3RJVA

Crystal structure of a putative sel1 repeat protein (kpn_04481) from klebsiella pneumoniae subsp. pneumoniae at 1.65 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
EPGSQYQQQAEAGDRRAQYYLADTWVSSGDYQKAEYWAQKAAAQGDGDALALLAQLKIRNPQQADYPQARQLAEKAVEAGSKSGEIVLARVLVNRQAGATDVAHAITLLQDAARDSESDAAVDAQMLLGLIYASGVHGPEDDVKASEYFKGSSSLSRTGYAEYWAGMMFQQGEKGFIEPNKQKALHWLNVSCLEGFDTGCEEFDRISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative Sel1 repeat protein (KPN_04481) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution
rcsb
molecule keywords Putative Sel1 repeat protein
molecule tags Protein binding
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 81
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08238 Sel1 Sel1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rjvA01
1.25.40.740 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rjvA02
1HH8A 5FTPA 4APOA 3CV0A 4N39A 4UI9K 4O6FA 4N3CA 4WUYA 2C0MA 2WQHA 4G2VA 2FEZA 3CVQA 3JYSA 3K9IA 4F3VA 4KYOB 4H7XA 2VGYA 4UI9J 2VSYA 4N5CA 5AYWD 3TAXA 5BT1A 4RG9A 3WXXA 1KT1A 2KATA 3ULQA 2HYZA 2ONDA 4G1TA 4XIFA 3ZPJA 3Q47B 4ME2A 4AM9A 2IFUA 5A7DB 4I1AA 4H7YA 3UQ3A 3FP3A 3VTXA 2I6HA 5CCMA 3ZHEA 2PQNA 5KJLA 2VQ2A 3GYZA 5FZSA 3CVNA 5D0OD 2KCLA 5JJ7A 3ZFWA 3LPZA 3QDNA 3OXLA 4NQ0A 2FI7A 3PDNA 4NRHB 1PC2A 4BWRA 2L6JA 5EX3A 4UI9C 4G23A 1KT0A 5DIZA 3Q4AB 4N2QA 4GPKA 1XNFA 4GZ5A 3ASHA 3MA5A 4HOTA 4UQXA 3OXGA 4GYOA 4KBQA 3QWVA 3LKUA 2E2EA 5FZRA 3KAEA 2NC9A 3IEGA 2PQRA 3MKRA 4W9RA 1QQEA 4B94A 3ZGQA 4BT9A 5JJ6A 2XGMA 5ARGA 4G25A 4I17A 4BTBA 2XCCA 1B89A 4KXKB 4CGWA 4CDRA 4WNFA 5EX0A 3QWWA 2UY1B 4G26A 3CK9A 4GZ6A 3OXFA 3TG4A 3CEQA 1IYGA 5JJTA 3PE3A 3UUXA 5KJMA 5A6CA 1A17A 3MV3B 3RKVA 3LY8A 2FO7A 5G04J 1OUVA 5ARFA 2VYIA 5BW8C 4BT8A 2AVPA 2JLBA 2C0LA 2V5FA 2Q7FA 2KCKA 3BEEA 2LSUA 2GW1A 2BUGA 3U3WA 1P5QA 5M72A 4GZ3A 3U4TA 4HOSA 4GCOA 3ZN3A 1W3BA 3GW4A 3AS5A 4G24A 4UQYA 3AS8A 4XI0A 3QWPA 3RO3A 2FBNA 3Q5MA 3E4BA 4U04A 3HYMB 3GZ1A 3ESKA 4YVQC 3FFLA 1ZU2A 1NZNA 4J8FA 1HZ4A 2C2LA 2P58C 5KJKA 2VGXA 3RIBA 3S7JA 3NF1A 5EKQD 5G04C 3S7BA 4AIFA 3CVLA 3N71A 5HI7A 5BNWA 4I9CA 4WNEA 1NA0A 2DBAA 4U0SA 5CHEE 5C1DA 3URZA 5HQ8A 2XGOA 4LEUA 4ABNA 2WPVA 2R5SA 2YQ8A 2LNIA 4EQFA 1HXIA 4YNDA 3QOUA 3CK8A 3UPVA 1FCHA 3ZHEB 2PZIA 3PE4A 2KC7A 2J9QA 2XEVA 2YHCA 4A1SA 4UQZA 3LYAA 4WNDA 3RJVA 3Q15A 1YA0A 2XGSA 4HORA 4AY6A 3FWVA 4U0UA 1ELWA 4Y6WA 4J8DA 5CCLA 3O48A 1Y8MA 2PL2A 4GYYA 3SZ7A 2VGXB 4GA0A 3LY9A 4RG6A 5FZQA 4N3AA 4GYWA 3Q49B 3VTYA 3QKYA 3AS4A 5LCWC 2FF4A 2MHKA 3CKCA 4N2SA 4XI9A 5G05J 3ASDA 4J0UA 2UY1A 3RU0A 1QZ2A 5DBKA 1KLXA 5KJNA 4BTAA 1ZBPA 1IHGA 2QFCA 3MEKA 4JA9A 1NA3A 4I2ZA 5FT9A 1WAO1 2IF4A 4WNGA 3SF4A 3KS2A 2UWJG 3R9AB 4AY5A 4Y6CA 4JA7A 3S7DA 3ASGA 4I9EA 4IN3B 4I2WA 4J8EA 4HOQA 2KCVA 3S7FA 3RO2A 4CGVA 4JHRA 1E96B 2HO1A 3CK7A 2LSVA 4U07A 2HR2A 3TGOA 4GA1A 3EDTB 2XPIA 3TG5A 2OOEA 4YVOA 1ELRA 3MV2B 5LCWJ 5D0QD 2XCBA 3ASFA 3LCAA 4HOUA 4GCNA 3LY7A 4JL0A 5G05C 2VSNA 3KD7A 3CKBA 2Y4UA 3CVPA 4U0ZA 4N3BA 2Y4TA 1WM5A 4GA2A 1TJCA 3GZ2A 5FJYA
chains in the Genus database with same CATH superfamily
5FTPA 4DK5A 4MBGA 3CVWA 4UI9K 1PAQA 4KVMA 3FTUA 4G2VA 5AQBA 3CVQA 1HF8A 3LJNA 4U8VD 4F3VA 2WXGA 3SBSA 3HVEB 5BPPA 4HVBA 4EBAG 4UI9J 3SFXA 3NOCD 4I43A 1KT1A 3KSLA 2KATA 1IKND 3ULQA 1HO8A 4EHMA 4G1TA 3LDZA 4XIFA 2DCPA 3ZPJA 3FUEA 2DYRE 3Q47B 4ME2A 4AM9A 2HM8A 4CDMA 3G2WA 3R9MA 4ILHB 4F6RD 4H7YA 2J4BA 4OYSA 3FP3A 3PRZA 4UWGA 2DYSE 2B6CA 3NBNB 4O60A 5KJLA 4IYPA 1SA4A 2XEHA 2VQ2A 3FHEA 1BLXB 4A1GA 3PZ1A 3CVXA 3RAUA 5JJ7A 3SD5A 5JHBA 2QYJA 3QDNA 2MOWA 1YMPA 3OXLA 4APFA 4BWRA 5AQ7A 2AW6A 2L6JA 4UI9C 1PY1A 3DSWA 1TYQG 2NXPA 4GPKA 4K03A 1JCRA 3UKUG 2ETAA 3CVYA 3RK6A 2XPZA 2E2EA 1HG2A 3TL5A 4LNGA 4GB9A 2YNQA 3BQOA 1INZA 1TN8A 3Q78A 1U3CA 3C5RA 3ZGQA 3VLFA 5JJ6A 2XGMA 2WQ7A 1U3DA 4FJZA 4PS7A 4I17A 1MX2A 3MKQB 4QFVA 4BTBA 2LXMA 1B89A 5AIJA 3QWWA 3Q9UC 4K5AB 4V3IA 4GMLA 4C0MA 2X6HA 4G11A 2CFZA 1HS6A 2H6GA 1IYGA 4L1BA 4XX5A 1Q2ZA 4JXTA 1NFIE 1A17A 3Q73A 4HBDA 3RKVA 1UW4B 3T8KA 1IQUA 3U66A 1OUVA 4JVSA 3FULA 3DSXA 3QK0A 1HX8A 3P2BA 4J7WA 2AVPA 3S2AA 1N4QA 2LSUA 2WVIA 5M72A 3SGHA 3L08A 4JD2G 3RSEG 3C98A 2H6FA 3ONKA 3Q5MA 3FTSA 3E4BA 3HYMB 3L54A 4DX2A 3GZSA 2V5QC 4YVQC 2P9UG 3BG1B 3EIQC 2IO3C 4JPSA 3ZRHA 4HQDA 1N4RA 3RIBA 3S7JA 3NF1A 3J5QB 4LUNU 1E8ZA 5EIBE 4O1PA 4G8LA 3S7BA 3DXMG 3RRNB 4CZ2D 3NZUA 1LTXA 1N0RA 1A5EA 3AG3E 5BNWA 4PUCA 2DBAA 3NQPA 3IBEA 3AU5A 4OAVB 5FQ7A 3PUJA 3UINC 1EPUA 5HQ8A 3VLEA 2R5SA 1SZAA 3G2VA 3HHMA 2XS1A 1H6PA 4XZ4A 3D3MA 1HXIA 4YNDA 3CK8A 4GMRA 3ZHEB 3B95A 1U2VG 2A5UA 1K8KG 2OVBA 3QC1A 1MHQA 4MRUA 1WY6A 2KBXA 2ZGGA 4A1SA 2IJGX 3C72A 3OTNA 1HG5A 1YA0A 3WG7E 3ULEG 4U0UA 5KBAA 3AAAC 5IY5E 4HXIA 3PS6A 5CCLA 4FHJA 1Y8MA 4TXQA 3DSUA 4MS6A 1V55E 3SZ7A 2L0TB 2VGXB 4GA0A 2P9LG 3Q49B 3VTYA 2AJAA 2ETCA 4BX8A 5LCWC 4I6GA 3CKCA 5BV0A 2ZGDA 1JUQA 2I1KA 3CHSA 2UY1A 4RVBA 5CEDB 4A3VA 5DBKA 3CHOA 4LRZA 4ANWA 3TWUA 4FU3A 3ZNGA 4LNBA 1IHGA 2WB2A 5FT9A 1WAO1 2WXMA 5AAOA 5AENA 1MX4A 3W9GA 3FTVA 4Y6CA 2I1JA 3B7TA 3AG1E 4HOQA 3RO2A 4CGVA 4JHRA 2IU1A 2LSVA 1OWLA 3Q9NC 4XE0A 3C3OA 4CEMA 3EDTB 5FQ4A 2AXUA 4UWKA 2WXJA 1S64A 2ZU6B 3MV2B 3ENEA 2XCBA 4HB5A 3LCAA 1OCOE 2CHZA 2ZXWE 2Y4UA 3CVPA 4U0ZA 4JEUA 4LNUD 4APOA 3UT7A 1DCQA 5AJLA 3Q75A 2WQHA 1AWCB 1JCSA 3FEYA 3JYSA 2PM6A 2WXHA 4CRWA 1H2VC 1KZOA 3AJIA 2VGYA 3CLJA 5ANRA 4HNAD 3CVUA 2WXNA 5AYWD 3TAXA 4RG9A 1IQRA 3ZEFA 4WWOA 1MJ0A 4M3OA 3UT4A 4DI3A 3SFYA 5FINA 2WXOA 1OWOA 4ACLA 3E34A 2IFUA 4UWHA 5B1BE 3L16A 2JABA 4IRUA 3UQ3A 3IXEA 2CG2A 5BUZA 2QY7A 2I6HA 3ZUVB 1TNBA 3UX4A 5CERB 4FADA 4ANVA 4F1SA 4TXRA 2OV8A 4QQIA 3GYZA 5FZSA 5AQAA 4ILGA 1QNFA 1MYOA 5D0OD 4JEHA 4JZYA 3G2UA 3TXNA 1Z3YA 4NQ0A 3U9WA 3DSTA 2CFUA 2FI7A 3PDNA 4AOFA 3V79K 2XZTG 4LCTA 4MLPA 3SY2A 3TWQA 3FU6A 3EUVA 4N2QA 2F0YA 3CHPA 3DRAA 4GYOA 4Q69A 3IKOB 2XENA 4KBQA 3JQ0A 3LKUA 4HRLA 4BEPA 2NYJA 3L9TA 3EHQA 4GTQA 4U95D 4BSXA 3MZLB 3LJ3A 3IEGA 2PQRA 1H2TC 4L2LA 4CCAA 4HI9A 4UWLA 4OVUA 3TWTA 2YHEA 4BT9A 2A5EA 1ELKA 4B89A 3FY4A 5ARGA 4AV7A 4G25A 4RQIA 2XCCA 2XRZA 4KXKB 4CDRA 5EX0A 4FP7A 5J90A 1G3NB 1LF8A 1TNOA 4BY6A 3TG4A 4L9PA 3CEQA 5JJTA 4LSZE 3DWLG 4F7AA 2EIKE 2BKGA 2LAHA 1DC2A 3TWWA 1V54E 3LY8A 3I3NA 3CQGB 5G04J 1GW6A 4K5BA 3LVQE 3V2XA 2P2CP 1WG0A 3B7BA 3JXJA 4LERA 3SI5A 1L5JA 2QYUA 1YYHA 2H6IA 2Q7FA 2KCKA 3AU4A 2GW1A 2BUGA 2XS8A 3U4TA 1DCEA 2IOSA 4EBAA 2PM7A 4GCOA 1W3BA 3D9MA 3FUDA 4AXHA 3AS8A 4XI0A 5G2NA 2ETBA 3SHFA 3ZW3A 3LVRE 3APFA 3MYVA 3GZ1A 3PZ3A 3L22A 4FLBA 4TUUA 4TUMA 2EQXA 1E8YA 4J8FA 2C2LA 3CSFA 4CT0A 3FH5A 2WXLA 3FEXA 2IOLA 5AARA 3B7RL 5G04C 5CRVA 3CVLA 3N71A 5T3RA 4I9CA 4WNEA 4U0SA 5CHEE 2GGFA 3MCXA 1OCZE 4LEUA 4ABNA 4I1MA 4DJAA 3FU3A 4J8YA 3EJNA 5LOZA 4NURA 3EHNA 1H2UA 2IONA 1VDYA 2I9CA 1IHBA 5EYLA 3FUHA 3UIOC 3E30A 3R7QA 2J9QA 3SNXA 4J6IA 2IY0C 4J8SA 4UQZA 1SQMA 5CEAA 4JC8A 4GTSA 2XGSA 1N11A 4AY6A 3ONLA 4Y6WA 3UKRG 1N4SA 3P1UA 4J8DA 3HG0D 2PL2A 5ENRD 4GYYA 3V2OA 2BKKB 4RG6A 3UI2A 4GYWA 4FULA 4CYMD 5HRYA 4K5CA 2V0PA 4JW1A 3UIPC 2HE0A 1O1TA 4JHKA 3ML9A 1KZPA 5KJNA 3C3QA 5AJDA 1ZBPA 1HE8A 4KVOA 3UM0A 1EF1C 4L7TA 2KZTA 5LFAA 3DPDA 3R9AB 3PREA 2X38A 3S7DA 4EZKA 4IN3B 4GTMA 4J8EA 2WMOA 4C0EA 3DEPA 2F37A 4U07A 2VJ8A 5EN5D 2HR2A 3QARA 3APDA 4GTRA 2E0IA 3FU0A 3RRUA 4YVOA 5E75A 4B93B 4U8HA 1O1SA 5LCWJ 5D0QD 3FU5A 4HOUA 5ANLA 4GCNA 3LY7A 1HFAA 3UM2A 3CKBA 2FULA 3FUJA 4A63B 1K1AA 1E7UA 2XHEA 3ZKJA 1WM5A 2QZAA 5FJYA 1HH8A 2RFMA 3CV0A 5D2MC 3OAWA 4WUYA 2C0MA 3QB2A 1UN8A 2RD0A 3T8MA 1TN6A 1H0AA 4HRNA 1JWGA 1BU9A 4BERA 1QBQA 3FUNA 2GRNB 4IULA 4FC8A 4U96D 3WXXA 4WWNA 4MKTA 2XQ0A 2ONDA 4U7EB 1TNYA 2WMNA 2J49A 5A7DB 4BX9A 1BD8A 1NP7A 3AG2E 4I1AA 3EU9A 2AWIA 5ENSD 3SO8A 3HRAA 1S70B 3FDHA 3ZHEA 2PQNA 3SBTB 4EZJA 2VTBA 4Q94A 1RW2A 2I2OA 2X3MA 3CVNA 2BTDA 1BI8B 2KCLA 2IQCA 3PEUB 2ZIRA 1DNPA 3LPZA 3FUKA 2OEVA 1FVFA 3KSQA 4NRHB 3CSTA 1SA5A 1LD8A 3J5PA 5EX3A 2XEEA 4G23A 5DIZA 1XNFA 4GZ5A 3UM1A 3ASHA 3MA5A 3TWXA 4UQXA 3ZVVA 3E32A 3ULYA 2GRPB 1UOHA 1NI1A 3HXEA 4EZLA 2WXPA 2ZISA 4ANXA 4RLYA 1QYMA 5FZRA 3HXDA 2NC9A 3V31A 1E8XA 2DIWA 3MKRA 5BXOA 5KNGA 5J08A 4W9RA 5T4YA 2WXRA 1QQEA 4KZ0A 3HXFA 4B8CB 2P9NG 4U8YD 2MRIA 4OVVA 4DX6D 4CGWA 4ZFHA 3PZ2A 1OY3D 1N94A 3EHMA 4K0RA 3CK9A 3I5PA 2F8YA 2J07A 2DWZA 3ML8A 3CR3A 3OXFA 4G8KA 3PE3A 5KJMA 3MGBA 2XRYA 3SFZA 2RFAA 1Z3XA 3D9KA 1D8DA 4AVXA 5A23A 4BT8A 1FT1A 4HI8A 3HDXA 5BV1A 2V5FA 2L6BA 5EYPF 3U3WA 3ISMC 1P5QA 4GZ3A 4DLQA 4DX5D 4HOSA 3DBSA 1FVHA 3ZN3A 4PS8A 5KCMA 3D9IA 3GW4A 3AS5A 4G24A 4UQYA 1LD7A 3TXMA 3CIAA 3QWPA 2XZDG 4XEIG 1D9SA 4EECA 1OWPA 3F6QA 2FBNA 1H6OA 3BUAA 1E7VA 2EILE 2DZNA 2NSZA 2YINA 3ESKA 2H6HA 1SVXA 3B7UX 3FFLA 5T8IA 2EIJE 1NZNA 1O1RA 3FTYA 3E37A 2ILRA 4GAAA 5EKQD 4AIFA 3FH8A 4M7CA 3IHVA 2LAIA 3D9PA 5ENTD 2VSXE 3D9LA 2X6KA 1MZCA 3D9JA 2P9KG 5C1DA 2XGOA 4ILIA 4L23A 3G2TA 2X6IA 3CHRA 3PEVB 4EQFA 4NIKA 3QOUA 3UPVA 1FCHA 2R2LA 5H7PA 4BETA 2PZIA 3PE4A 3ABKE 3Q7AA 1N9AA 3JQ1A 5E76A 3ABME 4XKCA 2XEVA 1S0PA 2YHCA 3RRMB 3HXBA 4O1OA 3DPYA 4WNDA 4FA6A 4PS3A 1N4PA 4HORA 3R7RA 3FWVA 1ELWA 1TN7A 2CHXA 3VLDA 3X2QE 3O48A 5B3SE 3AG4E 5ENNA 4HLEA 4U63A 2KM4A 3LY9A 1Y6IA 5FIOA 4N3AA 3FUIA 3AS4A 2FF4A 2OEWA 5HKPA 3ASDA 3DSSA 4J0UA 4N5QA 3HVEA 5CMYA 1QZ2A 3RU0A 1KLXA 2A4ZA 4BFRA 4DX7D 4BTAA 2EIME 2QFCA 3MEKA 3W9FA 1MX6A 2XPYA 1NA3A 4I2ZA 2WXIA 4GZCA 3IHYA 2IF4A 4WNGA 2F8XK 2WXKA 4Z68A 3KS2A 3E33A 5CMWA 5AQ9A 2JEKA 4FLHA 4GZDA 1OCRE 3UTMA 3D9NA 4JA7A 2B0OE 4I9EA 2GRQB 2R02A 4I2WA 5BXUA 2AXVA 3PUKA 2RKKA 1Z5SC 3T5VA 3CQCB 4KT6B 5EIDA 1N54A 1E96B 1N52A 2HO1A 5CECB 1MQSA 3CGHA 3TGOA 3ASNE 4GA1A 4GMJA 2XPIA 1SZ9A 3TG5A 3T9KA 3DSVA 2DVWA 4E85A 2X6FA 1ELRA 3FTXA 3CHQA 1KPSB 3APCA 4X8QA 4BESA 5ENOD 4AP2A 1Z6TA 4C48B 1K1BA 4N3BA 3FH7A 2R05A 4GA2A 2R59A 1TJCA 2BEDA 4DI4A 4N39A 4HFGA 3ASOE 5EILA 4HLLA 2P9IG 1XGWA 4N3CA 4O6FA 2FEZA 2FO1E 3UXGA 4FJYA 3K9IA 4KYOB 4H7XA 4FHKA 3PH0C 5B1AE 3I4GA 2VSYA 3BG0B 4N5CA 4RSYA 1TR4A 5BT1A 1OT8A 2L0IA 4B8AA 3QAQA 1JCQA 5JHAA 5HS0A 2HYZA 3QNKA 2AXZA 2KZTB 3MKQA 4F53A 4YDOA 1X5BA 3KEAA 2P9PG 4TXPA 1ZB1A 5G55A 4R7LA 3VTXA 5CCMA 4DUIA 2J8SD 3JXIA 3LS8A 3UT8A 2RG8A 2CG3A 3JCKC 3LEWA 2R03A 3CVVA 4TRQA 3V30A 2EINE 4YDEA 2GRRB 3ZFWA 4DLOA 3L13A 3I4RB 4UUCA 1PC2A 3EHRA 1KT0A 2R17C 3NB2A 3Q4AB 4HOTA 3OXGA 3QWVA 1K3ZD 3Q7FA 2QC9A 1H19A 3ZXPA 5FQ6A 3HIZA 4ACKA 4C9BB 2BF0X 2IEJA 2P9SG 1BPOA 3KAEA 2Y1LE 2MYOA 5FWQA 3U64A 4AJWA 1BI7B 4B94A 5EDSA 4ANUA 3D9OA 3KEZA 3ZIMA 1OXJA 4GU5A 1AP7A 5KNHD 4D10C 1TJFA 1IXVA 3FUMA 3LXUX 4WNFA 3PVLA 2UY1B 3TJPA 4G26A 4GZ6A 2V4LA 5ENPD 4LG6A 1TNUA 4I6EA 3UUXA 3C3RA 2VTBB 2WQ6A 5A6CA 2Y3AA 1O5MA 2VGEA 4GTOA 1X81A 3MV3B 3MX3A 2FO7A 1TEZA 3B7SA 1OWMA 4GTPA 5ARFA 2VYIA 4PH4B 5BW8C 2KXPC 2X6JA 1FPPA 3ZXSA 2JLBA 2C0LA 1UJKA 1UN9A 3BEEA 5LP0A 1JWFA 5FQ8A 2V8SE 1D8EA 1NL4A 4B0ZA 4HRMB 2DZOA 3DEOA 4PDXA 1YCSB 5LX8A 1RZ4A 3NOGD 1JPLA 3RO3A 4EPZA 3FUFA 4U04A 3JUIA 1UJJA 3IV0A 3ZU7B 3B13A 5KWDA 1ZU2A 5ITZF 1HZ4A 2WXQA 2P58C 3ESLA 5KJKA 2VGXA 1HU3A 4Q96A 1OCCE 4UWFA 3UMVA 2PNNA 5HI7A 3CHMA 2M63A 2OVFA 4ZHBA 4NACA 3PZDA 5CBOA 4CT4A 1NA0A 1OWNA 4OAUC 3PNLB 1WDYA 3URZA 2J4DA 3BU8A 2WPVA 2Y0BG 4A3TA 4YDYA 1UG3A 2YQ8A 2LNIA 4WAFA 4CDNA 3NZSA 3QJZA 1TNZA 3NAWA 5JA4D 5CRUA 5JMND 2GRMA 3EU5A 3ZYMA 2CHWA 2Y69E 4JHJA 4WWPA 3FTZA 4HS2A 3ZYQA 2KC7A 2L9BA 2V4HC 1S63A 2OCCE 5AN8A 5D66A 4URKA 3L6AA 3LYAA 2GROB 3O4ZA 3RJVA 3Q15A 4TV3A 4JB8P 2LO6A 4YDWA 3TWSA 1FT2A 2LXLA 1E8WA 3JUEA 3FTWA 4GPMA 1DVPA 3D9HA 1N0QA 4L2YA 2LUHA 5FZQA 3QKYA 4XKBA 4F1PA 3TWVA 2MHKA 4N2SA 4XI9A 2VSOE 5G05J 4DRXE 5CBNA 3L17A 4I6JA 4KMOA 1SW6A 4JA9A 4A55A 2J09A 4E6HA 2WM9A 4ATZD 2GRLA 3SF4A 4I1OB 3DXKG 5ENQD 3ZYLA 2UWJG 3L82A 3HXCA 4AY5A 4DPRA 3PZ4A 3ASGA 4GTVA 2J08A 2IO2C 2KCVA 3S7FA 3EIJA 1N95A 3MJWA 3TWRA 3CK7A 4BSZB 4KZCA 1EDUA 2OOEA 3UM3A 4DX1A 3ZYKA 1E90A 3Q79A 2WXFA 3ABLE 4AEZC 3ASFA 4GTTA 3SQVA 3T5XA 5C2YA 4JL0A 5G05C 3PNTB 2VSNA 3KD7A 4P29A 1EYHA 2Y4TA 4ATGA 1H6KA 3GZ2A 3G2SA
chains in the Genus database with same CATH topology
1HH8A 4DI4A 5FTPA 4APOA 4DK5A 3UT7A 3CV0A 5AJLA 3CVWA 4N39A 4UI9K 4HFGA 3OAWA 1PAQA 1XGWA 4N3CA 4KVMA 2C0MA 3QB2A 4O6FA 4WUYA 3FTUA 1UN8A 2WQHA 4G2VA 2FEZA 3CVQA 1HF8A 2RD0A 4FJYA 3FEYA 3JYSA 3K9IA 3T8MA 4F3VA 2PM6A 2WXHA 2WXGA 4KYOB 4H7XA 4CRWA 1H2VC 4FHKA 1H0AA 3PH0C 1JWGA 3SBSA 3HVEB 2VGYA 3CLJA 5BPPA 5ANRA 4HVBA 4EBAG 3I4GA 4UI9J 3CVUA 3FUNA 2VSYA 3BG0B 2WXNA 4N5CA 5AYWD 4RSYA 3TAXA 5BT1A 4RG9A 2L0IA 4IULA 4FC8A 1IQRA 4B8AA 3QAQA 4I43A 1KT1A 3WXXA 3ZEFA 5JHAA 4WWOA 4WWNA 2KATA 4MKTA 3ULQA 2HYZA 1HO8A 2ONDA 2XQ0A 3QNKA 4G1TA 4M3OA 3UT4A 3LDZA 4XIFA 4DI3A 2DCPA 3ZPJA 2AXZA 3FUEA 2KZTB 3MKQA 2WMNA 3Q47B 2WXOA 4ME2A 1OWOA 2HM8A 4ACLA 4AM9A 4CDMA 4F53A 2J49A 2IFUA 3G2WA 1X5BA 5A7DB 4UWHA 4BX9A 1NP7A 4I1AA 3L16A 4ILHB 4H7YA 4IRUA 3UQ3A 2AWIA 2J4BA 4OYSA 3FP3A 3PRZA 5G55A 2CG2A 4R7LA 3VTXA 4UWGA 5BUZA 2QY7A 2I6HA 5CCMA 3FDHA 3ZHEA 3LS8A 3UT8A 3UX4A 2PQNA 3SBTB 5KJLA 4FADA 4ANVA 4IYPA 4EZJA 2VTBA 4Q94A 2VQ2A 4F1SA 3FHEA 2RG8A 2OV8A 3GYZA 2CG3A 3JCKC 3LEWA 5FZSA 4A1GA 4ILGA 1QNFA 3CVVA 3CVXA 2I2OA 2X3MA 3CVNA 4TRQA 2BTDA 2KCLA 5D0OD 2IQCA 4JEHA 3SD5A 5JJ7A 4JZYA 3G2UA 3TXNA 3PEUB 5JHBA 1Z3YA 3ZFWA 1DNPA 3LPZA 3QDNA 2MOWA 3FUKA 4DLOA 3OXLA 4NQ0A 3L13A 1FVFA 3I4RB 4APFA 3U9WA 2CFUA 2FI7A 3PDNA 4AOFA 4NRHB 1PC2A 3CSTA 4BWRA 2AW6A 4LCTA 4MLPA 2L6JA 3FU6A 5EX3A 4UI9C 1PY1A 4G23A 1KT0A 2R17C 5DIZA 3Q4AB 4N2QA 2NXPA 4GPKA 1XNFA 4GZ5A 3CHPA 3ASHA 4K03A 3MA5A 4HOTA 4UQXA 3OXGA 3ZVVA 4GYOA 4Q69A 3IKOB 3CVYA 3RK6A 2XPZA 3QWVA 4KBQA 4EZLA 3JQ0A 3LKUA 2WXPA 4ANXA 1H19A 5FQ6A 3HIZA 2E2EA 5FZRA 4ACKA 1HG2A 3TL5A 2BF0X 4BSXA 4C9BB 3MZLB 4GB9A 1BPOA 2NC9A 2YNQA 3KAEA 3LJ3A 3IEGA 1E8XA 2PQRA 2DIWA 1H2TC 4L2LA 1INZA 4CCAA 5FWQA 3MKRA 1U3CA 4UWLA 3U64A 4AJWA 4OVUA 5J08A 4W9RA 5T4YA 2WXRA 1QQEA 4B94A 4KZ0A 3ZGQA 2YHEA 5EDSA 4BT9A 3VLFA 1ELKA 4ANUA 5JJ6A 2XGMA 2WQ7A 4B8CB 3D9OA 1U3DA 4B89A 3FY4A 3KEZA 5ARGA 3ZIMA 4G25A 4AV7A 4FJZA 4PS7A 2MRIA 4I17A 4QFVA 3MKQB 4BTBA 4GU5A 2XCCA 4OVVA 4D10C 1TJFA 1B89A 3FUMA 2XRZA 4KXKB 4CGWA 4CDRA 3LXUX 4WNFA 3PVLA 5EX0A 5AIJA 4FP7A 3EHMA 3QWWA 5J90A 4V3IA 2UY1B 3TJPA 4G26A 4K0RA 3CK9A 3I5PA 1LF8A 2J07A 3ML8A 4GMLA 3CR3A 4C0MA 4GZ6A 2X6HA 4G11A 2CFZA 1HS6A 3OXFA 4BY6A 3TG4A 2V4LA 3CEQA 1IYGA 5JJTA 4I6EA 3PE3A 3UUXA 4F7AA 5KJMA 3MGBA 2VTBB 2WQ6A 4L1BA 4XX5A 5A6CA 2Y3AA 4JXTA 2LAHA 2XRYA 1A17A 3MV3B 3MX3A 3RKVA 1UW4B 3I3NA 2FO7A 3LY8A 1IQUA 3CQGB 5G04J 1TEZA 3SFZA 1OUVA 4JVSA 3U66A 3FULA 3D9KA 1GW6A 1Z3XA 3B7SA 1OWMA 3LVQE 4AVXA 5ARFA 2VYIA 4PH4B 5BW8C 3QK0A 5A23A 2X6JA 4BT8A 1HX8A 3P2BA 4LERA 3SI5A 1L5JA 2AVPA 3ZXSA 2JLBA 3S2AA 2C0LA 3HDXA 1UJKA 5BV1A 2V5FA 2Q7FA 1UN9A 2KCKA 3AU4A 3BEEA 5LP0A 2LSUA 2GW1A 2WVIA 2BUGA 1JWFA 3U3WA 5FQ8A 1P5QA 5M72A 4GZ3A 2V8SE 3U4TA 4DLQA 2IOSA 4HOSA 3SGHA 4B0ZA 3DBSA 3L08A 4EBAA 2PM7A 1FVHA 4GCOA 3ZN3A 1W3BA 3D9MA 4PS8A 3D9IA 3GW4A 5KCMA 3AS5A 3FUDA 4G24A 4UQYA 4AXHA 3AS8A 4PDXA 3C98A 4XI0A 5G2NA 3TXMA 5LX8A 3CIAA 3QWPA 3SHFA 1JPLA 3ZW3A 3RO3A 1OWPA 4EECA 2FBNA 3LVRE 3ONKA 4EPZA 3FUFA 3FTSA 3E4BA 3Q5MA 3APFA 3MYVA 4U04A 3JUIA 3HYMB 3GZ1A 3L22A 3L54A 1UJJA 1E7VA 3IV0A 2YINA 2NSZA 3GZSA 4FLBA 3ESKA 3B13A 4YVQC 3B7UX 3FFLA 4TUUA 5T8IA 1ZU2A 2EQXA 1NZNA 1E8YA 3BG1B 4J8FA 1HZ4A 3EIQC 2WXQA 2C2LA 2P58C 3CSFA 4CT0A 3ESLA 5KJKA 3FH5A 4JPSA 3FTYA 3ZRHA 2WXLA 3FEXA 2VGXA 1HU3A 2IOLA 3RIBA 4Q96A 3S7JA 3NF1A 2ILRA 4GAAA 4UWFA 4LUNU 1E8ZA 5EKQD 3B7RL 5G04C 3UMVA 3S7BA 4AIFA 3FH8A 3RRNB 3NZUA 3CVLA 1TJCA 3N71A 5HI7A 3CHMA 5T3RA 2M63A 2OVFA 4NACA 5BNWA 4I9CA 3PZDA 4WNEA 4CT4A 3IHVA 2LAIA 4PUCA 1NA0A 3D9PA 1OWNA 2DBAA 4U0SA 3NQPA 3IBEA 3AU5A 2VSXE 5CHEE 3D9LA 3PNLB 3PUJA 5FQ7A 2X6KA 3D9JA 5C1DA 3URZA 2GGFA 1EPUA 5HQ8A 2J4DA 3MCXA 2XGOA 4LEUA 4ABNA 4ILIA 4I1MA 2WPVA 3G2TA 4L23A 3VLEA 4DJAA 2X6IA 2R5SA 1SZAA 4A3TA 3CHRA 3G2VA 1UG3A 2YQ8A 3PEVB 3FU3A 2LNIA 3HHMA 4WAFA 4CDNA 4EQFA 4XZ4A 3D3MA 3NZSA 3EJNA 3QJZA 5LOZA 4NURA 1HXIA 4YNDA 3EHNA 1H2UA 3QOUA 2GRMA 3CK8A 3UPVA 1FCHA 3ZYMA 2IONA 2CHWA 1VDYA 2I9CA 4JHJA 3ZHEB 5FJYA 4WWPA 3FTZA 3FUHA 2PZIA 4HS2A 2A5UA 3PE4A 3ZYQA 2OVBA 3QC1A 3R7QA 2KC7A 2L9BA 3JQ1A 5E76A 4XKCA 1MHQA 2J9QA 2XEVA 1S0PA 2YHCA 4MRUA 3SNXA 1WY6A 4J6IA 4URKA 4A1SA 3RRMB 3L6AA 4J8SA 4UQZA 3LYAA 1SQMA 2IJGX 4WNDA 4FA6A 3O4ZA 3RJVA 4PS3A 3OTNA 4JC8A 1HG5A 3Q15A 1YA0A 4TV3A 2XGSA 4HORA 2LO6A 3R7RA 4AY6A 3FWVA 3ONLA 1ELWA 4U0UA 4Y6WA 2CHXA 1E8WA 3VLDA 3P1UA 4HXIA 3PS6A 4J8DA 5CCLA 3O48A 1Y8MA 3FTWA 4FHJA 4MS6A 5ENNA 2PL2A 1DVPA 4GYYA 3SZ7A 2L0TB 4L2YA 2VGXB 4HLEA 4GA0A 4U63A 2KM4A 3LY9A 4RG6A 5FZQA 1Y6IA 4N3AA 3FUIA 4GYWA 3Q49B 3VTYA 3QKYA 3AS4A 4XKBA 4BX8A 5LCWC 4I6GA 4FULA 2FF4A 2MHKA 3CKCA 4N2SA 5BV0A 4XI9A 1JUQA 2I1KA 2VSOE 2V0PA 5G05J 3ASDA 4J0UA 3CHSA 2UY1A 4JW1A 4RVBA 3HVEA 4JHKA 5CMYA 1QZ2A 5DBKA 3RU0A 1KLXA 3ML9A 4A3VA 3CHOA 2A4ZA 3L17A 4LRZA 5KJNA 4BFRA 4BTAA 4ANWA 5AJDA 1ZBPA 1HE8A 4KVOA 4FU3A 4I6JA 4KMOA 1IHGA 2QFCA 3MEKA 4JA9A 4A55A 2XPYA 1NA3A 1EF1C 4I2ZA 2J09A 2WB2A 2WXIA 5FT9A 4L7TA 1WAO1 2WXMA 4GZCA 4E6HA 3IHYA 2IF4A 2WM9A 4WNGA 5AENA 2GRLA 2WXKA 3SF4A 4I1OB 2KZTA 3ZYLA 3KS2A 5CMWA 2UWJG 5LFAA 3DPDA 2JEKA 3R9AB 4AY5A 3FTVA 4Y6CA 3PREA 2X38A 4FLHA 4GZDA 4DPRA 3D9NA 4JA7A 3S7DA 2I1JA 3ASGA 4I9EA 3B7TA 4IN3B 4I2WA 4EZKA 2AXVA 3PUKA 4J8EA 2J08A 4HOQA 2KCVA 3S7FA 3RO2A 2WMOA 4CGVA 3T5VA 3EIJA 3CQCB 4KT6B 4C0EA 1N54A 4JHRA 2IU1A 3MJWA 1E96B 1N52A 2HO1A 3CK7A 2LSVA 4U07A 1OWLA 2VJ8A 1MQSA 2HR2A 4XE0A 3CGHA 3TGOA 3QARA 3APDA 4GA1A 4GMJA 4CEMA 3EDTB 2XPIA 5FQ4A 1SZ9A 2E0IA 3FU0A 2AXUA 1EDUA 4KZCA 2OOEA 4YVOA 5E75A 3RRUA 4UWKA 3TG5A 2WXJA 4U8HA 4E85A 2X6FA 2ZU6B 1ELRA 3MV2B 3ENEA 1E90A 3ZYKA 2WXFA 5LCWJ 3FTXA 3CHQA 5D0QD 2XCBA 3FU5A 3ASFA 3LCAA 4AEZC 4HOUA 5ANLA 5C2YA 3T5XA 4GCNA 2CHZA 3APCA 3LY7A 4JL0A 5G05C 1HFAA 3PNTB 2VSNA 3KD7A 3CKBA 4AP2A 2FULA 2Y4UA 3FUJA 3CVPA 4U0ZA 1Z6TA 4P29A 1E7UA 2XHEA 4N3BA 1EYHA 3FH7A 2Y4TA 4ATGA 4JEUA 1WM5A 4GA2A 1H6KA 2R59A 3GZ2A 3G2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HH8 A;  5FTP A;  4APO A;  3CV0 A;  4N39 A;  4UI9 K;  4O6F A;  4N3C A;  4WUY A;  2C0M A;  2WQH A;  4G2V A;  2FEZ A;  3CVQ A;  3JYS A;  3K9I A;  4F3V A;  4KYO B;  4H7X A;  2VGY A;  4UI9 J;  2VSY A;  4N5C A;  5AYW D;  3TAX A;  5BT1 A;  4RG9 A;  3WXX A;  1KT1 A;  2KAT A;  3ULQ A;  2HYZ A;  2OND A;  4G1T A;  4XIF A;  3ZPJ A;  3Q47 B;  4ME2 A;  4AM9 A;  2IFU A;  5A7D B;  4I1A A;  4H7Y A;  3UQ3 A;  3FP3 A;  3VTX A;  2I6H A;  5CCM A;  3ZHE A;  2PQN A;  5KJL A;  2VQ2 A;  3GYZ A;  5FZS A;  3CVN A;  5D0O D;  2KCL A;  5JJ7 A;  3ZFW A;  3LPZ A;  3QDN A;  3OXL A;  4NQ0 A;  2FI7 A;  3PDN A;  4NRH B;  1PC2 A;  4BWR A;  2L6J A;  5EX3 A;  4UI9 C;  4G23 A;  1KT0 A;  5DIZ A;  3Q4A B;  4N2Q A;  4GPK A;  1XNF A;  4GZ5 A;  3ASH A;  3MA5 A;  4HOT A;  4UQX A;  3OXG A;  4GYO A;  4KBQ A;  3QWV A;  3LKU A;  2E2E A;  5FZR A;  3KAE A;  2NC9 A;  3IEG A;  2PQR A;  3MKR A;  4W9R A;  1QQE A;  4B94 A;  3ZGQ A;  4BT9 A;  5JJ6 A;  2XGM A;  5ARG A;  4G25 A;  4I17 A;  4BTB A;  2XCC A;  1B89 A;  4KXK B;  4CGW A;  4CDR A;  4WNF A;  5EX0 A;  3QWW A;  2UY1 B;  4G26 A;  3CK9 A;  4GZ6 A;  3OXF A;  3TG4 A;  3CEQ A;  1IYG A;  5JJT A;  3PE3 A;  3UUX A;  5KJM A;  5A6C A;  1A17 A;  3MV3 B;  3RKV A;  3LY8 A;  2FO7 A;  5G04 J;  1OUV A;  5ARF A;  2VYI A;  5BW8 C;  4BT8 A;  2AVP A;  2JLB A;  2C0L A;  2V5F A;  2Q7F A;  2KCK A;  3BEE A;  2LSU A;  2GW1 A;  2BUG A;  3U3W A;  1P5Q A;  5M72 A;  4GZ3 A;  3U4T A;  4HOS A;  4GCO A;  3ZN3 A;  1W3B A;  3GW4 A;  3AS5 A;  4G24 A;  4UQY A;  3AS8 A;  4XI0 A;  3QWP A;  3RO3 A;  2FBN A;  3Q5M A;  3E4B A;  4U04 A;  3HYM B;  3GZ1 A;  3ESK A;  4YVQ C;  3FFL A;  1ZU2 A;  1NZN A;  4J8F A;  1HZ4 A;  2C2L A;  2P58 C;  5KJK A;  2VGX A;  3RIB A;  3S7J A;  3NF1 A;  5EKQ D;  5G04 C;  3S7B A;  4AIF A;  3CVL A;  3N71 A;  5HI7 A;  5BNW A;  4I9C A;  4WNE A;  1NA0 A;  2DBA A;  4U0S A;  5CHE E;  5C1D A;  3URZ A;  5HQ8 A;  2XGO A;  4LEU A;  4ABN A;  2WPV A;  2R5S A;  2YQ8 A;  2LNI A;  4EQF A;  1HXI A;  4YND A;  3QOU A;  3CK8 A;  3UPV A;  1FCH A;  3ZHE B;  2PZI A;  3PE4 A;  2KC7 A;  2J9Q A;  2XEV A;  2YHC A;  4A1S A;  4UQZ A;  3LYA A;  4WND A;  3RJV A;  3Q15 A;  1YA0 A;  2XGS A;  4HOR A;  4AY6 A;  3FWV A;  4U0U A;  1ELW A;  4Y6W A;  4J8D A;  5CCL A;  3O48 A;  1Y8M A;  2PL2 A;  4GYY A;  3SZ7 A;  2VGX B;  4GA0 A;  3LY9 A;  4RG6 A;  5FZQ A;  4N3A A;  4GYW A;  3Q49 B;  3VTY A;  3QKY A;  3AS4 A;  5LCW C;  2FF4 A;  2MHK A;  3CKC A;  4N2S A;  4XI9 A;  5G05 J;  3ASD A;  4J0U A;  2UY1 A;  3RU0 A;  1QZ2 A;  5DBK A;  1KLX A;  5KJN A;  4BTA A;  1ZBP A;  1IHG A;  2QFC A;  3MEK A;  4JA9 A;  1NA3 A;  4I2Z A;  5FT9 A;  1WAO 1;  2IF4 A;  4WNG A;  3SF4 A;  3KS2 A;  2UWJ G;  3R9A B;  4AY5 A;  4Y6C A;  4JA7 A;  3S7D A;  3ASG A;  4I9E A;  4IN3 B;  4I2W A;  4J8E A;  4HOQ A;  2KCV A;  3S7F A;  3RO2 A;  4CGV A;  4JHR A;  1E96 B;  2HO1 A;  3CK7 A;  2LSV A;  4U07 A;  2HR2 A;  3TGO A;  4GA1 A;  3EDT B;  2XPI A;  3TG5 A;  2OOE A;  4YVO A;  1ELR A;  3MV2 B;  5LCW J;  5D0Q D;  2XCB A;  3ASF A;  3LCA A;  4HOU A;  4GCN A;  3LY7 A;  4JL0 A;  5G05 C;  2VSN A;  3KD7 A;  3CKB A;  2Y4U A;  3CVP A;  4U0Z A;  4N3B A;  2Y4T A;  1WM5 A;  4GA2 A;  1TJC A;  3GZ2 A;  5FJY A; 
#chains in the Genus database with same CATH topology
 5FTP A;  4DK5 A;  4MBG A;  3CVW A;  4UI9 K;  1PAQ A;  4KVM A;  3FTU A;  4G2V A;  5AQB A;  3CVQ A;  1HF8 A;  3LJN A;  4U8V D;  4F3V A;  2WXG A;  3SBS A;  3HVE B;  5BPP A;  4HVB A;  4EBA G;  4UI9 J;  3SFX A;  3NOC D;  4I43 A;  1KT1 A;  3KSL A;  2KAT A;  1IKN D;  3ULQ A;  1HO8 A;  4EHM A;  4G1T A;  3LDZ A;  4XIF A;  2DCP A;  3ZPJ A;  3FUE A;  2DYR E;  3Q47 B;  4ME2 A;  4AM9 A;  2HM8 A;  4CDM A;  3G2W A;  3R9M A;  4ILH B;  4F6R D;  4H7Y A;  2J4B A;  4OYS A;  3FP3 A;  3PRZ A;  4UWG A;  2DYS E;  2B6C A;  3NBN B;  4O60 A;  5KJL A;  4IYP A;  1SA4 A;  2XEH A;  2VQ2 A;  3FHE A;  1BLX B;  4A1G A;  3PZ1 A;  3CVX A;  3RAU A;  5JJ7 A;  3SD5 A;  5JHB A;  2QYJ A;  3QDN A;  2MOW A;  1YMP A;  3OXL A;  4APF A;  4BWR A;  5AQ7 A;  2AW6 A;  2L6J A;  4UI9 C;  1PY1 A;  3DSW A;  1TYQ G;  2NXP A;  4GPK A;  4K03 A;  1JCR A;  3UKU G;  2ETA A;  3CVY A;  3RK6 A;  2XPZ A;  2E2E A;  1HG2 A;  3TL5 A;  4LNG A;  4GB9 A;  2YNQ A;  3BQO A;  1INZ A;  1TN8 A;  3Q78 A;  1U3C A;  3C5R A;  3ZGQ A;  3VLF A;  5JJ6 A;  2XGM A;  2WQ7 A;  1U3D A;  4FJZ A;  4PS7 A;  4I17 A;  1MX2 A;  3MKQ B;  4QFV A;  4BTB A;  2LXM A;  1B89 A;  5AIJ A;  3QWW A;  3Q9U C;  4K5A B;  4V3I A;  4GML A;  4C0M A;  2X6H A;  4G11 A;  2CFZ A;  1HS6 A;  2H6G A;  1IYG A;  4L1B A;  4XX5 A;  1Q2Z A;  4JXT A;  1NFI E;  1A17 A;  3Q73 A;  4HBD A;  3RKV A;  1UW4 B;  3T8K A;  1IQU A;  3U66 A;  1OUV A;  4JVS A;  3FUL A;  3DSX A;  3QK0 A;  1HX8 A;  3P2B A;  4J7W A;  2AVP A;  3S2A A;  1N4Q A;  2LSU A;  2WVI A;  5M72 A;  3SGH A;  3L08 A;  4JD2 G;  3RSE G;  3C98 A;  2H6F A;  3ONK A;  3Q5M A;  3FTS A;  3E4B A;  3HYM B;  3L54 A;  4DX2 A;  3GZS A;  2V5Q C;  4YVQ C;  2P9U G;  3BG1 B;  3EIQ C;  2IO3 C;  4JPS A;  3ZRH A;  4HQD A;  1N4R A;  3RIB A;  3S7J A;  3NF1 A;  3J5Q B;  4LUN U;  1E8Z A;  5EIB E;  4O1P A;  4G8L A;  3S7B A;  3DXM G;  3RRN B;  4CZ2 D;  3NZU A;  1LTX A;  1N0R A;  1A5E A;  3AG3 E;  5BNW A;  4PUC A;  2DBA A;  3NQP A;  3IBE A;  3AU5 A;  4OAV B;  5FQ7 A;  3PUJ A;  3UIN C;  1EPU A;  5HQ8 A;  3VLE A;  2R5S A;  1SZA A;  3G2V A;  3HHM A;  2XS1 A;  1H6P A;  4XZ4 A;  3D3M A;  1HXI A;  4YND A;  3CK8 A;  4GMR A;  3ZHE B;  3B95 A;  1U2V G;  2A5U A;  1K8K G;  2OVB A;  3QC1 A;  1MHQ A;  4MRU A;  1WY6 A;  2KBX A;  2ZGG A;  4A1S A;  2IJG X;  3C72 A;  3OTN A;  1HG5 A;  1YA0 A;  3WG7 E;  3ULE G;  4U0U A;  5KBA A;  3AAA C;  5IY5 E;  4HXI A;  3PS6 A;  5CCL A;  4FHJ A;  1Y8M A;  4TXQ A;  3DSU A;  4MS6 A;  1V55 E;  3SZ7 A;  2L0T B;  2VGX B;  4GA0 A;  2P9L G;  3Q49 B;  3VTY A;  2AJA A;  2ETC A;  4BX8 A;  5LCW C;  4I6G A;  3CKC A;  5BV0 A;  2ZGD A;  1JUQ A;  2I1K A;  3CHS A;  2UY1 A;  4RVB A;  5CED B;  4A3V A;  5DBK A;  3CHO A;  4LRZ A;  4ANW A;  3TWU A;  4FU3 A;  3ZNG A;  4LNB A;  1IHG A;  2WB2 A;  5FT9 A;  1WAO 1;  2WXM A;  5AAO A;  5AEN A;  1MX4 A;  3W9G A;  3FTV A;  4Y6C A;  2I1J A;  3B7T A;  3AG1 E;  4HOQ A;  3RO2 A;  4CGV A;  4JHR A;  2IU1 A;  2LSV A;  1OWL A;  3Q9N C;  4XE0 A;  3C3O A;  4CEM A;  3EDT B;  5FQ4 A;  2AXU A;  4UWK A;  2WXJ A;  1S64 A;  2ZU6 B;  3MV2 B;  3ENE A;  2XCB A;  4HB5 A;  3LCA A;  1OCO E;  2CHZ A;  2ZXW E;  2Y4U A;  3CVP A;  4U0Z A;  4JEU A;  4LNU D;  4APO A;  3UT7 A;  1DCQ A;  5AJL A;  3Q75 A;  2WQH A;  1AWC B;  1JCS A;  3FEY A;  3JYS A;  2PM6 A;  2WXH A;  4CRW A;  1H2V C;  1KZO A;  3AJI A;  2VGY A;  3CLJ A;  5ANR A;  4HNA D;  3CVU A;  2WXN A;  5AYW D;  3TAX A;  4RG9 A;  1IQR A;  3ZEF A;  4WWO A;  1MJ0 A;  4M3O A;  3UT4 A;  4DI3 A;  3SFY A;  5FIN A;  2WXO A;  1OWO A;  4ACL A;  3E34 A;  2IFU A;  4UWH A;  5B1B E;  3L16 A;  2JAB A;  4IRU A;  3UQ3 A;  3IXE A;  2CG2 A;  5BUZ A;  2QY7 A;  2I6H A;  3ZUV B;  1TNB A;  3UX4 A;  5CER B;  4FAD A;  4ANV A;  4F1S A;  4TXR A;  2OV8 A;  4QQI A;  3GYZ A;  5FZS A;  5AQA A;  4ILG A;  1QNF A;  1MYO A;  5D0O D;  4JEH A;  4JZY A;  3G2U A;  3TXN A;  1Z3Y A;  4NQ0 A;  3U9W A;  3DST A;  2CFU A;  2FI7 A;  3PDN A;  4AOF A;  3V79 K;  2XZT G;  4LCT A;  4MLP A;  3SY2 A;  3TWQ A;  3FU6 A;  3EUV A;  4N2Q A;  2F0Y A;  3CHP A;  3DRA A;  4GYO A;  4Q69 A;  3IKO B;  2XEN A;  4KBQ A;  3JQ0 A;  3LKU A;  4HRL A;  4BEP A;  2NYJ A;  3L9T A;  3EHQ A;  4GTQ A;  4U95 D;  4BSX A;  3MZL B;  3LJ3 A;  3IEG A;  2PQR A;  1H2T C;  4L2L A;  4CCA A;  4HI9 A;  4UWL A;  4OVU A;  3TWT A;  2YHE A;  4BT9 A;  2A5E A;  1ELK A;  4B89 A;  3FY4 A;  5ARG A;  4AV7 A;  4G25 A;  4RQI A;  2XCC A;  2XRZ A;  4KXK B;  4CDR A;  5EX0 A;  4FP7 A;  5J90 A;  1G3N B;  1LF8 A;  1TNO A;  4BY6 A;  3TG4 A;  4L9P A;  3CEQ A;  5JJT A;  4LSZ E;  3DWL G;  4F7A A;  2EIK E;  2BKG A;  2LAH A;  1DC2 A;  3TWW A;  1V54 E;  3LY8 A;  3I3N A;  3CQG B;  5G04 J;  1GW6 A;  4K5B A;  3LVQ E;  3V2X A;  2P2C P;  1WG0 A;  3B7B A;  3JXJ A;  4LER A;  3SI5 A;  1L5J A;  2QYU A;  1YYH A;  2H6I A;  2Q7F A;  2KCK A;  3AU4 A;  2GW1 A;  2BUG A;  2XS8 A;  3U4T A;  1DCE A;  2IOS A;  4EBA A;  2PM7 A;  4GCO A;  1W3B A;  3D9M A;  3FUD A;  4AXH A;  3AS8 A;  4XI0 A;  5G2N A;  2ETB A;  3SHF A;  3ZW3 A;  3LVR E;  3APF A;  3MYV A;  3GZ1 A;  3PZ3 A;  3L22 A;  4FLB A;  4TUU A;  4TUM A;  2EQX A;  1E8Y A;  4J8F A;  2C2L A;  3CSF A;  4CT0 A;  3FH5 A;  2WXL A;  3FEX A;  2IOL A;  5AAR A;  3B7R L;  5G04 C;  5CRV A;  3CVL A;  3N71 A;  5T3R A;  4I9C A;  4WNE A;  4U0S A;  5CHE E;  2GGF A;  3MCX A;  1OCZ E;  4LEU A;  4ABN A;  4I1M A;  4DJA A;  3FU3 A;  4J8Y A;  3EJN A;  5LOZ A;  4NUR A;  3EHN A;  1H2U A;  2ION A;  1VDY A;  2I9C A;  1IHB A;  5EYL A;  3FUH A;  3UIO C;  3E30 A;  3R7Q A;  2J9Q A;  3SNX A;  4J6I A;  2IY0 C;  4J8S A;  4UQZ A;  1SQM A;  5CEA A;  4JC8 A;  4GTS A;  2XGS A;  1N11 A;  4AY6 A;  3ONL A;  4Y6W A;  3UKR G;  1N4S A;  3P1U A;  4J8D A;  3HG0 D;  2PL2 A;  5ENR D;  4GYY A;  3V2O A;  2BKK B;  4RG6 A;  3UI2 A;  4GYW A;  4FUL A;  4CYM D;  5HRY A;  4K5C A;  2V0P A;  4JW1 A;  3UIP C;  2HE0 A;  1O1T A;  4JHK A;  3ML9 A;  1KZP A;  5KJN A;  3C3Q A;  5AJD A;  1ZBP A;  1HE8 A;  4KVO A;  3UM0 A;  1EF1 C;  4L7T A;  2KZT A;  5LFA A;  3DPD A;  3R9A B;  3PRE A;  2X38 A;  3S7D A;  4EZK A;  4IN3 B;  4GTM A;  4J8E A;  2WMO A;  4C0E A;  3DEP A;  2F37 A;  4U07 A;  2VJ8 A;  5EN5 D;  2HR2 A;  3QAR A;  3APD A;  4GTR A;  2E0I A;  3FU0 A;  3RRU A;  4YVO A;  5E75 A;  4B93 B;  4U8H A;  1O1S A;  5LCW J;  5D0Q D;  3FU5 A;  4HOU A;  5ANL A;  4GCN A;  3LY7 A;  1HFA A;  3UM2 A;  3CKB A;  2FUL A;  3FUJ A;  4A63 B;  1K1A A;  1E7U A;  2XHE A;  3ZKJ A;  1WM5 A;  2QZA A;  5FJY A;  1HH8 A;  2RFM A;  3CV0 A;  5D2M C;  3OAW A;  4WUY A;  2C0M A;  3QB2 A;  1UN8 A;  2RD0 A;  3T8M A;  1TN6 A;  1H0A A;  4HRN A;  1JWG A;  1BU9 A;  4BER A;  1QBQ A;  3FUN A;  2GRN B;  4IUL A;  4FC8 A;  4U96 D;  3WXX A;  4WWN A;  4MKT A;  2XQ0 A;  2OND A;  4U7E B;  1TNY A;  2WMN A;  2J49 A;  5A7D B;  4BX9 A;  1BD8 A;  1NP7 A;  3AG2 E;  4I1A A;  3EU9 A;  2AWI A;  5ENS D;  3SO8 A;  3HRA A;  1S70 B;  3FDH A;  3ZHE A;  2PQN A;  3SBT B;  4EZJ A;  2VTB A;  4Q94 A;  1RW2 A;  2I2O A;  2X3M A;  3CVN A;  2BTD A;  1BI8 B;  2KCL A;  2IQC A;  3PEU B;  2ZIR A;  1DNP A;  3LPZ A;  3FUK A;  2OEV A;  1FVF A;  3KSQ A;  4NRH B;  3CST A;  1SA5 A;  1LD8 A;  3J5P A;  5EX3 A;  2XEE A;  4G23 A;  5DIZ A;  1XNF A;  4GZ5 A;  3UM1 A;  3ASH A;  3MA5 A;  3TWX A;  4UQX A;  3ZVV A;  3E32 A;  3ULY A;  2GRP B;  1UOH A;  1NI1 A;  3HXE A;  4EZL A;  2WXP A;  2ZIS A;  4ANX A;  4RLY A;  1QYM A;  5FZR A;  3HXD A;  2NC9 A;  3V31 A;  1E8X A;  2DIW A;  3MKR A;  5BXO A;  5KNG A;  5J08 A;  4W9R A;  5T4Y A;  2WXR A;  1QQE A;  4KZ0 A;  3HXF A;  4B8C B;  2P9N G;  4U8Y D;  2MRI A;  4OVV A;  4DX6 D;  4CGW A;  4ZFH A;  3PZ2 A;  1OY3 D;  1N94 A;  3EHM A;  4K0R A;  3CK9 A;  3I5P A;  2F8Y A;  2J07 A;  2DWZ A;  3ML8 A;  3CR3 A;  3OXF A;  4G8K A;  3PE3 A;  5KJM A;  3MGB A;  2XRY A;  3SFZ A;  2RFA A;  1Z3X A;  3D9K A;  1D8D A;  4AVX A;  5A23 A;  4BT8 A;  1FT1 A;  4HI8 A;  3HDX A;  5BV1 A;  2V5F A;  2L6B A;  5EYP F;  3U3W A;  3ISM C;  1P5Q A;  4GZ3 A;  4DLQ A;  4DX5 D;  4HOS A;  3DBS A;  1FVH A;  3ZN3 A;  4PS8 A;  5KCM A;  3D9I A;  3GW4 A;  3AS5 A;  4G24 A;  4UQY A;  1LD7 A;  3TXM A;  3CIA A;  3QWP A;  2XZD G;  4XEI G;  1D9S A;  4EEC A;  1OWP A;  3F6Q A;  2FBN A;  1H6O A;  3BUA A;  1E7V A;  2EIL E;  2DZN A;  2NSZ A;  2YIN A;  3ESK A;  2H6H A;  1SVX A;  3B7U X;  3FFL A;  5T8I A;  2EIJ E;  1NZN A;  1O1R A;  3FTY A;  3E37 A;  2ILR A;  4GAA A;  5EKQ D;  4AIF A;  3FH8 A;  4M7C A;  3IHV A;  2LAI A;  3D9P A;  5ENT D;  2VSX E;  3D9L A;  2X6K A;  1MZC A;  3D9J A;  2P9K G;  5C1D A;  2XGO A;  4ILI A;  4L23 A;  3G2T A;  2X6I A;  3CHR A;  3PEV B;  4EQF A;  4NIK A;  3QOU A;  3UPV A;  1FCH A;  2R2L A;  5H7P A;  4BET A;  2PZI A;  3PE4 A;  3ABK E;  3Q7A A;  1N9A A;  3JQ1 A;  5E76 A;  3ABM E;  4XKC A;  2XEV A;  1S0P A;  2YHC A;  3RRM B;  3HXB A;  4O1O A;  3DPY A;  4WND A;  4FA6 A;  4PS3 A;  1N4P A;  4HOR A;  3R7R A;  3FWV A;  1ELW A;  1TN7 A;  2CHX A;  3VLD A;  3X2Q E;  3O48 A;  5B3S E;  3AG4 E;  5ENN A;  4HLE A;  4U63 A;  2KM4 A;  3LY9 A;  1Y6I A;  5FIO A;  4N3A A;  3FUI A;  3AS4 A;  2FF4 A;  2OEW A;  5HKP A;  3ASD A;  3DSS A;  4J0U A;  4N5Q A;  3HVE A;  5CMY A;  1QZ2 A;  3RU0 A;  1KLX A;  2A4Z A;  4BFR A;  4DX7 D;  4BTA A;  2EIM E;  2QFC A;  3MEK A;  3W9F A;  1MX6 A;  2XPY A;  1NA3 A;  4I2Z A;  2WXI A;  4GZC A;  3IHY A;  2IF4 A;  4WNG A;  2F8X K;  2WXK A;  4Z68 A;  3KS2 A;  3E33 A;  5CMW A;  5AQ9 A;  2JEK A;  4FLH A;  4GZD A;  1OCR E;  3UTM A;  3D9N A;  4JA7 A;  2B0O E;  4I9E A;  2GRQ B;  2R02 A;  4I2W A;  5BXU A;  2AXV A;  3PUK A;  2RKK A;  1Z5S C;  3T5V A;  3CQC B;  4KT6 B;  5EID A;  1N54 A;  1E96 B;  1N52 A;  2HO1 A;  5CEC B;  1MQS A;  3CGH A;  3TGO A;  3ASN E;  4GA1 A;  4GMJ A;  2XPI A;  1SZ9 A;  3TG5 A;  3T9K A;  3DSV A;  2DVW A;  4E85 A;  2X6F A;  1ELR A;  3FTX A;  3CHQ A;  1KPS B;  3APC A;  4X8Q A;  4BES A;  5ENO D;  4AP2 A;  1Z6T A;  4C48 B;  1K1B A;  4N3B A;  3FH7 A;  2R05 A;  4GA2 A;  2R59 A;  1TJC A;  2BED A;  4DI4 A;  4N39 A;  4HFG A;  3ASO E;  5EIL A;  4HLL A;  2P9I G;  1XGW A;  4N3C A;  4O6F A;  2FEZ A;  2FO1 E;  3UXG A;  4FJY A;  3K9I A;  4KYO B;  4H7X A;  4FHK A;  3PH0 C;  5B1A E;  3I4G A;  2VSY A;  3BG0 B;  4N5C A;  4RSY A;  1TR4 A;  5BT1 A;  1OT8 A;  2L0I A;  4B8A A;  3QAQ A;  1JCQ A;  5JHA A;  5HS0 A;  2HYZ A;  3QNK A;  2AXZ A;  2KZT B;  3MKQ A;  4F53 A;  4YDO A;  1X5B A;  3KEA A;  2P9P G;  4TXP A;  1ZB1 A;  5G55 A;  4R7L A;  3VTX A;  5CCM A;  4DUI A;  2J8S D;  3JXI A;  3LS8 A;  3UT8 A;  2RG8 A;  2CG3 A;  3JCK C;  3LEW A;  2R03 A;  3CVV A;  4TRQ A;  3V30 A;  2EIN E;  4YDE A;  2GRR B;  3ZFW A;  4DLO A;  3L13 A;  3I4R B;  4UUC A;  1PC2 A;  3EHR A;  1KT0 A;  2R17 C;  3NB2 A;  3Q4A B;  4HOT A;  3OXG A;  3QWV A;  1K3Z D;  3Q7F A;  2QC9 A;  1H19 A;  3ZXP A;  5FQ6 A;  3HIZ A;  4ACK A;  4C9B B;  2BF0 X;  2IEJ A;  2P9S G;  1BPO A;  3KAE A;  2Y1L E;  2MYO A;  5FWQ A;  3U64 A;  4AJW A;  1BI7 B;  4B94 A;  5EDS A;  4ANU A;  3D9O A;  3KEZ A;  3ZIM A;  1OXJ A;  4GU5 A;  1AP7 A;  5KNH D;  4D10 C;  1TJF A;  1IXV A;  3FUM A;  3LXU X;  4WNF A;  3PVL A;  2UY1 B;  3TJP A;  4G26 A;  4GZ6 A;  2V4L A;  5ENP D;  4LG6 A;  1TNU A;  4I6E A;  3UUX A;  3C3R A;  2VTB B;  2WQ6 A;  5A6C A;  2Y3A A;  1O5M A;  2VGE A;  4GTO A;  1X81 A;  3MV3 B;  3MX3 A;  2FO7 A;  1TEZ A;  3B7S A;  1OWM A;  4GTP A;  5ARF A;  2VYI A;  4PH4 B;  5BW8 C;  2KXP C;  2X6J A;  1FPP A;  3ZXS A;  2JLB A;  2C0L A;  1UJK A;  1UN9 A;  3BEE A;  5LP0 A;  1JWF A;  5FQ8 A;  2V8S E;  1D8E A;  1NL4 A;  4B0Z A;  4HRM B;  2DZO A;  3DEO A;  4PDX A;  1YCS B;  5LX8 A;  1RZ4 A;  3NOG D;  1JPL A;  3RO3 A;  4EPZ A;  3FUF A;  4U04 A;  3JUI A;  1UJJ A;  3IV0 A;  3ZU7 B;  3B13 A;  5KWD A;  1ZU2 A;  5ITZ F;  1HZ4 A;  2WXQ A;  2P58 C;  3ESL A;  5KJK A;  2VGX A;  1HU3 A;  4Q96 A;  1OCC E;  4UWF A;  3UMV A;  2PNN A;  5HI7 A;  3CHM A;  2M63 A;  2OVF A;  4ZHB A;  4NAC A;  3PZD A;  5CBO A;  4CT4 A;  1NA0 A;  1OWN A;  4OAU C;  3PNL B;  1WDY A;  3URZ A;  2J4D A;  3BU8 A;  2WPV A;  2Y0B G;  4A3T A;  4YDY A;  1UG3 A;  2YQ8 A;  2LNI A;  4WAF A;  4CDN A;  3NZS A;  3QJZ A;  1TNZ A;  3NAW A;  5JA4 D;  5CRU A;  5JMN D;  2GRM A;  3EU5 A;  3ZYM A;  2CHW A;  2Y69 E;  4JHJ A;  4WWP A;  3FTZ A;  4HS2 A;  3ZYQ A;  2KC7 A;  2L9B A;  2V4H C;  1S63 A;  2OCC E;  5AN8 A;  5D66 A;  4URK A;  3L6A A;  3LYA A;  2GRO B;  3O4Z A;  3RJV A;  3Q15 A;  4TV3 A;  4JB8 P;  2LO6 A;  4YDW A;  3TWS A;  1FT2 A;  2LXL A;  1E8W A;  3JUE A;  3FTW A;  4GPM A;  1DVP A;  3D9H A;  1N0Q A;  4L2Y A;  2LUH A;  5FZQ A;  3QKY A;  4XKB A;  4F1P A;  3TWV A;  2MHK A;  4N2S A;  4XI9 A;  2VSO E;  5G05 J;  4DRX E;  5CBN A;  3L17 A;  4I6J A;  4KMO A;  1SW6 A;  4JA9 A;  4A55 A;  2J09 A;  4E6H A;  2WM9 A;  4ATZ D;  2GRL A;  3SF4 A;  4I1O B;  3DXK G;  5ENQ D;  3ZYL A;  2UWJ G;  3L82 A;  3HXC A;  4AY5 A;  4DPR A;  3PZ4 A;  3ASG A;  4GTV A;  2J08 A;  2IO2 C;  2KCV A;  3S7F A;  3EIJ A;  1N95 A;  3MJW A;  3TWR A;  3CK7 A;  4BSZ B;  4KZC A;  1EDU A;  2OOE A;  3UM3 A;  4DX1 A;  3ZYK A;  1E90 A;  3Q79 A;  2WXF A;  3ABL E;  4AEZ C;  3ASF A;  4GTT A;  3SQV A;  3T5X A;  5C2Y A;  4JL0 A;  5G05 C;  3PNT B;  2VSN A;  3KD7 A;  4P29 A;  1EYH A;  2Y4T A;  4ATG A;  1H6K A;  3GZ2 A;  3G2S A; 
#chains in the Genus database with same CATH homology
 1HH8 A;  4DI4 A;  5FTP A;  4APO A;  4DK5 A;  3UT7 A;  3CV0 A;  5AJL A;  3CVW A;  4N39 A;  4UI9 K;  4HFG A;  3OAW A;  1PAQ A;  1XGW A;  4N3C A;  4KVM A;  2C0M A;  3QB2 A;  4O6F A;  4WUY A;  3FTU A;  1UN8 A;  2WQH A;  4G2V A;  2FEZ A;  3CVQ A;  1HF8 A;  2RD0 A;  4FJY A;  3FEY A;  3JYS A;  3K9I A;  3T8M A;  4F3V A;  2PM6 A;  2WXH A;  2WXG A;  4KYO B;  4H7X A;  4CRW A;  1H2V C;  4FHK A;  1H0A A;  3PH0 C;  1JWG A;  3SBS A;  3HVE B;  2VGY A;  3CLJ A;  5BPP A;  5ANR A;  4HVB A;  4EBA G;  3I4G A;  4UI9 J;  3CVU A;  3FUN A;  2VSY A;  3BG0 B;  2WXN A;  4N5C A;  5AYW D;  4RSY A;  3TAX A;  5BT1 A;  4RG9 A;  2L0I A;  4IUL A;  4FC8 A;  1IQR A;  4B8A A;  3QAQ A;  4I43 A;  1KT1 A;  3WXX A;  3ZEF A;  5JHA A;  4WWO A;  4WWN A;  2KAT A;  4MKT A;  3ULQ A;  2HYZ A;  1HO8 A;  2OND A;  2XQ0 A;  3QNK A;  4G1T A;  4M3O A;  3UT4 A;  3LDZ A;  4XIF A;  4DI3 A;  2DCP A;  3ZPJ A;  2AXZ A;  3FUE A;  2KZT B;  3MKQ A;  2WMN A;  3Q47 B;  2WXO A;  4ME2 A;  1OWO A;  2HM8 A;  4ACL A;  4AM9 A;  4CDM A;  4F53 A;  2J49 A;  2IFU A;  3G2W A;  1X5B A;  5A7D B;  4UWH A;  4BX9 A;  1NP7 A;  4I1A A;  3L16 A;  4ILH B;  4H7Y A;  4IRU A;  3UQ3 A;  2AWI A;  2J4B A;  4OYS A;  3FP3 A;  3PRZ A;  5G55 A;  2CG2 A;  4R7L A;  3VTX A;  4UWG A;  5BUZ A;  2QY7 A;  2I6H A;  5CCM A;  3FDH A;  3ZHE A;  3LS8 A;  3UT8 A;  3UX4 A;  2PQN A;  3SBT B;  5KJL A;  4FAD A;  4ANV A;  4IYP A;  4EZJ A;  2VTB A;  4Q94 A;  2VQ2 A;  4F1S A;  3FHE A;  2RG8 A;  2OV8 A;  3GYZ A;  2CG3 A;  3JCK C;  3LEW A;  5FZS A;  4A1G A;  4ILG A;  1QNF A;  3CVV A;  3CVX A;  2I2O A;  2X3M A;  3CVN A;  4TRQ A;  2BTD A;  2KCL A;  5D0O D;  2IQC A;  4JEH A;  3SD5 A;  5JJ7 A;  4JZY A;  3G2U A;  3TXN A;  3PEU B;  5JHB A;  1Z3Y A;  3ZFW A;  1DNP A;  3LPZ A;  3QDN A;  2MOW A;  3FUK A;  4DLO A;  3OXL A;  4NQ0 A;  3L13 A;  1FVF A;  3I4R B;  4APF A;  3U9W A;  2CFU A;  2FI7 A;  3PDN A;  4AOF A;  4NRH B;  1PC2 A;  3CST A;  4BWR A;  2AW6 A;  4LCT A;  4MLP A;  2L6J A;  3FU6 A;  5EX3 A;  4UI9 C;  1PY1 A;  4G23 A;  1KT0 A;  2R17 C;  5DIZ A;  3Q4A B;  4N2Q A;  2NXP A;  4GPK A;  1XNF A;  4GZ5 A;  3CHP A;  3ASH A;  4K03 A;  3MA5 A;  4HOT A;  4UQX A;  3OXG A;  3ZVV A;  4GYO A;  4Q69 A;  3IKO B;  3CVY A;  3RK6 A;  2XPZ A;  3QWV A;  4KBQ A;  4EZL A;  3JQ0 A;  3LKU A;  2WXP A;  4ANX A;  1H19 A;  5FQ6 A;  3HIZ A;  2E2E A;  5FZR A;  4ACK A;  1HG2 A;  3TL5 A;  2BF0 X;  4BSX A;  4C9B B;  3MZL B;  4GB9 A;  1BPO A;  2NC9 A;  2YNQ A;  3KAE A;  3LJ3 A;  3IEG A;  1E8X A;  2PQR A;  2DIW A;  1H2T C;  4L2L A;  1INZ A;  4CCA A;  5FWQ A;  3MKR A;  1U3C A;  4UWL A;  3U64 A;  4AJW A;  4OVU A;  5J08 A;  4W9R A;  5T4Y A;  2WXR A;  1QQE A;  4B94 A;  4KZ0 A;  3ZGQ A;  2YHE A;  5EDS A;  4BT9 A;  3VLF A;  1ELK A;  4ANU A;  5JJ6 A;  2XGM A;  2WQ7 A;  4B8C B;  3D9O A;  1U3D A;  4B89 A;  3FY4 A;  3KEZ A;  5ARG A;  3ZIM A;  4G25 A;  4AV7 A;  4FJZ A;  4PS7 A;  2MRI A;  4I17 A;  4QFV A;  3MKQ B;  4BTB A;  4GU5 A;  2XCC A;  4OVV A;  4D10 C;  1TJF A;  1B89 A;  3FUM A;  2XRZ A;  4KXK B;  4CGW A;  4CDR A;  3LXU X;  4WNF A;  3PVL A;  5EX0 A;  5AIJ A;  4FP7 A;  3EHM A;  3QWW A;  5J90 A;  4V3I A;  2UY1 B;  3TJP A;  4G26 A;  4K0R A;  3CK9 A;  3I5P A;  1LF8 A;  2J07 A;  3ML8 A;  4GML A;  3CR3 A;  4C0M A;  4GZ6 A;  2X6H A;  4G11 A;  2CFZ A;  1HS6 A;  3OXF A;  4BY6 A;  3TG4 A;  2V4L A;  3CEQ A;  1IYG A;  5JJT A;  4I6E A;  3PE3 A;  3UUX A;  4F7A A;  5KJM A;  3MGB A;  2VTB B;  2WQ6 A;  4L1B A;  4XX5 A;  5A6C A;  2Y3A A;  4JXT A;  2LAH A;  2XRY A;  1A17 A;  3MV3 B;  3MX3 A;  3RKV A;  1UW4 B;  3I3N A;  2FO7 A;  3LY8 A;  1IQU A;  3CQG B;  5G04 J;  1TEZ A;  3SFZ A;  1OUV A;  4JVS A;  3U66 A;  3FUL A;  3D9K A;  1GW6 A;  1Z3X A;  3B7S A;  1OWM A;  3LVQ E;  4AVX A;  5ARF A;  2VYI A;  4PH4 B;  5BW8 C;  3QK0 A;  5A23 A;  2X6J A;  4BT8 A;  1HX8 A;  3P2B A;  4LER A;  3SI5 A;  1L5J A;  2AVP A;  3ZXS A;  2JLB A;  3S2A A;  2C0L A;  3HDX A;  1UJK A;  5BV1 A;  2V5F A;  2Q7F A;  1UN9 A;  2KCK A;  3AU4 A;  3BEE A;  5LP0 A;  2LSU A;  2GW1 A;  2WVI A;  2BUG A;  1JWF A;  3U3W A;  5FQ8 A;  1P5Q A;  5M72 A;  4GZ3 A;  2V8S E;  3U4T A;  4DLQ A;  2IOS A;  4HOS A;  3SGH A;  4B0Z A;  3DBS A;  3L08 A;  4EBA A;  2PM7 A;  1FVH A;  4GCO A;  3ZN3 A;  1W3B A;  3D9M A;  4PS8 A;  3D9I A;  3GW4 A;  5KCM A;  3AS5 A;  3FUD A;  4G24 A;  4UQY A;  4AXH A;  3AS8 A;  4PDX A;  3C98 A;  4XI0 A;  5G2N A;  3TXM A;  5LX8 A;  3CIA A;  3QWP A;  3SHF A;  1JPL A;  3ZW3 A;  3RO3 A;  1OWP A;  4EEC A;  2FBN A;  3LVR E;  3ONK A;  4EPZ A;  3FUF A;  3FTS A;  3E4B A;  3Q5M A;  3APF A;  3MYV A;  4U04 A;  3JUI A;  3HYM B;  3GZ1 A;  3L22 A;  3L54 A;  1UJJ A;  1E7V A;  3IV0 A;  2YIN A;  2NSZ A;  3GZS A;  4FLB A;  3ESK A;  3B13 A;  4YVQ C;  3B7U X;  3FFL A;  4TUU A;  5T8I A;  1ZU2 A;  2EQX A;  1NZN A;  1E8Y A;  3BG1 B;  4J8F A;  1HZ4 A;  3EIQ C;  2WXQ A;  2C2L A;  2P58 C;  3CSF A;  4CT0 A;  3ESL A;  5KJK A;  3FH5 A;  4JPS A;  3FTY A;  3ZRH A;  2WXL A;  3FEX A;  2VGX A;  1HU3 A;  2IOL A;  3RIB A;  4Q96 A;  3S7J A;  3NF1 A;  2ILR A;  4GAA A;  4UWF A;  4LUN U;  1E8Z A;  5EKQ D;  3B7R L;  5G04 C;  3UMV A;  3S7B A;  4AIF A;  3FH8 A;  3RRN B;  3NZU A;  3CVL A;  1TJC A;  3N71 A;  5HI7 A;  3CHM A;  5T3R A;  2M63 A;  2OVF A;  4NAC A;  5BNW A;  4I9C A;  3PZD A;  4WNE A;  4CT4 A;  3IHV A;  2LAI A;  4PUC A;  1NA0 A;  3D9P A;  1OWN A;  2DBA A;  4U0S A;  3NQP A;  3IBE A;  3AU5 A;  2VSX E;  5CHE E;  3D9L A;  3PNL B;  3PUJ A;  5FQ7 A;  2X6K A;  3D9J A;  5C1D A;  3URZ A;  2GGF A;  1EPU A;  5HQ8 A;  2J4D A;  3MCX A;  2XGO A;  4LEU A;  4ABN A;  4ILI A;  4I1M A;  2WPV A;  3G2T A;  4L23 A;  3VLE A;  4DJA A;  2X6I A;  2R5S A;  1SZA A;  4A3T A;  3CHR A;  3G2V A;  1UG3 A;  2YQ8 A;  3PEV B;  3FU3 A;  2LNI A;  3HHM A;  4WAF A;  4CDN A;  4EQF A;  4XZ4 A;  3D3M A;  3NZS A;  3EJN A;  3QJZ A;  5LOZ A;  4NUR A;  1HXI A;  4YND A;  3EHN A;  1H2U A;  3QOU A;  2GRM A;  3CK8 A;  3UPV A;  1FCH A;  3ZYM A;  2ION A;  2CHW A;  1VDY A;  2I9C A;  4JHJ A;  3ZHE B;  5FJY A;  4WWP A;  3FTZ A;  3FUH A;  2PZI A;  4HS2 A;  2A5U A;  3PE4 A;  3ZYQ A;  2OVB A;  3QC1 A;  3R7Q A;  2KC7 A;  2L9B A;  3JQ1 A;  5E76 A;  4XKC A;  1MHQ A;  2J9Q A;  2XEV A;  1S0P A;  2YHC A;  4MRU A;  3SNX A;  1WY6 A;  4J6I A;  4URK A;  4A1S A;  3RRM B;  3L6A A;  4J8S A;  4UQZ A;  3LYA A;  1SQM A;  2IJG X;  4WND A;  4FA6 A;  3O4Z A;  3RJV A;  4PS3 A;  3OTN A;  4JC8 A;  1HG5 A;  3Q15 A;  1YA0 A;  4TV3 A;  2XGS A;  4HOR A;  2LO6 A;  3R7R A;  4AY6 A;  3FWV A;  3ONL A;  1ELW A;  4U0U A;  4Y6W A;  2CHX A;  1E8W A;  3VLD A;  3P1U A;  4HXI A;  3PS6 A;  4J8D A;  5CCL A;  3O48 A;  1Y8M A;  3FTW A;  4FHJ A;  4MS6 A;  5ENN A;  2PL2 A;  1DVP A;  4GYY A;  3SZ7 A;  2L0T B;  4L2Y A;  2VGX B;  4HLE A;  4GA0 A;  4U63 A;  2KM4 A;  3LY9 A;  4RG6 A;  5FZQ A;  1Y6I A;  4N3A A;  3FUI A;  4GYW A;  3Q49 B;  3VTY A;  3QKY A;  3AS4 A;  4XKB A;  4BX8 A;  5LCW C;  4I6G A;  4FUL A;  2FF4 A;  2MHK A;  3CKC A;  4N2S A;  5BV0 A;  4XI9 A;  1JUQ A;  2I1K A;  2VSO E;  2V0P A;  5G05 J;  3ASD A;  4J0U A;  3CHS A;  2UY1 A;  4JW1 A;  4RVB A;  3HVE A;  4JHK A;  5CMY A;  1QZ2 A;  5DBK A;  3RU0 A;  1KLX A;  3ML9 A;  4A3V A;  3CHO A;  2A4Z A;  3L17 A;  4LRZ A;  5KJN A;  4BFR A;  4BTA A;  4ANW A;  5AJD A;  1ZBP A;  1HE8 A;  4KVO A;  4FU3 A;  4I6J A;  4KMO A;  1IHG A;  2QFC A;  3MEK A;  4JA9 A;  4A55 A;  2XPY A;  1NA3 A;  1EF1 C;  4I2Z A;  2J09 A;  2WB2 A;  2WXI A;  5FT9 A;  4L7T A;  1WAO 1;  2WXM A;  4GZC A;  4E6H A;  3IHY A;  2IF4 A;  2WM9 A;  4WNG A;  5AEN A;  2GRL A;  2WXK A;  3SF4 A;  4I1O B;  2KZT A;  3ZYL A;  3KS2 A;  5CMW A;  2UWJ G;  5LFA A;  3DPD A;  2JEK A;  3R9A B;  4AY5 A;  3FTV A;  4Y6C A;  3PRE A;  2X38 A;  4FLH A;  4GZD A;  4DPR A;  3D9N A;  4JA7 A;  3S7D A;  2I1J A;  3ASG A;  4I9E A;  3B7T A;  4IN3 B;  4I2W A;  4EZK A;  2AXV A;  3PUK A;  4J8E A;  2J08 A;  4HOQ A;  2KCV A;  3S7F A;  3RO2 A;  2WMO A;  4CGV A;  3T5V A;  3EIJ A;  3CQC B;  4KT6 B;  4C0E A;  1N54 A;  4JHR A;  2IU1 A;  3MJW A;  1E96 B;  1N52 A;  2HO1 A;  3CK7 A;  2LSV A;  4U07 A;  1OWL A;  2VJ8 A;  1MQS A;  2HR2 A;  4XE0 A;  3CGH A;  3TGO A;  3QAR A;  3APD A;  4GA1 A;  4GMJ A;  4CEM A;  3EDT B;  2XPI A;  5FQ4 A;  1SZ9 A;  2E0I A;  3FU0 A;  2AXU A;  1EDU A;  4KZC A;  2OOE A;  4YVO A;  5E75 A;  3RRU A;  4UWK A;  3TG5 A;  2WXJ A;  4U8H A;  4E85 A;  2X6F A;  2ZU6 B;  1ELR A;  3MV2 B;  3ENE A;  1E90 A;  3ZYK A;  2WXF A;  5LCW J;  3FTX A;  3CHQ A;  5D0Q D;  2XCB A;  3FU5 A;  3ASF A;  3LCA A;  4AEZ C;  4HOU A;  5ANL A;  5C2Y A;  3T5X A;  4GCN A;  2CHZ A;  3APC A;  3LY7 A;  4JL0 A;  5G05 C;  1HFA A;  3PNT B;  2VSN A;  3KD7 A;  3CKB A;  4AP2 A;  2FUL A;  2Y4U A;  3FUJ A;  3CVP A;  4U0Z A;  1Z6T A;  4P29 A;  1E7U A;  2XHE A;  4N3B A;  1EYH A;  3FH7 A;  2Y4T A;  4ATG A;  4JEU A;  1WM5 A;  4GA2 A;  1H6K A;  2R59 A;  3GZ2 A;  3G2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...