1JPLA

Gga3 vhs domain complexed with c-terminal peptide from cation-independent mannose 6-phosphate receptor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
161
structure length
161
Chain Sequence
AMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
total genus 55
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1jplA00
2DIWA 4GZDA 3ZYLA 3D9IA 1DVPA 3RRUA 4FU3A 1X5BA 1VDYA 3G2SA 3CLJA 1UJJA 5LP0A 1ELKA 3D9MA 1HF8A 1UJKA 2L0IA 2KM4A 4Q94A 1SZAA 3D9OA 1HG2A 1MHQA 1JWFA 3D9LA 4Q96A 1H0AA 2QY7A 3D9PA 3G2VA 5CMYA 3ZYKA 5CMWA 3ZYMA 2V8SE 3D9JA 4GZCA 1JUQA 1HFAA 3ONKA 1INZA 5LOZA 4JXTA 1EYHA 1EDUA 2DCPA 1JPLA 1PY1A 1HX8A 1XGWA 3G2WA 3ZYQA 4HFGA 2MOWA 1SZ9A 3D9NA 2L0TB 3G2UA 1LF8A 2BF0X 3D9KA 4NACA 3ONLA 1HG5A 1JWGA 3LDZA 4AVXA 2LO6A 4FLBA 5J08A 3G2TA
chains in the Genus database with same CATH superfamily
4GTSA 2J49A 2BTDA 3APCA 4M3OA 2GRQB 1KZPA 1XNFA 2XCBA 5EILA 5ANLA 1BI8B 3CV0A 4M7CA 5CBNA 1N9AA 4I6EA 2CHZA 3ASFA 2F0YA 3VLFA 2VGXB 5B1AE 3IEGA 4J8DA 3HRAA 4U96D 1Y8MA 4L9PA 1TNYA 3HXBA 1OWNA 3CHOA 2CG3A 3ULQA 1OWLA 5CECB 5KNGA 1PY1A 5CEAA 3Q7AA 3V30A 2B0OE 1LD8A 2F8YA 3UM0A 2GGFA 2A5UA 1H2TC 2ZGDA 5A7DB 3C3QA 1H2VC 1RZ4A 3PNTB 3HXFA 3QB2A 1V54E 3DEOA 5HS0A 4GYWA 1EDUA 2XEEA 3D3MA 1MX4A 3B7UX 3B7TA 3Q49B 3UKUG 4YVQC 3BQOA 3D9HA 2L0IA 3OAWA 3P2BA 1QNFA 3PZ1A 4BSZB 2KZTB 3LY7A 4N2QA 4NRHB 3D9NA 4W9RA 3KEAA 2BUGA 3S2AA 2KXPC 1N54A 3TWUA 3PEUB 4AEZC 4BT9A 2X3MA 3ZXSA 3E30A 2EINE 1ELKA 3T8KA 3L22A 5LCWC 4HXIA 2PQNA 3LCAA 2VTBA 3CVQA 4CGWA 5BUZA 5BNWA 4G25A 4DX5D 5D66A 5BXOA 1HU3A 2QC9A 3O48A 3FTUA 4BFRA 4JB8P 3AG3E 2Y3AA 4EZKA 3WG7E 2ZU6B 2R5SA 1XGWA 2V5FA 4JD2G 3T9KA 4GTMA 3MGBA 2XENA 4URKA 3EHMA 2DIWA 3SZ7A 2KC7A 4NQ0A 1WAO1 5E75A 2VSXE 3MA5A 1G3NB 3QKYA 3FTSA 3X2QE 4I1AA 5A23A 3ZNGA 1NL4A 3RRMB 5AYWD 4XX5A 2OV8A 3F6QA 3NBNB 4KBQA 2XCCA 1IKND 2WXNA 3RRUA 1UOHA 1Y6IA 1NP7A 4WNFA 3CVXA 2ZISA 3U4TA 3CVYA 4CDNA 4J8SA 4J6IA 1N4QA 4XEIG 2L0TB 3LY8A 4RQIA 3ZW3A 4GYYA 2KCLA 2XQ0A 4HORA 4ACLA 5JHBA 5HI7A 4KVOA 2R05A 3L17A 4N5QA 4PS3A 4RG6A 4LNUD 1N4RA 5AQBA 1NFIE 1H19A 4YVOA 4MS6A 5FQ4A 4OAVB 4QFVA 4AY5A 5FZRA 4AP2A 4A63B 3CQGB 3I4RB 3MKRA 4IN3B 4CRWA 3CK7A 1Z6TA 1ZB1A 4P29A 3D9KA 1SVXA 2AXUA 5HKPA 2V4HC 2YHEA 2XPIA 4U04A 2XRYA 2GRLA 3E33A 3FH7A 2WXJA 4O1PA 3OXFA 4FP7A 2X38A 4JVSA 2PQRA 4LCTA 2IEJA 3ULYA 2H6FA 5AQ9A 1MZCA 3DSUA 4G2VA 4HOSA 4C0MA 3QDNA 4GTOA 5HRYA 5CRUA 4N3BA 1INZA 4ANVA 2Y1LE 2A5EA 3R9AB 2ILRA 3UQ3A 3ZVVA 3EHRA 1IQRA 2I2OA 3FDHA 3PZ3A 4XI9A 3Q47B 1MYOA 5AQAA 5AQ7A 1YYHA 4WNDA 2ZIRA 3UM1A 3JCKC 2YHCA 4ME2A 4JW1A 4E85A 3CK8A 3UT7A 3FEXA 3U66A 3CR3A 4OAUC 3DEPA 4U8VD 2VSOE 4TUMA 4G8KA 2GRPB 4WNEA 1E8ZA 1E96B 3UMVA 3JXJA 5T4YA 2EIJE 3APFA 3TWRA 3TWXA 5FZSA 3TXNA 3D9IA 1HE8A 1X5BA 3VLEA 3QARA 3CHQA 1K8KG 4N2SA 4Q69A 4BERA 3RAUA 3R7RA 3PDNA 3TGOA 3FH5A 4GTQA 4GB9A 3PRZA 3PEVB 4J8YA 2LO6A 4B89A 2X6JA 3WXXA 4NIKA 4BY6A 1A17A 3UUXA 2J09A 3FP3A 5BPPA 1EPUA 4YNDA 3ONKA 3L82A 2P9PG 3KD7A 2PNNA 3V2OA 4PDXA 3NZUA 3PNLB 5JJ6A 1ELRA 4C9BB 4PUCA 4HOQA 4V3IA 2WXQA 4UWKA 2QY7A 4DX2A 4B93B 4CYMD 5JA4D 1SA5A 3FU0A 5ARGA 3I4GA 4EPZA 3Q15A 4XKCA 3JUIA 3PUJA 2V4LA 4HS2A 5T8IA 3B7BA 2BKKB 3V2XA 3MEKA 4KMOA 5KCMA 4GA1A 4J8EA 1JPLA 3HHMA 5E76A 4TXQA 4GAAA 1TN7A 2I1JA 4K5CA 2OCCE 4BETA 1E90A 5KJMA 4J0UA 5ARFA 4WAFA 2EIKE 2FEZA 1U3DA 2IO2C 1N94A 2LAIA 3DPDA 2FULA 4H7XA 1SZ9A 2FBNA 2KCKA 3IHYA 5BXUA 1B89A 5KWDA 3E37A 2DBAA 2HO1A 3UINC 2P9NG 1D8DA 2OOEA 1N95A 4GYOA 2GRMA 1OCOE 3G2UA 4F1PA 3U9WA 3AS4A 2AJAA 2E2EA 2XEVA 2WMOA 2DVWA 5AAOA 4A55A 2CG2A 1E8XA 4CCAA 5BW8C 2OVBA 4AOFA 4A3TA 3DSVA 3LKUA 4GZ5A 2UY1B 4U95D 4ATZD 3HXCA 5CERB 2YQ8A 1JWGA 2HR2A 5G2NA 3RRNB 2VSYA 5ANRA 2OVFA 4APFA 2CFUA 3MCXA 5FZQA 4L7TA 1U2VG 1H6OA 3ML8A 3SO8A 2WXLA 3D9OA 1IHGA 2P9KG 4G1TA 3ZYMA 4FADA 1N0QA 4MLPA 4YDYA 2R02A 5AJLA 3HXEA 2C0LA 4XE0A 3Q78A 5EKQD 4OYSA 3UIOC 1D8EA 3DPYA 4F3VA 4KT6B 4ACKA 1OXJA 4X8QA 1HO8A 4I9CA 3FUDA 4DUIA 3LXUX 3RJVA 4AV7A 3AG1E 4U0ZA 1KPSB 4YDOA 3DXKG 5ENTD 5JJTA 3PE4A 3HIZA 4Y6WA 5D0QD 4ABNA 5KJKA 2VSNA 1JWFA 3L13A 4BEPA 3ASGA 3EJNA 2E0IA 3NOCD 2AWIA 4MKTA 1LTXA 4HFGA 4ILHB 4IRUA 1HXIA 4IYPA 3TWVA 1EF1C 5CMWA 4I1MA 2WMNA 3D9JA 3KEZA 3J5QB 2MOWA 4IULA 3UIPC 4ILGA 1H6PA 4G26A 4G24A 4AIFA 2VQ2A 2GROB 2JABA 1TR4A 3EHNA 1BPOA 3Q4AB 4LG6A 1K3ZD 2WXGA 1P5QA 4DI3A 4H7YA 1OCCE 4DI4A 5JJ7A 3PZ2A 2EILE 4F6RD 3LPZA 2IONA 1JCQA 4RSYA 3KS2A 1TNZA 4HRMB 3FHEA 3CVNA 3PZ4A 4BX9A 5LOZA 4I17A 1WM5A 3AJIA 2FF4A 2KATA 5DBKA 4N3CA 2P58C 3UTMA 3O4ZA 4I6GA 2JEKA 3ZHEA 4CEMA 3DWLG 4G11A 5DIZA 3MJWA 3S7FA 2B6CA 2XPZA 2LXLA 3MKQA 4KXKB 1O1RA 3C98A 3TG5A 4EZJA 3HYMB 1HF8A 3JQ0A 3SGHA 3G2VA 2EIME 1IHBA 4XKBA 2KZTA 2FO1E 2YINA 3LYAA 4N39A 4JEHA 2IO3C 4HI9A 1RW2A 1NZNA 2RD0A 2J08A 1Z3YA 3D9MA 4OVVA 4YDEA 4ANWA 3IV0A 4HI8A 4K5AB 3SHFA 5KJNA 2ONDA 3LJ3A 2AXVA 3OTNA 3UXGA 2H6IA 3E4BA 2DYRE 2CFZA 4B8AA 2R17C 2XHEA 3ABLE 2R2LA 3MX3A 4F53A 4B8CB 3FUFA 5FIOA 2BKGA 3D9LA 3UT8A 4L2LA 4ZHBA 4CT4A 3FU3A 2WXPA 4AVXA 3ASHA 1YMPA 4O1OA 3LVQE 3GZ1A 3Q9NC 1BD8A 1MX2A 2I1KA 4RG9A 5A6CA 4JHJA 3DSWA 1S64A 1JUQA 4B0ZA 2X6HA 2LSVA 3SF4A 5KNHD 5FTPA 4I2ZA 3ONLA 4I6JA 3Q73A 5EIBE 2Y0BG 2IJGX 4GZ6A 4N5CA 2A4ZA 4GCNA 3MV2B 3BU8A 3TWSA 5ENSD 1QZ2A 3CIAA 3PZDA 2AVPA 3EIQC 4QQIA 5G05J 4GTTA 1SA4A 3B13A 3Q75A 4DX7D 4AM9A 3JQ1A 2ETBA 4JEUA 4FA6A 2BEDA 2Y4UA 2MYOA 4K5BA 5BV1A 2I6HA 5G55A 2J4DA 3QWVA 1X81A 1WY6A 3FU5A 3UM2A 2X6KA 3CK9A 5M72A 3BG1B 4BSXA 2JLBA 3UKRG 4LERA 2XS8A 3R9MA 3SFYA 3FTYA 4G23A 4WWNA 5EN5D 3NOGD 2PM7A 3JXIA 4TUUA 2J4BA 5LCWJ 4U0UA 5ENQD 3ZHEB 3TG4A 4GTVA 1YA0A 4I9EA 1SZAA 4Q96A 5FQ7A 3D9PA 4RLYA 4J8FA 1OWMA 3ASOE 3K9IA 3GYZA 2KCVA 3HVEB 1FT2A 2DWZA 3ABME 3SNXA 3LDZA 5J08A 2P9LG 1O1TA 5CBOA 4FU3A 1BI7B 2WQHA 2Q7FA 5EDSA 2GRRB 1V55E 2P9UG 4UQZA 3Q79A 3DXMG 4LUNU 3T5VA 2RFMA 4B94A 3ISMC 3AU5A 2XGMA 3FU6A 2X6IA 3OXGA 2FI7A 2OEWA 4GZDA 4U8HA 3CVVA 3RK6A 1FPPA 1JCRA 4WUYA 2L6BA 4FJZA 3ZYKA 4GZCA 3B95A 5CCMA 4FC8A 3QOUA 4JPSA 3CHPA 4GZ3A 1LD7A 3GW4A 2WXKA 1HZ4A 4ZFHA 3CKCA 5EX0A 3CKBA 1IQUA 4U07A 3NAWA 4R7LA 3CSTA 3HDXA 4E6HA 3W9GA 1E7UA 1MQSA 4C48B 3VLDA 3RIBA 1K1BA 3FUKA 3UT4A 4DK5A 3ZYLA 3BUAA 4LNBA 3JUEA 2NC9A 5ENOD 3Q7FA 3RU0A 3EDTB 2VJ8A 1N52A 5C1DA 4HB5A 3TWQA 3LJNA 4HLLA 3ZYQA 3SFZA 4GA0A 2RG8A 4F1SA 1S0PA 3U3WA 2YNQA 3Q9UC 1KLXA 1DVPA 4DLOA 3IBEA 3EU9A 4GMLA 1QYMA 1AP7A 4A3VA 5FQ6A 2IQCA 5CMYA 4CGVA 5CRVA 3ZN3A 2WB2A 3PVLA 1OWPA 3LEWA 4JXTA 2DYSE 2F37A 5CEDB 1PAQA 5CHEE 2M63A 4OVUA 4L2YA 1VDYA 4DX6D 3ULEG 3FUNA 4FJYA 3E32A 1TEZA 3EU5A 1DCQA 4F7AA 3TJPA 4A1GA 3BEEA 3FTVA 4UWLA 4HOUA 4FLBA 1HS6A 1UW4B 2ETCA 4JHKA 3GZSA 1ZBPA 2PZIA 4GU5A 3B7RL 1E7VA 1ELWA 5G04J 4A1SA 4LNGA 4BTBA 2RFAA 1TNOA 2MRIA 3CVPA 3CEQA 3FULA 5ENNA 4L1BA 4LRZA 5IY5E 1UJKA 4HQDA 4WWPA 1TJFA 3AAAC 4XI0A 3URZA 3ZUVB 3IXEA 2H6HA 3L6AA 2WXOA 1JCSA 3ZKJA 1HH8A 5FT9A 4J7WA 4WWOA 3SD5A 4HBDA 4HLEA 4AXHA 4L23A 2P9IG 3V31A 2HE0A 3ESLA 4UWFA 4BX8A 2Y69E 2XRZA 5HQ8A 4YDWA 2C2LA 3AG4E 3HG0D 1YCSB 3C3RA 5ENPD 3RO2A 3VTYA 5JHAA 4DPRA 2XS1A 2EQXA 2CHXA 2XGSA 2AW6A 3CLJA 4DJAA 3UX4A 3EHQA 2MHKA 3TL5A 4C0EA 3ZIMA 1EYHA 2DCPA 1HX8A 3SQVA 4GTPA 3NZSA 3UI2A 4JL0A 3IKOB 3PUKA 3PH0C 1QBQA 1OT8A 1IXVA 1BLXB 1NI1A 2XZDG 1DCEA 5KBAA 2J07A 2WXHA 5BV0A 2L6JA 4NACA 4HVBA 5AIJA 4APOA 3AU4A 2IFUA 2XZTG 4PS7A 3RSEG 2OEVA 1Z3XA 1PC2A 3FY4A 3MYVA 2WXIA 3LY9A 2LUHA 4UI9K 3TXMA 2R59A 2J9QA 1Z5SC 2GRNB 3AG2E 2HM8A 1U3CA 2LXMA 1WDYA 4GTRA 3GZ2A 1QQEA 3DBSA 2IU1A 4I2WA 5KJLA 3EUVA 2LAHA 2QFCA 3NB2A 1OUVA 3TWTA 3FUEA 1OCRE 3SBTB 4K0RA 4I43A 5D0OD 4CDRA 4Z68A 4DX1A 4EZLA 4JZYA 4CZ2D 4RVBA 1HG2A 4N3AA 1UN9A 1N4PA 1UN8A 3R7QA 4JC8A 3C72A 4ATGA 3ZFWA 2WPVA 1K1AA 2LSUA 3V79K 3CVWA 4BESA 3LS8A 4GPKA 4NURA 5AJDA 5LFAA 1S63A 3RKVA 1UG3A 4Y6CA 5D2MC 3FTXA 3JYSA 2NSZA 3L54A 1TJCA 3TWWA 3FTWA 3C5RA 3ASNE 3DSTA 3L16A 3IHVA 1HG5A 3ML9A 4U8YD 1KZOA 2IOSA 3ZPJA 4FHKA 3T8MA 5C2YA 4DRXE 2UY1A 4LEUA 4EQFA 3KSLA 3FUIA 1MJ0A 5B3SE 1H6KA 1H2UA 3QJZA 3DSXA 4MRUA 1Q2ZA 1OCZE 3L08A 3L9TA 3QWWA 2IY0C 3PREA 1NA0A 3AS5A 4EECA 3FEYA 4JA7A 1OY3D 4AJWA 3SY2A 4KZ0A 4AY6A 5G04C 4PH4B 3CQCB 2XPYA 2PM6A 2QYUA 1KT0A 2UWJG 3OXLA 4U7EB 4FLHA 3CHRA 2V8SE 2VGYA 3CVUA 5FQ8A 2WM9A 3ZU7B 2BF0X 5AENA 1L5JA 2WXFA 4GA2A 3FUMA 3MZLB 1TNUA 4I1OB 1GW6A 3QC1A 1UJJA 3VTXA 4GMJA 3FFLA 4MBGA 4UQYA 1BU9A 1MHQA 1H0AA 1W3BA 2ZXWE 3ZEFA 3CSFA 3QAQA 3UPVA 4UQXA 1LF8A 2PL2A 3FTZA 3U64A 2NYJA 4XZ4A 4HOTA 2WXRA 3ASDA 3ESKA 5G05C 5BT1A 4O6FA 4KVMA 5EX3A 3ABKE 2Y4TA 5AN8A 1OWOA 4U63A 4G8LA 3Q5MA 2VYIA 1O5MA 3FH8A 5FJYA 4UWHA 1FVHA 2WXMA 3B7SA 3APDA 1HFAA 3G2WA 1TYQG 3NF1A 2LNIA 2HYZA 1WG0A 4JHRA 2CHWA 5ENRD 3ZXPA 4ANUA 2NXPA 4Q94A 5EIDA 2QZAA 3NQPA 2GW1A 4KYOB 4XIFA 1A5EA 1SW6A 2IOLA 2X6FA 3CGHA 4TV3A 2R03A 4HRLA 2ZGGA 5EYLA 3KAEA 4TRQA 4KZCA 3G2TA 4BT8A 4EBAG 3FUJA 3G2SA 2KM4A 3I5PA 4PS8A 5J90A 5ITZF 3SI5A 3FUHA 1E8WA 2DZOA 3MKQB 2QYJA 1FT1A 3E34A 2WQ6A 1N0RA 1FCHA 1D9SA 5B1BE 3P1UA 3PE3A 1NA3A 1TN6A 3UM3A 2J8SD 2WQ7A 5H7PA 1MX6A 1O1SA 3DRAA 3TAXA 4UWGA 4GMRA 4U0SA 3ENEA 3T5XA 3LVRE 2DZNA 5AARA 5T3RA 4ANXA 1AWCB 3AS8A 4DLQA 5EYPF 3SBSA 3ZRHA 4HRNA 2WVIA 3QK0A 2VTBB 4ILIA 4TXPA 1TN8A 3W9FA 1S70B 2XGOA 4JA9A 3RO3A 1N4SA 4BTAA 2VGEA 1N11A 4GCOA 3EIJA 4O60A 4FULA 4K03A 1ZU2A 2RKKA 4EBAA 5JMND 4D10C 4CT0A 3C3OA 4WNGA 5FWQA 4TXRA 2F8XK 4HNAD 1DNPA 2L9BA 3J5PA 2P9SG 4UI9C 3CVLA 2IF4A 3MV3B 2V5QC 3ZGQA 1IYGA 1FVFA 3S7DA 5FINA 2P2CP 3I3NA 2AXZA 3S7JA 2C0MA 1KT1A 3S7BA 3CHMA 3SFXA 3HVEA 4GPMA 4CDMA 4EHMA 3PS6A 2VGXA 2KBXA 2XEHA 4BWRA 3BG0B 4FHJA 1DC2A 2I9CA 5LP0A 2ETAA 5CCLA 2FO7A 3CHSA 1TNBA 3HXDA 5LX8A 3QWPA 4LSZE 4UUCA 3DSSA 3N71A 4UI9J 3QNKA 2V0PA 3FWVA 1SQMA 1E8YA 3KSQA 2H6GA
chains in the Genus database with same CATH topology
2IJGX 5JJ6A 1ELRA 1U3CA 4GZ6A 4N5CA 4C9BB 2J49A 2A4ZA 4PUCA 2BTDA 4GCNA 3MV2B 4HOQA 3APCA 2WXQA 4M3OA 4V3IA 3GZ2A 1QZ2A 1XNFA 3CIAA 4UWKA 1QQEA 2XCBA 2IU1A 3DBSA 2AVPA 2QY7A 3PZDA 4I2WA 3EIQC 5KJLA 5G05J 2LAHA 5ANLA 2QFCA 3CV0A 3FU0A 4I6EA 2CHZA 1OUVA 3B13A 3ASFA 3FUEA 3VLFA 4AM9A 3SBTB 3JQ1A 2VGXB 5ARGA 3I4GA 3IEGA 4J8DA 4JEUA 4K0RA 4FA6A 4EPZA 3Q15A 4I43A 4XKCA 5D0OD 4CDRA 3JUIA 3PUJA 2Y4UA 2V4LA 1Y8MA 4HS2A 4JZYA 5T8IA 4EZLA 4RVBA 5BV1A 1OWNA 3CHOA 1HG2A 2I6HA 5G55A 2CG3A 4N3AA 3MEKA 2J4DA 1UN9A 4KMOA 3ULQA 1OWLA 1UN8A 3R7QA 5KCMA 4JC8A 3QWVA 4GA1A 4J8EA 1JPLA 1PY1A 4ATGA 3ZFWA 1WY6A 2WPVA 3FU5A 2LSUA 2X6KA 3HHMA 5E76A 4GAAA 3CK9A 5M72A 2I1JA 2GGFA 3CVWA 3BG1B 2A5UA 3LS8A 1H2TC 2JLBA 4BSXA 5A7DB 4GPKA 4NURA 5AJDA 5LFAA 4LERA 1E90A 1H2VC 3RKVA 5KJMA 1UG3A 4J0UA 4Y6CA 3FTYA 3FTXA 3PNTB 3JYSA 2NSZA 4G23A 4WWNA 4WAFA 3QB2A 3L54A 1TJCA 2FEZA 5ARFA 1U3DA 2LAIA 3FTWA 2PM7A 3DPDA 1EDUA 4GYWA 2FULA 4H7XA 1SZ9A 2FBNA 4TUUA 2KCKA 3D3MA 3IHYA 3L16A 1B89A 2J4BA 3IHVA 1HG5A 3B7UX 5LCWJ 4U0UA 3ML9A 3B7TA 3Q49B 2DBAA 2HO1A 4YVQC 3ZHEB 3TG4A 2L0IA 2IOSA 1YA0A 3ZPJA 3OAWA 4I9EA 1SZAA 3P2BA 1QNFA 4Q96A 5FQ7A 2OOEA 3D9PA 4FHKA 3T8MA 5C2YA 4J8FA 4GYOA 1OWMA 2KZTB 3LY7A 2UY1A 4N2QA 3K9IA 4LEUA 2GRMA 3GYZA 4EQFA 3FUIA 2KCVA 3HVEB 4NRHB 3D9NA 3G2UA 4W9RA 2BUGA 3S2AA 3U9WA 3AS4A 3SNXA 1N54A 3LDZA 3PEUB 2E2EA 2XEVA 1H6KA 5J08A 4AEZC 1H2UA 2WMOA 4BT9A 2X3MA 4FU3A 4A55A 3ZXSA 2CG2A 1E8XA 2WQHA 2Q7FA 3QJZA 5BW8C 4CCAA 1ELKA 4MRUA 2OVBA 5EDSA 4AOFA 3L22A 4UQZA 4A3TA 5LCWC 4LUNU 3L08A 3T5VA 3LKUA 4B94A 4GZ5A 2UY1B 4HXIA 3QWWA 2PQNA 3AU5A 3PREA 2XGMA 3LCAA 3CVQA 2VTBA 4CGWA 1NA0A 3AS5A 4EECA 3FU6A 2X6IA 5BUZA 3OXGA 5BNWA 3FEYA 4G25A 2YQ8A 2FI7A 4JA7A 1JWGA 4AJWA 2HR2A 1HU3A 4GZDA 4U8HA 5G2NA 3RRNB 2VSYA 4KZ0A 3O48A 5ANRA 5G04C 2OVFA 3RK6A 4APFA 4PH4B 2CFUA 3CQCB 3MCXA 5FZQA 3FTUA 2XPYA 4L7TA 2PM6A 4BFRA 3ML8A 1KT0A 2UWJG 2WXLA 3D9OA 3OXLA 1IHGA 4G1TA 2Y3AA 4FJZA 4WUYA 3ZYKA 4FLHA 3CHRA 4EZKA 3ZYMA 2V8SE 2VGYA 2ZU6B 4GZCA 4FADA 3CVUA 5CCMA 4FC8A 2R5SA 4MLPA 5FQ8A 1XGWA 5AJLA 3QOUA 2V5FA 4JPSA 3CHPA 2C0LA 2WM9A 4GZ3A 2BF0X 3MGBA 4XE0A 4URKA 5AENA 3GW4A 1L5JA 2WXKA 5EKQD 1HZ4A 4OYSA 2WXFA 3EHMA 3CKCA 5EX0A 3CKBA 1IQUA 2DIWA 4GA2A 4U07A 3SZ7A 3FUMA 3MZLB 2KC7A 4I1OB 4F3VA 4NQ0A 1GW6A 1WAO1 3QC1A 4KT6B 4R7LA 4ACKA 1UJJA 5E75A 3VTXA 1HO8A 4GMJA 2VSXE 3CSTA 3FFLA 3FUDA 3HDXA 4I9CA 3MA5A 4UQYA 4E6HA 1MHQA 1H0AA 3LXUX 3RJVA 3QKYA 1W3BA 3FTSA 1E7UA 1MQSA 3ZEFA 4AV7A 4U0ZA 4I1AA 3CSFA 3QAQA 5A23A 3UPVA 3VLDA 3RIBA 3RRMB 3FUKA 4UQXA 1LF8A 2PL2A 5AYWD 4XX5A 3FTZA 2OV8A 3UT4A 4DK5A 4KBQA 2XCCA 2WXNA 3ZYLA 3RRUA 3U64A 1Y6IA 5JJTA 4XZ4A 4HOTA 2WXRA 3PE4A 3HIZA 4Y6WA 5D0QD 2NC9A 4ABNA 1NP7A 4WNFA 3RU0A 3ASDA 3CVXA 3EDTB 5KJKA 3ESKA 2VJ8A 2VSNA 1N52A 5G05C 1JWFA 3L13A 3U4TA 3CVYA 5BT1A 5C1DA 4O6FA 4KVMA 4CDNA 4J8SA 5EX3A 4J6IA 3ASGA 3EJNA 2E0IA 3ZYQA 2L0TB 3LY8A 2Y4TA 3SFZA 4GA0A 2AWIA 2RG8A 4MKTA 4F1SA 1S0PA 1OWOA 4U63A 3ZW3A 3U3WA 2YNQA 1KLXA 4HFGA 4ILHB 4IRUA 4GYYA 1DVPA 4DLOA 3IBEA 3Q5MA 1HXIA 2VYIA 2KCLA 2XQ0A 4GMLA 4HORA 4A3VA 4IYPA 5FQ6A 1EF1C 4ACLA 5JHBA 3FH8A 5HI7A 4KVOA 2IQCA 5FJYA 4UWHA 1FVHA 2WXMA 5CMYA 3B7SA 4CGVA 3APDA 4I1MA 2WMNA 3D9JA 3KEZA 3PVLA 3ZN3A 1OWPA 5CMWA 2WB2A 3LEWA 3L17A 1HFAA 4PS3A 4RG6A 4JXTA 3G2WA 3NF1A 2MOWA 4IULA 1H19A 2LNIA 4ILGA 4YVOA 4G26A 2HYZA 4G24A 4AIFA 4MS6A 2VQ2A 5FQ4A 4QFVA 4AY5A 1PAQA 3EHNA 1BPOA 2M63A 4JHRA 3Q4AB 5CHEE 5FZRA 4OVUA 2CHWA 4L2YA 4AP2A 2WXGA 1VDYA 1P5QA 4ANUA 2NXPA 3FUNA 4Q94A 4DI3A 3CQGB 4FJYA 4H7YA 3I4RB 2GW1A 3NQPA 4KYOB 4XIFA 2IOLA 3MKRA 1TEZA 2X6FA 4IN3B 3CGHA 4DI4A 4CRWA 3CK7A 4TV3A 1Z6TA 5JJ7A 4F7AA 3KAEA 4P29A 3TJPA 4TRQA 3D9KA 4A1GA 4KZCA 3BEEA 2AXUA 3FTVA 4UWLA 4HOUA 4FLBA 3G2TA 1HS6A 2YHEA 1UW4B 3LPZA 4BT8A 4JHKA 2IONA 3FUJA 3GZSA 4RSYA 4EBAG 2XPIA 1ZBPA 4U04A 2PZIA 4GU5A 3G2SA 3KS2A 2XRYA 2GRLA 3B7RL 3FH7A 3FHEA 1E7VA 1ELWA 5G04J 2WXJA 2KM4A 3CVNA 4A1SA 3I5PA 4BTBA 3OXFA 4BX9A 2MRIA 4FP7A 3CVPA 5LOZA 4I17A 3CEQA 1WM5A 3FULA 4PS8A 5ENNA 2X38A 5J90A 2FF4A 4JVSA 2PQRA 4LCTA 2KATA 4L1BA 3SI5A 5DBKA 4LRZA 2P58C 4N3CA 3O4ZA 4I6GA 4HOSA 4G2VA 3FUHA 1E8WA 4C0MA 3MKQB 2JEKA 3ZHEA 4CEMA 2WQ6A 1FCHA 1UJKA 4G11A 4WWPA 1TJFA 3QDNA 5DIZA 3MJWA 3P1UA 4XI0A 3URZA 3PE3A 1NA3A 3S7FA 4N3BA 3L6AA 2XPZA 2WXOA 2WQ7A 1INZA 4ANVA 3R9AB 2ILRA 3TAXA 4UWGA 1HH8A 5FT9A 3UQ3A 3ZVVA 1IQRA 2I2OA 4U0SA 3ENEA 4WWOA 3SD5A 3FDHA 3MKQA 4KXKB 4XI9A 3T5XA 3LVRE 4HLEA 3C98A 4AXHA 4L23A 3Q47B 3TG5A 4EZJA 3HYMB 1HF8A 5T3RA 4ANXA 3JQ0A 3ESLA 4UWFA 4BX8A 3AS8A 4DLQA 3SGHA 2XRZA 3G2VA 5HQ8A 4WNDA 3SBSA 3JCKC 3ZRHA 2YHCA 2WVIA 2C2LA 3QK0A 4ME2A 4JW1A 4ILIA 4XKBA 2KZTA 2VTBB 2YINA 3RO2A 4E85A 3LYAA 3CK8A 2XGOA 3UT7A 3VTYA 5JHAA 3FEXA 4JA9A 4N39A 3U66A 3CR3A 4JEHA 4DPRA 3RO3A 4BTAA 4GCOA 2EQXA 2VSOE 3EIJA 2CHXA 2XGSA 2AW6A 3CLJA 1NZNA 2RD0A 2J08A 1Z3YA 3D9MA 4OVVA 4FULA 4K03A 1ZU2A 4EBAA 4DJAA 4ANWA 3IV0A 3SHFA 4D10C 3UX4A 4WNEA 2MHKA 1E8ZA 2ONDA 3LJ3A 3TL5A 5KJNA 4C0EA 2AXVA 1E96B 3OTNA 3ZIMA 4CT0A 4WNGA 3UMVA 5T4YA 1EYHA 2DCPA 3E4BA 1HX8A 2CFZA 5FWQA 4B8AA 1DNPA 2L9BA 2R17C 2XHEA 3APFA 4UI9C 3MX3A 3NZSA 3CVLA 4JL0A 2IF4A 5FZSA 3TXNA 3D9IA 3MV3B 4F53A 1HE8A 1X5BA 3ZGQA 3IKOB 3FUFA 3VLEA 3QARA 3PUKA 4B8CB 1IYGA 1FVFA 3CHQA 3PH0C 3S7DA 4N2SA 4Q69A 3D9LA 3UT8A 3I3NA 3R7RA 2AXZA 3PDNA 3S7JA 4L2LA 2C0MA 1KT1A 3CVVA 3TGOA 3S7BA 2J07A 2WXHA 3CHMA 3FH5A 4CT4A 3HVEA 5BV0A 2L6JA 4CDMA 3FU3A 4GB9A 3PS6A 3PRZA 3PEVB 2VGXA 4NACA 4HVBA 2WXPA 4BWRA 4AVXA 5AIJA 3BG0B 2LO6A 4APOA 3AU4A 4B89A 2IFUA 2X6JA 3ASHA 3WXXA 4FHJA 3LVQE 3GZ1A 4PS7A 2I9CA 4BY6A 5LP0A 1Z3XA 4AY6A 5CCLA 2I1KA 1A17A 3UUXA 4RG9A 5A6CA 2FO7A 1PC2A 3CHSA 2J09A 3FP3A 3FY4A 3MYVA 4JHJA 5BPPA 2WXIA 3LY9A 5LX8A 1EPUA 3QWPA 1JUQA 4YNDA 4B0ZA 3N71A 3ONKA 4UI9K 2X6HA 2R59A 3TXMA 2LSVA 3SF4A 4UI9J 3QNKA 2V0PA 3FWVA 2J9QA 3KD7A 4PDXA 5FTPA 4I2ZA 3NZUA 1SQMA 3ONLA 4I6JA 1E8YA 3PNLB 2HM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIW A;  4GZD A;  3ZYL A;  3D9I A;  1DVP A;  3RRU A;  4FU3 A;  1X5B A;  1VDY A;  3G2S A;  3CLJ A;  1UJJ A;  5LP0 A;  1ELK A;  3D9M A;  1HF8 A;  1UJK A;  2L0I A;  2KM4 A;  4Q94 A;  1SZA A;  3D9O A;  1HG2 A;  1MHQ A;  1JWF A;  3D9L A;  4Q96 A;  1H0A A;  2QY7 A;  3D9P A;  3G2V A;  5CMY A;  3ZYK A;  5CMW A;  3ZYM A;  2V8S E;  3D9J A;  4GZC A;  1JUQ A;  1HFA A;  3ONK A;  1INZ A;  5LOZ A;  4JXT A;  1EYH A;  1EDU A;  2DCP A;  1JPL A;  1PY1 A;  1HX8 A;  1XGW A;  3G2W A;  3ZYQ A;  4HFG A;  2MOW A;  1SZ9 A;  3D9N A;  2L0T B;  3G2U A;  1LF8 A;  2BF0 X;  3D9K A;  4NAC A;  3ONL A;  1HG5 A;  1JWG A;  3LDZ A;  4AVX A;  2LO6 A;  4FLB A;  5J08 A;  3G2T A; 
#chains in the Genus database with same CATH topology
 4GTS A;  2J49 A;  2BTD A;  3APC A;  4M3O A;  2GRQ B;  1KZP A;  1XNF A;  2XCB A;  5EIL A;  5ANL A;  1BI8 B;  3CV0 A;  4M7C A;  5CBN A;  1N9A A;  4I6E A;  2CHZ A;  3ASF A;  2F0Y A;  3VLF A;  2VGX B;  5B1A E;  3IEG A;  4J8D A;  3HRA A;  4U96 D;  1Y8M A;  4L9P A;  1TNY A;  3HXB A;  1OWN A;  3CHO A;  2CG3 A;  3ULQ A;  1OWL A;  5CEC B;  5KNG A;  1PY1 A;  5CEA A;  3Q7A A;  3V30 A;  2B0O E;  1LD8 A;  2F8Y A;  3UM0 A;  2GGF A;  2A5U A;  1H2T C;  2ZGD A;  5A7D B;  3C3Q A;  1H2V C;  1RZ4 A;  3PNT B;  3HXF A;  3QB2 A;  1V54 E;  3DEO A;  5HS0 A;  4GYW A;  1EDU A;  2XEE A;  3D3M A;  1MX4 A;  3B7U X;  3B7T A;  3Q49 B;  3UKU G;  4YVQ C;  3BQO A;  3D9H A;  2L0I A;  3OAW A;  3P2B A;  1QNF A;  3PZ1 A;  4BSZ B;  2KZT B;  3LY7 A;  4N2Q A;  4NRH B;  3D9N A;  4W9R A;  3KEA A;  2BUG A;  3S2A A;  2KXP C;  1N54 A;  3TWU A;  3PEU B;  4AEZ C;  4BT9 A;  2X3M A;  3ZXS A;  3E30 A;  2EIN E;  1ELK A;  3T8K A;  3L22 A;  5LCW C;  4HXI A;  2PQN A;  3LCA A;  2VTB A;  3CVQ A;  4CGW A;  5BUZ A;  5BNW A;  4G25 A;  4DX5 D;  5D66 A;  5BXO A;  1HU3 A;  2QC9 A;  3O48 A;  3FTU A;  4BFR A;  4JB8 P;  3AG3 E;  2Y3A A;  4EZK A;  3WG7 E;  2ZU6 B;  2R5S A;  1XGW A;  2V5F A;  4JD2 G;  3T9K A;  4GTM A;  3MGB A;  2XEN A;  4URK A;  3EHM A;  2DIW A;  3SZ7 A;  2KC7 A;  4NQ0 A;  1WAO 1;  5E75 A;  2VSX E;  3MA5 A;  1G3N B;  3QKY A;  3FTS A;  3X2Q E;  4I1A A;  5A23 A;  3ZNG A;  1NL4 A;  3RRM B;  5AYW D;  4XX5 A;  2OV8 A;  3F6Q A;  3NBN B;  4KBQ A;  2XCC A;  1IKN D;  2WXN A;  3RRU A;  1UOH A;  1Y6I A;  1NP7 A;  4WNF A;  3CVX A;  2ZIS A;  3U4T A;  3CVY A;  4CDN A;  4J8S A;  4J6I A;  1N4Q A;  4XEI G;  2L0T B;  3LY8 A;  4RQI A;  3ZW3 A;  4GYY A;  2KCL A;  2XQ0 A;  4HOR A;  4ACL A;  5JHB A;  5HI7 A;  4KVO A;  2R05 A;  3L17 A;  4N5Q A;  4PS3 A;  4RG6 A;  4LNU D;  1N4R A;  5AQB A;  1NFI E;  1H19 A;  4YVO A;  4MS6 A;  5FQ4 A;  4OAV B;  4QFV A;  4AY5 A;  5FZR A;  4AP2 A;  4A63 B;  3CQG B;  3I4R B;  3MKR A;  4IN3 B;  4CRW A;  3CK7 A;  1Z6T A;  1ZB1 A;  4P29 A;  3D9K A;  1SVX A;  2AXU A;  5HKP A;  2V4H C;  2YHE A;  2XPI A;  4U04 A;  2XRY A;  2GRL A;  3E33 A;  3FH7 A;  2WXJ A;  4O1P A;  3OXF A;  4FP7 A;  2X38 A;  4JVS A;  2PQR A;  4LCT A;  2IEJ A;  3ULY A;  2H6F A;  5AQ9 A;  1MZC A;  3DSU A;  4G2V A;  4HOS A;  4C0M A;  3QDN A;  4GTO A;  5HRY A;  5CRU A;  4N3B A;  1INZ A;  4ANV A;  2Y1L E;  2A5E A;  3R9A B;  2ILR A;  3UQ3 A;  3ZVV A;  3EHR A;  1IQR A;  2I2O A;  3FDH A;  3PZ3 A;  4XI9 A;  3Q47 B;  1MYO A;  5AQA A;  5AQ7 A;  1YYH A;  4WND A;  2ZIR A;  3UM1 A;  3JCK C;  2YHC A;  4ME2 A;  4JW1 A;  4E85 A;  3CK8 A;  3UT7 A;  3FEX A;  3U66 A;  3CR3 A;  4OAU C;  3DEP A;  4U8V D;  2VSO E;  4TUM A;  4G8K A;  2GRP B;  4WNE A;  1E8Z A;  1E96 B;  3UMV A;  3JXJ A;  5T4Y A;  2EIJ E;  3APF A;  3TWR A;  3TWX A;  5FZS A;  3TXN A;  3D9I A;  1HE8 A;  1X5B A;  3VLE A;  3QAR A;  3CHQ A;  1K8K G;  4N2S A;  4Q69 A;  4BER A;  3RAU A;  3R7R A;  3PDN A;  3TGO A;  3FH5 A;  4GTQ A;  4GB9 A;  3PRZ A;  3PEV B;  4J8Y A;  2LO6 A;  4B89 A;  2X6J A;  3WXX A;  4NIK A;  4BY6 A;  1A17 A;  3UUX A;  2J09 A;  3FP3 A;  5BPP A;  1EPU A;  4YND A;  3ONK A;  3L82 A;  2P9P G;  3KD7 A;  2PNN A;  3V2O A;  4PDX A;  3NZU A;  3PNL B;  5JJ6 A;  1ELR A;  4C9B B;  4PUC A;  4HOQ A;  4V3I A;  2WXQ A;  4UWK A;  2QY7 A;  4DX2 A;  4B93 B;  4CYM D;  5JA4 D;  1SA5 A;  3FU0 A;  5ARG A;  3I4G A;  4EPZ A;  3Q15 A;  4XKC A;  3JUI A;  3PUJ A;  2V4L A;  4HS2 A;  5T8I A;  3B7B A;  2BKK B;  3V2X A;  3MEK A;  4KMO A;  5KCM A;  4GA1 A;  4J8E A;  1JPL A;  3HHM A;  5E76 A;  4TXQ A;  4GAA A;  1TN7 A;  2I1J A;  4K5C A;  2OCC E;  4BET A;  1E90 A;  5KJM A;  4J0U A;  5ARF A;  4WAF A;  2EIK E;  2FEZ A;  1U3D A;  2IO2 C;  1N94 A;  2LAI A;  3DPD A;  2FUL A;  4H7X A;  1SZ9 A;  2FBN A;  2KCK A;  3IHY A;  5BXU A;  1B89 A;  5KWD A;  3E37 A;  2DBA A;  2HO1 A;  3UIN C;  2P9N G;  1D8D A;  2OOE A;  1N95 A;  4GYO A;  2GRM A;  1OCO E;  3G2U A;  4F1P A;  3U9W A;  3AS4 A;  2AJA A;  2E2E A;  2XEV A;  2WMO A;  2DVW A;  5AAO A;  4A55 A;  2CG2 A;  1E8X A;  4CCA A;  5BW8 C;  2OVB A;  4AOF A;  4A3T A;  3DSV A;  3LKU A;  4GZ5 A;  2UY1 B;  4U95 D;  4ATZ D;  3HXC A;  5CER B;  2YQ8 A;  1JWG A;  2HR2 A;  5G2N A;  3RRN B;  2VSY A;  5ANR A;  2OVF A;  4APF A;  2CFU A;  3MCX A;  5FZQ A;  4L7T A;  1U2V G;  1H6O A;  3ML8 A;  3SO8 A;  2WXL A;  3D9O A;  1IHG A;  2P9K G;  4G1T A;  3ZYM A;  4FAD A;  1N0Q A;  4MLP A;  4YDY A;  2R02 A;  5AJL A;  3HXE A;  2C0L A;  4XE0 A;  3Q78 A;  5EKQ D;  4OYS A;  3UIO C;  1D8E A;  3DPY A;  4F3V A;  4KT6 B;  4ACK A;  1OXJ A;  4X8Q A;  1HO8 A;  4I9C A;  3FUD A;  4DUI A;  3LXU X;  3RJV A;  4AV7 A;  3AG1 E;  4U0Z A;  1KPS B;  4YDO A;  3DXK G;  5ENT D;  5JJT A;  3PE4 A;  3HIZ A;  4Y6W A;  5D0Q D;  4ABN A;  5KJK A;  2VSN A;  1JWF A;  3L13 A;  4BEP A;  3ASG A;  3EJN A;  2E0I A;  3NOC D;  2AWI A;  4MKT A;  1LTX A;  4HFG A;  4ILH B;  4IRU A;  1HXI A;  4IYP A;  3TWV A;  1EF1 C;  5CMW A;  4I1M A;  2WMN A;  3D9J A;  3KEZ A;  3J5Q B;  2MOW A;  4IUL A;  3UIP C;  4ILG A;  1H6P A;  4G26 A;  4G24 A;  4AIF A;  2VQ2 A;  2GRO B;  2JAB A;  1TR4 A;  3EHN A;  1BPO A;  3Q4A B;  4LG6 A;  1K3Z D;  2WXG A;  1P5Q A;  4DI3 A;  4H7Y A;  1OCC E;  4DI4 A;  5JJ7 A;  3PZ2 A;  2EIL E;  4F6R D;  3LPZ A;  2ION A;  1JCQ A;  4RSY A;  3KS2 A;  1TNZ A;  4HRM B;  3FHE A;  3CVN A;  3PZ4 A;  4BX9 A;  5LOZ A;  4I17 A;  1WM5 A;  3AJI A;  2FF4 A;  2KAT A;  5DBK A;  4N3C A;  2P58 C;  3UTM A;  3O4Z A;  4I6G A;  2JEK A;  3ZHE A;  4CEM A;  3DWL G;  4G11 A;  5DIZ A;  3MJW A;  3S7F A;  2B6C A;  2XPZ A;  2LXL A;  3MKQ A;  4KXK B;  1O1R A;  3C98 A;  3TG5 A;  4EZJ A;  3HYM B;  1HF8 A;  3JQ0 A;  3SGH A;  3G2V A;  2EIM E;  1IHB A;  4XKB A;  2KZT A;  2FO1 E;  2YIN A;  3LYA A;  4N39 A;  4JEH A;  2IO3 C;  4HI9 A;  1RW2 A;  1NZN A;  2RD0 A;  2J08 A;  1Z3Y A;  3D9M A;  4OVV A;  4YDE A;  4ANW A;  3IV0 A;  4HI8 A;  4K5A B;  3SHF A;  5KJN A;  2OND A;  3LJ3 A;  2AXV A;  3OTN A;  3UXG A;  2H6I A;  3E4B A;  2DYR E;  2CFZ A;  4B8A A;  2R17 C;  2XHE A;  3ABL E;  2R2L A;  3MX3 A;  4F53 A;  4B8C B;  3FUF A;  5FIO A;  2BKG A;  3D9L A;  3UT8 A;  4L2L A;  4ZHB A;  4CT4 A;  3FU3 A;  2WXP A;  4AVX A;  3ASH A;  1YMP A;  4O1O A;  3LVQ E;  3GZ1 A;  3Q9N C;  1BD8 A;  1MX2 A;  2I1K A;  4RG9 A;  5A6C A;  4JHJ A;  3DSW A;  1S64 A;  1JUQ A;  4B0Z A;  2X6H A;  2LSV A;  3SF4 A;  5KNH D;  5FTP A;  4I2Z A;  3ONL A;  4I6J A;  3Q73 A;  5EIB E;  2Y0B G;  2IJG X;  4GZ6 A;  4N5C A;  2A4Z A;  4GCN A;  3MV2 B;  3BU8 A;  3TWS A;  5ENS D;  1QZ2 A;  3CIA A;  3PZD A;  2AVP A;  3EIQ C;  4QQI A;  5G05 J;  4GTT A;  1SA4 A;  3B13 A;  3Q75 A;  4DX7 D;  4AM9 A;  3JQ1 A;  2ETB A;  4JEU A;  4FA6 A;  2BED A;  2Y4U A;  2MYO A;  4K5B A;  5BV1 A;  2I6H A;  5G55 A;  2J4D A;  3QWV A;  1X81 A;  1WY6 A;  3FU5 A;  3UM2 A;  2X6K A;  3CK9 A;  5M72 A;  3BG1 B;  4BSX A;  2JLB A;  3UKR G;  4LER A;  2XS8 A;  3R9M A;  3SFY A;  3FTY A;  4G23 A;  4WWN A;  5EN5 D;  3NOG D;  2PM7 A;  3JXI A;  4TUU A;  2J4B A;  5LCW J;  4U0U A;  5ENQ D;  3ZHE B;  3TG4 A;  4GTV A;  1YA0 A;  4I9E A;  1SZA A;  4Q96 A;  5FQ7 A;  3D9P A;  4RLY A;  4J8F A;  1OWM A;  3ASO E;  3K9I A;  3GYZ A;  2KCV A;  3HVE B;  1FT2 A;  2DWZ A;  3ABM E;  3SNX A;  3LDZ A;  5J08 A;  2P9L G;  1O1T A;  5CBO A;  4FU3 A;  1BI7 B;  2WQH A;  2Q7F A;  5EDS A;  2GRR B;  1V55 E;  2P9U G;  4UQZ A;  3Q79 A;  3DXM G;  4LUN U;  3T5V A;  2RFM A;  4B94 A;  3ISM C;  3AU5 A;  2XGM A;  3FU6 A;  2X6I A;  3OXG A;  2FI7 A;  2OEW A;  4GZD A;  4U8H A;  3CVV A;  3RK6 A;  1FPP A;  1JCR A;  4WUY A;  2L6B A;  4FJZ A;  3ZYK A;  4GZC A;  3B95 A;  5CCM A;  4FC8 A;  3QOU A;  4JPS A;  3CHP A;  4GZ3 A;  1LD7 A;  3GW4 A;  2WXK A;  1HZ4 A;  4ZFH A;  3CKC A;  5EX0 A;  3CKB A;  1IQU A;  4U07 A;  3NAW A;  4R7L A;  3CST A;  3HDX A;  4E6H A;  3W9G A;  1E7U A;  1MQS A;  4C48 B;  3VLD A;  3RIB A;  1K1B A;  3FUK A;  3UT4 A;  4DK5 A;  3ZYL A;  3BUA A;  4LNB A;  3JUE A;  2NC9 A;  5ENO D;  3Q7F A;  3RU0 A;  3EDT B;  2VJ8 A;  1N52 A;  5C1D A;  4HB5 A;  3TWQ A;  3LJN A;  4HLL A;  3ZYQ A;  3SFZ A;  4GA0 A;  2RG8 A;  4F1S A;  1S0P A;  3U3W A;  2YNQ A;  3Q9U C;  1KLX A;  1DVP A;  4DLO A;  3IBE A;  3EU9 A;  4GML A;  1QYM A;  1AP7 A;  4A3V A;  5FQ6 A;  2IQC A;  5CMY A;  4CGV A;  5CRV A;  3ZN3 A;  2WB2 A;  3PVL A;  1OWP A;  3LEW A;  4JXT A;  2DYS E;  2F37 A;  5CED B;  1PAQ A;  5CHE E;  2M63 A;  4OVU A;  4L2Y A;  1VDY A;  4DX6 D;  3ULE G;  3FUN A;  4FJY A;  3E32 A;  1TEZ A;  3EU5 A;  1DCQ A;  4F7A A;  3TJP A;  4A1G A;  3BEE A;  3FTV A;  4UWL A;  4HOU A;  4FLB A;  1HS6 A;  1UW4 B;  2ETC A;  4JHK A;  3GZS A;  1ZBP A;  2PZI A;  4GU5 A;  3B7R L;  1E7V A;  1ELW A;  5G04 J;  4A1S A;  4LNG A;  4BTB A;  2RFA A;  1TNO A;  2MRI A;  3CVP A;  3CEQ A;  3FUL A;  5ENN A;  4L1B A;  4LRZ A;  5IY5 E;  1UJK A;  4HQD A;  4WWP A;  1TJF A;  3AAA C;  4XI0 A;  3URZ A;  3ZUV B;  3IXE A;  2H6H A;  3L6A A;  2WXO A;  1JCS A;  3ZKJ A;  1HH8 A;  5FT9 A;  4J7W A;  4WWO A;  3SD5 A;  4HBD A;  4HLE A;  4AXH A;  4L23 A;  2P9I G;  3V31 A;  2HE0 A;  3ESL A;  4UWF A;  4BX8 A;  2Y69 E;  2XRZ A;  5HQ8 A;  4YDW A;  2C2L A;  3AG4 E;  3HG0 D;  1YCS B;  3C3R A;  5ENP D;  3RO2 A;  3VTY A;  5JHA A;  4DPR A;  2XS1 A;  2EQX A;  2CHX A;  2XGS A;  2AW6 A;  3CLJ A;  4DJA A;  3UX4 A;  3EHQ A;  2MHK A;  3TL5 A;  4C0E A;  3ZIM A;  1EYH A;  2DCP A;  1HX8 A;  3SQV A;  4GTP A;  3NZS A;  3UI2 A;  4JL0 A;  3IKO B;  3PUK A;  3PH0 C;  1QBQ A;  1OT8 A;  1IXV A;  1BLX B;  1NI1 A;  2XZD G;  1DCE A;  5KBA A;  2J07 A;  2WXH A;  5BV0 A;  2L6J A;  4NAC A;  4HVB A;  5AIJ A;  4APO A;  3AU4 A;  2IFU A;  2XZT G;  4PS7 A;  3RSE G;  2OEV A;  1Z3X A;  1PC2 A;  3FY4 A;  3MYV A;  2WXI A;  3LY9 A;  2LUH A;  4UI9 K;  3TXM A;  2R59 A;  2J9Q A;  1Z5S C;  2GRN B;  3AG2 E;  2HM8 A;  1U3C A;  2LXM A;  1WDY A;  4GTR A;  3GZ2 A;  1QQE A;  3DBS A;  2IU1 A;  4I2W A;  5KJL A;  3EUV A;  2LAH A;  2QFC A;  3NB2 A;  1OUV A;  3TWT A;  3FUE A;  1OCR E;  3SBT B;  4K0R A;  4I43 A;  5D0O D;  4CDR A;  4Z68 A;  4DX1 A;  4EZL A;  4JZY A;  4CZ2 D;  4RVB A;  1HG2 A;  4N3A A;  1UN9 A;  1N4P A;  1UN8 A;  3R7Q A;  4JC8 A;  3C72 A;  4ATG A;  3ZFW A;  2WPV A;  1K1A A;  2LSU A;  3V79 K;  3CVW A;  4BES A;  3LS8 A;  4GPK A;  4NUR A;  5AJD A;  5LFA A;  1S63 A;  3RKV A;  1UG3 A;  4Y6C A;  5D2M C;  3FTX A;  3JYS A;  2NSZ A;  3L54 A;  1TJC A;  3TWW A;  3FTW A;  3C5R A;  3ASN E;  3DST A;  3L16 A;  3IHV A;  1HG5 A;  3ML9 A;  4U8Y D;  1KZO A;  2IOS A;  3ZPJ A;  4FHK A;  3T8M A;  5C2Y A;  4DRX E;  2UY1 A;  4LEU A;  4EQF A;  3KSL A;  3FUI A;  1MJ0 A;  5B3S E;  1H6K A;  1H2U A;  3QJZ A;  3DSX A;  4MRU A;  1Q2Z A;  1OCZ E;  3L08 A;  3L9T A;  3QWW A;  2IY0 C;  3PRE A;  1NA0 A;  3AS5 A;  4EEC A;  3FEY A;  4JA7 A;  1OY3 D;  4AJW A;  3SY2 A;  4KZ0 A;  4AY6 A;  5G04 C;  4PH4 B;  3CQC B;  2XPY A;  2PM6 A;  2QYU A;  1KT0 A;  2UWJ G;  3OXL A;  4U7E B;  4FLH A;  3CHR A;  2V8S E;  2VGY A;  3CVU A;  5FQ8 A;  2WM9 A;  3ZU7 B;  2BF0 X;  5AEN A;  1L5J A;  2WXF A;  4GA2 A;  3FUM A;  3MZL B;  1TNU A;  4I1O B;  1GW6 A;  3QC1 A;  1UJJ A;  3VTX A;  4GMJ A;  3FFL A;  4MBG A;  4UQY A;  1BU9 A;  1MHQ A;  1H0A A;  1W3B A;  2ZXW E;  3ZEF A;  3CSF A;  3QAQ A;  3UPV A;  4UQX A;  1LF8 A;  2PL2 A;  3FTZ A;  3U64 A;  2NYJ A;  4XZ4 A;  4HOT A;  2WXR A;  3ASD A;  3ESK A;  5G05 C;  5BT1 A;  4O6F A;  4KVM A;  5EX3 A;  3ABK E;  2Y4T A;  5AN8 A;  1OWO A;  4U63 A;  4G8L A;  3Q5M A;  2VYI A;  1O5M A;  3FH8 A;  5FJY A;  4UWH A;  1FVH A;  2WXM A;  3B7S A;  3APD A;  1HFA A;  3G2W A;  1TYQ G;  3NF1 A;  2LNI A;  2HYZ A;  1WG0 A;  4JHR A;  2CHW A;  5ENR D;  3ZXP A;  4ANU A;  2NXP A;  4Q94 A;  5EID A;  2QZA A;  3NQP A;  2GW1 A;  4KYO B;  4XIF A;  1A5E A;  1SW6 A;  2IOL A;  2X6F A;  3CGH A;  4TV3 A;  2R03 A;  4HRL A;  2ZGG A;  5EYL A;  3KAE A;  4TRQ A;  4KZC A;  3G2T A;  4BT8 A;  4EBA G;  3FUJ A;  3G2S A;  2KM4 A;  3I5P A;  4PS8 A;  5J90 A;  5ITZ F;  3SI5 A;  3FUH A;  1E8W A;  2DZO A;  3MKQ B;  2QYJ A;  1FT1 A;  3E34 A;  2WQ6 A;  1N0R A;  1FCH A;  1D9S A;  5B1B E;  3P1U A;  3PE3 A;  1NA3 A;  1TN6 A;  3UM3 A;  2J8S D;  2WQ7 A;  5H7P A;  1MX6 A;  1O1S A;  3DRA A;  3TAX A;  4UWG A;  4GMR A;  4U0S A;  3ENE A;  3T5X A;  3LVR E;  2DZN A;  5AAR A;  5T3R A;  4ANX A;  1AWC B;  3AS8 A;  4DLQ A;  5EYP F;  3SBS A;  3ZRH A;  4HRN A;  2WVI A;  3QK0 A;  2VTB B;  4ILI A;  4TXP A;  1TN8 A;  3W9F A;  1S70 B;  2XGO A;  4JA9 A;  3RO3 A;  1N4S A;  4BTA A;  2VGE A;  1N11 A;  4GCO A;  3EIJ A;  4O60 A;  4FUL A;  4K03 A;  1ZU2 A;  2RKK A;  4EBA A;  5JMN D;  4D10 C;  4CT0 A;  3C3O A;  4WNG A;  5FWQ A;  4TXR A;  2F8X K;  4HNA D;  1DNP A;  2L9B A;  3J5P A;  2P9S G;  4UI9 C;  3CVL A;  2IF4 A;  3MV3 B;  2V5Q C;  3ZGQ A;  1IYG A;  1FVF A;  3S7D A;  5FIN A;  2P2C P;  3I3N A;  2AXZ A;  3S7J A;  2C0M A;  1KT1 A;  3S7B A;  3CHM A;  3SFX A;  3HVE A;  4GPM A;  4CDM A;  4EHM A;  3PS6 A;  2VGX A;  2KBX A;  2XEH A;  4BWR A;  3BG0 B;  4FHJ A;  1DC2 A;  2I9C A;  5LP0 A;  2ETA A;  5CCL A;  2FO7 A;  3CHS A;  1TNB A;  3HXD A;  5LX8 A;  3QWP A;  4LSZ E;  4UUC A;  3DSS A;  3N71 A;  4UI9 J;  3QNK A;  2V0P A;  3FWV A;  1SQM A;  1E8Y A;  3KSQ A;  2H6G A; 
#chains in the Genus database with same CATH homology
 2IJG X;  5JJ6 A;  1ELR A;  1U3C A;  4GZ6 A;  4N5C A;  4C9B B;  2J49 A;  2A4Z A;  4PUC A;  2BTD A;  4GCN A;  3MV2 B;  4HOQ A;  3APC A;  2WXQ A;  4M3O A;  4V3I A;  3GZ2 A;  1QZ2 A;  1XNF A;  3CIA A;  4UWK A;  1QQE A;  2XCB A;  2IU1 A;  3DBS A;  2AVP A;  2QY7 A;  3PZD A;  4I2W A;  3EIQ C;  5KJL A;  5G05 J;  2LAH A;  5ANL A;  2QFC A;  3CV0 A;  3FU0 A;  4I6E A;  2CHZ A;  1OUV A;  3B13 A;  3ASF A;  3FUE A;  3VLF A;  4AM9 A;  3SBT B;  3JQ1 A;  2VGX B;  5ARG A;  3I4G A;  3IEG A;  4J8D A;  4JEU A;  4K0R A;  4FA6 A;  4EPZ A;  3Q15 A;  4I43 A;  4XKC A;  5D0O D;  4CDR A;  3JUI A;  3PUJ A;  2Y4U A;  2V4L A;  1Y8M A;  4HS2 A;  4JZY A;  5T8I A;  4EZL A;  4RVB A;  5BV1 A;  1OWN A;  3CHO A;  1HG2 A;  2I6H A;  5G55 A;  2CG3 A;  4N3A A;  3MEK A;  2J4D A;  1UN9 A;  4KMO A;  3ULQ A;  1OWL A;  1UN8 A;  3R7Q A;  5KCM A;  4JC8 A;  3QWV A;  4GA1 A;  4J8E A;  1JPL A;  1PY1 A;  4ATG A;  3ZFW A;  1WY6 A;  2WPV A;  3FU5 A;  2LSU A;  2X6K A;  3HHM A;  5E76 A;  4GAA A;  3CK9 A;  5M72 A;  2I1J A;  2GGF A;  3CVW A;  3BG1 B;  2A5U A;  3LS8 A;  1H2T C;  2JLB A;  4BSX A;  5A7D B;  4GPK A;  4NUR A;  5AJD A;  5LFA A;  4LER A;  1E90 A;  1H2V C;  3RKV A;  5KJM A;  1UG3 A;  4J0U A;  4Y6C A;  3FTY A;  3FTX A;  3PNT B;  3JYS A;  2NSZ A;  4G23 A;  4WWN A;  4WAF A;  3QB2 A;  3L54 A;  1TJC A;  2FEZ A;  5ARF A;  1U3D A;  2LAI A;  3FTW A;  2PM7 A;  3DPD A;  1EDU A;  4GYW A;  2FUL A;  4H7X A;  1SZ9 A;  2FBN A;  4TUU A;  2KCK A;  3D3M A;  3IHY A;  3L16 A;  1B89 A;  2J4B A;  3IHV A;  1HG5 A;  3B7U X;  5LCW J;  4U0U A;  3ML9 A;  3B7T A;  3Q49 B;  2DBA A;  2HO1 A;  4YVQ C;  3ZHE B;  3TG4 A;  2L0I A;  2IOS A;  1YA0 A;  3ZPJ A;  3OAW A;  4I9E A;  1SZA A;  3P2B A;  1QNF A;  4Q96 A;  5FQ7 A;  2OOE A;  3D9P A;  4FHK A;  3T8M A;  5C2Y A;  4J8F A;  4GYO A;  1OWM A;  2KZT B;  3LY7 A;  2UY1 A;  4N2Q A;  3K9I A;  4LEU A;  2GRM A;  3GYZ A;  4EQF A;  3FUI A;  2KCV A;  3HVE B;  4NRH B;  3D9N A;  3G2U A;  4W9R A;  2BUG A;  3S2A A;  3U9W A;  3AS4 A;  3SNX A;  1N54 A;  3LDZ A;  3PEU B;  2E2E A;  2XEV A;  1H6K A;  5J08 A;  4AEZ C;  1H2U A;  2WMO A;  4BT9 A;  2X3M A;  4FU3 A;  4A55 A;  3ZXS A;  2CG2 A;  1E8X A;  2WQH A;  2Q7F A;  3QJZ A;  5BW8 C;  4CCA A;  1ELK A;  4MRU A;  2OVB A;  5EDS A;  4AOF A;  3L22 A;  4UQZ A;  4A3T A;  5LCW C;  4LUN U;  3L08 A;  3T5V A;  3LKU A;  4B94 A;  4GZ5 A;  2UY1 B;  4HXI A;  3QWW A;  2PQN A;  3AU5 A;  3PRE A;  2XGM A;  3LCA A;  3CVQ A;  2VTB A;  4CGW A;  1NA0 A;  3AS5 A;  4EEC A;  3FU6 A;  2X6I A;  5BUZ A;  3OXG A;  5BNW A;  3FEY A;  4G25 A;  2YQ8 A;  2FI7 A;  4JA7 A;  1JWG A;  4AJW A;  2HR2 A;  1HU3 A;  4GZD A;  4U8H A;  5G2N A;  3RRN B;  2VSY A;  4KZ0 A;  3O48 A;  5ANR A;  5G04 C;  2OVF A;  3RK6 A;  4APF A;  4PH4 B;  2CFU A;  3CQC B;  3MCX A;  5FZQ A;  3FTU A;  2XPY A;  4L7T A;  2PM6 A;  4BFR A;  3ML8 A;  1KT0 A;  2UWJ G;  2WXL A;  3D9O A;  3OXL A;  1IHG A;  4G1T A;  2Y3A A;  4FJZ A;  4WUY A;  3ZYK A;  4FLH A;  3CHR A;  4EZK A;  3ZYM A;  2V8S E;  2VGY A;  2ZU6 B;  4GZC A;  4FAD A;  3CVU A;  5CCM A;  4FC8 A;  2R5S A;  4MLP A;  5FQ8 A;  1XGW A;  5AJL A;  3QOU A;  2V5F A;  4JPS A;  3CHP A;  2C0L A;  2WM9 A;  4GZ3 A;  2BF0 X;  3MGB A;  4XE0 A;  4URK A;  5AEN A;  3GW4 A;  1L5J A;  2WXK A;  5EKQ D;  1HZ4 A;  4OYS A;  2WXF A;  3EHM A;  3CKC A;  5EX0 A;  3CKB A;  1IQU A;  2DIW A;  4GA2 A;  4U07 A;  3SZ7 A;  3FUM A;  3MZL B;  2KC7 A;  4I1O B;  4F3V A;  4NQ0 A;  1GW6 A;  1WAO 1;  3QC1 A;  4KT6 B;  4R7L A;  4ACK A;  1UJJ A;  5E75 A;  3VTX A;  1HO8 A;  4GMJ A;  2VSX E;  3CST A;  3FFL A;  3FUD A;  3HDX A;  4I9C A;  3MA5 A;  4UQY A;  4E6H A;  1MHQ A;  1H0A A;  3LXU X;  3RJV A;  3QKY A;  1W3B A;  3FTS A;  1E7U A;  1MQS A;  3ZEF A;  4AV7 A;  4U0Z A;  4I1A A;  3CSF A;  3QAQ A;  5A23 A;  3UPV A;  3VLD A;  3RIB A;  3RRM B;  3FUK A;  4UQX A;  1LF8 A;  2PL2 A;  5AYW D;  4XX5 A;  3FTZ A;  2OV8 A;  3UT4 A;  4DK5 A;  4KBQ A;  2XCC A;  2WXN A;  3ZYL A;  3RRU A;  3U64 A;  1Y6I A;  5JJT A;  4XZ4 A;  4HOT A;  2WXR A;  3PE4 A;  3HIZ A;  4Y6W A;  5D0Q D;  2NC9 A;  4ABN A;  1NP7 A;  4WNF A;  3RU0 A;  3ASD A;  3CVX A;  3EDT B;  5KJK A;  3ESK A;  2VJ8 A;  2VSN A;  1N52 A;  5G05 C;  1JWF A;  3L13 A;  3U4T A;  3CVY A;  5BT1 A;  5C1D A;  4O6F A;  4KVM A;  4CDN A;  4J8S A;  5EX3 A;  4J6I A;  3ASG A;  3EJN A;  2E0I A;  3ZYQ A;  2L0T B;  3LY8 A;  2Y4T A;  3SFZ A;  4GA0 A;  2AWI A;  2RG8 A;  4MKT A;  4F1S A;  1S0P A;  1OWO A;  4U63 A;  3ZW3 A;  3U3W A;  2YNQ A;  1KLX A;  4HFG A;  4ILH B;  4IRU A;  4GYY A;  1DVP A;  4DLO A;  3IBE A;  3Q5M A;  1HXI A;  2VYI A;  2KCL A;  2XQ0 A;  4GML A;  4HOR A;  4A3V A;  4IYP A;  5FQ6 A;  1EF1 C;  4ACL A;  5JHB A;  3FH8 A;  5HI7 A;  4KVO A;  2IQC A;  5FJY A;  4UWH A;  1FVH A;  2WXM A;  5CMY A;  3B7S A;  4CGV A;  3APD A;  4I1M A;  2WMN A;  3D9J A;  3KEZ A;  3PVL A;  3ZN3 A;  1OWP A;  5CMW A;  2WB2 A;  3LEW A;  3L17 A;  1HFA A;  4PS3 A;  4RG6 A;  4JXT A;  3G2W A;  3NF1 A;  2MOW A;  4IUL A;  1H19 A;  2LNI A;  4ILG A;  4YVO A;  4G26 A;  2HYZ A;  4G24 A;  4AIF A;  4MS6 A;  2VQ2 A;  5FQ4 A;  4QFV A;  4AY5 A;  1PAQ A;  3EHN A;  1BPO A;  2M63 A;  4JHR A;  3Q4A B;  5CHE E;  5FZR A;  4OVU A;  2CHW A;  4L2Y A;  4AP2 A;  2WXG A;  1VDY A;  1P5Q A;  4ANU A;  2NXP A;  3FUN A;  4Q94 A;  4DI3 A;  3CQG B;  4FJY A;  4H7Y A;  3I4R B;  2GW1 A;  3NQP A;  4KYO B;  4XIF A;  2IOL A;  3MKR A;  1TEZ A;  2X6F A;  4IN3 B;  3CGH A;  4DI4 A;  4CRW A;  3CK7 A;  4TV3 A;  1Z6T A;  5JJ7 A;  4F7A A;  3KAE A;  4P29 A;  3TJP A;  4TRQ A;  3D9K A;  4A1G A;  4KZC A;  3BEE A;  2AXU A;  3FTV A;  4UWL A;  4HOU A;  4FLB A;  3G2T A;  1HS6 A;  2YHE A;  1UW4 B;  3LPZ A;  4BT8 A;  4JHK A;  2ION A;  3FUJ A;  3GZS A;  4RSY A;  4EBA G;  2XPI A;  1ZBP A;  4U04 A;  2PZI A;  4GU5 A;  3G2S A;  3KS2 A;  2XRY A;  2GRL A;  3B7R L;  3FH7 A;  3FHE A;  1E7V A;  1ELW A;  5G04 J;  2WXJ A;  2KM4 A;  3CVN A;  4A1S A;  3I5P A;  4BTB A;  3OXF A;  4BX9 A;  2MRI A;  4FP7 A;  3CVP A;  5LOZ A;  4I17 A;  3CEQ A;  1WM5 A;  3FUL A;  4PS8 A;  5ENN A;  2X38 A;  5J90 A;  2FF4 A;  4JVS A;  2PQR A;  4LCT A;  2KAT A;  4L1B A;  3SI5 A;  5DBK A;  4LRZ A;  2P58 C;  4N3C A;  3O4Z A;  4I6G A;  4HOS A;  4G2V A;  3FUH A;  1E8W A;  4C0M A;  3MKQ B;  2JEK A;  3ZHE A;  4CEM A;  2WQ6 A;  1FCH A;  1UJK A;  4G11 A;  4WWP A;  1TJF A;  3QDN A;  5DIZ A;  3MJW A;  3P1U A;  4XI0 A;  3URZ A;  3PE3 A;  1NA3 A;  3S7F A;  4N3B A;  3L6A A;  2XPZ A;  2WXO A;  2WQ7 A;  1INZ A;  4ANV A;  3R9A B;  2ILR A;  3TAX A;  4UWG A;  1HH8 A;  5FT9 A;  3UQ3 A;  3ZVV A;  1IQR A;  2I2O A;  4U0S A;  3ENE A;  4WWO A;  3SD5 A;  3FDH A;  3MKQ A;  4KXK B;  4XI9 A;  3T5X A;  3LVR E;  4HLE A;  3C98 A;  4AXH A;  4L23 A;  3Q47 B;  3TG5 A;  4EZJ A;  3HYM B;  1HF8 A;  5T3R A;  4ANX A;  3JQ0 A;  3ESL A;  4UWF A;  4BX8 A;  3AS8 A;  4DLQ A;  3SGH A;  2XRZ A;  3G2V A;  5HQ8 A;  4WND A;  3SBS A;  3JCK C;  3ZRH A;  2YHC A;  2WVI A;  2C2L A;  3QK0 A;  4ME2 A;  4JW1 A;  4ILI A;  4XKB A;  2KZT A;  2VTB B;  2YIN A;  3RO2 A;  4E85 A;  3LYA A;  3CK8 A;  2XGO A;  3UT7 A;  3VTY A;  5JHA A;  3FEX A;  4JA9 A;  4N39 A;  3U66 A;  3CR3 A;  4JEH A;  4DPR A;  3RO3 A;  4BTA A;  4GCO A;  2EQX A;  2VSO E;  3EIJ A;  2CHX A;  2XGS A;  2AW6 A;  3CLJ A;  1NZN A;  2RD0 A;  2J08 A;  1Z3Y A;  3D9M A;  4OVV A;  4FUL A;  4K03 A;  1ZU2 A;  4EBA A;  4DJA A;  4ANW A;  3IV0 A;  3SHF A;  4D10 C;  3UX4 A;  4WNE A;  2MHK A;  1E8Z A;  2OND A;  3LJ3 A;  3TL5 A;  5KJN A;  4C0E A;  2AXV A;  1E96 B;  3OTN A;  3ZIM A;  4CT0 A;  4WNG A;  3UMV A;  5T4Y A;  1EYH A;  2DCP A;  3E4B A;  1HX8 A;  2CFZ A;  5FWQ A;  4B8A A;  1DNP A;  2L9B A;  2R17 C;  2XHE A;  3APF A;  4UI9 C;  3MX3 A;  3NZS A;  3CVL A;  4JL0 A;  2IF4 A;  5FZS A;  3TXN A;  3D9I A;  3MV3 B;  4F53 A;  1HE8 A;  1X5B A;  3ZGQ A;  3IKO B;  3FUF A;  3VLE A;  3QAR A;  3PUK A;  4B8C B;  1IYG A;  1FVF A;  3CHQ A;  3PH0 C;  3S7D A;  4N2S A;  4Q69 A;  3D9L A;  3UT8 A;  3I3N A;  3R7R A;  2AXZ A;  3PDN A;  3S7J A;  4L2L A;  2C0M A;  1KT1 A;  3CVV A;  3TGO A;  3S7B A;  2J07 A;  2WXH A;  3CHM A;  3FH5 A;  4CT4 A;  3HVE A;  5BV0 A;  2L6J A;  4CDM A;  3FU3 A;  4GB9 A;  3PS6 A;  3PRZ A;  3PEV B;  2VGX A;  4NAC A;  4HVB A;  2WXP A;  4BWR A;  4AVX A;  5AIJ A;  3BG0 B;  2LO6 A;  4APO A;  3AU4 A;  4B89 A;  2IFU A;  2X6J A;  3ASH A;  3WXX A;  4FHJ A;  3LVQ E;  3GZ1 A;  4PS7 A;  2I9C A;  4BY6 A;  5LP0 A;  1Z3X A;  4AY6 A;  5CCL A;  2I1K A;  1A17 A;  3UUX A;  4RG9 A;  5A6C A;  2FO7 A;  1PC2 A;  3CHS A;  2J09 A;  3FP3 A;  3FY4 A;  3MYV A;  4JHJ A;  5BPP A;  2WXI A;  3LY9 A;  5LX8 A;  1EPU A;  3QWP A;  1JUQ A;  4YND A;  4B0Z A;  3N71 A;  3ONK A;  4UI9 K;  2X6H A;  2R59 A;  3TXM A;  2LSV A;  3SF4 A;  4UI9 J;  3QNK A;  2V0P A;  3FWV A;  2J9Q A;  3KD7 A;  4PDX A;  5FTP A;  4I2Z A;  3NZU A;  1SQM A;  3ONL A;  4I6J A;  1E8Y A;  3PNL B;  2HM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...