1JPLA

Gga3 vhs domain complexed with c-terminal peptide from cation-independent mannose 6-phosphate receptor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
161
structure length
161
Chain Sequence
AMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
publication title Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1jplA00
1EDUA 1LF8A 1UJKA 1UJJA 4FU3A 1X5BA 2BF0X 3ONLA 1JUQA 1HF8A 2L0TB 1HFAA 3D9NA 2V8SE 2QY7A 3G2UA 4GZDA 2DCPA 3D9KA 3G2TA 3D9MA 1INZA 3G2SA 4AVXA 5CMWA 1XGWA 1HG2A 3D9PA 1VDYA 3D9JA 1HX8A 3ONKA 5LP0A 1H0AA 1SZAA 5LOZA 1JWGA 3G2VA 1HG5A 1JPLA 2KM4A 3D9IA 4NACA 3RRUA 2LO6A 3LDZA 3G2WA 4Q94A 5CMYA 3ZYLA 4FLBA 5J08A 1EYHA 1MHQA 1SZ9A 4HFGA 3ZYKA 4Q96A 3ZYQA 3CLJA 1DVPA 1ELKA 3D9LA 4GZCA 1PY1A 2DIWA 3D9OA 4JXTA 3ZYMA 2MOWA 1JWFA 2L0IA
chains in the Genus database with same CATH superfamily
4HVBA 3CVLA 3CGHA 3ONLA 2WQHA 4AV7A 3C3OA 3Q47B 3FTSA 2F0YA 2HR2A 3U3WA 3Q78A 3LJ3A 3PUJA 3RRUA 2X6IA 3LPZA 4QFVA 3CHQA 2P2CP 4MBGA 2MOWA 1E7UA 1IXVA 3NZUA 4MLPA 3TXNA 2Y4UA 3HHMA 5JJ6A 2V5FA 2IFUA 2R59A 3AG1E 4JW1A 1QYMA 4U0SA 4ANWA 2EINE 4NQ0A 4D10C 5B1AE 2IQCA 4GZCA 3Q9UC 3R9MA 2FEZA 4U96D 2WQ6A 2WM9A 3J5PA 3QOUA 4DLQA 4EZJA 4UQZA 4DX2A 1JPLA 4GCNA 4GTRA 3RK6A 4YVQC 3LVQE 3PZ1A 4U7EB 3FUJA 4PH4B 5ENQD 4FHJA 4KVOA 4C48B 2KCLA 3FEXA 2XRZA 3C5RA 5HI7A 1JCRA 1O1SA 1OT8A 1E7VA 4FULA 1KT1A 4UI9C 2X6HA 5EIBE 2VQ2A 3P1UA 5CERB 3CK9A 3QNKA 5EYPF 3ENEA 4N5CA 3R7QA 4Q94A 4GTVA 4DX5D 5JJ7A 3DSXA 4B94A 4ATGA 3JYSA 4KZCA 3ABKE 3Q4AB 4U8HA 3MZLB 1U2VG 2DVWA 2VGEA 4YDOA 2XPZA 3FTVA 5G04J 2J08A 1X81A 2I9CA 3KEZA 4ILHB 3ZKJA 5A23A 1N4RA 3QAQA 4AJWA 1G3NB 3TJPA 5FT9A 5DIZA 2UWJG 4BT8A 4L2LA 4AVXA 3JCKC 1NZNA 3MYVA 1H6OA 3FUIA 1TR4A 4HQDA 3CVUA 1BI7B 3MA5A 4CDMA 3Q75A 1NA0A 3NQPA 1NL4A 4L7TA 3CR3A 3RO2A 3RRNB 5ITZF 3OXGA 3CQGB 2CFZA 3CVVA 3UIOC 3I4RB 3MCXA 1AWCB 2ETAA 1OCZE 5AJLA 3ZFWA 2X3MA 3FUNA 4G2VA 2V4HC 4BX8A 3MKRA 4XI0A 4WNEA 4UWHA 1OXJA 3UT7A 1JCSA 4CEMA 2WMOA 3D9MA 2XQ0A 5T8IA 2VSYA 5KJMA 3FUEA 4GPKA 5AYWD 4EHMA 1MJ0A 2P9UG 3CK8A 5KBAA 3CQCB 4GMLA 1KT0A 3EDTB 3K9IA 5BV1A 2L0TB 1TNZA 4UQXA 1QZ2A 1HU3A 4MRUA 3RO3A 2WXQA 2X6FA 3V2XA 3FTXA 2X38A 4CGWA 4GTMA 1X5BA 4EBAG 4OAVB 2H6IA 2GRPB 4A55A 4G26A 2V5QC 2ETBA 3FU3A 3IBEA 5LP0A 4AP2A 1FCHA 2IOLA 5EX0A 3SF4A 2KCVA 1HS6A 3SNXA 5CRVA 3S2AA 4ACKA 4AY5A 4J8SA 4DUIA 1TNYA 1Z5SC 3DSTA 5AARA 2WXHA 3PZ4A 3L17A 1KZPA 2VYIA 4ABNA 3SFYA 4J8FA 2IO3C 3ABLE 4JPSA 1OCRE 4UUCA 5G04C 4FLHA 3Q5MA 2H6GA 2RFAA 2JLBA 4H7XA 5C2YA 2OOEA 3UT4A 3FP3A 2IU1A 4CRWA 3FY4A 3DPDA 4WWPA 2OEVA 5ENTD 1MX4A 5FJYA 2AXZA 2JABA 4YDEA 4I6GA 3CVQA 4APFA 3PE4A 4PDXA 2EIME 2XEVA 3UUXA 5BXOA 3C3QA 2PNNA 2UY1B 3WG7E 1N4SA 2DYSE 2MHKA 4J8YA 4C0MA 4K03A 3KEAA 1BI8B 3VTXA 2FULA 4FJZA 4ANVA 1SA4A 4A3TA 4I9CA 4XE0A 3AU5A 4I2ZA 1BD8A 3NOCD 5JJTA 3JXIA 5AQBA 3SBSA 1BLXB 4WWNA 3PEVB 2KXPC 2AXVA 2KBXA 1QQEA 5LOZA 4TUMA 4URKA 3TWWA 4C0EA 1OY3D 3D9LA 1ELKA 1WG0A 3IHVA 5M72A 3UMVA 4JHRA 3ZXSA 2WXMA 3FH5A 4KYOB 3AS4A 3JUEA 3S7DA 3JQ0A 2WVIA 3UINC 1IQUA 3DSUA 2WXKA 4FC8A 2FBNA 3TL5A 1QBQA 5HS0A 4UI9K 1IKND 3L6AA 5G05J 2MRIA 4HRLA 2BF0X 3ZNGA 3NAWA 2VGXA 3Q15A 3T8MA 3AAAC 3FEYA 2XGOA 1WDYA 3ML9A 5FQ6A 2XZDG 5CBNA 1O1RA 2KZTA 3LY9A 5KNHD 1N9AA 4U0ZA 1DCEA 3ULQA 4PS8A 3X2QE 4G25A 3FUMA 2XGSA 3LKUA 4PUCA 4RVBA 1DCQA 5FZSA 4K5AB 5IY5E 1HFAA 2I6HA 3RRMB 2XEEA 4J0UA 1KPSB 3BEEA 4KT6B 5BV0A 1S64A 4HRNA 4RSYA 2J09A 3VLEA 4ILGA 3IHYA 2J4BA 4GTPA 3FTUA 3IV0A 4HOUA 3FWVA 4L23A 4RQIA 3ZRHA 3FU5A 3MEKA 4DK5A 3P2BA 1V54E 2UY1A 3T5VA 3RJVA 4I9EA 3DXKG 4TV3A 5T4YA 4EZKA 3CV0A 3HIZA 3EHNA 2OCCE 3L9TA 3ZHEB 1H2VC 4JC8A 3HXCA 1O1TA 1OUVA 5EIDA 3TG5A 2XZTG 4JEHA 1U3DA 1JUQA 4XKBA 1P5QA 4Q69A 2BUGA 3E33A 4X8QA 1TJCA 3HVEA 4E85A 1HG5A 3QDNA 4LUNU 3JUIA 4HLLA 5JHBA 2GRRB 1PY1A 3CVWA 3V2OA 5FZQA 2RFMA 1WAO1 3CKBA 4BTBA 2GW1A 4I1AA 3ASGA 3HXEA 2CHXA 3EU9A 3QWPA 1HX8A 1IHBA 1MYOA 1E8XA 3G2WA 2J07A 2RD0A 3T5XA 3NF1A 4UWLA 3SFXA 3E32A 4N3CA 5FINA 3TXMA 4MS6A 5G05C 3SY2A 2QFCA 3FTZA 1JWGA 4ZFHA 3C98A 3NZSA 2XRYA 3S7BA 2P9IG 4P29A 5FQ7A 4FP7A 4F1SA 2E0IA 4DJAA 2GGFA 5D66A 4JVSA 4CGVA 3UKUG 3D9HA 3ZW3A 4CZ2D 3G2VA 4I6EA 3CEQA 4LRZA 2AJAA 2EIKE 4DX1A 5HQ8A 2IJGX 3ZUVB 2HYZA 3RU0A 3ESKA 3DRAA 1K8KG 1N52A 5LCWJ 3AS5A 4WAFA 5FQ4A 1SQMA 3ZGQA 1YA0A 5JA4D 1MZCA 3SGHA 2DWZA 3FUKA 4CT4A 2XEHA 2VGYA 2XPYA 3PZ2A 3B7SA 3PNLB 5CCLA 2LXLA 3R7RA 3IKOB 1N4QA 2OV8A 3JQ1A 2YHCA 3UM0A 2LSVA 4AOFA 4BTAA 5KCMA 3D3MA 4TXPA 3B13A 4B8AA 4F6RD 3DBSA 3HXDA 5ENRD 2IO2C 4YVOA 3BQOA 3ZHEA 2FF4A 3G2SA 2V4LA 1K1AA 2RG8A 3BG1B 5AQAA 3KAEA 3CKCA 4GZ6A 2GROB 4C9BB 1U3CA 1MQSA 5CRUA 4Y6WA 4BETA 3ML8A 3IXEA 3FDHA 4CT0A 4I1MA 4XEIG 1D9SA 2B6CA 5ENNA 3ZEFA 3SBTB 4UQYA 4AY6A 1FPPA 3HG0D 2Y1LE 3ONKA 3KS2A 4JEUA 3GZ2A 3PZDA 2R5SA 2PM6A 4FHKA 1TN8A 3RAUA 2J49A 3B7RL 2DYRE 4BERA 3ZVVA 4GYYA 2XENA 3LS8A 3JXJA 3Q73A 5DBKA 5JMND 2LSUA 1L5JA 4I17A 4JZYA 5E76A 2KC7A 3ZPJA 1DC2A 3CK7A 2CG3A 5HKPA 3MGBA 2QYUA 1HXIA 3FHEA 3DSSA 3AJIA 3MV3B 4BSZB 1B89A 2WQ7A 5B3SE 3S7FA 4LEUA 3TWUA 3ASNE 4BWRA 4L1BA 2C0MA 4WWOA 1E8ZA 4GCOA 3T8KA 3EHRA 3PRZA 2A5UA 1H2TC 4DX7D 1WM5A 2FO7A 3ZN3A 2AVPA 5LCWC 2LAIA 3PDNA 3CSFA 1OWOA 2ZIRA 4GA1A 2VGXB 3ASDA 2F8XK 1SA5A 4U8VD 1TJFA 4AM9A 3B7BA 3GW4A 3N71A 4AIFA 4NURA 3NB2A 2BEDA 5AIJA 2XS8A 3TWTA 2VJ8A 2GRMA 1ELRA 3LY8A 3MJWA 1ELWA 2I1JA 3TWQA 3ZYLA 4I1OB 3LCAA 2KZTB 4H7YA 3ABME 4N3BA 1D8DA 3L08A 4O1OA 3L82A 3D9KA 1S70B 1N11A 1A17A 3Q49B 4TUUA 3U64A 4HOSA 4KXKB 1XGWA 2PZIA 2CHZA 2P9SG 3L22A 3LY7A 3D9PA 3Q9NC 5KNGA 5BUZA 3D9IA 3TWRA 2WMNA 2XCCA 2XGMA 4J7WA 4DI3A 5FTPA 4YDYA 3HXFA 1EF1C 3UM3A 1OWLA 3CHPA 4KBQA 2L9BA 4WNGA 5LX8A 4HLEA 5G2NA 3PVLA 2GRLA 3B7UX 4HOTA 3ULEG 3R9AB 4OVVA 2FO1E 5CHEE 4ANUA 4F3VA 1EYHA 3RSEG 2CG2A 2P9NG 4G8KA 1TNOA 4FU3A 5CEAA 1BU9A 5FZRA 4HORA 1MX6A 2BTDA 1OCCE 3F6QA 2B0OE 5A7DB 2IONA 3VTYA 1N4PA 1RW2A 1YMPA 3UQ3A 1Z6TA 1H2UA 1EDUA 4GZ3A 2AXUA 3HVEB 5AN8A 3LYAA 1QNFA 5D2MC 2E2EA 2QYJA 3FFLA 3B7TA 1N0RA 3CVNA 3D9JA 5EYLA 3I5PA 4J8EA 1UW4B 3APCA 4O60A 4EECA 3FTYA 3MX3A 4Y6CA 1UN9A 3CSTA 2PQRA 4JB8P 2NXPA 1YCSB 4G8LA 3VLDA 5BXUA 1HG2A 2GRNB 3EUVA 2OEWA 4L9PA 2Y4TA 4N2QA 4KZ0A 5BT1A 2PQNA 3TWVA 2Y3AA 3GYZA 2R03A 3UTMA 1UJKA 3SFZA 3UX4A 4HOQA 2DZNA 5AENA 3ZIMA 3FU0A 4V3IA 2ZISA 4ACLA 3WXXA 1E8YA 4M3OA 3EHQA 3LDZA 5E75A 3Q7FA 2P9KG 2L6JA 2F8YA 3L16A 4IYPA 4GA0A 4IN3B 4O6FA 5AJDA 4G23A 3PNTB 3RKVA 4JHKA 1Y8MA 2V0PA 2H6FA 1HE8A 1N0QA 3DXMG 2HE0A 2YNQA 1H0AA 1SZAA 1Q2ZA 3TG4A 3CVPA 5JHAA 3IEGA 3PE3A 2A5EA 4HI9A 3FUFA 1HF8A 4U8YD 3W9FA 4CYMD 4EQFA 4JA9A 1TNUA 3D9NA 2V8SE 1IHGA 1PAQA 2ZU6B 4ANXA 3KSQA 4ATZD 1UN8A 5AQ9A 4XI9A 2LO6A 2WXNA 4BT9A 4WUYA 2KCKA 5J08A 4GMRA 4DPRA 1IQRA 4FLBA 5KJNA 2KATA 3PEUB 2QY7A 4IRUA 4EBAA 1ZBPA 4XX5A 3AU4A 5CMWA 4GU5A 4DLOA 3QB2A 5BW8C 3PUKA 2PL2A 1AP7A 1NI1A 3UI2A 3EIJA 3D9OA 4DX6D 4F53A 5B1BE 3MKQB 2EQXA 4ILIA 4BEPA 2DBAA 4I2WA 3V31A 4GTSA 1YYHA 2KM4A 3ESLA 3CHMA 1TNBA 4BFRA 1SZ9A 2I1KA 2WXIA 4JA7A 3I3NA 4FA6A 4OVUA 4U95D 4IULA 3HRAA 5FWQA 2J9QA 2EILE 5EX3A 2M63A 2IY0C 3DEOA 2AWIA 3BU8A 3B95A 3APFA 3RIBA 3V79K 1OWMA 4PS7A 3BUAA 4BESA 3UIPC 2DCPA 3CHRA 4W9RA 2LUHA 3GZSA 3AS8A 1XNFA 4NRHB 4EPZA 5CECB 4N2SA 3NOGD 4G11A 2GRQB 2R02A 1FT1A 4GAAA 3SQVA 4K5BA 3ASHA 3OAWA 3EU5A 1UG3A 3OXFA 3PZ3A 4RG9A 2WXPA 3V30A 5LFAA 4JHJA 1KLXA 5ANRA 3FUHA 1UJJA 4AEZC 4KVMA 1INZA 3CHSA 2BKGA 3EIQC 3AG2E 3QJZA 4ME2A 3ULYA 1N54A 4LNUD 4U63A 1E8WA 3VLFA 1LD8A 1LTXA 3HYMB 3G2UA 2NYJA 4LNGA 3UXGA 3UM1A 2RKKA 1WY6A 2C2LA 2VSXE 3PH0C 2VSNA 5FQ8A 2WXJA 4I6JA 4GTTA 3UPVA 1NA3A 2IF4A 4R7LA 4N5QA 4TXRA 5CMYA 2BKKB 4CDNA 1HO8A 4G24A 4E6HA 3CLJA 4JXTA 5T3RA 4N3AA 4PS3A 4G1TA 3QK0A 4GPMA 4GTQA 1RZ4A 2P58C 4XZ4A 1OWPA 4U07A 1DNPA 1EPUA 2XS1A 4J6IA 5H7PA 3MKQA 4HNAD 2ZXWE 4TRQA 1H6PA 3AG4E 3Q7AA 2P9PG 4HFGA 3ZYKA 3T9KA 1D8EA 1H6KA 5C1DA 1E90A 2ETCA 4LNBA 4MKTA 1O5MA 3O4ZA 2HO1A 4JD2G 4JL0A 3J5QB 1V55E 5J90A 4Q96A 4XIFA 4CDRA 4FADA 3SO8A 2YQ8A 1TN7A 5CEDB 2IEJA 5ANLA 1LD7A 1TYQG 3SD5A 3KSLA 3DEPA 3C72A 4GTOA 1K3ZD 2ILRA 2J8SD 2MYOA 2WXGA 3FULA 2ZGDA 4BSXA 3UKRG 4N39A 4BX9A 2WXOA 2LXMA 2NSZA 5EN5D 4DRXE 2QZAA 3OTNA 3ISMC 3SZ7A 1SW6A 4HRMB 3E4BA 3Q79A 2NC9A 3HXBA 4EZLA 1S0PA 1LF8A 2Q7FA 4HI8A 3ZXPA 3AG3E 4RG6A 2VSOE 4YDWA 4K5CA 4FJYA 4K0RA 4AXHA 2WB2A 2Y69E 1NP7A 2LNIA 4APOA 3MV2B 1ZB1A 1HH8A 2R17C 4LSZE 3TWXA 2C0LA 2LAHA 2P9LG 3QARA 2R2LA 4BY6A 1VDYA 1FVFA 3UM2A 1S63A 3LXUX 5HRYA 5EILA 3ASFA 1TN6A 4GZDA 4UWGA 4B93B 4B0ZA 2FI7A 2A4ZA 5FIOA 2WPVA 2VTBB 4UWKA 4LCTA 4Z68A 1HZ4A 4F1PA 2DIWA 4KMOA 3TAXA 3SI5A 1JWFA 2J4DA 1SVXA 4GYWA 1PC2A 4GYOA 1W3BA 4RLYA 2XHEA 4ZHBA 5ENOD 1NFIE 2L6BA 4U04A 1Y6IA 5ARFA 2WXLA 5G55A 1MHQA 4TXQA 1KZOA 2L0IA 2CFUA 5CCMA 1K1BA 4CCAA 3FUDA 2WXRA 1N95A 1E96B 3DPYA 4A63B 2QC9A 3C3RA 5EKQD 3LJNA 5ENPD 1A5EA 2YINA 2ZGGA 4A1SA 5AAOA 1TEZA 2IOSA 4GA2A 3W9GA 2R05A 3I4GA 1ZU2A 1OWNA 3HDXA 3L13A 3UT8A 3FH8A 4YNDA 2HM8A 3CHOA 2JEKA 4F7AA 4UWFA 4B89A 4O1PA 3LEWA 3U9WA 3ZYQA 1DVPA 3ZYMA 5BNWA 3TWSA 4A3VA 3QWVA 2Y0BG 4WNFA 3E37A 5CBOA 4HB5A 3ZU7B 2XCBA 4DI4A 1FT2A 2ONDA 3GZ1A 4LG6A 2DZOA 4I43A 3PREA 3BG0B 5BPPA 1H19A 3TGOA 2X6KA 5D0OD 3CVXA 5KJLA 1JCQA 3DWLG 5AQ7A 3EHMA 4HS2A 2YHEA 3QWWA 4OAUC 1UOHA 3U4TA 4NIKA 2XPIA 1IYGA 2OVBA 4GMJA 5ARGA 2OVFA 3U66A 3EJNA 2PM7A 5KJKA 5KWDA 3SHFA 4A1GA 2WXFA 4M7CA 5ENSD 3KD7A 2CHWA 3APDA 4HBDA 1FVHA 2VTBA 3FTWA 3QC1A 2AW6A 3URZA 3L54A 3DSVA 4B8CB 3CIAA 4LERA 4L2YA 3OXLA 4UI9J 1GW6A 3FU6A 2I2OA 3LVRE 5A6CA 2X6JA 3O48A 1N94A 2F37A 4GZ5A 4J8DA 3PS6A 1MX2A 1BPOA 3DSWA 5D0QD 5EDSA 4QQIA 3FH7A 1Z3YA 3E30A 1Z3XA 4GB9A 3CVYA 4OYSA 4XKCA 3E34A 2H6HA 3QKYA 3G2TA 4WNDA 3S7JA 4NACA 4HXIA 3ASOE 3NBNB 2EIJE 1OCOE 4U0UA
chains in the Genus database with same CATH topology
2VGXB 4N3AA 3ASDA 4HVBA 3CVLA 3IHVA 3CGHA 3ONLA 4G1TA 1TJFA 3QK0A 2WQHA 3GW4A 4PS3A 3UMVA 4AM9A 5M72A 4JHRA 3N71A 3ZXSA 4AIFA 2WXMA 3FH5A 4AV7A 4KYOB 3Q47B 2P58C 3AS4A 4NURA 4XZ4A 1OWPA 3FTSA 3S7DA 5AIJA 3JQ0A 2HR2A 4U07A 2WVIA 1DNPA 1IQUA 2VJ8A 2GRMA 1ELRA 3LY8A 1EPUA 2WXKA 4FC8A 3LJ3A 3MJWA 3U3WA 3PUJA 3RRUA 1ELWA 2I1JA 4J6IA 3MKQA 2FBNA 4I1OB 2X6IA 3LPZA 3LCAA 4QFVA 4TRQA 4UI9K 3TL5A 3CHQA 2KZTB 4HFGA 3ZYKA 4H7YA 3L6AA 5G05J 2MRIA 2MOWA 1E7UA 3NZUA 1H6KA 2BF0X 5C1DA 1E90A 4MLPA 4N3BA 2Y4UA 3TXNA 3L08A 3HHMA 5JJ6A 2V5FA 2IFUA 3D9KA 4MKTA 2R59A 1A17A 2VGXA 3Q49B 4TUUA 3U64A 4HOSA 4KXKB 4JW1A 1XGWA 2PZIA 2CHZA 3L22A 3LY7A 3D9PA 4U0SA 4ANWA 3O4ZA 3Q15A 2HO1A 3T8MA 5BUZA 4JL0A 3D9IA 2WMNA 2XCCA 3FEYA 4NQ0A 4D10C 2XGOA 2XGMA 5J90A 4Q96A 4XIFA 4CDRA 4DI3A 4FADA 4U0UA 5FTPA 2IQCA 3ML9A 4GZCA 2YQ8A 5FQ6A 5ANLA 2FEZA 1EF1C 3SD5A 1OWLA 2KZTA 3CHPA 2WQ6A 2WM9A 4KBQA 3LY9A 2L9BA 4WNGA 5LX8A 4HLEA 3QOUA 5G2NA 3PVLA 4DLQA 2ILRA 2GRLA 4EZJA 4UQZA 4U0ZA 3B7UX 4HOTA 3ULQA 4PS8A 3R9AB 4OVVA 4G25A 2WXGA 3FUMA 1JPLA 5CHEE 4ANUA 4GCNA 2XGSA 4F3VA 3LKUA 1EYHA 3FULA 4PUCA 4BSXA 3RK6A 4N39A 4RVBA 2CG2A 2WXOA 4BX9A 4YVQC 3LVQE 4FU3A 5FZSA 3FUJA 1HFAA 2NSZA 2I6HA 4PH4B 4FHJA 5FZRA 3RRMB 4HORA 4J0UA 2BTDA 4KVOA 5BV0A 3BEEA 3OTNA 4KT6B 3SZ7A 5A7DB 3E4BA 2IONA 2KCLA 2NC9A 4RSYA 3VTYA 2J09A 3VLEA 4ILGA 3UQ3A 1Z6TA 3IHYA 4EZLA 2J4BA 1H2UA 3FTUA 3IV0A 3FEXA 2XRZA 4HOUA 3FWVA 4L23A 1S0PA 3ZRHA 1EDUA 1LF8A 3FU5A 3MEKA 4GZ3A 4DK5A 2AXUA 5HI7A 3P2BA 2Q7FA 3HVEB 2UY1A 1E7VA 3T5VA 3RJVA 4FULA 3LYAA 1KT1A 4I9EA 4RG6A 4UI9C 2X6HA 1QNFA 2E2EA 4TV3A 2VSOE 3FFLA 3B7TA 5T4YA 3CVNA 2VQ2A 3P1UA 4EZKA 3CK9A 3D9JA 3QNKA 3CV0A 3HIZA 4FJYA 3EHNA 3ZYLA 3ENEA 4N5CA 3R7QA 4K0RA 4Q94A 4AXHA 3I5PA 4J8EA 1UW4B 3APCA 2WB2A 5JJ7A 4B94A 4EECA 3ZHEB 4ATGA 1H2VC 4JC8A 3FTYA 3JYSA 1OUVA 1NP7A 4KZCA 3TG5A 2LNIA 3Q4AB 4JEHA 4APOA 1U3DA 3MV2B 3MX3A 4Y6CA 4U8HA 1JUQA 1HH8A 4XKBA 1UN9A 3CSTA 3MZLB 2PQRA 4CDMA 2R17C 2C0LA 1P5QA 2NXPA 2LAHA 4Q69A 2XPZA 3FTVA 3QARA 2BUGA 3VLDA 5G04J 2J08A 2I9CA 3KEZA 1HG2A 1TJCA 4BY6A 1VDYA 4ILHB 3HVEA 4E85A 5A23A 3QAQA 1HG5A 4AJWA 3QDNA 4LUNU 2Y4TA 1FVFA 3JUIA 5JHBA 4N2QA 3TJPA 4KZ0A 5BT1A 5FT9A 2PQNA 2Y3AA 3LXUX 1PY1A 3GYZA 3CVWA 5DIZA 1UJKA 5FZQA 3SFZA 2UWJG 3UX4A 1WAO1 3ASFA 4GZDA 3CKBA 4HOQA 4UWGA 4BT8A 4BTBA 5AENA 4L2LA 4B0ZA 3ZIMA 2FI7A 3FU0A 4V3IA 4ACLA 4AVXA 2GW1A 1NZNA 3JCKC 3ASGA 4I1AA 3WXXA 2CHXA 3MYVA 2A4ZA 1E8YA 3QWPA 1HX8A 4M3OA 2WPVA 1E8XA 3LDZA 2VTBB 3G2WA 3FUIA 5E75A 2J07A 2RD0A 4LCTA 4UWKA 3T5XA 3NF1A 4UWLA 1HZ4A 3CVUA 2L6JA 2DIWA 4KMOA 3L16A 4IYPA 3SI5A 1JWFA 2J4DA 3MA5A 4GA0A 3TAXA 1NA0A 4IN3B 4O6FA 3NQPA 4GYWA 4G23A 5AJDA 1PC2A 3PNTB 3RKVA 4N3CA 4GYOA 4JHKA 4L7TA 1W3BA 3TXMA 1Y8MA 3CR3A 2V0PA 4MS6A 3RO2A 2XHEA 5G05C 3RRNB 3OXGA 1HE8A 2QFCA 3CQGB 4U04A 2CFZA 2YNQA 3FTZA 3CVVA 1Y6IA 5ARFA 3I4RB 1H0AA 1SZAA 3MCXA 2WXLA 1JWGA 3TG4A 3CVPA 3C98A 3NZSA 5JHAA 3IEGA 5G55A 3PE3A 1MHQA 5AJLA 3ZFWA 2X3MA 3FUNA 4G2VA 2XRYA 3FUFA 1HF8A 2L0IA 2CFUA 3S7BA 4BX8A 3MKRA 4XI0A 4P29A 4WNEA 5CCMA 5FQ7A 4UWHA 4FP7A 4EQFA 4JA9A 4F1SA 3UT7A 3D9NA 2E0IA 2V8SE 1IHGA 4DJAA 4CCAA 1PAQA 2GGFA 2ZU6B 4ANXA 4CEMA 3FUDA 2WMOA 2WXRA 3D9MA 1UN8A 2XQ0A 1E96B 5T8IA 2VSYA 4JVSA 4CGVA 5EKQD 5KJMA 3ZW3A 3FUEA 3G2VA 4GPKA 4I6EA 2LO6A 4XI9A 3CEQA 4LRZA 5AYWD 2WXNA 4BT9A 4WUYA 2YINA 2KCKA 5J08A 3CK8A 4A1SA 4DPRA 5HQ8A 1TEZA 2IOSA 1IQRA 4GA2A 4FLBA 2IJGX 3CQCB 3I4GA 4GMLA 1KT0A 1ZU2A 2HYZA 5KJNA 3RU0A 3EDTB 1OWNA 2KATA 3ESKA 3K9IA 3HDXA 3PEUB 2L0TB 3L13A 3UT8A 5BV1A 2QY7A 4IRUA 1N52A 3FH8A 4EBAA 5LCWJ 1ZBPA 3AS5A 4YNDA 4WAFA 4XX5A 3AU4A 4UQXA 1QZ2A 2HM8A 1HU3A 5FQ4A 5CMWA 4GU5A 1SQMA 3CHOA 4MRUA 3ZGQA 4DLOA 3QB2A 5BW8C 1YA0A 2JEKA 3RO3A 3PUKA 4UWFA 4F7AA 4B89A 2PL2A 2WXQA 2X6FA 3LEWA 3FTXA 3U9WA 3EIJA 3ZYQA 1DVPA 3D9OA 3SGHA 2X38A 3ZYMA 5BNWA 4A3VA 3FUKA 4CT4A 4CGWA 1X5BA 4EBAG 3QWVA 2VGYA 2XPYA 4F53A 3B7SA 3PNLB 4WNFA 4A55A 5CCLA 4G26A 3R7RA 3MKQB 3IKOB 2EQXA 4ILIA 2OV8A 3JQ1A 2XCBA 3FU3A 2YHCA 3IBEA 2DBAA 2LSVA 4I2WA 4AOFA 4BTAA 5KCMA 3D3MA 5LP0A 4AP2A 4DI4A 1FCHA 2KM4A 3B13A 4B8AA 2IOLA 3CHMA 2ONDA 3ESLA 3GZ1A 5EX0A 3SF4A 2KCVA 1HS6A 4BFRA 3SNXA 1SZ9A 3S2AA 4ACKA 2I1KA 3DBSA 4I43A 2WXIA 3PREA 4JA7A 4AY5A 3BG0B 3I3NA 4FA6A 4J8SA 5BPPA 4OVUA 1H19A 3TGOA 2X6KA 4IULA 5D0OD 5FWQA 2J9QA 5EX3A 2M63A 3CVXA 4YVOA 5KJLA 3ZHEA 2FF4A 2WXHA 2V4LA 3G2SA 2RG8A 3BG1B 3KAEA 3CKCA 4GZ6A 3L17A 2VYIA 3EHMA 4ABNA 4C9BB 1U3CA 2YHEA 3QWWA 2AWIA 4HS2A 1MQSA 4J8FA 4Y6WA 3ML8A 4JPSA 3FDHA 3APFA 4CT0A 3RIBA 3U4TA 2XPIA 5G04C 4FLHA 4I1MA 1IYGA 2OVBA 4GMJA 1OWMA 5ARGA 3Q5MA 4PS7A 2OVFA 3U66A 2JLBA 3EJNA 4H7XA 5C2YA 2OOEA 5ENNA 2DCPA 2PM7A 3CHRA 3GZSA 4W9RA 3UT4A 3FP3A 2IU1A 4CRWA 3ZEFA 3AS8A 3FY4A 5KJKA 1XNFA 3DPDA 4UQYA 4WWPA 3SBTB 4AY6A 4NRHB 4EPZA 3SHFA 3ONKA 4N2SA 3KS2A 4A1GA 4G11A 2WXFA 4JEUA 3GZ2A 3PZDA 2AXZA 2R5SA 5FJYA 2PM6A 3KD7A 4GAAA 2CHWA 3APDA 4FHKA 1FVHA 2J49A 3ASHA 2VTBA 4I6GA 3B7RL 3CVQA 3FTWA 3OAWA 3QC1A 1UG3A 4APFA 2AW6A 3OXFA 3URZA 3ZVVA 3L54A 4GYYA 3PE4A 4B8CB 4PDXA 3LS8A 3CIAA 2XEVA 3UUXA 4RG9A 2WXPA 5DBKA 4LERA 4L2YA 2LSUA 2UY1B 3OXLA 4UI9J 1GW6A 3FU6A 2MHKA 5LFAA 4JHJA 1KLXA 2I2OA 5ANRA 3LVRE 1L5JA 5A6CA 3FUHA 1UJJA 2X6JA 4I17A 4C0MA 3O48A 4K03A 4AEZC 4GZ5A 4JZYA 5E76A 2KC7A 4KVMA 3ZPJA 3CK7A 4J8DA 2FULA 3VTXA 3CHSA 1INZA 4FJZA 4ANVA 3PS6A 4A3TA 3EIQC 4I9CA 3QJZA 2CG3A 4XE0A 4ME2A 3MGBA 3AU5A 1N54A 1HXIA 1BPOA 3FHEA 4I2ZA 5D0QD 4U63A 3MV3B 5EDSA 3FH7A 1Z3YA 5JJTA 1E8WA 1B89A 1Z3XA 4GB9A 2WQ7A 3VLFA 3S7FA 3SBSA 3CVYA 4OYSA 4XKCA 4WWNA 4LEUA 3HYMB 4BWRA 3G2UA 3PEVB 4L1BA 2C0MA 3QKYA 4WWOA 3G2TA 2AXVA 4WNDA 1E8ZA 4GCOA 1WY6A 2C2LA 3PRZA 2VSXE 3PH0C 2VSNA 5FQ8A 3S7JA 2A5UA 2WXJA 1H2TC 4I6JA 1QQEA 1WM5A 5LOZA 2FO7A 4HXIA 1NA3A 2IF4A 4NACA 3UPVA 4R7LA 4URKA 3ZN3A 2AVPA 5CMYA 4CDNA 5LCWC 2LAIA 4C0EA 1HO8A 3PDNA 4G24A 3CSFA 3CLJA 3D9LA 1ELKA 4JXTA 4E6HA 1OWOA 4GA1A 5T3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDU A;  1LF8 A;  1UJK A;  1UJJ A;  4FU3 A;  1X5B A;  2BF0 X;  3ONL A;  1JUQ A;  1HF8 A;  2L0T B;  1HFA A;  3D9N A;  2V8S E;  2QY7 A;  3G2U A;  4GZD A;  2DCP A;  3D9K A;  3G2T A;  3D9M A;  1INZ A;  3G2S A;  4AVX A;  5CMW A;  1XGW A;  1HG2 A;  3D9P A;  1VDY A;  3D9J A;  1HX8 A;  3ONK A;  5LP0 A;  1H0A A;  1SZA A;  5LOZ A;  1JWG A;  3G2V A;  1HG5 A;  1JPL A;  2KM4 A;  3D9I A;  4NAC A;  3RRU A;  2LO6 A;  3LDZ A;  3G2W A;  4Q94 A;  5CMY A;  3ZYL A;  4FLB A;  5J08 A;  1EYH A;  1MHQ A;  1SZ9 A;  4HFG A;  3ZYK A;  4Q96 A;  3ZYQ A;  3CLJ A;  1DVP A;  1ELK A;  3D9L A;  4GZC A;  1PY1 A;  2DIW A;  3D9O A;  4JXT A;  3ZYM A;  2MOW A;  1JWF A;  2L0I A; 
#chains in the Genus database with same CATH topology
 4HVB A;  3CVL A;  3CGH A;  3ONL A;  2WQH A;  4AV7 A;  3C3O A;  3Q47 B;  3FTS A;  2F0Y A;  2HR2 A;  3U3W A;  3Q78 A;  3LJ3 A;  3PUJ A;  3RRU A;  2X6I A;  3LPZ A;  4QFV A;  3CHQ A;  2P2C P;  4MBG A;  2MOW A;  1E7U A;  1IXV A;  3NZU A;  4MLP A;  3TXN A;  2Y4U A;  3HHM A;  5JJ6 A;  2V5F A;  2IFU A;  2R59 A;  3AG1 E;  4JW1 A;  1QYM A;  4U0S A;  4ANW A;  2EIN E;  4NQ0 A;  4D10 C;  5B1A E;  2IQC A;  4GZC A;  3Q9U C;  3R9M A;  2FEZ A;  4U96 D;  2WQ6 A;  2WM9 A;  3J5P A;  3QOU A;  4DLQ A;  4EZJ A;  4UQZ A;  4DX2 A;  1JPL A;  4GCN A;  4GTR A;  3RK6 A;  4YVQ C;  3LVQ E;  3PZ1 A;  4U7E B;  3FUJ A;  4PH4 B;  5ENQ D;  4FHJ A;  4KVO A;  4C48 B;  2KCL A;  3FEX A;  2XRZ A;  3C5R A;  5HI7 A;  1JCR A;  1O1S A;  1OT8 A;  1E7V A;  4FUL A;  1KT1 A;  4UI9 C;  2X6H A;  5EIB E;  2VQ2 A;  3P1U A;  5CER B;  3CK9 A;  3QNK A;  5EYP F;  3ENE A;  4N5C A;  3R7Q A;  4Q94 A;  4GTV A;  4DX5 D;  5JJ7 A;  3DSX A;  4B94 A;  4ATG A;  3JYS A;  4KZC A;  3ABK E;  3Q4A B;  4U8H A;  3MZL B;  1U2V G;  2DVW A;  2VGE A;  4YDO A;  2XPZ A;  3FTV A;  5G04 J;  2J08 A;  1X81 A;  2I9C A;  3KEZ A;  4ILH B;  3ZKJ A;  5A23 A;  1N4R A;  3QAQ A;  4AJW A;  1G3N B;  3TJP A;  5FT9 A;  5DIZ A;  2UWJ G;  4BT8 A;  4L2L A;  4AVX A;  3JCK C;  1NZN A;  3MYV A;  1H6O A;  3FUI A;  1TR4 A;  4HQD A;  3CVU A;  1BI7 B;  3MA5 A;  4CDM A;  3Q75 A;  1NA0 A;  3NQP A;  1NL4 A;  4L7T A;  3CR3 A;  3RO2 A;  3RRN B;  5ITZ F;  3OXG A;  3CQG B;  2CFZ A;  3CVV A;  3UIO C;  3I4R B;  3MCX A;  1AWC B;  2ETA A;  1OCZ E;  5AJL A;  3ZFW A;  2X3M A;  3FUN A;  4G2V A;  2V4H C;  4BX8 A;  3MKR A;  4XI0 A;  4WNE A;  4UWH A;  1OXJ A;  3UT7 A;  1JCS A;  4CEM A;  2WMO A;  3D9M A;  2XQ0 A;  5T8I A;  2VSY A;  5KJM A;  3FUE A;  4GPK A;  5AYW D;  4EHM A;  1MJ0 A;  2P9U G;  3CK8 A;  5KBA A;  3CQC B;  4GML A;  1KT0 A;  3EDT B;  3K9I A;  5BV1 A;  2L0T B;  1TNZ A;  4UQX A;  1QZ2 A;  1HU3 A;  4MRU A;  3RO3 A;  2WXQ A;  2X6F A;  3V2X A;  3FTX A;  2X38 A;  4CGW A;  4GTM A;  1X5B A;  4EBA G;  4OAV B;  2H6I A;  2GRP B;  4A55 A;  4G26 A;  2V5Q C;  2ETB A;  3FU3 A;  3IBE A;  5LP0 A;  4AP2 A;  1FCH A;  2IOL A;  5EX0 A;  3SF4 A;  2KCV A;  1HS6 A;  3SNX A;  5CRV A;  3S2A A;  4ACK A;  4AY5 A;  4J8S A;  4DUI A;  1TNY A;  1Z5S C;  3DST A;  5AAR A;  2WXH A;  3PZ4 A;  3L17 A;  1KZP A;  2VYI A;  4ABN A;  3SFY A;  4J8F A;  2IO3 C;  3ABL E;  4JPS A;  1OCR E;  4UUC A;  5G04 C;  4FLH A;  3Q5M A;  2H6G A;  2RFA A;  2JLB A;  4H7X A;  5C2Y A;  2OOE A;  3UT4 A;  3FP3 A;  2IU1 A;  4CRW A;  3FY4 A;  3DPD A;  4WWP A;  2OEV A;  5ENT D;  1MX4 A;  5FJY A;  2AXZ A;  2JAB A;  4YDE A;  4I6G A;  3CVQ A;  4APF A;  3PE4 A;  4PDX A;  2EIM E;  2XEV A;  3UUX A;  5BXO A;  3C3Q A;  2PNN A;  2UY1 B;  3WG7 E;  1N4S A;  2DYS E;  2MHK A;  4J8Y A;  4C0M A;  4K03 A;  3KEA A;  1BI8 B;  3VTX A;  2FUL A;  4FJZ A;  4ANV A;  1SA4 A;  4A3T A;  4I9C A;  4XE0 A;  3AU5 A;  4I2Z A;  1BD8 A;  3NOC D;  5JJT A;  3JXI A;  5AQB A;  3SBS A;  1BLX B;  4WWN A;  3PEV B;  2KXP C;  2AXV A;  2KBX A;  1QQE A;  5LOZ A;  4TUM A;  4URK A;  3TWW A;  4C0E A;  1OY3 D;  3D9L A;  1ELK A;  1WG0 A;  3IHV A;  5M72 A;  3UMV A;  4JHR A;  3ZXS A;  2WXM A;  3FH5 A;  4KYO B;  3AS4 A;  3JUE A;  3S7D A;  3JQ0 A;  2WVI A;  3UIN C;  1IQU A;  3DSU A;  2WXK A;  4FC8 A;  2FBN A;  3TL5 A;  1QBQ A;  5HS0 A;  4UI9 K;  1IKN D;  3L6A A;  5G05 J;  2MRI A;  4HRL A;  2BF0 X;  3ZNG A;  3NAW A;  2VGX A;  3Q15 A;  3T8M A;  3AAA C;  3FEY A;  2XGO A;  1WDY A;  3ML9 A;  5FQ6 A;  2XZD G;  5CBN A;  1O1R A;  2KZT A;  3LY9 A;  5KNH D;  1N9A A;  4U0Z A;  1DCE A;  3ULQ A;  4PS8 A;  3X2Q E;  4G25 A;  3FUM A;  2XGS A;  3LKU A;  4PUC A;  4RVB A;  1DCQ A;  5FZS A;  4K5A B;  5IY5 E;  1HFA A;  2I6H A;  3RRM B;  2XEE A;  4J0U A;  1KPS B;  3BEE A;  4KT6 B;  5BV0 A;  1S64 A;  4HRN A;  4RSY A;  2J09 A;  3VLE A;  4ILG A;  3IHY A;  2J4B A;  4GTP A;  3FTU A;  3IV0 A;  4HOU A;  3FWV A;  4L23 A;  4RQI A;  3ZRH A;  3FU5 A;  3MEK A;  4DK5 A;  3P2B A;  1V54 E;  2UY1 A;  3T5V A;  3RJV A;  4I9E A;  3DXK G;  4TV3 A;  5T4Y A;  4EZK A;  3CV0 A;  3HIZ A;  3EHN A;  2OCC E;  3L9T A;  3ZHE B;  1H2V C;  4JC8 A;  3HXC A;  1O1T A;  1OUV A;  5EID A;  3TG5 A;  2XZT G;  4JEH A;  1U3D A;  1JUQ A;  4XKB A;  1P5Q A;  4Q69 A;  2BUG A;  3E33 A;  4X8Q A;  1TJC A;  3HVE A;  4E85 A;  1HG5 A;  3QDN A;  4LUN U;  3JUI A;  4HLL A;  5JHB A;  2GRR B;  1PY1 A;  3CVW A;  3V2O A;  5FZQ A;  2RFM A;  1WAO 1;  3CKB A;  4BTB A;  2GW1 A;  4I1A A;  3ASG A;  3HXE A;  2CHX A;  3EU9 A;  3QWP A;  1HX8 A;  1IHB A;  1MYO A;  1E8X A;  3G2W A;  2J07 A;  2RD0 A;  3T5X A;  3NF1 A;  4UWL A;  3SFX A;  3E32 A;  4N3C A;  5FIN A;  3TXM A;  4MS6 A;  5G05 C;  3SY2 A;  2QFC A;  3FTZ A;  1JWG A;  4ZFH A;  3C98 A;  3NZS A;  2XRY A;  3S7B A;  2P9I G;  4P29 A;  5FQ7 A;  4FP7 A;  4F1S A;  2E0I A;  4DJA A;  2GGF A;  5D66 A;  4JVS A;  4CGV A;  3UKU G;  3D9H A;  3ZW3 A;  4CZ2 D;  3G2V A;  4I6E A;  3CEQ A;  4LRZ A;  2AJA A;  2EIK E;  4DX1 A;  5HQ8 A;  2IJG X;  3ZUV B;  2HYZ A;  3RU0 A;  3ESK A;  3DRA A;  1K8K G;  1N52 A;  5LCW J;  3AS5 A;  4WAF A;  5FQ4 A;  1SQM A;  3ZGQ A;  1YA0 A;  5JA4 D;  1MZC A;  3SGH A;  2DWZ A;  3FUK A;  4CT4 A;  2XEH A;  2VGY A;  2XPY A;  3PZ2 A;  3B7S A;  3PNL B;  5CCL A;  2LXL A;  3R7R A;  3IKO B;  1N4Q A;  2OV8 A;  3JQ1 A;  2YHC A;  3UM0 A;  2LSV A;  4AOF A;  4BTA A;  5KCM A;  3D3M A;  4TXP A;  3B13 A;  4B8A A;  4F6R D;  3DBS A;  3HXD A;  5ENR D;  2IO2 C;  4YVO A;  3BQO A;  3ZHE A;  2FF4 A;  3G2S A;  2V4L A;  1K1A A;  2RG8 A;  3BG1 B;  5AQA A;  3KAE A;  3CKC A;  4GZ6 A;  2GRO B;  4C9B B;  1U3C A;  1MQS A;  5CRU A;  4Y6W A;  4BET A;  3ML8 A;  3IXE A;  3FDH A;  4CT0 A;  4I1M A;  4XEI G;  1D9S A;  2B6C A;  5ENN A;  3ZEF A;  3SBT B;  4UQY A;  4AY6 A;  1FPP A;  3HG0 D;  2Y1L E;  3ONK A;  3KS2 A;  4JEU A;  3GZ2 A;  3PZD A;  2R5S A;  2PM6 A;  4FHK A;  1TN8 A;  3RAU A;  2J49 A;  3B7R L;  2DYR E;  4BER A;  3ZVV A;  4GYY A;  2XEN A;  3LS8 A;  3JXJ A;  3Q73 A;  5DBK A;  5JMN D;  2LSU A;  1L5J A;  4I17 A;  4JZY A;  5E76 A;  2KC7 A;  3ZPJ A;  1DC2 A;  3CK7 A;  2CG3 A;  5HKP A;  3MGB A;  2QYU A;  1HXI A;  3FHE A;  3DSS A;  3AJI A;  3MV3 B;  4BSZ B;  1B89 A;  2WQ7 A;  5B3S E;  3S7F A;  4LEU A;  3TWU A;  3ASN E;  4BWR A;  4L1B A;  2C0M A;  4WWO A;  1E8Z A;  4GCO A;  3T8K A;  3EHR A;  3PRZ A;  2A5U A;  1H2T C;  4DX7 D;  1WM5 A;  2FO7 A;  3ZN3 A;  2AVP A;  5LCW C;  2LAI A;  3PDN A;  3CSF A;  1OWO A;  2ZIR A;  4GA1 A;  2VGX B;  3ASD A;  2F8X K;  1SA5 A;  4U8V D;  1TJF A;  4AM9 A;  3B7B A;  3GW4 A;  3N71 A;  4AIF A;  4NUR A;  3NB2 A;  2BED A;  5AIJ A;  2XS8 A;  3TWT A;  2VJ8 A;  2GRM A;  1ELR A;  3LY8 A;  3MJW A;  1ELW A;  2I1J A;  3TWQ A;  3ZYL A;  4I1O B;  3LCA A;  2KZT B;  4H7Y A;  3ABM E;  4N3B A;  1D8D A;  3L08 A;  4O1O A;  3L82 A;  3D9K A;  1S70 B;  1N11 A;  1A17 A;  3Q49 B;  4TUU A;  3U64 A;  4HOS A;  4KXK B;  1XGW A;  2PZI A;  2CHZ A;  2P9S G;  3L22 A;  3LY7 A;  3D9P A;  3Q9N C;  5KNG A;  5BUZ A;  3D9I A;  3TWR A;  2WMN A;  2XCC A;  2XGM A;  4J7W A;  4DI3 A;  5FTP A;  4YDY A;  3HXF A;  1EF1 C;  3UM3 A;  1OWL A;  3CHP A;  4KBQ A;  2L9B A;  4WNG A;  5LX8 A;  4HLE A;  5G2N A;  3PVL A;  2GRL A;  3B7U X;  4HOT A;  3ULE G;  3R9A B;  4OVV A;  2FO1 E;  5CHE E;  4ANU A;  4F3V A;  1EYH A;  3RSE G;  2CG2 A;  2P9N G;  4G8K A;  1TNO A;  4FU3 A;  5CEA A;  1BU9 A;  5FZR A;  4HOR A;  1MX6 A;  2BTD A;  1OCC E;  3F6Q A;  2B0O E;  5A7D B;  2ION A;  3VTY A;  1N4P A;  1RW2 A;  1YMP A;  3UQ3 A;  1Z6T A;  1H2U A;  1EDU A;  4GZ3 A;  2AXU A;  3HVE B;  5AN8 A;  3LYA A;  1QNF A;  5D2M C;  2E2E A;  2QYJ A;  3FFL A;  3B7T A;  1N0R A;  3CVN A;  3D9J A;  5EYL A;  3I5P A;  4J8E A;  1UW4 B;  3APC A;  4O60 A;  4EEC A;  3FTY A;  3MX3 A;  4Y6C A;  1UN9 A;  3CST A;  2PQR A;  4JB8 P;  2NXP A;  1YCS B;  4G8L A;  3VLD A;  5BXU A;  1HG2 A;  2GRN B;  3EUV A;  2OEW A;  4L9P A;  2Y4T A;  4N2Q A;  4KZ0 A;  5BT1 A;  2PQN A;  3TWV A;  2Y3A A;  3GYZ A;  2R03 A;  3UTM A;  1UJK A;  3SFZ A;  3UX4 A;  4HOQ A;  2DZN A;  5AEN A;  3ZIM A;  3FU0 A;  4V3I A;  2ZIS A;  4ACL A;  3WXX A;  1E8Y A;  4M3O A;  3EHQ A;  3LDZ A;  5E75 A;  3Q7F A;  2P9K G;  2L6J A;  2F8Y A;  3L16 A;  4IYP A;  4GA0 A;  4IN3 B;  4O6F A;  5AJD A;  4G23 A;  3PNT B;  3RKV A;  4JHK A;  1Y8M A;  2V0P A;  2H6F A;  1HE8 A;  1N0Q A;  3DXM G;  2HE0 A;  2YNQ A;  1H0A A;  1SZA A;  1Q2Z A;  3TG4 A;  3CVP A;  5JHA A;  3IEG A;  3PE3 A;  2A5E A;  4HI9 A;  3FUF A;  1HF8 A;  4U8Y D;  3W9F A;  4CYM D;  4EQF A;  4JA9 A;  1TNU A;  3D9N A;  2V8S E;  1IHG A;  1PAQ A;  2ZU6 B;  4ANX A;  3KSQ A;  4ATZ D;  1UN8 A;  5AQ9 A;  4XI9 A;  2LO6 A;  2WXN A;  4BT9 A;  4WUY A;  2KCK A;  5J08 A;  4GMR A;  4DPR A;  1IQR A;  4FLB A;  5KJN A;  2KAT A;  3PEU B;  2QY7 A;  4IRU A;  4EBA A;  1ZBP A;  4XX5 A;  3AU4 A;  5CMW A;  4GU5 A;  4DLO A;  3QB2 A;  5BW8 C;  3PUK A;  2PL2 A;  1AP7 A;  1NI1 A;  3UI2 A;  3EIJ A;  3D9O A;  4DX6 D;  4F53 A;  5B1B E;  3MKQ B;  2EQX A;  4ILI A;  4BEP A;  2DBA A;  4I2W A;  3V31 A;  4GTS A;  1YYH A;  2KM4 A;  3ESL A;  3CHM A;  1TNB A;  4BFR A;  1SZ9 A;  2I1K A;  2WXI A;  4JA7 A;  3I3N A;  4FA6 A;  4OVU A;  4U95 D;  4IUL A;  3HRA A;  5FWQ A;  2J9Q A;  2EIL E;  5EX3 A;  2M63 A;  2IY0 C;  3DEO A;  2AWI A;  3BU8 A;  3B95 A;  3APF A;  3RIB A;  3V79 K;  1OWM A;  4PS7 A;  3BUA A;  4BES A;  3UIP C;  2DCP A;  3CHR A;  4W9R A;  2LUH A;  3GZS A;  3AS8 A;  1XNF A;  4NRH B;  4EPZ A;  5CEC B;  4N2S A;  3NOG D;  4G11 A;  2GRQ B;  2R02 A;  1FT1 A;  4GAA A;  3SQV A;  4K5B A;  3ASH A;  3OAW A;  3EU5 A;  1UG3 A;  3OXF A;  3PZ3 A;  4RG9 A;  2WXP A;  3V30 A;  5LFA A;  4JHJ A;  1KLX A;  5ANR A;  3FUH A;  1UJJ A;  4AEZ C;  4KVM A;  1INZ A;  3CHS A;  2BKG A;  3EIQ C;  3AG2 E;  3QJZ A;  4ME2 A;  3ULY A;  1N54 A;  4LNU D;  4U63 A;  1E8W A;  3VLF A;  1LD8 A;  1LTX A;  3HYM B;  3G2U A;  2NYJ A;  4LNG A;  3UXG A;  3UM1 A;  2RKK A;  1WY6 A;  2C2L A;  2VSX E;  3PH0 C;  2VSN A;  5FQ8 A;  2WXJ A;  4I6J A;  4GTT A;  3UPV A;  1NA3 A;  2IF4 A;  4R7L A;  4N5Q A;  4TXR A;  5CMY A;  2BKK B;  4CDN A;  1HO8 A;  4G24 A;  4E6H A;  3CLJ A;  4JXT A;  5T3R A;  4N3A A;  4PS3 A;  4G1T A;  3QK0 A;  4GPM A;  4GTQ A;  1RZ4 A;  2P58 C;  4XZ4 A;  1OWP A;  4U07 A;  1DNP A;  1EPU A;  2XS1 A;  4J6I A;  5H7P A;  3MKQ A;  4HNA D;  2ZXW E;  4TRQ A;  1H6P A;  3AG4 E;  3Q7A A;  2P9P G;  4HFG A;  3ZYK A;  3T9K A;  1D8E A;  1H6K A;  5C1D A;  1E90 A;  2ETC A;  4LNB A;  4MKT A;  1O5M A;  3O4Z A;  2HO1 A;  4JD2 G;  4JL0 A;  3J5Q B;  1V55 E;  5J90 A;  4Q96 A;  4XIF A;  4CDR A;  4FAD A;  3SO8 A;  2YQ8 A;  1TN7 A;  5CED B;  2IEJ A;  5ANL A;  1LD7 A;  1TYQ G;  3SD5 A;  3KSL A;  3DEP A;  3C72 A;  4GTO A;  1K3Z D;  2ILR A;  2J8S D;  2MYO A;  2WXG A;  3FUL A;  2ZGD A;  4BSX A;  3UKR G;  4N39 A;  4BX9 A;  2WXO A;  2LXM A;  2NSZ A;  5EN5 D;  4DRX E;  2QZA A;  3OTN A;  3ISM C;  3SZ7 A;  1SW6 A;  4HRM B;  3E4B A;  3Q79 A;  2NC9 A;  3HXB A;  4EZL A;  1S0P A;  1LF8 A;  2Q7F A;  4HI8 A;  3ZXP A;  3AG3 E;  4RG6 A;  2VSO E;  4YDW A;  4K5C A;  4FJY A;  4K0R A;  4AXH A;  2WB2 A;  2Y69 E;  1NP7 A;  2LNI A;  4APO A;  3MV2 B;  1ZB1 A;  1HH8 A;  2R17 C;  4LSZ E;  3TWX A;  2C0L A;  2LAH A;  2P9L G;  3QAR A;  2R2L A;  4BY6 A;  1VDY A;  1FVF A;  3UM2 A;  1S63 A;  3LXU X;  5HRY A;  5EIL A;  3ASF A;  1TN6 A;  4GZD A;  4UWG A;  4B93 B;  4B0Z A;  2FI7 A;  2A4Z A;  5FIO A;  2WPV A;  2VTB B;  4UWK A;  4LCT A;  4Z68 A;  1HZ4 A;  4F1P A;  2DIW A;  4KMO A;  3TAX A;  3SI5 A;  1JWF A;  2J4D A;  1SVX A;  4GYW A;  1PC2 A;  4GYO A;  1W3B A;  4RLY A;  2XHE A;  4ZHB A;  5ENO D;  1NFI E;  2L6B A;  4U04 A;  1Y6I A;  5ARF A;  2WXL A;  5G55 A;  1MHQ A;  4TXQ A;  1KZO A;  2L0I A;  2CFU A;  5CCM A;  1K1B A;  4CCA A;  3FUD A;  2WXR A;  1N95 A;  1E96 B;  3DPY A;  4A63 B;  2QC9 A;  3C3R A;  5EKQ D;  3LJN A;  5ENP D;  1A5E A;  2YIN A;  2ZGG A;  4A1S A;  5AAO A;  1TEZ A;  2IOS A;  4GA2 A;  3W9G A;  2R05 A;  3I4G A;  1ZU2 A;  1OWN A;  3HDX A;  3L13 A;  3UT8 A;  3FH8 A;  4YND A;  2HM8 A;  3CHO A;  2JEK A;  4F7A A;  4UWF A;  4B89 A;  4O1P A;  3LEW A;  3U9W A;  3ZYQ A;  1DVP A;  3ZYM A;  5BNW A;  3TWS A;  4A3V A;  3QWV A;  2Y0B G;  4WNF A;  3E37 A;  5CBO A;  4HB5 A;  3ZU7 B;  2XCB A;  4DI4 A;  1FT2 A;  2OND A;  3GZ1 A;  4LG6 A;  2DZO A;  4I43 A;  3PRE A;  3BG0 B;  5BPP A;  1H19 A;  3TGO A;  2X6K A;  5D0O D;  3CVX A;  5KJL A;  1JCQ A;  3DWL G;  5AQ7 A;  3EHM A;  4HS2 A;  2YHE A;  3QWW A;  4OAU C;  1UOH A;  3U4T A;  4NIK A;  2XPI A;  1IYG A;  2OVB A;  4GMJ A;  5ARG A;  2OVF A;  3U66 A;  3EJN A;  2PM7 A;  5KJK A;  5KWD A;  3SHF A;  4A1G A;  2WXF A;  4M7C A;  5ENS D;  3KD7 A;  2CHW A;  3APD A;  4HBD A;  1FVH A;  2VTB A;  3FTW A;  3QC1 A;  2AW6 A;  3URZ A;  3L54 A;  3DSV A;  4B8C B;  3CIA A;  4LER A;  4L2Y A;  3OXL A;  4UI9 J;  1GW6 A;  3FU6 A;  2I2O A;  3LVR E;  5A6C A;  2X6J A;  3O48 A;  1N94 A;  2F37 A;  4GZ5 A;  4J8D A;  3PS6 A;  1MX2 A;  1BPO A;  3DSW A;  5D0Q D;  5EDS A;  4QQI A;  3FH7 A;  1Z3Y A;  3E30 A;  1Z3X A;  4GB9 A;  3CVY A;  4OYS A;  4XKC A;  3E34 A;  2H6H A;  3QKY A;  3G2T A;  4WND A;  3S7J A;  4NAC A;  4HXI A;  3ASO E;  3NBN B;  2EIJ E;  1OCO E;  4U0U A; 
#chains in the Genus database with same CATH homology
 2VGX B;  4N3A A;  3ASD A;  4HVB A;  3CVL A;  3IHV A;  3CGH A;  3ONL A;  4G1T A;  1TJF A;  3QK0 A;  2WQH A;  3GW4 A;  4PS3 A;  3UMV A;  4AM9 A;  5M72 A;  4JHR A;  3N71 A;  3ZXS A;  4AIF A;  2WXM A;  3FH5 A;  4AV7 A;  4KYO B;  3Q47 B;  2P58 C;  3AS4 A;  4NUR A;  4XZ4 A;  1OWP A;  3FTS A;  3S7D A;  5AIJ A;  3JQ0 A;  2HR2 A;  4U07 A;  2WVI A;  1DNP A;  1IQU A;  2VJ8 A;  2GRM A;  1ELR A;  3LY8 A;  1EPU A;  2WXK A;  4FC8 A;  3LJ3 A;  3MJW A;  3U3W A;  3PUJ A;  3RRU A;  1ELW A;  2I1J A;  4J6I A;  3MKQ A;  2FBN A;  4I1O B;  2X6I A;  3LPZ A;  3LCA A;  4QFV A;  4TRQ A;  4UI9 K;  3TL5 A;  3CHQ A;  2KZT B;  4HFG A;  3ZYK A;  4H7Y A;  3L6A A;  5G05 J;  2MRI A;  2MOW A;  1E7U A;  3NZU A;  1H6K A;  2BF0 X;  5C1D A;  1E90 A;  4MLP A;  4N3B A;  2Y4U A;  3TXN A;  3L08 A;  3HHM A;  5JJ6 A;  2V5F A;  2IFU A;  3D9K A;  4MKT A;  2R59 A;  1A17 A;  2VGX A;  3Q49 B;  4TUU A;  3U64 A;  4HOS A;  4KXK B;  4JW1 A;  1XGW A;  2PZI A;  2CHZ A;  3L22 A;  3LY7 A;  3D9P A;  4U0S A;  4ANW A;  3O4Z A;  3Q15 A;  2HO1 A;  3T8M A;  5BUZ A;  4JL0 A;  3D9I A;  2WMN A;  2XCC A;  3FEY A;  4NQ0 A;  4D10 C;  2XGO A;  2XGM A;  5J90 A;  4Q96 A;  4XIF A;  4CDR A;  4DI3 A;  4FAD A;  4U0U A;  5FTP A;  2IQC A;  3ML9 A;  4GZC A;  2YQ8 A;  5FQ6 A;  5ANL A;  2FEZ A;  1EF1 C;  3SD5 A;  1OWL A;  2KZT A;  3CHP A;  2WQ6 A;  2WM9 A;  4KBQ A;  3LY9 A;  2L9B A;  4WNG A;  5LX8 A;  4HLE A;  3QOU A;  5G2N A;  3PVL A;  4DLQ A;  2ILR A;  2GRL A;  4EZJ A;  4UQZ A;  4U0Z A;  3B7U X;  4HOT A;  3ULQ A;  4PS8 A;  3R9A B;  4OVV A;  4G25 A;  2WXG A;  3FUM A;  1JPL A;  5CHE E;  4ANU A;  4GCN A;  2XGS A;  4F3V A;  3LKU A;  1EYH A;  3FUL A;  4PUC A;  4BSX A;  3RK6 A;  4N39 A;  4RVB A;  2CG2 A;  2WXO A;  4BX9 A;  4YVQ C;  3LVQ E;  4FU3 A;  5FZS A;  3FUJ A;  1HFA A;  2NSZ A;  2I6H A;  4PH4 B;  4FHJ A;  5FZR A;  3RRM B;  4HOR A;  4J0U A;  2BTD A;  4KVO A;  5BV0 A;  3BEE A;  3OTN A;  4KT6 B;  3SZ7 A;  5A7D B;  3E4B A;  2ION A;  2KCL A;  2NC9 A;  4RSY A;  3VTY A;  2J09 A;  3VLE A;  4ILG A;  3UQ3 A;  1Z6T A;  3IHY A;  4EZL A;  2J4B A;  1H2U A;  3FTU A;  3IV0 A;  3FEX A;  2XRZ A;  4HOU A;  3FWV A;  4L23 A;  1S0P A;  3ZRH A;  1EDU A;  1LF8 A;  3FU5 A;  3MEK A;  4GZ3 A;  4DK5 A;  2AXU A;  5HI7 A;  3P2B A;  2Q7F A;  3HVE B;  2UY1 A;  1E7V A;  3T5V A;  3RJV A;  4FUL A;  3LYA A;  1KT1 A;  4I9E A;  4RG6 A;  4UI9 C;  2X6H A;  1QNF A;  2E2E A;  4TV3 A;  2VSO E;  3FFL A;  3B7T A;  5T4Y A;  3CVN A;  2VQ2 A;  3P1U A;  4EZK A;  3CK9 A;  3D9J A;  3QNK A;  3CV0 A;  3HIZ A;  4FJY A;  3EHN A;  3ZYL A;  3ENE A;  4N5C A;  3R7Q A;  4K0R A;  4Q94 A;  4AXH A;  3I5P A;  4J8E A;  1UW4 B;  3APC A;  2WB2 A;  5JJ7 A;  4B94 A;  4EEC A;  3ZHE B;  4ATG A;  1H2V C;  4JC8 A;  3FTY A;  3JYS A;  1OUV A;  1NP7 A;  4KZC A;  3TG5 A;  2LNI A;  3Q4A B;  4JEH A;  4APO A;  1U3D A;  3MV2 B;  3MX3 A;  4Y6C A;  4U8H A;  1JUQ A;  1HH8 A;  4XKB A;  1UN9 A;  3CST A;  3MZL B;  2PQR A;  4CDM A;  2R17 C;  2C0L A;  1P5Q A;  2NXP A;  2LAH A;  4Q69 A;  2XPZ A;  3FTV A;  3QAR A;  2BUG A;  3VLD A;  5G04 J;  2J08 A;  2I9C A;  3KEZ A;  1HG2 A;  1TJC A;  4BY6 A;  1VDY A;  4ILH B;  3HVE A;  4E85 A;  5A23 A;  3QAQ A;  1HG5 A;  4AJW A;  3QDN A;  4LUN U;  2Y4T A;  1FVF A;  3JUI A;  5JHB A;  4N2Q A;  3TJP A;  4KZ0 A;  5BT1 A;  5FT9 A;  2PQN A;  2Y3A A;  3LXU X;  1PY1 A;  3GYZ A;  3CVW A;  5DIZ A;  1UJK A;  5FZQ A;  3SFZ A;  2UWJ G;  3UX4 A;  1WAO 1;  3ASF A;  4GZD A;  3CKB A;  4HOQ A;  4UWG A;  4BT8 A;  4BTB A;  5AEN A;  4L2L A;  4B0Z A;  3ZIM A;  2FI7 A;  3FU0 A;  4V3I A;  4ACL A;  4AVX A;  2GW1 A;  1NZN A;  3JCK C;  3ASG A;  4I1A A;  3WXX A;  2CHX A;  3MYV A;  2A4Z A;  1E8Y A;  3QWP A;  1HX8 A;  4M3O A;  2WPV A;  1E8X A;  3LDZ A;  2VTB B;  3G2W A;  3FUI A;  5E75 A;  2J07 A;  2RD0 A;  4LCT A;  4UWK A;  3T5X A;  3NF1 A;  4UWL A;  1HZ4 A;  3CVU A;  2L6J A;  2DIW A;  4KMO A;  3L16 A;  4IYP A;  3SI5 A;  1JWF A;  2J4D A;  3MA5 A;  4GA0 A;  3TAX A;  1NA0 A;  4IN3 B;  4O6F A;  3NQP A;  4GYW A;  4G23 A;  5AJD A;  1PC2 A;  3PNT B;  3RKV A;  4N3C A;  4GYO A;  4JHK A;  4L7T A;  1W3B A;  3TXM A;  1Y8M A;  3CR3 A;  2V0P A;  4MS6 A;  3RO2 A;  2XHE A;  5G05 C;  3RRN B;  3OXG A;  1HE8 A;  2QFC A;  3CQG B;  4U04 A;  2CFZ A;  2YNQ A;  3FTZ A;  3CVV A;  1Y6I A;  5ARF A;  3I4R B;  1H0A A;  1SZA A;  3MCX A;  2WXL A;  1JWG A;  3TG4 A;  3CVP A;  3C98 A;  3NZS A;  5JHA A;  3IEG A;  5G55 A;  3PE3 A;  1MHQ A;  5AJL A;  3ZFW A;  2X3M A;  3FUN A;  4G2V A;  2XRY A;  3FUF A;  1HF8 A;  2L0I A;  2CFU A;  3S7B A;  4BX8 A;  3MKR A;  4XI0 A;  4P29 A;  4WNE A;  5CCM A;  5FQ7 A;  4UWH A;  4FP7 A;  4EQF A;  4JA9 A;  4F1S A;  3UT7 A;  3D9N A;  2E0I A;  2V8S E;  1IHG A;  4DJA A;  4CCA A;  1PAQ A;  2GGF A;  2ZU6 B;  4ANX A;  4CEM A;  3FUD A;  2WMO A;  2WXR A;  3D9M A;  1UN8 A;  2XQ0 A;  1E96 B;  5T8I A;  2VSY A;  4JVS A;  4CGV A;  5EKQ D;  5KJM A;  3ZW3 A;  3FUE A;  3G2V A;  4GPK A;  4I6E A;  2LO6 A;  4XI9 A;  3CEQ A;  4LRZ A;  5AYW D;  2WXN A;  4BT9 A;  4WUY A;  2YIN A;  2KCK A;  5J08 A;  3CK8 A;  4A1S A;  4DPR A;  5HQ8 A;  1TEZ A;  2IOS A;  1IQR A;  4GA2 A;  4FLB A;  2IJG X;  3CQC B;  3I4G A;  4GML A;  1KT0 A;  1ZU2 A;  2HYZ A;  5KJN A;  3RU0 A;  3EDT B;  1OWN A;  2KAT A;  3ESK A;  3K9I A;  3HDX A;  3PEU B;  2L0T B;  3L13 A;  3UT8 A;  5BV1 A;  2QY7 A;  4IRU A;  1N52 A;  3FH8 A;  4EBA A;  5LCW J;  1ZBP A;  3AS5 A;  4YND A;  4WAF A;  4XX5 A;  3AU4 A;  4UQX A;  1QZ2 A;  2HM8 A;  1HU3 A;  5FQ4 A;  5CMW A;  4GU5 A;  1SQM A;  3CHO A;  4MRU A;  3ZGQ A;  4DLO A;  3QB2 A;  5BW8 C;  1YA0 A;  2JEK A;  3RO3 A;  3PUK A;  4UWF A;  4F7A A;  4B89 A;  2PL2 A;  2WXQ A;  2X6F A;  3LEW A;  3FTX A;  3U9W A;  3EIJ A;  3ZYQ A;  1DVP A;  3D9O A;  3SGH A;  2X38 A;  3ZYM A;  5BNW A;  4A3V A;  3FUK A;  4CT4 A;  4CGW A;  1X5B A;  4EBA G;  3QWV A;  2VGY A;  2XPY A;  4F53 A;  3B7S A;  3PNL B;  4WNF A;  4A55 A;  5CCL A;  4G26 A;  3R7R A;  3MKQ B;  3IKO B;  2EQX A;  4ILI A;  2OV8 A;  3JQ1 A;  2XCB A;  3FU3 A;  2YHC A;  3IBE A;  2DBA A;  2LSV A;  4I2W A;  4AOF A;  4BTA A;  5KCM A;  3D3M A;  5LP0 A;  4AP2 A;  4DI4 A;  1FCH A;  2KM4 A;  3B13 A;  4B8A A;  2IOL A;  3CHM A;  2OND A;  3ESL A;  3GZ1 A;  5EX0 A;  3SF4 A;  2KCV A;  1HS6 A;  4BFR A;  3SNX A;  1SZ9 A;  3S2A A;  4ACK A;  2I1K A;  3DBS A;  4I43 A;  2WXI A;  3PRE A;  4JA7 A;  4AY5 A;  3BG0 B;  3I3N A;  4FA6 A;  4J8S A;  5BPP A;  4OVU A;  1H19 A;  3TGO A;  2X6K A;  4IUL A;  5D0O D;  5FWQ A;  2J9Q A;  5EX3 A;  2M63 A;  3CVX A;  4YVO A;  5KJL A;  3ZHE A;  2FF4 A;  2WXH A;  2V4L A;  3G2S A;  2RG8 A;  3BG1 B;  3KAE A;  3CKC A;  4GZ6 A;  3L17 A;  2VYI A;  3EHM A;  4ABN A;  4C9B B;  1U3C A;  2YHE A;  3QWW A;  2AWI A;  4HS2 A;  1MQS A;  4J8F A;  4Y6W A;  3ML8 A;  4JPS A;  3FDH A;  3APF A;  4CT0 A;  3RIB A;  3U4T A;  2XPI A;  5G04 C;  4FLH A;  4I1M A;  1IYG A;  2OVB A;  4GMJ A;  1OWM A;  5ARG A;  3Q5M A;  4PS7 A;  2OVF A;  3U66 A;  2JLB A;  3EJN A;  4H7X A;  5C2Y A;  2OOE A;  5ENN A;  2DCP A;  2PM7 A;  3CHR A;  3GZS A;  4W9R A;  3UT4 A;  3FP3 A;  2IU1 A;  4CRW A;  3ZEF A;  3AS8 A;  3FY4 A;  5KJK A;  1XNF A;  3DPD A;  4UQY A;  4WWP A;  3SBT B;  4AY6 A;  4NRH B;  4EPZ A;  3SHF A;  3ONK A;  4N2S A;  3KS2 A;  4A1G A;  4G11 A;  2WXF A;  4JEU A;  3GZ2 A;  3PZD A;  2AXZ A;  2R5S A;  5FJY A;  2PM6 A;  3KD7 A;  4GAA A;  2CHW A;  3APD A;  4FHK A;  1FVH A;  2J49 A;  3ASH A;  2VTB A;  4I6G A;  3B7R L;  3CVQ A;  3FTW A;  3OAW A;  3QC1 A;  1UG3 A;  4APF A;  2AW6 A;  3OXF A;  3URZ A;  3ZVV A;  3L54 A;  4GYY A;  3PE4 A;  4B8C B;  4PDX A;  3LS8 A;  3CIA A;  2XEV A;  3UUX A;  4RG9 A;  2WXP A;  5DBK A;  4LER A;  4L2Y A;  2LSU A;  2UY1 B;  3OXL A;  4UI9 J;  1GW6 A;  3FU6 A;  2MHK A;  5LFA A;  4JHJ A;  1KLX A;  2I2O A;  5ANR A;  3LVR E;  1L5J A;  5A6C A;  3FUH A;  1UJJ A;  2X6J A;  4I17 A;  4C0M A;  3O48 A;  4K03 A;  4AEZ C;  4GZ5 A;  4JZY A;  5E76 A;  2KC7 A;  4KVM A;  3ZPJ A;  3CK7 A;  4J8D A;  2FUL A;  3VTX A;  3CHS A;  1INZ A;  4FJZ A;  4ANV A;  3PS6 A;  4A3T A;  3EIQ C;  4I9C A;  3QJZ A;  2CG3 A;  4XE0 A;  4ME2 A;  3MGB A;  3AU5 A;  1N54 A;  1HXI A;  1BPO A;  3FHE A;  4I2Z A;  5D0Q D;  4U63 A;  3MV3 B;  5EDS A;  3FH7 A;  1Z3Y A;  5JJT A;  1E8W A;  1B89 A;  1Z3X A;  4GB9 A;  2WQ7 A;  3VLF A;  3S7F A;  3SBS A;  3CVY A;  4OYS A;  4XKC A;  4WWN A;  4LEU A;  3HYM B;  4BWR A;  3G2U A;  3PEV B;  4L1B A;  2C0M A;  3QKY A;  4WWO A;  3G2T A;  2AXV A;  4WND A;  1E8Z A;  4GCO A;  1WY6 A;  2C2L A;  3PRZ A;  2VSX E;  3PH0 C;  2VSN A;  5FQ8 A;  3S7J A;  2A5U A;  2WXJ A;  1H2T C;  4I6J A;  1QQE A;  1WM5 A;  5LOZ A;  2FO7 A;  4HXI A;  1NA3 A;  2IF4 A;  4NAC A;  3UPV A;  4R7L A;  4URK A;  3ZN3 A;  2AVP A;  5CMY A;  4CDN A;  5LCW C;  2LAI A;  4C0E A;  1HO8 A;  3PDN A;  4G24 A;  3CSF A;  3CLJ A;  3D9L A;  1ELK A;  4JXT A;  4E6H A;  1OWO A;  4GA1 A;  5T3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...