3RJVA

Crystal structure of a putative sel1 repeat protein (kpn_04481) from klebsiella pneumoniae subsp. pneumoniae at 1.65 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
EPGSQYQQQAEAGDRRAQYYLADTWVSSGDYQKAEYWAQKAAAQGDGDALALLAQLKIRNPQQADYPQARQLAEKAVEAGSKSGEIVLARVLVNRQAGATDVAHAITLLQDAARDSESDAAVDAQMLLGLIYASGVHGPEDDVKASEYFKGSSSLSRTGYAEYWAGMMFQQGEKGFIEPNKQKALHWLNVSCLEGFDTGCEEFDRISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative Sel1 repeat protein (KPN_04481) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Protein binding
molecule keywords Putative Sel1 repeat protein
total genus 81
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08238 Sel1 Sel1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rjvA01
1.25.40.740 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rjvA02
2R5SA 3QOUA 5G05C 3PDNA 2QFCA 3CKCA 3CK7A 3K9IA 4KBQA 1HZ4A 2E2EA 2LNIA 3E4BA 3FP3A 4BWRA 3VTYA 5JJ6A 5KJLA 2VGYA 4HOTA 1YA0A 2C0LA 1W3BA 3EDTB 4IN3B 4ME2A 2HO1A 3GYZA 4UI9K 3S7DA 4YVOA 5JJ7A 2GW1A 3CKBA 3RJVA 3WXXA 5C1DA 5A6CA 3N71A 3LY7A 2HYZA 5LCWC 5KJMA 4I2ZA 4ABNA 2KATA 4GZ3A 3ESKA 4JL0A 4U07A 5D0QD 3CV0A 5ARFA 1KLXA 1XNFA 4RG9A 5ARGA 4NRHB 2LSVA 2J9QA 3KS2A 5CHEE 2PQNA 4WNEA 3UUXA 5EX3A 2XGMA 3Q15A 1QZ2A 4BT8A 4A1SA 4GZ5A 4BTBA 2WPVA 3CVQA 3FFLA 3LKUA 5KJKA 1NA3A 1WM5A 1B89A 4UQXA 3LYAA 2KC7A 4JHRA 4GA2A 4H7XA 1PC2A 2UY1B 2UY1A 3FWVA 2HR2A 3GW4A 4J0UA 4UQZA 3PE4A 2VSYA 5CCMA 5FZSA 3MA5A 3R9AB 2LSUA 3URZA 3GZ1A 4I9CA 1FCHA 4RG6A 2VQ2A 4Y6CA 3ZHEA 3ZHEB 4AY5A 4UQYA 2XEVA 3ASDA 4KXKB 4N2QA 2AVPA 2UWJG 2PQRA 2XGSA 3MV2B 5FT9A 3ZFWA 4F3VA 5CCLA 3U3WA 3MKRA 4U0UA 3RU0A 5A7DB 3CVPA 4O6FA 4HOQA 4GA0A 2IFUA 2ONDA 3CVLA 5HQ8A 4CDRA 1ZBPA 2JLBA 4G25A 3ASGA 3Q4AB 4G2VA 4XI9A 3SZ7A 2C0MA 3IEGA 4YVQC 2FO7A 4N3AA 2XCCA 4U04A 3AS4A 1ELWA 3TGOA 4UI9C 4Y6WA 5AYWD 4G24A 3VTXA 5D0OD 2XCBA 4UI9J 4CGWA 5JJTA 4GPKA 4HOSA 3S7FA 4I1AA 3CK8A 5FZRA 4APOA 4LEUA 3S7JA 1IYGA 4N39A 3KD7A 3QKYA 3CEQA 5EKQD 5G05J 4G26A 4J8EA 3PE3A 4AM9A 3OXGA 3LY9A 3S7BA 4B94A 4HORA 4BTAA 3KAEA 5G04J 1HXIA 4KYOB 3TG5A 4AIFA 5HI7A 3UPVA 3TAXA 3HYMB 1ZU2A 3OXFA 3ULQA 2NC9A 3ZGQA 4G1TA 4CGVA 1Y8MA 1E96B 2KCLA 5EX0A 5BNWA 1A17A 2MHKA 4GZ6A 1WAO1 1IHGA 1QQEA 3AS5A 3CVNA 3SF4A 4N3CA 3LCAA 4JA7A 4WNDA 4I2WA 3MEKA 3ASHA 5DIZA 3OXLA 3RKVA 3QWWA 3TG4A 4GCOA 5BT1A 5FJYA 4U0SA 4GYYA 4BT9A 4XIFA 2OOEA 2XGOA 3LPZA 3Q5MA 4GYOA 2C2LA 1P5QA 3CK9A 4J8FA 4WNFA 3U4TA 4AY6A 1HH8A 2WQHA 3BEEA 4N3BA 2Y4UA 3RO3A 2Y4TA 2PZIA 4I9EA 4W9RA 4JA9A 2V5FA 2I6HA 4HOUA 5LCWJ 4EQFA 2P58C 2FBNA 3QWPA 1KT0A 2FEZA 3O48A 2FF4A 2VYIA 1NA0A 2YQ8A 3ASFA 3AS8A 3JYSA 4YNDA 5BW8C 3UQ3A 4N2SA 4N5CA 4G23A 3Q49B 2VGXA 2VGXB 3ZPJA 2KCKA 2DBAA 3LY8A 4I17A 4U0ZA 2XPIA 2BUGA 1OUVA 4H7YA 2IF4A 4WUYA 4XI0A 3QWVA 2VSNA 4GCNA 2PL2A 4GA1A 4WNGA 3ZN3A 3QDNA 5FTPA 3GZ2A 3NF1A 5KJNA 2KCVA 4J8DA 5FZQA 1KT1A 1TJCA 2YHCA 2Q7FA 3Q47B 5G04C 3MV3B 2L6JA 2FI7A 4GYWA 3RIBA 3RO2A 4NQ0A 1ELRA 5DBKA 1NZNA 5M72A
chains in the Genus database with same CATH superfamily
4U96D 1TYQG 2E2EA 4B8CB 3EHQA 4UI9K 3FEYA 3RJVA 3HXCA 3FU0A 1KZOA 4FADA 1L5JA 1TEZA 4A3TA 3FDHA 2AXZA 3RAUA 3TWWA 4RQIA 5EX3A 2EIKE 4D10C 4GZ5A 3CVQA 1HO8A 3FWVA 3PVLA 4RSYA 2VQ2A 2XGSA 3CVWA 2WXOA 4J8SA 3V2OA 5HQ8A 2ETCA 3NOGD 1SVXA 3C3RA 2V4HC 2H6IA 2XPYA 1FT2A 4CGWA 5AQ7A 1Z5SC 5B1BE 4PH4B 3SBSA 1H6KA 5EX0A 2AWIA 5ENOD 2P9NG 4EPZA 1N4RA 3SF4A 2LAIA 3PZ4A 1JCSA 3DPDA 1Z3YA 2B0OE 3L82A 2FF4A 3SD5A 3AG3E 1TNYA 1JPLA 2GRRB 2YHCA 4DUIA 3JXJA 3DXMG 3SQVA 3AU4A 5AIJA 3TXMA 3FHEA 3VTYA 4GU5A 3I4RB 5JJ7A 4YVOA 2IU1A 3NAWA 1OY3D 2YINA 3N71A 1RW2A 5AQBA 3FU5A 3ENEA 3SGHA 3AJIA 4EBAA 4F53A 2OEWA 4ANXA 3L9TA 5FWQA 4DLOA 4UWHA 5KWDA 2WXFA 2P9KG 2HR2A 5FZSA 3MA5A 4K5BA 4DI4A 3CQGB 4AY5A 3CVXA 3MKRA 5D2MC 3DPYA 3G2WA 4LNGA 3Q4AB 3SZ7A 3ZXPA 3D9NA 3MYVA 3TWXA 4UWFA 5FZRA 1PY1A 4K0RA 5AENA 4J8EA 4EHMA 2VTBB 2BTDA 5G04J 3WG7E 4CGVA 5BPPA 4RLYA 4FHJA 4N3CA 1BD8A 4LNBA 3QWWA 3U66A 1O1RA 3LPZA 4QFVA 3P2BA 5CEAA 3B13A 3U9WA 1MX2A 4HOUA 2J09A 2WMNA 4O60A 3SBTB 2VGXB 3ZPJA 3LY8A 3D9PA 1WG0A 1E8YA 4WNGA 3SO8A 5FTPA 5KJKA 2V0PA 2I1JA 2CFZA 3RRMB 4DX7D 3ZYMA 2FI7A 2R17C 4KVMA 5M72A 4MLPA 1HZ4A 3QAQA 5KJLA 4HRMB 3ML8A 3FUDA 3HXFA 2FULA 1MHQA 2WXNA 5ARFA 3MGBA 2ETAA 2J9QA 4AP2A 5E75A 2QY7A 4JW1A 1MQSA 3DXKG 4DPRA 2H6FA 2UY1A 1N0RA 1U2VG 1GW6A 2WXLA 2XENA 4B0ZA 3FTUA 2XS8A 4DX5D 2BF0X 2HM8A 4UI9C 5JJTA 3CK8A 4B8AA 2L0IA 3VLFA 2WXKA 3FTYA 3LY9A 2B6CA 3EU9A 4EBAG 5AJLA 2AW6A 3EIQC 5CRVA 2KCLA 4A1GA 3BU8A 1EF1C 2XZTG 5ENRD 4XX5A 4DK5A 4JPSA 1HH8A 2PZIA 3APCA 4DRXE 3HG0D 2NXPA 3QWPA 2A5EA 3FH5A 3QB2A 3KEZA 2XPIA 1OUVA 3I3NA 4XI0A 4KT6B 5EILA 5G04C 4PDXA 1UN8A 1TNZA 2GRQB 1IYGA 4I43A 3AAAC 4O1OA 4L23A 5JMND 1H2TC 4KZ0A 4ILIA 1YA0A 1UN9A 2A5UA 5BV1A 4BERA 3LY7A 2DVWA 4M7CA 2ZU6B 4Q69A 5ARGA 4UWKA 3GZSA 3UT7A 3PEVB 3SFYA 4DI3A 3FEXA 3PE4A 4TRQA 3B7BA 4KXKB 2WXRA 3U3WA 2R02A 3HIZA 2PNNA 1OCRE 1N95A 3HXDA 5E76A 3LJ3A 1A5EA 5JHBA 1S0PA 3UX4A 4AM9A 1OT8A 4BTAA 3UIOC 4Q96A 2NC9A 2WXQA 3I5PA 4YDYA 1A17A 5KCMA 1AWCB 3V30A 4WNDA 4AVXA 4U0SA 2Y0BG 3Q5MA 3U4TA 4WNFA 3CHRA 3ZEFA 4I1MA 1BPOA 4HQDA 3AS8A 2L6BA 3PZDA 5CMWA 4F1SA 4BSXA 2CHZA 2PL2A 3ZIMA 4HXIA 3RRNB 2KCVA 2OCCE 4LUNU 3RO2A 4NQ0A 5ENQD 4WWNA 2J4DA 3K9IA 1X81A 1HU3A 5C1DA 4TUMA 2X6HA 5FQ7A 4IULA 1INZA 3HDXA 1SQMA 3PRZA 2XGMA 4BTBA 4I6GA 2WPVA 4ANVA 4B89A 2L0TB 4C0MA 1FVHA 2QYJA 3R9AB 4L7TA 4RG6A 2EIJE 4N2QA 4IYPA 1IHBA 5ENSD 3QC1A 2X6FA 4O6FA 4HOQA 2X6KA 4XI9A 1ELKA 4XE0A 2XCCA 3FUMA 4CT0A 1LF8A 5BUZA 2WXIA 1OCOE 1LD8A 5EIBE 2XZDG 4N39A 3E33A 5CRUA 3B7RL 3CVUA 3NB2A 4HORA 3KAEA 5AAOA 1HXIA 5LX8A 4KYOB 3TG5A 3E34A 2YHEA 2ZXWE 3TWTA 3AS5A 4APFA 4I6EA 3J5PA 4BT9A 2V5QC 3DSVA 2H6GA 3UM2A 1K1AA 3BUAA 3IKOB 1NA0A 4HI9A 2WVIA 5FQ6A 4N5CA 4JD2G 2F8XK 3EJNA 4WUYA 3C3QA 3EU5A 3Q7AA 3NF1A 5KJNA 1MJ0A 3MZLB 4ANUA 1KZPA 3QJZA 4QQIA 4FHKA 2V8SE 5FQ8A 3CKBA 4GTSA 1HS6A 4XEIG 3FTSA 4ABNA 3ESKA 4JL0A 2QC9A 3BG0B 3UIPC 3ZVVA 1N11A 1SA5A 4JEUA 1BLXB 4J8YA 4AOFA 3L13A 2ZGDA 2XRYA 5CCMA 3HVEA 2ZIRA 1OWOA 4Y6CA 3ZHEB 3CHQA 2WXPA 4BESA 4FULA 3TWSA 5LOZA 2XEHA 4EZKA 2FO7A 3AS4A 3VTXA 4U8VD 4GMJA 4L9PA 1HFAA 2CHWA 3UMVA 1NI1A 4LCTA 3RRUA 1PAQA 5JA4D 1SW6A 3DSXA 5BV0A 1QQEA 2VSXE 3IHYA 3MEKA 4GCOA 3C98A 1QBQA 4DX2A 2I6HA 1K1BA 2IEJA 5T3RA 4BX8A 4LNUD 2IF4A 4J6IA 4A55A 1O1TA 4B93B 1TJCA 1N94A 5A23A 5FQ4A 1ELRA 4GZ3A 4KBQA 2LNIA 4UWGA 4C0EA 3T5XA 4F6RD 3RSEG 3MKQA 1S64A 4HNAD 2HYZA 1S70B 4N5QA 2XS1A 4MRUA 2MOWA 4K5AB 2IOLA 3LVRE 3V2XA 1X5BA 3LJNA 3E37A 1B89A 2IY0C 2DCPA 4J0UA 4PS8A 3FU6A 3HRAA 3VLDA 1H2UA 2PQRA 3UKRG 4U0UA 5A7DB 2LO6A 3AG1E 2IOSA 4N3AA 3TWQA 5AYWD 3IXEA 5D0OD 3PUJA 2XHEA 3B95A 3KD7A 5EKQD 5G05J 5J08A 3MX3A 3OXGA 3S7BA 4AIFA 1YCSB 4GTVA 3NZSA 4JA7A 2P9UG 4GYYA 3D3MA 1JWGA 3E32A 3MJWA 4K5CA 1TN8A 4CT4A 1U3CA 3D9IA 2EIME 4EQFA 2P58C 2VJ8A 3UQ3A 2IJGX 2KCKA 2KZTA 1O5MA 2P2CP 1TN6A 1VDYA 1TR4A 5CHEE 3CLJA 1QNFA 3Q79A 3EDTB 3VLEA 3GYZA 3L54A 2HE0A 2E0IA 2AJAA 3JXIA 3AG4E 2J07A 3ZNGA 3UT4A 1N9AA 1MYOA 1Q2ZA 3LKUA 1WM5A 4UQXA 4JHRA 4H7XA 2EINE 2WQ7A 3AG2E 3NOCD 4GPMA 3ZRHA 2UWJG 4MBGA 2LXLA 3Q73A 2X6IA 3PREA 2LUHA 3ZYQA 2LXMA 4G24A 1IKND 4GZDA 3FUFA 1UG3A 4APOA 2CG2A 4LEUA 4LG6A 4GTOA 1WDYA 4JC8A 1E96B 2F8YA 2H6HA 4GTTA 5DIZA 3TG4A 4BX9A 3TWVA 1K8KG 1OCCE 4AY6A 3NZUA 2RG8A 1OWNA 4J7WA 4GMRA 4G8LA 2V5FA 3C72A 1TNUA 1FVFA 5ITZF 3O48A 5BW8C 4GCNA 4F1PA 3GZ2A 4XKBA 3FH8A 4HLLA 1YMPA 4CDNA 2L6JA 4GYWA 4WWPA 3JQ1A 3DEPA 2Y69E 4HOTA 1W3BA 4U8YD 3HXBA 3J5QB 2X3MA 3WXXA 3PH0C 4E85A 2A4ZA 3L08A 3PS6A 4MS6A 5D0QD 3DSWA 1QYMA 4FJYA 5IY5E 3UUXA 4DX1A 4FLHA 4LERA 4YDEA 2XPZA 3L6AA 5T4YA 3SI5A 2DYRE 4X8QA 2ZISA 4ACKA 3ASDA 2AVPA 2RFAA 3JQ0A 3D9HA 2P9PG 3IEGA 3TGOA 2MYOA 3P1UA 3ZUVB 1OXJA 2GROB 3JUIA 3ISMC 3ULYA 4ZFHA 2GGFA 2P9IG 4MKTA 5CMYA 3CGHA 3FUHA 3TAXA 3PZ1A 2EILE 1Y8MA 5AQ9A 2AXUA 3B7UX 4ANWA 5EYPF 3FUEA 3LCAA 1JWFA 4TUUA 3LS8A 4FA6A 3UI2A 4HVBA 4N3BA 4NACA 3PUKA 4TV3A 2X38A 3D9LA 4JA9A 1KT0A 3ASFA 3EHMA 3DWLG 4U0ZA 3Q9NC 3C3OA 3QWVA 3ZN3A 1E8ZA 2IO2C 3QDNA 2WXMA 3UM0A 3G2TA 4CZ2D 3BG1B 1MX4A 1HF8A 4FJZA 2FO1E 5JJ6A 3UINC 5LP0A 4ME2A 4GTPA 5A6CA 4F7AA 3ZYKA 3BQOA 3RK6A 1BU9A 4BETA 3SNXA 1DCQA 1OCZE 2EQXA 2LSUA 3EIJA 3DEOA 4ILGA 1SZ9A 4GA0A 2IFUA 3CVLA 2C0MA 4R7LA 4UI9J 2P9LG 5EN5D 4G26A 4KZCA 2OEVA 4DLQA 2VTBA 3FULA 4HLEA 4JEHA 4V3IA 4PS3A 1Z6TA 1V55E 5BNWA 2F0YA 3CVNA 3ASHA 4CCAA 3ML9A 1S63A 4WAFA 2C2LA 3BEEA 2Y4UA 2BEDA 4JB8P 4HBDA 1G3NB 3LVQE 4G23A 2I1KA 3CHOA 2VGXA 1O1SA 2DBAA 3NBNB 4U7EB 1BI7B 2L9BA 2WM9A 3UM3A 2Q7FA 5BXOA 3RIBA 2V4LA 4L2YA 5CECB 3CKCA 4HB5A 2C0LA 3CR3A 5KJMA 1N0QA 3KS2A 1DC2A 2PQNA 1SA4A 4BT8A 4G11A 4AXHA 1UW4B 2RFMA 1NA3A 4GTRA 1UJJA 4BEPA 4L2LA 2UY1B 2ILRA 3JCKC 1KPSB 3GZ1A 4GAAA 4I9CA 2LAHA 5KNHD 1D8EA 4OVUA 3ZFWA 3ASOE 5BXUA 4CDRA 4KVOA 3ONKA 4GB9A 5ENTD 2XCBA 4HOSA 1NL4A 1XGWA 4OVVA 1UOHA 2IO3C 3S7JA 4DJAA 1WY6A 5C2YA 4C9BB 4HRLA 5EYLA 1RZ4A 2R2LA 4M3OA 4JHKA 4LSZE 2R05A 3C5RA 3T9KA 1E8WA 2ZGGA 3KEAA 5BT1A 4ATZD 3DBSA 4UUCA 3HXEA 2BKGA 3UTMA 2OVFA 3KSLA 3PEUB 3JYSA 4OAUC 5J90A 2DYSE 4N2SA 5G2NA 4BY6A 1EPUA 2BKKB 4K03A 3FUIA 3ZYLA 3ABME 2M63A 3Q47B 2DZNA 3QOUA 5FIOA 4JVSA 3S2AA 3PDNA 2CFUA 3CIAA 1MX6A 4FC8A 3L22A 3UKUG 2RKKA 3TJPA 3CV0A 4NRHB 3ZXSA 4A1SA 3OAWA 4HRNA 5LFAA 3APFA 3G2UA 1HG5A 2Y3AA 2XEVA 3CSFA 3ABKE 3FH7A 3TXNA 1JCQA 2R03A 3DSUA 5EDSA 1EDUA 3D9JA 5AN8A 3S7FA 4I1AA 3IV0A 3CVYA 2KXPC 3FTWA 4GZCA 4UWLA 3NQPA 3UPVA 1H2VC 3ZGQA 3T5VA 1ZU2A 3ULQA 3DSTA 1IQUA 2KBXA 5HRYA 1N54A 4ACLA 3OXLA 1HX8A 3AU5A 4GTQA 4XIFA 2OOEA 5D66A 3APDA 3FTXA 2FBNA 2VSOE 4Q94A 3QARA 4YNDA 1YYHA 2BUGA 4H7YA 4C48B 4PUCA 5FZQA 1TJFA 1NZNA 3CK7A 3FP3A 2VGYA 4IN3B 5CERB 4I2ZA 4U07A 1NFIE 4RG9A 3QK0A 4OAVB 3Q15A 3EUVA 3ABLE 1N4QA 2NYJA 5AQAA 1PC2A 1FT1A 4NIKA 1HE8A 3MV2B 4F3VA 2XEEA 2NSZA 3SFZA 2ONDA 1DNPA 2VGEA 4FU3A 3D9OA 1TN7A 3FUNA 2JEKA 4CRWA 4EZJA 1TNOA 4BFRA 5ENNA 1D8DA 3HYMB 3OXFA 5T8IA 3CQCB 3ESLA 5FJYA 4EZLA 5KNGA 2XGOA 4A3VA 4J8FA 3CK9A 2Y1LE 4LRZA 3L17A 4AJWA 4AV7A 2X6JA 2FEZA 5EIDA 3FU3A 3Q49B 3FTVA 4GMLA 2PM6A 1K3ZD 1E7VA 2OV8A 3ONLA 2J08A 3MV3B 2GRPB 1JUQA 4NURA 1IQRA 3E4BA 2KM4A 4ZHBA 2HO1A 3DRAA 4I6JA 3UXGA 2QZAA 3FUKA 3ULEG 2KATA 2ETBA 1KLXA 3PZ2A 1N52A 3CHPA 4TXPA 5G55A 4BSZB 4GA2A 1H0AA 1OWMA 3HVEB 3ZHEA 4CEMA 3Q75A 3L16A 3CVPA 3EHNA 3SFXA 5B3SE 3G2VA 3KSQA 4JZYA 4YDOA 3U64A 3QKYA 3G2SA 3HHMA 3PE3A 3O4ZA 1OWPA 2F37A 1E7UA 4YDWA 4RVBA 2YNQA 2J4BA 1H6OA 2P9SG 3LXUX 1WAO1 3T8KA 1E8XA 2WMOA 5ANLA 1OWLA 2IONA 1Y6IA 2J49A 5AJDA 3F6QA 4GYOA 3ASNE 2CG3A 3RO3A 1N4PA 1SZAA 4HS2A 4FLBA 4W9RA 5CEDB 5LCWJ 3V79K 3CSTA 3V31A 5B1AE 1MZCA 4U95D 4E6HA 2XRZA 2VSNA 2WXHA 2I2OA 4J8DA 3Q9UC 3B7SA 5DBKA 2R5SA 5G05C 2J8SD 2QFCA 4HI8A 2WXGA 3MKQB 2GW1A 4I1OB 3R7RA 5LCWC 4URKA 4Z68A 4CDMA 3TWRA 3JUEA 4WNEA 1FPPA 3CVVA 3FTZA 1V54E 3R7QA 2KC7A 3W9FA 4EECA 4U63A 3CHMA 3QNKA 1FCHA 2MRIA 5HKPA 5CCLA 2RD0A 4AEZC 1ZBPA 5KBAA 1TNBA 4L1BA 4YVQC 1H19A 4Y6WA 4GPKA 3LDZA 3UT8A 3MCXA 2CHXA 3CEQA 4ATGA 2WB2A 4B94A 4CYMD 4TXRA 5HI7A 4G1TA 4PS7A 3R9MA 4GZ6A 1DCEA 3ZKJA 1N4SA 4G8KA 3RKVA 5HS0A 1P5QA 2WQHA 3OTNA 5H7PA 2Y4TA 3UM1A 5FINA 4I9EA 4XKCA 3T8MA 3TL5A 2DZOA 3SY2A 3FUJA 1NP7A 2GRMA 1ZB1A 1IXVA 5CBOA 4I17A 4XZ4A 2KZTB 4GTMA 2GRNB 1KT1A 1EYHA 1E90A 4IRUA 3EHRA 3ZU7B 3IBEA 3LEWA 3X2QE 1BI8B 4BWRA 1LD7A 3CHSA 3S7DA 1U3DA 2WQ6A 5ENPD 2I9CA 2GRLA 1XNFA 4JHJA 4OYSA 1UJKA 2JABA 2LSVA 5ANRA 4DX6D 2WXJA 4FP7A 1QZ2A 3FFLA 3PNTB 4A63B 3PZ3A 3LYAA 2OVBA 4JXTA 3GW4A 4P29A 4UQZA 2VSYA 5AARA 3URZA 5CBNA 4UQYA 5FT9A 3Q78A 2DIWA 3RU0A 4WWOA 3DSSA 1AP7A 2JLBA 4G25A 3ASGA 4G2VA 1DVPA 1ELWA 4ILHB 4HFGA 2QYUA 4TXQA 2IQCA 1Z3XA 3TWUA 3Q7FA 5JHAA 3W9GA 3D9MA 2AXVA 3IHVA 2MHKA 1IHGA 3SHFA 4I2WA 1JCRA 1D9SA 3FY4A 2DWZA 3D9KA 3B7TA 3PNLB 3E30A 4U8HA 3I4GA 4O1PA 2VYIA 2YQ8A 2XQ0A 1LTXA 4GA1A 1HG2A 3ZW3A 2PM7A 4KMOA 1H6PA 2R59A 4U04A
chains in the Genus database with same CATH topology
4WWNA 4WWPA 2J4DA 3JQ1A 3K9IA 3CK7A 2E2EA 3FP3A 4HOTA 2VGYA 4IN3B 1W3BA 4B8CB 4UI9K 3FEYA 2X3MA 1HU3A 3RJVA 3WXXA 5C1DA 2X6HA 3FU0A 3PH0C 5FQ7A 4E85A 2A4ZA 4FADA 3L08A 3PS6A 4IULA 1L5JA 4I2ZA 4MS6A 4U07A 5D0QD 4A3TA 1TEZA 1INZA 3HDXA 4RG9A 3FDHA 3QK0A 2AXZA 1SQMA 4FJYA 3PRZA 3UUXA 5EX3A 2XGMA 3Q15A 4D10C 4BTBA 4GZ5A 4I6GA 4FLHA 2WPVA 3CVQA 4ANVA 4B89A 4LERA 2L0TB 1HO8A 2XPZA 3L6AA 5T4YA 1PC2A 3SI5A 3FWVA 4C0MA 3PVLA 4RSYA 1FVHA 3R9AB 4L7TA 4RG6A 2VQ2A 4ACKA 3ASDA 4N2QA 1HE8A 2AVPA 2XGSA 4IYPA 3CVWA 3JQ0A 3MV2B 2WXOA 4F3VA 2NSZA 3QC1A 2X6FA 4J8SA 4HOQA 4O6FA 2ONDA 3SFZA 5HQ8A 2X6KA 4XI9A 1ELKA 3IEGA 4XE0A 3TGOA 2XCCA 1DNPA 3FUMA 2XPYA 4CT0A 4FU3A 1LF8A 4CGWA 5BUZA 2WXIA 3D9OA 3FUNA 3P1UA 2JEKA 4N39A 4CRWA 4EZJA 3JUIA 3B7RL 3CVUA 2GGFA 4HORA 4PH4B 4MKTA 4BFRA 3KAEA 5CMYA 1HXIA 3CGHA 4KYOB 5ENNA 3TG5A 5LX8A 3FUHA 3HYMB 3OXFA 3TAXA 2YHEA 3SBSA 1H6KA 5T8IA 1Y8MA 5EX0A 2AWIA 4EPZA 2AXUA 3AS5A 3B7UX 3SF4A 4ANWA 3FUEA 3LCAA 3CQCB 2LAIA 1JWFA 3ESLA 4APFA 4TUUA 4I6EA 5FJYA 4EZLA 3DPDA 3LS8A 4BT9A 4FA6A 2XGOA 4A3VA 4J8FA 3CK9A 1Z3YA 4HVBA 4N3BA 4LRZA 4NACA 3PUKA 4TV3A 2X38A 3D9LA 4JA9A 3L17A 4AJWA 4AV7A 2X6JA 3IKOB 1KT0A 2FEZA 2FF4A 1NA0A 3ASFA 2WVIA 3EHMA 5FQ6A 3FU3A 4N5CA 3Q49B 3SD5A 4U0ZA 3EJNA 3FTVA 4GMLA 4WUYA 3QWVA 3ZN3A 1E8ZA 2PM6A 3QDNA 2WXMA 1E7VA 1JPLA 2OV8A 3NF1A 3G2TA 3ONLA 5KJNA 2YHCA 3MZLB 4ANUA 3BG1B 2J08A 3MV3B 1JUQA 3AU4A 5AIJA 3QJZA 1HF8A 4NURA 3TXMA 4FJZA 1IQRA 4FHKA 3E4BA 3FHEA 2KM4A 3VTYA 5JJ6A 4GU5A 5LP0A 3I4RB 4ME2A 2V8SE 5FQ8A 2HO1A 5JJ7A 4YVOA 2IU1A 3CKBA 4I6JA 5A6CA 2YINA 1HS6A 3N71A 3FUKA 4F7AA 3FTSA 4ABNA 2KATA 3ZYKA 3ESKA 4JL0A 3BG0B 3FU5A 3ZVVA 3ENEA 1KLXA 3SGHA 4EBAA 4JEUA 4F53A 4ANXA 1N52A 3RK6A 3CHPA 3SNXA 4AOFA 5FWQA 5G55A 3L13A 4DLOA 4UWHA 2EQXA 4GA2A 2XRYA 2WXFA 1H0AA 2HR2A 5CCMA 1OWMA 3HVEA 3HVEB 3MA5A 5FZSA 2LSUA 4DI4A 1OWOA 3CQGB 4Y6CA 3EIJA 3ZHEA 3ZHEB 3CHQA 4AY5A 4CEMA 2WXPA 3CVXA 3MKRA 3L16A 4ILGA 1SZ9A 3CVPA 4FULA 3G2WA 3EHNA 2IFUA 3CVLA 4GA0A 5LOZA 4EZKA 3Q4AB 3SZ7A 2C0MA 2FO7A 3D9NA 3MYVA 3AS4A 4R7LA 3VTXA 4UI9J 3G2VA 4UWFA 5FZRA 4JZYA 3U64A 1PY1A 3G2SA 3QKYA 4K0RA 5AENA 4G26A 3HHMA 4J8EA 4GMJA 3PE3A 4KZCA 3O4ZA 1HFAA 1OWPA 2CHWA 4DLQA 3UMVA 2VTBB 1E7UA 2VTBA 3FULA 4LCTA 2BTDA 3RRUA 5G04J 1PAQA 4RVBA 4HLEA 4JEHA 2YNQA 2J4BA 4V3IA 3LXUX 4PS3A 4CGVA 1Z6TA 5BNWA 5BPPA 1WAO1 5BV0A 1QQEA 3CVNA 1E8XA 2VSXE 2WMOA 4FHJA 4N3CA 3IHYA 5ANLA 3MEKA 1OWLA 3ASHA 2IONA 1Y6IA 2J49A 3QWWA 4GCOA 5AJDA 4CCAA 3U66A 3ML9A 4WAFA 3LPZA 4GYOA 2C2LA 4QFVA 3P2BA 3C98A 3BEEA 2CG3A 3B13A 2Y4UA 3RO3A 1SZAA 4HS2A 3U9WA 4FLBA 4W9RA 2I6HA 4HOUA 5LCWJ 2J09A 2WMNA 3CSTA 5T3RA 4BX8A 3LVQE 3SBTB 4G23A 2I1KA 3CHOA 2VGXA 2VGXB 3ZPJA 2DBAA 3LY8A 3D9PA 4E6HA 2IF4A 1E8YA 4J6IA 4A55A 2XRZA 2VSNA 2L9BA 2WXHA 4WNGA 2WM9A 5FTPA 5KJKA 2I2OA 2V0PA 4J8DA 1TJCA 2I1JA 2Q7FA 2CFZA 3RRMB 5A23A 5FQ4A 3RIBA 2FI7A 2R17C 3ZYMA 3B7SA 1ELRA 4GZ3A 4KVMA 5DBKA 5M72A 2R5SA 4MLPA 2V4LA 5G05C 4L2YA 2QFCA 3CKCA 4KBQA 1HZ4A 2LNIA 3QAQA 4UWGA 4C0EA 3T5XA 5KJLA 2C0LA 3ML8A 2WXGA 3MKQB 3MKQA 2GW1A 3FUDA 4I1OB 3CR3A 2FULA 2HYZA 1MHQA 2WXNA 3R7RA 5LCWC 5KJMA 4URKA 5ARFA 3MGBA 4CDMA 4MRUA 2MOWA 2IOLA 2J9QA 3KS2A 4AP2A 2PQNA 4WNEA 3LVRE 5E75A 4BT8A 1X5BA 2QY7A 3CVVA 4JW1A 1MQSA 4G11A 3FTZA 4AXHA 4DPRA 1UW4B 1NA3A 1B89A 3R7QA 2KC7A 1UJJA 2DCPA 4L2LA 4J0UA 2UY1B 2UY1A 4PS8A 2ILRA 4EECA 3JCKC 3FU6A 4U63A 3CHMA 3GZ1A 3QNKA 1FCHA 4GAAA 4I9CA 2LAHA 1GW6A 2MRIA 3VLDA 1H2UA 2WXLA 4OVUA 2PQRA 3ZFWA 5CCLA 4U0UA 4B0ZA 5A7DB 3FTUA 2LO6A 2RD0A 2IOSA 4AEZC 1ZBPA 4KVOA 4CDRA 2BF0X 4L1BA 2HM8A 3ONKA 4YVQC 4N3AA 4GB9A 4U04A 1H19A 4UI9C 4Y6WA 5AYWD 4GPKA 3LDZA 2XCBA 3PUJA 2XHEA 5D0OD 3UT8A 5JJTA 4HOSA 1XGWA 3MCXA 3CK8A 4OVVA 4B8AA 2CHXA 3S7JA 2L0IA 3KD7A 5EKQD 3CEQA 2WXKA 5G05J 3VLFA 4DJAA 3FTYA 5J08A 3MX3A 1WY6A 3OXGA 3LY9A 4ATGA 3S7BA 4B94A 2WB2A 4AIFA 5C2YA 4C9BB 5HI7A 4EBAG 5AJLA 2AW6A 4G1TA 3EIQC 2KCLA 4A1GA 4PS7A 4GZ6A 4M3OA 4JHKA 3NZSA 1EF1C 4JA7A 1E8WA 4XX5A 3RKVA 5BT1A 4DK5A 4JPSA 4GYYA 3D3MA 1JWGA 3DBSA 1P5QA 1HH8A 2WQHA 3OTNA 3MJWA 2Y4TA 2PZIA 4CT4A 3APCA 1U3CA 4I9EA 4XKCA 3D9IA 4EQFA 2P58C 3T8MA 2NXPA 3TL5A 2VJ8A 3QWPA 2OVFA 3FUJA 3JYSA 3PEUB 3FH5A 1NP7A 5J90A 3UQ3A 4N2SA 2GRMA 5G2NA 2IJGX 2KCKA 4I17A 3QB2A 1EPUA 3KEZA 4BY6A 4XZ4A 2XPIA 1OUVA 3I3NA 2KZTB 2KZTA 4XI0A 4K03A 3FUIA 4KT6B 3ZYLA 1KT1A 2M63A 3Q47B 1EYHA 1E90A 1UN8A 4PDXA 4IRUA 5G04C 1VDYA 3IBEA 3LEWA 4I43A 1IYGA 5CHEE 3CLJA 3QOUA 4JVSA 3S2AA 4L23A 1H2TC 3PDNA 2CFUA 3CIAA 4KZ0A 1QNFA 4ILIA 4BWRA 4FC8A 1YA0A 3EDTB 3VLEA 3CHSA 3S7DA 3GYZA 1UN9A 2A5UA 5BV1A 1U3DA 3L54A 3L22A 3LY7A 2WQ6A 3TJPA 2E0IA 2I9CA 2ZU6B 4Q69A 3CV0A 2GRLA 1XNFA 5ARGA 4JHJA 4NRHB 4UWKA 3GZSA 3UT7A 2J07A 1UJKA 4OYSA 2LSVA 5ANRA 3UT4A 2WXJA 3ZXSA 4FP7A 1QZ2A 3PEVB 4A1SA 3OAWA 3FFLA 3LKUA 3PNTB 5LFAA 1WM5A 4UQXA 3APFA 3LYAA 2OVBA 3G2UA 4JHRA 1HG5A 4JXTA 4DI3A 4H7XA 3FEXA 2WQ7A 3GW4A 4P29A 2Y3AA 4UQZA 3PE4A 2VSYA 3URZA 4TRQA 4UQYA 2XEVA 4KXKB 3ZRHA 2UWJG 5FT9A 2WXRA 3CSFA 2DIWA 3FH7A 3U3WA 3HIZA 3RU0A 3TXNA 4WWOA 2JLBA 4G25A 3ASGA 4G2VA 2X6IA 3PREA 3ZYQA 1DVPA 1ELWA 5EDSA 1EDUA 4G24A 4HFGA 3D9JA 4ILHB 4GZDA 3FUFA 1UG3A 3S7FA 4I1AA 5E76A 4APOA 2CG2A 3IV0A 2IQCA 4LEUA 1Z3XA 3CVYA 3LJ3A 5JHBA 1S0PA 3UX4A 3FTWA 4AM9A 4GZCA 4UWLA 4BTAA 5JHAA 3NQPA 4Q96A 3UPVA 1H2VC 3ZGQA 1ZU2A 3D9MA 4JC8A 2NC9A 3ULQA 2WXQA 3T5VA 1IQUA 2AXVA 3I5PA 3IHVA 1E96B 1A17A 2MHKA 1IHGA 5KCMA 1N54A 4WNDA 4ACLA 3SHFA 4I2WA 4AVXA 5DIZA 3OXLA 3TG4A 4BX9A 1HX8A 4U0SA 3AU5A 4XIFA 2OOEA 3Q5MA 3U4TA 4AY6A 3FY4A 4WNFA 3NZUA 2RG8A 3CHRA 3D9KA 1OWNA 3ZEFA 3APDA 3B7TA 3PNLB 3FTXA 2V5FA 4I1MA 2FBNA 2VSOE 1BPOA 4Q94A 1FVFA 3QARA 3I4GA 4U8HA 3O48A 2VYIA 3AS8A 2YQ8A 5BW8C 4YNDA 3PZDA 5CMWA 2XQ0A 4F1SA 2BUGA 4H7YA 4BSXA 2CHZA 4GCNA 2PL2A 4GA1A 1HG2A 3ZIMA 4HXIA 4PUCA 3RRNB 3ZW3A 2PM7A 3GZ2A 2KCVA 4XKBA 5FZQA 4KMOA 3FH8A 4CDNA 1TJFA 4LUNU 2L6JA 2R59A 4GYWA 3RO2A 4NQ0A 1NZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5S A;  3QOU A;  5G05 C;  3PDN A;  2QFC A;  3CKC A;  3CK7 A;  3K9I A;  4KBQ A;  1HZ4 A;  2E2E A;  2LNI A;  3E4B A;  3FP3 A;  4BWR A;  3VTY A;  5JJ6 A;  5KJL A;  2VGY A;  4HOT A;  1YA0 A;  2C0L A;  1W3B A;  3EDT B;  4IN3 B;  4ME2 A;  2HO1 A;  3GYZ A;  4UI9 K;  3S7D A;  4YVO A;  5JJ7 A;  2GW1 A;  3CKB A;  3RJV A;  3WXX A;  5C1D A;  5A6C A;  3N71 A;  3LY7 A;  2HYZ A;  5LCW C;  5KJM A;  4I2Z A;  4ABN A;  2KAT A;  4GZ3 A;  3ESK A;  4JL0 A;  4U07 A;  5D0Q D;  3CV0 A;  5ARF A;  1KLX A;  1XNF A;  4RG9 A;  5ARG A;  4NRH B;  2LSV A;  2J9Q A;  3KS2 A;  5CHE E;  2PQN A;  4WNE A;  3UUX A;  5EX3 A;  2XGM A;  3Q15 A;  1QZ2 A;  4BT8 A;  4A1S A;  4GZ5 A;  4BTB A;  2WPV A;  3CVQ A;  3FFL A;  3LKU A;  5KJK A;  1NA3 A;  1WM5 A;  1B89 A;  4UQX A;  3LYA A;  2KC7 A;  4JHR A;  4GA2 A;  4H7X A;  1PC2 A;  2UY1 B;  2UY1 A;  3FWV A;  2HR2 A;  3GW4 A;  4J0U A;  4UQZ A;  3PE4 A;  2VSY A;  5CCM A;  5FZS A;  3MA5 A;  3R9A B;  2LSU A;  3URZ A;  3GZ1 A;  4I9C A;  1FCH A;  4RG6 A;  2VQ2 A;  4Y6C A;  3ZHE A;  3ZHE B;  4AY5 A;  4UQY A;  2XEV A;  3ASD A;  4KXK B;  4N2Q A;  2AVP A;  2UWJ G;  2PQR A;  2XGS A;  3MV2 B;  5FT9 A;  3ZFW A;  4F3V A;  5CCL A;  3U3W A;  3MKR A;  4U0U A;  3RU0 A;  5A7D B;  3CVP A;  4O6F A;  4HOQ A;  4GA0 A;  2IFU A;  2OND A;  3CVL A;  5HQ8 A;  4CDR A;  1ZBP A;  2JLB A;  4G25 A;  3ASG A;  3Q4A B;  4G2V A;  4XI9 A;  3SZ7 A;  2C0M A;  3IEG A;  4YVQ C;  2FO7 A;  4N3A A;  2XCC A;  4U04 A;  3AS4 A;  1ELW A;  3TGO A;  4UI9 C;  4Y6W A;  5AYW D;  4G24 A;  3VTX A;  5D0O D;  2XCB A;  4UI9 J;  4CGW A;  5JJT A;  4GPK A;  4HOS A;  3S7F A;  4I1A A;  3CK8 A;  5FZR A;  4APO A;  4LEU A;  3S7J A;  1IYG A;  4N39 A;  3KD7 A;  3QKY A;  3CEQ A;  5EKQ D;  5G05 J;  4G26 A;  4J8E A;  3PE3 A;  4AM9 A;  3OXG A;  3LY9 A;  3S7B A;  4B94 A;  4HOR A;  4BTA A;  3KAE A;  5G04 J;  1HXI A;  4KYO B;  3TG5 A;  4AIF A;  5HI7 A;  3UPV A;  3TAX A;  3HYM B;  1ZU2 A;  3OXF A;  3ULQ A;  2NC9 A;  3ZGQ A;  4G1T A;  4CGV A;  1Y8M A;  1E96 B;  2KCL A;  5EX0 A;  5BNW A;  1A17 A;  2MHK A;  4GZ6 A;  1WAO 1;  1IHG A;  1QQE A;  3AS5 A;  3CVN A;  3SF4 A;  4N3C A;  3LCA A;  4JA7 A;  4WND A;  4I2W A;  3MEK A;  3ASH A;  5DIZ A;  3OXL A;  3RKV A;  3QWW A;  3TG4 A;  4GCO A;  5BT1 A;  5FJY A;  4U0S A;  4GYY A;  4BT9 A;  4XIF A;  2OOE A;  2XGO A;  3LPZ A;  3Q5M A;  4GYO A;  2C2L A;  1P5Q A;  3CK9 A;  4J8F A;  4WNF A;  3U4T A;  4AY6 A;  1HH8 A;  2WQH A;  3BEE A;  4N3B A;  2Y4U A;  3RO3 A;  2Y4T A;  2PZI A;  4I9E A;  4W9R A;  4JA9 A;  2V5F A;  2I6H A;  4HOU A;  5LCW J;  4EQF A;  2P58 C;  2FBN A;  3QWP A;  1KT0 A;  2FEZ A;  3O48 A;  2FF4 A;  2VYI A;  1NA0 A;  2YQ8 A;  3ASF A;  3AS8 A;  3JYS A;  4YND A;  5BW8 C;  3UQ3 A;  4N2S A;  4N5C A;  4G23 A;  3Q49 B;  2VGX A;  2VGX B;  3ZPJ A;  2KCK A;  2DBA A;  3LY8 A;  4I17 A;  4U0Z A;  2XPI A;  2BUG A;  1OUV A;  4H7Y A;  2IF4 A;  4WUY A;  4XI0 A;  3QWV A;  2VSN A;  4GCN A;  2PL2 A;  4GA1 A;  4WNG A;  3ZN3 A;  3QDN A;  5FTP A;  3GZ2 A;  3NF1 A;  5KJN A;  2KCV A;  4J8D A;  5FZQ A;  1KT1 A;  1TJC A;  2YHC A;  2Q7F A;  3Q47 B;  5G04 C;  3MV3 B;  2L6J A;  2FI7 A;  4GYW A;  3RIB A;  3RO2 A;  4NQ0 A;  1ELR A;  5DBK A;  1NZN A;  5M72 A; 
#chains in the Genus database with same CATH topology
 4U96 D;  1TYQ G;  2E2E A;  4B8C B;  3EHQ A;  4UI9 K;  3FEY A;  3RJV A;  3HXC A;  3FU0 A;  1KZO A;  4FAD A;  1L5J A;  1TEZ A;  4A3T A;  3FDH A;  2AXZ A;  3RAU A;  3TWW A;  4RQI A;  5EX3 A;  2EIK E;  4D10 C;  4GZ5 A;  3CVQ A;  1HO8 A;  3FWV A;  3PVL A;  4RSY A;  2VQ2 A;  2XGS A;  3CVW A;  2WXO A;  4J8S A;  3V2O A;  5HQ8 A;  2ETC A;  3NOG D;  1SVX A;  3C3R A;  2V4H C;  2H6I A;  2XPY A;  1FT2 A;  4CGW A;  5AQ7 A;  1Z5S C;  5B1B E;  4PH4 B;  3SBS A;  1H6K A;  5EX0 A;  2AWI A;  5ENO D;  2P9N G;  4EPZ A;  1N4R A;  3SF4 A;  2LAI A;  3PZ4 A;  1JCS A;  3DPD A;  1Z3Y A;  2B0O E;  3L82 A;  2FF4 A;  3SD5 A;  3AG3 E;  1TNY A;  1JPL A;  2GRR B;  2YHC A;  4DUI A;  3JXJ A;  3DXM G;  3SQV A;  3AU4 A;  5AIJ A;  3TXM A;  3FHE A;  3VTY A;  4GU5 A;  3I4R B;  5JJ7 A;  4YVO A;  2IU1 A;  3NAW A;  1OY3 D;  2YIN A;  3N71 A;  1RW2 A;  5AQB A;  3FU5 A;  3ENE A;  3SGH A;  3AJI A;  4EBA A;  4F53 A;  2OEW A;  4ANX A;  3L9T A;  5FWQ A;  4DLO A;  4UWH A;  5KWD A;  2WXF A;  2P9K G;  2HR2 A;  5FZS A;  3MA5 A;  4K5B A;  4DI4 A;  3CQG B;  4AY5 A;  3CVX A;  3MKR A;  5D2M C;  3DPY A;  3G2W A;  4LNG A;  3Q4A B;  3SZ7 A;  3ZXP A;  3D9N A;  3MYV A;  3TWX A;  4UWF A;  5FZR A;  1PY1 A;  4K0R A;  5AEN A;  4J8E A;  4EHM A;  2VTB B;  2BTD A;  5G04 J;  3WG7 E;  4CGV A;  5BPP A;  4RLY A;  4FHJ A;  4N3C A;  1BD8 A;  4LNB A;  3QWW A;  3U66 A;  1O1R A;  3LPZ A;  4QFV A;  3P2B A;  5CEA A;  3B13 A;  3U9W A;  1MX2 A;  4HOU A;  2J09 A;  2WMN A;  4O60 A;  3SBT B;  2VGX B;  3ZPJ A;  3LY8 A;  3D9P A;  1WG0 A;  1E8Y A;  4WNG A;  3SO8 A;  5FTP A;  5KJK A;  2V0P A;  2I1J A;  2CFZ A;  3RRM B;  4DX7 D;  3ZYM A;  2FI7 A;  2R17 C;  4KVM A;  5M72 A;  4MLP A;  1HZ4 A;  3QAQ A;  5KJL A;  4HRM B;  3ML8 A;  3FUD A;  3HXF A;  2FUL A;  1MHQ A;  2WXN A;  5ARF A;  3MGB A;  2ETA A;  2J9Q A;  4AP2 A;  5E75 A;  2QY7 A;  4JW1 A;  1MQS A;  3DXK G;  4DPR A;  2H6F A;  2UY1 A;  1N0R A;  1U2V G;  1GW6 A;  2WXL A;  2XEN A;  4B0Z A;  3FTU A;  2XS8 A;  4DX5 D;  2BF0 X;  2HM8 A;  4UI9 C;  5JJT A;  3CK8 A;  4B8A A;  2L0I A;  3VLF A;  2WXK A;  3FTY A;  3LY9 A;  2B6C A;  3EU9 A;  4EBA G;  5AJL A;  2AW6 A;  3EIQ C;  5CRV A;  2KCL A;  4A1G A;  3BU8 A;  1EF1 C;  2XZT G;  5ENR D;  4XX5 A;  4DK5 A;  4JPS A;  1HH8 A;  2PZI A;  3APC A;  4DRX E;  3HG0 D;  2NXP A;  3QWP A;  2A5E A;  3FH5 A;  3QB2 A;  3KEZ A;  2XPI A;  1OUV A;  3I3N A;  4XI0 A;  4KT6 B;  5EIL A;  5G04 C;  4PDX A;  1UN8 A;  1TNZ A;  2GRQ B;  1IYG A;  4I43 A;  3AAA C;  4O1O A;  4L23 A;  5JMN D;  1H2T C;  4KZ0 A;  4ILI A;  1YA0 A;  1UN9 A;  2A5U A;  5BV1 A;  4BER A;  3LY7 A;  2DVW A;  4M7C A;  2ZU6 B;  4Q69 A;  5ARG A;  4UWK A;  3GZS A;  3UT7 A;  3PEV B;  3SFY A;  4DI3 A;  3FEX A;  3PE4 A;  4TRQ A;  3B7B A;  4KXK B;  2WXR A;  3U3W A;  2R02 A;  3HIZ A;  2PNN A;  1OCR E;  1N95 A;  3HXD A;  5E76 A;  3LJ3 A;  1A5E A;  5JHB A;  1S0P A;  3UX4 A;  4AM9 A;  1OT8 A;  4BTA A;  3UIO C;  4Q96 A;  2NC9 A;  2WXQ A;  3I5P A;  4YDY A;  1A17 A;  5KCM A;  1AWC B;  3V30 A;  4WND A;  4AVX A;  4U0S A;  2Y0B G;  3Q5M A;  3U4T A;  4WNF A;  3CHR A;  3ZEF A;  4I1M A;  1BPO A;  4HQD A;  3AS8 A;  2L6B A;  3PZD A;  5CMW A;  4F1S A;  4BSX A;  2CHZ A;  2PL2 A;  3ZIM A;  4HXI A;  3RRN B;  2KCV A;  2OCC E;  4LUN U;  3RO2 A;  4NQ0 A;  5ENQ D;  4WWN A;  2J4D A;  3K9I A;  1X81 A;  1HU3 A;  5C1D A;  4TUM A;  2X6H A;  5FQ7 A;  4IUL A;  1INZ A;  3HDX A;  1SQM A;  3PRZ A;  2XGM A;  4BTB A;  4I6G A;  2WPV A;  4ANV A;  4B89 A;  2L0T B;  4C0M A;  1FVH A;  2QYJ A;  3R9A B;  4L7T A;  4RG6 A;  2EIJ E;  4N2Q A;  4IYP A;  1IHB A;  5ENS D;  3QC1 A;  2X6F A;  4O6F A;  4HOQ A;  2X6K A;  4XI9 A;  1ELK A;  4XE0 A;  2XCC A;  3FUM A;  4CT0 A;  1LF8 A;  5BUZ A;  2WXI A;  1OCO E;  1LD8 A;  5EIB E;  2XZD G;  4N39 A;  3E33 A;  5CRU A;  3B7R L;  3CVU A;  3NB2 A;  4HOR A;  3KAE A;  5AAO A;  1HXI A;  5LX8 A;  4KYO B;  3TG5 A;  3E34 A;  2YHE A;  2ZXW E;  3TWT A;  3AS5 A;  4APF A;  4I6E A;  3J5P A;  4BT9 A;  2V5Q C;  3DSV A;  2H6G A;  3UM2 A;  1K1A A;  3BUA A;  3IKO B;  1NA0 A;  4HI9 A;  2WVI A;  5FQ6 A;  4N5C A;  4JD2 G;  2F8X K;  3EJN A;  4WUY A;  3C3Q A;  3EU5 A;  3Q7A A;  3NF1 A;  5KJN A;  1MJ0 A;  3MZL B;  4ANU A;  1KZP A;  3QJZ A;  4QQI A;  4FHK A;  2V8S E;  5FQ8 A;  3CKB A;  4GTS A;  1HS6 A;  4XEI G;  3FTS A;  4ABN A;  3ESK A;  4JL0 A;  2QC9 A;  3BG0 B;  3UIP C;  3ZVV A;  1N11 A;  1SA5 A;  4JEU A;  1BLX B;  4J8Y A;  4AOF A;  3L13 A;  2ZGD A;  2XRY A;  5CCM A;  3HVE A;  2ZIR A;  1OWO A;  4Y6C A;  3ZHE B;  3CHQ A;  2WXP A;  4BES A;  4FUL A;  3TWS A;  5LOZ A;  2XEH A;  4EZK A;  2FO7 A;  3AS4 A;  3VTX A;  4U8V D;  4GMJ A;  4L9P A;  1HFA A;  2CHW A;  3UMV A;  1NI1 A;  4LCT A;  3RRU A;  1PAQ A;  5JA4 D;  1SW6 A;  3DSX A;  5BV0 A;  1QQE A;  2VSX E;  3IHY A;  3MEK A;  4GCO A;  3C98 A;  1QBQ A;  4DX2 A;  2I6H A;  1K1B A;  2IEJ A;  5T3R A;  4BX8 A;  4LNU D;  2IF4 A;  4J6I A;  4A55 A;  1O1T A;  4B93 B;  1TJC A;  1N94 A;  5A23 A;  5FQ4 A;  1ELR A;  4GZ3 A;  4KBQ A;  2LNI A;  4UWG A;  4C0E A;  3T5X A;  4F6R D;  3RSE G;  3MKQ A;  1S64 A;  4HNA D;  2HYZ A;  1S70 B;  4N5Q A;  2XS1 A;  4MRU A;  2MOW A;  4K5A B;  2IOL A;  3LVR E;  3V2X A;  1X5B A;  3LJN A;  3E37 A;  1B89 A;  2IY0 C;  2DCP A;  4J0U A;  4PS8 A;  3FU6 A;  3HRA A;  3VLD A;  1H2U A;  2PQR A;  3UKR G;  4U0U A;  5A7D B;  2LO6 A;  3AG1 E;  2IOS A;  4N3A A;  3TWQ A;  5AYW D;  3IXE A;  5D0O D;  3PUJ A;  2XHE A;  3B95 A;  3KD7 A;  5EKQ D;  5G05 J;  5J08 A;  3MX3 A;  3OXG A;  3S7B A;  4AIF A;  1YCS B;  4GTV A;  3NZS A;  4JA7 A;  2P9U G;  4GYY A;  3D3M A;  1JWG A;  3E32 A;  3MJW A;  4K5C A;  1TN8 A;  4CT4 A;  1U3C A;  3D9I A;  2EIM E;  4EQF A;  2P58 C;  2VJ8 A;  3UQ3 A;  2IJG X;  2KCK A;  2KZT A;  1O5M A;  2P2C P;  1TN6 A;  1VDY A;  1TR4 A;  5CHE E;  3CLJ A;  1QNF A;  3Q79 A;  3EDT B;  3VLE A;  3GYZ A;  3L54 A;  2HE0 A;  2E0I A;  2AJA A;  3JXI A;  3AG4 E;  2J07 A;  3ZNG A;  3UT4 A;  1N9A A;  1MYO A;  1Q2Z A;  3LKU A;  1WM5 A;  4UQX A;  4JHR A;  4H7X A;  2EIN E;  2WQ7 A;  3AG2 E;  3NOC D;  4GPM A;  3ZRH A;  2UWJ G;  4MBG A;  2LXL A;  3Q73 A;  2X6I A;  3PRE A;  2LUH A;  3ZYQ A;  2LXM A;  4G24 A;  1IKN D;  4GZD A;  3FUF A;  1UG3 A;  4APO A;  2CG2 A;  4LEU A;  4LG6 A;  4GTO A;  1WDY A;  4JC8 A;  1E96 B;  2F8Y A;  2H6H A;  4GTT A;  5DIZ A;  3TG4 A;  4BX9 A;  3TWV A;  1K8K G;  1OCC E;  4AY6 A;  3NZU A;  2RG8 A;  1OWN A;  4J7W A;  4GMR A;  4G8L A;  2V5F A;  3C72 A;  1TNU A;  1FVF A;  5ITZ F;  3O48 A;  5BW8 C;  4GCN A;  4F1P A;  3GZ2 A;  4XKB A;  3FH8 A;  4HLL A;  1YMP A;  4CDN A;  2L6J A;  4GYW A;  4WWP A;  3JQ1 A;  3DEP A;  2Y69 E;  4HOT A;  1W3B A;  4U8Y D;  3HXB A;  3J5Q B;  2X3M A;  3WXX A;  3PH0 C;  4E85 A;  2A4Z A;  3L08 A;  3PS6 A;  4MS6 A;  5D0Q D;  3DSW A;  1QYM A;  4FJY A;  5IY5 E;  3UUX A;  4DX1 A;  4FLH A;  4LER A;  4YDE A;  2XPZ A;  3L6A A;  5T4Y A;  3SI5 A;  2DYR E;  4X8Q A;  2ZIS A;  4ACK A;  3ASD A;  2AVP A;  2RFA A;  3JQ0 A;  3D9H A;  2P9P G;  3IEG A;  3TGO A;  2MYO A;  3P1U A;  3ZUV B;  1OXJ A;  2GRO B;  3JUI A;  3ISM C;  3ULY A;  4ZFH A;  2GGF A;  2P9I G;  4MKT A;  5CMY A;  3CGH A;  3FUH A;  3TAX A;  3PZ1 A;  2EIL E;  1Y8M A;  5AQ9 A;  2AXU A;  3B7U X;  4ANW A;  5EYP F;  3FUE A;  3LCA A;  1JWF A;  4TUU A;  3LS8 A;  4FA6 A;  3UI2 A;  4HVB A;  4N3B A;  4NAC A;  3PUK A;  4TV3 A;  2X38 A;  3D9L A;  4JA9 A;  1KT0 A;  3ASF A;  3EHM A;  3DWL G;  4U0Z A;  3Q9N C;  3C3O A;  3QWV A;  3ZN3 A;  1E8Z A;  2IO2 C;  3QDN A;  2WXM A;  3UM0 A;  3G2T A;  4CZ2 D;  3BG1 B;  1MX4 A;  1HF8 A;  4FJZ A;  2FO1 E;  5JJ6 A;  3UIN C;  5LP0 A;  4ME2 A;  4GTP A;  5A6C A;  4F7A A;  3ZYK A;  3BQO A;  3RK6 A;  1BU9 A;  4BET A;  3SNX A;  1DCQ A;  1OCZ E;  2EQX A;  2LSU A;  3EIJ A;  3DEO A;  4ILG A;  1SZ9 A;  4GA0 A;  2IFU A;  3CVL A;  2C0M A;  4R7L A;  4UI9 J;  2P9L G;  5EN5 D;  4G26 A;  4KZC A;  2OEV A;  4DLQ A;  2VTB A;  3FUL A;  4HLE A;  4JEH A;  4V3I A;  4PS3 A;  1Z6T A;  1V55 E;  5BNW A;  2F0Y A;  3CVN A;  3ASH A;  4CCA A;  3ML9 A;  1S63 A;  4WAF A;  2C2L A;  3BEE A;  2Y4U A;  2BED A;  4JB8 P;  4HBD A;  1G3N B;  3LVQ E;  4G23 A;  2I1K A;  3CHO A;  2VGX A;  1O1S A;  2DBA A;  3NBN B;  4U7E B;  1BI7 B;  2L9B A;  2WM9 A;  3UM3 A;  2Q7F A;  5BXO A;  3RIB A;  2V4L A;  4L2Y A;  5CEC B;  3CKC A;  4HB5 A;  2C0L A;  3CR3 A;  5KJM A;  1N0Q A;  3KS2 A;  1DC2 A;  2PQN A;  1SA4 A;  4BT8 A;  4G11 A;  4AXH A;  1UW4 B;  2RFM A;  1NA3 A;  4GTR A;  1UJJ A;  4BEP A;  4L2L A;  2UY1 B;  2ILR A;  3JCK C;  1KPS B;  3GZ1 A;  4GAA A;  4I9C A;  2LAH A;  5KNH D;  1D8E A;  4OVU A;  3ZFW A;  3ASO E;  5BXU A;  4CDR A;  4KVO A;  3ONK A;  4GB9 A;  5ENT D;  2XCB A;  4HOS A;  1NL4 A;  1XGW A;  4OVV A;  1UOH A;  2IO3 C;  3S7J A;  4DJA A;  1WY6 A;  5C2Y A;  4C9B B;  4HRL A;  5EYL A;  1RZ4 A;  2R2L A;  4M3O A;  4JHK A;  4LSZ E;  2R05 A;  3C5R A;  3T9K A;  1E8W A;  2ZGG A;  3KEA A;  5BT1 A;  4ATZ D;  3DBS A;  4UUC A;  3HXE A;  2BKG A;  3UTM A;  2OVF A;  3KSL A;  3PEU B;  3JYS A;  4OAU C;  5J90 A;  2DYS E;  4N2S A;  5G2N A;  4BY6 A;  1EPU A;  2BKK B;  4K03 A;  3FUI A;  3ZYL A;  3ABM E;  2M63 A;  3Q47 B;  2DZN A;  3QOU A;  5FIO A;  4JVS A;  3S2A A;  3PDN A;  2CFU A;  3CIA A;  1MX6 A;  4FC8 A;  3L22 A;  3UKU G;  2RKK A;  3TJP A;  3CV0 A;  4NRH B;  3ZXS A;  4A1S A;  3OAW A;  4HRN A;  5LFA A;  3APF A;  3G2U A;  1HG5 A;  2Y3A A;  2XEV A;  3CSF A;  3ABK E;  3FH7 A;  3TXN A;  1JCQ A;  2R03 A;  3DSU A;  5EDS A;  1EDU A;  3D9J A;  5AN8 A;  3S7F A;  4I1A A;  3IV0 A;  3CVY A;  2KXP C;  3FTW A;  4GZC A;  4UWL A;  3NQP A;  3UPV A;  1H2V C;  3ZGQ A;  3T5V A;  1ZU2 A;  3ULQ A;  3DST A;  1IQU A;  2KBX A;  5HRY A;  1N54 A;  4ACL A;  3OXL A;  1HX8 A;  3AU5 A;  4GTQ A;  4XIF A;  2OOE A;  5D66 A;  3APD A;  3FTX A;  2FBN A;  2VSO E;  4Q94 A;  3QAR A;  4YND A;  1YYH A;  2BUG A;  4H7Y A;  4C48 B;  4PUC A;  5FZQ A;  1TJF A;  1NZN A;  3CK7 A;  3FP3 A;  2VGY A;  4IN3 B;  5CER B;  4I2Z A;  4U07 A;  1NFI E;  4RG9 A;  3QK0 A;  4OAV B;  3Q15 A;  3EUV A;  3ABL E;  1N4Q A;  2NYJ A;  5AQA A;  1PC2 A;  1FT1 A;  4NIK A;  1HE8 A;  3MV2 B;  4F3V A;  2XEE A;  2NSZ A;  3SFZ A;  2OND A;  1DNP A;  2VGE A;  4FU3 A;  3D9O A;  1TN7 A;  3FUN A;  2JEK A;  4CRW A;  4EZJ A;  1TNO A;  4BFR A;  5ENN A;  1D8D A;  3HYM B;  3OXF A;  5T8I A;  3CQC B;  3ESL A;  5FJY A;  4EZL A;  5KNG A;  2XGO A;  4A3V A;  4J8F A;  3CK9 A;  2Y1L E;  4LRZ A;  3L17 A;  4AJW A;  4AV7 A;  2X6J A;  2FEZ A;  5EID A;  3FU3 A;  3Q49 B;  3FTV A;  4GML A;  2PM6 A;  1K3Z D;  1E7V A;  2OV8 A;  3ONL A;  2J08 A;  3MV3 B;  2GRP B;  1JUQ A;  4NUR A;  1IQR A;  3E4B A;  2KM4 A;  4ZHB A;  2HO1 A;  3DRA A;  4I6J A;  3UXG A;  2QZA A;  3FUK A;  3ULE G;  2KAT A;  2ETB A;  1KLX A;  3PZ2 A;  1N52 A;  3CHP A;  4TXP A;  5G55 A;  4BSZ B;  4GA2 A;  1H0A A;  1OWM A;  3HVE B;  3ZHE A;  4CEM A;  3Q75 A;  3L16 A;  3CVP A;  3EHN A;  3SFX A;  5B3S E;  3G2V A;  3KSQ A;  4JZY A;  4YDO A;  3U64 A;  3QKY A;  3G2S A;  3HHM A;  3PE3 A;  3O4Z A;  1OWP A;  2F37 A;  1E7U A;  4YDW A;  4RVB A;  2YNQ A;  2J4B A;  1H6O A;  2P9S G;  3LXU X;  1WAO 1;  3T8K A;  1E8X A;  2WMO A;  5ANL A;  1OWL A;  2ION A;  1Y6I A;  2J49 A;  5AJD A;  3F6Q A;  4GYO A;  3ASN E;  2CG3 A;  3RO3 A;  1N4P A;  1SZA A;  4HS2 A;  4FLB A;  4W9R A;  5CED B;  5LCW J;  3V79 K;  3CST A;  3V31 A;  5B1A E;  1MZC A;  4U95 D;  4E6H A;  2XRZ A;  2VSN A;  2WXH A;  2I2O A;  4J8D A;  3Q9U C;  3B7S A;  5DBK A;  2R5S A;  5G05 C;  2J8S D;  2QFC A;  4HI8 A;  2WXG A;  3MKQ B;  2GW1 A;  4I1O B;  3R7R A;  5LCW C;  4URK A;  4Z68 A;  4CDM A;  3TWR A;  3JUE A;  4WNE A;  1FPP A;  3CVV A;  3FTZ A;  1V54 E;  3R7Q A;  2KC7 A;  3W9F A;  4EEC A;  4U63 A;  3CHM A;  3QNK A;  1FCH A;  2MRI A;  5HKP A;  5CCL A;  2RD0 A;  4AEZ C;  1ZBP A;  5KBA A;  1TNB A;  4L1B A;  4YVQ C;  1H19 A;  4Y6W A;  4GPK A;  3LDZ A;  3UT8 A;  3MCX A;  2CHX A;  3CEQ A;  4ATG A;  2WB2 A;  4B94 A;  4CYM D;  4TXR A;  5HI7 A;  4G1T A;  4PS7 A;  3R9M A;  4GZ6 A;  1DCE A;  3ZKJ A;  1N4S A;  4G8K A;  3RKV A;  5HS0 A;  1P5Q A;  2WQH A;  3OTN A;  5H7P A;  2Y4T A;  3UM1 A;  5FIN A;  4I9E A;  4XKC A;  3T8M A;  3TL5 A;  2DZO A;  3SY2 A;  3FUJ A;  1NP7 A;  2GRM A;  1ZB1 A;  1IXV A;  5CBO A;  4I17 A;  4XZ4 A;  2KZT B;  4GTM A;  2GRN B;  1KT1 A;  1EYH A;  1E90 A;  4IRU A;  3EHR A;  3ZU7 B;  3IBE A;  3LEW A;  3X2Q E;  1BI8 B;  4BWR A;  1LD7 A;  3CHS A;  3S7D A;  1U3D A;  2WQ6 A;  5ENP D;  2I9C A;  2GRL A;  1XNF A;  4JHJ A;  4OYS A;  1UJK A;  2JAB A;  2LSV A;  5ANR A;  4DX6 D;  2WXJ A;  4FP7 A;  1QZ2 A;  3FFL A;  3PNT B;  4A63 B;  3PZ3 A;  3LYA A;  2OVB A;  4JXT A;  3GW4 A;  4P29 A;  4UQZ A;  2VSY A;  5AAR A;  3URZ A;  5CBN A;  4UQY A;  5FT9 A;  3Q78 A;  2DIW A;  3RU0 A;  4WWO A;  3DSS A;  1AP7 A;  2JLB A;  4G25 A;  3ASG A;  4G2V A;  1DVP A;  1ELW A;  4ILH B;  4HFG A;  2QYU A;  4TXQ A;  2IQC A;  1Z3X A;  3TWU A;  3Q7F A;  5JHA A;  3W9G A;  3D9M A;  2AXV A;  3IHV A;  2MHK A;  1IHG A;  3SHF A;  4I2W A;  1JCR A;  1D9S A;  3FY4 A;  2DWZ A;  3D9K A;  3B7T A;  3PNL B;  3E30 A;  4U8H A;  3I4G A;  4O1P A;  2VYI A;  2YQ8 A;  2XQ0 A;  1LTX A;  4GA1 A;  1HG2 A;  3ZW3 A;  2PM7 A;  4KMO A;  1H6P A;  2R59 A;  4U04 A; 
#chains in the Genus database with same CATH homology
 4WWN A;  4WWP A;  2J4D A;  3JQ1 A;  3K9I A;  3CK7 A;  2E2E A;  3FP3 A;  4HOT A;  2VGY A;  4IN3 B;  1W3B A;  4B8C B;  4UI9 K;  3FEY A;  2X3M A;  1HU3 A;  3RJV A;  3WXX A;  5C1D A;  2X6H A;  3FU0 A;  3PH0 C;  5FQ7 A;  4E85 A;  2A4Z A;  4FAD A;  3L08 A;  3PS6 A;  4IUL A;  1L5J A;  4I2Z A;  4MS6 A;  4U07 A;  5D0Q D;  4A3T A;  1TEZ A;  1INZ A;  3HDX A;  4RG9 A;  3FDH A;  3QK0 A;  2AXZ A;  1SQM A;  4FJY A;  3PRZ A;  3UUX A;  5EX3 A;  2XGM A;  3Q15 A;  4D10 C;  4BTB A;  4GZ5 A;  4I6G A;  4FLH A;  2WPV A;  3CVQ A;  4ANV A;  4B89 A;  4LER A;  2L0T B;  1HO8 A;  2XPZ A;  3L6A A;  5T4Y A;  1PC2 A;  3SI5 A;  3FWV A;  4C0M A;  3PVL A;  4RSY A;  1FVH A;  3R9A B;  4L7T A;  4RG6 A;  2VQ2 A;  4ACK A;  3ASD A;  4N2Q A;  1HE8 A;  2AVP A;  2XGS A;  4IYP A;  3CVW A;  3JQ0 A;  3MV2 B;  2WXO A;  4F3V A;  2NSZ A;  3QC1 A;  2X6F A;  4J8S A;  4HOQ A;  4O6F A;  2OND A;  3SFZ A;  5HQ8 A;  2X6K A;  4XI9 A;  1ELK A;  3IEG A;  4XE0 A;  3TGO A;  2XCC A;  1DNP A;  3FUM A;  2XPY A;  4CT0 A;  4FU3 A;  1LF8 A;  4CGW A;  5BUZ A;  2WXI A;  3D9O A;  3FUN A;  3P1U A;  2JEK A;  4N39 A;  4CRW A;  4EZJ A;  3JUI A;  3B7R L;  3CVU A;  2GGF A;  4HOR A;  4PH4 B;  4MKT A;  4BFR A;  3KAE A;  5CMY A;  1HXI A;  3CGH A;  4KYO B;  5ENN A;  3TG5 A;  5LX8 A;  3FUH A;  3HYM B;  3OXF A;  3TAX A;  2YHE A;  3SBS A;  1H6K A;  5T8I A;  1Y8M A;  5EX0 A;  2AWI A;  4EPZ A;  2AXU A;  3AS5 A;  3B7U X;  3SF4 A;  4ANW A;  3FUE A;  3LCA A;  3CQC B;  2LAI A;  1JWF A;  3ESL A;  4APF A;  4TUU A;  4I6E A;  5FJY A;  4EZL A;  3DPD A;  3LS8 A;  4BT9 A;  4FA6 A;  2XGO A;  4A3V A;  4J8F A;  3CK9 A;  1Z3Y A;  4HVB A;  4N3B A;  4LRZ A;  4NAC A;  3PUK A;  4TV3 A;  2X38 A;  3D9L A;  4JA9 A;  3L17 A;  4AJW A;  4AV7 A;  2X6J A;  3IKO B;  1KT0 A;  2FEZ A;  2FF4 A;  1NA0 A;  3ASF A;  2WVI A;  3EHM A;  5FQ6 A;  3FU3 A;  4N5C A;  3Q49 B;  3SD5 A;  4U0Z A;  3EJN A;  3FTV A;  4GML A;  4WUY A;  3QWV A;  3ZN3 A;  1E8Z A;  2PM6 A;  3QDN A;  2WXM A;  1E7V A;  1JPL A;  2OV8 A;  3NF1 A;  3G2T A;  3ONL A;  5KJN A;  2YHC A;  3MZL B;  4ANU A;  3BG1 B;  2J08 A;  3MV3 B;  1JUQ A;  3AU4 A;  5AIJ A;  3QJZ A;  1HF8 A;  4NUR A;  3TXM A;  4FJZ A;  1IQR A;  4FHK A;  3E4B A;  3FHE A;  2KM4 A;  3VTY A;  5JJ6 A;  4GU5 A;  5LP0 A;  3I4R B;  4ME2 A;  2V8S E;  5FQ8 A;  2HO1 A;  5JJ7 A;  4YVO A;  2IU1 A;  3CKB A;  4I6J A;  5A6C A;  2YIN A;  1HS6 A;  3N71 A;  3FUK A;  4F7A A;  3FTS A;  4ABN A;  2KAT A;  3ZYK A;  3ESK A;  4JL0 A;  3BG0 B;  3FU5 A;  3ZVV A;  3ENE A;  1KLX A;  3SGH A;  4EBA A;  4JEU A;  4F53 A;  4ANX A;  1N52 A;  3RK6 A;  3CHP A;  3SNX A;  4AOF A;  5FWQ A;  5G55 A;  3L13 A;  4DLO A;  4UWH A;  2EQX A;  4GA2 A;  2XRY A;  2WXF A;  1H0A A;  2HR2 A;  5CCM A;  1OWM A;  3HVE A;  3HVE B;  3MA5 A;  5FZS A;  2LSU A;  4DI4 A;  1OWO A;  3CQG B;  4Y6C A;  3EIJ A;  3ZHE A;  3ZHE B;  3CHQ A;  4AY5 A;  4CEM A;  2WXP A;  3CVX A;  3MKR A;  3L16 A;  4ILG A;  1SZ9 A;  3CVP A;  4FUL A;  3G2W A;  3EHN A;  2IFU A;  3CVL A;  4GA0 A;  5LOZ A;  4EZK A;  3Q4A B;  3SZ7 A;  2C0M A;  2FO7 A;  3D9N A;  3MYV A;  3AS4 A;  4R7L A;  3VTX A;  4UI9 J;  3G2V A;  4UWF A;  5FZR A;  4JZY A;  3U64 A;  1PY1 A;  3G2S A;  3QKY A;  4K0R A;  5AEN A;  4G26 A;  3HHM A;  4J8E A;  4GMJ A;  3PE3 A;  4KZC A;  3O4Z A;  1HFA A;  1OWP A;  2CHW A;  4DLQ A;  3UMV A;  2VTB B;  1E7U A;  2VTB A;  3FUL A;  4LCT A;  2BTD A;  3RRU A;  5G04 J;  1PAQ A;  4RVB A;  4HLE A;  4JEH A;  2YNQ A;  2J4B A;  4V3I A;  3LXU X;  4PS3 A;  4CGV A;  1Z6T A;  5BNW A;  5BPP A;  1WAO 1;  5BV0 A;  1QQE A;  3CVN A;  1E8X A;  2VSX E;  2WMO A;  4FHJ A;  4N3C A;  3IHY A;  5ANL A;  3MEK A;  1OWL A;  3ASH A;  2ION A;  1Y6I A;  2J49 A;  3QWW A;  4GCO A;  5AJD A;  4CCA A;  3U66 A;  3ML9 A;  4WAF A;  3LPZ A;  4GYO A;  2C2L A;  4QFV A;  3P2B A;  3C98 A;  3BEE A;  2CG3 A;  3B13 A;  2Y4U A;  3RO3 A;  1SZA A;  4HS2 A;  3U9W A;  4FLB A;  4W9R A;  2I6H A;  4HOU A;  5LCW J;  2J09 A;  2WMN A;  3CST A;  5T3R A;  4BX8 A;  3LVQ E;  3SBT B;  4G23 A;  2I1K A;  3CHO A;  2VGX A;  2VGX B;  3ZPJ A;  2DBA A;  3LY8 A;  3D9P A;  4E6H A;  2IF4 A;  1E8Y A;  4J6I A;  4A55 A;  2XRZ A;  2VSN A;  2L9B A;  2WXH A;  4WNG A;  2WM9 A;  5FTP A;  5KJK A;  2I2O A;  2V0P A;  4J8D A;  1TJC A;  2I1J A;  2Q7F A;  2CFZ A;  3RRM B;  5A23 A;  5FQ4 A;  3RIB A;  2FI7 A;  2R17 C;  3ZYM A;  3B7S A;  1ELR A;  4GZ3 A;  4KVM A;  5DBK A;  5M72 A;  2R5S A;  4MLP A;  2V4L A;  5G05 C;  4L2Y A;  2QFC A;  3CKC A;  4KBQ A;  1HZ4 A;  2LNI A;  3QAQ A;  4UWG A;  4C0E A;  3T5X A;  5KJL A;  2C0L A;  3ML8 A;  2WXG A;  3MKQ B;  3MKQ A;  2GW1 A;  3FUD A;  4I1O B;  3CR3 A;  2FUL A;  2HYZ A;  1MHQ A;  2WXN A;  3R7R A;  5LCW C;  5KJM A;  4URK A;  5ARF A;  3MGB A;  4CDM A;  4MRU A;  2MOW A;  2IOL A;  2J9Q A;  3KS2 A;  4AP2 A;  2PQN A;  4WNE A;  3LVR E;  5E75 A;  4BT8 A;  1X5B A;  2QY7 A;  3CVV A;  4JW1 A;  1MQS A;  4G11 A;  3FTZ A;  4AXH A;  4DPR A;  1UW4 B;  1NA3 A;  1B89 A;  3R7Q A;  2KC7 A;  1UJJ A;  2DCP A;  4L2L A;  4J0U A;  2UY1 B;  2UY1 A;  4PS8 A;  2ILR A;  4EEC A;  3JCK C;  3FU6 A;  4U63 A;  3CHM A;  3GZ1 A;  3QNK A;  1FCH A;  4GAA A;  4I9C A;  2LAH A;  1GW6 A;  2MRI A;  3VLD A;  1H2U A;  2WXL A;  4OVU A;  2PQR A;  3ZFW A;  5CCL A;  4U0U A;  4B0Z A;  5A7D B;  3FTU A;  2LO6 A;  2RD0 A;  2IOS A;  4AEZ C;  1ZBP A;  4KVO A;  4CDR A;  2BF0 X;  4L1B A;  2HM8 A;  3ONK A;  4YVQ C;  4N3A A;  4GB9 A;  4U04 A;  1H19 A;  4UI9 C;  4Y6W A;  5AYW D;  4GPK A;  3LDZ A;  2XCB A;  3PUJ A;  2XHE A;  5D0O D;  3UT8 A;  5JJT A;  4HOS A;  1XGW A;  3MCX A;  3CK8 A;  4OVV A;  4B8A A;  2CHX A;  3S7J A;  2L0I A;  3KD7 A;  5EKQ D;  3CEQ A;  2WXK A;  5G05 J;  3VLF A;  4DJA A;  3FTY A;  5J08 A;  3MX3 A;  1WY6 A;  3OXG A;  3LY9 A;  4ATG A;  3S7B A;  4B94 A;  2WB2 A;  4AIF A;  5C2Y A;  4C9B B;  5HI7 A;  4EBA G;  5AJL A;  2AW6 A;  4G1T A;  3EIQ C;  2KCL A;  4A1G A;  4PS7 A;  4GZ6 A;  4M3O A;  4JHK A;  3NZS A;  1EF1 C;  4JA7 A;  1E8W A;  4XX5 A;  3RKV A;  5BT1 A;  4DK5 A;  4JPS A;  4GYY A;  3D3M A;  1JWG A;  3DBS A;  1P5Q A;  1HH8 A;  2WQH A;  3OTN A;  3MJW A;  2Y4T A;  2PZI A;  4CT4 A;  3APC A;  1U3C A;  4I9E A;  4XKC A;  3D9I A;  4EQF A;  2P58 C;  3T8M A;  2NXP A;  3TL5 A;  2VJ8 A;  3QWP A;  2OVF A;  3FUJ A;  3JYS A;  3PEU B;  3FH5 A;  1NP7 A;  5J90 A;  3UQ3 A;  4N2S A;  2GRM A;  5G2N A;  2IJG X;  2KCK A;  4I17 A;  3QB2 A;  1EPU A;  3KEZ A;  4BY6 A;  4XZ4 A;  2XPI A;  1OUV A;  3I3N A;  2KZT B;  2KZT A;  4XI0 A;  4K03 A;  3FUI A;  4KT6 B;  3ZYL A;  1KT1 A;  2M63 A;  3Q47 B;  1EYH A;  1E90 A;  1UN8 A;  4PDX A;  4IRU A;  5G04 C;  1VDY A;  3IBE A;  3LEW A;  4I43 A;  1IYG A;  5CHE E;  3CLJ A;  3QOU A;  4JVS A;  3S2A A;  4L23 A;  1H2T C;  3PDN A;  2CFU A;  3CIA A;  4KZ0 A;  1QNF A;  4ILI A;  4BWR A;  4FC8 A;  1YA0 A;  3EDT B;  3VLE A;  3CHS A;  3S7D A;  3GYZ A;  1UN9 A;  2A5U A;  5BV1 A;  1U3D A;  3L54 A;  3L22 A;  3LY7 A;  2WQ6 A;  3TJP A;  2E0I A;  2I9C A;  2ZU6 B;  4Q69 A;  3CV0 A;  2GRL A;  1XNF A;  5ARG A;  4JHJ A;  4NRH B;  4UWK A;  3GZS A;  3UT7 A;  2J07 A;  1UJK A;  4OYS A;  2LSV A;  5ANR A;  3UT4 A;  2WXJ A;  3ZXS A;  4FP7 A;  1QZ2 A;  3PEV B;  4A1S A;  3OAW A;  3FFL A;  3LKU A;  3PNT B;  5LFA A;  1WM5 A;  4UQX A;  3APF A;  3LYA A;  2OVB A;  3G2U A;  4JHR A;  1HG5 A;  4JXT A;  4DI3 A;  4H7X A;  3FEX A;  2WQ7 A;  3GW4 A;  4P29 A;  2Y3A A;  4UQZ A;  3PE4 A;  2VSY A;  3URZ A;  4TRQ A;  4UQY A;  2XEV A;  4KXK B;  3ZRH A;  2UWJ G;  5FT9 A;  2WXR A;  3CSF A;  2DIW A;  3FH7 A;  3U3W A;  3HIZ A;  3RU0 A;  3TXN A;  4WWO A;  2JLB A;  4G25 A;  3ASG A;  4G2V A;  2X6I A;  3PRE A;  3ZYQ A;  1DVP A;  1ELW A;  5EDS A;  1EDU A;  4G24 A;  4HFG A;  3D9J A;  4ILH B;  4GZD A;  3FUF A;  1UG3 A;  3S7F A;  4I1A A;  5E76 A;  4APO A;  2CG2 A;  3IV0 A;  2IQC A;  4LEU A;  1Z3X A;  3CVY A;  3LJ3 A;  5JHB A;  1S0P A;  3UX4 A;  3FTW A;  4AM9 A;  4GZC A;  4UWL A;  4BTA A;  5JHA A;  3NQP A;  4Q96 A;  3UPV A;  1H2V C;  3ZGQ A;  1ZU2 A;  3D9M A;  4JC8 A;  2NC9 A;  3ULQ A;  2WXQ A;  3T5V A;  1IQU A;  2AXV A;  3I5P A;  3IHV A;  1E96 B;  1A17 A;  2MHK A;  1IHG A;  5KCM A;  1N54 A;  4WND A;  4ACL A;  3SHF A;  4I2W A;  4AVX A;  5DIZ A;  3OXL A;  3TG4 A;  4BX9 A;  1HX8 A;  4U0S A;  3AU5 A;  4XIF A;  2OOE A;  3Q5M A;  3U4T A;  4AY6 A;  3FY4 A;  4WNF A;  3NZU A;  2RG8 A;  3CHR A;  3D9K A;  1OWN A;  3ZEF A;  3APD A;  3B7T A;  3PNL B;  3FTX A;  2V5F A;  4I1M A;  2FBN A;  2VSO E;  1BPO A;  4Q94 A;  1FVF A;  3QAR A;  3I4G A;  4U8H A;  3O48 A;  2VYI A;  3AS8 A;  2YQ8 A;  5BW8 C;  4YND A;  3PZD A;  5CMW A;  2XQ0 A;  4F1S A;  2BUG A;  4H7Y A;  4BSX A;  2CHZ A;  4GCN A;  2PL2 A;  4GA1 A;  1HG2 A;  3ZIM A;  4HXI A;  4PUC A;  3RRN B;  3ZW3 A;  2PM7 A;  3GZ2 A;  2KCV A;  4XKB A;  5FZQ A;  4KMO A;  3FH8 A;  4CDN A;  1TJF A;  4LUN U;  2L6J A;  2R59 A;  4GYW A;  3RO2 A;  4NQ0 A;  1NZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...