1JPLA

Gga3 vhs domain complexed with c-terminal peptide from cation-independent mannose 6-phosphate receptor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
161
structure length
161
Chain Sequence
b'AMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
publication title Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 55
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1jplA00
2DCPA 2MOWA 1INZA 4FU3A 1JPLA 5CMYA 1EYHA 3RRUA 3ZYQA 2V8SE 3G2WA 1PY1A 4FLBA 1HX8A 2L0IA 1MHQA 2L0TB 1SZAA 2KM4A 3D9NA 5CMWA 1UJKA 4AVXA 3G2TA 2QY7A 1HFAA 3G2SA 5LP0A 4GZDA 3D9PA 3ZYKA 1HF8A 3D9MA 3D9OA 3LDZA 1JWFA 4Q96A 4GZCA 1UJJA 3D9LA 3ONLA 4HFGA 3D9JA 3G2VA 4NACA 1HG2A 5LOZA 3ZYMA 1HG5A 3ONKA 3G2UA 3ZYLA 1JWGA 1LF8A 1H0AA 1XGWA 1DVPA 2BF0X 1X5BA 3D9KA 4JXTA 2DIWA 3D9IA 4Q94A 5J08A 1JUQA 1SZ9A 3CLJA 1ELKA 1EDUA 2LO6A 1VDYA
chains in the Genus database with same CATH superfamily
4AXHA 2VGEA 3PUKA 3RK6A 5AJLA 3LXUX 3CVYA 2OCCE 3MKRA 3PREA 4TXRA 5CCMA 3NZSA 4BSZB 3L6AA 4CDRA 4HRLA 3CVUA 3CEQA 3DSSA 2XZTG 2IO3C 3I5PA 3ML8A 3G2TA 3C3QA 4BEPA 3B7TA 2H6FA 2DYRE 1N9AA 3TWUA 2XRYA 5EN5D 3ASNE 3LY9A 2LSVA 3FHEA 3P1UA 3CVVA 3LYAA 4TUMA 4MRUA 1S0PA 2VSYA 5ENSD 2P2CP 4PUCA 3ZYKA 4XEIG 4FJZA 5E76A 1KZOA 3PZ1A 5HKPA 3ZU7B 5BPPA 2DWZA 3P2BA 2HE0A 3L13A 4NRHB 1UN9A 3PZDA 2B0OE 4ILGA 5EYLA 4JPSA 1FT1A 3ZHEA 4KYOB 4JEHA 3UINC 2XCBA 3FUDA 1H0AA 2C0MA 1OCRE 2GGFA 1BI7B 1WDYA 4GTTA 3Q9UC 3RIBA 3UIOC 2Y69E 4L9PA 1TNYA 2I6HA 3DXMG 1Y6IA 4HI8A 3ZXSA 1IQRA 3DEPA 2BTDA 1NP7A 2PZIA 4AIFA 2Y0BG 3FU0A 2RKKA 4AV7A 3S7DA 4G8LA 3S7BA 2X3MA 2R17C 4L1BA 1E8YA 3QNKA 4J8FA 4URKA 1DC2A 1ELWA 2AXZA 1OT8A 2P9UG 3CIAA 2E2EA 3L54A 4WUYA 3CLJA 3FEXA 2AVPA 4GYWA 4W9RA 1SW6A 3Q75A 3SF4A 4GTOA 4K5CA 4N5QA 4YNDA 3UKUG 3JQ0A 4HI9A 1UJKA 4N39A 2ZISA 3CQGB 1DCQA 4GTMA 4FULA 1QNFA 1ZB1A 5ARGA 1TR4A 4DLQA 1KZPA 4DX1A 4YDWA 4A1SA 5BUZA 4JC8A 2IY0C 3AG3E 2L9BA 4N3AA 2PL2A 4HOUA 2R03A 4DLOA 5DBKA 4U0SA 4C0MA 1Z3XA 3IBEA 1E90A 3TAXA 2WPVA 1IHGA 3ZW3A 5FTPA 4N3BA 2UY1B 4Y6WA 5D2MC 4N5CA 2UY1A 4FP7A 4I1OB 1SZ9A 4H7XA 3NAWA 4WNDA 3KEZA 3RSEG 1YCSB 2J8SD 1Z3YA 5C1DA 1JWFA 2VYIA 2VGXB 3EHRA 2FEZA 3IEGA 5FQ7A 2VGXA 4F1SA 2KATA 4DRXE 1INZA 5JJ7A 2PQNA 3LY8A 4I9CA 4G1TA 1N4PA 2XS1A 4DX6D 3OAWA 2WQHA 1MZCA 3K9IA 2RFMA 4GZCA 3BEEA 1PC2A 1GW6A 2WXHA 3I4RB 3FUIA 3BQOA 3CHPA 1Z6TA 4B8CB 3T5VA 4MLPA 3UT8A 1N0RA 3ULEG 5KCMA 4IRUA 4U95D 4Z68A 2GRRB 2H6HA 3FTWA 3PE3A 4JZYA 4AM9A 4F3VA 5EIBE 2IJGX 4N2QA 4DPRA 3PVLA 1P5QA 4HS2A 3PE4A 3BU8A 4LSZE 2ZXWE 2XPZA 4GA0A 4WNGA 1TEZA 1TYQG 4IULA 3FUKA 2XENA 3CSTA 2WXIA 1K3ZD 3C72A 4U8YD 3ESLA 2WXFA 3HXEA 3CHMA 3IHVA 4I9EA 3RKVA 3FTZA 2P9KG 4D10C 4HOSA 3R9AB 1W3BA 3MV2B 3HG0D 2XGSA 3J5QB 2CFZA 3IKOB 3ASOE 3ZRHA 4ATGA 4JXTA 3D9IA 4BESA 4XIFA 3FUFA 3DBSA 1VDYA 3W9GA 4FADA 2P9PG 4I2ZA 3EIJA 1SVXA 4YDEA 4B89A 3AU5A 5CBOA 3DSUA 4GZ6A 4B8AA 3BG1B 2QYJA 4O6FA 5M72A 5IY5E 2FF4A 5JMND 2VSNA 3KSLA 3MZLB 5CECB 5ENOD 1D8DA 2XGOA 1FVFA 3JYSA 3E34A 4UQZA 5EX3A 3APDA 3PZ2A 2FBNA 4WAFA 3LPZA 4JD2G 4AEZC 2VSOE 4JW1A 5ENRD 4GMRA 1HX8A 1TNUA 3BUAA 1MX2A 4GZDA 4BETA 5G05J 2WXKA 3EDTB 1BLXB 3FFLA 2KBXA 4TXPA 2F37A 3SNXA 1NZNA 5J08A 4RVBA 4FLHA 2CG3A 1N11A 4JB8P 4HORA 2L6JA 3CK9A 3NQPA 4QFVA 3UKRG 3SFYA 5A23A 3JUIA 1Z5SC 4U07A 4K0RA 2R5SA 3ONLA 3D9JA 5HS0A 1HE8A 4BX8A 2J07A 4I1MA 5FJYA 2DIWA 3UX4A 3FU6A 3FTYA 3KS2A 1JCRA 3IV0A 4EQFA 3TXMA 4KVOA 1UJJA 5AQAA 1OWOA 5EKQD 5G2NA 4OAUC 1DVPA 5EIDA 3SFZA 4CGWA 4QQIA 3CV0A 4LRZA 4GB9A 1FCHA 2C2LA 4LNGA 2ETBA 3TJPA 3UUXA 1N4RA 1OWNA 1YYHA 3HXBA 2VQ2A 4L2YA 2I1KA 4GA1A 1V55E 3ONKA 1O1SA 4ILIA 4UWKA 4Q94A 3C3RA 5T4YA 3ASGA 3RRUA 4TUUA 2CFUA 5G55A 2VTBB 4F7AA 1LD8A 4LCTA 3HXDA 3RO2A 2XHEA 4GCOA 3SD5A 2LAHA 3FTXA 2VJ8A 3SBSA 3ZEFA 3ZXPA 3OTNA 1LTXA 2AW6A 3KAEA 2XCCA 3BG0B 1O1RA 3ULYA 3W9FA 1SQMA 4GTRA 3WG7E 3B7BA 2WXNA 1AWCB 3FU3A 4CT4A 3ABLE 4AY6A 4GZ5A 2PM7A 2V8SE 3GYZA 3FP3A 3MV3B 5BXUA 3JQ1A 1UG3A 3FH7A 1FT2A 5LFAA 4UQXA 3O4ZA 2LUHA 4AY5A 2P9NG 4WWOA 2RD0A 4CRWA 2HYZA 4PS7A 1EPUA 2MRIA 3U64A 3LVQE 5J90A 5ARFA 3TG4A 1SA4A 2JEKA 4BFRA 3HVEB 1U3CA 5D66A 3VLEA 1QQEA 4WNFA 3HVEA 2WXJA 4KVMA 4V3IA 4OYSA 1X81A 1HG2A 4XX5A 1OCCE 2AWIA 4J6IA 3CKBA 1ZBPA 4CCAA 2LO6A 1JCSA 2J9QA 2WMNA 4I1AA 4CYMD 3UIPC 2KM4A 5CMWA 4PS3A 1WM5A 1MX4A 4HOTA 2X38A 2KC7A 5A7DB 4ZHBA 3CK7A 4J8SA 3DXKG 3KSQA 2R05A 4XI0A 4C48B 2BKGA 2R02A 1QBQA 3FH8A 1WAO1 3MA5A 2J08A 4G11A 2FO1E 3RAUA 5BNWA 2KCKA 1N95A 2XEEA 3LKUA 3SZ7A 3FULA 1U2VG 1NFIE 5JHBA 1OWPA 2BUGA 4BTBA 4A3VA 3CVPA 2F8XK 3ML9A 1TN7A 5EYPF 4DI3A 5ANLA 1OY3D 2J4BA 5KNGA 3SBTB 3CVWA 4GCNA 3PRZA 4AVXA 2QY7A 3VLDA 4BSXA 2GRLA 4C9BB 4AJWA 3B13A 4HQDA 5JHAA 1KT0A 4E85A 1EDUA 3IXEA 4BWRA 4J8DA 3U66A 3DWLG 4GZ3A 4YDYA 4FJYA 2GRQB 4I6EA 5KNHD 2LNIA 3NF1A 1MYOA 5KJLA 4IN3B 4IYPA 4HNAD 3ZNGA 1H6KA 3AS4A 2KCLA 2Y4TA 3ASFA 1RW2A 2IQCA 5LOZA 4R7LA 4U96D 3PH0C 4J8EA 4JHJA 4L7TA 3ESKA 4LEUA 2AXUA 2WXQA 3SO8A 3ABME 5LCWC 3T8MA 3SHFA 2V4HC 3QB2A 3GZSA 2MYOA 3HHMA 4EZJA 5ENPD 4B0ZA 3TWVA 1NA0A 1MJ0A 1N4SA 5ENQD 3IHYA 2NYJA 4AOFA 3EU9A 3V30A 3TL5A 2ZGGA 4U8VD 3PZ3A 3UM0A 1X5BA 1A5EA 3MGBA 1IQUA 2BKKB 3ZVVA 5AQ9A 5CEAA 4BERA 3U9WA 3CVNA 2LXLA 3FEYA 2DZNA 4J8YA 3FH5A 3D3MA 3V2XA 2WXOA 4O1OA 1HG5A 3ZYLA 5KJMA 2J49A 4NURA 4UWGA 3EU5A 3CGHA 2GRPB 3Q9NC 4XZ4A 4LERA 2QZAA 4RSYA 3RU0A 1E7UA 3QARA 2A5EA 3SI5A 5LX8A 3QOUA 5CCLA 1N54A 1NA3A 4L2LA 1FPPA 1E8XA 5HRYA 4HLLA 3ASDA 4GA2A 5CRUA 4KMOA 4JEUA 3EHNA 4LNUD 3T8KA 1KT1A 4U04A 1HFAA 3CVLA 3QC1A 5A6CA 2V0PA 3Q7FA 1NL4A 3EHQA 3FU5A 4OVVA 4ACLA 4MS6A 4WWPA 3FUEA 4ATZD 1FVHA 4EBAG 1O1TA 4ANUA 4GYYA 2PQRA 3NOGD 3LJ3A 3E30A 2XEHA 5EILA 1EYHA 2WVIA 4MKTA 3FUJA 4YVQC 4DI4A 4PH4B 4B94A 1OXJA 3X2QE 2R59A 2GRNB 1HF8A 3Q15A 2ZGDA 3PNLB 4NQ0A 1DCEA 3ZPJA 3ZIMA 5DIZA 4BT8A 3EIQC 4UUCA 4DUIA 4XI9A 3RJVA 4FU3A 1E8ZA 3ABKE 4PS8A 3L16A 4OVUA 5AN8A 1SZAA 4BY6A 3PS6A 5B1AE 3ZUVB 5D0OD 1H19A 2NC9A 3UPVA 4CDNA 4G8KA 3Q78A 4ACKA 3S2AA 2OV8A 1HO8A 4BTAA 2YHEA 3AS5A 3B95A 5KWDA 5T3RA 4F1PA 3VTXA 2FO7A 2KXPC 2AXVA 5C2YA 3HXFA 3R9MA 1PAQA 3APFA 2BEDA 1E7VA 5AQ7A 3HYMB 3OXGA 2VSXE 3TWTA 2HR2A 5FIOA 3O48A 3TXNA 2EQXA 5AYWD 3NB2A 2EIME 1Y8MA 4J7WA 4H7YA 5FWQA 2ZIRA 3FTVA 4I43A 2BF0X 5KBAA 3QWWA 4F6RD 3PUJA 4K03A 2CG2A 3CR3A 3PNTB 3NBNB 2PNNA 5KJKA 2GROB 2CHXA 4FHJA 3JUEA 3R7RA 3EHMA 4Q69A 4F53A 5HQ8A 3EUVA 3L22A 4O60A 1H2TC 5ITZF 5G04C 3B7UX 4P29A 4CGVA 2EINE 2JLBA 4GMJA 3EJNA 3DRAA 4ANVA 4UI9C 2F8YA 4NACA 5E75A 3FUNA 1LF8A 5AAOA 3PDNA 1D9SA 4U63A 2XZDG 4L23A 3FUHA 4DK5A 4DX2A 2LXMA 5B1BE 4ME2A 3UTMA 3CQCB 4UWLA 4JVSA 3FWVA 5ENNA 3CHRA 2WXGA 3RRMB 2ETAA 4HRMB 4HLEA 3CHQA 3MEKA 3C3OA 2QC9A 4HXIA 2QFCA 2HM8A 3CHOA 2I1JA 4A55A 3TGOA 1S70B 2VTBA 3OXLA 2XQ0A 3Q7AA 4NIKA 5AQBA 5FZRA 3QWVA 2EILE 4EBAA 3E33A 3FY4A 3OXFA 3TWSA 3UM2A 3V31A 3AAAC 3D9PA 2QYUA 3PZ4A 1BPOA 4TRQA 2WQ7A 3SFXA 4KBQA 1YMPA 1YA0A 5G05C 2V5QC 4AP2A 1IHBA 2EIJE 2MOWA 2WM9A 3F6QA 3DSWA 3PEUB 1NI1A 2XGMA 5BV1A 3C98A 2P9IG 4K5BA 1WY6A 4GMLA 2LAIA 3E32A 2V4LA 5FZQA 5CRVA 4U8HA 2OVFA 1JPLA 3L17A 3CVXA 2IONA 4N3CA 4RG6A 5EX0A 3G2SA 3MJWA 1OWMA 3DEOA 3GW4A 2HO1A 2I2OA 3DPDA 2H6GA 4UI9K 4G23A 3TG5A 3FUMA 3AG1E 4M7CA 3UT4A 3UQ3A 3CHSA 5H7PA 3VTYA 3ZHEB 1S63A 3ZGQA 2M63A 5FQ6A 3LDZA 1MX6A 5FZSA 3RO3A 3D9LA 2XRZA 3QK0A 1E96B 3KD7A 1TJFA 4GPMA 1TNOA 1Q2ZA 4LUNU 1UOHA 4ANWA 3I3NA 1QYMA 3J5PA 5FINA 3PEVB 3T9KA 4TV3A 1TN6A 3SQVA 3CKCA 1KPSB 4HRNA 4DX7D 5AARA 5LCWJ 1TN8A 4EZLA 1AP7A 3JCKC 3L82A 4JA9A 2GRMA 4BT9A 3I4GA 1JCQA 4GPKA 3HRAA 2YINA 4A63B 4GTQA 1K8KG 2H6IA 2XPIA 2X6KA 4BX9A 1EF1C 2R2LA 2IOSA 4YDOA 3CVQA 3NZUA 4CEMA 4FA6A 1HXIA 5B3SE 1U3DA 3FDHA 1UN8A 1D8EA 3UXGA 1HS6A 1N0QA 1B89A 3D9OA 3S7JA 3ULQA 2J09A 3FTUA 4XE0A 2FI7A 2A5UA 1RZ4A 3Q4AB 3ZN3A 1IYGA 4HOQA 4GAAA 3QJZA 5AJDA 3T5XA 3AG4E 4U0UA 2CHWA 4LG6A 2DBAA 3S7FA 1IKND 4CDMA 3RRNB 5JA4D 1BD8A 3B7SA 3G2VA 1SA5A 1JWGA 2PM6A 2J4DA 4KZ0A 2DVWA 4UQYA 2DZOA 5T8IA 4TXQA 4A3TA 3UM1A 1K1BA 1TNZA 3HIZA 3LS8A 4HFGA 3TWXA 2WMOA 1L5JA 2Y4UA 2WXRA 2XS8A 3E37A 3QKYA 2VGYA 4EZKA 4YVOA 4A1GA 3KEAA 3AG2E 4UWFA 4JHRA 4WNEA 3JXIA 2IU1A 4RG9A 5CBNA 3GZ2A 5ENTD 4XKBA 4HB5A 4GTVA 2RG8A 3SGHA 3DSVA 3QDNA 5AENA 4MBGA 4G2VA 3ZKJA 2WQ6A 3HXCA 5FQ8A 2LSUA 3HDXA 5CMYA 4OAVB 1H6OA 1E8WA 4RQIA 1HU3A 3R7QA 3V2OA 3CK8A 2ZU6B 1ELRA 4K5AB 4RLYA 3TWWA 1OUVA 3GZ1A 3MYVA 4HVBA 4I17A 3B7RL 4PDXA 2GW1A 2OEWA 3VLFA 3CSFA 1V54E 2IOLA 1K1AA 2Y3AA 1S64A 3UMVA 2XPYA 3MCXA 4M3OA 4Y6CA 1H2UA 1H2VC 3MX3A 4I6GA 4N2SA 4ZFHA 3ZYMA 2RFAA 5BXOA 4B93B 3Q79A 5JJ6A 3UI2A 3ZFWA 1WG0A 3AS8A 2KZTB 4APFA 5LP0A 5CHEE 3QAQA 2Y1LE 2KZTA 3D9MA 4U7EB 4O1PA 5G04J 3JXJA 4FHKA 1KLXA 1H6PA 2YQ8A 2B6CA 2IF4A 3U3WA 2ILRA 4DJAA 4UI9J 4WWNA 4FLBA 1N4QA 1PY1A 1QZ2A 2X6FA 2L0TB 4ANXA 1O5MA 5FQ4A 2KCVA 2X6JA 1IXVA 3L08A 1TNBA 3UM3A 4X8QA 3WXXA 3Q73A 4G25A 1BI8B 3NOCD 1MQSA 4DX5D 3ASHA 4HBDA 3APCA 3LEWA 2L6BA 3LVRE 3TWQA 5D0QD 3UT7A 5CERB 2CHZA 3AJIA 3Q5MA 4I6JA 1ELKA 3AU4A 3SY2A 5BT1A 3LY7A 3G2WA 4EHMA 4GYOA 2L0IA 1MHQA 2OEVA 4ILHB 3V79K 2OVBA 1OCZE 1HZ4A 3MKQB 4EECA 2MHKA 2YHCA 3MKQA 2C0LA 1JUQA 5JJTA 1OCOE 4KZCA 5KJNA 3DPYA 3N71A 3Q49B 5AIJA 2AJAA 4KXKB 4I2WA 3URZA 3ZYQA 3DSXA 3U4TA 4J0UA 4KT6B 4APOA 1A17A 2OOEA 2WXPA 2DYSE 2NXPA 1HH8A 3D9HA 2E0IA 3ISMC 1XNFA 5BV0A 2ETCA 1XGWA 3C5RA 2FULA 2IFUA 3LCAA 5ANRA 2X6IA 2Q7FA 3DSTA 3TWRA 3FTSA 4JL0A 4E6HA 3ENEA 3E4BA 2X6HA 5EDSA 2F0YA 2JABA 4UWHA 3G2UA 5FT9A 4ABNA 3Q47B 3D9KA 1ZU2A 4JA7A 2P9SG 1G3NB 5BW8C 2ONDA 2IO2C 2YNQA 4FC8A 4XKCA 3D9NA 4GTPA 1LD7A 4G26A 4Q96A 5HI7A 2UWJG 2NSZA 1N52A 2P9LG 2WB2A 2DCPA 2WXMA 2I9CA 4JHKA 4G24A 2EIKE 1DNPA 4C0EA 1N94A 2XEVA 3L9TA 4U0ZA 4CZ2D 4EPZA 2P58C 1BU9A 2WXLA 2A4ZA 2V5FA 1UW4B 4GU5A 4LNBA 3LJNA 2IEJA 4GTSA 4CT0A 1OWLA 5CEDB 1TJCA 3QWPA
chains in the Genus database with same CATH topology
4AXHA 3ZVVA 2FF4A 2YINA 3U9WA 3CVNA 3FEYA 3PUKA 2VSNA 3RK6A 5AJLA 3LXUX 3CVYA 2XPIA 3MKRA 3PREA 2X6KA 3FH5A 3D3MA 2WXOA 4BX9A 5CCMA 3MZLB 3NZSA 1EF1C 2IOSA 3CVQA 3L6AA 2XGOA 1HG5A 3NZUA 4CEMA 3ZYLA 4CDRA 4FA6A 5KJMA 3CVUA 1FVFA 3JYSA 3CEQA 2J49A 4UQZA 1HXIA 4NURA 5EX3A 3APDA 2FBNA 4UWGA 4WAFA 3CGHA 3LPZA 1U3DA 4AEZC 4XZ4A 2VSOE 3FDHA 4JW1A 4LERA 1UN8A 4RSYA 1HX8A 3RU0A 1E7UA 3I5PA 3QARA 3SI5A 3ML8A 1HS6A 3G2TA 1B89A 4GZDA 5LX8A 3B7TA 3D9OA 3QOUA 2WXKA 5G05J 5CCLA 1N54A 3S7JA 3ULQA 2J09A 3EDTB 3FTUA 1NA3A 2XRYA 4L2LA 3FFLA 1E8XA 4XE0A 2FI7A 3SNXA 2A5UA 1NZNA 5J08A 4RVBA 3LY9A 2LSVA 3ASDA 3FHEA 3P1UA 3Q4AB 4FLHA 4GA2A 2CG3A 3ZN3A 3CVVA 1IYGA 4HOQA 3LYAA 4GAAA 4KMOA 4MRUA 2L6JA 3CK9A 3NQPA 1S0PA 3QJZA 4QFVA 5AJDA 4HORA 4JEUA 3T5XA 3EHNA 4U0UA 2CHWA 2VSYA 5A23A 1KT1A 4U04A 1HFAA 2DBAA 4PUCA 3S7FA 3JUIA 3ZYKA 3CVLA 3QC1A 5A6CA 4U07A 2V0PA 4K0RA 4FJZA 2R5SA 4CDMA 5E76A 3RRNB 3ONLA 3B7SA 3D9JA 3G2VA 3FU5A 4OVVA 4ACLA 1HE8A 4MS6A 4WWPA 2J07A 4BX8A 3FUEA 4I1MA 5FJYA 1FVHA 4EBAG 1JWGA 2PM6A 2DIWA 5BPPA 3UX4A 4ANUA 2J4DA 3FU6A 4GYYA 4KZ0A 3P2BA 3FTYA 2PQRA 3KS2A 3L13A 4NRHB 3LJ3A 1UN9A 1EYHA 2WVIA 4UQYA 4MKTA 3FUJA 3IV0A 4YVQC 5T8IA 4DI4A 4EQFA 4PH4B 4A3TA 3TXMA 3PZDA 4KVOA 4B94A 2R59A 4ILGA 1HF8A 4JPSA 3HIZA 3Q15A 3ZHEA 4KYOB 1UJJA 3LS8A 1OWOA 4HFGA 3PNLB 4JEHA 5EKQD 5G2NA 4NQ0A 2WMOA 2XCBA 3ZPJA 3FUDA 3ZIMA 1H0AA 5DIZA 1DVPA 4BT8A 2C0MA 3EIQC 2GGFA 1L5JA 3SFZA 2Y4UA 2WXRA 4CGWA 4XI9A 3RJVA 3QKYA 4FU3A 2VGYA 4EZKA 4YVOA 3RIBA 1E8ZA 3CV0A 4A1GA 4LRZA 4PS8A 4UWFA 4GB9A 3L16A 1FCHA 2C2LA 4JHRA 4WNEA 4OVUA 1SZAA 3TJPA 3UUXA 2IU1A 2I6HA 1OWNA 4BY6A 3PS6A 2VQ2A 1Y6IA 4RG9A 4L2YA 3GZ2A 2I1KA 4XKBA 5D0OD 1H19A 3ZXSA 4GA1A 1IQRA 2NC9A 3UPVA 4CDNA 2RG8A 3ONKA 3SGHA 3QDNA 5AENA 4ILIA 4G2VA 4Q94A 4UWKA 2WQ6A 5FQ8A 4ACKA 2BTDA 1NP7A 2LSUA 2PZIA 4AIFA 5T4YA 3ASGA 3S2AA 3HDXA 3FU0A 2OV8A 1HO8A 5CMYA 3RRUA 4BTAA 2YHEA 3AS5A 4AV7A 3S7DA 4TUUA 2CFUA 5G55A 5T3RA 3VTXA 1E8WA 2VTBB 3S7BA 2X3MA 1HU3A 4F7AA 2FO7A 2R17C 4LCTA 3R7QA 3RO2A 2AXVA 2XHEA 3CK8A 4GCOA 4L1BA 3SD5A 2LAHA 3FTXA 1E8YA 2VJ8A 3QNKA 4J8FA 3SBSA 5C2YA 4URKA 1PAQA 3APFA 3ZEFA 1ELWA 1E7VA 3OTNA 2AXZA 2AW6A 2ZU6B 3HYMB 3CIAA 3KAEA 2E2EA 2XCCA 3L54A 3OXGA 4WUYA 1ELRA 2VSXE 3CLJA 3FEXA 2AVPA 1OUVA 2HR2A 3BG0B 3GZ1A 3MYVA 4GYWA 4W9RA 4HVBA 3O48A 3TXNA 2EQXA 3SF4A 4I17A 3B7RL 4PDXA 4YNDA 5AYWD 2GW1A 3JQ0A 1Y8MA 3VLFA 1UJKA 4H7YA 4N39A 5FWQA 3CSFA 3CQGB 1SQMA 2IOLA 2Y3AA 4FULA 1QNFA 3UMVA 2WXNA 3FTVA 2XPYA 4I43A 5ARGA 2BF0X 3MCXA 4DLQA 3FU3A 4M3OA 4CT4A 3QWWA 4Y6CA 1H2UA 4AY6A 3PUJA 4GZ5A 2PM7A 4K03A 4A1SA 2V8SE 4JC8A 5BUZA 3GYZA 3FP3A 2CG2A 3CR3A 1H2VC 3MV3B 3MX3A 3PNTB 4I6GA 4N2SA 3JQ1A 1UG3A 3FH7A 4GPKA 5LFAA 4UQXA 3O4ZA 5KJKA 4AY5A 2L9BA 2CHXA 4N3AA 3ZYMA 4FHJA 4WWOA 2RD0A 2PL2A 4HOUA 3EHMA 3R7RA 2HYZA 4CRWA 4Q69A 4DLOA 5DBKA 4F53A 4U0SA 5HQ8A 4PS7A 4C0MA 1EPUA 1Z3XA 2MRIA 3U64A 3L22A 3IBEA 1H2TC 3LVQE 1E90A 5J90A 5ARFA 3B7UX 5G04C 3TG4A 4P29A 3TAXA 2WPVA 5JJ6A 4CGVA 2JLBA 4GMJA 2JEKA 3EJNA 3ZFWA 1IHGA 4BFRA 3HVEB 3ZW3A 3AS8A 2KZTB 5FTPA 4APFA 4N3BA 1U3CA 3VLEA 1QQEA 4WNFA 3HVEA 3QAQA 5CHEE 5LP0A 2WXJA 2KZTA 3D9MA 4KVMA 4V3IA 4ANVA 4UI9C 4OYSA 2UY1B 4Y6WA 4NACA 1HG2A 5E75A 5G04J 4N5CA 4XX5A 3FUNA 2UY1A 4FHKA 1LF8A 1KLXA 4FP7A 2AWIA 2YQ8A 4I1OB 4J6IA 3PDNA 1SZ9A 4U63A 2IF4A 3U3WA 4H7XA 4WNDA 2ILRA 1ZBPA 3CKBA 2LO6A 4CCAA 3KEZA 4L23A 3FUHA 4DJAA 4DK5A 4UI9J 2J9QA 2WMNA 4WWNA 4FLBA 1PY1A 1QZ2A 4I1AA 2X6FA 2L0TB 4ANXA 2KM4A 5CMWA 4PS3A 1WM5A 1Z3YA 4ME2A 5FQ4A 2KCVA 2X6JA 3CQCB 4HOTA 4UWLA 5C1DA 4JVSA 3FWVA 1JWFA 5ENNA 3CHRA 2VYIA 2WXGA 2X38A 3L08A 2VGXB 2FEZA 2KC7A 5A7DB 3CK7A 3IEGA 5FQ7A 3RRMB 2VGXA 4F1SA 2KATA 3WXXA 4J8SA 1INZA 4G25A 4HLEA 5JJ7A 2PQNA 3CHQA 4XI0A 1MQSA 3LY8A 3MEKA 4I9CA 4G1TA 4HXIA 2QFCA 3ASHA 3APCA 3LEWA 3OAWA 2HM8A 3CHOA 5M72A 2I1JA 4A55A 2WQHA 3TGOA 3K9IA 2VTBA 3FH8A 1WAO1 4GZCA 3MA5A 3BEEA 3LVRE 3OXLA 1PC2A 2XQ0A 1GW6A 2J08A 2WXHA 4G11A 5D0QD 3UT7A 5FZRA 3QWVA 3I4RB 5BNWA 2CHZA 2KCKA 3Q5MA 4I6JA 1ELKA 3FY4A 3OXFA 4EBAA 3FUIA 3AU4A 3CHPA 5BT1A 1Z6TA 3LKUA 4B8CB 3T5VA 3LY7A 3G2WA 4GYOA 2L0IA 1MHQA 4MLPA 3UT8A 3SZ7A 5KCMA 3FULA 4ILHB 4IRUA 2OVBA 3D9PA 5JHBA 1OWPA 2BUGA 1BPOA 4TRQA 4BTBA 2WQ7A 4A3VA 3CVPA 1HZ4A 4KBQA 3FTWA 3MKQB 3ML9A 4EECA 3PE3A 2MHKA 2YHCA 4JZYA 4DI3A 5ANLA 4AM9A 4F3VA 3MKQA 1YA0A 5G05C 2C0LA 1JUQA 4AP2A 5JJTA 4KZCA 2J4BA 5KJNA 3N71A 2IJGX 3Q49B 2MOWA 5AIJA 4KXKB 3SBTB 3CVWA 4I2WA 3URZA 4N2QA 3ZYQA 4GCNA 4DPRA 3U4TA 2WM9A 3PRZA 4J0UA 3PVLA 4KT6B 4AVXA 4APOA 2QY7A 3VLDA 1A17A 1P5QA 4BSXA 3PEUB 2OOEA 2GRLA 2XGMA 2WXPA 4HS2A 3C98A 3PE4A 2NXPA 4C9BB 5BV1A 1HH8A 2XPZA 4GA0A 4WNGA 2E0IA 4AJWA 1XNFA 3B13A 5BV0A 1WY6A 4GMLA 1XGWA 2LAIA 5JHAA 1TEZA 2FULA 5FZQA 1KT0A 2V4LA 2IFUA 3LCAA 5ANRA 4E85A 2X6IA 1EDUA 4IULA 3FUKA 4U8HA 4BWRA 2Q7FA 2OVFA 4J8DA 3FTSA 3CSTA 1JPLA 3U66A 3L17A 2WXIA 3CVXA 4JL0A 4E6HA 2IONA 4N3CA 4RG6A 5EX0A 3ENEA 4GZ3A 3G2SA 3E4BA 4FJYA 2X6HA 3MJWA 3ESLA 5EDSA 2WXFA 1OWMA 3GW4A 2HO1A 3CHMA 3IHVA 4I9EA 2I2OA 3DPDA 4I6EA 4UWHA 3RKVA 3FTZA 3G2UA 5FT9A 4ABNA 4UI9K 3Q47B 2LNIA 3D9KA 4G23A 3TG5A 4D10C 4HOSA 1ZU2A 3FUMA 3NF1A 4JA7A 3R9AB 3UT4A 3UQ3A 5KJLA 1W3BA 4IN3B 5BW8C 4IYPA 2ONDA 2YNQA 3CHSA 4FC8A 1H6KA 3D9NA 3MV2B 4XKCA 3VTYA 3ZHEB 2XGSA 3ZGQA 2M63A 5FQ6A 3AS4A 2KCLA 2Y4TA 4G26A 3LDZA 3ASFA 4Q96A 5FZSA 5HI7A 3RO3A 2UWJG 3D9LA 2IQCA 2NSZA 2CFZA 4R7LA 5LOZA 3IKOB 3PH0C 4J8EA 4JHJA 1N52A 2XRZA 4L7TA 3ESKA 1E96B 3QK0A 2AXUA 2WXQA 3KD7A 4LEUA 1TJFA 3ZRHA 4JXTA 4ATGA 4LUNU 3D9IA 4ANWA 2WB2A 5LCWC 3T8MA 3SHFA 4XIFA 3I3NA 3FUFA 3DBSA 1VDYA 2DCPA 3QB2A 3GZSA 4FADA 2WXMA 3PEVB 3HHMA 4EZJA 4I2ZA 4TV3A 2I9CA 4JHKA 4G24A 4B0ZA 3EIJA 1DNPA 3CKCA 4C0EA 2XEVA 1NA0A 4U0ZA 5LCWJ 4EPZA 3IHYA 2P58C 4EZLA 4AOFA 4B89A 3AU5A 2WXLA 2A4ZA 4GZ6A 2V5FA 3TL5A 1UW4B 3BG1B 4B8AA 3JCKC 4GU5A 1X5BA 3MGBA 4CT0A 4JA9A 2GRMA 4BT9A 1IQUA 1OWLA 3I4GA 1TJCA 3QWPA 4O6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DCP A;  2MOW A;  1INZ A;  4FU3 A;  1JPL A;  5CMY A;  1EYH A;  3RRU A;  3ZYQ A;  2V8S E;  3G2W A;  1PY1 A;  4FLB A;  1HX8 A;  2L0I A;  1MHQ A;  2L0T B;  1SZA A;  2KM4 A;  3D9N A;  5CMW A;  1UJK A;  4AVX A;  3G2T A;  2QY7 A;  1HFA A;  3G2S A;  5LP0 A;  4GZD A;  3D9P A;  3ZYK A;  1HF8 A;  3D9M A;  3D9O A;  3LDZ A;  1JWF A;  4Q96 A;  4GZC A;  1UJJ A;  3D9L A;  3ONL A;  4HFG A;  3D9J A;  3G2V A;  4NAC A;  1HG2 A;  5LOZ A;  3ZYM A;  1HG5 A;  3ONK A;  3G2U A;  3ZYL A;  1JWG A;  1LF8 A;  1H0A A;  1XGW A;  1DVP A;  2BF0 X;  1X5B A;  3D9K A;  4JXT A;  2DIW A;  3D9I A;  4Q94 A;  5J08 A;  1JUQ A;  1SZ9 A;  3CLJ A;  1ELK A;  1EDU A;  2LO6 A;  1VDY A; 
#chains in the Genus database with same CATH topology
 4AXH A;  2VGE A;  3PUK A;  3RK6 A;  5AJL A;  3LXU X;  3CVY A;  2OCC E;  3MKR A;  3PRE A;  4TXR A;  5CCM A;  3NZS A;  4BSZ B;  3L6A A;  4CDR A;  4HRL A;  3CVU A;  3CEQ A;  3DSS A;  2XZT G;  2IO3 C;  3I5P A;  3ML8 A;  3G2T A;  3C3Q A;  4BEP A;  3B7T A;  2H6F A;  2DYR E;  1N9A A;  3TWU A;  2XRY A;  5EN5 D;  3ASN E;  3LY9 A;  2LSV A;  3FHE A;  3P1U A;  3CVV A;  3LYA A;  4TUM A;  4MRU A;  1S0P A;  2VSY A;  5ENS D;  2P2C P;  4PUC A;  3ZYK A;  4XEI G;  4FJZ A;  5E76 A;  1KZO A;  3PZ1 A;  5HKP A;  3ZU7 B;  5BPP A;  2DWZ A;  3P2B A;  2HE0 A;  3L13 A;  4NRH B;  1UN9 A;  3PZD A;  2B0O E;  4ILG A;  5EYL A;  4JPS A;  1FT1 A;  3ZHE A;  4KYO B;  4JEH A;  3UIN C;  2XCB A;  3FUD A;  1H0A A;  2C0M A;  1OCR E;  2GGF A;  1BI7 B;  1WDY A;  4GTT A;  3Q9U C;  3RIB A;  3UIO C;  2Y69 E;  4L9P A;  1TNY A;  2I6H A;  3DXM G;  1Y6I A;  4HI8 A;  3ZXS A;  1IQR A;  3DEP A;  2BTD A;  1NP7 A;  2PZI A;  4AIF A;  2Y0B G;  3FU0 A;  2RKK A;  4AV7 A;  3S7D A;  4G8L A;  3S7B A;  2X3M A;  2R17 C;  4L1B A;  1E8Y A;  3QNK A;  4J8F A;  4URK A;  1DC2 A;  1ELW A;  2AXZ A;  1OT8 A;  2P9U G;  3CIA A;  2E2E A;  3L54 A;  4WUY A;  3CLJ A;  3FEX A;  2AVP A;  4GYW A;  4W9R A;  1SW6 A;  3Q75 A;  3SF4 A;  4GTO A;  4K5C A;  4N5Q A;  4YND A;  3UKU G;  3JQ0 A;  4HI9 A;  1UJK A;  4N39 A;  2ZIS A;  3CQG B;  1DCQ A;  4GTM A;  4FUL A;  1QNF A;  1ZB1 A;  5ARG A;  1TR4 A;  4DLQ A;  1KZP A;  4DX1 A;  4YDW A;  4A1S A;  5BUZ A;  4JC8 A;  2IY0 C;  3AG3 E;  2L9B A;  4N3A A;  2PL2 A;  4HOU A;  2R03 A;  4DLO A;  5DBK A;  4U0S A;  4C0M A;  1Z3X A;  3IBE A;  1E90 A;  3TAX A;  2WPV A;  1IHG A;  3ZW3 A;  5FTP A;  4N3B A;  2UY1 B;  4Y6W A;  5D2M C;  4N5C A;  2UY1 A;  4FP7 A;  4I1O B;  1SZ9 A;  4H7X A;  3NAW A;  4WND A;  3KEZ A;  3RSE G;  1YCS B;  2J8S D;  1Z3Y A;  5C1D A;  1JWF A;  2VYI A;  2VGX B;  3EHR A;  2FEZ A;  3IEG A;  5FQ7 A;  2VGX A;  4F1S A;  2KAT A;  4DRX E;  1INZ A;  5JJ7 A;  2PQN A;  3LY8 A;  4I9C A;  4G1T A;  1N4P A;  2XS1 A;  4DX6 D;  3OAW A;  2WQH A;  1MZC A;  3K9I A;  2RFM A;  4GZC A;  3BEE A;  1PC2 A;  1GW6 A;  2WXH A;  3I4R B;  3FUI A;  3BQO A;  3CHP A;  1Z6T A;  4B8C B;  3T5V A;  4MLP A;  3UT8 A;  1N0R A;  3ULE G;  5KCM A;  4IRU A;  4U95 D;  4Z68 A;  2GRR B;  2H6H A;  3FTW A;  3PE3 A;  4JZY A;  4AM9 A;  4F3V A;  5EIB E;  2IJG X;  4N2Q A;  4DPR A;  3PVL A;  1P5Q A;  4HS2 A;  3PE4 A;  3BU8 A;  4LSZ E;  2ZXW E;  2XPZ A;  4GA0 A;  4WNG A;  1TEZ A;  1TYQ G;  4IUL A;  3FUK A;  2XEN A;  3CST A;  2WXI A;  1K3Z D;  3C72 A;  4U8Y D;  3ESL A;  2WXF A;  3HXE A;  3CHM A;  3IHV A;  4I9E A;  3RKV A;  3FTZ A;  2P9K G;  4D10 C;  4HOS A;  3R9A B;  1W3B A;  3MV2 B;  3HG0 D;  2XGS A;  3J5Q B;  2CFZ A;  3IKO B;  3ASO E;  3ZRH A;  4ATG A;  4JXT A;  3D9I A;  4BES A;  4XIF A;  3FUF A;  3DBS A;  1VDY A;  3W9G A;  4FAD A;  2P9P G;  4I2Z A;  3EIJ A;  1SVX A;  4YDE A;  4B89 A;  3AU5 A;  5CBO A;  3DSU A;  4GZ6 A;  4B8A A;  3BG1 B;  2QYJ A;  4O6F A;  5M72 A;  5IY5 E;  2FF4 A;  5JMN D;  2VSN A;  3KSL A;  3MZL B;  5CEC B;  5ENO D;  1D8D A;  2XGO A;  1FVF A;  3JYS A;  3E34 A;  4UQZ A;  5EX3 A;  3APD A;  3PZ2 A;  2FBN A;  4WAF A;  3LPZ A;  4JD2 G;  4AEZ C;  2VSO E;  4JW1 A;  5ENR D;  4GMR A;  1HX8 A;  1TNU A;  3BUA A;  1MX2 A;  4GZD A;  4BET A;  5G05 J;  2WXK A;  3EDT B;  1BLX B;  3FFL A;  2KBX A;  4TXP A;  2F37 A;  3SNX A;  1NZN A;  5J08 A;  4RVB A;  4FLH A;  2CG3 A;  1N11 A;  4JB8 P;  4HOR A;  2L6J A;  3CK9 A;  3NQP A;  4QFV A;  3UKR G;  3SFY A;  5A23 A;  3JUI A;  1Z5S C;  4U07 A;  4K0R A;  2R5S A;  3ONL A;  3D9J A;  5HS0 A;  1HE8 A;  4BX8 A;  2J07 A;  4I1M A;  5FJY A;  2DIW A;  3UX4 A;  3FU6 A;  3FTY A;  3KS2 A;  1JCR A;  3IV0 A;  4EQF A;  3TXM A;  4KVO A;  1UJJ A;  5AQA A;  1OWO A;  5EKQ D;  5G2N A;  4OAU C;  1DVP A;  5EID A;  3SFZ A;  4CGW A;  4QQI A;  3CV0 A;  4LRZ A;  4GB9 A;  1FCH A;  2C2L A;  4LNG A;  2ETB A;  3TJP A;  3UUX A;  1N4R A;  1OWN A;  1YYH A;  3HXB A;  2VQ2 A;  4L2Y A;  2I1K A;  4GA1 A;  1V55 E;  3ONK A;  1O1S A;  4ILI A;  4UWK A;  4Q94 A;  3C3R A;  5T4Y A;  3ASG A;  3RRU A;  4TUU A;  2CFU A;  5G55 A;  2VTB B;  4F7A A;  1LD8 A;  4LCT A;  3HXD A;  3RO2 A;  2XHE A;  4GCO A;  3SD5 A;  2LAH A;  3FTX A;  2VJ8 A;  3SBS A;  3ZEF A;  3ZXP A;  3OTN A;  1LTX A;  2AW6 A;  3KAE A;  2XCC A;  3BG0 B;  1O1R A;  3ULY A;  3W9F A;  1SQM A;  4GTR A;  3WG7 E;  3B7B A;  2WXN A;  1AWC B;  3FU3 A;  4CT4 A;  3ABL E;  4AY6 A;  4GZ5 A;  2PM7 A;  2V8S E;  3GYZ A;  3FP3 A;  3MV3 B;  5BXU A;  3JQ1 A;  1UG3 A;  3FH7 A;  1FT2 A;  5LFA A;  4UQX A;  3O4Z A;  2LUH A;  4AY5 A;  2P9N G;  4WWO A;  2RD0 A;  4CRW A;  2HYZ A;  4PS7 A;  1EPU A;  2MRI A;  3U64 A;  3LVQ E;  5J90 A;  5ARF A;  3TG4 A;  1SA4 A;  2JEK A;  4BFR A;  3HVE B;  1U3C A;  5D66 A;  3VLE A;  1QQE A;  4WNF A;  3HVE A;  2WXJ A;  4KVM A;  4V3I A;  4OYS A;  1X81 A;  1HG2 A;  4XX5 A;  1OCC E;  2AWI A;  4J6I A;  3CKB A;  1ZBP A;  4CCA A;  2LO6 A;  1JCS A;  2J9Q A;  2WMN A;  4I1A A;  4CYM D;  3UIP C;  2KM4 A;  5CMW A;  4PS3 A;  1WM5 A;  1MX4 A;  4HOT A;  2X38 A;  2KC7 A;  5A7D B;  4ZHB A;  3CK7 A;  4J8S A;  3DXK G;  3KSQ A;  2R05 A;  4XI0 A;  4C48 B;  2BKG A;  2R02 A;  1QBQ A;  3FH8 A;  1WAO 1;  3MA5 A;  2J08 A;  4G11 A;  2FO1 E;  3RAU A;  5BNW A;  2KCK A;  1N95 A;  2XEE A;  3LKU A;  3SZ7 A;  3FUL A;  1U2V G;  1NFI E;  5JHB A;  1OWP A;  2BUG A;  4BTB A;  4A3V A;  3CVP A;  2F8X K;  3ML9 A;  1TN7 A;  5EYP F;  4DI3 A;  5ANL A;  1OY3 D;  2J4B A;  5KNG A;  3SBT B;  3CVW A;  4GCN A;  3PRZ A;  4AVX A;  2QY7 A;  3VLD A;  4BSX A;  2GRL A;  4C9B B;  4AJW A;  3B13 A;  4HQD A;  5JHA A;  1KT0 A;  4E85 A;  1EDU A;  3IXE A;  4BWR A;  4J8D A;  3U66 A;  3DWL G;  4GZ3 A;  4YDY A;  4FJY A;  2GRQ B;  4I6E A;  5KNH D;  2LNI A;  3NF1 A;  1MYO A;  5KJL A;  4IN3 B;  4IYP A;  4HNA D;  3ZNG A;  1H6K A;  3AS4 A;  2KCL A;  2Y4T A;  3ASF A;  1RW2 A;  2IQC A;  5LOZ A;  4R7L A;  4U96 D;  3PH0 C;  4J8E A;  4JHJ A;  4L7T A;  3ESK A;  4LEU A;  2AXU A;  2WXQ A;  3SO8 A;  3ABM E;  5LCW C;  3T8M A;  3SHF A;  2V4H C;  3QB2 A;  3GZS A;  2MYO A;  3HHM A;  4EZJ A;  5ENP D;  4B0Z A;  3TWV A;  1NA0 A;  1MJ0 A;  1N4S A;  5ENQ D;  3IHY A;  2NYJ A;  4AOF A;  3EU9 A;  3V30 A;  3TL5 A;  2ZGG A;  4U8V D;  3PZ3 A;  3UM0 A;  1X5B A;  1A5E A;  3MGB A;  1IQU A;  2BKK B;  3ZVV A;  5AQ9 A;  5CEA A;  4BER A;  3U9W A;  3CVN A;  2LXL A;  3FEY A;  2DZN A;  4J8Y A;  3FH5 A;  3D3M A;  3V2X A;  2WXO A;  4O1O A;  1HG5 A;  3ZYL A;  5KJM A;  2J49 A;  4NUR A;  4UWG A;  3EU5 A;  3CGH A;  2GRP B;  3Q9N C;  4XZ4 A;  4LER A;  2QZA A;  4RSY A;  3RU0 A;  1E7U A;  3QAR A;  2A5E A;  3SI5 A;  5LX8 A;  3QOU A;  5CCL A;  1N54 A;  1NA3 A;  4L2L A;  1FPP A;  1E8X A;  5HRY A;  4HLL A;  3ASD A;  4GA2 A;  5CRU A;  4KMO A;  4JEU A;  3EHN A;  4LNU D;  3T8K A;  1KT1 A;  4U04 A;  1HFA A;  3CVL A;  3QC1 A;  5A6C A;  2V0P A;  3Q7F A;  1NL4 A;  3EHQ A;  3FU5 A;  4OVV A;  4ACL A;  4MS6 A;  4WWP A;  3FUE A;  4ATZ D;  1FVH A;  4EBA G;  1O1T A;  4ANU A;  4GYY A;  2PQR A;  3NOG D;  3LJ3 A;  3E30 A;  2XEH A;  5EIL A;  1EYH A;  2WVI A;  4MKT A;  3FUJ A;  4YVQ C;  4DI4 A;  4PH4 B;  4B94 A;  1OXJ A;  3X2Q E;  2R59 A;  2GRN B;  1HF8 A;  3Q15 A;  2ZGD A;  3PNL B;  4NQ0 A;  1DCE A;  3ZPJ A;  3ZIM A;  5DIZ A;  4BT8 A;  3EIQ C;  4UUC A;  4DUI A;  4XI9 A;  3RJV A;  4FU3 A;  1E8Z A;  3ABK E;  4PS8 A;  3L16 A;  4OVU A;  5AN8 A;  1SZA A;  4BY6 A;  3PS6 A;  5B1A E;  3ZUV B;  5D0O D;  1H19 A;  2NC9 A;  3UPV A;  4CDN A;  4G8K A;  3Q78 A;  4ACK A;  3S2A A;  2OV8 A;  1HO8 A;  4BTA A;  2YHE A;  3AS5 A;  3B95 A;  5KWD A;  5T3R A;  4F1P A;  3VTX A;  2FO7 A;  2KXP C;  2AXV A;  5C2Y A;  3HXF A;  3R9M A;  1PAQ A;  3APF A;  2BED A;  1E7V A;  5AQ7 A;  3HYM B;  3OXG A;  2VSX E;  3TWT A;  2HR2 A;  5FIO A;  3O48 A;  3TXN A;  2EQX A;  5AYW D;  3NB2 A;  2EIM E;  1Y8M A;  4J7W A;  4H7Y A;  5FWQ A;  2ZIR A;  3FTV A;  4I43 A;  2BF0 X;  5KBA A;  3QWW A;  4F6R D;  3PUJ A;  4K03 A;  2CG2 A;  3CR3 A;  3PNT B;  3NBN B;  2PNN A;  5KJK A;  2GRO B;  2CHX A;  4FHJ A;  3JUE A;  3R7R A;  3EHM A;  4Q69 A;  4F53 A;  5HQ8 A;  3EUV A;  3L22 A;  4O60 A;  1H2T C;  5ITZ F;  5G04 C;  3B7U X;  4P29 A;  4CGV A;  2EIN E;  2JLB A;  4GMJ A;  3EJN A;  3DRA A;  4ANV A;  4UI9 C;  2F8Y A;  4NAC A;  5E75 A;  3FUN A;  1LF8 A;  5AAO A;  3PDN A;  1D9S A;  4U63 A;  2XZD G;  4L23 A;  3FUH A;  4DK5 A;  4DX2 A;  2LXM A;  5B1B E;  4ME2 A;  3UTM A;  3CQC B;  4UWL A;  4JVS A;  3FWV A;  5ENN A;  3CHR A;  2WXG A;  3RRM B;  2ETA A;  4HRM B;  4HLE A;  3CHQ A;  3MEK A;  3C3O A;  2QC9 A;  4HXI A;  2QFC A;  2HM8 A;  3CHO A;  2I1J A;  4A55 A;  3TGO A;  1S70 B;  2VTB A;  3OXL A;  2XQ0 A;  3Q7A A;  4NIK A;  5AQB A;  5FZR A;  3QWV A;  2EIL E;  4EBA A;  3E33 A;  3FY4 A;  3OXF A;  3TWS A;  3UM2 A;  3V31 A;  3AAA C;  3D9P A;  2QYU A;  3PZ4 A;  1BPO A;  4TRQ A;  2WQ7 A;  3SFX A;  4KBQ A;  1YMP A;  1YA0 A;  5G05 C;  2V5Q C;  4AP2 A;  1IHB A;  2EIJ E;  2MOW A;  2WM9 A;  3F6Q A;  3DSW A;  3PEU B;  1NI1 A;  2XGM A;  5BV1 A;  3C98 A;  2P9I G;  4K5B A;  1WY6 A;  4GML A;  2LAI A;  3E32 A;  2V4L A;  5FZQ A;  5CRV A;  4U8H A;  2OVF A;  1JPL A;  3L17 A;  3CVX A;  2ION A;  4N3C A;  4RG6 A;  5EX0 A;  3G2S A;  3MJW A;  1OWM A;  3DEO A;  3GW4 A;  2HO1 A;  2I2O A;  3DPD A;  2H6G A;  4UI9 K;  4G23 A;  3TG5 A;  3FUM A;  3AG1 E;  4M7C A;  3UT4 A;  3UQ3 A;  3CHS A;  5H7P A;  3VTY A;  3ZHE B;  1S63 A;  3ZGQ A;  2M63 A;  5FQ6 A;  3LDZ A;  1MX6 A;  5FZS A;  3RO3 A;  3D9L A;  2XRZ A;  3QK0 A;  1E96 B;  3KD7 A;  1TJF A;  4GPM A;  1TNO A;  1Q2Z A;  4LUN U;  1UOH A;  4ANW A;  3I3N A;  1QYM A;  3J5P A;  5FIN A;  3PEV B;  3T9K A;  4TV3 A;  1TN6 A;  3SQV A;  3CKC A;  1KPS B;  4HRN A;  4DX7 D;  5AAR A;  5LCW J;  1TN8 A;  4EZL A;  1AP7 A;  3JCK C;  3L82 A;  4JA9 A;  2GRM A;  4BT9 A;  3I4G A;  1JCQ A;  4GPK A;  3HRA A;  2YIN A;  4A63 B;  4GTQ A;  1K8K G;  2H6I A;  2XPI A;  2X6K A;  4BX9 A;  1EF1 C;  2R2L A;  2IOS A;  4YDO A;  3CVQ A;  3NZU A;  4CEM A;  4FA6 A;  1HXI A;  5B3S E;  1U3D A;  3FDH A;  1UN8 A;  1D8E A;  3UXG A;  1HS6 A;  1N0Q A;  1B89 A;  3D9O A;  3S7J A;  3ULQ A;  2J09 A;  3FTU A;  4XE0 A;  2FI7 A;  2A5U A;  1RZ4 A;  3Q4A B;  3ZN3 A;  1IYG A;  4HOQ A;  4GAA A;  3QJZ A;  5AJD A;  3T5X A;  3AG4 E;  4U0U A;  2CHW A;  4LG6 A;  2DBA A;  3S7F A;  1IKN D;  4CDM A;  3RRN B;  5JA4 D;  1BD8 A;  3B7S A;  3G2V A;  1SA5 A;  1JWG A;  2PM6 A;  2J4D A;  4KZ0 A;  2DVW A;  4UQY A;  2DZO A;  5T8I A;  4TXQ A;  4A3T A;  3UM1 A;  1K1B A;  1TNZ A;  3HIZ A;  3LS8 A;  4HFG A;  3TWX A;  2WMO A;  1L5J A;  2Y4U A;  2WXR A;  2XS8 A;  3E37 A;  3QKY A;  2VGY A;  4EZK A;  4YVO A;  4A1G A;  3KEA A;  3AG2 E;  4UWF A;  4JHR A;  4WNE A;  3JXI A;  2IU1 A;  4RG9 A;  5CBN A;  3GZ2 A;  5ENT D;  4XKB A;  4HB5 A;  4GTV A;  2RG8 A;  3SGH A;  3DSV A;  3QDN A;  5AEN A;  4MBG A;  4G2V A;  3ZKJ A;  2WQ6 A;  3HXC A;  5FQ8 A;  2LSU A;  3HDX A;  5CMY A;  4OAV B;  1H6O A;  1E8W A;  4RQI A;  1HU3 A;  3R7Q A;  3V2O A;  3CK8 A;  2ZU6 B;  1ELR A;  4K5A B;  4RLY A;  3TWW A;  1OUV A;  3GZ1 A;  3MYV A;  4HVB A;  4I17 A;  3B7R L;  4PDX A;  2GW1 A;  2OEW A;  3VLF A;  3CSF A;  1V54 E;  2IOL A;  1K1A A;  2Y3A A;  1S64 A;  3UMV A;  2XPY A;  3MCX A;  4M3O A;  4Y6C A;  1H2U A;  1H2V C;  3MX3 A;  4I6G A;  4N2S A;  4ZFH A;  3ZYM A;  2RFA A;  5BXO A;  4B93 B;  3Q79 A;  5JJ6 A;  3UI2 A;  3ZFW A;  1WG0 A;  3AS8 A;  2KZT B;  4APF A;  5LP0 A;  5CHE E;  3QAQ A;  2Y1L E;  2KZT A;  3D9M A;  4U7E B;  4O1P A;  5G04 J;  3JXJ A;  4FHK A;  1KLX A;  1H6P A;  2YQ8 A;  2B6C A;  2IF4 A;  3U3W A;  2ILR A;  4DJA A;  4UI9 J;  4WWN A;  4FLB A;  1N4Q A;  1PY1 A;  1QZ2 A;  2X6F A;  2L0T B;  4ANX A;  1O5M A;  5FQ4 A;  2KCV A;  2X6J A;  1IXV A;  3L08 A;  1TNB A;  3UM3 A;  4X8Q A;  3WXX A;  3Q73 A;  4G25 A;  1BI8 B;  3NOC D;  1MQS A;  4DX5 D;  3ASH A;  4HBD A;  3APC A;  3LEW A;  2L6B A;  3LVR E;  3TWQ A;  5D0Q D;  3UT7 A;  5CER B;  2CHZ A;  3AJI A;  3Q5M A;  4I6J A;  1ELK A;  3AU4 A;  3SY2 A;  5BT1 A;  3LY7 A;  3G2W A;  4EHM A;  4GYO A;  2L0I A;  1MHQ A;  2OEV A;  4ILH B;  3V79 K;  2OVB A;  1OCZ E;  1HZ4 A;  3MKQ B;  4EEC A;  2MHK A;  2YHC A;  3MKQ A;  2C0L A;  1JUQ A;  5JJT A;  1OCO E;  4KZC A;  5KJN A;  3DPY A;  3N71 A;  3Q49 B;  5AIJ A;  2AJA A;  4KXK B;  4I2W A;  3URZ A;  3ZYQ A;  3DSX A;  3U4T A;  4J0U A;  4KT6 B;  4APO A;  1A17 A;  2OOE A;  2WXP A;  2DYS E;  2NXP A;  1HH8 A;  3D9H A;  2E0I A;  3ISM C;  1XNF A;  5BV0 A;  2ETC A;  1XGW A;  3C5R A;  2FUL A;  2IFU A;  3LCA A;  5ANR A;  2X6I A;  2Q7F A;  3DST A;  3TWR A;  3FTS A;  4JL0 A;  4E6H A;  3ENE A;  3E4B A;  2X6H A;  5EDS A;  2F0Y A;  2JAB A;  4UWH A;  3G2U A;  5FT9 A;  4ABN A;  3Q47 B;  3D9K A;  1ZU2 A;  4JA7 A;  2P9S G;  1G3N B;  5BW8 C;  2OND A;  2IO2 C;  2YNQ A;  4FC8 A;  4XKC A;  3D9N A;  4GTP A;  1LD7 A;  4G26 A;  4Q96 A;  5HI7 A;  2UWJ G;  2NSZ A;  1N52 A;  2P9L G;  2WB2 A;  2DCP A;  2WXM A;  2I9C A;  4JHK A;  4G24 A;  2EIK E;  1DNP A;  4C0E A;  1N94 A;  2XEV A;  3L9T A;  4U0Z A;  4CZ2 D;  4EPZ A;  2P58 C;  1BU9 A;  2WXL A;  2A4Z A;  2V5F A;  1UW4 B;  4GU5 A;  4LNB A;  3LJN A;  2IEJ A;  4GTS A;  4CT0 A;  1OWL A;  5CED B;  1TJC A;  3QWP A; 
#chains in the Genus database with same CATH homology
 4AXH A;  3ZVV A;  2FF4 A;  2YIN A;  3U9W A;  3CVN A;  3FEY A;  3PUK A;  2VSN A;  3RK6 A;  5AJL A;  3LXU X;  3CVY A;  2XPI A;  3MKR A;  3PRE A;  2X6K A;  3FH5 A;  3D3M A;  2WXO A;  4BX9 A;  5CCM A;  3MZL B;  3NZS A;  1EF1 C;  2IOS A;  3CVQ A;  3L6A A;  2XGO A;  1HG5 A;  3NZU A;  4CEM A;  3ZYL A;  4CDR A;  4FA6 A;  5KJM A;  3CVU A;  1FVF A;  3JYS A;  3CEQ A;  2J49 A;  4UQZ A;  1HXI A;  4NUR A;  5EX3 A;  3APD A;  2FBN A;  4UWG A;  4WAF A;  3CGH A;  3LPZ A;  1U3D A;  4AEZ C;  4XZ4 A;  2VSO E;  3FDH A;  4JW1 A;  4LER A;  1UN8 A;  4RSY A;  1HX8 A;  3RU0 A;  1E7U A;  3I5P A;  3QAR A;  3SI5 A;  3ML8 A;  1HS6 A;  3G2T A;  1B89 A;  4GZD A;  5LX8 A;  3B7T A;  3D9O A;  3QOU A;  2WXK A;  5G05 J;  5CCL A;  1N54 A;  3S7J A;  3ULQ A;  2J09 A;  3EDT B;  3FTU A;  1NA3 A;  2XRY A;  4L2L A;  3FFL A;  1E8X A;  4XE0 A;  2FI7 A;  3SNX A;  2A5U A;  1NZN A;  5J08 A;  4RVB A;  3LY9 A;  2LSV A;  3ASD A;  3FHE A;  3P1U A;  3Q4A B;  4FLH A;  4GA2 A;  2CG3 A;  3ZN3 A;  3CVV A;  1IYG A;  4HOQ A;  3LYA A;  4GAA A;  4KMO A;  4MRU A;  2L6J A;  3CK9 A;  3NQP A;  1S0P A;  3QJZ A;  4QFV A;  5AJD A;  4HOR A;  4JEU A;  3T5X A;  3EHN A;  4U0U A;  2CHW A;  2VSY A;  5A23 A;  1KT1 A;  4U04 A;  1HFA A;  2DBA A;  4PUC A;  3S7F A;  3JUI A;  3ZYK A;  3CVL A;  3QC1 A;  5A6C A;  4U07 A;  2V0P A;  4K0R A;  4FJZ A;  2R5S A;  4CDM A;  5E76 A;  3RRN B;  3ONL A;  3B7S A;  3D9J A;  3G2V A;  3FU5 A;  4OVV A;  4ACL A;  1HE8 A;  4MS6 A;  4WWP A;  2J07 A;  4BX8 A;  3FUE A;  4I1M A;  5FJY A;  1FVH A;  4EBA G;  1JWG A;  2PM6 A;  2DIW A;  5BPP A;  3UX4 A;  4ANU A;  2J4D A;  3FU6 A;  4GYY A;  4KZ0 A;  3P2B A;  3FTY A;  2PQR A;  3KS2 A;  3L13 A;  4NRH B;  3LJ3 A;  1UN9 A;  1EYH A;  2WVI A;  4UQY A;  4MKT A;  3FUJ A;  3IV0 A;  4YVQ C;  5T8I A;  4DI4 A;  4EQF A;  4PH4 B;  4A3T A;  3TXM A;  3PZD A;  4KVO A;  4B94 A;  2R59 A;  4ILG A;  1HF8 A;  4JPS A;  3HIZ A;  3Q15 A;  3ZHE A;  4KYO B;  1UJJ A;  3LS8 A;  1OWO A;  4HFG A;  3PNL B;  4JEH A;  5EKQ D;  5G2N A;  4NQ0 A;  2WMO A;  2XCB A;  3ZPJ A;  3FUD A;  3ZIM A;  1H0A A;  5DIZ A;  1DVP A;  4BT8 A;  2C0M A;  3EIQ C;  2GGF A;  1L5J A;  3SFZ A;  2Y4U A;  2WXR A;  4CGW A;  4XI9 A;  3RJV A;  3QKY A;  4FU3 A;  2VGY A;  4EZK A;  4YVO A;  3RIB A;  1E8Z A;  3CV0 A;  4A1G A;  4LRZ A;  4PS8 A;  4UWF A;  4GB9 A;  3L16 A;  1FCH A;  2C2L A;  4JHR A;  4WNE A;  4OVU A;  1SZA A;  3TJP A;  3UUX A;  2IU1 A;  2I6H A;  1OWN A;  4BY6 A;  3PS6 A;  2VQ2 A;  1Y6I A;  4RG9 A;  4L2Y A;  3GZ2 A;  2I1K A;  4XKB A;  5D0O D;  1H19 A;  3ZXS A;  4GA1 A;  1IQR A;  2NC9 A;  3UPV A;  4CDN A;  2RG8 A;  3ONK A;  3SGH A;  3QDN A;  5AEN A;  4ILI A;  4G2V A;  4Q94 A;  4UWK A;  2WQ6 A;  5FQ8 A;  4ACK A;  2BTD A;  1NP7 A;  2LSU A;  2PZI A;  4AIF A;  5T4Y A;  3ASG A;  3S2A A;  3HDX A;  3FU0 A;  2OV8 A;  1HO8 A;  5CMY A;  3RRU A;  4BTA A;  2YHE A;  3AS5 A;  4AV7 A;  3S7D A;  4TUU A;  2CFU A;  5G55 A;  5T3R A;  3VTX A;  1E8W A;  2VTB B;  3S7B A;  2X3M A;  1HU3 A;  4F7A A;  2FO7 A;  2R17 C;  4LCT A;  3R7Q A;  3RO2 A;  2AXV A;  2XHE A;  3CK8 A;  4GCO A;  4L1B A;  3SD5 A;  2LAH A;  3FTX A;  1E8Y A;  2VJ8 A;  3QNK A;  4J8F A;  3SBS A;  5C2Y A;  4URK A;  1PAQ A;  3APF A;  3ZEF A;  1ELW A;  1E7V A;  3OTN A;  2AXZ A;  2AW6 A;  2ZU6 B;  3HYM B;  3CIA A;  3KAE A;  2E2E A;  2XCC A;  3L54 A;  3OXG A;  4WUY A;  1ELR A;  2VSX E;  3CLJ A;  3FEX A;  2AVP A;  1OUV A;  2HR2 A;  3BG0 B;  3GZ1 A;  3MYV A;  4GYW A;  4W9R A;  4HVB A;  3O48 A;  3TXN A;  2EQX A;  3SF4 A;  4I17 A;  3B7R L;  4PDX A;  4YND A;  5AYW D;  2GW1 A;  3JQ0 A;  1Y8M A;  3VLF A;  1UJK A;  4H7Y A;  4N39 A;  5FWQ A;  3CSF A;  3CQG B;  1SQM A;  2IOL A;  2Y3A A;  4FUL A;  1QNF A;  3UMV A;  2WXN A;  3FTV A;  2XPY A;  4I43 A;  5ARG A;  2BF0 X;  3MCX A;  4DLQ A;  3FU3 A;  4M3O A;  4CT4 A;  3QWW A;  4Y6C A;  1H2U A;  4AY6 A;  3PUJ A;  4GZ5 A;  2PM7 A;  4K03 A;  4A1S A;  2V8S E;  4JC8 A;  5BUZ A;  3GYZ A;  3FP3 A;  2CG2 A;  3CR3 A;  1H2V C;  3MV3 B;  3MX3 A;  3PNT B;  4I6G A;  4N2S A;  3JQ1 A;  1UG3 A;  3FH7 A;  4GPK A;  5LFA A;  4UQX A;  3O4Z A;  5KJK A;  4AY5 A;  2L9B A;  2CHX A;  4N3A A;  3ZYM A;  4FHJ A;  4WWO A;  2RD0 A;  2PL2 A;  4HOU A;  3EHM A;  3R7R A;  2HYZ A;  4CRW A;  4Q69 A;  4DLO A;  5DBK A;  4F53 A;  4U0S A;  5HQ8 A;  4PS7 A;  4C0M A;  1EPU A;  1Z3X A;  2MRI A;  3U64 A;  3L22 A;  3IBE A;  1H2T C;  3LVQ E;  1E90 A;  5J90 A;  5ARF A;  3B7U X;  5G04 C;  3TG4 A;  4P29 A;  3TAX A;  2WPV A;  5JJ6 A;  4CGV A;  2JLB A;  4GMJ A;  2JEK A;  3EJN A;  3ZFW A;  1IHG A;  4BFR A;  3HVE B;  3ZW3 A;  3AS8 A;  2KZT B;  5FTP A;  4APF A;  4N3B A;  1U3C A;  3VLE A;  1QQE A;  4WNF A;  3HVE A;  3QAQ A;  5CHE E;  5LP0 A;  2WXJ A;  2KZT A;  3D9M A;  4KVM A;  4V3I A;  4ANV A;  4UI9 C;  4OYS A;  2UY1 B;  4Y6W A;  4NAC A;  1HG2 A;  5E75 A;  5G04 J;  4N5C A;  4XX5 A;  3FUN A;  2UY1 A;  4FHK A;  1LF8 A;  1KLX A;  4FP7 A;  2AWI A;  2YQ8 A;  4I1O B;  4J6I A;  3PDN A;  1SZ9 A;  4U63 A;  2IF4 A;  3U3W A;  4H7X A;  4WND A;  2ILR A;  1ZBP A;  3CKB A;  2LO6 A;  4CCA A;  3KEZ A;  4L23 A;  3FUH A;  4DJA A;  4DK5 A;  4UI9 J;  2J9Q A;  2WMN A;  4WWN A;  4FLB A;  1PY1 A;  1QZ2 A;  4I1A A;  2X6F A;  2L0T B;  4ANX A;  2KM4 A;  5CMW A;  4PS3 A;  1WM5 A;  1Z3Y A;  4ME2 A;  5FQ4 A;  2KCV A;  2X6J A;  3CQC B;  4HOT A;  4UWL A;  5C1D A;  4JVS A;  3FWV A;  1JWF A;  5ENN A;  3CHR A;  2VYI A;  2WXG A;  2X38 A;  3L08 A;  2VGX B;  2FEZ A;  2KC7 A;  5A7D B;  3CK7 A;  3IEG A;  5FQ7 A;  3RRM B;  2VGX A;  4F1S A;  2KAT A;  3WXX A;  4J8S A;  1INZ A;  4G25 A;  4HLE A;  5JJ7 A;  2PQN A;  3CHQ A;  4XI0 A;  1MQS A;  3LY8 A;  3MEK A;  4I9C A;  4G1T A;  4HXI A;  2QFC A;  3ASH A;  3APC A;  3LEW A;  3OAW A;  2HM8 A;  3CHO A;  5M72 A;  2I1J A;  4A55 A;  2WQH A;  3TGO A;  3K9I A;  2VTB A;  3FH8 A;  1WAO 1;  4GZC A;  3MA5 A;  3BEE A;  3LVR E;  3OXL A;  1PC2 A;  2XQ0 A;  1GW6 A;  2J08 A;  2WXH A;  4G11 A;  5D0Q D;  3UT7 A;  5FZR A;  3QWV A;  3I4R B;  5BNW A;  2CHZ A;  2KCK A;  3Q5M A;  4I6J A;  1ELK A;  3FY4 A;  3OXF A;  4EBA A;  3FUI A;  3AU4 A;  3CHP A;  5BT1 A;  1Z6T A;  3LKU A;  4B8C B;  3T5V A;  3LY7 A;  3G2W A;  4GYO A;  2L0I A;  1MHQ A;  4MLP A;  3UT8 A;  3SZ7 A;  5KCM A;  3FUL A;  4ILH B;  4IRU A;  2OVB A;  3D9P A;  5JHB A;  1OWP A;  2BUG A;  1BPO A;  4TRQ A;  4BTB A;  2WQ7 A;  4A3V A;  3CVP A;  1HZ4 A;  4KBQ A;  3FTW A;  3MKQ B;  3ML9 A;  4EEC A;  3PE3 A;  2MHK A;  2YHC A;  4JZY A;  4DI3 A;  5ANL A;  4AM9 A;  4F3V A;  3MKQ A;  1YA0 A;  5G05 C;  2C0L A;  1JUQ A;  4AP2 A;  5JJT A;  4KZC A;  2J4B A;  5KJN A;  3N71 A;  2IJG X;  3Q49 B;  2MOW A;  5AIJ A;  4KXK B;  3SBT B;  3CVW A;  4I2W A;  3URZ A;  4N2Q A;  3ZYQ A;  4GCN A;  4DPR A;  3U4T A;  2WM9 A;  3PRZ A;  4J0U A;  3PVL A;  4KT6 B;  4AVX A;  4APO A;  2QY7 A;  3VLD A;  1A17 A;  1P5Q A;  4BSX A;  3PEU B;  2OOE A;  2GRL A;  2XGM A;  2WXP A;  4HS2 A;  3C98 A;  3PE4 A;  2NXP A;  4C9B B;  5BV1 A;  1HH8 A;  2XPZ A;  4GA0 A;  4WNG A;  2E0I A;  4AJW A;  1XNF A;  3B13 A;  5BV0 A;  1WY6 A;  4GML A;  1XGW A;  2LAI A;  5JHA A;  1TEZ A;  2FUL A;  5FZQ A;  1KT0 A;  2V4L A;  2IFU A;  3LCA A;  5ANR A;  4E85 A;  2X6I A;  1EDU A;  4IUL A;  3FUK A;  4U8H A;  4BWR A;  2Q7F A;  2OVF A;  4J8D A;  3FTS A;  3CST A;  1JPL A;  3U66 A;  3L17 A;  2WXI A;  3CVX A;  4JL0 A;  4E6H A;  2ION A;  4N3C A;  4RG6 A;  5EX0 A;  3ENE A;  4GZ3 A;  3G2S A;  3E4B A;  4FJY A;  2X6H A;  3MJW A;  3ESL A;  5EDS A;  2WXF A;  1OWM A;  3GW4 A;  2HO1 A;  3CHM A;  3IHV A;  4I9E A;  2I2O A;  3DPD A;  4I6E A;  4UWH A;  3RKV A;  3FTZ A;  3G2U A;  5FT9 A;  4ABN A;  4UI9 K;  3Q47 B;  2LNI A;  3D9K A;  4G23 A;  3TG5 A;  4D10 C;  4HOS A;  1ZU2 A;  3FUM A;  3NF1 A;  4JA7 A;  3R9A B;  3UT4 A;  3UQ3 A;  5KJL A;  1W3B A;  4IN3 B;  5BW8 C;  4IYP A;  2OND A;  2YNQ A;  3CHS A;  4FC8 A;  1H6K A;  3D9N A;  3MV2 B;  4XKC A;  3VTY A;  3ZHE B;  2XGS A;  3ZGQ A;  2M63 A;  5FQ6 A;  3AS4 A;  2KCL A;  2Y4T A;  4G26 A;  3LDZ A;  3ASF A;  4Q96 A;  5FZS A;  5HI7 A;  3RO3 A;  2UWJ G;  3D9L A;  2IQC A;  2NSZ A;  2CFZ A;  4R7L A;  5LOZ A;  3IKO B;  3PH0 C;  4J8E A;  4JHJ A;  1N52 A;  2XRZ A;  4L7T A;  3ESK A;  1E96 B;  3QK0 A;  2AXU A;  2WXQ A;  3KD7 A;  4LEU A;  1TJF A;  3ZRH A;  4JXT A;  4ATG A;  4LUN U;  3D9I A;  4ANW A;  2WB2 A;  5LCW C;  3T8M A;  3SHF A;  4XIF A;  3I3N A;  3FUF A;  3DBS A;  1VDY A;  2DCP A;  3QB2 A;  3GZS A;  4FAD A;  2WXM A;  3PEV B;  3HHM A;  4EZJ A;  4I2Z A;  4TV3 A;  2I9C A;  4JHK A;  4G24 A;  4B0Z A;  3EIJ A;  1DNP A;  3CKC A;  4C0E A;  2XEV A;  1NA0 A;  4U0Z A;  5LCW J;  4EPZ A;  3IHY A;  2P58 C;  4EZL A;  4AOF A;  4B89 A;  3AU5 A;  2WXL A;  2A4Z A;  4GZ6 A;  2V5F A;  3TL5 A;  1UW4 B;  3BG1 B;  4B8A A;  3JCK C;  4GU5 A;  1X5B A;  3MGB A;  4CT0 A;  4JA9 A;  2GRM A;  4BT9 A;  1IQU A;  1OWL A;  3I4G A;  1TJC A;  3QWP A;  4O6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...