  5FZQ A;  3K9I A;  3RIB A;  3LCA A;  4GCN A;  3MV3 B;  3KS2 A;  3TGO A;  4UI9 K;  4YVO A;  3S7F A;  3ZN3 A;  2P58 C;  4I9E A;  3QWV A;  2KCL A;  1P5Q A;  4XIF A;  3Q49 B;  4B94 A;  4JHR A;  5FZR A;  4IN3 B;  4YND A;  2YHC A;  1XNF A;  3OXG A;  4H7Y A;  3VTX A;  4AIF A;  5EX3 A;  5D0O D;  3GYZ A;  2VGX A;  2KAT A;  2KCK A;  5D0Q D;  3ZFW A;  5M72 A;  1Y8M A;  4H7X A;  2FBN A;  3LY7 A;  3CV0 A;  3QDN A;  4XI9 A;  5CCM A;  3Q5M A;  3S7D A;  2E2E A;  1WAO 1;  3FFL A;  2LNI A;  1NA3 A;  3CKC A;  2PQN A;  4N2S A;  5JJ6 A;  4Y6C A;  4GZ6 A;  1B89 A;  4I17 A;  3SF4 A;  2XGO A;  4BT8 A;  3UUX A;  4UQX A;  2VSN A;  1A17 A;  2I6H A;  4CGW A;  3SZ7 A;  3BEE A;  1QQE A;  2VGX B;  3RU0 A;  5FZS A;  5A6C A;  3QKY A;  2C2L A;  3U3W A;  3ESK A;  4GA0 A;  4KYO B;  2XCB A;  2UWJ G;  4WND A;  3WXX A;  2VGY A;  3CK7 A;  5DBK A;  1KLX A;  5A7D B;  1HH8 A;  3LPZ A;  4BT9 A;  4WNG A;  4WUY A;  4RG6 A;  2JLB A;  4U07 A;  2FI7 A;  3ASG A;  1ELR A;  2PL2 A;  2OND A;  3AS5 A;  3R9A B;  3NF1 A;  3PDN A;  4Y6W A;  2PZI A;  2XEV A;  3MKR A;  2IFU A;  5HQ8 A;  3UPV A;  5ARF A;  3AS8 A;  5G05 J;  3N71 A;  4BTB A;  4APO A;  5EX0 A;  4HOU A;  5LCW J;  4J8D A;  3ZGQ A;  4JA7 A;  5C1D A;  3CVL A;  4BWR A;  3Q4A B;  3QOU A;  2XGS A;  5BNW A;  2WQH A;  4AM9 A;  1ZBP A;  1HXI A;  4G25 A;  5G04 J;  4YVQ C;  5KJM A;  1PC2 A;  2R5S A;  2HR2 A;  3S7B A;  4HOR A;  4U0U A;  4GA1 A;  3UQ3 A;  4XI0 A;  3KAE A;  2OOE A;  4HOT A;  2MHK A;  1IHG A;  2GW1 A;  4G1T A;  4N3A A;  2HO1 A;  4GA2 A;  5KJK A;  2Y4U A;  4WNF A;  3QWW A;  3KD7 A;  3CEQ A;  4LEU A;  3MA5 A;  1QZ2 A;  3AS4 A;  1ZU2 A;  1E96 B;  4AY5 A;  3CKB A;  2LSU A;  4J8E A;  3URZ A;  3ASD A;  4WNE A;  4F3V A;  3MV2 B;  5DIZ A;  5AYW D;  2VQ2 A;  1FCH A;  3TAX A;  4GYW A;  4G23 A;  4I2W A;  2KC7 A;  4U0S A;  4CDR A;  4BTA A;  2FO7 A;  3ULQ A;  2VYI A;  3Q47 B;  4ME2 A;  3ASH A;  4GYO A;  4JL0 A;  3S7J A;  3QWP A;  3E4B A;  2XGM A;  3ZHE A;  1HZ4 A;  2KCV A;  2FF4 A;  4CGV A;  3LKU A;  2UY1 A;  3TG5 A;  4UI9 J;  5CCL A;  1KT1 A;  4I9C A;  5JJT A;  2L6J A;  5BT1 A;  4GYY A;  4N3B A;  4N2Q A;  5FJY A;  4UI9 C;  3PE3 A;  3FP3 A;  1NZN A;  1IYG A;  1OUV A;  3RJV A;  3VTY A;  5G05 C;  3CK9 A;  3ZHE B;  1KT0 A;  4ABN A;  4UQY A;  4N5C A;  3EDT B;  2LSV A;  1TJC A;  5JJ7 A;  4N39 A;  4GPK A;  5LCW C;  4U0Z A;  5ARG A;  2UY1 B;  3LY8 A;  4NRH B;  4EQF A;  2WPV A;  4J0U A;  5FT9 A;  4JA9 A;  4I1A A;  4GCO A;  1WM5 A;  1ELW A;  3CVP A;  4HOS A;  2IF4 A;  4KBQ A;  5G04 C;  3CK8 A;  3GW4 A;  2AVP A;  5CHE E;  4GZ3 A;  3Q15 A;  2NC9 A;  2Q7F A;  2Y4T A;  2DBA A;  4RG9 A;  4N3C A;  2C0M A;  2C0L A;  3HYM B;  4G2V A;  5EKQ D;  5BW8 C;  1NA0 A;  3OXL A;  1YA0 A;  4J8F A;  4KXK B;  2VSY A;  3CVN A;  3IEG A;  3ASF A;  5KJL A; 
#chains in the Genus database with same CATH topology
 3ASN E;  3LXU X;  3D9N A;  4AY6 A;  1BU9 A;  1JCQ A;  1X81 A;  2LO6 A;  3WG7 E;  3KSQ A;  3D9K A;  1S0P A;  3DSU A;  3PEV B;  2PQR A;  2E0I A;  1TEZ A;  3SHF A;  2IU1 A;  1E8X A;  4U04 A;  4GMJ A;  4PS3 A;  5ANR A;  1K8K G;  2J9Q A;  3GZ1 A;  4L2L A;  3ZPJ A;  2OVB A;  1OWP A;  3RK6 A;  2AW6 A;  2RFM A;  3NB2 A;  2R2L A;  4F53 A;  4JVS A;  4GZ5 A;  3LY9 A;  2Y69 E;  3JCK C;  5IY5 E;  1KZP A;  2FUL A;  3DRA A;  3RIB A;  3L17 A;  5KNH D;  3LCA A;  3TGO A;  3B7S A;  2DZO A;  4KMO A;  2OV8 A;  3QK0 A;  3SFY A;  2ETC A;  1LF8 A;  3I4R B;  5ENS D;  1TR4 A;  3DSV A;  4Q96 A;  3VLE A;  2WXL A;  4I1M A;  1H2T C;  4B94 A;  2JEK A;  4FLH A;  3ZUV B;  2PM7 A;  4IN3 B;  4BX8 A;  3C5R A;  1JUQ A;  1LD7 A;  2WXQ A;  2P9K G;  4G8L A;  4WAF A;  3VTX A;  2CFZ A;  5BV1 A;  3APC A;  3ML9 A;  2KAT A;  2GGF A;  5D0Q D;  4H7X A;  3LDZ A;  3LY7 A;  3QDN A;  4XI9 A;  4CT4 A;  3Q9U C;  3TXN A;  4EZJ A;  1E8Z A;  5CMY A;  3FFL A;  1NA3 A;  2PQN A;  4YDY A;  2EIM E;  5JJ6 A;  2LXL A;  2KZT B;  2Y3A A;  3P1U A;  3FU6 A;  1Q2Z A;  4J8S A;  3QNK A;  4GAA A;  3SF4 A;  4HNA D;  5E75 A;  4LER A;  3F6Q A;  4OVV A;  3UUX A;  3PZ1 A;  4UQX A;  1TYQ G;  1A17 A;  4EZL A;  2DZN A;  3SZ7 A;  1HO8 A;  3IHY A;  1OCR E;  2H6G A;  1QQE A;  4X8Q A;  3EHQ A;  5FZS A;  3ESL A;  3L54 A;  3APD A;  3T9K A;  3C3Q A;  2WXG A;  3L16 A;  2LXM A;  1VDY A;  2C2L A;  1K1A A;  3MZL B;  1TNO A;  2XCB A;  3G2S A;  5T8I A;  2MYO A;  5B1B E;  4TUM A;  3J5P A;  2RKK A;  2VGY A;  4B8C B;  1KLX A;  3UMV A;  3FU5 A;  3LPZ A;  2IOL A;  3UIN C;  3SO8 A;  4WUY A;  1U3C A;  4RG6 A;  1SA4 A;  4U07 A;  4PS7 A;  2FI7 A;  4FP7 A;  5ANL A;  2ZXW E;  2ZGG A;  4OAV B;  4Y6W A;  1N11 A;  3MKR A;  2GRO B;  2AWI A;  4BTB A;  4APO A;  4FJZ A;  2ZIR A;  1QBQ A;  3FTV A;  4J8Y A;  5J90 A;  5BXO A;  3FTU A;  3AG3 E;  4JPS A;  5C1D A;  3B13 A;  5KNG A;  3QB2 A;  3CVX A;  1YCS B;  2KXP C;  4V3I A;  4UUC A;  3NZS A;  3UT7 A;  2WQH A;  4AM9 A;  3FUL A;  4G25 A;  2FO1 E;  3CST A;  4AEZ C;  1Z5S C;  1OY3 D;  3IBE A;  5C2Y A;  1EYH A;  5ENR D;  3S7B A;  3TWQ A;  3JQ1 A;  4XI0 A;  3KAE A;  2OOE A;  4U95 D;  3BG1 B;  5AAO A;  1DNP A;  1MYO A;  1UG3 A;  4GML A;  4HFG A;  3IXE A;  3FU3 A;  4DRX E;  2Y4U A;  1N52 A;  3EHM A;  3UT8 A;  3PUJ A;  5CBO A;  4UWL A;  3MA5 A;  3DXM G;  4BET A;  3AS4 A;  4GB9 A;  1UOH A;  4K0R A;  4HLE A;  1E96 B;  1JPL A;  2LSU A;  4WNE A;  4HRN A;  3MV2 B;  3PH0 C;  1MJ0 A;  2L6B A;  2M63 A;  1K3Z D;  1FCH A;  1SQM A;  2XEE A;  2LAH A;  3TAX A;  3Q7F A;  4HVB A;  3TWT A;  2FO7 A;  2GRM A;  1UJK A;  4GYO A;  4U8H A;  2OCC E;  4DLO A;  3LS8 A;  1RZ4 A;  5AJD A;  5JHB A;  1FVF A;  2A5U A;  3V2X A;  1HZ4 A;  4O1O A;  2AXZ A;  4UWG A;  4ANW A;  3UI2 A;  3LKU A;  2L9B A;  3C3O A;  2V4H C;  3UM3 A;  5EIB E;  4A1G A;  2WXO A;  5AQA A;  3CSF A;  2L6J A;  4ACK A;  5BT1 A;  5BV0 A;  3C72 A;  3SY2 A;  2XZD G;  3FP3 A;  4LNG A;  5EID A;  3C98 A;  4TV3 A;  3VLF A;  1EPU A;  5G05 C;  1S64 A;  3LVQ E;  2LSV A;  1TJC A;  4N39 A;  4GPK A;  3ZVV A;  5LCW C;  4U0Z A;  5ARG A;  2ION A;  2V5Q C;  4L2Y A;  1N94 A;  2WPV A;  3SD5 A;  3AJI A;  3DSX A;  4GCO A;  4XKB A;  3JUE A;  4HOS A;  4KBQ A;  3MKQ A;  1H6P A;  5G04 C;  2KBX A;  3CVW A;  3PZD A;  2V4L A;  3FH8 A;  2DBA A;  4RG9 A;  2XRY A;  2C0M A;  2VSX E;  1UN8 A;  2H6F A;  4I6J A;  4CDN A;  4O1P A;  4DX6 D;  5BW8 C;  4KXK B;  4JHK A;  5LP0 A;  3ASF A;  5KJL A;  3E32 A;  1OWN A;  3D3M A;  3CVY A;  2EIL E;  5FIN A;  3SFZ A;  3ZXP A;  3T8K A;  4XEI G;  1H19 A;  4JW1 A;  4J7W A;  4FHK A;  4GTO A;  3CVU A;  3JYS A;  3CIA A;  2WXP A;  3O48 A;  4JB8 P;  4GTT A;  2L0T B;  3FWV A;  2OVF A;  3D9P A;  3IKO B;  2EIJ E;  4O6F A;  1NL4 A;  1DCE A;  3UIO C;  1DCQ A;  5FTP A;  4EEC A;  4ILH B;  5FQ6 A;  3ML8 A;  2P9L G;  2R02 A;  3ZKJ A;  1GW6 A;  4W9R A;  2GRQ B;  1S63 A;  1BD8 A;  1D8D A;  3JUI A;  3R7Q A;  3LJN A;  2ZGD A;  3L08 A;  4GCN A;  5FWQ A;  1FT1 A;  1N0R A;  3ZYM A;  4YVO A;  4RVB A;  1FT2 A;  2WM9 A;  2XS8 A;  1JWF A;  3S7F A;  3QC1 A;  3QWV A;  4AJW A;  4BEP A;  3PVL A;  5ENN A;  4B89 A;  1E7U A;  3EU9 A;  3G2V A;  3FH5 A;  2IO2 C;  4HRL A;  4F7A A;  3FUJ A;  1HS6 A;  5AIJ A;  2H6H A;  1H6K A;  3OXG A;  3JQ0 A;  5EX3 A;  3TL5 A;  3GYZ A;  5B3S E;  4F1P A;  3UM0 A;  5M72 A;  1SA5 A;  2J07 A;  5CCM A;  3B7U X;  2VTB A;  3S7D A;  1WAO 1;  3MCX A;  4NAC A;  3PNT B;  2AXV A;  1MHQ A;  5ENT D;  5KBA A;  3B95 A;  2GRP B;  2XGO A;  3DPD A;  1S70 B;  1JCS A;  2I6H A;  4CGW A;  4CRW A;  2J08 A;  3EUV A;  3RU0 A;  4LG6 A;  3FEY A;  5A6C A;  2HE0 A;  1K1B A;  3RAU A;  4A63 B;  1TN8 A;  3HXB A;  2ILR A;  3QKY A;  3NZU A;  1ELK A;  3ESK A;  4GA0 A;  5BUZ A;  2VTB B;  3B7B A;  4HRM B;  4JD2 G;  3FH7 A;  1INZ A;  4FHJ A;  4I6E A;  1FVH A;  3RRN B;  2JAB A;  2AXU A;  2R17 C;  5CMW A;  2V8S E;  3RRU A;  1V54 E;  4C48 B;  1N95 A;  4WNG A;  4G8K A;  1TN7 A;  4HQD A;  2F37 A;  3NAW A;  3PZ3 A;  2PL2 A;  3R9A B;  3NF1 A;  4CCA A;  3QAR A;  3FUD A;  2VSO E;  3UKU G;  5HQ8 A;  3UPV A;  5ARF A;  3U66 A;  4EZK A;  3ZYQ A;  4YDO A;  1H0A A;  2V0P A;  4G11 A;  4XE0 A;  4C0M A;  4XKC A;  1O1T A;  3ZGQ A;  3SGH A;  4BX9 A;  2J4D A;  4JEH A;  3EHR A;  2XGS A;  4LSZ E;  5KWD A;  5BNW A;  3C3R A;  3AG1 E;  4TUU A;  1ZBP A;  2P9N G;  3D9O A;  4ILG A;  4JEU A;  4BFR A;  5KJM A;  1PC2 A;  4MKT A;  2R03 A;  3UQ3 A;  3TWU A;  2MHK A;  3TWV A;  2GW1 A;  1N4S A;  2BKK B;  4FAD A;  2HO1 A;  2WQ6 A;  5EN5 D;  2CG2 A;  3KD7 A;  4FUL A;  4A55 A;  1TNZ A;  4U96 D;  3PNL B;  3MX3 A;  1Y6I A;  1ZU2 A;  3CQC B;  3L22 A;  4AY5 A;  4F3V A;  3SI5 A;  2ZIS A;  2AJA A;  2VQ2 A;  1UJJ A;  2ETA A;  3O4Z A;  2I2O A;  3ULY A;  4CDR A;  4BTA A;  3U64 A;  2VYI A;  3APF A;  3S7J A;  3MGB A;  4LRZ A;  3E4B A;  4GTQ A;  2KCV A;  4D10 C;  2FF4 A;  3P2B A;  4AXH A;  4CDM A;  2WXM A;  4L9P A;  1U3D A;  2KM4 A;  2BKG A;  1KT1 A;  4I9C A;  4BY6 A;  4GYY A;  3ONL A;  3PE3 A;  1NZN A;  3TWX A;  4DUI A;  4U63 A;  4GTR A;  1DC2 A;  3EHN A;  2QY7 A;  2Y1L E;  2DYR E;  3EDT B;  4UWF A;  3LY8 A;  3DWL G;  3ZXS A;  1MX2 A;  2P9U G;  4EQF A;  5E76 A;  4P29 A;  5T4Y A;  1MX6 A;  2PNN A;  4JA9 A;  3D9M A;  2CFU A;  4I1A A;  1WM5 A;  1ELW A;  3PZ4 A;  5CHE E;  3Q15 A;  1RW2 A;  2Y4T A;  1H6O A;  3PZ2 A;  3L82 A;  1HFA A;  3HYM B;  4ANU A;  3PUK A;  1H2V C;  3Q7A A;  3ZIM A;  4MS6 A;  3CVN A;  1BI8 B;  5T3R A;  2A4Z A;  1H2U A;  2YQ8 A;  3UX4 A;  4DK5 A;  3NOC D;  3CLJ A;  3ABM E;  3LJ3 A;  1SVX A;  3V2O A;  2BUG A;  1G3N B;  1HU3 A;  4LNU D;  3R7R A;  4IRU A;  2X6K A;  5HI7 A;  3LYA A;  3HVE A;  1AWC B;  4A3V A;  2RG8 A;  2WXI A;  3RO2 A;  3UM1 A;  3DEP A;  2QFC A;  3RKV A;  3FY4 A;  3Q9N C;  4HOQ A;  1JWG A;  3HRA A;  1D9S A;  3OXF A;  3SFX A;  3KEA A;  4J6I A;  4K5B A;  4NQ0 A;  3DSW A;  2FEZ A;  3G2U A;  1HG5 A;  3TG4 A;  4CEM A;  5HRY A;  3TWR A;  4G24 A;  4PH4 B;  5FZQ A;  3K9I A;  2IY0 C;  3BU8 A;  4UWH A;  4OAU C;  3FEX A;  4PS8 A;  5CRU A;  3KEZ A;  2IO3 C;  2EQX A;  4HI8 A;  3ASO E;  4EBA G;  3GZS A;  3MYV A;  3KS2 A;  4UI9 K;  5AJL A;  2BF0 X;  3FTX A;  1N4R A;  1E8W A;  3ENE A;  5G55 A;  2P58 C;  3AG2 E;  4EPZ A;  1OXJ A;  2KCL A;  3NQP A;  4K5A B;  1XGW A;  4ANV A;  3NBN B;  5FZR A;  1BLX B;  4DJA A;  2YHC A;  3FUH A;  1HE8 A;  1E8Y A;  3AU5 A;  3DBS A;  4H7Y A;  4L1B A;  4R7L A;  4U8Y D;  5D0O D;  2VGX A;  2KCK A;  3CHO A;  4YDE A;  4ANX A;  2FBN A;  3CV0 A;  3LVR E;  2P9I G;  4ATZ D;  3Q5M A;  1EF1 C;  2E2E A;  2LNI A;  2MRI A;  3CKC A;  4AV7 A;  5J08 A;  2OEW A;  3R9M A;  5BPP A;  4GZD A;  4GZ6 A;  3UIP C;  4I17 A;  4EHM A;  1N0Q A;  3CHQ A;  4B8A A;  3MKQ B;  2DIW A;  4JZY A;  1TJF A;  2P9S G;  3G2W A;  3HHM A;  3RRM B;  5JHA A;  2VGX B;  1MX4 A;  3ZYK A;  1IQU A;  1TN6 A;  3BUA A;  3T5X A;  2XPZ A;  4KYO B;  5HKP A;  5AQ7 A;  1HF8 A;  4WWN A;  4HLL A;  2XPY A;  4APF A;  1OCC E;  2PM6 A;  4PDX A;  2Y0B G;  2B0O E;  3CK7 A;  5DBK A;  5A7D B;  1HH8 A;  1UN9 A;  4I43 A;  4MLP A;  2JLB A;  3E37 A;  3ASG A;  1ELR A;  3B7R L;  3CHM A;  2X6H A;  3AS5 A;  4YDW A;  4HS2 A;  2XEV A;  2X6J A;  2J4B A;  2IFU A;  5G05 J;  1IXV A;  4E6H A;  3CGH A;  3ZNG A;  2OEV A;  1TNB A;  4MBG A;  4FC8 A;  2VJ8 A;  5LCW J;  3UT4 A;  1L5J A;  4DI4 A;  4JA7 A;  4GPM A;  3CVL A;  2XS1 A;  4BWR A;  2XEN A;  1MZC A;  1SZ9 A;  5G04 J;  3DSS A;  2X3M A;  3EIJ A;  2XRZ A;  2YNQ A;  5AQ9 A;  2QZA A;  2R5S A;  1LD8 A;  4HXI A;  3E34 A;  1SZA A;  3PS6 A;  4HOR A;  3FUE A;  4ATG A;  1QNF A;  4OYS A;  4U8V D;  4AOF A;  4HOT A;  2B6C A;  4N3A A;  3HXF A;  4TXQ A;  4GA2 A;  4RSY A;  4K5C A;  5CEA A;  4WNF A;  4JC8 A;  2EIK E;  4URK A;  4BSZ B;  3CEQ A;  4LEU A;  5AN8 A;  2GRR B;  3QJZ A;  1NFI E;  3UTM A;  2WXK A;  5CRV A;  4KZC A;  3CKB A;  4J8E A;  1O1R A;  3HXD A;  3Q79 A;  5AEN A;  5AYW D;  3SQV A;  1Z6T A;  4DX1 A;  4CYM D;  4DLQ A;  4GZC A;  4GYW A;  2F8Y A;  2KC7 A;  3DPY A;  4ZFH A;  4LCT A;  2XZT G;  3FUN A;  3S2A A;  3EJN A;  3W9F A;  3PRE A;  3D9J A;  3ASH A;  1QYM A;  2LUH A;  1UW4 B;  3FTY A;  5D66 A;  1Z3Y A;  4CGV A;  4DX7 D;  5LX8 A;  4JHJ A;  5CBN A;  3J5Q B;  4TXR A;  5FQ8 A;  2ETB A;  5EIL A;  3Q73 A;  3ZYL A;  4UI9 J;  4B0Z A;  3V31 A;  5CCL A;  5H7P A;  4DX2 A;  5A23 A;  2F8X K;  5JJT A;  5BXU A;  4N3B A;  4N2Q A;  5FJY A;  3Q75 A;  1IYG A;  2F0Y A;  2NXP A;  2CG3 A;  3VTY A;  1HX8 A;  4RQI A;  3CK9 A;  3I5P A;  2YIN A;  4ABN A;  3SNX A;  3UXG A;  5JJ7 A;  2WB2 A;  3FTS A;  3KSL A;  4FA6 A;  2WXH A;  3V79 K;  2DWZ A;  1PY1 A;  1O5M A;  2KZT A;  4J0U A;  2LAI A;  2CHW A;  4O60 A;  2P9P G;  4Q94 A;  5LOZ A;  2IF4 A;  4FLB A;  4M7C A;  2IEJ A;  4Z68 A;  2NC9 A;  4L7T A;  4QQI A;  4OVU A;  4GTV A;  2XEH A;  4G2V A;  3FUM A;  3JXJ A;  4ZHB A;  2L0I A;  1YA0 A;  1OWL A;  2NSZ A;  3B7T A;  3IEG A;  4RLY A;  1FPP A;  1AP7 A;  2H6I A;  1D8E A;  4IUL A;  1BPO A;  4G26 A;  4GTP A;  2WQ7 A;  1ZB1 A;  4CT0 A;  3PE4 A;  4UQZ A;  4BER A;  2HYZ A;  2WVI A;  3U4T A;  5CEC B;  3D9I A;  3GZ2 A;  4XX5 A;  1W3B A;  1SW6 A;  3MJW A;  4E85 A;  4A3T A;  3CVQ A;  4MRU A;  4Q69 A;  1JCR A;  2YHE A;  4KZ0 A;  3MEK A;  1TNY A;  2XPI A;  3HIZ A;  3L9T A;  2R05 A;  4NUR A;  2RFA A;  3FTW A;  4AP2 A;  3ISM C;  4A1S A;  2XCC A;  3RO3 A;  2V5F A;  5KJN A;  4I2Z A;  4L23 A;  4IYP A;  4WWO A;  4BES A;  1IHB A;  2I1J A;  2BED A;  1BI7 B;  2VGE A;  1OCZ E;  2GRN B;  3W9G A;  3CHS A;  3MV3 B;  4HBD A;  2CHX A;  1DVP A;  3TJP A;  3U9W A;  4WWP A;  4LNB A;  4NIK A;  2WMN A;  1U2V G;  1KPS B;  3ZN3 A;  4I9E A;  3JXI A;  4PUC A;  1WY6 A;  1IQR A;  3Q78 A;  1P5Q A;  3FUI A;  4XIF A;  3Q49 B;  3ULE G;  3PRZ A;  4JHR A;  3SBT B;  4HB5 A;  2IQC A;  4YND A;  5LFA A;  1XNF A;  3ABK E;  2RD0 A;  3AAA C;  2J8S D;  4AIF A;  3CVV A;  3ONK A;  2WXR A;  1YYH A;  1NP7 A;  3ZFW A;  1Z3X A;  1Y8M A;  4DX5 D;  2CHZ A;  3IV0 A;  2WXJ A;  4FJY A;  1WDY A;  1WG0 A;  4N2S A;  4HI9 A;  4KVM A;  4Y6C A;  5G2N A;  3FU0 A;  1B89 A;  4JXT A;  1A5E A;  3TWS A;  4BT8 A;  2VSN A;  1NI1 A;  1YMP A;  5CER B;  3ZEF A;  3BEE A;  2IOS A;  3LEW A;  3G2T A;  3OTN A;  4C0E A;  5JMN D;  4KT6 B;  4ILI A;  1OWO A;  3SBS A;  3BG0 B;  3UM2 A;  4GTS A;  3U3W A;  2MOW A;  2QYU A;  4AVX A;  2UWJ G;  2IJG X;  1N4P A;  2DYS E;  4WND A;  3HG0 D;  5CED B;  3CHP A;  2A5E A;  3WXX A;  1TNU A;  2X6F A;  3RSE G;  3FDH A;  4BT9 A;  3ZW3 A;  5AAR A;  1LTX A;  3CHR A;  3HVE B;  2R59 A;  2OND A;  2J09 A;  3PDN A;  5ENP D;  1KZO A;  2PZI A;  3PEU B;  3AG4 E;  3AS8 A;  3N71 A;  5EYL A;  3BQO A;  5EX0 A;  4DI3 A;  3T8M A;  4HOU A;  2NYJ A;  1OT8 A;  4J8D A;  4U7E B;  3Q4A B;  3QOU A;  5ENO D;  1O1S A;  4UWK A;  1HXI A;  2GRL A;  2J49 A;  4YVQ C;  1OCO E;  3FUF A;  2QYJ A;  3HXE A;  2HR2 A;  3CQG B;  2XQ0 A;  3DXK G;  3ZU7 B;  4U0U A;  4GA1 A;  1IHG A;  3FUK A;  3ABL E;  4G1T A;  4F6R D;  3OAW A;  2BTD A;  5AQB A;  1OWM A;  4TXP A;  5KJK A;  3QWW A;  5FQ4 A;  2X6I A;  1E7V A;  5FIO A;  2DCP A;  4GU5 A;  1QZ2 A;  2XHE A;  3EIQ C;  1N4Q A;  3FTZ A;  3DST A;  1IKN D;  3URZ A;  3ASD A;  5DIZ A;  3D9L A;  3AU4 A;  4C9B B;  2WMO A;  3E33 A;  4G23 A;  4N5Q A;  4I2W A;  3IHV A;  4I1O B;  4U0S A;  3TWW A;  4CZ2 D;  1N9A A;  3E30 A;  3I4G A;  2I9C A;  4GMR A;  3ULQ A;  3Q47 B;  4ME2 A;  4KVO A;  4I6G A;  3UKR G;  4ACL A;  4JL0 A;  3QWP A;  2QC9 A;  5ENQ D;  3EU5 A;  3QAQ A;  2XGM A;  3ZHE A;  5JA4 D;  2WXF A;  3L6A A;  2UY1 A;  4B93 B;  3HXC A;  3TG5 A;  3NOG D;  1MQS A;  2X38 A;  3TXM A;  1PAQ A;  5KCM A;  3DEO A;  4UI9 C;  1OUV A;  4K03 A;  3D9H A;  1N54 A;  3RJV A;  4LUN U;  5EDS A;  3ZHE B;  1KT0 A;  4UQY A;  4N5C A;  3ZRH A;  4F1S A;  1E90 A;  4QFV A;  2UY1 B;  2WXN A;  3L13 A;  2P2C P;  5FQ7 A;  3V30 A;  2EIN E;  4NRH B;  5B1A E;  4M3O A;  4BSX A;  4TRQ A;  3HDX A;  5FT9 A;  5EYP F;  3CVP A;  3VLD A;  1X5B A;  2HM8 A;  2ZU6 B;  3CK8 A;  3I3N A;  3GW4 A;  1HG2 A;  4XZ4 A;  4DPR A;  4FU3 A;  3FHE A;  2AVP A;  5ITZ F;  2DVW A;  4GZ3 A;  5D2M C;  2Q7F A;  4N3C A;  3CR3 A;  1EDU A;  4GTM A;  2C0L A;  5HS0 A;  3X2Q E;  5EKQ D;  4EBA A;  1NA0 A;  3OXL A;  3T5V A;  4J8F A;  2VSY A;  2I1K A;  1V55 E; 
#chains in the Genus database with same CATH homology
 5T3R A;  2A4Z A;  3LXU X;  1H2U A;  3D9N A;  2YQ8 A;  4AY6 A;  4IUL A;  1OWN A;  1BPO A;  3D3M A;  4G26 A;  3UX4 A;  4DK5 A;  2WQ7 A;  3CVY A;  3CLJ A;  2LO6 A;  4CT0 A;  3SFZ A;  3PE4 A;  4UQZ A;  3LJ3 A;  2HYZ A;  2WVI A;  2BUG A;  1H19 A;  4JW1 A;  1HU3 A;  4FHK A;  3U4T A;  3D9K A;  3R7R A;  3CVU A;  3D9I A;  3JYS A;  3CIA A;  3GZ2 A;  4IRU A;  2X6K A;  1W3B A;  2WXP A;  4XX5 A;  1S0P A;  3O48 A;  3MJW A;  3PEV B;  5HI7 A;  2PQR A;  2E0I A;  1TEZ A;  3SHF A;  2IU1 A;  4A3T A;  2L0T B;  3FWV A;  4E85 A;  1E8X A;  3CVQ A;  3LYA A;  4GMJ A;  4MRU A;  3HVE A;  4U04 A;  4PS3 A;  5ANR A;  2RG8 A;  4A3V A;  4Q69 A;  2YHE A;  2WXI A;  2J9Q A;  3RO2 A;  2OVF A;  3D9P A;  3GZ1 A;  4L2L A;  3IKO B;  3ZPJ A;  4KZ0 A;  2OVB A;  3MEK A;  4O6F A;  2QFC A;  1OWP A;  3RKV A;  3RK6 A;  2XPI A;  3HIZ A;  3FY4 A;  2AW6 A;  4NUR A;  4HOQ A;  5FTP A;  4EEC A;  4ILH B;  5FQ6 A;  4F53 A;  4JVS A;  1JWG A;  3FTW A;  4AP2 A;  4GZ5 A;  3ML8 A;  3OXF A;  4A1S A;  2XCC A;  3RO3 A;  2V5F A;  4J6I A;  4NQ0 A;  2FEZ A;  3G2U A;  5KJN A;  1HG5 A;  4I2Z A;  3TG4 A;  4CEM A;  3LY9 A;  4G24 A;  4PH4 B;  1GW6 A;  4L23 A;  4W9R A;  4IYP A;  4WWO A;  3JCK C;  2I1J A;  5FZQ A;  3K9I A;  2FUL A;  3JUI A;  3R7Q A;  4UWH A;  3FEX A;  4PS8 A;  3KEZ A;  3RIB A;  3L17 A;  2EQX A;  3LCA A;  4EBA G;  3L08 A;  4GCN A;  5FWQ A;  3GZS A;  3MYV A;  3CHS A;  3MV3 B;  3KS2 A;  3ZYM A;  4UI9 K;  4YVO A;  3TGO A;  5AJL A;  2BF0 X;  3B7S A;  3FTX A;  4RVB A;  4KMO A;  2CHX A;  2WM9 A;  1DVP A;  1E8W A;  3TJP A;  3U9W A;  4WWP A;  2OV8 A;  3ENE A;  5G55 A;  2WMN A;  1JWF A;  3S7F A;  3QK0 A;  3ZN3 A;  2P58 C;  3QC1 A;  3QWV A;  4I9E A;  4PUC A;  4EPZ A;  1LF8 A;  4AJW A;  3I4R B;  2KCL A;  1WY6 A;  3NQP A;  1IQR A;  1P5Q A;  3FUI A;  4XIF A;  3PVL A;  1XGW A;  3Q49 B;  4Q96 A;  3VLE A;  2WXL A;  5ENN A;  4B89 A;  3PRZ A;  1H2T C;  4I1M A;  1E7U A;  4B94 A;  2JEK A;  4FLH A;  3G2V A;  4JHR A;  3SBT B;  5FZR A;  4ANV A;  3FH5 A;  4DJA A;  2PM7 A;  4IN3 B;  4BX8 A;  1JUQ A;  4F7A A;  2IQC A;  2YHC A;  3FUJ A;  4YND A;  5LFA A;  3FUH A;  1HE8 A;  1XNF A;  2WXQ A;  1E8Y A;  1HS6 A;  5AIJ A;  1H6K A;  3OXG A;  3JQ0 A;  2RD0 A;  3AU5 A;  3DBS A;  4H7Y A;  4WAF A;  3VTX A;  4L1B A;  4R7L A;  4AIF A;  5EX3 A;  3TL5 A;  3CVV A;  2CFZ A;  5D0O D;  5BV1 A;  3APC A;  3ONK A;  3GYZ A;  2WXR A;  2VGX A;  1NP7 A;  3ML9 A;  2KAT A;  2GGF A;  2KCK A;  3CHO A;  4ANX A;  5D0Q D;  1Z3X A;  3ZFW A;  1Y8M A;  4H7X A;  5M72 A;  2FBN A;  2J07 A;  3LDZ A;  3LY7 A;  3CV0 A;  3LVR E;  3QDN A;  4XI9 A;  2CHZ A;  3B7U X;  4CT4 A;  5CCM A;  3IV0 A;  2WXJ A;  3Q5M A;  3TXN A;  4EZJ A;  2VTB A;  3S7D A;  1EF1 C;  1E8Z A;  2E2E A;  4FJY A;  1WAO 1;  5CMY A;  3FFL A;  3MCX A;  2LNI A;  1NA3 A;  4NAC A;  2MRI A;  3CKC A;  4AV7 A;  5J08 A;  2PQN A;  4N2S A;  3PNT B;  5JJ6 A;  4KVM A;  4Y6C A;  2AXV A;  2KZT B;  2Y3A A;  3P1U A;  1MHQ A;  3FU6 A;  5G2N A;  5BPP A;  3FU0 A;  4GZD A;  4GZ6 A;  1B89 A;  4J8S A;  3QNK A;  4GAA A;  4I17 A;  4JXT A;  3SF4 A;  3CHQ A;  4B8A A;  2XGO A;  4LER A;  5E75 A;  4BT8 A;  4OVV A;  3MKQ B;  2DIW A;  3DPD A;  3UUX A;  4UQX A;  2VSN A;  1A17 A;  2I6H A;  4JZY A;  4EZL A;  1TJF A;  3G2W A;  4CRW A;  4CGW A;  3ZEF A;  2J08 A;  3SZ7 A;  3HHM A;  3BEE A;  1HO8 A;  3IHY A;  2IOS A;  3RRM B;  3LEW A;  3G2T A;  5JHA A;  1QQE A;  2VGX B;  3RU0 A;  3OTN A;  4C0E A;  3FEY A;  5FZS A;  3ESL A;  5A6C A;  3L54 A;  4KT6 B;  3APD A;  4ILI A;  1OWO A;  2WXG A;  3SBS A;  3L16 A;  3BG0 B;  2ILR A;  1IQU A;  3QKY A;  3ZYK A;  1VDY A;  2C2L A;  3T5X A;  3U3W A;  3NZU A;  1ELK A;  2MOW A;  3ESK A;  4GA0 A;  2XPZ A;  4KYO B;  5BUZ A;  2VTB B;  3FH7 A;  1INZ A;  3MZL B;  4AVX A;  2XCB A;  4FHJ A;  1HF8 A;  3G2S A;  4I6E A;  4WWN A;  1FVH A;  3RRN B;  2UWJ G;  2AXU A;  2XPY A;  2IJG X;  4APF A;  4WND A;  2PM6 A;  5T8I A;  4PDX A;  2R17 C;  3CHP A;  5CMW A;  3WXX A;  2V8S E;  2VGY A;  3RRU A;  2X6F A;  3CK7 A;  5DBK A;  1KLX A;  3UMV A;  4B8C B;  5A7D B;  1HH8 A;  1UN9 A;  3FU5 A;  3FDH A;  3LPZ A;  2IOL A;  4I43 A;  4BT9 A;  4WNG A;  4WUY A;  1U3C A;  3ZW3 A;  4MLP A;  4RG6 A;  3CHR A;  2JLB A;  3HVE B;  4U07 A;  4PS7 A;  2FI7 A;  3ASG A;  1ELR A;  3B7R L;  2R59 A;  4FP7 A;  3CHM A;  2PL2 A;  5ANL A;  2OND A;  2X6H A;  3AS5 A;  3R9A B;  3NF1 A;  2J09 A;  3PDN A;  4HS2 A;  4Y6W A;  4CCA A;  2PZI A;  3QAR A;  2XEV A;  3MKR A;  2X6J A;  3FUD A;  3PEU B;  2VSO E;  2J4B A;  2IFU A;  5HQ8 A;  3UPV A;  5ARF A;  3AS8 A;  5G05 J;  3U66 A;  3N71 A;  2AWI A;  4BTB A;  4EZK A;  4E6H A;  3CGH A;  3ZYQ A;  4APO A;  1H0A A;  4FJZ A;  5EX0 A;  4DI3 A;  2V0P A;  3FTV A;  3T8M A;  4G11 A;  4HOU A;  4FC8 A;  5J90 A;  3FTU A;  4XE0 A;  2VJ8 A;  4C0M A;  5LCW J;  3UT4 A;  4J8D A;  4XKC A;  1L5J A;  4DI4 A;  3ZGQ A;  4JA7 A;  4JPS A;  5C1D A;  3SGH A;  3B13 A;  3CVX A;  3QB2 A;  4BX9 A;  3CVL A;  4BWR A;  3Q4A B;  2J4D A;  3QOU A;  4JEH A;  2XGS A;  4V3I A;  3UT7 A;  3NZS A;  5BNW A;  2WQH A;  1SZ9 A;  4AM9 A;  3FUL A;  4UWK A;  4TUU A;  1ZBP A;  1HXI A;  4G25 A;  2GRL A;  5G04 J;  2J49 A;  3CST A;  4AEZ C;  4YVQ C;  2X3M A;  3D9O A;  4ILG A;  3EIJ A;  4JEU A;  2XRZ A;  2YNQ A;  4BFR A;  5KJM A;  1PC2 A;  2R5S A;  3FUF A;  3IBE A;  4MKT A;  5C2Y A;  4HXI A;  1EYH A;  2HR2 A;  3CQG B;  2XQ0 A;  1SZA A;  3PS6 A;  3S7B A;  4HOR A;  3FUE A;  4ATG A;  4U0U A;  4GA1 A;  3UQ3 A;  1QNF A;  3JQ1 A;  4OYS A;  4XI0 A;  3KAE A;  2OOE A;  4AOF A;  4HOT A;  2MHK A;  1IHG A;  3FUK A;  3BG1 B;  2GW1 A;  1DNP A;  4G1T A;  4N3A A;  4FAD A;  3OAW A;  2HO1 A;  2BTD A;  1UG3 A;  4GML A;  4HFG A;  2WQ6 A;  1OWM A;  2CG2 A;  4GA2 A;  3FU3 A;  4RSY A;  5KJK A;  2Y4U A;  1N52 A;  4WNF A;  3QWW A;  4JC8 A;  2X6I A;  5FQ4 A;  1E7V A;  3EHM A;  3KD7 A;  3PUJ A;  3CEQ A;  4FUL A;  3UT8 A;  4URK A;  4UWL A;  4LEU A;  3MA5 A;  2DCP A;  4GU5 A;  4A55 A;  3QJZ A;  1QZ2 A;  2XHE A;  3PNL B;  3EIQ C;  3MX3 A;  3AS4 A;  4GB9 A;  4K0R A;  1Y6I A;  1ZU2 A;  4HLE A;  2WXK A;  1E96 B;  3CQC B;  1JPL A;  3L22 A;  4AY5 A;  4KZC A;  3FTZ A;  3CKB A;  2LSU A;  4J8E A;  3URZ A;  3ASD A;  5AEN A;  4WNE A;  4F3V A;  3MV2 B;  3PH0 C;  5DIZ A;  5AYW D;  1Z6T A;  3D9L A;  3SI5 A;  2M63 A;  3AU4 A;  4C9B B;  2WMO A;  2VQ2 A;  1UJJ A;  1SQM A;  1FCH A;  4DLQ A;  2LAH A;  3TAX A;  4GZC A;  4GYW A;  4G23 A;  3O4Z A;  2I2O A;  4I2W A;  2KC7 A;  3IHV A;  4LCT A;  4I1O B;  4U0S A;  3FUN A;  3S2A A;  4BTA A;  4CDR A;  3U64 A;  3I4G A;  4HVB A;  2FO7 A;  2I9C A;  3EJN A;  3PRE A;  2GRM A;  3ULQ A;  2VYI A;  3Q47 B;  4ME2 A;  3D9J A;  4KVO A;  4I6G A;  3APF A;  4ACL A;  1UJK A;  3ASH A;  4GYO A;  4JL0 A;  4U8H A;  3S7J A;  3MGB A;  3QWP A;  4LRZ A;  4DLO A;  3LS8 A;  3E4B A;  5AJD A;  5JHB A;  3QAQ A;  2XGM A;  3ZHE A;  1FVF A;  2A5U A;  1HZ4 A;  1UW4 B;  2KCV A;  3FTY A;  2AXZ A;  1Z3Y A;  4UWG A;  4D10 C;  2FF4 A;  3P2B A;  4ANW A;  4CGV A;  2WXF A;  4AXH A;  3L6A A;  4CDM A;  3LKU A;  5LX8 A;  4JHJ A;  2WXM A;  2L9B A;  2UY1 A;  5FQ8 A;  1U3D A;  3TG5 A;  3ZYL A;  4UI9 J;  4A1G A;  4B0Z A;  2KM4 A;  5CCL A;  1KT1 A;  2WXO A;  4I9C A;  5A23 A;  1MQS A;  3CSF A;  5JJT A;  2X38 A;  3TXM A;  2L6J A;  1PAQ A;  4ACK A;  4BY6 A;  5BT1 A;  5BV0 A;  4GYY A;  4N3B A;  3ONL A;  5FJY A;  5KCM A;  4N2Q A;  4UI9 C;  3PE3 A;  3FP3 A;  1NZN A;  1IYG A;  1OUV A;  4K03 A;  1N54 A;  3RJV A;  3C98 A;  4TV3 A;  3VLF A;  4LUN U;  4U63 A;  2NXP A;  5EDS A;  2CG3 A;  3VTY A;  1EPU A;  1HX8 A;  5G05 C;  3CK9 A;  3EHN A;  3I5P A;  2YIN A;  3ZHE B;  1KT0 A;  4ABN A;  2QY7 A;  4UQY A;  4N5C A;  3EDT B;  3LVQ E;  2LSV A;  3ZRH A;  3SNX A;  1TJC A;  4UWF A;  5JJ7 A;  4F1S A;  4N39 A;  1E90 A;  4GPK A;  2WB2 A;  3ZVV A;  5LCW C;  4QFV A;  3FTS A;  4U0Z A;  5ARG A;  2UY1 B;  4FA6 A;  3LY8 A;  2WXN A;  3L13 A;  2WXH A;  5FQ7 A;  3ZXS A;  2ION A;  4L2Y A;  4NRH B;  1PY1 A;  2KZT A;  4M3O A;  4BSX A;  4TRQ A;  4EQF A;  2WPV A;  4J0U A;  3HDX A;  5E76 A;  2LAI A;  4P29 A;  5FT9 A;  2CHW A;  5T4Y A;  4Q94 A;  3SD5 A;  4JA9 A;  3D9M A;  2CFU A;  4I1A A;  4GCO A;  1WM5 A;  4XKB A;  5LOZ A;  1ELW A;  3CVP A;  4HOS A;  2IF4 A;  3MKQ A;  1X5B A;  2HM8 A;  4FLB A;  4KBQ A;  5G04 C;  3VLD A;  2ZU6 B;  3CK8 A;  3I3N A;  3GW4 A;  1HG2 A;  4XZ4 A;  3CVW A;  4DPR A;  4FU3 A;  3FHE A;  2AVP A;  3PZD A;  2V4L A;  5CHE E;  4GZ3 A;  3Q15 A;  3FH8 A;  2NC9 A;  2Q7F A;  2Y4T A;  2DBA A;  4RG9 A;  2XRY A;  4L7T A;  4N3C A;  2C0M A;  2VSX E;  3CR3 A;  1UN8 A;  4I6J A;  1EDU A;  4OVU A;  1HFA A;  2C0L A;  3HYM B;  4CDN A;  4G2V A;  4ANU A;  3FUM A;  5EKQ D;  5BW8 C;  4EBA A;  1NA0 A;  3OXL A;  2L0I A;  3T5V A;  1YA0 A;  1OWL A;  3PUK A;  4J8F A;  1H2V C;  4JHK A;  4KXK B;  2NSZ A;  2VSY A;  4MS6 A;  3ZIM A;  3B7T A;  3CVN A;  2I1K A;  3IEG A;  5LP0 A;  3ASF A;  5KJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...