4XE0A

Idelalisib bound to the p110 subunit of pi3k delta
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
917
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural, Biochemical, and Biophysical Characterization of Idelalisib Binding to Phosphoinositide 3-Kinase delta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
total genus 263
structure length 815
sequence length 917
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4xe0A05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xe0A01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4xe0A03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xe0A02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4xe0A04
1E90A 2WXNA 1DJHA 3APDA 2X6IA 2CM5A 2DMGA 4Y1SA 4DK5A 4URKA 1RH8A 4L1BA 1DJWA 1TJXA 2N1TE 1UGKA 4QAMB 4Y1TA 4BFRA 5JHAA 3PRZA 1CJYA 2X6HA 2X6JA 2B3RA 2WXPA 1E7UA 4ANWA 3PFQA 4ANVA 3LJ3A 2Q0ZX 2R83A 3JZYA 4WEEA 1WFMA 4FHJA 2QZQA 3PREA 2CHDA 1HE8A 3QK0A 1UOVA 3DPDA 4G11A 2CM6A 2WXMA 1DJXA 5ENNA 1YRKA 2NCEA 4OVVA 4AOFA 2WXRA 3IBEA 2CHXA 4FULA 4PS3A 1W15A 4QJ4B 3L54A 2WXLA 3DBSA 3B7YA 3F00A 3M7FB 3N5AA 3L13A 4FADA 5CCGE 4UWGA 2WXHA 3ML9A 3FDWA 3IM1A 4EZKA 4FJYA 4AJWA 4NP9A 2X38A 4UWFA 3L4CA 3RPBA 4XX5A 1K5WA 1DSYA 2NSQA 3L08A 4UWKA 1DJZA 1W16A 3TJPA 4FHKA 3SD5A 4WWPA 3OHMB 4UWLA 4V11A 3R7QA 4GNKB 4LT7A 3MJWA 5H4ZA 4WWNA 4KZCA 4FJZA 5H4YA 2BWQA 2ENJA 3ZVVA 3R7RA 2FJUB 2WXOA 2WXJA 1DJYA 4IQHA 4TS6A 4HLEA 4PS8A 4QJ5B 5EDSA 2WXKA 3APCA 4F93B 4A55A 4LCVA 3ML8A 1A25A 4OYSA 3QJZA 3F04A 4JPSA 2Y3AA 2RD0A 2K4AA 3OAWA 4HVBA 2K45A 4PH4B 3KWTA 3NZSA 5CCHE 3W57A 3QAQA 5ANLA 2CJSA 2Z0UA 3CSTA 4TV3A 2YOAA 4QJ3B 4EZJA 2EP6A 3RDJA 2A5UA 1V27A 4ICWA 2ISDA 4F1SA 4EZLA 3HIZA 4GB9A 4IHBA 3TL5A 1RSYA 2WXQA 4PS7A 4NS0A 1GMIA 4FA6A 4NPJA 2CHWA 4J6IA 1BDYA 2K8MA 2WXGA 2YRBA 3L16A 3L17A 4XE0A 3ZW3A 4L1LA 1DJGA 3W56A 3P2BA 5G55A 1CJAA 5T8IA 2DMHA 4ANXA 2K3HA 3NZUA 3KWUA 2V4LA 4WWOA 2X6FA 2FK9A 3IHYA 3CSFA 2LHAA 4UWHA 2ZKMX 3S2AA 3F05A 3PYCA 4ICXA 4BGDA 2ENQA 1E8YA 3NSJA 2X6KA 3HN8A 1QATA 1E8XA 5JHBA 4F92B 1E8WA 4OVUA 4KZ0A 4TUUA 4FLHA 2QZ5A 2WXIA 5CCJA 4NPKA 1WFJA 4KITB 3APFA 4MJJA 2NQ3A 3TWYA 4DNLA 2D8KA 3QR1A 4F91B 2I9CA 1TJMA 2Q3XA 3PS6A 1DQVA 2CJTA 3QR0A 2UZPA 5KJ7E 3ENEA 3HHMA 1RLWA 2CHZA 3QARA 4LDCA 2ENPA 2KI6A 1BYNA 1E8ZA 1DJIA 3ZIMA 4L23A 3LS8A 4XZ4A 1E7VA 3T8MA 4L2YA 3GPEA 1UOWA 2WXFA 1BCIA 2A4ZA 4ANUA 4WAFA 3FBKA 2JQZA 1QASA 3L9BA 5G2NA 3F01A
chains in the Genus database with same CATH superfamily
5JMND 1UD5A 2W59A 2WOYA 5F3HB 4BJLA 1TZOA 2ZX8A 5BW7C 2HH0L 3QNFA 3AADB 4ZTOH 4FN2A 1FO4A 1U8HA 5DEJA 1ZSHA 1UGKA 2OL3H 3MRNB 4GYOA 3L5XH 1AG0A 1XIWD 3CN0A 4GQ9H 4H2CA 2N7EA 3WIIH 4W9DA 1SYSB 1CPUA 3BGFC 4DHJD 3N55A 1YJDL 3CX2A 3P9MA 2W9LA 1HNGA 3PSEB 4RFNC 1LO4H 2NCEA 1OAYH 3D2UA 3MNWA 3OKKB 5ENNA 3RIBA 4P23B 3G6JE 3CHOA 3UO1H 3C6SA 5DMIH 4C56E 1LD8A 5KZCB 5HGBA 1DYQA 2FSEA 4U1LA 2LQRA 3S4SG 1PBYA 4UDUB 5ESQB 2HJ1A 4XOAA 4C56A 1DQDL 2E3VA 1EFXB 3UGEA 3QIBD 1JZGA 1IAIH 3P2DA 3WKMH 3UT4A 1QKZH 4GH7B 2VN4A 4YDYA 4FXTA 5IBUB 3V4PB 1NBZA 1TGZB 1BHGA 1N0LB 4H7YA 1N7ML 3BP4A 3L3JB 2DLTA 2FJFA 3D9NA 4WFGE 4K4KA 2NBUA 4JDZB 3LH8A 1EFXD 5F9OH 3V6FB 3TWCH 1NIEA 1UXWB 2VERN 5BZWB 2BWQA 1BOGA 2KMAA 5KVFE 2GITA 4N25A 3VLDA 1PIFA 1U95A 4ZDHA 1YMME 1A47A 4QRFA 4YX2H 4YHIA 1NCUA 3SI5A 4GBXD 4A55A 1GL4B 3EH5B 2EMSA 4ILIA 2W9EL 3LEXB 4HDIA 1KCUL 4HZLB 4ERSH 4DQOL 1OE3A 2BO0A 2HKHL 2P8PB 1MW2A 4HLLA 5DBKA 3O6MH 2IG2H 5C9JB 1JUFB 4TNWF 4XNYL 5FK9A 5HYJA 1DANU 1XH3B 1T80A 3EZJB 3TL5A 1NANH 5F1SA 5JHLH 4JA9A 5D1ZD 4X4KA 4KWUA 3ZYZA 5EUOB 4C56D 4XBEH 5IHUH 4E9SA 5IB3B 1DJGA 2VW7A 1NI1A 1CGVA 3T65B 5T8IA 2GKIA 1AGEB 2AFNA 4OI9A 4JR9L 5IQ9A 3T4YA 2YD6A 2GW5A 4G1EB 4WWOA 2JIXB 4J3VA 4AG4L 1KLUB 3ISMC 5B3JE 1E4WL 4RQIA 1BEYH 1MOEA 2WLJA 1KTDB 2F68X 4HJSA 4N6RB 3V8CA 3BMVA 3BVTA 2X6KA 1SJVA 3H7PA 1QRND 2EADA 4WFGD 1S5IH 1Y6NR 2NW3A 2AK1H 5E8OB 1UNSA 2MOWA 2HN7A 4GP5B 4ZMQA 5AEAA 4YT0B 2R2CA 3QJTB 2WV3A 4KI5E 4BUQA 5CKGA 3TFKC 4WI5A 2HLEB 2EDRA 2E4TA 2NUPA 4LMQE 1FGNL 4ELKB 5F1NA 5I6OA 4M62L 1CD1A 3CVWA 4LXFA 2CDEA 2WQAA 4XDCA 3TWUA 1JGDB 3H9SE 1E10A 3CE1A 3K6OA 4O1OA 2NY2B 5CCMA 4L0YA 1Z5LB 43CAB 3ZBMA 2D7MA 1FRRA 3EJYD 3HCVA 4PR5A 4WHDA 4YDLC 4UNVA 5JYMA 2I60L 3FU6A 4JFED 2ZXDA 3LZFL 4I4WA 1XMEB 5FCUL 2GBAA 3N44F 5EBMA 2CKBL 2YAEA 1U92A 4ILDA 4LNFA 3M62B 3GI8H 1MNUH 2PO6B 2P9IG 1U42A 2WMPB 3NG0A 5I5MA 1S7VB 2W60B 1K2DA 1H8OA 2WVUA 1XCTA 2V3PA 1WHOA 4BVUC 1FPTH 4U07A 3FSAA 3O0LA 3RWEB 1T21B 4BCYA 3CFIC 3TIDA 5KSUB 1E40A 3IBEA 3VVWA 2X4RA 5CZXD 4KKJA 1W15A 2IONA 2C3HA 3TC9A 3F6IA 4HRMB 3LPPA 4UZGA 1W2KT 1XD1A 2YAQA 1JIBA 5B4MC 4AQZA 3VXUD 3GZSA 2VO5A 4HWIB 2Y0SA 4Z3IA 2BNQA 2C7NB 1WFIA 4B5EA 4S11A 5FR3A 3PUKA 2L7QA 2MCAA 2HVBA 3I2CH 3QEQB 2DAJA 3VB8A 5D6CB 4JFDB 3VTXA 3T3PE 4A6YA 1M53A 1YYMH 4XN2A 5DFTA 1RMFL 4A7QA 3DVNV 3RI7C 3BISA 5LCWC 4JN2A 1PJWA 1NCAL 1KN4H 3MCLL 4ZBJA 3ZZQA 4L1HA 2Q6WA 2ZSVB 2I32A 3ZEFA 5CIPA 3EECA 1I1CA 3DPBA 2IH9A 5L2KE 3HN3A 1L6XA 1AZVA 4JPSA 1DQTA 2C4FU 3B9KC 5D1QE 1ECYA 3OTTA 2INDC 5LO7A 5TGBB 3VX0A 1MQSA 1J19A 1I9RH 5IEHA 3FMGH 2HG5A 2GBJA 1XTLA 4BKLA 5C2UB 4IHBA 1JZ3A 3ZDXB 1E0ZA 2Y2TA 3MCYA 4ZODA 1QHQA 2J8UF 3L8QA 4ZPVB 3VE0B 4HCPB 4PJAB 4UQDA 2WVIA 4P57B 3L4XA 4NKOB 3B1TA 1QBBA 1RL1A 3ZHEA 1YQ2A 4Y16A 5FKPA 3P2BA 4Z7OE 3BDXA 4JIOU 3GXFA 3VH3B 1ND0B 4JG9A 5H2BB 5BUGA 4P46C 2EDQA 2FYYA 4P59H 5I17A 5I71C 5C1ZA 3PE3A 1KG0B 4JHZA 4FQ2H 3AG3E 4XWGH 4XMTA 2OCJA 1WWCA 3C72A 1T83C 2BLFA 3PQYE 3RD2A 4LHQB 4Y19B 3SB3A 1WAPA 3UO1L 4Z7WE 4JKLA 3IAM1 4ZRJA 2VXQA 4Y4HB 4KZDH 1JPSH 5E08H 1G9MC 3JXAA 3JWDH 1F1HA 2EDKA 4MD4A 3WOVA 4OLWL 1J9TA 3LNEA 1RAXA 1OWPA 4E0RA 1FP5A 2Y36H 5FOBB 1DQVA 3MZTA 4ZQKA 1D4BA 1OWWA 5JXAH 3RDTB 4KROD 1GGCL 5C07D 1CGUA 4N1HB 4CSPA 3NN8A 2V5YA 1T20B 3HBZA 4N6EB 2H47C 3CFCL 3Q3NC 1E27A 3T9WA 3JV0A 4X6CA 3IS0X 4BETA 5KVGH 4NJCA 2MJEA 1QZ1A 5C07B 4DWHA 3B9JA 2X53A 4JRYE 3DJSA 5DQJB 1HE7A 4XCFL 1WWAX 5EOQL 3ZTNL 5C86A 5IHLB 4K03A 2MQ0A 2LRWA 4XWTA 1S3KL 2KC7A 3VQIA 1MJUL 4PV9A 4JPIB 4KMTL 3FEYA 3L3OA 2W9DL 2WSPA 4AL8C 3UI3A 4NAWA 3PWLB 3RUGA 3OZ9L 4KO6A 5GGRA 4AIEA 1GCYA 2Z34A 3E9SA 1OCCE 1ZT1A 5DHXB 4JFHE 5MEOB 1KTJA 2GJ6B 1BMZA 4JFOA 1OF2A 2E8ZA 4K7FB 3U82B 4UAOC 4FFWC 4YHOH 3BK1A 2GFBA 3K9PB 4N9GB 2LGSA 1OT1A 3OJ3A 5J12B 1ZLSH 3APMA 3ASDA 2HJFB 4IDJH 1UGNA 2FQDA 15C8H 2D7PA 2HT3D 3HPJA 3SE4A 3A1QB 2JB5H 1GCFA 4XC3H 4Z7NE 1UH6A 4BTBA 2ZJSH 2MQJA 4HHGA 2YO3A 4J3OG 1FFNB 4MXQD 3STLA 4YBLC 4UTBA 1N52A 3O2DA 4JFDE 5IHWA 3QUMH 4U6YB 1RZQA 2CG2A 2D9CA 3N3KB 3VMNA 4YDIH 3UBGA 3VXSB 4IU2A 4LLUB 1I7RA 1LEGA 1G7HA 3B9AA 5DJCA 1HQRD 4LSRH 3CAFA 3D85A 4M1GL 2F8OA 1OTUC 4IOFD 4HSCX 3IU4L 1UKQA 3EGSA 5CNHA 3WXVH 3ZDZE 4FQIH 1MCQA 1BBJA 3LPGA 4OF5A 5GGRY 3ARGC 1BOYA 4WO4C 3TONA 3MUHL 1G9MH 1KSRA 3L45A 3BJLA 3QQ3A 4F7TB 4I18A 2MQCA 4X9HA 2W0FB 5E5MB 1LQBA 2EKEC 3PDOA 3WDHA 2UWEB 3RZCB 5IB1B 4V2BA 2YQBA 3A3YB 3O6FB 1FNSL 4PI0A 2BIQA 1M57B 5JPNC 1KB3A 2WUBL 3HNSL 3PAVA 1B2WH 4XMUA 5JOFA 3PXLA 1CGSL 1T66C 3L1OL 5E6IB 1UW4B 2R02A 2XWCA 3TEYA 4ATWA 3MA7B 2EILE 4D2NA 2UVEA 1ZAGA 2HFFA 4ZD3L 2J6WA 4MQXC 3B9EA 4MJIB 3I75A 3C2AL 3DSFL 4WGWB 4P2RD 5IZ7A 4WU7B 2LSVA 1K4CA 4J3OD 1QNIA 1LEIA 2P9PG 4NAJA 3B2UD 5FM8A 1KIUA 1IGJB 4UM9A 5KS9F 4KO5A 4LAJH 4M8VA 4KKBC 1TVBA 4U3SB 3U4KA 4LGRB 4A6YL 1LO0L 3BO8A 4HEPA 1YO4A 1ZA6B 2FD6L 3NIFF 5FUCC 5T3ZH 5CFAA 1M7DB 4G43B 4JFXA 4EBQL 2VC2B 1LO3H 2CO4A 4NP4H 2XQ0A 4DKEL 3DVNB 5KVDH 2EMTA 5DJ0B 1L2NA 4XYCA 4DBGA 1G9NL 1XXGA 1QZ2A 4DLQA 1ACCA 2HVJB 3QA3B 5D7JB 3B2GA 1TR7A 1BZ7B 4GUPB 1PY1A 1YD8U 4Q0XL 1PY9A 3GPEA 3SDCA 2IAMC 3FTWA 4YVQC 1N8ZB 5A2JH 1DP0A 3RMKC 2NDGA 2N4FA 3QXTA 2VTBA 1W6WA 5FYJD 1IBXA 4KVCL 2GSGB 2WW8A 3AEBB 4Y1TA 3MXVL 4PD4K 5E8DH 2H3KA 4XPTH 4DP2X 2O5ZL 5CGMA 5KTEL 4ATGA 5EIIA 4OQTL 4C4KO 1EYHA 5FTPA 4QR7A 1H0DA 2UYZB 3NACH 1AOHA 2RPVA 3C0RB 2W1NA 2QZQA 6CGTA 2WLKA 2HT4D 1FZKA 2F8IA 2P5EA 2A4EA 2YPLB 4QPEA 3C08L 4DGWC 4B93B 3AEEB 1B9KA 4U6XA 3GSOA 1IEHA 2GVYA 3AE1B 3RWGA 2VXQH 3MBWB 3T6VA 4HIIA 3UAJA 3BZEA 2DZKA 4PYHA 3OLDA 2VH2A 1KXQE 4PS4H 1Y07A 3IFLL 4HCRL 2EO1A 1DZBA 5FO9A 1CDHA 1CVRA 1XMWA 4U7EB 5D7EA 1KBGL 4N8CL 3VXPB 1A7NL 3W9DB 3A9JA 2Q76B 3HZMB 2EDDA 3CSYA 2RFXA 1ETZA 43C9A 2CO7A 2BJML 3SD5A 2RJMA 4MX7B 4NBXB 1PZBA 2YUWA 1FYTA 4TNFA 3H8HA 3A6CL 1L0XB 4K9EH 3V52L 3BINA 3O3BB 3IJYA 2X41A 4IKGA 4HIHA 3B83A 2VE6A 4NACA 4GS7C 4OD2A 1UJ3A 4R0LB 5D96C 4W6WB 5C09D 4U3CA 3G7TA 4BFJA 4IBUA 3RNKB 4MXVF 5AZHA 1P1ZA 3MV9D 4Y4FD 3ORJA 3Q01A 1YJ1A 3MEKA 2WP3T 4IM2A 3G5XB 3IGKA 1UWYA 4X0KA 1UCTA 4FFYL 4GW4B 2PWGA 4JFEB 1A1MA 4ONGH 3CHQA 2P48B 5B1AB 2VQTA 1BZ9A 4F1PA 4JAMB 4C9BB 2Z8LA 1EEYA 5HTSA 5F9AC 1CFNA 1LILA 2AXZA 4BYHA 3Q2AC 1IM3B 3PHSA 5B39B 3S97C 2JJTA 2YLKA 4EQ3A 5C71A 2J73A 3G6AB 2YHCA 4L1LA 1RP8A 2WZPA 4FERA 2H0PA 1QF6A 1CQVA 4LP4A 4DZ8A 5MERA 2A74C 1K52A 4BFIA 1PY0A 4GZ3A 2BHFA 3ZKMC 1N3NB 4CILA 1OB1B 3U52E 1BFVL 2ARJA 4OBSA 3ZUCA 4AVIA 4BK8A 1EGJL 4W9KC 3B9DA 2KUTA 2OMTA 1NVID 2DI9A 2BF8B 2QEJC 4LRZA 1WC7B 3MLTA 5EYPF 3BPOC 5FW7A 4LMQI 1D7FA 1F8TH 3VTTA 3VRIB 4O5LH 2ENYA 4MYWB 3UTPD 5KBPA 5IT2H 1U3HB 2P9RA 2JKIS 2X4OA 3UXFA 4QCIA 1C5BL 5T5FA 3QARA 3QRLA 5LJYH 3SGJC 3R2IA 1NTDA 4I0PB 1I1AD 5DUMH 4WUYA 1OCZB 1XSIA 1KZQA 3PV6B 1DSFL 3VXRD 3KYKH 5JXEA 3SOBH 2HUEA 2CRIA 3OJ4B 2YLMA 4AYSA 1A02N 1JMLA 4W6YB 1WEJH 1JN6B 3MOBH 4LSTH 3BW9A 1ZHKA 3V6FA 4OB5H 5EPMA 3LQZA 3BU8A 4FA7B 25C8L 2KMWA 3U6XS 1NUGA 5E23A 4ZQTA 3VD2A 4A20A 3KPTA 1NCDH 1QR1B 4ES9A 2BW2A 3SBTB 5DO8A 3ZN6A 2WXPA 4X99A 4NNYB 4YHIB 1NBCA 3A67L 4OZ4A 5ISZE 3CK9A 5DHMC 4LL9A 5DJYA 3WXXA 2OZ4L 1T22A 3LEXA 4JM2F 1D5BA 3QEUB 4MCYA 4POYA 1K8RB 1TFHA 2WP9B 5AAWA 3TBTB 3VFGH 4XO4A 3C87A 4JO1H 4BE5A 1K1AA 5GS0C 2R39A 2XWEA 4KMOA 4GEIA 2FECL 2DZIA 5CX3A 5J12C 2QR0A 5BS0D 3Q5TA 3DPYA 2DV6A 4R4BA 3P3TA 5CO1A 5FLUA 3ABME 3BXNA 4WW1A 3RKPA 3V55A 3TZVA 1ZDSA 2FJHA 4JMNA 3D4CA 2NLJA 1AO7D 1PG7W 1WO2A 1DVFA 2DY2A 1XGWA 1A9EB 1X5FA 3Q9NC 2AQNA 2XKUA 1JDDA 3D06A 2WBJA 3HRZB 4LHUD 4NENA 2N9LA 1TTCA 5LHDA 4JE3B 1A9VA 2DWYA 1R0AL 1INQA 5GS2H 1X5JA 3TBLD 4DXFA 1MFAL 1U4FA 3CHMA 1EEQA 2DYPA 4WW2C 3VXRE 4Z6AT 2B77A 1A9BB 1XGUA 3L3IB 2OV0A 3J5PA 3AWGA 1UD7A 4MNQD 2CMRL 1UWEL 2HN7B 1JP5A 1I9IL 2HT2C 2WWKO 4FFYA 4H8WC 4TUJA 3VFOA 3WGUB 4BSWA 3WD5L 4CC4C 5ISZB 1G87A 3U30B 3L82A 3D25B 3BRDA 5EC1B 4WW2A 5T3XE 3F62A 4AQ1C 2WCGA 2DQHH 4IIZA 4PGBA 4A66A 4JZYA 3Q7JA 4J7WA 5ICXA 3RJQB 4WI0B 1FO0L 2G5BB 2WYIA 1Q9KB 3JT0A 2RTTA 1D7DA 5FYLH 1P6AB 3PQYA 5AKRA 1TQWA 5HBBA 3TURA 4LDTD 1PFDA 4XX1E 5CMAB 1SLXA 3H0TA 3SN6N 3MXVH 4LASH 3E37A 3KYNA 4LEXL 1XCXA 1HH9B 2WO3B 3BPLB 3DGCR 4WK0B 3SQOL 3MZGB 4CKVX 5DD6B 3DCGA 3UGBB 3P1UA 2ZG3A 4F8QA 4EOYA 3RLSA 4KO7A 5EN5D 3VQ2C 4BY6A 2PO6A 3BRGC 5EE0A 5SV3A 1FVHA 2WMPA 3BQUD 3SBPA 3BP7B 4KZ0A 2JPHA 2DYPD 4K3JL 3UTQB 2DKUA 3HR5B 5C6TL 5DR5L 3X13A 4KUZH 3M1BB 4XP4L 3ZYLA 3NA4A 1DJSA 2DJMA 1BX2B 4JM0A 2R15A 3A47A 4PBXA 5KJ7E 2UXVA 4PJ5D 2ZG2A 4XAKD 5GPRA 3V4VB 1KGIA 4IRSB 4FAAB 2LLLA 1O7DC 4G7VH 3V4PL 4I0PC 1U2YA 4XZ4A 3MC0B 4OAWB 4GQQA 2OMVB 1NCWH 5D2NB 5E4IA 1K1BA 3BPCA 5IFJA 5E1HB 4PVNA 5HKHA 2QMJA 3QQ9C 4LCCA 5KNGA 1DO6A 1XF1A 2FBOJ 2H0EA 3B9KB 3FO2B 2IFGA 4G1MB 1BW8A 1ET5A 3BD5A 2KAJA 5BZDB 3V79C 2BT6A 4Y1AD 4AYMC 4MXWH 3RNBC 2WQ7A 1GRWA 5HDWA 4F33B 2VLKA 3NSYA 4BFRA 5DYFA 1OGPA 3N44B 3TCLA 2BVPB 1OE2A 3K0YA 3TG4A 4F3FB 1NLBL 4PWKA 2H6HA 1P9MA 2A3TA 4JQIL 4PJBA 5JH5C 2ZONA 2I38A 1URIA 3QQ8B 4Z23A 2CH8A 2ITDA 3O45B 4OGXL 5E24E 4LNRA 1EU3A 4HIQA 4N0FA 5BNWA 2L3ZA 3QRFM 4CMMA 4KRNA 2KXJA 1G9ML 3HG1B 3VGGA 1QILA 4DF9A 2CCLA 4LVNB 3WD5H 2HSIA 3I4GA 4PBWD 1ADQA 2IALB 3WNPA 3AU1B 1ZVYA 1ZCRA 4UMGA 1ND0A 5H2BA 1INDL 1G7IB 2ZCBA 1CYGA 1NICA 1V5OA 1W0VB 3GLAA 5L8KB 1VADB 1VD2A 2RMMA 5H4ZA 4YDIL 2EKIA 1U8CA 5CTRC 3N30A 1R0AH 4OZIA 3RZWC 2A2QT 2VC2H 2I9LB 2YUZA 2WXOA 3MCKA 3ARZA 4R5XA 5GXBB 4PYUA 3TXAA 1UUSA 3GZ1A 4APFA 3HS0C 5J6HB 5EU7E 4HK0B 4C7ZA 3T3ME 4MGXA 2PWFA 2XICA 1GS7A 1ZXQA 4Y1AE 2CDGA 2K7PA 3F7RA 3DYPA 5EZOL 5I2IB 3REVB 2XI9A 3FZUC 2PLPA 3CFJB 2AGJL 5GSRA 5D4IA 3QAQA 1CFBA 3WE6B 4D3CH 2MNWA 1IRAY 2CDFB 2FGZA 2NXZC 3D4GA 1MEXL 3X12B 3KLHD 1OSZA 4OLXL 2YNQA 1FRGL 3D4YA 5E0QA 4KDVA 4KYOB 4AEIH 2JJSA 3RU8L 1E6EB 4D9QE 2A9NL 1YAIA 3WSQL 3K3QA 1NCIA 5IY5E 4MXVE 3NABL 1B2YA 2P43B 4NQVB 3GE8C 2EEXA 2IO1B 3O2VL 4MRUA 1ID5I 1JWSA 1I1YB 2LHAA 3C3OA 4NNXA 4N8VG 1LXMA 4LP5A 3UC0H 3L10B 4W9DC 1E5CA 2LJ5A 4L3EB 4AGMA 5GGUB 1I3GL 3ARPA 1Z9SB 3PRMB 4KGSA 3MACL 3ZGHA 4W9IA 1ZT1B 3ASGA 2H2SD 2R56L 4HEPG 5BUAA 3P11H 3HE7C 1F0ZA 1EXUB 1IGCA 4IK6A 3FUNA 3LS5H 1YUHB 3ZMRA 4JVWA 3LVEA 2NXZD 4OLZL 1CD0A 1WIAA 4E74A 2ZCHL 4RESB 1J0KA 1IC7H 2JFCA 3DTUB 4I6LB 2V5QC 2JYEA 3F58H 4WFED 4NEHB 2Z92A 2X10A 4EXPX 3FAHA 4IBTA 3CKCA 3UIPC 4ODTL 5C09B 3PZ7A 2AXWA 4Z7UE 1KGWA 4DCQB 5ESVB 5TE6L 4LEOB 3BZFB 2Q8AL 4MQSB 1JPGA 4M61B 3HE6D 3MV9B 3NAAH 3D39D 4JDEA 4Y4FB 3QWOA 5D93C 5BNXD 2R4RL 4QT5B 3VXSD 6FABL 1JYWA 3AE4B 1PEWA 1BBJB 2YAMA 3LIZH 3MRBB 3NSXA 4HKXB 4JO3H 1WBXB 4KKAC 2P26A 4H44C 3QDJB 5FYKD 3TVMD 3V4VL 4R7XA 4YHYC 1TTRA 4I17A 1UA7A 4NLAA 3LNDA 3N40F 5K33A 2UWEA 3RZCA 2C3WA 3QPXL 4MNQE 3SYAA 1N5AB 3VRLF 5B4MD 4NO0B 2Q9OA 5L7XL 2NY1D 3JWOC 3GHBH 2WGSA 2YOCA 2UXTA 4MM3B 5K1JA 4Z7OF 4BA0A 4NZTH 4OUUB 4GTPA 3F85A 3QUZA 5I18H 3EO1B 4AV5A 4K71B 4LSUH 4FKEA 4MJIA 3DV6A 4KUCF 4LLDA 4WEBL 3C6SB 4WHYG 5AWNH 3D09A 1YYML 4N3BA 4ZNEA 3WL9A 1HHHB 4N0CC 4BIKA 3T9LA 3A6CH 2WBJC 2GEQA 5F7AA 1ZA3B 5DJ2B 2OW7A 4ZYSA 2XPYA 3EBIA 2GYSA 3BE1H 1I1FA 1UACH 4U3SA 3I84A 4URTB 5HG2A 2V0GA 2AXUA 3EBGA 2FE8A 2PPEA 1AC6A 1JI2A 3NABH 3VFRB 1NBZB 2O2VA 5F7KC 1JWMA 1N26A 3BSZA 2BP8A 2K4AA 3DSNB 4HLZG 2BBCA 4Z1PA 3EG9A 4YBLB 1M6OB 4F57L 4Z78A 3DOSB 3X1BA 1XNFA 2HO1A 1MPAH 2X3AA 1OXJA 3RDJA 4D0CA 1MEXH 3ALBA 1EDQA 5BQ7A 3FFDB 3ILDA 4U1SB 4U1MA 2LGXA 2G3MA 3HAEG 1C8PA 2A83B 4UAOB 4YSDA 5TFSL 1QFWL 2VTBB 3S7GA 5KTEH 3OHXC 4JFFE 5IR1A 2UYLA 2X6FA 3MO1B 1R6VA 3RTQA 4ETQA 5CUSH 2PYFB 5DHYB 4IULA 1NUNB 5B7FA 4I8DA 3BN9C 5EIIB 1T3FA 2WZ0A 3BT2L 4G9DB 2VN3A 3WBDA 1OCWH 2BH0A 1VRSA 4DGUA 2RR3A 1KXQA 2EVIA 1VERA 5ICYA 5B38B 1KN2L 2XU9A 4MLSA 4PJDF 5FQ7A 1OT4A 3P4MB 5IGXL 3GQFA 3EDKA 1NMCB 2DQEL 4WFFD 1EJ8A 5C6WH 2GB2A 1RIVH 1XF5B 1GUAB 5T1JA 3TWVA 3CVUA 2ZIDA 3MU3A 4JS7A 2B4CH 2WDQB 4DPRA 4YDEA 3ASOB 3MLXH 2QDVA 1NCBH 3VU1A 3EHVA 1NAKL 4O4YL 2XTSA 1IIKA 3K2UH 4RMQA 1T5XD 4MJ4A 2WQRA 3QFDB 3TS8A 4MNQB 3HUJB 3NJFA 4NC1E 1FYTB 5L83A 1L5GA 3VXTB 3GYZA 2E6PA 2IDYA 3OLMD 2CU3A 2IO3C 4OKVB 3DBLB 3HS8A 3IJYB 2VWEE 3EGDB 4HGWA 3HG0D 2K8QA 3AB5A 4GI6A 3OKNB 4KQ4L 5CF3A 4WKZB 1AZUA 2XWRA 1F6AB 1OD7A 4FFZA 3JZYA 4X6CE 2E4FA 2YXFA 4HF5H 1W91A 4ENED 3SE8L 1T04B 2EC9T 1J7AA 3MKKA 4PU2A 5F97E 1R4MI 4X5PA 4LVNC 1OWRM 1MFCH 4UQ3A 1I8UA 2WNKA 1SEBD 1S5HA 2WWKT 2WOBA 2QADB 4FOMA 4NP9A 2N1KA 2R69H 4HWBL 5I0XA 1MI5E 5EA0H 2Y07H 2J0MA 1TNNA 2VDQL 3EDDA 2GRIA 2Y5TB 4Q6YA 4CDHA 3RNGC 4MNGE 1QFHA 3F2LA 4TNVK 2FHBA 3CZKA 4KMLB 2R23A 1TUPA 1IBBA 1J7VR 2KDIA 3K72A 4MDKE 4XB7A 1OB1A 3ARED 1L9QA 4YUEH 4X4XA 3DXAA 3MI6A 4UQXA 1FYHB 4X8GA 1MHPL 1J5OL 3QORA 5ID0A 4U1GC 4JM4H 4DDID 1A4AA 2PYEA 3ZQWA 2TAAA 2UX6A 5KVEE 4ZSOE 1SJEA 1WGRA 3ATAA 1EBAA 4A6YB 3SYPA 1SNRA 4KI5C 1DN0B 4QCIB 1VPOL 1YN7A 2PYEE 4UT6L 3D12B 1WGDA 1WZAA 3V7AE 4Q6IA 2YEPB 1Z9OA 1G4RA 2Z35A 1G4MA 1NAKH 1F4XL 4B96A 1WG0A 2B4CC 3MLVH 1UACL 3MLSL 2ATPB 5DPWA 2Z4QA 4MZRA 3GBMH 4BH7A 4BEIA 3C2SA 4J6IA 3P69A 5LNEA 2QVKA 1OEZW 1NGWA 3WN5C 2AKRA 4JRYB 4KKCC 4L4TB 5EPMB 3IU3A 3D0VA 4OF0A 4PRHD 2H89B 1D6VL 4QXVA 3P73A 1NEKB 3O6ML 1HWHB 3C5XA 1P7FA 3P4NB 2HFEA 4NRZB 1DVZA 1TTAA 1HHKB 4L8SB 5K9JL 5D4HA 4TPRL 2WTRA 1OAXL 2WVSA 1NC4A 1UOHA 1G6RH 3GXNA 4OZIF 4N2MA 1MCKA 4YO0A 5I19L 1BLXB 3ZHEB 3C6EA 4UM9D 4WJOA 2W65B 1EV2E 4XMVA 5CCLA 2C34A 3IG3A 3DUUB 4Z3HA 4BQ6A 1JD7A 4YDLB 1TY2A 2R0ZL 2EACA 3JWNC 2BWDA 4OIIL 3WA0A 2ICEB 1AG6A 4Y19E 3FW6A 2QR0B 4U1HB 1JZ7A 3MGBA 4A1GA 1LVEA 2NYYC 2LXCA 4A39A 4JVUA 3CMOH 4DH2A 2GBNA 1GS6X 3EBAA 4BZYA 1DVFB 3HRZA 4JFWA 3U30C 3II2A 4E41A 5CP3A 3CVHL 1SY6L 1MY7A 2WNWA 3ZE2F 3GRWA 1YA5A 4HFGA 2Q3AA 2GSMB 4WGVB 2FBRA 4JM2B 4GOSA 2L0DA 4KV5E 3TA4D 3VQMA 2CO1A 3GMQA 4LK0M 4F27A 1NGXB 1EO5A 2ZCHH 3G3LA 3EOAB 4IDLA 3REWB 2OJ1A 1OP5H 1R3IL 4ZSOB 1YMPA 1PPIA 1HQRA 4RA3A 2Z9TA 4DP1X 5IFAL 3MV7A 3IU4H 1BAFH 3HG2A 5LCVA 2OMZB 7PCYA 1ESFA 4YWGH 1Q9KA 2Y4SA 4C00A 4YXDB 1A4CA 3QULA 1MFEL 4J3UA 4FP8H 2AQRA 3FDWA 2E47A 4KU1A 1E9QB 4TYUA 1R5VA 4ABWA 1ZLEA 1UH4A 4NZTL 4RQQA 4K3EL 4K5NA 4AWJC 3N91A 4YHML 3KYCD 3HC0A 4LNGA 5TF0A 4RF0A 3QCUH 3SFEB 2ZGDA 1MI5D 5KG9A 1N4SA 3HS0B 3WYRA 5MEOA 5ICUA 4KK8C 1TEGA 4V11A 1WGHA 1IQRA 1Y6IA 1ORQB 3CBRA 2DWEA 5EO9B 4R6UA 4ALAL 2A6IB 4L5FH 4YXHH 5E2JA 3BLBA 3SBRA 3WMPA 1MI5B 5KVEH 3Q9QA 2ZVOA 2EH8L 4TS6A 1C78A 2I69A 3QG6B 2PE6B 4GLSC 1N0RA 1YQ3B 2Z7ZA 3VD5A 1YEHH 4KOBA 4LVEA 5GHWL 4ZRQA 3C5SA 3O8XA 3BUPA 4XN8A 4LFHG 5GS1C 4ZXBD 2FVNA 2XT1B 4Q9RL 2CA3A 1FG9C 1HEZB 2UZIH 4FC8A 4Q89A 4QJ3B 2BOBB 4TNWK 2FSEB 1FL6A 3AITA 4LESA 4I2ZA 4KTEH 2JKRM 3MV7D 3T5VA 2NY0B 5AVXB 2LHEA 2V3SA 3MV11 1C77A 3RVVD 2IANA 3ATDA 1TG8A 3QQ3B 1XV8A 4F7TA 1VCBC 2K8MA 2VDMB 4H25A 4AYID 2I26N 2YRBA 5CWSA 2PKOA 4UU9B 5E5MA 1RCYA 2IANE 1EF5A 2JYTA 1X1MA 3QH3A 3FAXA 5E95B 5JXEC 2SAKA 2LFGA 4N5ED 2LEKA 4GBXA 3KPSB 2VLKB 5I1CH 3FQWB 4YL8A 1RURL 5IOKA 5EHFA 5JOFB 4PIBA 5JORA 2HAZA 4U4BA 2BX5A 3RA7L 5JJTA 2PXYA 5D2NC 2PPHA 4NQCE 1CFTB 2MCPL 2VZKB 3WFBH 3LRSB 4AXWB 3F7LA 3HI1A 1EAPB 5I1JL 3FTUA 1QQEA 3RVXC 4LNRB 1QSEB 4B9JA 4OFIA 3Q1EA 2F53B 3IMTA 2DVWA 1R1CA 3S0PA 5J9PA 4E42B 1HTQA 2XX1A 3QYMA 3FL7A 5E00A 2QLYA 2IQ9L 2M0AA 2KTRB 1BBDH 3D9HA 1I3UA 4N28A 3JYBA 3DVNA 1VADA 4P8QA 1DJHA 1YY8B 3UG5A 3ULUL 4KIKA 1USZA 3S5LA 4X8QA 3AWEA 4IKNA 5A23A 2VDRH 3A9KB 4GS7B 5D96B 4UINH 4ATZD 2FH6A 3ESVF 1CJYA 2PW9A 5GJSL 4TL5A 3TA3B 2FR4A 2WO4A 3AV8A 4MJ6B 5PCYA 2PNNA 4AS1A 4XP5L 3HM3A 3RPFC 3MOAH 3QXDA 5ALBH 2AEQH 3OB0H 2VSXE 3VUWA 4PV8B 1DBJL 1KZYA 3CVPA 1AQKH 2DQIH 3DO3A 1CI5A 2KFJA 5LXGL 1WGKA 3EDTB 4ZI8A 1ZXIA 3BVXA 2OZ4A 1T7VA 4JFEE 3VLFA 4QXUL 1OSZB 3MRPA 5ACLA 5GGVH 4LNBA 2OJEA 3NOGD 3NJJA 2ZXCA 3N9GL 2J8UE 1IGFL 4GQRA 4M7CA 4YEEA 4AGPA 4JFYA 1XH0A 2YJLA 3WJJA 3OG6B 1DVYA 2JJTC 1F58H 2NSQA 5CFHA 1E9PB 2BSTA 3U1PA 4MHHI 1VEPA 5GISL 1QI4A 4KZCA 1I1YA 1NCOA 3DUSA 3LPFA 2VGLM 5EBLA 1Y6KR 4TQPA 3UQ3A 5T3RA 3US1A 2IJGX 4M7KH 2RGFA 1UWGH 2DF3A 1OGSA 4JG1H 5KBAA 3GRWL 4ZO8A 1G7MA 4PDXA 4NRYB 3HI5H 1A1NB 3WELA 1I3RB 1HHGA 2V2XA 1JTPA 5CILL 3WNJA 2IPKB 4DX1A 4J8EA 3VMOA 1QUPA 4HX1A 2VQUA 3SD2A 5KSBA 1ZPUA 2QVTA 2V9HA 2MLBA 1BG9A 1OIOA 2YD9A 4NFDA 3FILB 2F61A 3OXFA 3RWEA 3VUYA 5DC4B 3UF8A 3MRHB 1P7KB 4MKTA 1N18A 2BSED 4XI5C 2XXCB 3NT0A 1OCWL 3TYGH 2ZNWA 5JOPE 4AX3A 3CQFA 5KJNA 1T6VN 2V5MA 3RNKA 1JFHA 3TWXA 1AXSA 5FDWB 5I6LA 5IROD 5AQAA 1AANA 5CEZE 2LMCA 2FHFA 4AQ8C 1KH0A 3LKUA 3BZFA 4GQ9L 4X8JB 4DESA 2HLFC 3AE6B 3FH8A 3H9SD 4KNTA 2P9NG 2ENQA 3HN5A 3NSJA 2KDGA 3P3YA 5CZRA 3U9PH 4AGOA 1MCOH 4XC1L 4M7LL 2A77L 3EJPA 2AL3A 3QZOA 5D1XC 4MH8A 5I74C 3I74A 1F13A 2VL4A 3VJ6B 4EUTA 1T1ZB 1IKNC 4DUIA 4AJYV 4L4VA 2V9UA 2Y22A 3QAZC 5KBLA 2UUDH 5F93C 3ZTCA 1Q0WB 4BV1A 4AVXA 1JGVL 2XKNA 3VFWA 4BFIB 4NO0A 4ZMXA 2N7JA 2B9AA 2FULA 4DEWA 4BSZB 5C3LD 3MKRA 1DANT 3EHBC 1QQRA 3BDYH 4WWKA 4C58B 1CN4A 2XCCA 5T1LA 2AW2A 5T3XD 4NNPH 1ZLVK 2ADJB 4KH9A 1JZ2A 5ICZB 3HRAA 1ACYL 3ZJVA 4X5LA 4XNZC 1BXTA 3G08B 3F01A 2ED6A 2FO8A 3OAZH 3TBYB 4OCNC 4CADA 2IJ0C 3CHPA 4CDMA 1SMAA 4JCWA 2P49B 4WW2F 5DA4A 5GHWH 4ZZKA 1LO2H 5ANMB 1QBML 1HL8A 2MPAH 5D71L 5DVMA 3H9SA 1UWXH 1R9FA 5I15H 3BG1B 4JPVH 3A6BL 4D8OA 4DQOH 5D1XD 4ASWC 4Q9CA 2XEVA 3ZPJA 1AO7A 2AYOB 3JXIA 4K07A 3EFFA 2WK2A 3DA0A 3ZGIA 4TSCH 5DZJA 1MFAH 2R29L 5F2FA 5L2KB 1G6RL 4RSYA 4WFHE 3OVUB 2IYDB 2AJUL 2P44B 4JRYD 4F5CE 1QNZL 4OR1A 3FBQA 4Z76B 3MX3A 2GROB 5L7XH 1NOFA 3SYQA 3LKPB 3S3PA 1K6QL 4OQ1A 5F1KC 1JAEA 4JFZL 4M9OA 2ZUSA 4UIMA 4LDEB 5EF0A 2RIKA 3POHA 3OAYK 4ACKA 3FB7B 4JBSA 1J9CT 2MFNA 1HCZA 1QKZL 5D9SA 5INCA 5KS9A 1ASOA 2NZ9C 3I02B 3SFYA 4H8UA 1MWOA 4UTAA 2D31B 3KWWB 1GW0A 4JJ5A 4QO1A 3OJDA 2ZXQA 3FZUD 2XN2A 2AQ3B 4OLVH 3ULUE 2XN0A 3G2UA 4KVMA 1A7QL 4HPLB 2GC4C 1G6RA 1FM0D 12E8H 2YRLA 3NIFE 2GABA 5LAXA 3C60B 3TN0C 3GXTA 3CFMA 3RNFC 5CSBA 4ZFQA 1P7EA 5JMRA 1SJHA 3ZHDA 1A9EA 1LHZA 2X4SB 1TOXA 5I0YA 4JGJA 3VGEA 3ZE0F 1ELKA 3MRFA 1PL3A 5DS8B 5CEYA 4D0BB 4KV2A 2OR9L 4EZJA 1SZAA 1SOQA 5F7DB 3OAZK 4M7LH 1H19A 5DHDA 4HOQA 1W72L 3HIZA 3CN1A 3TWRA 3O6LH 2P5PA 5I73B 1P7HL 1V81A 2PPDA 2CRZA 5JOPD 3AQZA 4EI5D 3CLWA 3T2LA 1X9LA 2J8SD 4NERA 4L9PA 4MLIA 4XO5A 2W8CA 3D85D 2VZ1A 4GRLA 3D08A 3TH3T 4Y4HC 4P9HH 5DRZA 3UG3A 3D52A 1SZNA 2JZ3B 1DEDA 3GMRB 1VGEH 1I7RB 4LLUA 5DJCB 1LEKA 1I8LA 2HTKC 4ORGB 1XCTL 2G45B 3LRKA 4DQOC 3RX9A 5DF0A 4DKFL 4YLBA 1H6EA 1N68A 4JGNA 1JK8B 1QMUA 4OZGE 5AKSA 2D3BA 2VW6A 2GI7A 1KJ2B 3APFA 2BYTA 3QPQC 4I2XB 4P46B 3S4SB 3C5ZD 4WK2B 4Z3JA 1CU4H 1ZS8A 1Z5SC 2M83A 2YMXH 3C8KA 2RH0A 1MFNA 3IHVA 2APFA 4WTZA 4AYEC 2NDFA 1Z6TA 1H3UA 5ILTL 3TPUA 3T8MA 3IDIB 1T0OA 4ZW6A 1F4XH 4PGCB 1MCWW 5EEWA 1UB6B 3TT3L 3MA7A 5GISH 3SGKC 5BMGA 3P9MB 1DVXA 1MFDL 4Q4IA 2F15A 2QSDA 1QFOA 1JV2B 1S2EA 2X3BA 5CR8A 5EKQD 1NPJA 5JDJA 3W39A 3PVLA 3QC6X 4HCFA 1R4NB 4JPQA 3H42H 3WIHA 2TRHA 1TZ1A 4LPXA 5A43C 4LPTA 4B97A 3ZHNA 3HUJF 2BVQB 3RCZA 3CSGA 4M02A 2FATH 2CIIB 3EYSL 4H1LG 3MNZB 4GSUA 4OGYL 1R5IB 3O0RL 2NW2A 3QPQD 1KJMA 4A6QA 3V7MA 1FL3A 3ELAT 3MFGA 3D4ZA 3W9EA 2ZQKA 4IGBD 2DIBA 5CGTA 5E8EB 3MA9H 3CVCA 2RCSL 3PV7A 3KPOA 4G6ML 5IBTH 2CE6A 2DQMA 1NPUA 1BOGB 2NY6D 3FYIB 4JCMA 2YC1A 3DX1A 3K46A 1FGNH 3ESOA 2OSWA 3B56A 3N71A 5DMJB 3KPRA 4S2SA 3TF7C 4LRIA 3WJLA 4ZMTA 4ACPA 2FGWH 4EKUA 4KXZI 3BYTB 2VDNL 4X9FA 1XGZA 4UWLA 4LIQL 5EZLA 3DTXB 4NUGL 4AEHL 5KBKA 3EJCA 4D94A 1BD2E 1J1PL 1I8KB 5MEPA 3P1MA 4XPFH 3FN0H 2OULB 4R0LC 3FQTA 2PO6C 3MFFA 4HJ0D 2HRLA 1YIWA 3ULVH 3OKYA 2GT9A 1OTTC 2K0PA 3DBLI 1DDTA 2YEZA 5JA4D 5KJ4A 4B9IA 3T2NH 2BNQD 2J4DA 3Q06A 2HD5B 1FNAA 3P3UA 1RI8A 3UZEA 4FGMA 3LTVA 4HRSA 4L4TE 3VSQA 1BU9A 1XF5L 4IWQA 2RA1A 4KK5D 4ADIA 1RPUA 1YG9A 4TQ8A 3BAWA 1KYFA 2EXYC 2MHJA 2VSCA 4LSDA 4UT7H 4E5XB 3JV6A 4MSWA 1MIEH 3KD7A 2JELH 5SX5K 3S96A 4ZMLA 3Q3FA 1QBLH 4MDIA 1S9KC 2QPSA 3G5VA 3NCJL 4BOSC 2R27A 3HZKA 4OCRH 4YL4A 1BAGA 5C09E 2GMIC 2KNBA 4UM8B 1KEMH 2G75B 4WJNA 4E41B 5FLVA 2GBRA 1QRNA 2NOYA 1TZAA 3L81A 5LN4A 4HUNB 4JJHA 4TM9A 2Y1AA 5I1EL 2IGGA 4IS6A 1I85C 2V7HA 4NKQB 4YPGB 4X5WA 4NJ9H 3BJ91 3B7UX 4AYGA 2JCCE 4CJ0A 4WNFA 4NPKA 2C3XA 2R9HD 1FSKB 2ZOKB 5DDHB 4YHOL 3KXFD 1KGJA 3PWPE 3V4UL 3RYTA 3K2UL 2XWTA 1OAKL 2V3DA 3ULUH 4F7AA 2NY3D 2APTA 4NUJB 3T3PB 4I4WB 2VDPL 3PO0A 5HQ8A 5SWQA 3SBWA 3UO8B 1Q1OA 3ZDZB 2KZTB 1JGUH 1JNJA 4A63A 3ARDA 4G3YL 2Z91B 4YR6A 5TDOA 1AYOA 3FSVA 1HG5A 3WLBA 2WQWA 2J12B 4ZT1A 3G2TA 5GGUA 1TKWB 2VMEA 4M4RB 2L7UA 4XVTL 1GC7A 3EOBB 1PUTA 1NUDA 5B39A 4B3VA 2YUXA 3OG5A 3RILA 4P4KB 1S78D 3KPLA 4M5YH 1ZT7B 4XMPH 2QPUA 3WFHA 3RZCD 1P0RA 2KMCA 2V4IB 3RP1A 1YX6B 5AZGA 3GSNA 3HI6H 3LHPL 4PJDE 4JG0L 2F8XK 1JZIA 1UWEH 1W0WA 3II3A 8CGTA 4OGQC 1DJWA 3BD3A 4YGVA 5F7YC 5GXGB 2C9UA 4NNJB 2ARJB 3QQ4A 4MKMA 4I3SL 4A7GA 5HHXH 3V0WL 4R2GB 5IQOA 2AJAA 1NGZA 2M8XA 1TYJA 4RWYL 3LDBC 5H37A 3DXMG 4KI5F 3B2UC 5IVZB 4JXTA 1ZUD2 4AMKH 5CEZH 4KKBD 2QSVA 5JPMC 4PJCF 4KHXH 4BKGA 4GLRH 3ILPB 3H9ZA 1WV7T 2CS4A 4H7VA 4BWTA 1F2RC 2DBLL 4Z7VE 2Q6WB 4I3GA 5FKAB 4B9FA 4QRRD 3L08A 5DRXB 1WG3A 2Q5BA 1RUPH 4P23C 2HFGL 1G9NC 3ECWA 2AQQA 1PGBA 2P8MA 2AERT 3MRJB 2XNAC 3WS6A 3ABGA 2YUVA 1PZCA 4K7PY 4GBXB 3KPSA 5EU6A 1A3QA 1J8HB 5HHVL 4AY0A 2BM3A 2ACZB 1YEJH 1JNNH 3N1YC 2AXJA 1ZV2A 2ZP9A 1XLPA 4MM3A 1AD9A 4QJ5B 4NNYA 2MBEA 2PXYB 3ARTA 3LSOB 4FI8A 4HIJB 2LXAA 3ULUC 3IT6B 5JZEB 2CLRB 3V9EA 3UZQB 3LRSA 3F83A 4AM0A 4IBQA 4N86A 5K39B 1J10A 4I18C 2PR4H 4MNGA 1JDCA 4U6HB 3NMEA 5BS0B 2JJVA 5ACMA 5I17B 5MENE 4Q8BA 5C2BH 4G80B 1X81A 5K9OB 1TZIA 4XP9H 4G9FA 1XBRA 4NQTA 5JZ7C 2IPTL 2W07A 2K39A 1OANA 1DCLA 1S7SA 2PW2B 2DQFA 4GKNB 5JW3L 5E00B 3I9AA 1QOBA 1JWMB 2QGCA 1HTYA 4LLWA 2FJHB 3NHEB 1F4YH 3EG9B 1CJAA 1LK3L 4FMVA 2Q8BH 5FOBA 4EUPG 2CR0A 2KZWA 4HS6B 1K3IA 4M5ZL 5C70A 2I25N 2YPVA 4FXCA 2BC4A 4HROA 2BCKA 2XPGB 4PRAB 3Q78A 5ALCH 4K7SA 1GZQA 4RGNC 2WU5B 1DQQB 5CCJA 1NCCH 3S5YA 1WFJA 2EEFA 3U9UA 2PETA 4GG6E 1ZIAA 3MC9A 3FRUB 4PJDA 3WKPA 3RO3A 3TFBA 1KB5A 1MVYA 5A2BA 3PWUA 4P2OD 2L7JA 2PPFA 1YN4A 1AR1D 2HTLC 4F7PA 3IJ7A 3S6CA 1WAO1 1IGMH 4EBAA 4NQXB 4PJXB 5FGCB 3TH2T 4KGJA 2QSCL 5C0BB 2NNAB 4LBAA 2VSNA 3QS3A 1RFAA 2YZ8A 2NVUI 2MCNB 5JDSB 2MHAA 4LF3B 4ZUVB 1FGVL 4P48A 4XCYA 1MY5A 5CMAA 4BQ9A 3UJTH 4PRDB 3L9RB 1Y1UA 4RGOH 1E7PB 4XVSL 1K8IA 2FT7A 2PM6A 3U25A 3SY2A 4H20L 1X9UA 2PP7A 1EWCA 4ME2A 2XCMC 3CDGB 3X2QB 1A14L 5J13B 4HQQL 1G3NB 1G7MB 4RGND 5K9JH 5DVPA 5HJGA 3RKVA 4PLOB 5I71B 3X13B 1UOVA 3CXHK 5I24A 4IBVA 1CMOA 4CL7A 1DQML 3ECQA 4WNJA 3C08H 2HFTA 3QEGL 4F2FA 4AEIL 1XF4B 5KW9L 2F53E 3LCAA 5J56B 3BAEH 1G7HB 3F00A 4YHKH 3B7BA 1BQ5A 1JRPA 5PAZA 1PDKB 4WKZA 4L5FE 1MAKA 3DWLG 3BZ5A 4OAWA 2C9AA 1IX2A 1AIFA 1UA6H 1YPZB 5D2NA 2GRPB 1S7WA 3SKNA 3NCXA 4LASL 4NO3A 5FB8A 3KSQA 2IH8A 2Y2YA 2Y25A 3FO2A 2Z93A 3EO9L 3NDZE 3AW5A 4XOCA 2KFKB 4NN5C 3O2DL 5EBMB 3EO0B 3S36X 2RAMA 3O4LA 5CJQL 4DETA 4HKBB 5JW4R 4JK0D 1ASQA 1T7WA 1FRDA 3D51A 5DMYA 4KVCH 5HHOE 2YQ8A 5IGXH 1OAJA 4LEUA 4ZXBC 2P1YA 3E1F1 5DC0A 3SSGA 1A2YB 4X6BA 3RL1B 2RQEA 3FQRA 4UYQA 5CS7A 3KR3L 5SWSD 3ZDYE 4KGLA 5IG7A 3QDMD 4PW3A 3T0ED 4F2ME 3BHBA 1CLYH 4A7GF 1CICA 1PMYA 4NN7B 4OJCA 4ZO6A 1J1OH 1OPOA 1YEEH 4XOEA 4LOUC 3U48A 1NGYB 4HJKA 4GI8A 3BIAX 5E9AA 4M6NH 1MFWA 3ASWA 3HG1A 3L7EB 3L4YA 3QCTH 5B3SB 5HSFA 5ICZA 1RHHA 4GW1A 3HG3A 5DFWH 1DUZB 1RZGB 3B3IA 3O3DA 3RY5A 5C1DA 5BV1A 3GYRA 3RPIA 4EBQH 1M7DA 5TFSH 1TN6A 3KCWA 3C2AH 3DSFH 1YECL 2D73A 4TLSA 5D93B 3Q7FA 5LNK1 3PRPB 4M7ZC 3CSFA 1S0PA 2VSMB 1MHCB 4Q2ZA 5A2LH 5T1MB 3QB2A 3MLPA 3BWAA 3KVDD 3KYMA 1SEBB 3WNKA 3OKMB 2ZP0T 4HK0A 2A9CA 3EFDL 3V0DA 2QFRA 3CVYA 2FX9H 3HXBA 4ZYKB 1WMHA 4XGAB 1BECA 3U4EB 1AKJD 2DQTH 1L0PA 4BDVB 4PCSA 1IL1A 1L4ZB 2HRGA 4ZUWB 5FGCE 3VNYA 2VZKD 4I77H 2VR4A 4OJAA 3WE6A 1WPCA 3MNMA 4U3XA 3MRIB 3LKPA 1SBSL 3AAZA 3X11A 5BVJA 4Y9GA 1IFHH 4UANA 2A4ZA 4LGPB 1SMDA 2PP9A 3RA7H 1A4JB 5DA0B 2PWEA 5CBOA 1QWHA 1NOAA 2RHEA 4TXVB 3TV3L 1U8MA 2BTDA 3AT9A 4IRJA 5AKVA 5DJZB 3QJSB 2ZYSA 2GIXA 4XCFH 3RWGB 3PHAA 5K59F 2KD0A 1G6RB 1X3DA 3RRMB 2PJHA 5MP6H 5J11B 5CU5A 4OY9A 4HPHA 1WFUA 2EYSB 5I6PA 4GTSA 1W72A 4HI9A 5AUMA 5AW7B 5LBVA 4AQ8A 4AOFA 3WAJA 3EC8A 3QZBA 3P3SA 4MZ2A 3QI9B 4P9ML 5BV0A 3DROB 3RE0A 1YUHA 1VFOA 3EFOB 3UGUA 3C6LD 4LQ1A 3BQUC 4KTYA 3KDPB 2DKMA 2NX5A 5ITBH 2CO6A 4UBDD 3GMQB 4HK2A 3B2MA 3GS0A 1EVTC 2Y23A 2XETA 3RPKA 3CX5K 2VB5A 1OB0A 1RUQH 3A23A 1SDDB 1IKFL 4AV0A 3KBPA 3NEXA 4ZSOA 5I8OH 2F7IA 3PGFH 2D2QA 1OW0C 3UAFA 4K7UA 3N1GC 2WB1A 4QNPF 3I9V1 3GXUB 4JFEA 2EVHA 4FEMA 4RM9A 2OOEA 1CT8A 3T08A 1BQSA 2R1WA 4HKXA 4R4FH 4F8PA 1WWBX 5D7IE 5KG9B 3DHIC 2WNGA 1ZGLM 3V0JA 4LBEA 4KXKB 2IQAA 2NCNA 4HVBA 3QGVA 3IKCB 1FT1A 1H2TC 1V55E 2P5ED 3CFCH 4DZ8B 2AEPH 5F88A 3KAEA 2DMBA 4DN4L 4NY0A 1WZ1H 2OR9H 3QUZD 1YNLH 4KH2A 1OPGH 2WWMC 4C4BA 4G5ZL 3NFPA 4PS7A 4JO1L 2MBOA 1G0DA 1OZTG 2OMTB 4M5YL 4XMPL 4W6XB 1HZ6A 2IF4A 3DOIA 4RISH 1UM6H 4Y5YA 1BREA 4H4NA 3BKCL 4HFWB 5IT2L 3EDJA 4N2QA 2ICIA 4HJGA 4EN2A 1BLNB 4PWEA 3QDAA 3VFPB 5IM7B 3GOEA 4XNBA 5DJ2A 3S2CA 4GAYA 4JFDD 1TQCB 3M1OA 2DIJA 2YSTA 5IJDC 4LU5L 3CFBB 3QHZL 3LKOA 3V5DB 4M6OL 1UATA 2NW2B 1JNHA 5FHBH 4R4ND 1GYUA 4X4YA 5KSAA 2AV7A 2D8KA 4ELMF 5FO8A 3T2OA 1M9WA 2I1KA 2JSFA 3BW9B 3NZHH 1A4KB 3BH9B 4RGNE 3SE9H 4YFDB 1IAKA 1AAJA 1MX2A 1QWUA 3ZDMC 4ISVA 3FFDA 4U1SA 2FL5B 4M48L 1E7VA 5D5ME 3GSNH 4B53A 5EEYA 5CM1A 2PWHA 2QVIA 4J8DA 4GDKA 3BAKA 1EIBA 4LLYB 5G05C 1WXAA 4AXWA 1PX8A 5GSVB 4B50A 1S6NA 3P4RB 4NT6A 2KK8A 4PMFA 5IR1B 3OPUA 4QHKJ 4DFIA 1WZ0A 4N2LA 4ZNCD 3H85A 1J8KA 4ZDVA 2J1YA 3BWUF 4GQPH 3JXJA 3CFKB 5B7EA 5D0OD 1XGYL 3BXNB 3VFSB 3E2HC 5BZXA 5JA9A 3TSSA 4OLEA 4Y4KC 3ABVB 3EH2A 3VI3F 1T4KA 5EU4A 3NH7L 4PJFB 3ELQA 2MSED 3S5LB 5H37G 2MMXA 3A9KA 2O6CA 3RFZC 2M4NA 1HHJB 1GJUA 1XB3A 1XFPA 4J5VA 4MJ2A 4REZA 4R7DA 2OVBA 1T4WA 4PJHA 4XX1G 5HHMB 3KBFA 1TKGA 4XGZA 4Y4KA 5AQ7A 4RX4A 1XZ0B 2ZKYA 3ROLA 2H3NA 2QQKH 3U7AA 2N9KA 1RJCA 1TCRA 2L1AA 5AOZA 3GZOA 4UM8A 1FBIL 1XCWA 5HGDB 4RZCB 1E4WH 4WW2B 4MNQA 1J88A 4N0RA 2BB6A 4BM7A 1KXVA 2ATKB 3MLRL 1IBHA 3HZYB 5DEGA 2P2CP 4A3PA 2OYKA 2F8VA 1XR9B 4AIXA 3PDDA 4HGWB 4OZGF 4JFYB 4DP0X 3DX8B 5F9WB 3PY9A 4N2HA 5L6YL 3N1QC 3PNTB 4M3OA 5AIJA 1U30A 3ARBB 3N42B 4MB4A 4X7TB 1RV6X 1T6BX 3SDXE 4FTDA 4KBPA 4TTDD 3Q8CA 2KZTA 5CLZA 2YOAA 3QHTC 2E75C 5EBLB 3K6IA 3Q13A 4AK2A 4GG8A 2DYSB 2XIDA 3ETRA 2ITEA 2LT9A 5E2UH 2XQYG 2ZIRA 2WXQA 4O51B 4EN3C 3KWXA 5JW3H 1LJMA 4AIOA 4YX2L 2K6ZA 2NZ9D 2IPKA 4WFHD 5KSBB 3KPLB 2O6VD 4JN1L 1K5NA 1XO3A 5FF6B 3ZSSA 1BD2B 4HJTA 3IETB 4BT9A 4HC1L 1BI8B 4U1JA 4KGTA 1P7KA 3VDZA 3K72B 2F54E 3KJ4C 4A2MA 5DJXA 4JLRB 3LXBA 3LMJL 1NINA 3IFOB 3PNWA 2XOTA 2PPAA 4OF8A 2VIRB 1AJ7L 4XBEL 5IHUL 1TITA 2VDLL 3DIFB 3D9PA 1CIUA 4BWRA 4X2UA 3O9WB 3KLHC 3VD7A 2EXYD 1J05B 1F6LL 4XMWA 4TTDC 3UEZA 1KCUH 4PJ5E 1KCVL 4XAKE 3ZX1A 3FB8A 1BQUA 3LN5B 1EDYA 5CBAA 1IGCL 2Y7QB 1RPQA 2DQEH 1ZJBA 1KYOJ 3ILPA 4C55A 3ZDXF 3GMOA 4ILGA 1L3WA 4LPVA 1MF2L 4APQA 2GJZA 4K2UL 2E46A 1H6FA 5A16A 4W9GA 3S35L 3CQGB 5T1KB 5GZOA 5DC2A 1TT6A 4L0PB 3SDAA 2P8MB 1OSEA 1RFDL 4M3KB 2IPKD 3QJVB 3IU3B 3FU8A 2P80A 2FO7A 1UG9A 1WBZA 2ITDB 2I2OA 3O45A 3RBSA 3U2SA 3TPKA 5A40E 1ZS2A 5KJKA 3QUKB 4CMMB 2J0KA 5JQHC 4YSTA 3BSHA 2LTQC 5D8JH 4BBNF 1AYFA 4D7BA 2CLRA 1BP3B 1SPDA 3HKZA 4KQ3H 4YO0B 3UCQA 2KDYA 3RAUA 2XLLA 5C0NC 4JUSA 2VKXA 1UQSA 5B39G 1OGWA 4NQEA 4PJEA 1CTNA 1W0VA 5DD0L 2IOLA 4BUGA 3DX2A 1E9OA 5BV7C 2X2IA 5ID1A 3AE5B 2J1XA 1TZIB 1MCFA 3D50A 4OZIB 1BZQK 3FF8A 4IDJL 3QIUD 3TUOA 4EZKA 1JW9D 1WJ3A 4N5UA 2BNRE 1W0YT 3Q8FA 4R90L 1KYOK 4TRQA 1V3KA 3OMIB 1FVDA 4BSJA 3Q79A 4NCDA 1DJZA 1U8LA 3LS4L 5F7MC 1IM9A 4GRMB 2B0SH 3HE6C 1KLGA 3VXQB 1UH3A 1IHGA 3LVTA 3FKYA 3B8YA 5LP0A 5E7BA 3T6WA 4CU6A 2H26B 4UT9L 1HILB 1RZIB 1M56B 2VAJA 1SN0A 2XTJB 1ANUA 5AAPA 1PD0A 3DKHA 3CC5B 5GRYA 2R2BB 4PLKD 3G6DH 3CDFA 2MBQA 3EIFA 4NHUB 4I9CA 2H2SC 3G9AB 1H3VA 2ZPKL 3HMWH 4X42A 1SXSA 3UINB 2RGSA 3GJEA 3W57A 4H7XA 5IB5A 4QO1B 3I3NA 4F7PB 1YN6B 2PR4L 1TNZA 1YC7A 2XEEA 5J0BA 2OMZA 3DX6B 5JLZA 2HYZA 2XXMB 1VZIA 2OI9B 3M88A 4WCYL 1IFHL 3K2MC 1JBJA 2J8OA 3R9AB 3NSFA 1I8IA 2AF2A 2IOIA 4X6DF 4YBQC 3QIUA 1SJHB 4TXQA 4LVHB 4K5OA 4NO2B 5LNDA 2DWDB 2EIMB 2X4SA 1OGTB 4LLVA 1T83A 4YLQT 4UOW0 2XDHA 4NGHH 5M95B 1BVLA 4MJSA 2ICWA 2J49A 1OGAE 2KS0A 2NUTB 3PIQB 2EIBA 1KFAL 1YMHB 3PZ2A 1RWSA 3HDXA 2Z92B 2VRQA 4MTMA 3ESLA 2XYCA 4GRLB 4K8RC 2YEQA 1HNFA 4B9KA 2X88A 4MB3A 5C09A 5M72A 3HFFA 1XGQB 1C5CL 2VDMH 3P9LB 4KK5C 4DCQA 5A1AA 3CH1B 3ZUNC 4KJWC 1HEZA 4OLZH 5I23A 3B4NA 4HYTB 4KRPC 5EC2B 2FIFA 1WY8A 2K6DB 1FL6B 1GA2A 3VTMA 2ZOLA 2AJYL 1GGCH 3CZFA 3T04D 5DQDL 1N4XH 4M9PA 2XZAH 4HWEH 1NDDA 3DYMA 4PJXF 5M7QA 4QUOA 2MQ3A 3IGLA 2WIIA 1MJJB 4IK7A 1LL1A 1WF9A 4KVNL 5CIPH 3D39A 2OS7A 1HG2A 1D7CA 1DYZA 1EUTA 1IEBA 1NCGA 2YMOA 3KPSD 3QH3B 4BEPA 1U8PA 2A6KB 5G04C 5HJ3A 1FCCC 3UM2A 1A6VH 1HFAA 3BC9A 1BIHA 2EDEA 3LKRA 3VGDA 4Y2DB 4JKPL 4N0YH 3VYPA 1HX8A 2X6HA 2EDXA 4N8UA 4PI2A 1MF2H 3QFJE 1HN1A 2P24A 3Q3GA 5BXUA 4IG7B 5AW1B 1OF0A 1HE8A 4Y2DD 3QUZB 1R3JA 5T5NF 1CFTA 2DTSA 3BUBA 5JPNB 4O2FA 2CKHB 4CBZA 2WNMA 4I6GA 2X6UA 1VFBA 2VDPH 3D18B 4PGZA 4YXLL 4RFEA 1OAKH 4YE4L 4UMSA 2WXHA 4HJJH 1MJDA 3PZ4A 5E1AA 3LXFA 2F53A 4IRZH 1MLBA 2DLIA 1HIMH 1S8DA 1FV1A 3H3BC 5EYLA 3HS9A 2MYOA 1UJKA 2ZWYA 4QWWD 2AVPA 3OAUH 4IJ3C 3GSQB 4HA1A 5FHAL 3B6SA 3FONA 4BHUA 4EAEA 1YY8A 5HYJE 4DUWA 1JNLH 1KN4L 3J7HA 4TQEL 2H3XC 1GKOA 4U1MB 5D2LE 5ES4B 4L8DA 1T7XA 4TQIA 2GRRB 4OCYH 3SZKC 1EQWA 5F1IB 3SJVE 5J18A 5CERB 2VXUH 2FQGA 5LX8A 1RZJL 1T1YB 2O6EA 2BK8A 5TK4A 3SDCD 2Q5WD 5LWYL 1O6TA 2EE3A 1F2QA 2XZDG 1MDTA 2XRYA 2Z0UA 5C0AD 5CUSL 3IJSB 3JUEA 5KVDE 4D9LL 4LAQL 1BQLH 2JKXA 4AWJA 1P53A 1RERA 2VLMD 4YSXB 1A7OH 3PV1A 3QJUB 3DVGY 5F8RC 3SNXA 4C54A 4GDLB 2F37A 1RZ8B 1NKOA 2DQDL 3FXIC 3OXSA 3VHTC 4C0EA 3QX1A 4MAUL 1PLGL 1JWAD 3WIMA 2MA9B 2CGRH 1E8YA 4I48B 3NAWA 5IBLC 2WUBH 2CNYA 3SYOA 2CBOA 2A9ML 4U05A 1AZZC 5I1KH 2BRRL 2CUIA 5EUKB 2EYSA 1M1XB 2VDOB 3WTXA 4F9LA 2BSEA 2I60H 5KYYA 4ENEC 1J5CA 3R4DA 1S70B 1SN5A 4R8WL 1JTOA 2VLKE 4PREB 3WTUA 2UZPA 4JFPA 2V7HB 3CX5J 4OKVA 1V10A 5AAWC 1SE2A 1E8ZA 1KLGD 4DN4H 2KZBA 4IUMB 3QNXB 3H4FA 5AAMA 5BUZA 4K5CA 5KANI 3RIKA 2D03H 4KY1L 4AE0A 2COVD 5IESL 1SFHA 2IPTH 3NQKA 5SWZE 1WAAA 1SW6A 5DR5H 3BEVB 1IARB 2KJHB 1J18A 1JPTH 1NCNA 5FT9A 1JVLA 1FZMA 1PU0A 3KS2A 5I5RA 4W4OA 5LLIA 1D5MB 2BVUA 1QW9A 2GRNB 4HUUB 3RTQD 2C1OB 3PRZA 2IAMD 4AV4A 3VI4A 4JKWA 4ZMOA 1TKWA 4LEXH 3IPFA 1TPXC 1Y56A 1GJZA 4XDDA 3PL6C 3Q6FA 3ULVF 2EDHA 1NI3A 2WKGA 2JKTM 2HJLB 3SDDD 5IHZA 3WS3A 3UH8A 4DZBB 3MLXL 1OWNA 5E56A 4N2BA 2FCBA 2FIRT 2VISA 3IKCA 4WIPA 3SPCA 3UTTE 1KUMA 3QCVH 5F9DC 3M8OL 2P58C 2VGEA 1HKLL 2J1ZA 2WUCL 3WUWA 4LP8A 4AVJA 2Q8AH 1QPPA 1MCPH 1J9QA 2DWSA 3U8ZA 3V5HA 1S7QB 3SJVA 3ARFD 5C0BE 5EF3A 5EORH 1OT2A 4M3HA 4JCLA 3ZRFC 4ONFH 3EIQC 4YK4B 3QCUL 1C8QA 4FYQA 2F8YA 3FU7A 2EDNA 3JUZA 4HFWA 3UERA 1EAOA 4GYBA 2V3FA 2X9XA 3W11D 5A2KH 1AN8A 4QHMB 1I1AA 2YLHA 5HI3C 2B20A 3F6JA 5IM7A 5HDRA 4Q6IB 4UDUA 5ESQA 2C3VA 3LXUX 3N2JA 5D55A 2F0YA 3LKOB 4TUOA 3V5DA 2QEJA 2PCYA 1BGXH 2KJ6A 2A9AA 2H1PL 4OLWH 1YX5B 2UY1A 4S1DD 3W1ZA 4LQFL 4HJEA 4QRRB 3IXEA 3AG4B 4KJPD 4N39A 4WNQA 2X5PA 5GGTH 1WX9A 3S9DB 1GGIL 3QEHA 1CF8L 1UCBH 3SHQA 1MPAL 4FQ2L 4XWGL 1F00I 4A37A 3TT1L 1I82A 2C9QA 3QJFA 4L8SA 1TLMA 3UDWA 1X5GA 3F5WA 3ECBB 1NC4B 1YYLH 3TWWA 4KHTL 1AD0B 4QMEA 5HHQB 4K73A 2IWKA 2ZNXA 4HDIB 1AP2A 1NANI 1WCQA 2RDGA 3IXSA 3CD4A 3AZUA 3E30A 1ADQL 4GYWA 2B3AA 2FK9A 5CD3A 5FYKL 3ASNE 2YSSA 4JHAL 1VEOA 1B0GA 2A0LD 3Q2LA 4KK6C 4K5MA 4OZGA 5SX4H 2EYRB 1E8XA 3EF4A 3VUAA 5AD0A 5E6UB 4FQPA 2Y1VA 1BXXA 2EXWC 2FEEL 3K74B 4M7KL 2VDRB 3C60A 5D7JD 1JHTA 5IB3A 4UOJA 2NQ3A 2H8PB 1Z9LA 1NEUA 4FNSA 1KZOA 3W2DA 1STEA 4EI5B 2AJUH 1KJVA 3I6LE 1RZ7H 1KLUA 3FB5A 4HS6A 2LVCA 4QRUB 2VLKD 5I9QB 1A22B 3NCYS 1AQDB 1K50A 2TSSA 1M05B 2H6FA 2GUOA 3MR9B 4JM2A 4R7NA 3RGVB 3VQLA 2VLRE 1DQQA 2XV0A 3UKUG 1FVEB 3O81A 1HXYD 4ARIA 4M43L 2EDYA 2G9HB 4CVZA 1ZHNB 3EGRA 2E56A 3LKSB 1PD1A 1PEZA 1A6PA 3S37L 5AUKA 2ZAIA 5FZRA 3PWUB 1J0HA 4J8RB 3MLSH 5E6JA 1IC1A 1ORSA 3BAXA 4FQLL 1ZWIA 4PRHB 1VLXA 3GE3C 5DRZB 2LGIA 4CZ2D 3TJHC 3SQVA 1LEKB 3JUYA 1AR1B 5C0BA 4R90H 4M6MH 5JJ6A 1B6UA 4GXUN 3IFNH 4OH2A 4OM0L 3IMBA 3KHOA 2FWSA 3ZNGA 3PGCA 4Y5VB 5I30H 3WTYA 5GZNA 2X4NA 4E9VA 2VR3A 3PGEA 2ZNVB 1P84J 3CZSA 3HS0A 1AR2A 1YEIH 3B2DC 3CLEL 2HRPL 3IT8D 3M6DA 1HSBB 3CVBA 4QJ4B 2A6IA 4A7VA 4HIPA 4JJOA 1UA3A 3W0WA 3WHE0 1MI5A 1FXAA 3LPZA 1TT5B 4FFZH 1TETL 4UDTB 4KQ0A 2IBZY 2WLZA 5MEQA 4MAYA 1EH9A 3TGXA 4XTRD 4A3OA 2BUGA 1JPFB 3SFXA 1BD2A 1DVFD 3R06B 4OD3L 3TJPA 1CLVA 4F8CB 1NIDA 1H8LA 3BQUB 2BIIA 1V8CA 4EKXA 5DU7A 4CC4A 4CMHC 4K9EL 2O6VB 4MVBC 5H4YA 4E36A 1MJ7L 2VH5L 4N68A 3R7RA 2CA4A 4M0WA 1UM5H 1D9KD 4MA1B 2FQEA 1MXDA 1KM7A 4DO6A 2BVQA 2V33A 3NESA 4KUZL 4DUXA 4U49A 2IANB 4W9CC 3SHSA 2AZAA 4H25B 4ELME 1R5IA 2HTHA 5J1SC 1L3NA 4JANA 3VDAA 2PTTB 4B95A 5D6CA 4JFDA 5AOIA 3H1UA 4KDTA 1TLKA 3JCKC 1X4XA 2AQ2A 2Y4TA 3MRMA 1FRGH 3EO0A 5FQ4A 3QEQD 4ZRPA 1F0LA 2DQCL 2QHOA 3VR8B 3O6FD 1FAIH 1MX4A 5DVOA 4ZMAT 4JFHD 2H0JA 5B7MA 4ZOAA 5JORB 1G7PA 1P5VB 1N0XL 5CJQH 2C2LA 3MTRA 4CGWA 5D7IF 3U7YH 3ZW3A 2JRIB 4FRWA 1IBDA 3FQRB 5IG7B 1YZZA 5D7IB 1VZ7A 4NQKE 4OM0H 2R0LH 4BWUA 1JWGA 3QIWC 1QEWB 3CVIH 3RVWD 2C9WB 1CICB 2DM2A 3TU6A 3RWJA 1G6VK 5A6IA 4Q9RH 1QTSA 1KDJA 1AHKA 4M5ZH 3W5UB 5FYJU 5GS1A 1XH2A 2QJDA 5AYUL 3LYYA 1SA4A 4HALA 3RPIB 1AI1L 2W91A 1ONQB 4H5SA 5AZ2H 4QRTA 3FTVA 5EV7A 2FYYB 2MJWA 3HVEB 4XI5D 1QPXA 5I75B 2J5WA 1E9OB 1R19A 5EOCL 3UBFA 3UACA 1GIGL 5F9JA 5BCAA 3GI9H 1DLFH 4QI3A 4AH2B 3KPPA 4Y89A 3PWVA 4Y19A 5IHBA 1D6EC 1UOWA 1K8DB 4BELD 1XSKA 4CSZA 1WH0A 5B1JA 4MDIB 4WAFA 4PJ8C 1ITCA 2LABA 1ITBB 5DZ9A 4ODVL 4NURA 3GKZA 4ZUWA 3U1SH 3VRLE 1WI0A 3ZZLA 1TZHB 3EJQA 4JQIA 3NJLA 1CJEA 1NMBH 2N1TE 2ZCLH 4A04A 2VM9A 3GJFH 7CGTA 3VGAB 4YDZA 4YPGA 1TYGB 2R2BA 2OZ4H 3FCUB 2VRKA 2R0WH 5HDQL 5FZSA 4JPWL 3WCQA 2J88L 4PB0L 4P5KB 4MA1C 3OLEA 5BVPL 4NUJA 3GSWA 1UM4L 1URZA 1RSFA 4NJ6A 3OKEB 4DK3A 5EU5B 3WFEL 1CLOL 5HVGB 1R3KB 5HGHB 3P0VL 1SHSA 4OGAD 4J27A 1V1PB 4LHUB 1A7RH 5HHOA 3GB7B 1U8NA 2Q20A 3GSRB 4LOVA 4G3XB 1WWWX 4PVLA 1ZY9A 2ZF8A 1KYAA 2FWOA 3LPOA 3ROOB 4AUUA 1HHGB 1W72B 1SOSA 4Y19D 3U83A 2W80C 5DD6A 5FDYA 1QAWA 3V0WH 2Q7YA 5H7PA 1ET8A 2DM3A 1OOWA 1XR8A 3Q8BA 4JFUA 2ICWB 2JV6A 1T5XA 4O02H 3NP4A 1C9FA 4I2XE 4HOUA 3DGDA 4JKMA 2YZ1A 2NUTA 1WIUA 4PJHF 5GRVK 5ABZA 2Y5PA 4FQCH 1TMCB 4LIQE 4FF9A 1G9EA 2XZTG 1DE4A 4C0MA 4RMRA 2GTWB 3SFDB 4U6YA 4E9XA 4Q9QH 4OVZA 4EMZA 2V8LA 2GSIA 2KC2A 4DX7D 5HJDA 3BG0B 1OXYA 2AVFA 1EJFA 3ZDXE 3SY0B 5BOJA 4F1SA 3LKQB 3FOMB 1THAA 2X0WA 3VYNA 1BM3L 4MDJA 1R34A 1HWGB 5F7BA 4ODTH 5FKAA 4LBEB 4O00A 3AS5A 5BYRA 5FECB 1M7XA 1JPST 4BFKA 4JKKA 5F88B 5HJ3B 3VFWB 2JU6X 3OMAB 1JGIA 1P4LA 3QIBC 5IVXF 2VN6A 4PYZA 4C56C 2P24B 3PXHA 3G2WA 1GGIH 1GC1L 1T0NA 1WUNT 4JA7A 1JPTL 2YXWA 2J2ZB 3RGHA 3TV3H 1OY3D 2EELA 4RGNB 3RZFA 1A8JH 1OCOE 4ZTOL 1SOKA 2I9CA 1A7RL 3TYFB 2ZXWB 1PKQB 2O5YH 1VFBB 3D18A 3MGTB 4D9QD 2NS5A 3A4RA 2E27L 4S1RL 1G7LA 3BPNB 5CJ5A 4OI8A 3IBOA 5JOEA 4BE6A 4BRJA 2ZSWB 3QNYB 1FIGH 5DVKA 1P5UB 2V5TA 3SE3A 1QR4A 3ZYJA 2IWEA 4KUCD 1E2ZA 4LSPL 3V4PA 1BCIA 3CBKB 3OXRA 4TVPH 3WENA 2KBXA 3BYYA 5FGSA 4LK4A 3FRPA 1OW0A 4RRPG 4XKCA 1HOCB 4QTHA 1F1DA 3ZKJC 2XN1A 3B6SB 3FONB 4NAQA 4XMKL 1R4NI 2VDLH 4NQQA 1NGPL 4HUWB 1NCDL 5AVQB 2EICA 5FYJE 3IDYB 1KB9K 1PLGH 4XXCA 5D3DA 1U95B 1ENFA 3NJIA 4A2FA 5F7LB 3F7VB 3V8OA 4L8DB 1INEH 3AKLA 1RZKC 4LNKA 2I6HA 3KYOA 4H8HA 5DGRA 1ZANL 1XZWA 3QK0A 1S7UB 2NY1C 3IRPX 3NJXA 1WUZA 5IEKB 4NT6B 1JERA 2JI2A 2XPIA 3KWWA 2GSGA 5EILA 2V1YA 4BD4A 1AOZA 1SOXA 2X40A 5SWSB 5FK9B 3NIFB 1V7NH 3PWPB 3V6ZB 2D7TL 5I8CB 2FAZA 3CFKA 5MP6L 1HCFX 2AHIA 3VFSA 1XQQA 2APBA 4XVJH 2KLCA 5JDSA 2ONDA 4ZAKC 3LNFA 3Q1SL 3NY5A 5ITFA 2YHEA 2VSOE 3GSOB 3L9RA 1PLAA 5JPMA 5E2WH 1LMKA 4NKMB 5ABDE 3ULUD 2IWGA 1NGQL 2DQGL 4YN3A 2DQIL 1TKYA 1EANA 2EDLA 3K8MA 3ZE1E 5F96L 2PEAA 3HHSA 4EOWL 1LO3L 3WY2A 2Z64C 3A9JB 3F64A 2AV1B 4LNIA 4NWTL 2C4FT 2WQHA 4R8WH 4P99A 1OHQA 4MZIA 5I1GH 4HCRA 5T33H 2VR9A 3EFCA 2CO7B 3KE0A 3OAWA 3GC3A 1DDHB 2W0KA 3EYVA 3OX8A 2FIKA 2W95A 4PWGA 5FUCE 4ELKA 1D5MC 1CLCA 3B37A 5E94A 3B08A 4WZ9A 1Q9OA 3P0YL 1CURA 2H45A 3H7BB 2VE6B 1ZK5A 3HMXH 3I50H 4P2QD 3S36L 1Z5LA 43CAA 2NY4D 1OV8A 3HVDA 5J6GA 1SLWA 2GCYA 4TKWA 3ARBA 2P45B 3JVZX 4OD1H 1HA5A 3GMNB 1L0YA 3S4SA 1MNUL 3TCTA 3BT0A 4WEMB 3FTSA 1B4JH 3PYCA 2JKJA 4Y5VC 2NYKA 4LNOA 4NQDE 3O4LB 5JJ7A 1BZDA 1CL7H 2KWUB 4XRCB 1NL0H 1NCWL 1JF1B 3NH7H 4X6DB 2QGDA 2BSRA 3EADA 2IVFC 2XN9D 3IXTA 2L32A 1SEQL 2OJZH 2VISB 1T21A 1JV2A 1WTGT 2VW4A 1JWUB 3FQYA 1JZ4A 4QY8B 1IGDA 4YDVB 4YIQA 2IO2C 2OXGB 3S7JA 4C4VB 3U9WA 4MD0A 3CDYA 5ENOD 2NPTB 3ZTDA 3V5HB 1UTDA 3JBG7 4A3VA 4P05A 2R05A 2CFZA 2B0OE 3L7EA 3MLTB 1F11B 2VIRA 5CJOH 4ZFHA 1DUZA 1MW0A 1RZGA 4PBDA 4BZ2H 3W9EB 3BUAA 4KROC 3DDGA 5FYLL 1KXHA 2KT7A 1MW3A 3MJ7A 4W9HA 4OFVA 1HT6A 4QKTA 3X14B 4YE4H 1V2YA 3IFWB 1TENA 4NAMA 2Y06H 2ZSVA 4Q96A 2Y6SD 3BWAB 2ETWA 3IJHB 3QQDA 2B4CL 4XHJD 1DQLL 2G30A 3KPRB 4HUXB 4UZUA 1Y8RC 2YQ3A 3SDDA 1OGAD 3FTGB 1G5AA 1L9SA 1I8MA 3O8XC 1M1SA 1CU4L 4LU5H 2OVFA 3M1CA 4WNQB 1SMOA 5EUOF 2FNBA 2OMYA 3NA9L 1B3JA 2EIEA 1UT1A 3AY4A 2P28B 5JIIA 3UTTA 3ZE1B 4X99B 1I9IH 3CFUA 3ZKXC 4NP4L 4HEMA 4KHXL 3S8WA 3AAZB 3UOAB 1WCBA 2UX7A 3ARFA 1HH8A 3QIUC 4NKOA 4XB3A 1T22B 2LWPA 3GSUB 1TNOA 1HC1A 5CHFA 3WAOA 1UQSB 2BZDA 3WO4C 1A4BA 4APXA 5EX0A 4AUYA 1U8MB 3LNGA 4IRJB 4RGOL 5DMKA 1E5WA 3TLRA 4TUKH 5DT1H 1JNNL 1SUHA 2X8XX 4BKSD 2OTUA 3MACH 1MQKH 5EDSA 4Q6IC 4F93B 4HXBL 1A8ZA 2GHZA 5BMFL 4JY6B 1FVDB 3EOTL 2L4OA 1EPUA 2G75A 2NX5D 4G8GD 3RWFB 2CJSA 3FB5B 4QRUA 3FTYA 1TVHA 4B0MM 3HNSH 1P1AA 3FB6A 1TTUA 1FIEA 4LARH 3KVQA 5G5DA 4RMTA 4P2AA 4HISA 3MJ5A 3DV4B 3EJZC 4X5WB 2DQJL 2NX5B 3MOBL 4LSTL 4NBZB 3RU8H 2FIDA 4NS0A 1A7QH 4G6KH 4JPKL 4NHUA 3RGVD 3V0HA 4ZUTA 2V2TB 3ERXA 3DDCB 4PWIA 3VRJA 2DM4A 3IB4A 2B8OT 4Y9FA 1WD9A 5CAYB 3PU7A 3NTCH 5EC1A 1ORSB 3L4UA 2V3NA 2ADGB 1AS7A 4ADJA 4JRWA 3MROB 3QJOA 4B6WA 1CGTA 1A5FH 2C9VA 5KCMA 5E9NA 5C0AA 1DBAL 4RH6A 3CMMB 3ARDB 4YR6B 5TDOB 2LAAA 3T1FB 1RY7B 3MBEC 3FCBA 1VIWA 2OHFA 3FNKA 4XB8A 4L9DA 4CC0A 4XI9A 1QSFB 4G9FD 3CF6E 3F3HA 3K9OB 3QA8A 5BYQA 1XSOA 1OGTA 2ZICA 4LVOB 2Y7OA 1OF2B 1S9YB 2BYFA 5ENWA 4F91B 4OIFA 3MX0A 5C8JA 4PAZA 3KJ6H 2R2HB 1BFTA 4R7VA 1AQ8A 1OP3K 4N9GA 1N94A 1Y7VA 3GZQA 5E5LA 5AW4B 2J7QB 3HLKA 3SJVD 2HJFA 3D9JA 1MRFL 2IXQB 4JPVL 4XN9A 3BP7A 5JHMA 3FQNB 3I2CL 3NFPB 4I89A 2XIBA 4G8GE 1EGJH 2O93L 2B2XL 4UF7C 1QASA 2CLZB 4CSTA 3V30A 3ZQ9A 4YQXL 1S9VB 4RAVA 3PJLA 4LUNU 1LEGB 3OLGA 3TJEL 3X1EA 2R0LL 4EPSA 5JQIB 1O5MA 4M0WB 1PTZA 2OCFD 5DS2A 1IAMA 2ODIA 1L7TL