1JPLA

Gga3 vhs domain complexed with c-terminal peptide from cation-independent mannose 6-phosphate receptor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
161
structure length
161
Chain Sequence
AMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
publication title Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 55
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1jplA00
4JXTA 1HF8A 2LO6A 4GZCA 1UJJA 1MHQA 4FU3A 2V8SE 1JUQA 5LOZA 1HG5A 1SZ9A 2DCPA 1HFAA 1PY1A 2L0IA 3D9LA 4GZDA 3RRUA 3D9MA 3ZYKA 3D9OA 3D9NA 3ONLA 2BF0X 5J08A 4AVXA 1HX8A 3G2VA 3D9KA 1HG2A 3LDZA 1VDYA 1UJKA 3ZYMA 5CMYA 3G2WA 1H0AA 2KM4A 3D9JA 2QY7A 3ZYQA 4Q94A 1JWFA 3CLJA 1EYHA 1DVPA 4NACA 5CMWA 4Q96A 3D9IA 1INZA 1ELKA 3G2UA 2MOWA 1LF8A 5LP0A 2DIWA 1JWGA 1SZAA 1X5BA 3G2SA 1XGWA 3ONKA 3ZYLA 4HFGA 3G2TA 3D9PA 2L0TB 1JPLA 1EDUA 4FLBA
chains in the Genus database with same CATH superfamily
1TNZA 4JA9A 3O4ZA 4GZ6A 3UT8A 3TWXA 3VLEA 4KVMA 1TNUA 3CQGB 1UJKA 1H0AA 5FTPA 4AV7A 2KZTA 3ASGA 1WM5A 4K5CA 5EX3A 1BI7B 2X6KA 4XX5A 4HRLA 4G8LA 1IQUA 5ENQD 4GZCA 3S7FA 4AOFA 5AAOA 3NB2A 2I6HA 3ZYKA 1HO8A 2UWJG 4A1SA 5CECB 3PDNA 2GGFA 2LXLA 4HQDA 1U3CA 5CCMA 4XZ4A 2F8YA 3TWVA 3RO2A 2FULA 1NA3A 3TJPA 2WXMA 3CHRA 3ONLA 5FZSA 4GZ3A 4I17A 2WXIA 4PUCA 4XKCA 4LG6A 3JXJA 3LYAA 3JUEA 4HVBA 3CR3A 4I1OB 2Y69E 2LO6A 2V4LA 3Q9NC 2A5EA 1WY6A 5FJYA 3AS5A 5B1BE 3RSEG 2XEVA 3QB2A 3Q47B 3DXKG 3TWSA 3S7JA 3JUIA 2XPIA 4N39A 3L82A 3DBSA 5FZQA 2CHXA 3DWLG 3U66A 1H6PA 2LSUA 3ABME 5KJMA 2OOEA 3D9HA 3G2VA 4PS8A 3UXGA 1OT8A 1EYHA 5HS0A 3NBNB 1RZ4A 1X81A 3I4RB 3D3MA 4GCNA 3MV2B 3FTWA 4N5QA 4FLHA 3FDHA 4M3OA 4JHJA 4BSXA 4GA0A 4BESA 2C0MA 4K5BA 5DBKA 4U63A 3CKBA 1Z6TA 2J4BA 4U07A 2AVPA 4HFGA 2WQ6A 4N2QA 1E96B 3E32A 3EDTB 4XI0A 4IRUA 3TXNA 4JL0A 4CRWA 4JPSA 3BQOA 1ELRA 5G05J 2YHEA 1KZOA 3FH5A 3UPVA 2R03A 4FU3A 5ENPD 3CSTA 1N54A 2IOLA 2Y0BG 2IO3C 5J08A 4AVXA 3FY4A 3OAWA 5FINA 3ML9A 2J09A 4YDYA 1PAQA 2Q7FA 3D9IA 4HI9A 5EYLA 4HLLA 2WXFA 3QK0A 1MHQA 4HOTA 3MEKA 3ZFWA 2AWIA 3L16A 3DSTA 1YA0A 4GYWA 4TRQA 1Z5SC 3V2OA 3U4TA 3G2UA 3SY2A 3FEXA 3OXGA 3UM3A 1HE8A 4BSZB 3ABKE 4XI9A 1S63A 2IEJA 4CGWA 3JYSA 4A63B 2I1JA 5AJLA 2RG8A 1B89A 5HQ8A 5E76A 3ZYLA 3ML8A 2L0TB 1D9SA 1H6KA 4WWNA 1AWCB 2OV8A 3MCXA 3IXEA 4DX2A 2DCPA 2L0IA 2NXPA 4U04A 1EF1C 3PREA 4JB8P 1VDYA 2CG2A 2KC7A 3APDA 3DPYA 4J8SA 3B7RL 2H6GA 3UQ3A 4W9RA 3QWWA 3E34A 4UWGA 1QQEA 1YCSB 2X6IA 5M72A 4GTMA 3V2XA 2DYSE 5BUZA 3ASFA 5LCWJ 5CHEE 3CVQA 2C0LA 4EZKA 1Z3XA 3T8MA 4YVOA 3AG4E 1BLXB 3CGHA 5B3SE 3NZSA 2ZIRA 3SZ7A 3I5PA 2HR2A 2ETBA 5AYWD 4F6RD 5CEDB 3CVLA 4X8QA 1MX4A 1OCRE 2H6IA 3FUJA 4WUYA 2V5FA 2IQCA 2WXRA 2VSNA 3ULYA 5ANLA 3DEPA 3Q7FA 5JMND 4L2LA 3KS2A 3KAEA 4AXHA 2KXPC 4LCTA 1BPOA 3IKOB 5C2YA 2DZOA 1JWFA 5AQ7A 1INZA 3JCKC 4ACKA 4CEMA 1E7VA 4CDMA 3FUDA 3C5RA 4LRZA 2WXNA 2AXUA 3SGHA 4QQIA 3UUXA 2XZDG 1OWPA 1DCEA 2R05A 4F53A 3EU5A 4ATZD 4O1OA 3ZNGA 5A23A 5ITZF 2VGXB 3QDNA 5BT1A 2E2EA 4OVUA 2P2CP 1AP7A 4AEZC 4BETA 4J8YA 2GROB 1SZAA 4XIFA 4UI9C 3E30A 3TL5A 4HNAD 4L23A 1E90A 2DYRE 4FULA 3QWVA 3SFXA 2WXGA 2BF0X 5BPPA 2AJAA 3TAXA 5A6CA 4P29A 5BV0A 1BU9A 3AG1E 1DVPA 4NACA 3EIJA 2KBXA 1IKND 2R17C 1OY3D 5G55A 2X38A 1UG3A 3AU4A 4GZDA 4F1SA 2VSYA 3CQCB 1P5QA 4TV3A 2R59A 2X6JA 4KVOA 4QFVA 1ZB1A 2WMOA 4HOUA 4UQXA 4IYPA 1QBQA 1KZPA 5LX8A 2P9KG 2VGXA 2FO1E 2LAIA 3DSVA 3RRUA 4U8VD 3HXFA 3KSQA 3FTUA 5FT9A 4OAUC 2IU1A 4Q94A 4UWHA 2L6JA 3EUVA 3LS8A 4GYOA 4BFRA 4NURA 1O1TA 3BG0B 5EIBE 2LAHA 4GMRA 4KXKB 4DX6D 4DX7D 3Q9UC 4C9BB 2IONA 1K1AA 5HKPA 4LNGA 5HI7A 1N95A 4JEHA 3ZN3A 4Z68A 2J08A 4WWPA 1LF8A 4G23A 5FQ4A 5JHBA 2NSZA 4FJYA 4CDNA 1KPSB 2ZGGA 2GRNB 3HRAA 4JD2G 5CRVA 4Y6WA 2WQ7A 3Q79A 1LD7A 4N3CA 3FP3A 5CRUA 3URZA 5KCMA 5CMWA 3TWQA 4M7CA 1JCQA 5CERB 2LNIA 4ILGA 1BD8A 4EQFA 3ASOE 3ZXPA 2XEHA 4E6HA 1LTXA 3PZDA 3MJWA 4U0ZA 3HIZA 3C98A 1RW2A 2JABA 3PZ1A 4Q69A 1PC2A 4K5AB 2FBNA 4F3VA 2ETCA 5CBOA 3ZPJA 4DI4A 1JCRA 3CVVA 2PNNA 4U95D 3UINC 3RKVA 3RJVA 3P2BA 3U3WA 4JHKA 4G1TA 3T5XA 2VTBB 4WNEA 3DRAA 4BT8A 2P9IG 2WXQA 2PZIA 4LNUD 4J7WA 2GRLA 3ZKJA 5BXUA 3UM1A 1TNBA 3UI2A 2KATA 3FHEA 3L54A 4A3TA 2X6FA 2YNQA 5KBAA 4U7EB 1H2VC 1XNFA 2ZU6B 5AN8A 4BERA 5D0QD 3TWRA 4JHRA 4ME2A 1TNOA 4ANWA 3SHFA 4FHKA 4FLBA 3FFLA 3T9KA 2R5SA 5G2NA 3LJNA 4ANVA 1N11A 1HXIA 2V4HC 1DC2A 3FU6A 5T8IA 4AY5A 2EILE 3Q75A 2DZNA 2XGMA 4AP2A 3NAWA 3DSUA 1TEZA 4ILIA 4N3AA 1QYMA 5FQ7A 1OCOE 4JC8A 3D9KA 4HS2A 4G2VA 2VTBA 4K03A 3FTSA 3FUEA 4DRXE 2IF4A 4FA6A 3CEQA 3RAUA 3APCA 1O5MA 4HB5A 4BY6A 4GTQA 4E85A 4RQIA 3EU9A 2DWZA 3O48A 3Q15A 3ZRHA 4HORA 3ABLE 5EDSA 2E0IA 1UW4B 2B6CA 3ASDA 1E7UA 3SBSA 3ZYQA 2ETAA 1MYOA 4PDXA 3TWTA 1OXJA 3ESLA 2BKKB 2XRYA 4F7AA 1SA5A 4MKTA 4BTAA 3ESKA 3UM0A 4GTTA 1MZCA 3B7UX 2GRPB 2H6FA 3HYMB 4APOA 3FU3A 2UY1B 3LY8A 3C3RA 3HDXA 1IQRA 1WAO1 4UWLA 3L13A 1SQMA 3AU5A 4WNDA 3CKCA 2LSVA 1BI8B 4RSYA 4JW1A 4G8KA 3TGOA 5J90A 3AG2E 2HM8A 1TR4A 2CHWA 3D9JA 3CK7A 2FF4A 2XGOA 3Q73A 1IHGA 4K0RA 5JJ6A 5EKQD 2YINA 1FT2A 5D66A 1FVFA 1OWMA 4YDOA 3EHMA 4H7XA 3UM2A 1FVHA 2XRZA 5D0OD 3D9NA 4U8HA 4GTVA 5IY5E 3FWVA 2J4DA 2GRRB 4I6JA 3CVWA 3FUMA 3R7RA 3AS8A 1E8WA 3IHVA 2AXZA 1O1SA 3L6AA 2P9NG 3JXIA 5HRYA 4NRHB 4AJWA 4I9CA 1N9AA 5KJLA 1H2UA 1KT0A 4I43A 2KCKA 4TXRA 2BUGA 1UOHA 1H2TC 3UIOC 4B94A 4G11A 5ENSD 1NFIE 4C0MA 4TXPA 3FUIA 2GRMA 1HH8A 1NA0A 5FZRA 3DXMG 4MBGA 3C3QA 2FI7A 3SI5A 1JWGA 2P9UG 4L7TA 4DJAA 1N0QA 4GYYA 3L17A 1SZ9A 3CHOA 2NYJA 3HXBA 3UIPC 3PE3A 2PL2A 4MRUA 4NIKA 2DBAA 3PRZA 2C2LA 4UI9K 2A4ZA 1Q2ZA 4U0SA 3QC1A 5AQBA 1IXVA 3ASNE 4V3IA 1ZU2A 1IYGA 4JXTA 1OUVA 1OWNA 3ZU7B 2XCCA 2XPYA 2WXLA 4BT9A 3CHSA 4C48B 1EPUA 3AS4A 1HX8A 1OCCE 4UQYA 5A7DB 2RFAA 4KT6B 3QJZA 1DCQA 3CLJA 1D8DA 3CSFA 5FQ6A 3C3OA 4A3VA 1YYHA 2OCCE 4G24A 2VSOE 4PS7A 1SA4A 5CBNA 4ZFHA 3KEAA 5EYPF 3U9WA 3FTZA 3VLDA 2CHZA 4ANUA 2XPZA 3V79K 2X3MA 4LSZE 5CMYA 2V5QC 2MRIA 3L22A 3GZSA 4XEIG 4YVQC 3PEUB 4ABNA 3HVEB 2R02A 3L08A 2XS8A 3FTVA 1JPLA 2XZTG 1D8EA 1L5JA 1SVXA 2Y4TA 4CT0A 3R7QA 4BWRA 3HG0D 4WAFA 3LJ3A 3F6QA 1UN9A 5C1DA 3B13A 2YHCA 2P9SG 4RVBA 1GW6A 3FUFA 3BUAA 4EBAA 1Z3YA 1V55E 5CEAA 4I6EA 3N71A 4WNGA 5D2MC 4I6GA 4WNFA 2KCVA 1Y6IA 1HG2A 4IULA 3LXUX 5EIDA 3EJNA 4FP7A 3SO8A 3LY9A 1TYQG 4G26A 3RU0A 3B7TA 3K9IA 3BEEA 4BX8A 4EECA 4UWFA 3NF1A 2BEDA 5T3RA 3B7SA 4CZ2D 1ZBPA 2MYOA 3UT7A 3FUNA 1HF8A 3AAAC 5AQ9A 2QFCA 4I2ZA 3UKRG 5EILA 3TG4A 3MYVA 1WG0A 3CVNA 3E4BA 3LDZA 5KNHD 3FUHA 3CVXA 4RG9A 3R9MA 4N3BA 4HI8A 2X6HA 4ANXA 3IV0A 5JJ7A 2FO7A 4UQZA 4XKBA 3MX3A 4DX5D 4GTPA 1N4QA 1NP7A 3MGBA 1A17A 5ARGA 3CK9A 2BKGA 5ENOD 2XCBA 4HBDA 2J9QA 4CCAA 3G2WA 1NZNA 2MHKA 1NL4A 5AIJA 4OAVB 4J6IA 4KZ0A 3PUJA 5BW8C 4J0UA 3FUKA 4TXQA 4GA2A 3BU8A 3DSWA 4TUMA 1N4RA 3HXCA 3DEOA 2LUHA 3UKUG 3EHQA 3ZIMA 4A1GA 3ZVVA 4N5CA 2WB2A 3AG3E 5LP0A 2HO1A 3X2QE 4O60A 5DIZA 3CHMA 3QNKA 4UI9J 4APFA 3FH8A 2XENA 1JCSA 2QYJA 4GTSA 5FIOA 1HS6A 2XS1A 3DSSA 2IO2C 4PH4B 2L6BA 4GZ5A 3WG7E 2L9BA 4MS6A 4O1PA 3ZGQA 1HZ4A 3HXEA 2R2LA 3SFYA 1X5BA 1Y8MA 2Y1LE 2VQ2A 3OXLA 5KWDA 1W3BA 2EIME 4ATGA 2JLBA 1UN8A 2DIWA 1DNPA 3ONKA 5BV1A 3VTXA 2NC9A 4PS3A 4B89A 1MJ0A 5CCLA 2F8XK 3ZHEB 2B0OE 3FH7A 3NOCD 4YNDA 3SD5A 2ZXWE 2ILRA 3UMVA 4TUUA 1ELKA 2MOWA 4JZYA 3V31A 2ONDA 3JQ0A 2A5UA 4U0UA 3EHNA 3ENEA 1UJJA 2RKKA 2WPVA 1V54E 4I9EA 3ZXSA 4B8CB 5ANRA 2HYZA 2HE0A 3Q5MA 4DLOA 3PNLB 4GPKA 3W9FA 5EX0A 2WVIA 3KD7A 3B7BA 3GW4A 4J8EA 4I2WA 1TJCA 4HRNA 4CDRA 2CFZA 3MZLB 1ELWA 3PNTB 5H7PA 1OWLA 2KM4A 5JJTA 2EQXA 5G05C 3QKYA 4FADA 2ZGDA 4KYOB 3C72A 3ZHEA 2I2OA 4OVVA 5ENNA 2F37A 3TXMA 3TG5A 4ILHB 4CT4A 1K8KG 1WDYA 3U64A 3ZYMA 1U3DA 2QY7A 3LKUA 3V30A 2LXMA 4KMOA 1MQSA 2AW6A 3MA5A 4C0EA 1N4PA 1N4SA 3FTXA 4L9PA 5JA4D 3RIBA 3B95A 2WM9A 3J5PA 3S2AA 2AXVA 4EPZA 4F1PA 4XE0A 2V0PA 3FU5A 3Q7AA 5ENRD 4YDEA 3GYZA 3SBTB 3WXXA 2J07A 5BNWA 2CG3A 4O6FA 3LEWA 4H7YA 2RD0A 4GMJA 4DUIA 1FT1A 2CFUA 1H6OA 4GCOA 2YQ8A 1JUQA 3JQ1A 5E75A 1S64A 3BG1B 1U2VG 3CHQA 5T4YA 3RRMB 2VGYA 2J8SD 3Q49B 4FJZA 3EIQC 5BXOA 3PZ3A 4KZCA 3TWWA 5LCWC 1S70B 4G25A 5JHAA 3IHYA 3SNXA 2WQHA 4GTOA 2XQ0A 3CV0A 4FHJA 5FWQA 3FU0A 5G04C 1FCHA 1XGWA 4EBAG 5FQ8A 4LUNU 3PH0C 1PY1A 4J8FA 3D9OA 2M63A 3UT4A 4DPRA 4LNBA 2UY1A 3P1UA 3LY7A 3QWPA 4DX1A 4DK5A 3GZ1A 1KLXA 1TN6A 3AJIA 3PEVB 2QZAA 3IEGA 4B93B 4UUCA 3HXDA 3PE4A 2WXJA 4EHMA 5LOZA 5AJDA 3ULQA 4EZLA 4IN3B 4BX9A 3QAQA 3PUKA 1N52A 5ENTD 1FPPA 2KCLA 3DSXA 2IY0C 3PZ2A 3RO3A 3G2TA 1TNYA 5LFAA 3FTYA 3RRNB 2OVBA 2RFMA 4DLQA 3KSLA 2WXPA 1A5EA 4KBQA 3CVPA 4GAAA 3LVQE 3SQVA 2I1KA 3OTNA 2PQRA 2GW1A 4BTBA 1G3NB 2QYUA 4HOQA 3D9MA 2VSXE 2I9CA 2JEKA 3PVLA 4R7LA 3Q4AB 4ACLA 4GU5A 1IHBA 3MKQB 4J8DA 5G04J 5ARFA 4BEPA 4RG6A 4L1BA 3J5QB 3FEYA 4JVSA 4GA1A 4L2YA 3CHPA 4I1MA 1MX6A 4LERA 3CVYA 2P9LG 5EN5D 2XEEA 4GPMA 2XGSA 4CGVA 5AQAA 2IJGX 3E37A 1O1RA 3QARA 3HHMA 3QOUA 2VJ8A 2VGEA 1QNFA 3TWUA 2OVFA 4I1AA 3I4GA 2Y3AA 4Y6CA 1E8YA 1SW6A 3SFZA 1E8ZA 1N0RA 1NI1A 4D10C 3PS6A 3S7DA 5AARA 3NOGD 2EINE 3NQPA 3MKQA 4Q96A 4N2SA 3SF4A 4FC8A 3W9GA 2J49A 3ISMC 4RLYA 4ZHBA 2WXKA 1YMPA 3MKRA 4HRMB 4A55A 3LPZA 4NQ0A 3T8KA 1TN7A 1K3ZD 3ULEG 3E33A 4B0ZA 1KT1A 3APFA 2QC9A 4MLPA 3HVEA 3S7BA 2DVWA 3RK6A 2EIKE 4JA7A 3FULA 2EIJE 1OCZE 4HXIA 3GZ2A 4AY6A 2WMNA 4HOSA 3CIAA 1OWOA 5B1AE 2WXOA 3ZW3A 3UTMA 3G2SA 3VLFA 3NZUA 5AENA 1EDUA 4HLEA 2XHEA 1HFAA 5KJKA 3D9LA 4JEUA 2GRQB 1S0PA 1TJFA 3LVRE 2Y4UA 2IFUA 3CVUA 3IBEA 1N94A 2PM7A 1TN8A 3D9PA 1K1BA 5KJNA 4U96D 2ZISA 4CYMD 4GMLA 2V8SE 1HG5A 1LD8A 1MX2A 3CK8A 2OEVA 3UX4A 3ASHA 4OYSA 2VYIA 2PM6A 2H6HA 4UWKA 4AIFA 1E8XA 2BTDA 3R9AB 2KZTB 2IOSA 3PZ4A 3I3NA 3MV3B 2OEWA 2P9PG 3Q78A 5KNGA 3L9TA 4LEUA 2PQNA 2WXHA 4WWOA 1H19A 3EHRA 3KEZA 3ZUVB 3DPDA 4GTRA 2P58C 4AM9A 4GB9A 4URKA 4U8YD 3ZEFA 4EZJA 4DI3A 2F0YA 1QZ2A 3T5VA 3OXFA 4YDWA 2FEZA 4B8AA 3LCAA 1HU3A 3VTYA
chains in the Genus database with same CATH topology
4DJAA 4JA9A 4L23A 4GYYA 1E90A 3GYZA 3L17A 1SZ9A 3O4ZA 3QWVA 4FULA 4GZ6A 3CHOA 3UT8A 3SBTB 3VLEA 4KVMA 3WXXA 2J07A 5BNWA 2WXGA 2BF0X 5BPPA 3CQGB 3PE3A 3TAXA 2CG3A 4P29A 5BV0A 5A6CA 1UJKA 1H0AA 2PL2A 4MRUA 4O6FA 5FTPA 4AV7A 2DBAA 3LEWA 3PRZA 2KZTA 3ASGA 1DVPA 1WM5A 4H7YA 4NACA 2C2LA 2RD0A 4GMJA 3EIJA 5EX3A 4UI9K 2A4ZA 4U0SA 3QC1A 2CFUA 2X6KA 4XX5A 4V3IA 1ZU2A 1IYGA 2R17C 1IQUA 4JXTA 1OUVA 4GZCA 5G55A 2X38A 1OWNA 4GCOA 2XCCA 2YQ8A 3S7FA 1UG3A 1JUQA 3JQ1A 4AOFA 2XPYA 3AU4A 5E75A 2WXLA 4BT9A 4GZDA 2I6HA 3CHSA 2VSYA 3ZYKA 3CQCB 1P5QA 4F1SA 3BG1B 1EPUA 4TV3A 3AS4A 1HX8A 1HO8A 4UQYA 5A7DB 2R59A 2UWJG 4KT6B 4A1SA 3QJZA 3CHQA 5T4YA 2X6JA 4KVOA 4QFVA 3RRMB 2WMOA 4HOUA 4UQXA 2VGYA 3PDNA 4IYPA 3CLJA 2GGFA 5LX8A 3CSFA 5FQ6A 4A3VA 3Q49B 1U3CA 4FJZA 5CCMA 3EIQC 4XZ4A 2VGXA 4KZCA 4G24A 2VSOE 4PS7A 2LAIA 5LCWC 3RO2A 4G25A 5JHAA 2FULA 3IHYA 1NA3A 3SNXA 3TJPA 2WXMA 3CHRA 3U9WA 3RRUA 2WQHA 3FTZA 3VLDA 3ONLA 5FZSA 4GZ3A 2CHZA 2WXIA 4I17A 4PUCA 4XKCA 4ANUA 2XPZA 2X3MA 2XQ0A 5CMYA 3FTUA 3LYAA 3CV0A 5FT9A 2IU1A 4Q94A 4UWHA 2MRIA 3L22A 2L6JA 3GZSA 4FHJA 5FWQA 4HVBA 3FU0A 3LS8A 5G04C 1FCHA 3CR3A 1XGWA 4GYOA 4YVQC 4BFRA 4NURA 3PEUB 4ABNA 3HVEB 4EBAG 5FQ8A 3L08A 3FTVA 3BG0B 1JPLA 4I1OB 2LO6A 2LAHA 4KXKB 2V4LA 4LUNU 3PH0C 1WY6A 1L5JA 3AS5A 1PY1A 5FJYA 4C9BB 2IONA 2XEVA 4J8FA 3D9OA 3QB2A 3Q47B 2M63A 3UT4A 2Y4TA 4CT0A 3R7QA 4DPRA 2UY1A 5HI7A 4BWRA 3P1UA 4WAFA 3LJ3A 3S7JA 3LY7A 3JUIA 1UN9A 2XPIA 4JEHA 4N39A 5C1DA 3QWPA 3ZN3A 4DK5A 2J08A 3GZ1A 4WWPA 3B13A 2YHCA 1KLXA 3DBSA 1LF8A 5FZQA 3PEVB 2CHXA 4G23A 4RVBA 5FQ4A 5JHBA 2NSZA 4FJYA 4CDNA 3IEGA 1GW6A 3FUFA 4EBAA 3U66A 1Z3YA 4Y6WA 2WQ7A 3PE4A 2LSUA 2WXJA 5LOZA 4I6EA 3N71A 4WNGA 4I6GA 5AJDA 3ULQA 5KJMA 4EZLA 4IN3B 2OOEA 4WNFA 2KCVA 4BX9A 3G2VA 1Y6IA 4N3CA 4PS8A 1HG2A 3FP3A 4IULA 3QAQA 3PUKA 3LXUX 1N52A 3URZA 5KCMA 5CMWA 1EYHA 3EJNA 2KCLA 4FP7A 2LNIA 4ILGA 3LY9A 3RO3A 4EQFA 3I4RB 3D3MA 4GCNA 3MV2B 3FTWA 3G2TA 4G26A 4E6HA 3RU0A 3B7TA 3K9IA 3BEEA 3MJWA 3PZDA 4BX8A 4EECA 3FTYA 4FLHA 5LFAA 4UWFA 3RRNB 4U0ZA 3FDHA 2OVBA 3NF1A 3HIZA 4M3OA 3C98A 4DLQA 2WXPA 5T3RA 4JHJA 4BSXA 4Q69A 4GA0A 4KBQA 1PC2A 3B7SA 3CVPA 4GAAA 2C0MA 3LVQE 2FBNA 4F3VA 5DBKA 4U63A 1ZBPA 3CKBA 3ZPJA 2I1KA 1Z6TA 2J4BA 2PQRA 3OTNA 4U07A 3UT7A 4DI4A 2AVPA 3FUNA 2GW1A 4HFGA 4BTBA 3CVVA 1HF8A 2WQ6A 2QFCA 4I2ZA 4N2QA 4HOQA 3D9MA 1E96B 3TG4A 3MYVA 3EDTB 2VSXE 3CVNA 3E4BA 3LDZA 4XI0A 4IRUA 3RJVA 2I9CA 3RKVA 3TXNA 2JEKA 3FUHA 3CVXA 3P2BA 3PVLA 4JL0A 3U3WA 4RG9A 4JHKA 3Q4AB 4R7LA 4CRWA 4G1TA 3T5XA 2VTBB 4JPSA 4WNEA 4BT8A 4GU5A 4N3BA 4ACLA 2WXQA 1ELRA 3MKQB 2PZIA 4J8DA 5G05J 2X6HA 4ANXA 2GRLA 3IV0A 2YHEA 5JJ7A 5G04J 2FO7A 4UQZA 4XKBA 5ARFA 3MX3A 3FH5A 3UPVA 4RG6A 1NP7A 3MGBA 4FU3A 3CSTA 4L1BA 1N54A 2KATA 1A17A 3FEYA 3CK9A 3FHEA 3L54A 2IOLA 4JVSA 5ARGA 4A3TA 5J08A 4AVXA 3FY4A 2XCBA 4GA1A 3OAWA 2J9QA 4L2YA 4CCAA 2X6FA 2YNQA 3CHPA 3ML9A 3G2WA 2J09A 4I1MA 1PAQA 1H2VC 1XNFA 2ZU6B 1NZNA 2MHKA 2Q7FA 3D9IA 5D0QD 5AIJA 4LERA 4JHRA 4ME2A 3CVYA 4J6IA 4KZ0A 3PUJA 5BW8C 4FHKA 3SHFA 4FLBA 4ANWA 4J0UA 3FUKA 4GA2A 2WXFA 3FFLA 3QK0A 2R5SA 5G2NA 1MHQA 2XGSA 4CGVA 2IJGX 4HOTA 3MEKA 3ZFWA 2AWIA 3QARA 3HHMA 3QOUA 2VJ8A 4ANVA 3L16A 3ZIMA 1YA0A 1HXIA 4A1GA 3ZVVA 4N5CA 2WB2A 1QNFA 3FU6A 4GYWA 4TRQA 5T8IA 4AY5A 2XGMA 3U4TA 4AP2A 3G2UA 5LP0A 2HO1A 2OVFA 3FEXA 3OXGA 4I1AA 5DIZA 3CHMA 1HE8A 1TEZA 4ILIA 4N3AA 3I4GA 2Y3AA 4Y6CA 3QNKA 4UI9J 1E8YA 4APFA 3FH8A 4XI9A 3SFZA 1E8ZA 5FQ7A 4CGWA 3JYSA 1HS6A 2I1JA 5AJLA 4JC8A 3D9KA 4PH4B 4D10C 4HS2A 3PS6A 3S7DA 4G2VA 2RG8A 2VTBA 4K03A 3FTSA 3FUEA 4GZ5A 1B89A 2IF4A 4FA6A 2L9BA 5HQ8A 4MS6A 3NQPA 4Q96A 3MKQA 4N2SA 3CEQA 5E76A 1HZ4A 3ZGQA 3SF4A 1X5BA 4FC8A 2J49A 3ZYLA 1Y8MA 3APCA 3ML8A 4BY6A 2L0TB 4E85A 1H6KA 2VQ2A 2WXKA 3OXLA 2OV8A 4WWNA 3MKRA 1W3BA 3MCXA 3O48A 4ATGA 2DCPA 3Q15A 4A55A 3ZRHA 2L0IA 3LPZA 2NXPA 4HORA 4U04A 5EDSA 2E0IA 1UW4B 4NQ0A 1EF1C 3PREA 1VDYA 2CG2A 2KC7A 2JLBA 3ASDA 3APDA 1E7UA 1UN8A 3SBSA 4J8SA 4B0ZA 3ZYQA 1KT1A 3APFA 3B7RL 4PDXA 4MLPA 3HVEA 2DIWA 3UQ3A 3S7BA 4W9RA 3RK6A 1DNPA 3ONKA 3ESLA 2XRYA 3QWWA 4JA7A 3FULA 5BV1A 4UWGA 3VTXA 1QQEA 4F7AA 2NC9A 2X6IA 4PS3A 4B89A 5M72A 5CCLA 4HXIA 3GZ2A 4MKTA 3ZHEB 4AY6A 2WMNA 4BTAA 3ESKA 5BUZA 4HOSA 3CIAA 3ASFA 5LCWJ 3FH7A 5CHEE 3B7UX 2C0LA 3CVQA 4YNDA 4EZKA 1Z3XA 3T8MA 1OWOA 4YVOA 3HYMB 3SD5A 3FU3A 4APOA 3CGHA 2UY1B 3LY8A 2WXOA 2ILRA 3HDXA 1IQRA 3UMVA 4TUUA 1ELKA 3NZSA 1WAO1 2MOWA 3ZW3A 4UWLA 3L13A 3G2SA 3VLFA 1SQMA 4JZYA 3AU5A 4WNDA 3NZUA 5AENA 2ONDA 3JQ0A 2A5UA 1EDUA 3SZ7A 3I5PA 4HLEA 4U0UA 3CKCA 2HR2A 5AYWD 3EHNA 2LSVA 3ENEA 1UJJA 3CVLA 4RSYA 2WPVA 2XHEA 1HFAA 4JW1A 3D9LA 4I9EA 3ZXSA 5KJKA 4B8CB 4JEUA 1S0PA 1TJFA 5ANRA 2HYZA 3LVRE 3TGOA 2Y4UA 5J90A 2HM8A 3FUJA 4WUYA 2CHWA 2IFUA 3D9JA 3CK7A 3Q5MA 4DLOA 3CVUA 2V5FA 3IBEA 2FF4A 3PNLB 4GPKA 5EX0A 2WVIA 2XGOA 2IQCA 2PM7A 2WXRA 1IHGA 3KD7A 4K0RA 5JJ6A 3D9PA 5EKQD 3GW4A 4J8EA 2YINA 1TJCA 4I2WA 2VSNA 5KJNA 1FVFA 4CDRA 5ANLA 4GMLA 1OWMA 3EHMA 2V8SE 3KS2A 4L2LA 1HG5A 3KAEA 2CFZA 4H7XA 4AXHA 1FVHA 3CK8A 3MZLB 3UX4A 1ELWA 3ASHA 3D9NA 5D0OD 2XRZA 4OYSA 2VYIA 4U8HA 3PNTB 4LCTA 1BPOA 1OWLA 2PM6A 3IKOB 5C2YA 2KM4A 1JWFA 5JJTA 2EQXA 5G05C 4AIFA 4UWKA 1INZA 1E8XA 2BTDA 3QKYA 3JCKC 3R9AB 4FADA 4ACKA 4CEMA 3FWVA 1E7VA 2J4DA 2KZTB 4CDMA 2IOSA 4KYOB 4I6JA 3FUDA 3I3NA 3CVWA 3MV3B 3ZHEA 3FUMA 2I2OA 4OVVA 5ENNA 3TXMA 4LRZA 3R7RA 2WXNA 3TG5A 3AS8A 1E8WA 3IHVA 2AXUA 4ILHB 3SGHA 2AXZA 4CT4A 3L6AA 4LEUA 2PQNA 4NRHB 3U64A 3UUXA 2WXHA 4AJWA 4WWOA 1H19A 1OWPA 1U3DA 3ZYMA 3KEZA 4I9CA 5KJLA 4F53A 2QY7A 3LKUA 1H2UA 1KT0A 3DPDA 4I43A 2KCKA 2P58C 4KMOA 1MQSA 5A23A 2AW6A 4AM9A 3MA5A 4GB9A 2BUGA 1H2TC 4C0EA 2VGXB 4URKA 3QDNA 4B94A 5BT1A 3ZEFA 4EZJA 4G11A 2E2EA 3FTXA 4C0MA 4OVUA 3FUIA 3RIBA 2GRMA 1HH8A 4DI3A 1NA0A 4AEZC 5FZRA 1QZ2A 2WM9A 3OXFA 3T5VA 2FEZA 3S2AA 2AXVA 2FI7A 3LCAA 3SI5A 4B8AA 4EPZA 1JWGA 1SZAA 4L7TA 4XIFA 4XE0A 2V0PA 4UI9C 3FU5A 3TL5A 1HU3A 3VTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXT A;  1HF8 A;  2LO6 A;  4GZC A;  1UJJ A;  1MHQ A;  4FU3 A;  2V8S E;  1JUQ A;  5LOZ A;  1HG5 A;  1SZ9 A;  2DCP A;  1HFA A;  1PY1 A;  2L0I A;  3D9L A;  4GZD A;  3RRU A;  3D9M A;  3ZYK A;  3D9O A;  3D9N A;  3ONL A;  2BF0 X;  5J08 A;  4AVX A;  1HX8 A;  3G2V A;  3D9K A;  1HG2 A;  3LDZ A;  1VDY A;  1UJK A;  3ZYM A;  5CMY A;  3G2W A;  1H0A A;  2KM4 A;  3D9J A;  2QY7 A;  3ZYQ A;  4Q94 A;  1JWF A;  3CLJ A;  1EYH A;  1DVP A;  4NAC A;  5CMW A;  4Q96 A;  3D9I A;  1INZ A;  1ELK A;  3G2U A;  2MOW A;  1LF8 A;  5LP0 A;  2DIW A;  1JWG A;  1SZA A;  1X5B A;  3G2S A;  1XGW A;  3ONK A;  3ZYL A;  4HFG A;  3G2T A;  3D9P A;  2L0T B;  1JPL A;  1EDU A;  4FLB A; 
#chains in the Genus database with same CATH topology
 1TNZ A;  4JA9 A;  3O4Z A;  4GZ6 A;  3UT8 A;  3TWX A;  3VLE A;  4KVM A;  1TNU A;  3CQG B;  1UJK A;  1H0A A;  5FTP A;  4AV7 A;  2KZT A;  3ASG A;  1WM5 A;  4K5C A;  5EX3 A;  1BI7 B;  2X6K A;  4XX5 A;  4HRL A;  4G8L A;  1IQU A;  5ENQ D;  4GZC A;  3S7F A;  4AOF A;  5AAO A;  3NB2 A;  2I6H A;  3ZYK A;  1HO8 A;  2UWJ G;  4A1S A;  5CEC B;  3PDN A;  2GGF A;  2LXL A;  4HQD A;  1U3C A;  5CCM A;  4XZ4 A;  2F8Y A;  3TWV A;  3RO2 A;  2FUL A;  1NA3 A;  3TJP A;  2WXM A;  3CHR A;  3ONL A;  5FZS A;  4GZ3 A;  4I17 A;  2WXI A;  4PUC A;  4XKC A;  4LG6 A;  3JXJ A;  3LYA A;  3JUE A;  4HVB A;  3CR3 A;  4I1O B;  2Y69 E;  2LO6 A;  2V4L A;  3Q9N C;  2A5E A;  1WY6 A;  5FJY A;  3AS5 A;  5B1B E;  3RSE G;  2XEV A;  3QB2 A;  3Q47 B;  3DXK G;  3TWS A;  3S7J A;  3JUI A;  2XPI A;  4N39 A;  3L82 A;  3DBS A;  5FZQ A;  2CHX A;  3DWL G;  3U66 A;  1H6P A;  2LSU A;  3ABM E;  5KJM A;  2OOE A;  3D9H A;  3G2V A;  4PS8 A;  3UXG A;  1OT8 A;  1EYH A;  5HS0 A;  3NBN B;  1RZ4 A;  1X81 A;  3I4R B;  3D3M A;  4GCN A;  3MV2 B;  3FTW A;  4N5Q A;  4FLH A;  3FDH A;  4M3O A;  4JHJ A;  4BSX A;  4GA0 A;  4BES A;  2C0M A;  4K5B A;  5DBK A;  4U63 A;  3CKB A;  1Z6T A;  2J4B A;  4U07 A;  2AVP A;  4HFG A;  2WQ6 A;  4N2Q A;  1E96 B;  3E32 A;  3EDT B;  4XI0 A;  4IRU A;  3TXN A;  4JL0 A;  4CRW A;  4JPS A;  3BQO A;  1ELR A;  5G05 J;  2YHE A;  1KZO A;  3FH5 A;  3UPV A;  2R03 A;  4FU3 A;  5ENP D;  3CST A;  1N54 A;  2IOL A;  2Y0B G;  2IO3 C;  5J08 A;  4AVX A;  3FY4 A;  3OAW A;  5FIN A;  3ML9 A;  2J09 A;  4YDY A;  1PAQ A;  2Q7F A;  3D9I A;  4HI9 A;  5EYL A;  4HLL A;  2WXF A;  3QK0 A;  1MHQ A;  4HOT A;  3MEK A;  3ZFW A;  2AWI A;  3L16 A;  3DST A;  1YA0 A;  4GYW A;  4TRQ A;  1Z5S C;  3V2O A;  3U4T A;  3G2U A;  3SY2 A;  3FEX A;  3OXG A;  3UM3 A;  1HE8 A;  4BSZ B;  3ABK E;  4XI9 A;  1S63 A;  2IEJ A;  4CGW A;  3JYS A;  4A63 B;  2I1J A;  5AJL A;  2RG8 A;  1B89 A;  5HQ8 A;  5E76 A;  3ZYL A;  3ML8 A;  2L0T B;  1D9S A;  1H6K A;  4WWN A;  1AWC B;  2OV8 A;  3MCX A;  3IXE A;  4DX2 A;  2DCP A;  2L0I A;  2NXP A;  4U04 A;  1EF1 C;  3PRE A;  4JB8 P;  1VDY A;  2CG2 A;  2KC7 A;  3APD A;  3DPY A;  4J8S A;  3B7R L;  2H6G A;  3UQ3 A;  4W9R A;  3QWW A;  3E34 A;  4UWG A;  1QQE A;  1YCS B;  2X6I A;  5M72 A;  4GTM A;  3V2X A;  2DYS E;  5BUZ A;  3ASF A;  5LCW J;  5CHE E;  3CVQ A;  2C0L A;  4EZK A;  1Z3X A;  3T8M A;  4YVO A;  3AG4 E;  1BLX B;  3CGH A;  5B3S E;  3NZS A;  2ZIR A;  3SZ7 A;  3I5P A;  2HR2 A;  2ETB A;  5AYW D;  4F6R D;  5CED B;  3CVL A;  4X8Q A;  1MX4 A;  1OCR E;  2H6I A;  3FUJ A;  4WUY A;  2V5F A;  2IQC A;  2WXR A;  2VSN A;  3ULY A;  5ANL A;  3DEP A;  3Q7F A;  5JMN D;  4L2L A;  3KS2 A;  3KAE A;  4AXH A;  2KXP C;  4LCT A;  1BPO A;  3IKO B;  5C2Y A;  2DZO A;  1JWF A;  5AQ7 A;  1INZ A;  3JCK C;  4ACK A;  4CEM A;  1E7V A;  4CDM A;  3FUD A;  3C5R A;  4LRZ A;  2WXN A;  2AXU A;  3SGH A;  4QQI A;  3UUX A;  2XZD G;  1OWP A;  1DCE A;  2R05 A;  4F53 A;  3EU5 A;  4ATZ D;  4O1O A;  3ZNG A;  5A23 A;  5ITZ F;  2VGX B;  3QDN A;  5BT1 A;  2E2E A;  4OVU A;  2P2C P;  1AP7 A;  4AEZ C;  4BET A;  4J8Y A;  2GRO B;  1SZA A;  4XIF A;  4UI9 C;  3E30 A;  3TL5 A;  4HNA D;  4L23 A;  1E90 A;  2DYR E;  4FUL A;  3QWV A;  3SFX A;  2WXG A;  2BF0 X;  5BPP A;  2AJA A;  3TAX A;  5A6C A;  4P29 A;  5BV0 A;  1BU9 A;  3AG1 E;  1DVP A;  4NAC A;  3EIJ A;  2KBX A;  1IKN D;  2R17 C;  1OY3 D;  5G55 A;  2X38 A;  1UG3 A;  3AU4 A;  4GZD A;  4F1S A;  2VSY A;  3CQC B;  1P5Q A;  4TV3 A;  2R59 A;  2X6J A;  4KVO A;  4QFV A;  1ZB1 A;  2WMO A;  4HOU A;  4UQX A;  4IYP A;  1QBQ A;  1KZP A;  5LX8 A;  2P9K G;  2VGX A;  2FO1 E;  2LAI A;  3DSV A;  3RRU A;  4U8V D;  3HXF A;  3KSQ A;  3FTU A;  5FT9 A;  4OAU C;  2IU1 A;  4Q94 A;  4UWH A;  2L6J A;  3EUV A;  3LS8 A;  4GYO A;  4BFR A;  4NUR A;  1O1T A;  3BG0 B;  5EIB E;  2LAH A;  4GMR A;  4KXK B;  4DX6 D;  4DX7 D;  3Q9U C;  4C9B B;  2ION A;  1K1A A;  5HKP A;  4LNG A;  5HI7 A;  1N95 A;  4JEH A;  3ZN3 A;  4Z68 A;  2J08 A;  4WWP A;  1LF8 A;  4G23 A;  5FQ4 A;  5JHB A;  2NSZ A;  4FJY A;  4CDN A;  1KPS B;  2ZGG A;  2GRN B;  3HRA A;  4JD2 G;  5CRV A;  4Y6W A;  2WQ7 A;  3Q79 A;  1LD7 A;  4N3C A;  3FP3 A;  5CRU A;  3URZ A;  5KCM A;  5CMW A;  3TWQ A;  4M7C A;  1JCQ A;  5CER B;  2LNI A;  4ILG A;  1BD8 A;  4EQF A;  3ASO E;  3ZXP A;  2XEH A;  4E6H A;  1LTX A;  3PZD A;  3MJW A;  4U0Z A;  3HIZ A;  3C98 A;  1RW2 A;  2JAB A;  3PZ1 A;  4Q69 A;  1PC2 A;  4K5A B;  2FBN A;  4F3V A;  2ETC A;  5CBO A;  3ZPJ A;  4DI4 A;  1JCR A;  3CVV A;  2PNN A;  4U95 D;  3UIN C;  3RKV A;  3RJV A;  3P2B A;  3U3W A;  4JHK A;  4G1T A;  3T5X A;  2VTB B;  4WNE A;  3DRA A;  4BT8 A;  2P9I G;  2WXQ A;  2PZI A;  4LNU D;  4J7W A;  2GRL A;  3ZKJ A;  5BXU A;  3UM1 A;  1TNB A;  3UI2 A;  2KAT A;  3FHE A;  3L54 A;  4A3T A;  2X6F A;  2YNQ A;  5KBA A;  4U7E B;  1H2V C;  1XNF A;  2ZU6 B;  5AN8 A;  4BER A;  5D0Q D;  3TWR A;  4JHR A;  4ME2 A;  1TNO A;  4ANW A;  3SHF A;  4FHK A;  4FLB A;  3FFL A;  3T9K A;  2R5S A;  5G2N A;  3LJN A;  4ANV A;  1N11 A;  1HXI A;  2V4H C;  1DC2 A;  3FU6 A;  5T8I A;  4AY5 A;  2EIL E;  3Q75 A;  2DZN A;  2XGM A;  4AP2 A;  3NAW A;  3DSU A;  1TEZ A;  4ILI A;  4N3A A;  1QYM A;  5FQ7 A;  1OCO E;  4JC8 A;  3D9K A;  4HS2 A;  4G2V A;  2VTB A;  4K03 A;  3FTS A;  3FUE A;  4DRX E;  2IF4 A;  4FA6 A;  3CEQ A;  3RAU A;  3APC A;  1O5M A;  4HB5 A;  4BY6 A;  4GTQ A;  4E85 A;  4RQI A;  3EU9 A;  2DWZ A;  3O48 A;  3Q15 A;  3ZRH A;  4HOR A;  3ABL E;  5EDS A;  2E0I A;  1UW4 B;  2B6C A;  3ASD A;  1E7U A;  3SBS A;  3ZYQ A;  2ETA A;  1MYO A;  4PDX A;  3TWT A;  1OXJ A;  3ESL A;  2BKK B;  2XRY A;  4F7A A;  1SA5 A;  4MKT A;  4BTA A;  3ESK A;  3UM0 A;  4GTT A;  1MZC A;  3B7U X;  2GRP B;  2H6F A;  3HYM B;  4APO A;  3FU3 A;  2UY1 B;  3LY8 A;  3C3R A;  3HDX A;  1IQR A;  1WAO 1;  4UWL A;  3L13 A;  1SQM A;  3AU5 A;  4WND A;  3CKC A;  2LSV A;  1BI8 B;  4RSY A;  4JW1 A;  4G8K A;  3TGO A;  5J90 A;  3AG2 E;  2HM8 A;  1TR4 A;  2CHW A;  3D9J A;  3CK7 A;  2FF4 A;  2XGO A;  3Q73 A;  1IHG A;  4K0R A;  5JJ6 A;  5EKQ D;  2YIN A;  1FT2 A;  5D66 A;  1FVF A;  1OWM A;  4YDO A;  3EHM A;  4H7X A;  3UM2 A;  1FVH A;  2XRZ A;  5D0O D;  3D9N A;  4U8H A;  4GTV A;  5IY5 E;  3FWV A;  2J4D A;  2GRR B;  4I6J A;  3CVW A;  3FUM A;  3R7R A;  3AS8 A;  1E8W A;  3IHV A;  2AXZ A;  1O1S A;  3L6A A;  2P9N G;  3JXI A;  5HRY A;  4NRH B;  4AJW A;  4I9C A;  1N9A A;  5KJL A;  1H2U A;  1KT0 A;  4I43 A;  2KCK A;  4TXR A;  2BUG A;  1UOH A;  1H2T C;  3UIO C;  4B94 A;  4G11 A;  5ENS D;  1NFI E;  4C0M A;  4TXP A;  3FUI A;  2GRM A;  1HH8 A;  1NA0 A;  5FZR A;  3DXM G;  4MBG A;  3C3Q A;  2FI7 A;  3SI5 A;  1JWG A;  2P9U G;  4L7T A;  4DJA A;  1N0Q A;  4GYY A;  3L17 A;  1SZ9 A;  3CHO A;  2NYJ A;  3HXB A;  3UIP C;  3PE3 A;  2PL2 A;  4MRU A;  4NIK A;  2DBA A;  3PRZ A;  2C2L A;  4UI9 K;  2A4Z A;  1Q2Z A;  4U0S A;  3QC1 A;  5AQB A;  1IXV A;  3ASN E;  4V3I A;  1ZU2 A;  1IYG A;  4JXT A;  1OUV A;  1OWN A;  3ZU7 B;  2XCC A;  2XPY A;  2WXL A;  4BT9 A;  3CHS A;  4C48 B;  1EPU A;  3AS4 A;  1HX8 A;  1OCC E;  4UQY A;  5A7D B;  2RFA A;  4KT6 B;  3QJZ A;  1DCQ A;  3CLJ A;  1D8D A;  3CSF A;  5FQ6 A;  3C3O A;  4A3V A;  1YYH A;  2OCC E;  4G24 A;  2VSO E;  4PS7 A;  1SA4 A;  5CBN A;  4ZFH A;  3KEA A;  5EYP F;  3U9W A;  3FTZ A;  3VLD A;  2CHZ A;  4ANU A;  2XPZ A;  3V79 K;  2X3M A;  4LSZ E;  5CMY A;  2V5Q C;  2MRI A;  3L22 A;  3GZS A;  4XEI G;  4YVQ C;  3PEU B;  4ABN A;  3HVE B;  2R02 A;  3L08 A;  2XS8 A;  3FTV A;  1JPL A;  2XZT G;  1D8E A;  1L5J A;  1SVX A;  2Y4T A;  4CT0 A;  3R7Q A;  4BWR A;  3HG0 D;  4WAF A;  3LJ3 A;  3F6Q A;  1UN9 A;  5C1D A;  3B13 A;  2YHC A;  2P9S G;  4RVB A;  1GW6 A;  3FUF A;  3BUA A;  4EBA A;  1Z3Y A;  1V55 E;  5CEA A;  4I6E A;  3N71 A;  4WNG A;  5D2M C;  4I6G A;  4WNF A;  2KCV A;  1Y6I A;  1HG2 A;  4IUL A;  3LXU X;  5EID A;  3EJN A;  4FP7 A;  3SO8 A;  3LY9 A;  1TYQ G;  4G26 A;  3RU0 A;  3B7T A;  3K9I A;  3BEE A;  4BX8 A;  4EEC A;  4UWF A;  3NF1 A;  2BED A;  5T3R A;  3B7S A;  4CZ2 D;  1ZBP A;  2MYO A;  3UT7 A;  3FUN A;  1HF8 A;  3AAA C;  5AQ9 A;  2QFC A;  4I2Z A;  3UKR G;  5EIL A;  3TG4 A;  3MYV A;  1WG0 A;  3CVN A;  3E4B A;  3LDZ A;  5KNH D;  3FUH A;  3CVX A;  4RG9 A;  3R9M A;  4N3B A;  4HI8 A;  2X6H A;  4ANX A;  3IV0 A;  5JJ7 A;  2FO7 A;  4UQZ A;  4XKB A;  3MX3 A;  4DX5 D;  4GTP A;  1N4Q A;  1NP7 A;  3MGB A;  1A17 A;  5ARG A;  3CK9 A;  2BKG A;  5ENO D;  2XCB A;  4HBD A;  2J9Q A;  4CCA A;  3G2W A;  1NZN A;  2MHK A;  1NL4 A;  5AIJ A;  4OAV B;  4J6I A;  4KZ0 A;  3PUJ A;  5BW8 C;  4J0U A;  3FUK A;  4TXQ A;  4GA2 A;  3BU8 A;  3DSW A;  4TUM A;  1N4R A;  3HXC A;  3DEO A;  2LUH A;  3UKU G;  3EHQ A;  3ZIM A;  4A1G A;  3ZVV A;  4N5C A;  2WB2 A;  3AG3 E;  5LP0 A;  2HO1 A;  3X2Q E;  4O60 A;  5DIZ A;  3CHM A;  3QNK A;  4UI9 J;  4APF A;  3FH8 A;  2XEN A;  1JCS A;  2QYJ A;  4GTS A;  5FIO A;  1HS6 A;  2XS1 A;  3DSS A;  2IO2 C;  4PH4 B;  2L6B A;  4GZ5 A;  3WG7 E;  2L9B A;  4MS6 A;  4O1P A;  3ZGQ A;  1HZ4 A;  3HXE A;  2R2L A;  3SFY A;  1X5B A;  1Y8M A;  2Y1L E;  2VQ2 A;  3OXL A;  5KWD A;  1W3B A;  2EIM E;  4ATG A;  2JLB A;  1UN8 A;  2DIW A;  1DNP A;  3ONK A;  5BV1 A;  3VTX A;  2NC9 A;  4PS3 A;  4B89 A;  1MJ0 A;  5CCL A;  2F8X K;  3ZHE B;  2B0O E;  3FH7 A;  3NOC D;  4YND A;  3SD5 A;  2ZXW E;  2ILR A;  3UMV A;  4TUU A;  1ELK A;  2MOW A;  4JZY A;  3V31 A;  2OND A;  3JQ0 A;  2A5U A;  4U0U A;  3EHN A;  3ENE A;  1UJJ A;  2RKK A;  2WPV A;  1V54 E;  4I9E A;  3ZXS A;  4B8C B;  5ANR A;  2HYZ A;  2HE0 A;  3Q5M A;  4DLO A;  3PNL B;  4GPK A;  3W9F A;  5EX0 A;  2WVI A;  3KD7 A;  3B7B A;  3GW4 A;  4J8E A;  4I2W A;  1TJC A;  4HRN A;  4CDR A;  2CFZ A;  3MZL B;  1ELW A;  3PNT B;  5H7P A;  1OWL A;  2KM4 A;  5JJT A;  2EQX A;  5G05 C;  3QKY A;  4FAD A;  2ZGD A;  4KYO B;  3C72 A;  3ZHE A;  2I2O A;  4OVV A;  5ENN A;  2F37 A;  3TXM A;  3TG5 A;  4ILH B;  4CT4 A;  1K8K G;  1WDY A;  3U64 A;  3ZYM A;  1U3D A;  2QY7 A;  3LKU A;  3V30 A;  2LXM A;  4KMO A;  1MQS A;  2AW6 A;  3MA5 A;  4C0E A;  1N4P A;  1N4S A;  3FTX A;  4L9P A;  5JA4 D;  3RIB A;  3B95 A;  2WM9 A;  3J5P A;  3S2A A;  2AXV A;  4EPZ A;  4F1P A;  4XE0 A;  2V0P A;  3FU5 A;  3Q7A A;  5ENR D;  4YDE A;  3GYZ A;  3SBT B;  3WXX A;  2J07 A;  5BNW A;  2CG3 A;  4O6F A;  3LEW A;  4H7Y A;  2RD0 A;  4GMJ A;  4DUI A;  1FT1 A;  2CFU A;  1H6O A;  4GCO A;  2YQ8 A;  1JUQ A;  3JQ1 A;  5E75 A;  1S64 A;  3BG1 B;  1U2V G;  3CHQ A;  5T4Y A;  3RRM B;  2VGY A;  2J8S D;  3Q49 B;  4FJZ A;  3EIQ C;  5BXO A;  3PZ3 A;  4KZC A;  3TWW A;  5LCW C;  1S70 B;  4G25 A;  5JHA A;  3IHY A;  3SNX A;  2WQH A;  4GTO A;  2XQ0 A;  3CV0 A;  4FHJ A;  5FWQ A;  3FU0 A;  5G04 C;  1FCH A;  1XGW A;  4EBA G;  5FQ8 A;  4LUN U;  3PH0 C;  1PY1 A;  4J8F A;  3D9O A;  2M63 A;  3UT4 A;  4DPR A;  4LNB A;  2UY1 A;  3P1U A;  3LY7 A;  3QWP A;  4DX1 A;  4DK5 A;  3GZ1 A;  1KLX A;  1TN6 A;  3AJI A;  3PEV B;  2QZA A;  3IEG A;  4B93 B;  4UUC A;  3HXD A;  3PE4 A;  2WXJ A;  4EHM A;  5LOZ A;  5AJD A;  3ULQ A;  4EZL A;  4IN3 B;  4BX9 A;  3QAQ A;  3PUK A;  1N52 A;  5ENT D;  1FPP A;  2KCL A;  3DSX A;  2IY0 C;  3PZ2 A;  3RO3 A;  3G2T A;  1TNY A;  5LFA A;  3FTY A;  3RRN B;  2OVB A;  2RFM A;  4DLQ A;  3KSL A;  2WXP A;  1A5E A;  4KBQ A;  3CVP A;  4GAA A;  3LVQ E;  3SQV A;  2I1K A;  3OTN A;  2PQR A;  2GW1 A;  4BTB A;  1G3N B;  2QYU A;  4HOQ A;  3D9M A;  2VSX E;  2I9C A;  2JEK A;  3PVL A;  4R7L A;  3Q4A B;  4ACL A;  4GU5 A;  1IHB A;  3MKQ B;  4J8D A;  5G04 J;  5ARF A;  4BEP A;  4RG6 A;  4L1B A;  3J5Q B;  3FEY A;  4JVS A;  4GA1 A;  4L2Y A;  3CHP A;  4I1M A;  1MX6 A;  4LER A;  3CVY A;  2P9L G;  5EN5 D;  2XEE A;  4GPM A;  2XGS A;  4CGV A;  5AQA A;  2IJG X;  3E37 A;  1O1R A;  3QAR A;  3HHM A;  3QOU A;  2VJ8 A;  2VGE A;  1QNF A;  3TWU A;  2OVF A;  4I1A A;  3I4G A;  2Y3A A;  4Y6C A;  1E8Y A;  1SW6 A;  3SFZ A;  1E8Z A;  1N0R A;  1NI1 A;  4D10 C;  3PS6 A;  3S7D A;  5AAR A;  3NOG D;  2EIN E;  3NQP A;  3MKQ A;  4Q96 A;  4N2S A;  3SF4 A;  4FC8 A;  3W9G A;  2J49 A;  3ISM C;  4RLY A;  4ZHB A;  2WXK A;  1YMP A;  3MKR A;  4HRM B;  4A55 A;  3LPZ A;  4NQ0 A;  3T8K A;  1TN7 A;  1K3Z D;  3ULE G;  3E33 A;  4B0Z A;  1KT1 A;  3APF A;  2QC9 A;  4MLP A;  3HVE A;  3S7B A;  2DVW A;  3RK6 A;  2EIK E;  4JA7 A;  3FUL A;  2EIJ E;  1OCZ E;  4HXI A;  3GZ2 A;  4AY6 A;  2WMN A;  4HOS A;  3CIA A;  1OWO A;  5B1A E;  2WXO A;  3ZW3 A;  3UTM A;  3G2S A;  3VLF A;  3NZU A;  5AEN A;  1EDU A;  4HLE A;  2XHE A;  1HFA A;  5KJK A;  3D9L A;  4JEU A;  2GRQ B;  1S0P A;  1TJF A;  3LVR E;  2Y4U A;  2IFU A;  3CVU A;  3IBE A;  1N94 A;  2PM7 A;  1TN8 A;  3D9P A;  1K1B A;  5KJN A;  4U96 D;  2ZIS A;  4CYM D;  4GML A;  2V8S E;  1HG5 A;  1LD8 A;  1MX2 A;  3CK8 A;  2OEV A;  3UX4 A;  3ASH A;  4OYS A;  2VYI A;  2PM6 A;  2H6H A;  4UWK A;  4AIF A;  1E8X A;  2BTD A;  3R9A B;  2KZT B;  2IOS A;  3PZ4 A;  3I3N A;  3MV3 B;  2OEW A;  2P9P G;  3Q78 A;  5KNG A;  3L9T A;  4LEU A;  2PQN A;  2WXH A;  4WWO A;  1H19 A;  3EHR A;  3KEZ A;  3ZUV B;  3DPD A;  4GTR A;  2P58 C;  4AM9 A;  4GB9 A;  4URK A;  4U8Y D;  3ZEF A;  4EZJ A;  4DI3 A;  2F0Y A;  1QZ2 A;  3T5V A;  3OXF A;  4YDW A;  2FEZ A;  4B8A A;  3LCA A;  1HU3 A;  3VTY A; 
#chains in the Genus database with same CATH homology
 4DJA A;  4JA9 A;  4L23 A;  4GYY A;  1E90 A;  3GYZ A;  3L17 A;  1SZ9 A;  3O4Z A;  3QWV A;  4FUL A;  4GZ6 A;  3CHO A;  3UT8 A;  3SBT B;  3VLE A;  4KVM A;  3WXX A;  2J07 A;  5BNW A;  2WXG A;  2BF0 X;  5BPP A;  3CQG B;  3PE3 A;  3TAX A;  2CG3 A;  4P29 A;  5BV0 A;  5A6C A;  1UJK A;  1H0A A;  2PL2 A;  4MRU A;  4O6F A;  5FTP A;  4AV7 A;  2DBA A;  3LEW A;  3PRZ A;  2KZT A;  3ASG A;  1DVP A;  1WM5 A;  4H7Y A;  4NAC A;  2C2L A;  2RD0 A;  4GMJ A;  3EIJ A;  5EX3 A;  4UI9 K;  2A4Z A;  4U0S A;  3QC1 A;  2CFU A;  2X6K A;  4XX5 A;  4V3I A;  1ZU2 A;  1IYG A;  2R17 C;  1IQU A;  4JXT A;  1OUV A;  4GZC A;  5G55 A;  2X38 A;  1OWN A;  4GCO A;  2XCC A;  2YQ8 A;  3S7F A;  1UG3 A;  1JUQ A;  3JQ1 A;  4AOF A;  2XPY A;  3AU4 A;  5E75 A;  2WXL A;  4BT9 A;  4GZD A;  2I6H A;  3CHS A;  2VSY A;  3ZYK A;  3CQC B;  1P5Q A;  4F1S A;  3BG1 B;  1EPU A;  4TV3 A;  3AS4 A;  1HX8 A;  1HO8 A;  4UQY A;  5A7D B;  2R59 A;  2UWJ G;  4KT6 B;  4A1S A;  3QJZ A;  3CHQ A;  5T4Y A;  2X6J A;  4KVO A;  4QFV A;  3RRM B;  2WMO A;  4HOU A;  4UQX A;  2VGY A;  3PDN A;  4IYP A;  3CLJ A;  2GGF A;  5LX8 A;  3CSF A;  5FQ6 A;  4A3V A;  3Q49 B;  1U3C A;  4FJZ A;  5CCM A;  3EIQ C;  4XZ4 A;  2VGX A;  4KZC A;  4G24 A;  2VSO E;  4PS7 A;  2LAI A;  5LCW C;  3RO2 A;  4G25 A;  5JHA A;  2FUL A;  3IHY A;  1NA3 A;  3SNX A;  3TJP A;  2WXM A;  3CHR A;  3U9W A;  3RRU A;  2WQH A;  3FTZ A;  3VLD A;  3ONL A;  5FZS A;  4GZ3 A;  2CHZ A;  2WXI A;  4I17 A;  4PUC A;  4XKC A;  4ANU A;  2XPZ A;  2X3M A;  2XQ0 A;  5CMY A;  3FTU A;  3LYA A;  3CV0 A;  5FT9 A;  2IU1 A;  4Q94 A;  4UWH A;  2MRI A;  3L22 A;  2L6J A;  3GZS A;  4FHJ A;  5FWQ A;  4HVB A;  3FU0 A;  3LS8 A;  5G04 C;  1FCH A;  3CR3 A;  1XGW A;  4GYO A;  4YVQ C;  4BFR A;  4NUR A;  3PEU B;  4ABN A;  3HVE B;  4EBA G;  5FQ8 A;  3L08 A;  3FTV A;  3BG0 B;  1JPL A;  4I1O B;  2LO6 A;  2LAH A;  4KXK B;  2V4L A;  4LUN U;  3PH0 C;  1WY6 A;  1L5J A;  3AS5 A;  1PY1 A;  5FJY A;  4C9B B;  2ION A;  2XEV A;  4J8F A;  3D9O A;  3QB2 A;  3Q47 B;  2M63 A;  3UT4 A;  2Y4T A;  4CT0 A;  3R7Q A;  4DPR A;  2UY1 A;  5HI7 A;  4BWR A;  3P1U A;  4WAF A;  3LJ3 A;  3S7J A;  3LY7 A;  3JUI A;  1UN9 A;  2XPI A;  4JEH A;  4N39 A;  5C1D A;  3QWP A;  3ZN3 A;  4DK5 A;  2J08 A;  3GZ1 A;  4WWP A;  3B13 A;  2YHC A;  1KLX A;  3DBS A;  1LF8 A;  5FZQ A;  3PEV B;  2CHX A;  4G23 A;  4RVB A;  5FQ4 A;  5JHB A;  2NSZ A;  4FJY A;  4CDN A;  3IEG A;  1GW6 A;  3FUF A;  4EBA A;  3U66 A;  1Z3Y A;  4Y6W A;  2WQ7 A;  3PE4 A;  2LSU A;  2WXJ A;  5LOZ A;  4I6E A;  3N71 A;  4WNG A;  4I6G A;  5AJD A;  3ULQ A;  5KJM A;  4EZL A;  4IN3 B;  2OOE A;  4WNF A;  2KCV A;  4BX9 A;  3G2V A;  1Y6I A;  4N3C A;  4PS8 A;  1HG2 A;  3FP3 A;  4IUL A;  3QAQ A;  3PUK A;  3LXU X;  1N52 A;  3URZ A;  5KCM A;  5CMW A;  1EYH A;  3EJN A;  2KCL A;  4FP7 A;  2LNI A;  4ILG A;  3LY9 A;  3RO3 A;  4EQF A;  3I4R B;  3D3M A;  4GCN A;  3MV2 B;  3FTW A;  3G2T A;  4G26 A;  4E6H A;  3RU0 A;  3B7T A;  3K9I A;  3BEE A;  3MJW A;  3PZD A;  4BX8 A;  4EEC A;  3FTY A;  4FLH A;  5LFA A;  4UWF A;  3RRN B;  4U0Z A;  3FDH A;  2OVB A;  3NF1 A;  3HIZ A;  4M3O A;  3C98 A;  4DLQ A;  2WXP A;  5T3R A;  4JHJ A;  4BSX A;  4Q69 A;  4GA0 A;  4KBQ A;  1PC2 A;  3B7S A;  3CVP A;  4GAA A;  2C0M A;  3LVQ E;  2FBN A;  4F3V A;  5DBK A;  4U63 A;  1ZBP A;  3CKB A;  3ZPJ A;  2I1K A;  1Z6T A;  2J4B A;  2PQR A;  3OTN A;  4U07 A;  3UT7 A;  4DI4 A;  2AVP A;  3FUN A;  2GW1 A;  4HFG A;  4BTB A;  3CVV A;  1HF8 A;  2WQ6 A;  2QFC A;  4I2Z A;  4N2Q A;  4HOQ A;  3D9M A;  1E96 B;  3TG4 A;  3MYV A;  3EDT B;  2VSX E;  3CVN A;  3E4B A;  3LDZ A;  4XI0 A;  4IRU A;  3RJV A;  2I9C A;  3RKV A;  3TXN A;  2JEK A;  3FUH A;  3CVX A;  3P2B A;  3PVL A;  4JL0 A;  3U3W A;  4RG9 A;  4JHK A;  3Q4A B;  4R7L A;  4CRW A;  4G1T A;  3T5X A;  2VTB B;  4JPS A;  4WNE A;  4BT8 A;  4GU5 A;  4N3B A;  4ACL A;  2WXQ A;  1ELR A;  3MKQ B;  2PZI A;  4J8D A;  5G05 J;  2X6H A;  4ANX A;  2GRL A;  3IV0 A;  2YHE A;  5JJ7 A;  5G04 J;  2FO7 A;  4UQZ A;  4XKB A;  5ARF A;  3MX3 A;  3FH5 A;  3UPV A;  4RG6 A;  1NP7 A;  3MGB A;  4FU3 A;  3CST A;  4L1B A;  1N54 A;  2KAT A;  1A17 A;  3FEY A;  3CK9 A;  3FHE A;  3L54 A;  2IOL A;  4JVS A;  5ARG A;  4A3T A;  5J08 A;  4AVX A;  3FY4 A;  2XCB A;  4GA1 A;  3OAW A;  2J9Q A;  4L2Y A;  4CCA A;  2X6F A;  2YNQ A;  3CHP A;  3ML9 A;  3G2W A;  2J09 A;  4I1M A;  1PAQ A;  1H2V C;  1XNF A;  2ZU6 B;  1NZN A;  2MHK A;  2Q7F A;  3D9I A;  5D0Q D;  5AIJ A;  4LER A;  4JHR A;  4ME2 A;  3CVY A;  4J6I A;  4KZ0 A;  3PUJ A;  5BW8 C;  4FHK A;  3SHF A;  4FLB A;  4ANW A;  4J0U A;  3FUK A;  4GA2 A;  2WXF A;  3FFL A;  3QK0 A;  2R5S A;  5G2N A;  1MHQ A;  2XGS A;  4CGV A;  2IJG X;  4HOT A;  3MEK A;  3ZFW A;  2AWI A;  3QAR A;  3HHM A;  3QOU A;  2VJ8 A;  4ANV A;  3L16 A;  3ZIM A;  1YA0 A;  1HXI A;  4A1G A;  3ZVV A;  4N5C A;  2WB2 A;  1QNF A;  3FU6 A;  4GYW A;  4TRQ A;  5T8I A;  4AY5 A;  2XGM A;  3U4T A;  4AP2 A;  3G2U A;  5LP0 A;  2HO1 A;  2OVF A;  3FEX A;  3OXG A;  4I1A A;  5DIZ A;  3CHM A;  1HE8 A;  1TEZ A;  4ILI A;  4N3A A;  3I4G A;  2Y3A A;  4Y6C A;  3QNK A;  4UI9 J;  1E8Y A;  4APF A;  3FH8 A;  4XI9 A;  3SFZ A;  1E8Z A;  5FQ7 A;  4CGW A;  3JYS A;  1HS6 A;  2I1J A;  5AJL A;  4JC8 A;  3D9K A;  4PH4 B;  4D10 C;  4HS2 A;  3PS6 A;  3S7D A;  4G2V A;  2RG8 A;  2VTB A;  4K03 A;  3FTS A;  3FUE A;  4GZ5 A;  1B89 A;  2IF4 A;  4FA6 A;  2L9B A;  5HQ8 A;  4MS6 A;  3NQP A;  4Q96 A;  3MKQ A;  4N2S A;  3CEQ A;  5E76 A;  1HZ4 A;  3ZGQ A;  3SF4 A;  1X5B A;  4FC8 A;  2J49 A;  3ZYL A;  1Y8M A;  3APC A;  3ML8 A;  4BY6 A;  2L0T B;  4E85 A;  1H6K A;  2VQ2 A;  2WXK A;  3OXL A;  2OV8 A;  4WWN A;  3MKR A;  1W3B A;  3MCX A;  3O48 A;  4ATG A;  2DCP A;  3Q15 A;  4A55 A;  3ZRH A;  2L0I A;  3LPZ A;  2NXP A;  4HOR A;  4U04 A;  5EDS A;  2E0I A;  1UW4 B;  4NQ0 A;  1EF1 C;  3PRE A;  1VDY A;  2CG2 A;  2KC7 A;  2JLB A;  3ASD A;  3APD A;  1E7U A;  1UN8 A;  3SBS A;  4J8S A;  4B0Z A;  3ZYQ A;  1KT1 A;  3APF A;  3B7R L;  4PDX A;  4MLP A;  3HVE A;  2DIW A;  3UQ3 A;  3S7B A;  4W9R A;  3RK6 A;  1DNP A;  3ONK A;  3ESL A;  2XRY A;  3QWW A;  4JA7 A;  3FUL A;  5BV1 A;  4UWG A;  3VTX A;  1QQE A;  4F7A A;  2NC9 A;  2X6I A;  4PS3 A;  4B89 A;  5M72 A;  5CCL A;  4HXI A;  3GZ2 A;  4MKT A;  3ZHE B;  4AY6 A;  2WMN A;  4BTA A;  3ESK A;  5BUZ A;  4HOS A;  3CIA A;  3ASF A;  5LCW J;  3FH7 A;  5CHE E;  3B7U X;  2C0L A;  3CVQ A;  4YND A;  4EZK A;  1Z3X A;  3T8M A;  1OWO A;  4YVO A;  3HYM B;  3SD5 A;  3FU3 A;  4APO A;  3CGH A;  2UY1 B;  3LY8 A;  2WXO A;  2ILR A;  3HDX A;  1IQR A;  3UMV A;  4TUU A;  1ELK A;  3NZS A;  1WAO 1;  2MOW A;  3ZW3 A;  4UWL A;  3L13 A;  3G2S A;  3VLF A;  1SQM A;  4JZY A;  3AU5 A;  4WND A;  3NZU A;  5AEN A;  2OND A;  3JQ0 A;  2A5U A;  1EDU A;  3SZ7 A;  3I5P A;  4HLE A;  4U0U A;  3CKC A;  2HR2 A;  5AYW D;  3EHN A;  2LSV A;  3ENE A;  1UJJ A;  3CVL A;  4RSY A;  2WPV A;  2XHE A;  1HFA A;  4JW1 A;  3D9L A;  4I9E A;  3ZXS A;  5KJK A;  4B8C B;  4JEU A;  1S0P A;  1TJF A;  5ANR A;  2HYZ A;  3LVR E;  3TGO A;  2Y4U A;  5J90 A;  2HM8 A;  3FUJ A;  4WUY A;  2CHW A;  2IFU A;  3D9J A;  3CK7 A;  3Q5M A;  4DLO A;  3CVU A;  2V5F A;  3IBE A;  2FF4 A;  3PNL B;  4GPK A;  5EX0 A;  2WVI A;  2XGO A;  2IQC A;  2PM7 A;  2WXR A;  1IHG A;  3KD7 A;  4K0R A;  5JJ6 A;  3D9P A;  5EKQ D;  3GW4 A;  4J8E A;  2YIN A;  1TJC A;  4I2W A;  2VSN A;  5KJN A;  1FVF A;  4CDR A;  5ANL A;  4GML A;  1OWM A;  3EHM A;  2V8S E;  3KS2 A;  4L2L A;  1HG5 A;  3KAE A;  2CFZ A;  4H7X A;  4AXH A;  1FVH A;  3CK8 A;  3MZL B;  3UX4 A;  1ELW A;  3ASH A;  3D9N A;  5D0O D;  2XRZ A;  4OYS A;  2VYI A;  4U8H A;  3PNT B;  4LCT A;  1BPO A;  1OWL A;  2PM6 A;  3IKO B;  5C2Y A;  2KM4 A;  1JWF A;  5JJT A;  2EQX A;  5G05 C;  4AIF A;  4UWK A;  1INZ A;  1E8X A;  2BTD A;  3QKY A;  3JCK C;  3R9A B;  4FAD A;  4ACK A;  4CEM A;  3FWV A;  1E7V A;  2J4D A;  2KZT B;  4CDM A;  2IOS A;  4KYO B;  4I6J A;  3FUD A;  3I3N A;  3CVW A;  3MV3 B;  3ZHE A;  3FUM A;  2I2O A;  4OVV A;  5ENN A;  3TXM A;  4LRZ A;  3R7R A;  2WXN A;  3TG5 A;  3AS8 A;  1E8W A;  3IHV A;  2AXU A;  4ILH B;  3SGH A;  2AXZ A;  4CT4 A;  3L6A A;  4LEU A;  2PQN A;  4NRH B;  3U64 A;  3UUX A;  2WXH A;  4AJW A;  4WWO A;  1H19 A;  1OWP A;  1U3D A;  3ZYM A;  3KEZ A;  4I9C A;  5KJL A;  4F53 A;  2QY7 A;  3LKU A;  1H2U A;  1KT0 A;  3DPD A;  4I43 A;  2KCK A;  2P58 C;  4KMO A;  1MQS A;  5A23 A;  2AW6 A;  4AM9 A;  3MA5 A;  4GB9 A;  2BUG A;  1H2T C;  4C0E A;  2VGX B;  4URK A;  3QDN A;  4B94 A;  5BT1 A;  3ZEF A;  4EZJ A;  4G11 A;  2E2E A;  3FTX A;  4C0M A;  4OVU A;  3FUI A;  3RIB A;  2GRM A;  1HH8 A;  4DI3 A;  1NA0 A;  4AEZ C;  5FZR A;  1QZ2 A;  2WM9 A;  3OXF A;  3T5V A;  2FEZ A;  3S2A A;  2AXV A;  2FI7 A;  3LCA A;  3SI5 A;  4B8A A;  4EPZ A;  1JWG A;  1SZA A;  4L7T A;  4XIF A;  4XE0 A;  2V0P A;  4UI9 C;  3FU5 A;  3TL5 A;  1HU3 A;  3VTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...