4XE0A

Idelalisib bound to the p110 subunit of pi3k delta
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
917
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
publication title Structural, Biochemical, and Biophysical Characterization of Idelalisib Binding to Phosphoinositide 3-Kinase delta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 263
structure length 815
sequence length 917
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4xe0A05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xe0A01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4xe0A03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xe0A02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4xe0A04
4HLEA 2JQZA 3QJZA 2X6FA 4L2YA 4ANXA 2CM6A 2Q3XA 3HN8A 3KWTA 2CHZA 4UWHA 4FHKA 4ANVA 4UWFA 3QR1A 3APDA 4TS6A 2X38A 4KZCA 4TUUA 2V4LA 4WWNA 3ML8A 1YRKA 3OHMB 3PRZA 4QJ4B 2ENJA 2WXQA 4F1SA 3SD5A 5CCGE 3PS6A 2WXRA 3TJPA 3L9BA 3S2AA 3R7RA 2X6KA 1A25A 4WWPA 3IHYA 3PREA 4PS7A 1DJZA 3P2BA 2WXIA 1TJMA 4XZ4A 2WXPA 1DJHA 1W15A 1DJWA 5KJ7E 2WXGA 2YOAA 5ENNA 2WXOA 3OAWA 4FA6A 2DMGA 4ICWA 3T8MA 2CJSA 4L1BA 1E7VA 3NZSA 2Z0UA 2RD0A 1WFJA 3LJ3A 1QASA 2X6JA 4UWKA 4EZKA 4FADA 3N5AA 4NS0A 5H4ZA 3DPDA 2WXFA 2ISDA 4PS8A 2CHDA 4PS3A 1DJXA 2K45A 2NQ3A 1GMIA 2ENPA 5CCJA 1TJXA 3NSJA 2Y3AA 1UOVA 3HIZA 3F00A 4QJ3B 2WXNA 3TWYA 1QATA 3CSFA 4FLHA 4OVVA 4XE0A 4F93B 4OVUA 3IBEA 4LDCA 3ENEA 2D8KA 4AJWA 3L54A 5ANLA 3RDJA 1E8ZA 4FJZA 3ZW3A 5CCHE 4BFRA 1W16A 3L13A 2DMHA 1E8WA 2YRBA 4ICXA 4PH4B 2B3RA 4LCVA 3NZUA 3B7YA 4JPSA 2ZKMX 1HE8A 4UWGA 1UOWA 4Y1TA 2X6HA 3W57A 3RPBA 2Q0ZX 4BGDA 4ANUA 3LS8A 2WXLA 1WFMA 5G55A 2FK9A 2ENQA 2LHAA 3PFQA 4FHJA 4DK5A 1UGKA 3ML9A 3L08A 4Y1SA 4URKA 4DNLA 2X6IA 3R7QA 4WAFA 2N1TE 3F04A 2I9CA 1E8YA 4QAMB 5EDSA 1RSYA 2NCEA 3W56A 4KZ0A 4UWLA 4WWOA 1DJGA 3DBSA 4EZLA 4ANWA 1DJYA 2QZQA 2CJTA 3JZYA 4MJJA 3KWUA 3QR0A 3ZIMA 1DQVA 2K8MA 4OYSA 4HVBA 4L23A 1DJIA 2WXMA 3QK0A 2A5UA 5JHBA 4KITB 2CHXA 2K3HA 2CM5A 3F05A 3CSTA 1V27A 4NP9A 4IQHA 2WXKA 4IHBA 2FJUB 2BWQA 1E7UA 4A55A 3HHMA 2R83A 3FDWA 3IM1A 4GNKB 1RLWA 2KI6A 3L4CA 4V11A 3APFA 3ZVVA 5JHAA 4XX5A 2K4AA 2QZ5A 2UZPA 4NPJA 1E8XA 4EZJA 3FBKA 5H4YA 4FULA 1DSYA 5T8IA 3APCA 2CHWA 3QAQA 1K5WA 4J6IA 3TL5A 1CJYA 4FJYA 4L1LA 1BCIA 1BDYA 3QARA 3PYCA 3MJWA 1E90A 1CJAA 4AOFA 1RH8A 2A4ZA 3L16A 3F01A 4G11A 4TV3A 4NPKA 4QJ5B 2WXJA 4GB9A 5G2NA 3GPEA 4F92B 3L17A 2NSQA 2WXHA 3M7FB 4LT7A 4F91B 2EP6A 1BYNA 4WEEA
chains in the Genus database with same CATH superfamily
1RULH 4NRYA 5E8DH 4KV2A 4K5CA 2E7LC 4P49A 1KENH 5MPOA 3ZEFA 2OMYA 1U3YA 1FO0B 3IS1X 4NN6C 1XQQA 5DJ0B 4HJKA 3ASNE 2ED8A 1AIFA 4U1JA 3OLDA 5C09B 4F57L 4UI9C 4IJ3C 2NTSP 2OA9A 3SFYA 5KJNA 1PU0A 4OFDA 2A74B 2AJ3B 3WEOA 5DJ6A 5I76B 1QPPA 4O5LH 3SYOA 4BA8A 1UD7A 1G9NL 2IAAC 2MEJB 2DWEA 3PREA 2Y1AA 4MCNA 1U8JA 3C60A 2MQJA 5FM4A 4AMWA 5FHAL 2BVCA 3CDZB 3U4BH 4IM0A 4MXVF 3WFEL 4I1NB 4Y5XA 1OWOA 4ITKA 4DX7D 1HZHH 1VF5C 2V0PA 1DVYA 3BVNB 3G6AA 3I74A 5I1AA 5KSVB 1WX9A 4MVBC 3A3YB 4JHVA 4YDJB 2OI9C 3CDGA 4QRUA 4Q9RH 2GBNA 1JTTA 3L0WB 3Q2AC 1J0JA 3UTTB 1A1NB 5KVDL 2DLEA 2RIKA 4FJVB 2R1YA 1I3VA 1LHZA 2F08A 4N68A 3UZVA 2LU7A 5IW6A 3EYFB 3NG0A 1JSYA 1MQSA 1V55B 2HMID 2KERA 4O1PA 1GJUA 2I9TA 1KB5L 5ISZA 2LQRA 3QXWA 4BDVB 1MCCA 4NZFA 1F9JA 5CCLA 3B2FA 1CDIA 3KPLB 4XP5H 3Q5YA 3L13A 4EBAG 1F97A 1AZUA 4FTDA 2YRPA 4LCDE 1CFQA 4PJIA 1MFEH 1A4AA 3UG3A 4UWGA 3FCUB 3GTTA 3AE4B 1E9QA 3UDWA 5MI0C 1XD3B 4PG9B 3EC8A 4L3EB 2FEEL 4JKWA 4UNTA 1G7HB 1LO4H 1MPAH 1Z9SA 3I4GA 2G3ZA 3IMRA 3MREA 5L6YH 2QVTA 4GRWE 4NWUL 1D4BA 4M61B 3EZ8A 1JN6B 5HHOA 5IV2B 2B1OA 1J5HA 4MM3A 4PRNB 4LNKA 2CDFA 3KR3H 4MX7A 5F9AC 4U1KA 3TNNA 2C7FA 2R03A 3T77B 2PTLA 3SGJC 2DZKA 5ID1B 3FT4A 3QEGL 4WHCA 2JRHA 5IHZA 4JZYA 4QXWA 5E7BA 3AS3A 4JFZL 1AO7B 4HWUA 4XVTH 3MMEA 4F8TA 5GXGB 2ZNWA 2IF4A 2ICEC 4M00A 4N8PA 4RH6A 4LL1A 1CD1A 4FQIL 4A8XC 1IAII 1BQHA 2VM9A 2CU3A 2EIEA 3D3MA 1QTSA 1NCUA 2PW1B 1DVPA 3NPSC 5I2IA 3KPPA 3MAWA 5CP3A 1CYWA 3HAEG 1FNVA 4LCYA 5IFHL 2X09A 2DLBA 3DXAA 4GG6B 1U8CA 1K5WA 3B9VA 1IKOP 1DQML 2UY1A 4I48B 3WUZA 5T1JA 1PIGA 1HWGB 3ZHNA 1RZIA 3AU0A 2Z31B 3MCYA 5F9WC 2EVIA 4WI6A 3JWNG 5ITFB 4LASH 4I2ZA 3FKUS 2AZUA 3DETD 5SX4H 2AERT 2WO4A 3SGKC 4MJSA 1EPUA 1TFHA 4MNHB 1LO3H 4M1DL 4HF5H 2VJ8A 1OALA 1BBJB 4PJEA 4F92B 5EX3A 2NSQA 3DMMB 3EBHA 3PU7A 3QXTA 4Z7NF 1CJEA 2EP6A 4OVZA 4Y2DB 4DCQA 4PW3A 1L7TH 2VLKA 5FHBL 3ECIA 3HYMB 4OZAA 4HXIA 5C2BH 5C6PB 4IC7B 2PPAA 5BXFA 1WBXB 1OGTA 2DQIH 3O2WL 4AG4L 1T2QL 4XPAH 5CD5D 3GQFA 4UYPA 5JHDB 1F3DH 1WS8A 1WI0A 4AEIL 2F8YA 4DKTA 4AJVA 3RWEA 3ERXA 4DUIA 2MCPH 4P3CH 3NACL 1E5WA 4HKXA 4YSTA 1BAFH 1GGTA 4JM0A 4MA1C 3T0XA 3CVHL 1OY3D 3RUGB 4ZMLA 2NY2B 3VGBA 2WXIA 2AEOA 3ARVA 4PUCA 3EADA 1AXTH 2EDQA 1LO5B 4DUXA 4DWHA 2EDLA 3G5VA 4KHXL 4L8SA 3ZHDA 1K51A 2MLBA 4B7LA 1BFSA 3UBXA 5BVJB 1RMFL 2C7UA 2OZ4H 1TKWB 1JCQA 4RMUA 4JDEB 2VN3A 2X1QA 4IRJB 1YEJH 3VD5A 2AI0H 1EU4A 3EO0A 3PIQB 4ODTH 4K4KA 5EU3B 2CG2A 3VXMA 4DP5X 5IMKB 3ONSA 1JGEA 4OLVH 3NCJL 2IDYA 4OGYL 1JW9D 1S3KL 5DQ9B 4LQFL 1CGXA 1QLEH 2P44B 1NYQA 2QQLL 2VRRB 3QWVA 4GIPD 3IGKA 4W70A 5AVXB 3ARXA 2FH8A 3AG3B 2VC2L 4BWWA 3T3NA 4MKMA 2ZCHL 2HUEA 4OKDA 3BOVA 1MX6A 4XVUC 5EU5B 2QYJA 3B5HA 1WIAA 3FCGA 4WWKD 4NNPL 2OJWA 2K6DB 5IQ9A 2YLKA 1Q72H 3GI9H 3GFUA 4YXHH 5IVXB 2BF0X 2I9CA 3BYTA 5GSVB 1NBQA 1X9QA 4WUKH 2D5GA 3D85A 5JR1L 4KO5A 2HMIC 1DUYB 1WWCA 1E27A 4Y5YC 5EPMB 5DMJB 1J8HE 4GKSA 4K5BA 1DYQA 2CR3A 3E9SA 2DNFA 2CXGA 2OL3H 3IN2A 3GNMH 3IGFA 3QJQB 4TNGA 1N9PA 2AV1A 4NZUH 4XWGH 5FECB 5K69A 2NNXA 1LDSA 2YPLD 3OMZA 4X83A 1WAPA 5IQLA 5I8CB 5LG6A 4I2XB 1NQBA 2KDBA 1RP9A 4J7RA 2YBGA 1AW7A 3L4CA 4JE3B 3HC4H 1KLGD 4YPGB 1WG0A 1CFNB 1SDDA 3EHBB 3H2WA 4PJCF 1AXSA 3ZL4L 3VFRB 4H0LC 1SHWA 1VLBA 3OZ9H 3CFMA 2HVJA 1LEKA 1Z6JT 1FZMB 4BSXA 5CFHA 1C12A 1QLFB 3S37H 2BSBA 3MRFB 1SA4A 2NY3D 1T1XB 3M86A 2P1YA 5JHLA 3OLMD 3POCA 2X2HA 3UAJD 2FT8A 1ML0A 4DEWA 4H2AA 1EZVY 2WX0A 3WNIA 5E94A 1FFNA 1SIFA 2NNAB 2RJMA 1OAUH 2WNMA 4BSWA 1F4WH 1KN2H 2D2QA 1XVSA 4IOIE 4DXGA 3O13A 4JVUA 2L7UA 3M17A 3ULVE 4AQ1A 1YMHE 1Y7VA 3BD4A 1XF3B 3WS3B 1XXGA 4A3PA 4EI5A 3O2VL 1RZQA 4JFDE 2LR4A 5EYPF 4PWIA 3VXPB 2XZCH 2VLJD 1N3NB 4P46D 2JWYA 4G70B 4XYCA 3KGSA 1XT9B 1QI3A 2PO6B 4RFNC 3FAHA 2O61B 4E9WA 1QOGA 3JYUA 5FIEA 5FYJL 3STZB 3DETC 4JCWA 2Q8BL 2XXFA 4JUSA 3RRUA 3SJVB 3CZLA 4L7TA 1M7DB 4ANKA 3QZOA 4DGYL 2NMQA 1MIMH 3D9LA 1UH2A 3CX5J 2E0PA 4TLSA 1MQKH 3LVQE 4J3OF 1IPGA 2AABL 4L1BA 5MENE 2WQ8A 3IKKA 1EAQA 4EJ1C 1CG9A 3B7UX 5K59E 4XBMA 4I0KA 3LQMA 3I50H 4YOKA 2CR0A 2YD8A 4M5YH 4MD4A 3WIFA 3RJQB 3NDZE 2R56L 4U6XB 4X99A 2F15A 2KBXA 2EIMB 3BP7A 4CU7A 2FR4A 1IM3D 3WYRA 4LVHB 1F1DA 4H7XA 5B38G 4OLZL 3QEQB 2UVEA 1UASA 4RRPA 3UJIH 3UTZB 3JVGC 1XIWC 3GBDA 3MLRL 2YR3A 4DGWC 3QQ9D 3VGFA 1ZHLA 4OZHB 4C48B 4CMMA 1KDJA 2DMHA 1UXSA 5KYWA 2PTUA 2WOYA 3O45B 3P54A 3OWEB 1RIVH 3W39B 3V8OA 1A9EA 5FUZH 4AVIA 1T1ZA 5DVPA 3IEGA 1CVRA 3UTSA 2JVCA 1OKEA 4PRIA 5E1QA 4GI8A 2P4AB 1T0OA 1KGYE 5KJRH 3UBGA 2VXSL 4IBYA 2ZAIA 1QZ2A 1SJMA 5FYKH 4ORGB 1JG9A 2ZKWA 2NXZD 2YPVA 5E1HB 3CHOA 2OSWA 4XRCA 1AHKA 1AKPA 2AXUA 3UIZA 2L7EA 2FCBA 2J5LC 3L3KB 5DQJB 2HT4D 2E75C 2MQGA 1E9PA 2ORBL 1T04A 3AQDA 2R61A 1JZ2A 4HPOL 1I8KA 1PTZA 3BWUC 4JN1H 3TBTA 2PEAA 2GI7A 3K8KA 3QHZH 3GMOB 3RNBC 1LEGB 3GS7A 4PJ5E 3Q3FA 5EA0L 3EXLA 4C7YA 1NCNA 4LHUA 5D9SA 1LGRA 3PHWB 2OBGA 2DB8A 3MLXL 4P2AA 4L29A 4OSUL 2NYYD 4GKLA 1FGVH 4LBAA 2VMCA 3PT2B 4HK3J 5JXED 4YZFE 3FXIC 1UH6A 2YD2A 1G9HA 1LWRA 1MCJA 5GS3A 4D9LH 1OOAA 4LNIA 4MTMA 3CGTA 3FNKA 4MCYA 5J57B 1WFYA 3KUZA 1CLZH 3PDNA 3HCVB 3K2MC 3VWJB 3ZJUA 3X1FA 3OR6B 4IBQA 4UQZA 3NIGF 2R7EB 2PYED 2YZ1A 3M7FB 3VA2C 2V1YA 1CTOA 2E6JA 4OQTL 1NDTA 2AQ1B 2C9SA 2OCFD 3FSAA 1MX4A 2EC9T 2FEJA 3QFGA 3CBRA 4HC1L 4LXFA 3TJEH 4GZCA 4JANA 1XGYL 4UCFA 2CKHB 3C5ZD 2XG5A 1KIUB 4UZUA 5J7CC 4M43H 2MPVA 3F7VA 2EKSB 4N0YL 4J4PA 4QRQB 5SWSA 1KEMH 5TQ0H 1FIEA 2BYTA 1ROWA 3ASWA 3MOQA 4ZSOE 2NY3C 1OGWA 5D2NC 2N0MA 1PGBA 4G8IA 3LDBB 4NN5B 3T9KA 3M6DA 4Y7OC 5DD0H 5B3SB 2LU3A 5BZDA 3S5ZA 4I9XA 3SKOB 4AGPA 5KTEL 3FH8A 1B9ZA 3G7TA 3FFCB 2R4SH 3UJTH 3N1YC 2V4HC 3C6LB 4TXQA 4H8HA 2A9NH 1T5KA 3HG1A 4UQ9A 4LPYA 3FOLA 2ZIDA 3O8XC 4OFQA 5IFJA 4J27A 1SUHA 3I3EA 5AOKA 4CADB 4RFEA 4GG8A 4X4KA 2MPAL 2UX6A 2FJFB 1XMWA 2ONDA 1DBKL 5DFTA 1URZA 5DJZA 1X5JA 2WBJC 4FC8A 5B22A 1L0YB 3C09C 1ZSHA 1HQRA 3DYMA 3A5VA 3O3DA 4TXRA 3HVEB 3QWZB 2APBA 1Q2ZA 1HHGA 2OSXA 2Q0ZX 3S5LA 2WLZA 2YMOA 1K6QL 3GW4A 1BVZA 2XTJD 2MEKA 2IBZX 5ESAB 4UI2A 3VXUD 3A6OA 4APOA 4LKXA 5D1ZA 3K71B 3US1A 2XCBA 4MDRA 3H9DA 4UINH 3H2QA 2IQ9L 2BVEA 1FN4A 4CW1B 2BIIA 4P5MA 3D0VB 1QI5A 4QHNA 3N04A 3H3PL 3LN4A 1TKGA 2BSSB 2XWRA 3WCYA 2YGQA 3DOSA 1AD9B 1L5JA 3HR6A 4MQSB 2DLFL 1S70B 2EILB 1O5PA 1UJKA 3LKNB 3AB0C 5FAAA 4ILDA 1AMXA 2E6PA 2GJJA 3ZT5A 4CGTA 2HDEA 1E6OL 1TBEA 3BPCB 4M7ZC 3MSPA 1Z0NA 1S9YB 3ETRA 5IQMA 1NI3A 4EUPG 4JHRA 4PUBH 2JXMB 1I7UB 3IFLL 5E8PA 3SGEI 1MCQA 1G7JA 1IM9D 2HT2D 5G5HA 3GZQA 4NPJA 5EG6C 4UQ2A 2ZUVA 4UILH 4P57A 2OP4L 4JFQB 1CGUA 2MBBB 2Q5WD 2FHFA 5PAZA 3L2MA 4A1RA 4GXVH 1SEBB 5SWQA 1LDPH 4DDID 4MLSA 2NXZC 3ZDXB 5FZQA 3T3PE 1J9CT 1LQBC 3QRLA 4X7SL 5C0IA 4KO9A 3QDMB 1NC2B 1TZGL 1Q94A 2HT4C 2VZTA 3KSQA 2K5PA 1BXAA 1IYFA 3MKRA 3BPNC 1AJ7L 3E2HC 3GPEA 1KT0A 4U1IB 2YKLL 2W8CA 2JCCB 3LRLA 3Q7FA 3DV4B 4YNYA 4YXLL 3WJLC 1P2CA 3IPBA 1CMOA 1EEYA 1TKYA 1F58H 1I9IL 1JPSH 1RULL 4KUZL 2EH8H 1Z3YA 4ATGA 4IYKA 5E8DL 3ZJVA 4L0ZA 3AREB 2OQJB 1KENL 2OZNA 2V3FA 3VXSB 3QYNA 3CHPA 1BQUA 4LLVA 2NYYC 2XWTA 1QZNA 3M95A 4U2YA 1OWRM 1VFAB 4I3SH 1S9WB 1UWYA 2DQEH 3NDYE 4FZ8H 4A2FA 5HJBA 3MHSD 2CO3A 4W9KA 4O5LL 2WCPA 2OMXA 2KMCA 5KJ7E 4U7MA 2FT7A 4P2QE 4PG2A 5FFGA 3ZE1B 2GW1A 1I4HA 2X4RB 4ZPVA 4XNMA 3OKLA 4NO0B 4LNBA 4OAWB 1WX8A 3ZRCA 3U4BL 4K5MA 1V97A 1L0PA 5AW6B 1HZHL 2OTWB 1FO0H 2IOIA 3JQOB 3PHAA 1J5IA 3IU4H 4Q9RL 3PXJA 4KMOA 2Y5BB 1AFVH 1FFOB 3U2SC 1B9RA 1Y8RC 1X7QB 3MCKA 4IBLT 4PJGE 3AXCA 3KPSD 1JPGB 4B7IA 5GJSH 3ZRCC 2IGFH 2BIPA 3EGSA 3HBGA 5IHLB 5F71A 4WI4A 1J7VR 3MRIB 2ZOLA 4X2UA 1TYRA 4G6FD 3V6EB 4TRQA 2APSA 1IC1A 4J6RH 2F7PA 3HR5B 3LV3A 2V2XA 1VIWA 1U8MB 1E8WA 2B0SH 2EH7H 2P5WB 4MB3A 4XP5L 1FJ1B 3VRAB 5EUKA 4AH2A 3CFEA 3OLGA 2O5NA 1FM0D 1TS2A 1KGIA 2DY2A 3JT0A 1MFEL 1SYVA 4LCCB 5C07B 4OZIB 3KSLA 3BO8B 4WSKA 4LBEB 4RGMA 5HHOD 1JMXA 4EXKA 2GC4C 1BXTA 1KCBA 4AKOA 2F53E 1LO4L 1MPAL 2DM2A 3T3OA 5IVZB 1AZZC 2PTTA 5L6YL 3K6SB 4HIIB 5BNXD 5AAWC 4HOUA 3CZGA 4XE5B 4CGWA 4HUKB 2JB6B 3KG5A 4Y9EA 1MG4A 3KR3L 3EHVA 1F4HA 2FWOA 1VAHA 2KD0A 5DVMA 1IEHA 1W0YT 3BN3B 4QRBA 3DVNU 1Z2MA 3QRFM 4O60A 1AZVA 4LEOB 4MB5A 1JBJA 2BS71 1L3WA 2IANB 4NM4H 1XLOA 1LE5A 1ZK5A 4AYDC 3VH4B 3DK2A 4XBEH 4DO6A 1KF9B 2XTJC 1K2DA 1XD0A 3FQNA 3VD0A 4ILGA 3DXAD 4MSWA 4OTXH 1H0DB 3ILEA 3WMPA 1OCOE 2JF1A 4CDNA 2C8NA 1BAWA 1PLGH 2BY1A 2E46A 3SPIA 3KYOB 4BWTA 2TRYA 4MMZA 4LOVA 5JLZA 4KKJA 1RL1A 2J44A 4XWTA 2P8MB 3T6ZA 3CKBA 3QNXA 1JYWA 5INCB 1OEZW 1AG0A 1JDCA 4GRWH 4LASL 2VGXA 4KUCD 2AITA 2ZNVB 4JB9H 2QSQA 2VLKD 1LO3L 1D7DA 4HF5L 1D5XB 5E00B 2GTWB 5HPMB 3FAXA 1H5BC 1J9RA 4HIHA 5DEFA 5E0QA 3H2PA 5F89B 3FQRB 5C6TH 4G5AA 5ANMA 4QYOB 2BSCA 3RNAC 3PG2A 1L7TL 4PV9A 1PZ5A 2HT2C 3DWMA 5C2BL 4U6YB 2FIRT 4W9IC 1YRKA 3IDGB 2DQIL 2G4SA 4N26A 3HG3A 4P3DA 2Z8VC 3QW9A 4XPAL 5GGTA 2PPEA 3IDYB 5EEVA 1GSKA 5DTFA 2MCPL 4P3CL 2BSDA 2AX5A 3VXNB 1BAFL 3ZNHB 5ITBH 4JE0A 4XZ4A 4O6FA 1DJWA 4D0CA 1WS7A 2WP9B 3V4VA 1U8QA 2VO8A 3D5OF 4H0GA 4LVNB 1GW0A 3IT4B 4XGAB 1AXTL 4X7CC 5K1NA 2JIXA 4YPJA 4JL1A 4B6WA 1QASA 4KV5E 3X17A 5KN5B 2C1OA 2LAAA 1XGQA 3I6LE 2OZ4L 3FUNA 2KZ1B 4HWBH 3VXMD 1UD6A 5AKTA 3SPVB 3PNWA 4M1GH 3F58H 4XE0A 4PRHA 1YEJL 2X6MA 3QJHA 2AI0L 5A2KH 4GH7B 3WY2A 1BVLA 1Y1DA 4NKMA 4ODTL 4PGBB 5CIPB 3WDIA 4LKCB 5A3ID 3BMWA 3RAJH 3QUHA 2HX7A 3SCMA 4GKZB 4BFRA 2C4FT 4OLVL 1TYJA 3VQIA 4O02A 4D8PB 2F37A 2BNUA 4ICVA 4YK4B 1EZUA 3KCPB 5IB4B 1IGCA 2R2QA 3I3NA 1QLEL 3BPLB 3MTNB 4ABQA 3D06A 3GM0A 3SNXA 5EBMA 2LU4A 2OJZH 2LJIA 5CTRC 4FFVD 1ZHNA 2QPEB 5E08H 2H26B 2BVPB 1M7IA 1ETZB 5EBLB 4W9HA 3NBNB 3FULA 3B2DC 1TYQG 2VR9A 1F3JB 1LWHA 1GYWA 5JPMB 2ATAA 1GOFA 1L6VA 4JFYB 1SVCP 1M57B 3V55A 1WLHA 1Q72L 5DUJA 3WALA 3GI9L 2WUBH 2HPOA 4JM2C 4WW1A 4YXHL 3S2CA 4WWOA 3O4LA 3A9JA 3HUJF 4WUKL 2K6ZA 3VI4A 3REVB 1P7QA 1HXMB 3EOYG 1TJCA 1J8RA 2PW9A 4LIQE 1D7FA 3UDWC 3QDJB 1XLNA 2OL3L 1DE4A 2WTRA 3GNML 4LVOB 5I5JA 2EMTA 2WQSA 4NZUL 4XWGL 1F1HA 2FJSA 3VI3E 2DZOA 2R83A 1BLNA 4NQDE 1QSEE 3Q69A 2QZ5A 3UJJH 3TO4B 3ESPA 4PJXA 2NR2A 5KVGE 2R29H 3HC4L 3T9WA 1R4XA 5EBWA 3X12B 4IU3A 5I66A 1EJ8A 1FG2B 1ZGLM 3GZNB 4YC2B 4CN4A 1WWTA 4ETYA 3OZ9L 1G9EA 1LD7A 1ONQA 4GTSA 3F83A 1NGWA 3CFUA 4U33A 5AOZA 4P04A 2MCMA 3S37L 2F8IA 3VM7A 4PYZA 1Q9LA 5GGUB 1MWOA 4WLCA 1K53A 3SR6A 2K8BA 2XPZA 4U1SA 3TT3H 5GRZA 1FYTB 1L7IH 3QEHB 1BFTA 3ZT6A 1M3IA 3OF6A 5IW3A 1JZ5A 1OAUL 4PBDA 4HG4J 4EI5D 1U3DA 4K71B 2XEEA 2KAJA 1F4WL 3A6CH 1KN2L 1F0ZA 3W9EA 3QO0A 4XNDA 4WWNA 2HKHH 1IJNA 2ADIA 5A2CA 1YEIH 2WLIB 5D7JB 2NUPB 4J8RA 3L6AA 1A02N 2L52A 3T6QC 3O6FB 5CS7A 2RGFA 2F8VA 2XZCL 1R4NB 3NCBB 1QRNA 5I1HH 2GSMB 3NCYS 3TT1H 4UM8B 3CVQA 5ID0B 3GMRA 4KK8D 4PJAF 3UPAA 4RDQG 3SY2A 5F88A 1TJMA 2XLLA 2VDOH 3Q8CA 2SODB 4M7LH 4U1HA 3ZQ4A 1V3LA 3B9KA 4H25B 4OV5A 4WZ9A 3SBPA 4NN6B 1S7TA 3VRJB 1MIML 1XGTA 4DZ8B 1MQKL 4IJ3B 3ARQA 3JUZA 1BOYA 3VYNA 3IPEA 1K5NA 4HYTB 1E0ZA 2QKIB 1A1OB 3OXRA 5I8EA 2L1AA 1W91A 2IXQA 4LCWA 4M6OH 3PDDA 2V7HB 1IQDB 1V9JA 3AEGB 3I50L 3L5XH 3LRSB 2EVJA 4PBVC 2VOTA 1P7BA 4M5YL 2D4FA 2D0FA 1WE7A 4OVUA 1OTSC 3MFFA 5MEOB 4QCIA 1M2VB 2HUHA 3IFWB 3AH7A 1UADC 4W9EA 4N2CA 5ANLA 1XGWA 3SDYL 1CFVH 4XKBA 4PWGA 1LJMA 2WNGA 3VFTA 2BZ7A 5D3IB 3UJIL 4Z7WF 3MHZA 3ULVH 2KZKA 4P23A 4F9LA 3JT2A 3MVSA 2BY3A 2YFOA 2YD1A 3HZYB 4A6QA 3UTSD 2FNWA 3WUWB 4CYEA 4PRID 1RIVL 3HLKA 1J0ZA 3QORA 5D6CB 3VFGH 3I5JC 4Z5RB 5FUZL 4YFLF 4B9PA 4U96D 5G05C 1TO4A 2FULA 5IB5A 3S8FB 1V1PA 3DUSB 5BRQA 3E33A 1FL5B 3VTVA 1JYVA 2K8HA 1I7TA 4BESA 5KJRL 4R0LA 4N2QA 2KYWA 2WPVA 3P9MB 2WIMA 4HH9B 1UENA 3VW3H 5EV7A 2VISB 4ZFQA 3VRBB 2VL5B 5FYKL 3LKPB 4L8BB 4RMTA 5IROA 4HUMB 3D2UD 5A3IC 4AYFA 4NJAH 1FL3A 3P0GB 2GIMA 1QSFA 4OZFA 5MI0B 2NUTA 3NUHB 4U49A 2KCVA 3TH2T 2WNWA 2CUAA 4EBAA 3MROA 3ULUF 4PR5B 4ZUSA 4HPYH 3QNYA 4HOXA 2DENB 1V27A 3PWJA 3W5NA 3JZ7A 2VTBB 1MJ7H 1DEEA 4RCOA 4MELA 4LHUD 3CXHJ 3NCMA 4JN1L 1J0GA 3NMEA 3WNOA 2VSOE 2XT1B 3QHZL 1OANA 4MAYA 4WW2B 3QUZD 4GAAA 2OTUB 2IY0C 2J6WA 4KX6B 1FVDA 1IIIA 3CHRA 3MV7E 2EKIA 2K8CA 1RUPH 1FGVL 3N42F 4RGOH 4WIQA 1OQQA 3VFMA 2EC9U 3E3QE 2ICEB 2IH9A 4ZMTA 4BBWA 4LLGM 4QRSB 5ACLA 4D9LL 4QPEA 3GLZA 3B2GA 2CUMA 1UZ6F 1E5BA 3SDXE 5EIIA 2JVUA 2PQRA 1CLZL 4IHOB 4ODUB 5HHDG 4MRBA 3OKEB 3L45A 3D9KA 2FBNA 2D7QA 2QC8A 3U8ZA 5K93A 2KMMA 4FBJB 1VACB 1CT8A 3CVBA 5JXVA 3F7LA 4G59C 3TJEL 1OSZA 1EAPA 5SWSD 4JGNA 3S7BA 4G80B 3GSNB 3HZKB 1BM7A 3FHAA 4M8VA 2WXQA 2Z0BA 3SD5A 5ENWB 5CCGE 3HE6A 4M43L 5HI5D 4DPCX 4ZFOB 1PCXA 3L9BA 5CSBA 1V10A 1N59A 2P8PB 1Q9OA 1T5XB 4XPHH 1WF9A 2FQEA 2YBRB 4PCSA 1KEML 3K6IA 2EECA 5TQ0L 4EVNB 3I85A 1GTNA 3HM6X 1DJHA 3RIAK 3IDXH 1F4YH 1JNLH 3D9IA 2ESVB 1T1YA 1UZXB 4BRVA 4GA2A 1KIRB 4ODBD 4UDUA 2WKGA 4Y1AE 3ZR6A 1E65A 1QO3A 5DD0L 5AQ9A 1WFJA 4XNXL 3HG1D 4AQ1C 1PZUB 4DDGD 3B37A 1PY4A 4EKJA 4NHUA 4FNRA 3C5JB 2CRMA 1ZKHA 2AXZA 4ZI8A 2CHDA 3UJTL 2R4SL 1OTTD 3QAZB 2NQ3A 4LSDA 5CUSH 4UTBA 2J8UE 2A9NL 2A2QT 1TNMA 4FNTA 1BFVH 2WO2B 2YA0A 3KVPA 3WE6A 2A83B 2C7MB 1RYJA 1S8DA 4KXDA 3TBVA 1HQRD 4RSYA 2WQ6A 5F7DA 3MRBB 4U07A 5CCHE 2QEJA 1Q10A 3FRUA 3RU8H 4QNPF 4QO1A 2XEWA 1BWWA 3DHGC 1I82A 3MJGX 3FOMA 4IIQA 4XNYH 3V4PA 4Z3TA 2JV6A 2ZKMX 4Y2NA 3LKQA 4RFBA 5D1ZD 4QMEA 4OGAD 2VGLM 5EO9A 1BFOB 1KXQA 2NX5A 3UYPB 1SRDA 5C3IA 2DBYA 1XH2A 3QUXD 2KPNA 1E4WH 3FW6A 4GTMA 4QHKI 4AVKA 4ODWA 2IH1A 1NCIA 3OHXB 2X4SB 4XODA 4IJTA 4UINL 5IBLD 5KBNC 4LJPB 2IONA 1IHGA 4QKXB 1QUNB 3KLLA 4J28A 3V5KA 3GIVB 4A2GA 4LLWA 3H9HB 2IADB 3BX7C 5HDRA 4WWID 3HS9A 2ZGDA 3C8KA 5DHEA 2YJQA 3KPNB 2FLRT 1N64H 2WXMA 3MRMA 4ZYNA 1C7TA 1R24B 2ADGB 1BJ1J 1E43A 5AZUA 2QGDA 3DUUB 3I3DA 3RHWF 3C3OA 1R33A 1UUPA 4L2LA 1HEZA 1IRAY 1SVZA 2KQSA 3K3QA 4XX1G 1GGCH 1MFVA 3WGVB 2BC4A 4ZTOL 1NBZB 4AYMC 3Q4AB 1IARB 4PUBL 3BVMA 1IAIH 2FQFA 3MPCA 3RIAF 1I1YB 4UILL 3R0MA 3M1BB 4KI5D 2RTTA 1GS8A 4XPFH 4GXVL 1NP7A 2ZU6B 1DYZA 1H3UA 1LDPL 4H13C 2EDDA 3NCYP 3HNSH 4MDIB 1KTLB 4RMRA 4W9GC 3LH9A 4WDIB 4PGZA 3V6ZA 4RM9A 3ZPJA 2V5FA 1ZLWK 2CR6A 3ABLB 3I2CH 3OZLA 2LABA 2Y2TA 3PL6A 4PMFA 2R1WA 3BSZA 5BQ7A 3CWIA 1HEHC 4F3FA 1ZGLP 3ASOB 5HYQB 1BQSA 3H9SA 1S5HA 5IP4A 1SBBB 3M46A 2VN6A 5KAQF 1JL8A 3DX9A 1BIHA 4RBPK 4UQ3A 4X4YB 3FRPA 2JK5B 1AHMA 5JZ7C 4F6RD 1NDMB 4E41E 1WDYA 4YVOA 1R3JB 2YGVA 3QUZC 1F58L 5SV4A 1JPSL 5A6IA 2EH8L 2FIDA 5AUMA 2GAZA 4A20A 1RZGA 3MRGA 4HCFA 3WKMH 4OJEH 1G1YA 4B27A 4K3EH 3RNQB 3SQOH 4J1UA 4JY6A 3R7RA 3V5DA 4I3SL 5DS1A 1Z5YD 4PJ7B 5I0ZA 4H26A 3FTWA 2O6FA 1KTKE 3EH2A 1A5EA 2DQEL 5LXHA 1DSFH 1XCXA 5E6IA 3V8CA 5I9QB 2ETWA 5KJLA 3IFOA 5TE6H 5GSRA 1NFIB 4YSDA 1BZ7A 4F5CE 1WXSA 5D2MC 5D4QA 2X4TA 3BGFC 4HV8B 3WNMA 3S88H 1INZA 5DO8A 3W2DL 1AY1H 4WURA 1OCCE 3VG0H 4KQ3H 4LPXA 2IOOA 4KVNH 1ZT4B 1FO0L 4O9HH 4QHKJ 5BRPA 4KDLB 4B5ZA 3CFBA 4Y5VA 4AUQC 4OUUA 3IU4L 4UANA 3UCQA 1EV2E 1AFVL 2G9KA 1MEXL 3IFPB 1QEWB 1TQWA 3BDXA 3G6JF 5B7EA 5E1AA 3ZYZA 3BVGA 2CO4A 5HI5C 1NGYA 1YNTE 4BVUC 3V6OA 4LSPH 3S98A 1PY9A 2WK2A 5GJSL 1MCPL 2IGFL 1UQSB 1S7QA 1ORSB 3Q3GB 2FJHB 4E5XA 3FT2A 3T1FA 1U3CA 2ZJSH 4J6RL 1R75A 2ZF9A 1IGTB 3I6SA 3AM8C 3RCZA 2B0SL 2EH7L 2Z3FA 2WXLA 4AMKH 4YT0B 3CIQA 4UTCA 2MCG1 4HKBA 1LD9B 1LYQA 1M05B 4Y2OB 5LG1A 4WNSA 1FSKB 4QY8A 1AGFA 2FCMA 2GFBB 3FC8A 1OY3B 3RZWC 4G9FE 1F2RI 2EDRA 3ZMEA 5EU6E 3LPGA 1U41A 3CMOL 5EZPA 4ILIA 1AZCA 1RJYA 1WF5A 2GB2A 3T0AA 4BKTC 4ELMA 1U36A 4IWOA 4CJ1A 2IDTA 2AV7A 4LQ1A 5HYJE 1QYMA 4NM4L 5D1ZC 4OGAC 5JOFA 3H85A 4XBEL 3ZVVA 3QUXC 2NBWB 4KSLC 3U46A 1IZJA 3OX8A 2FSEA 3W37A 2JWZA 2OR8A 4BFJA 1B0GB 3WJMB 4OTXL 3O3EA 3DK0A 4A63B 5IBLC 4AKPA 4DOHE 4E9XA 5I1JH 1PLGL 2RMNA 1AN8A 1RD6A 3DTDA 1QBAA 2J4WH 2Q6WB 2R2HA 1EM7A 5DD6A 4CJ0A 5F9DC 2CBMA 1AACA 1QW8A 2KDGA 2AK4E 5FGBA 4HJIA 1AAJA 1K8IB 1V80A 4WWKB 1UM6H 4L8DB 2AKRB 4NQXA 4JB9L 2WOBA 3D3VE 1KPVA 1VPOH 2LVOA 3RFZA 1QYGH 1BAGA 4BELD 3ZDZB 2C1PB 2L76A 2Y5CA 2Q86B 5C6TL 2YHGA 2L04A 1UA6H 3CZNA 3DECA 2KWDA 3GXPA 2N7EA 3VUYA 3BP4A 3QT2A 4WV1C 3WN6A 3WEMA 3LD8B 1QVOA 4HIPA 4QJ4B 5ABZA 7CGTA 3PEVB 5KZCD 4KI5C 5CLXA 4FTVA 4IULA 5AW5B 5A6MA 1ZLWH 2XQYA 3ETBF 4MLPA 2Y36H 4PMEA 2YAEA 2C3XA 5CJ5A 2YPLB 4R5VA 5KSBF 2Y7QB 5E56A 5HHME 4LESA 5ITBL 1S6NA 4G8GA 4QUOA 3IETB 4RBPH 2CD0A 2EDEA 3QULB 1KLGB 4GU2A 5BOPA 5CHVC 4J8YA 4UI9K 2YO3A 3DX0A 5FV1L 3MA7A 2C4FU 1BF2A 2R8SH 1P1AA 5GRXG 1U8PB 2NY1D 3GJFA 1KTCA 4PRHD 3E1ZA 4JFVA 2WKOF 3QWQB 1KBVA 2NY3B 1V05A 4JS7A 4HWBL 5D2NB 4JW3A 4LLUB 2Y4TA 3SCMD 1F2QA 4M1GL 5L2JB 1T22B 4W9KC 3F58L 1OCWH 5ALBH 3W11C 1KPUA 1BD2A 1P98A 3OJ3A 5HGBB 2J1ZA 2OX5B 3SE4C 3P1UA 1NFDE 5DSCB 1SXNA 2WINB 4FQJH 4Y4HA 4PJ9A 3RAJL 2V3NA 5DXWA 4DT2A 2IBIB 4O00A 4LOEA 5EILA 4RZKA 1K72A 1YUKB 2N01B 3MKKA 5DFVD 2ZUTA 3W57A 4X5LA 5IMMA 1MCSA 2XDHA 2ZCLH 3QIUB 2IYDB 4HPLB 4XC2A 2OMTA 3Q6GH 2H32A 3OKKA 3KHQA 4UQIM 4Z7QE 5FZRA 1K8DB 1BA9A 2IO2B 2OJZL 2XWEA 4M01A 2VLJB 5B1BE 3IU3A 4P46B 5E08L 1PGAA 2FO1E 1YEEL 4MB4A 5I4DA 2GBAA 3OKOA 1M94A 3O4LD 2YXVA 3DRTA 5HGDB 1KXHA 3C09B 4ADJA 4Z7OE 4KZ0A 1P7QD 3TV8A 1W72B 3MLUH 3X2QB 2DYPA 2PTVA 1N5WA 2WUBL 5IR1A 1FNLA 1DJYA 3DBHB 4HK0B 3RNKA 2G5RA 4HWZB 1ZDSA 1G1OA 5D7EA 4HOSA 3MN8A 4BK8A 1UT2A 1OXJA 4N2HA 2P28B 2XSKA 4MMXC 3SDDA 1NCOA 2MNJB 4RCAA 1H3VA 4GIVA 2D73A 2OEVA 3LAFA 1DQLH 4FG6D 2EIJB 5JHAA 1NLDH 1PNDA 4X42A 1DQQA 1IM3B 5HD8C 2X53A 3IGAA 2VSNA 3FCSB 3IG3A 5GGVY 3UJJL 3QAQA 3IDMA 3OXSB 2DWQA 2R29L 2ATKB 5E1IA 4NKDA 3AB0B 5KYXA 3KS2A 4NQEA 1U8KA 3SY0A 3C6EA 2KKQA 5KBMA 1J9SA 2WWNA 3OF6D 2WZ6A 5L4FA 3K74B 1UWMA 1SJVA 2DIBA 3F12B 5EN2A 4AXWB 3WG7E 3TT3L 3U0TA 1L7IL 1JV2A 1NTDA 3QFJE 4L18A 2LLLA 2NXZB 4XCFH 1XH3A 4I77H 1E2VA 1CMXB 1WC7A 3A6CL 4C58B 3P3SA 4MBOA 3ARBA 4UNIA 4LIQH 4GJTB 3CQPA 1OPGH 4F1SA 1QRND 1S7UA 3MV7D 2HKHL 4K8RH 5DJYB 4N9F4 3WFCH 1X4XA 1YEIL 4GBXA 2NXPA 3FTUA 4CDRA 2WZ5A 3B9AA 3BPNB 4NUPA 2Y7NA 4KXKB 3DKHA 3H7SA 2K8QA 2IPKA 2IV9A 3WLWD 1J88A 3E8UH 3B9KD 4P2RE 5I1HL 5C0BE 4LLQA 5DS2A 3TT1L 5LAPA 1WZKA 5JJ6A 3PPEA 3NIFF 3QC5X 4FNQA 3U7WH 2VDOL 5KVGH 4M7LL 4U6VH 2HJLA 4KKRA 2F1BA 3LJ3A 1U2CA 4DP0X 1AWDA 1BU9A 4LCWD 1FYHB 3FQYA 4JPIB 2AMUA 5IK3B 1RLFA 1YPZF 3BWAB 2I9LB 4JE4B 4N8UA 4UIMA 1PD1A 2K9FB 2WPGA 3X14B 3C6SA 3V5HA 3MBXH 1QATA 4M6OL 4R4BB 1YJJA 3MLPA 3UERA 3L5XL 5DMGD 3B3BA 4BKLB 4H44C 1U6AH 5G04C 2HG5B 2VDQH 3I3BA 3RFRA 4JHUA 1BXXA 4CU8A 1T0NB 1M9SA 3EOBB 4LCUB 1KJTA 3GIZH 4R96A 1CFVL 4F7EB 5B3JE 3LDZE 3ULVL 3QORD 4R26H 1Q1JH 2XTSA 3CZFA 4AT6B 4AL8C 3C5ZB 2C9VA 4PCTA 3LXAA 3U2SB 1VKXA 1BOGA 3MYJA 1B4LA 4JFPB 4LRIC 1WICA 3VFGL 5C0RH 1EVUA 3S48A 5ANRA 2NY1C 3AG4E 5KNHD 4XHJD 4G8LA 5IROD 2V17H 4N8VB 5G05J 4ZT1A 4F7MB 5CGYD 2P48B 1S9XA 3HG4A 1QSFD 3VW3L 1IXVA 3SCMC 1I1RA 4KXCA 4PJBF 4WNFA 2RAMA 5BW7C 4I4WB 3TWUA 2R2BA 4NJAL 4RWHA 1GGUA 3DJ9A 1HEJC 3KLHD 4IGBA 1MHEA 2EIBA 1WJUA 1B0RB 3W1YA 4BSVA 4B93B 1GKOA 5DFVC 5C9KA 4HPYL 2G30A 4MAYD 5IKCA 1HZ6A 4W9HC 4U3SB 5IJCC 4A55A 1MJ7L 2ERJB 3BAJA 4IKIA 2QPDB 5CEYA 2V2WB 3VA6A 2GJZB 3PV6A 5AVYB 3RGBA 2PM6A 3SGEH 3LKRB 2YC1A 4IU2B 1G4RA 4GMSH 1AGEB 1BG1A 4D9QE 4WUUE 1DSWA 2A0LC 5LGKA 1SDYA 1J48A 3KVDD 3EGDB 1WM2A 1RUPL 3NJXA 2XZDG 4RGOL 3RKPA 1UA7A 4TUOB 1G7QA 4R7XA 5FGCE 3MV11 1LK2B 2XTJB 3ARWA 3HPLB 4HJGA 2W3RA 3J5PA 1EANA 4F91B 3CE1A 3VXUB 5ES4B 2ZKXA 3DPBB 5HBBA 3OAYK 1J5OH 1A64A 2P24B 2LOEA 3KQ4A 3CC5A 2CNZA 1U8IB 5EC2A 1NUNB 2F9BT 4N2NA 3FQXB 5EC1A 3KBFA 2EINE 4FG6C 3CFNA 3HE6D 5DVNA 3VRIA 1C8PA 4AY6A 1D7CA 1IAOB 3IVFA 5T3ZD 4JG5A 4NIYE 2CQVA 4AYEC 3UC2A 1AQKH 4H1LH 3MA5A 5F3HA 3PY9A 3EUDA 4CAGA 1NH6A 1PNCA 3HXFA 2NY5H 2VW4A 2AEQH 4JO1H 4XPHL 1ZTMA 1H5BB 3NOBA 2KLSA 1VD2A 3AM9A 3WCQA 2D31B 4ALAC 2NW2A 2GGFA 1RKRA 2KCKA 3C8DA 1F4YL 1IM9B 1JNLL 2F58H 3IDXL 4LDTB 3VFOA 2AJSH 1WEJH 2B59A 5K9OB 4ONHA 3ZKMD 4HHAB 4QTFA 1IX2A 2BVOB 4BUQA 2B2XH 2V5RA 3KPQA 4A9AA 5HJ3B 3SQBB 2ZSWB 5CUSL 2VDPH 5D7IF 3TBCA 4JKPH 1J12A 1BFVL 5CBOA 2BXZA 4OIBA 1JVLA 3KDMA 2K6YA 5E8NB 3NOIA 2QMJA 4KX7A 4NRYB 3E3QC 4YHLH 5GGRY 1ZLVH 3WLWC 3HPJA 3B9KC 1F86A 4IKNA 5ESVA 2OMYB 5IGXH 1G9MC 4B89A 3ASHA 3RU8L 4U1JB 1AIFB 1LP9A 2NX5D 4WSJA 4XNYL 3L5IA 1JPLA 3WIHH 3LEYL 5HI7A 4CCAA 5DJ6B 1N68A 3L2LA 2I07A 2H45A 2ZISA 4ZMQA 5CMAA 2H9GA 2DWEB 3TMPB 3GLEA 1E4WL 3DDFA 4A66A 1U8JB 3INOA 5AW1B 3NSDA 1FHGA 4MS8D 1ZV2A 5LGJA 5TSSA 3F3HA 4W9EC 4A7UA 15C8H 5CJ8A 3GMMA 3ARGA 4Y5XB 3IXSA 2VN4A 1TZOA 2GSIA 1LMIA 1HSBA 5DMGC 3NRZA 3G6AB 5I1AB 3TURA 4K3JH 4P59H 3CDGB 4QRUB 3KD4A 3G2SA 5D93C 3ZSSA 4EAEA 1IGMH 2HKAA 2ZWSA 1OP3K 5GZOD 5CEDB 5IW6B 4K7SA 2PETA 2X2IA 1Z9LA 1MAMH 3UQ3A 5D1QA 2I9TB 3VUWA 1HL9A 1MHCA 1MCBA 1NAMA 3CSYA 3QUMA 4MNGE 5F0PB 3RVWD 1EZSA 2YXWA 5ISZB 1GGCL 4Y6WA 3KPSB 4FI8A 4K07A 3FQ1A 4HBDA 2Z4TA 5F7KC 3QZWA 3X0WA 2X44D 2CHWA 4G6FB 4XHJC 1IAIL 3PJLA 5F3BA 5LDSA 2J52A 1CFQB 1KIPA 4PJIB 1W8EA 3CWGA 3F6QA 1P4BH 1E9QB 5IEKA 1P1ZA 32C2A 4QHLA 4URTB 2EYSA 4XPFL 5KS9F 3S3PA 3CPUA 3PL6D 4C55A 3QWRA 3MREB 4JIOU 1Z9SB 3HNSL 4P9MH 3S3BB 3GZNI 3H9SD 5IP4D 5JIHA 5BCAA 3VACA 3I2CL 5HHOB 3ZNGA 4PWJA 4MM3B 4WFFE 8PAZA 2N9XA 3QXDA 5BV7B 3BQVA 2OMUA 1O7DC 4MX7B 1WBYA 4U1KB 3UTMA 2I85A 5AVVB 3TNNB 2RALA 3FT4B 3QR1A 4HUNB 5IHZB 1EU3A 1QLRA 2QBWA 1D5BB 2B9AA 4YDVA 2Q87A 3QHTC 3LPZA 3WKML 3MODH 4B3VA 5D66A 3MJ7A 4JO4H 1CD1B 5CAYB 3Q6FA 1OCRB 3BKYH 3LIUA 4K3EL 2VNCA 5E6ID 5EZLA 1BQHB 3KYAA 3SQOL 2GBJA 2YLMA 4M3HA 1KGJA 3LQZA 3EJTA 4GRLA 4PW4A 3KPPB 5I2IB 3NJLA 2D3AA 3ZQXA 4R84A 5HI4C 2R1XA 4LCYB 3SDAC 1WYJA 4I0PA 2X9XA 2BHUA 2QVKA 4CBPA 4I1MA 3DXAB 1U8CB 4MJ2A 3RPKA 1V5JA 4HFWA 5TE6L 1UD3A 2UY1B 3CN4A 3LY6A 1OOWA 4PS4H 3LZPA 1I3RA 1RZIB 1MQ8A 3S88L 1I4RA 1DJXA 2XFXA 5ECGA 1A3RH 2MKWA 4KK5D 4Y4FC 1AY1L 2E2EA 1NIDA 2SEBA 2V3DA 4KQ3L 1OW0A 1IC4H 4KVNL 5EIBE 1D3CA 2OR9H 4O9HL 4FQQA 4ZMNA 3D08A 5C0CA 5JDJA 3MUUA 1MWAH 1PFCA 3NESA 4PJEB 4ONOA 4F7ZA 2JYTA 2P5PA 3LSOA 4DCQB 1LFDA 1JF5A 4LSUH 2VLKB 4DX1A 1WMHA 4LSPL 1TNYA 3MLWH 5HDQH 2GTZA 3UP6A 5BXFB 3KVFB 4C4UA 1OGTB 4GKOA 3D32A 3NGBC 3BISA 1ZE3D 1SF0A 2X6HA 2IG2H 2OMBA 5A2AA 2ZJSL 3RWIA 4EO5A 4F9PA 4YHNA 1TN7A 3RWEB 3ZHEA 2J07A 5B7FA 3VXTA 4HKXB 2VR5A 4AMKL 3ZKMC 2XN9E 5TDOB 1HESA 3BWUF 3ARRA 2ZP9A 3UUXA 4V33A 1WH3A 4Z3IA 3DHMA 3GS2A 3SKNA 1UH3A 4NGHH 3QUYA 3G5VB 4L8SB 5HHVH 3FH5A 3PQYA 2BF8B 4WNEA 1NI2A 2A6JA 3UBXB 4IIQC 5DZPA 1HAWA 2C7UB 4GUQA 2O6EA 1JZ7A 3T4AA 1GGIH 3MV9E 5DO2D 4AQOA 5I28A 5BO1H 1TQBC 2G9HA 2QCZA 2HE0A 3EO0B 2J09A 3FEYA 4FXKC 3VXMB 5AW2B 1C1YB 1JGEB 5DC9B 3S4SA 4JFHE 4N0RA 2I27N 1IGJA 4AGOA 3V6CB 1SMOA 2E4TA 4MS8C 3BVVA 4G43A 3CIRB 1H0AA 4OIFA 2HWZH 3N85H 4HDIA 4Y4KC 2NTSA 3D9NA 1WAAE 2OXGA 5I1JL 1UELA 4X6CB 3BT2H 2PJHA 5KOVC 2J4WL 4W9JC 4FKEA 2QVMA 5IQ9B 4B0MA 4BERA 3IPFA 3S3DB 2LGDA 3BYTB 5GZOC 2VRKA 2ITEA 2PMZA 1UM6L 2LE9A 1CBJA 3QNFA 3S96A 1CGSH 3D85B 4QRPE 5ECJE 4C54A 4POUB 2LJ5A 3MRCA 1VPOL 1E27B 2IMNA 3ZLZA 2ITFA 3RVWC 1QYGL 3WNNA 4F24A 4GKSB 3Q3OC 5HYSA 1UB5A 3AITA 4FTVD 3HG0A 1UA6L 3OB0K 3O3UN 1KJ2A 3S9DB 5LGYA 2RDGA 3D4GA 2AV1B 4RWYH 4IKGA 4UT6H 2XYBA 1OQRA 1YMPA 2FDBP 1B4RA 4A67A 3H53A 2UYZB 3CH8A 4G8GD 5GZNA 3WTXA 3P69A 2GK2A 2Y36L 3EYQC 1N61A 1SDDB 5HGAA 4BQCA 1A8ZA 1AXSB 2AQNA 2P47B 3ECVA 4AGLA 1G6RH 2HXAA 2HVJB 1LEKB 2ADJA 3P2TA 5JJ7A 1HIMH 1KYDA 1GC1C 1NCGA 1KB9J 4GW1A 3G2VA 1C12B 4I1PA 1W0WA 1JNJA 4IBVA 2VR3A 1REIA 1T4KA 1WGOA 3AXLA 2DI9A 5LXVA 3V0VA 5BMIA 4Z7NE 5FQ4A 1BD2D 1FFNB 5E94B 3PVLA 4J3SA 4V3IA 3DX4A 3CZJA 4Y4HD 4PJFE 4PJ9D 4UF7C 4BSWB 4ERSH 4RQIA 5E6IC 5ALBL 1OCWL 1G7PB 2HLEB 3M17B 3V95A 4U7SA 4AQ1B 3WEXA 4EI5B 4DEPB 4KNSA 3BC9A 4FQJL 2XEVA 3KYDD 4HZ1A 4KMTH 3E0GA 4PJCA 2XGMA 4PJHE 2AAAA 3DBRI 3GSXB 5C0EB 3U6RA 1U4FA 3SBRA 2ZCLL 2GVYA 3GO1H 1ZV5A 3JVFC 3VTUA 1VA9A 2Y25A 1D5RA 3ATAA 1N0RA 1ISNA 2GJ6E 2XKUA 4M5SA 3NJMA 3V6OC 1B4TA 4KK9D 4CC4C 2HJ1A 5H8DA 4M5TA 1U8OA 1RY7B 4XNAA 5DHVA 1KMGA 1NMCB 3MLUL 3KWUA 3A1QA 5CXPA 3ZE0E 2JJTA 3IAM1 3W0WE 1CG9B 3UIOC 1SN5A 2KYIA 5AZFA 4M7CA 4TNFA 2BM3A 1MAKA 3BQUC 3EOAA 5E76A 3Q48A 4MD4B 3HXCA 1ZE3C 4NP9A 3WIFB 4LLDA 4X99B 3BP7B 2FR4B 1G6JA 2IAMC 2LNIA 2OAAA 2N7SA 3U1PA 2R69H 1DQLL 1V81A 2BK8A 4E36A 1NLDL 4LRNH 4CMMB 4F7PA 1UXSB 5KYWB 1FVEA 3RI5K 1MCWM 4HETA 4HIEA 4KGSA 4LMQI 3VDAA 4RA0C 3EJQA 4NQED 4BK5A 4N22A 2R2OA 3K91A 4US9A 1A9EB 4N2FA 5AVRB 1IUEA 1T1ZB 4KRPD 4YHIA 5JIQA 3T0EA 1QHOA 3UTSB 3TNMA 1IC0A 4JJOA 4PRIB 4ZUWA 3SD2A 1OAXH 2ZONA 4ZW6A 4RGOS 5D2LE 3AEBB 5E4EB 1B90A 5DO2C 2W1NA 3FKYA 1PG7W 4RISH 3WMSA 2Y07H 3LQAH 3CNKA 3GMLA 3X1GA 4A6YA 1Z9PA 1QTYT 4YHZH 4XRCB 3ARBD 2EO9A 1BJ1H 4HXAH 1AG6A 1KTKA 3TFKD 1KBWA 4NQCA 4GBXD 3U30A 4XCFL 2K6WA 1F56A 1E9PB 1O7VA 1T04B 4I77L 3TJHD 4MASA 4D9QD 2IPKD 4LIQL 5K1JA 1I8KB 1OPGL 3IKCA 3TBTB 4K8RL 3EZJB 2L3ZA 3NVZA 3WFCL 3SEBA 1X7TA 3ESLA 4JMXA 1XO8A 4KTEH 1T80A 3P2BA 1HX8A 5CSGA 4MBRA 4EKXA 1YMME 2C5DC 3E8UL 4LHUB 4XWOD 5D9SB 5EUOA 4L29B 4N4YB 1TN6A 3RFZC 1TPXC 2XN0A 4K7PY 2Z0UA 3U7WL 5KVGL 1BVOA 3OVUB 4U6VL 1WGRA 2WXFA 3ZXPA 4P99A 4J3BA 1T6BX 1VJSA 3C98A 1U33A 1CICA 2WD0A 3KE0A 3JWOH 4MCYB 3ZYMA 1R47A 2WNKA 4UIKH 4N9GA 4Z7VE 4BA0A 4YHYB 4Y7MA 2GB1A 2Z6FA 1BPOA 2KC0A 4XPGH 3MBXL 4XT1C 4Y19A 5E5UB 4Q9QH 1CFSA 3T9LA 2FX9H 1U6AL 1FRRA 3APNA 2VDQL 3BGFB 4JANB 2UUDH 5IFAH 2KN4A 1V1OA 3VFWA 2B3RA 3GIZL 4KNTA 1NEZA 1NCCH 4M8MA 3BVUA 3QYCA 3F7VB 4R26L 5H37G 4OI7A 1Q1JL 5SWSB 4I18C 5J56B 4ZX4A 5CHNA 1IAIM 1TT6A 1KXVC 5JQIB 4IW0A 3HMXA 4CVWA 1UACH 1UBIA 2CGYA 5C0AE 2KHAA 3ZUCA 2PP9A 5C0RL 3BWSA 3DYPA 1QA9A 2Y7SA 4G8IB 4PK1A 4L9DA 5BZDB 2MKLC 1MZYA 2V17L 4YGVA 1SFDA 4ANWA 3VD4A 5CBAB 3JZYA 2EELA 4PJ9C 4AS1A 3L1FA 4IGBD 3HXEA 5SX5K 3BRGC 4N3BA 2E3VA 5SV3A 2CU9A 3HG1B 3NJGA 3FOLB 4FDWA 1EAJA 2WVUA 3K1DA 2KHWB 4U05A 5IFJB 1ZS8A 3E6HA 4WTQA 2FJUB 4RFEB 4GG8B 4PDXA 1MREH 4X6EA 5DJZB 3NJTA 5ENQD 4EZJA 3GZ2A 2L0FA 1HQRB 2X2YA 4ZOCA 3O3DB 4W9ZA 3LY8A 2R23A 2KT7A 1HHGB 3FU9A 4GRWF 4GMSL 1HXYD 4TNVK 2BVQA 3BIID 2LEKA 4XCNA 4QRRE 1EIBA 1QMUA 5D1ZB 4LKXB 4NZDA 3GZOA 4AY5A 4GOCA 3MACH 1OZTG 4MZ3A 2DM7A 1NBYA 4G0NB 4P5MB 4BBNC 2JQZA 3AROA 4QHNB 1UUNA 4KTYA 3ZTCA 5CEZE 3KLQA 1J5OL 4GG6F 1NA0A 2A38A 3WHXA 1TJHH 3DOSB 2QADD 3CHSA 2Z91A 5BZWA 4BX9A 3UO1H 1OAJA 1WA1X 4QGTA 3ZLQC 3THMH 4TSSA 4YLQT 4HDOA 4QYAA 3SYPA 5CSZA 1IQRA 2INCC 4TOYH 4TKNA 1TQUA 3ALWA 3OV6A 1AOZA 2XVLA 4XOBA 1AQKL 3M88A 4U95D 5E8PB 3P4RB 2Y72A 1G7JB 3UTPD 2NY5L 4JO1L 3OAWA 2AEQL 4NO5A 4P57B 4HXBH 4AV0A 4TKWA 2D2OA 3ZL2A 2M0XA 4XNBA 2DYOA 5SWQB 3RY6A 3FUMA 2F58L 4KJQD 1MJUH 4FFZH 5C0IB 2AJSL 1WEJL 5F8QC 5F7FA 3RTLA 2B6CA 3ARBC 1AHWA 2K78A 5D1XE 5D7LA 1A3QA 3SGDI 3Q5TA 4JEGB 2MBQA 3TFKC 1Q94B 2B2XL 4WFGD 3F7YB 4JG9A 5HI3D 5HHQA 1MCEA 3TJHC 2BWIA 2B0OE 3MLZL 2KT6A 4PJ8A 1L2NA 3B7SA 1Z7JA 2VDPL 4YNYB 4JKPL 5FK9C 1R3IH 4M6AA 5EO1A 4QAWA 2PCPA 2UXFA 4MNQE 4YIQA 3VDZA 2H88B 1EEYB 3DGGA 2MWCA 2EUWA 4JM2F 4YHLL 3WXWH 4XWOC 2KDEB 3U2JA 2G60H 1EDQA 4LLVB 5HI1A 3DCGA 2XWTB 2IJGX 1PIFA 3MV8A 5HFYA 3UZEA 5K1VA 5CU5A 6PAZA 4GOSA 3BIAX 4OJAA 4LDOB 3WIHL 3WUWG 2CKNA 3M07A 2WWKO 4F7AA 1IV8A 1XB8A 2HRPH 3F04A 4LDLB 5J5EA 2OMXB 3QCAA 2HAZA 5FCUH 3SPCA 3QI9A 1I9JH 3L9EA 4ZPVB 4XNMB 3OKLB 4V1DA 5E75A 4BQ8A 4BFIA 3MP9A 3SPGA 15C8L 3O0RH 2B7DT 4LCIH 2KLCA 4K3JL 1YEGH 4JRYE 2IO1B 4P59L 3EFCA 4LAQH 3LXCA 2NPTA 3I3TB 1IGML 5T5NF 3ZU7B 1YC7A 3MCKB 2UU7A 1BZOA 4E74A 3TEXA 3GD1C 2AWIA 4R4ND 4Z1PA 3EGSB 1MAML 2ZOLB 4FFYH 1P53A 2DZEA 3FO1A 1VSCA 1D6EA 1RURH 2BFVH 3LV3B 2V2XB 3HK0A 3VD1A 1JZEA 2B5IC 3EH5B 1AXIB 5EUKB 4AH2B 3CFEB 3QWRD 4RNAA 2AP2A 2N4IA 4HCPB 1SYVB 5IB1A 1P4BL 1ZA3B 3GPSA 1G5GA 2K70A 4RGMB 1TZ8A 1E0OB 4IGBC 2QSCH 4XNZB 1NOFA 4TLUA 4HRNA 5LLIA 2IZVB 4P9ML 4IKLA 2PTTB 1N4QA 5E8EB 4JQIH 3C2AH 4L1TA 4AKQA 2FEDD 3DHHC 1OF2A 4YN3A 1WFTA 4UT9A 1X5IA 5TE7L 1OQYA 2X3CA 1LILA 1KZPA 2FWOB 1EYHA 2DF3A 1YVLA 3SKJH 2FYVA 1WT5A 4HSCX 4BCZA 4D0BA 1M1SA 5F9OH 3TJPA 4DKEH 1QTPA 5I73B 2BKFA 5AL0A 4QXTA 1LE5B 3SE6A 3GHBH 3T6XA 3QUKA 1MVKA 4GRLD 2MH7A 2NYJA 3MODL 1K2DB 2JJUA 4HHWA 4JO4L 4M9PA 4LE8A 4QKTA 4C56A 3BKYL 3FQNB 4I0PD 2WXGA 1FQ9C 4I48A 4E9LA 4MSWB 1L0QA 5BV7H 3FQTA 2DLTA 2XFGB 2ZPYA 5JLZB 1FMAD 4MMZB 1MHXA 5KSAA 5I6XB 3CU7A 4JY4B 3GC3A 2SEBD 3U36A 2K45A 5C0CD 2QADC 5EDXA 4PS4L 3CSPA 2YNQA 2Y7OA 4PLKD 3T2LA 2KX3A 4Y16C 3BZEA 1A3RL 2VGXB 1I8LA 1C5BH 2QDFA 4E42A 4YE0A 2ED7A 3G5ZA 1IC4L 2OR9L 4AUYA 3ULVF 1MWAL 2EKJA 1ZANH 2RDBC 4HIHB 5DEFB 1CBVH 1T2JA 2WLLA 5ANMB 3BUPA 4RAVA 5CP3H 4LSUL 4ELKA 1PZ5B 1VZ6A 3AY4A 1S64A 2OTPA 3MLWL 4YLCA 5HDQL 2XWJA 3NOCD 1T5WA 4P3DB 3BVZA 2XUWA 2IG2L 2BWDA 4WJOA 4KJQC 2V5TA 1F6AA 2AQ3A 5DTFB 5KZCB 4NRHB 4JLCA 4O2FB 5E1GA 5LUMA 2J53A 3QUYD 2GBTA 3PQYD 3T0BA 4N6RA 4D0CB 3V4VB 1U8QB 2CKBA 5I0DA 2WVIA 2O5YH 5K59F 4OLYH 2JIXB 5BRZE 3MBWA 4OF0A 4JFSA 2QZAA 3D8MA 4NGHL 2JY6A 3CFCH 5ENSD 2EDTA 2G9HD 2C1OB 3JQ0A 3N9YC 1D5ZC 1JWAD 1XGQB 2QILA 3FZUD 3NSFA 4HWIB 1GGIL 2EIKE 1V49A 3LCAA 4IHBA 1GS7A 1D5IH 2NY1B 4PRHB 5BO1L 3QC1A 3UM3A 1OP9A 3QJHB 3VGHA 2KWVB 1BVLB 1R5WA 4NKMB 2OSYA 3VU2A 4RF1A 4XTRD 5M94B 3SCMB 1RVFH 1I1AA 2H5UA 4NFBA 1UWXH 2BNUB 5MERA 1YEHH 1PX3A 2BB6A 4C0EA 1YD8U 1Q90A 3DTUB 3WAPA 5EBMB 2GT9A 2WB2A 2HWZL 2AJAA 1ZHNB 3N85L 3BEVA 1KULA 1OF0A 5SWZE 2L4OA 3PDGA 3SBTB 2ILRA 2YS4A 5DZOA 1VFBA 3BT2L 3NJJA 4ZRPA 5BXOA 2OMZA 4FQHA 3ONLA 2PR9A 2Q7YA 5F6HI 3ZDYE 4NJ6A 2LVQA 3MRHA 4F2FA 2CHZA 4D8OA 3O4LB 3A9JB 1CLYH 4R4NC 1U3JA 3VI4B 3HG0D 1CGSL 4MWFA 2Y06H 1P7QB 3B2UD 5DD5H 2XN9C 2K7PA 5FKAA 5I8CA 3EHRA 3Q05A 3JTTA 1NPNA 4TVPD 4XO5A 2J8HA 4JGHB 1K85A 4E68A 1DE4B 2WTRB 4EPZA 2M83A 1T89A 5AQBA 2NY6D 4UT6L 1UJJA 5FXCH 4BFNA 4GW5A 1MHPH 4HS6A 4RWYL 2KACA 5BUZA 1GC1L 1BLNB 4OJCA 1XH0A 1L5GA 4JDZA 4YZFF 4JFEA 4PJXB 5LX8A 5CEXA 4J3VA 1FP5A 3ZZSA 5EBWB 5F1NA 4IU3B 5I66B 3EJSA 1G6RL 5DYFA 3TG5A 3VLEA 1ONQB 1X44A 1HIML 4I5BA 3AS4A 1NGWB 5CINH 5FM5O 2Y3AA 2Z1PA 1Q9LB 4DK3A 4U1SB 3MR9A 5ACZA 2H6OA 3IMBA 2ALWA 3EJRA 3PHSA 3W5VB 3SU8X 1UJ3A 5KVFE 2HTHA 1ANUA 3AE8B 4ERSL 5E5MA 3W9EB 3QO0B 2INDC 2ADIB 4GFXA 3MLTA 3LS8A 4J8RB 1I35A 3AS5A 4GCOA 2EC8A 5DLLA 2TAAA 4KMTL 1WZ1H 1QRNB 4JRXA 2NNFA 1RRBA 5JHLH 1OW0C 1URLA 1CLOH 3GMRB 4RMQA 4PLKC 1IB5A 1WJ3A 5F88B 2DEYX 4U1HB 5G5DA 1M4VA 4JHZA 1PDXA 3B9KB 3KEDA 2BKRB 4HEME 2Q7NA 4OV5B 3S5YA 3CLJA 1P5UA 2EO7A 1S7TB 4HI9A 1G7MA 1MW1A 1PZBA 4UQEA 5DK2A 1XGTB 2MBOA 3RDTA 5KYNA 1SF3A 3SI5A 3FN3A 1CTNA 1DZBA 1K5NB 2BXYA 3OXRB 5I8EB 4YBQD 2IXQB 1RHFA 4LCWB 4PRBA 2VGYA 1K1BA 1HH6A 4OGQC 5F6HJ 4WIPA 4IOFC 3P4NA 1L7YA 4FG2A 5MEQA 2CHNA 2F54E 3AXIA 3MFFB 2KI6A 2I5YH 2V6HA 4QCIB 4UBDC 4TNWF 5DZ9A 5AG9A 5CHWA 3VFTB 4YDNA 2VR4A 1DSYA 4PJAA 2R69L 3QUYC 4O58H 2IWEA 4NLAA 1INEH 4J3OD 4LFHD 4LRNL 5D93B 3T0ED 4NLHA 5G4OA 1EZVX 2M0AA 3BUQA 4JRWA 1G1CA 4MA8H 4OT1H 4B9GA 1MI0A 4QFVA 3QORB 5DZLA 2NSXA 3T4AC 4YBLC 1FLTX 5IB5B 1V1PB 1NZRA 3NA9H 4PLNC 1YUHA 1KB5A 1OAXL 1I7TB 3N40P 1EDHA 1TGZB 1R46A 2W0FA 3X3GH 4BE6A 2CM6A 1HWHB 2A9DA 4RISL 1JCRA 3PZDA 4NQCD 3ZE2B 2Y07L 3LQAL 1A6VH 3ZK0A 4EUTA 2P7TA 4L5FE 4AYFB 4ECNA 1XHHA 1FL3B 2NUTB 4OZFB 1QSFB 3M7OA 4QLRA 4YHZL 3EU5A 4HXAL 5CD3A 1FH5H 1LEGA 1XXDC 4GS7C 4Z7WA 3WAJA 4RGNA 3MROB 2LASA 4ZUSB 2F1EA 3QNYB 4LSQH 4OAVB 3PWJB 5DT1H 1FXAA 3CQCB 3NAAH 4MQ7A 5DUMH 1DEEB 1MIEH 3IHYA 1J87A 1SE9A 2BW2A 5T3XH 5L8JB 2NOYA 4MAYB 3US0A 1NSNH 2FX7H 2WBKA 4KTEL 1SVBA 2VQTA 3NQIA 4ES9A 2ID5A 3KM2A 2A73A 4DI4A 1FVDB 2JKRM 4WU7A 5GS1A 2FCNA 2P45B 4JFFE 1WM5A 3UGEA 3ZL1A 1JZDC 3VWJA 1CICD 3B7BA 1JPTH 3EHQA 3Q5OA 3VFMB 3I75A 1O9VA 3D9HA 4KRNA 3B2UC 2DKSA 1TO5A 5EIIB 3O4ZA 3JWOL 5KBPA 4GAYA 4UIKL 4DERA 3FB5A 4KDWA 4Y19D 3CV5A 2AEWA 2VDLB 4NRXA 2R27A 3JWNE 5KJMA 1KB9K 1NOAA 2MIZA 3FFDA 5HVHB 4XPGL 2GLSA 4WK4B 1C8QA 1CT8B 2GJPA 2YRBA 3GBEA 4Q9QL 1F3RB 1OUVA 2FX9L 1OSZB 1EAPB 1CDYA 1U3HD 1ZB1A 5IFAL 5GQBA 5JIPA 5J2RA 2MQ3A 2ENQA 1NCCL 5EIDA 1U42A 1WZAA 1MCRA 2WVTA 3HE6B 4OD2A 3HA0A 4U4IA 4TSBH 4YDIH 4LERA 2C2LA 4I6LB 1N59B 1Q9OB 5FKPA 3HHRB 3QCTH 3SKOA 4IBZA 1UACL 3KNBA 4FMKA 5F96H 1WXMA 5KVDE 1WA0X 1T1YB 3MEKA 4NNYA 4UDUB 2ZXQA 2JU6X 3AMZA 5T1KA 2CJTA 1QO3B 3NQPA 9CGTA 4DP9X 1QR1A 4OYSA 1D8EA 4NHUB 4WQOA 4CL7A 4OZIF 7FABH 4PJGF 2DBAA 3RSEG 1FL6A 1Q4NX 2VKWA 2KLGA 3WXXA 2VABA 3QR2A 2YA2A 4Q8BA 2W88A 4QOKE 3CVHA 1B3JA 4Z7UE 3UH8A 4HIQA 2CBQA 1N0XH 5EFIA 3WE6B 4QHPA 1S8DB 4XVSH 3HVEA 3VGDA 3TBVB 2VZ1A 5F7DB 1MREL 4TL5A 4NHCH 2DWYA 1F18A 3FRUB 4QO1B 4XHQA 5CM1A 1LTXA 3FOMB 4G5ZH 4IIQB 3V4PB 1MI5A 5CJQH 1IGFH 4YX2H 7TAAA 3KCWA 2ZX9A 4M62H 1FA4A 3LKQB 4UOQA 2OJEA 1E6EB 4YO0A 1U0QA 3L3HA 5BUAA 3FU0A 5EO9B 4BTBA 2NX5B 2G2NA 3RKVA 2UZIH 4O51A 3U0PA 1N63A 2Y0SA 3EUVA 1HOEA 4FXKB 2GRIA 2R0LH 4W4OC 4I17A 1O1TA 4ODWB 2IH1B 1QFWI 5EN3A 5FUCC 3V9FA 3D39A 2YD5A 1UZ8A 3MACL 3EBGA 2PNNA 3KPRE 1HZLA 3FILA 3PAYA 4I88A 3V5KB 5LJYH 2YXMA 4LLWB 4UQDA 1DDTA 1VHPA 3C8KB 5C0JA 1TJHL 2FIKA 2YIHA 3Q8FA 3UO1L 3MRMB 3THML 2ARJA 1QX1A 2YOCA 1OHZA 3F7RA 3N40F 2XIDA 3NT0A 4J3OC 4TOYL 1R5VA 3GRGA 3T0EC 1HEZB 2L83A 4WWPA 1CGVA 3E38A 2BC4B 2R0ZH 3GSOA 2WXPA 3NABH 3RKDC 1WZMA 5ALCH 1RWSA 1L9OA 1FLRH 1KLUA 1NC2A 3HN5A 3BFOA 2LRUA 2BHFA 4HXBL 5D7LD 2YZ8A 3LZFH 5AAMA 5DEGA 3SO8A 1UF0A 2PXYC 3CSGA 3U30C 3DV4A 3UMTA 2AZAA 1MJUL 3PGFH 4FFZL 3V6ZB 3VFKA 2VYIA 4PJ8D 4MH8A 3DYOA 3HI1A 3PL6B 2A6DA 2R1WB 5BQ7B 4REZA 4OZGA 2Q8AH 4F3FB 4CSZA 3V0WH 5IQOA 3H9SB 1S5HB 3ZKQD 5IJVA 3TCXA 3ZZ1A 5L2KE 4JDVA 1I7ZB 3DX9B 4UQ3B 4JO8A 3W81A 1R3IL 1MNNA 2M56B 3FRPB 4NT6A 4DJMA 2NPLX 4AYGA 3AEAB 4H7YA 2EUZA 4JPSA 1HHKA 1KCSH 3BD3A 2DMBA 3MV8D 4MGYE 5AUMB 4GTRA 2VH2A 2F8OA 2GAZB 3WXWL 4GDLA 1HCVA 1RZGB 2AANA 3MRGB 4YHKH 1HVXA 5DCCA 3KH0A 4BWUA 2G60L 4AMXA 4J1UB 4JY6B 4GSDH 1OP5K 3V5DB 3CN1A 4FU3A 4H26B 1GOGA 3QI9D 1MYOA 2OTWA 4V1DD 5B1JA 5E6IB 3WFDH 2HRPL 4GUOA 4G3XB 4KV5F 3OR7A 3IFOB 4HA1A 1F0LA 2G3MA 4EN2A 2DIWA 1U30A 5GSRB 5F0MB 1BZ7B 5FCUL 5GRUH 1PD0A 1I9JL 2X4TB 4BINA 4N8VG 4ZTEA 4J2XA 1JPGA 3O0RL 4YVNA 1T03H 3FL7A 5BUGA 2IIJA 2CFZA 3CXFA 4LCIL 2XRYA 1KRHA 3CFBB 4Y5VB 1YEGL 4HRLA 1U3HC 4OUUB 3D09A 4LAQL 4F7CA 1AH1A 1XGZA 1CCZA 5E1AB 3IM1A 4XCCH 2PPDA 1NGYB 1EWYC 4N86A 1E4KA 4KVCH 1J5DA 5D1XC 4E9SA 1S7QB 5JMRA 3PZ4A 4FFYL 3G08A 4H8WC 2DWSA 1MY5A 3CC1A 3RP1A 3FT2B 3T1FB 2BFVL 1RURL 3VXRA 4E5XB 3V0GA 3I6GA 2J73A 3RPIA 3UIOB 2MJWA 3II3A 4R9HA 5IIEA 1CURA 3EJPA 3NK3A 2JB6A 4HHGA 1FAKT 4HKBB 3NN8A 3JW0X 2XRZA 1RZ8A 4AEFA 4NCC2 2QSCL 4QY8B 1AGFB 4Q96A 2YQ2A 3QS3A 4A04A 4CVZA 5GIRA 2O6DA 3AWGA 4JQIL 1SOSA 1A6ZA 3C2AL 1PZAA 2WQUA 3G6JA 3TONA 4PIBA 3T04D 1RJYB 1CQVA 2YGOA 2AL6A 3IWUA 2K1MA 3WY4A 2FZ3A 4ELMB 4LSVH 3PRZA 3T2NH 1PDKA 4JMNA 1SZNA 5D72H 4YSXB 3VI3F 3SKJL 1P84J 2AV7B 4ZQKA 5F2FA 4ZMPA 1I1FA 1UD2A 4P4KD 3S36X 4C56D 4N25A 1HKLH 5F9OL 4DKEL 2JFCA 1Y0LA 3II1A 2BYVE 3L10B 1N5YH 2VQ2A 4WHYH 3AB5A 5JOFB 3GMPA 4FYRA 2ZVOA 3QDGE 4JWUC 3U46B 4Q7DA 3OX8B 3R9MA 2FSEB 5KSAD 3TWRA 1PKQA 5D4HA 3ZTCC 1WUNT 4G71B 5BV7L 3O3EB 4Q4IA 3AEEB 2LSUA 5FR3A 1KSRA 1H6PA 2QR0A 5J1AB 1NEKB 3ZKXC 2R2HB 3OC8A 5DD6B 2IH3A 3ZMNA 3V0EA 5C2YA 3ULSA 4DLQA 2L8AA 3HIZA 3NEXA 2CFUA 5F89A 1EF5A 1CFTA 2VGEA 4OZBA 1MFDH 3PE4A 4R97C 2BS4B 4NQXB 1C5BL 4YFDB 1TPXB 4CNIA 3RFZB 3A4SC 5G5GA 1IAMA 1ZANL 4AW4A 2G3NA 3GXDA 1CBVL 5AYWD 4WGWB 4HKQA 2Y4UA 3BP4B 4DPRA 4X9IA 4UZSA 1QVOB 4I8DA 2ICWA 3BP5A 3QQ3A 1YN3A 2KC2A 3FUKA 4FTVB 1AGBA 3FCTA 4HCRH 1P69B 3Q14C 2OMWB 2JRIB 3BJ91 1J86A 3IVKA 1AKJA 3I4RB 1SE2A 5KN5A 4OQTA 4WJ5A 2MJDA 3PE3A 4HC1A 3DQVA 2W9LA 4M8UA 2E7BA 3FUIA 4G8GB 4HPHA 3EYOA 4UQXA 3WFZA 3RVXC 2QZQA 2FJGA 3L4UA 2O5YL 5HVFB 1G7LA 1PFDA 4OLYL 4HVBA 2WNXA 3ESUF 5IF0A 2N1WA 3MA7B 4IIZA 2CHXA 1JD9A 3CFCL 3QS2A 3GJFB 1FRGH 2BS3B 1CK1A 1UURA 1CQKA 1NOLA 5GGTH 4GKZA 2WXKA 5IAAC 1ASPA 4HQQH 1ZGLA 3MXWH 1I1AD 2UV3A 1D5IL 3E8VA 3QEUA 3RNFC 1KPUB 1BD2B 3IGUA 1OCZE 3M45A 3QI9C 1UC6A 3HS0C 4Y4HB 4PJ9B 1MJDA 2YLHA 4JN2A 2BVPA 4KMQA 1RVFL 4MT5A 5EBLA 3NBNA 2D3VA 1YEHL 5IMMB 1S9VA 4K94H 3A21A 2K25A 4Y2LA 1IVLA 1H8LA 5JTWA 1AP7A 3FBQA 4JVWA 2OMTB 3MDJA 2H32B 3OKKB 4GEJA 3F7KA 3ESNA 5F0LB 3IU3B 2RPQA 4DHJD 1E9OA 4I87A 4PREA 3RY4A 1OGAA 4FLOA 3OKOB 4MZ2A 1FNSH 1ZA6A 3DRTB 5ICYB 2FUQA 2WKOA 3VWKC 2JLLA 4MJ5A 4HNAD 2DYPB 3RWFA 5J1TC 5IR1B 1T0PB 4O02H 1CLYL 5K9JL 2VZSA 5HDBE 3V0FA 2Y06L 5DD5L 4LCTA 1OWPA 4E6HA 2JJSA 3SDDB 5E2TH 3N91A 1BZDA 1E5AA 5IQNA 3GB1A 3L3GA 1DJZA 4CN6A 3L5HA 4X8QA 5LLIC 2DAFA 1E7PB 3OM3B 5BT1A 4CGUB 1TETH 4NWTH 2XBTA 1PW3A 2C0LA 1DQQB 1MHPL 5GS2D 4AVHA 1WDAA 2AAVA 5FA4A 4E9VA 1AQ8A 4JX1C 1A7NH 3IGAB 1BQHG 2RB8A 4RMWA 4TQ0A 3GSVA 3IDMB 1KCKA 1Y8MA 4LOUC 1I8AA 4NKDB 2UWEA 5KYXB 4NQEB 1U8KB 1WT5C 1NCJA 3SY0B 3CVLA 3ZIYA 4QI3A 4KRPB 4ZRQA 2FT6A 6FABH 2P9IG 4L4TE 3PWUA 5CGMA 3NFNA 1TZ1A 3T3MB 4OU3A 4P4KC 4ZO8A 5EN2B 1HILA 4JX0A 4X6DE 4C56C 3U0TB 1JV2B 2DJ4A 4JKNA 4U0QB 4GXBA 1XH3B 5F7LB 2IV8A 1WC7B 3E80A 3ARBB 5KSAC 1H6KA 4JRXD 1XQ4A 1S7UB 2YD7A 4JZJC 4GBXB 4XPTH 1ZLUH 4HCNB 2E7LA 1X5LA 3CVWA 2KDYA 2IPKB 5ARFA 1WZ1L 5KSBE 4LLQB 4PVBA 5JHLL 1RSYA 1CLOL 4LLAA 5C1MB 5E9NA 1JRPA 3K9PB 4B8CB 1ODAA 3LKSA 3P1MA 3RDTD 1MCFA 4WNDA 2KBGA 1A1OA 1L4DB 2HJLB 2XN2A 4N2IA 1JUFA 2J8UF 5LCWJ 3B9JA 2IOMA 3MOBH 1P6WA 2MX2A 2ZD0A 3EBAA 1C4CA 4UIMB 4CRPA 2V9QA 3UBXG 3C6SB 3V5HB 1XGUB 1EJ6A 4PH8A 3OTNA 4XAKE 3T0DA 4LSTH 3IHPC 4WI8A 3V2AR 4RNRA 2I5YL 2HLAA 2NQCA 2CALA 4A3VA 2VDRB 2WKLA 4R96B 1R7SA 5KW9H 3U7DA 1UM5H 4FNUA 3ZHFA 1A7RH 3SOTA 5F7UA 2Z1KA 3CZFB 4ONGH 3TEYA 5HP5A 1T66C 4O58L 3H8NA 1INEL 5IQ7H 2BNQA 5AB2A 2H3KA 1P7KA 4HD9A 1VKXB 4OT1L 4G11A 1BOGB 1PLCA 4MA8L 4WI9A 3IAGC 1A6TA 2VE6A 2H0EA 1D2OA 1YPZA 1KJMA 3V0HA 3NA9L 3Q75A 1ZVHA 2H2SD 1EHLH 2J6EH 2ZZUT 4HBCH 4U1MA 1AIZA 4X8GA 2KC7A 1S9XB 3MUJA 3X3GL 2Z7UA 1QILA 2PWGA 1S3SG 1JIBA 4RGND 4U1LA 5C0ND 1YQ2A 4N1CA 1A6VL 2R2BB 4FCHA 43C9A 4J0UA 2HT3C 2N9LA 1ITCA 5HJGA 4Y9GA 4XP6H 4IGBB 1MHEB 1FH5L 4BSVB 5C70A 5IKCB 4LSQL 3QIBC 5DT1L 3NAAL 5DUML 3L48A 4GQZA 1JXJA 1SSNA 1MIEL 1SMDA 5DK0A 4HJ1A 5T3XL 2WVVA 4A2EA 4Z3EA 1Q1OA 5D7KE 5CEYB 1PY0A 2DMGA 1NSNL 2FX7L 1E2ZA 3C87A 3PV6B 1I53A 4JHBA 4NN7B 3V4UH 4Z3JA 2YC1B 5EU4A 1SJEA 4L4VE 4DFHA 3AE5B 4X9HA 4NERA 4JGMA 5C0FA 1BREA 2X05A 2MA9B 1JPTL 2W60A 4XXDA 3W5UB 2VAAA 2V5SA 1TCRA 1TJXA 1G7QB 3CXDH 2F61A 4CSPA 3T2QA 3ULUD 3P4QB 1T1WA 3ATEA 4HJGB 1CN4A 4GMJA 3LS5H 3DSNA 4LF3A 1T89C 4O4YH 3SGDH 1FHNA 1KEGH 4C80A 4GI6A 3CC5B 3DTXA 4LNOA 4DIXA 5EC2B 3OJ4B 5HGHA 4P9HH 5EC1B 4L5FH 2P43B 3HZMA 1PG7X 2ZE0A 1PZDA 4HOTA 3VRIB 1AVAA 2QADB 2Z59B 3RRNB 5F7MC 5I1IH 4G2AA 1F77A 4KK6C 2CA4A 1GYCA 2P5EA 1KWKA 4URKA 1ITBB 3BZ4A 5F3HB 4YDIL 2X5PA 4TSBL 4IN3B 1B0WA 2IALA 2O5ZH 1UKSA 2E7HA 3QCTL 3CVVA 1LO2H 5T1KD 4WFEE 1B0IA 3UTOA 2R9HD 1H3XA 2NW2B 5F96L 1NINA 2H41A 2CLZA 3ILQD 4HJ0D 3T2OA 5I8KH 3VFOB 2J20A 4DLOA 2B59B 4JY5H 5I1KH 4ONHB 4PJDE 1JD7A 1FNFA 1YNKL 2X3BA 4LGSB 3TGOA 4K5PA 7FABL 1YNTF 2ADFH 2HJFA 3F2LA 4P5SA 1N6ZA 5IHWA 5JO5A 2LI5A 1YYLH 2OYKA