4XE0A

Idelalisib bound to the p110 subunit of pi3k delta
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
917
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural, Biochemical, and Biophysical Characterization of Idelalisib Binding to Phosphoinositide 3-Kinase delta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
total genus 263
structure length 815
sequence length 917
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4xe0A05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xe0A01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4xe0A03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xe0A02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4xe0A04
3HHMA 5CCHE 4DK5A 5CCGE 1K5WA 3QARA 1W15A 3PS6A 1GMIA 4IQHA 4KZ0A 4Y1SA 3ZW3A 4FADA 2Z0UA 3T8MA 2Q3XA 1UGKA 3CSTA 1DJXA 4UWLA 1E8XA 2CHZA 4OYSA 2WXRA 2V4LA 3JZYA 4DNLA 4F92B 2R83A 2CHWA 4F1SA 5JHBA 3MJWA 3ZIMA 2B3RA 4LDCA 4ANWA 1YRKA 4UWFA 4NS0A 3NSJA 4FJYA 1HE8A 3L13A 3QR0A 4F91B 4L2YA 1DJGA 2NCEA 3APDA 3RDJA 2YOAA 3APFA 1E8YA 4XZ4A 3QR1A 4QAMB 2X6FA 3ML9A 4ANVA 1DJWA 4QJ4B 3L9BA 2WXHA 5T8IA 1QASA 3FDWA 4ANXA 4L1BA 4F93B 2NSQA 3NZSA 4TUUA 3B7YA 4QJ3B 4WWPA 3L16A 4AJWA 2UZPA 1W16A 3N5AA 1DJHA 2K3HA 2ENJA 4HVBA 4GB9A 4TV3A 4UWHA 4UWKA 1V27A 4ICXA 5KJ7E 3IM1A 2K4AA 2D8KA 2X6HA 2WXFA 2WXIA 3KWTA 2WXPA 1DQVA 2WXOA 2N1TE 4TS6A 2FJUB 3HIZA 4PS8A 4FHKA 3LS8A 3W57A 3PFQA 5EDSA 3APCA 5ENNA 3LJ3A 4IHBA 2DMGA 2ENPA 4EZJA 4MJJA 5ANLA 3PRZA 4WWOA 3S2AA 2ENQA 2NQ3A 4KZCA 5H4YA 2X38A 4G11A 4WEEA 5CCJA 2DMHA 3QAQA 1TJXA 2WXJA 2QZQA 1BYNA 2LHAA 1E8WA 1CJAA 4OVVA 3ENEA 2ISDA 2I9CA 2Y3AA 1A25A 3NZUA 1WFMA 3OHMB 3F05A 1RH8A 2KI6A 3TWYA 4WAFA 3GPEA 3TL5A 2CHXA 3IBEA 2X6IA 4NPKA 3R7QA 2EP6A 4XX5A 3L17A 2BWQA 5H4ZA 4PS7A 3DPDA 3P2BA 3QK0A 3IHYA 2CJTA 3M7FB 4LT7A 2K45A 1DJIA 1DJYA 4J6IA 2CM6A 3KWUA 2FK9A 3F01A 3ZVVA 4OVUA 3RPBA 3L08A 3ML8A 2A4ZA 4XE0A 1UOWA 1DSYA 4PS3A 4PH4B 2CJSA 1RLWA 4NP9A 3L4CA 2CHDA 3L54A 2Q0ZX 2WXMA 4Y1TA 4FJZA 2WXQA 3F00A 4ICWA 3HN8A 1DJZA 1RSYA 4BGDA 4URKA 2WXNA 2X6KA 4L23A 2ZKMX 4LCVA 3W56A 2A5UA 1E90A 4GNKB 4QJ5B 5G55A 1QATA 2WXKA 1UOVA 4KITB 2WXLA 4A55A 4NPJA 3R7RA 2QZ5A 4FHJA 4JPSA 4AOFA 4HLEA 4FULA 4FLHA 1E7VA 2X6JA 3TJPA 5G2NA 4EZKA 3QJZA 4ANUA 1BDYA 3OAWA 5JHAA 2YRBA 3DBSA 1CJYA 3F04A 3SD5A 3PYCA 1WFJA 2RD0A 2WXGA 4V11A 3CSFA 3PREA 4FA6A 2K8MA 4EZLA 4WWNA 1E8ZA 1E7UA 1BCIA 2CM5A 3FBKA 2JQZA 4UWGA 4L1LA 4BFRA 1TJMA
chains in the Genus database with same CATH superfamily
3THML 3HHMA 3VFNB 4DI4A 1GY1A 1X6LA 3SPVA 3ESNA 3VDBA 1KTKE 2M4NA 1XEUA 3ORJA 4PHZA 3V9FA 2KQ7A 1XF5B 4NO2A 2D5GA 4E3CA 3I6KA 3UTMA 2DYPA 4UB0L 1O6SA 4JMNA 4ZO9A 3VXOB 3C6SB 2CZNA 4CGTA 1J8RA 1LWHA 3AEBB 4OAUC 2ZUSA 5LHDA 1XF2A 5SV3A 1I1YB 1JZIA 5ITFB 3WLBA 1YC7A 4KUCD 1GGTA 3EADA 4MRCA 4X5PA 1H8SA 3VXUD 4KKZA 4M7JH 1KRHA 4LVOB 5A2BA 4NAJA 4Q9QL 1KLGA 2KTRB 3U6XS 2Y7OA 4KZDL 5B1CA 1MIEH 2HKHL 3AJ7A 2ADFL 4OZHA 3SFZA 2VMEA 3QFDA 1SVZA 2COVD 4XCFH 3P0VL 1XLPA 2D3CA 1H3GA 1ZVSA 3DX4A 2IG2H 3CTTA 3QWOB 3T6XA 4LCIH 4OLVH 5HHNB 3AULA 3AXLA 4MDRA 1O1TA 1PUTA 1G1OA 4EPZA 1RJZA 5D0OD 4C57C 2JKTM 5FYKL 2O6EA 1OQYA 3GMRA 2ID5A 5MPOA 4GLRH 5D71H 1MG3C 5GS1C 5CEYB 5F7AA 2CK0L 2N9LA 1B0GA 4GW4B 5J13C 2VZTA 3BP5B 2P9RA 2NBVB 2O61B 2GSIA 5INDB 2P8LB 1BD2B 3QSKB 4N8UA 1ULVA 1JPSL 2WNGA 2JLPA 5LGHH 2QMKA 2R8SH 2WWKT 1NGQH 2ORBL 3OMAB 2IGLA 2UUDK 2W94A 4ABVA 5AQ9A 1E9OB 1P4LB 2V1YA 5D2LA 1J87A 3OC8A 4A68A 3PHQA 1A1MA 4FX5A 4BCXA 4U0RC 4AYFA 5J1SC 3N42B 1XXGA 1TEGA 1UWGH 4DTGL 4R7NA 3Q9UC 1I4GA 4HPPA 4PTUA 4TQ8A 1TO4A 1JZGA 5K9QI 2BP0B 1SXSA 4MXVF 3P4QB 5JW3L 1K1BA 2HWZH 2OVFA 3U0WL 2V33A 5DJCB 4ODHL 4B0MA 4IOIB 4EIGB 2LR4A 5FEBA 1YAZA 1UZ8A 3PLYA 4GDLB 4H5SA 5C08D 4WNDA 1A7NL 3EHBC 3ZLZA 2IDUA 1O9ZA 3TO4B 3KM2A 1NOAA 4HS2A 1U8KB 4P9HL 1E9QB 4KKCD 4QXTB 1K2DB 1MX6A 4NQSA 4XOEA 2CKBH 3EH3B 3ETBF 3I85A 2QVIA 1WT5C 4YL9A 1NGZA 2AJVH 1GZHA 1F77A 3NJXA 3A6BH 3DPBB 2F0CA 2OW7A 3VFSB 2YNQA 4A04A 1I4HA 3S37X 4FLHA 3EA6A 1RVFH 2XVKA 3QJRB 4MS6A 1HL8A 3BPLC 4Z7QE 1EEUA 1K9TA 4PW4A 4IWOA 1MG8A 3TIEB 3N0AA 2ICEB 4MMYB 3I6GB 1F2QA 3CZJA 1BZ9B 4A2EA 2J8UA 2WP3O 5FA4B 2D7PA 2M0XA 1HL5A 4G6AC 1MJJA 5K69A 4OD1L 1M3JA 4A67A 4CMHC 3HUJA 2PN5A 3WU1A 7PCYA 1ZEAL 2QJDA 2Z8WC 4BBWA 2IH9A 4MNGA 3GUTB 3PP3K 3JUIA 2CBTA 2R2CA 5AAPA 3SY0B 2XGSA 4FQLL 5BQ7B 3UJTL 4LCUB 1KG0A 1YQVL 4E41A 1U2VG 2X0VA 2HRGA 5ID0B 2AWIA 1NMAH 2PABA 5E8PA 3EAKA 5JIKA 5HHXL 3FONA 3TBSB 1LGRA 4KUZH 2AI0H 4AWJA 3QR0A 3VA6A 3DMMA 5CFAA 4YTMB 2FBJL 5TE4H 3HG0A 1MFWA 2VDNB 1SOQA 4Y2DA 5CGYC 4A90A 5I16B 5DMIL 2V8SE 2VH5H 2CQVA 2BYTA 4LLMA 4NC2B 2W8CA 3MSPA 5BUGA 1S78D 2ONDA 2XN9C 3ME0A 4M5YH 5DJXB 2HT4D 4LLWB 2FX7H 3IEGA 4HI9A 5HBBA 4AGOA 1TEFA 2VWEE 4MA7H 1CI5A 1M71B 4II2B 4Y4KA 4JL9A 3M62B 4L5FL 4BRJA 1P6AB 3WIAA 2H6UA 3KJ4B 2NY2C 1YEHL 5FB8B 3PV1A 4I9WD 5H92C 1AKJA 3HXDA 1OW0C 4I9CA 2WTPA 3VXSE 3WXVH 3KUCB 3SOBH 2RCSH 5KJLA 1N6UA 3DRQB 4MDIA 2CFZA 3FHQA 3HLAB 1WZ1H 4ILIA 1DQDL 5L4JA 3Q1SL 1YEJH 2AGJH 2RHEA 2NYYC 1UEMA 4OJEH 2VWEC 1I8IB 4EE2A 1TS2A 3MLRL 3SO8A 3KYKH 3BQVA 4K7PH 1GAQB 3BIKA 5E5LA 3GC3A 1FJ1A 1Q9LB 4XAKD 4E41B 4DVBA 5ERWB 2LASA 2WQUA 3F7RA 4PJ7A 5DJ6B 3BYYB 1OARH 2B5IB 3Q3FA 2AQ3A 2GKIA 4FA7B 4BCYA 3ZOAA 4KMTH 3HG3A 1L4IA 3SO3B 4R7NB 3WJLC 1IQWH 1JVOA 4J4PC 3LRLA 3VRIA 2FB4L 3GRWL 4JHAH 3UQ3A 4PLJD 5IW6A 4DP4X 5AARA 4LEXL 1YEEL 2J12B 3V55A 3MJ9H 2CDFB 1IBFA 4OLYH 3K2KA 3SCMD 4FL4B 4LQ1A 1PY9A 3WENA 3CXFA 3ZE1F 3QIBD 1JF1B 1NCCL 2Q0ZX 2GRPB 2V0GA 4JRFA 1DN0A 1TS5A 2JELL 2BYFA 4UT6L 4MXWL 4DPCX 4KX9A 1CGYA 3J5PA 2XN2A 1SN0A 4W9RA 3M7OA 4QAWA 3I63C 1TTAA 5FYKE 3X17A 1U6AL 1BQRA 5C0FB 4PLJC 1U95B 5T5NG 3EH4B 1XIWA 2IO1B 3AEAB 1D4BA 2QADC 5LO7A 1JV2B 2CRIA 4GP5B 4GIVA 3V4VA 3E38A 2Z35B 3GS4A 3OZLA 2YRBA 4RISL 4Q9RH 2WB1A 5AOKA 2X2JA 4M6OH 3RAJH 1KJ3H 1MX4A 4WSKA 4JM4L 5DMYA 4JFFA 4PSRA 2VW4A 4KKNA 4GY4A 3FRUA 4ADIA 5J0BA 1GXEA 3BIKB 3O8XC 4HUUA 1GC7A 2VXQA 2VL5B 1QVOA 2YOCA 4G8KA 3N85H 3HE6A 1MCIA 4BFGA 1M7DA 1ZWIB 2F68X 3T8MA 4M7LL 43CAA 1BMWA 1KF6B 3HE7D 2BLFA 3O4LE 1OF2A 3WD5L 4G1MB 3ABKE 1MI5B 2OZ4H 1B0IA 1GGBH 4AEEA 2YAFA 4OZGF 2ERJB 1UG9A 3FFCA 2FAUA 4N0UE 5E8PB 3TBSA 1W3BA 1JNLL 3PHXB 3NOGD 1U42A 2FQEA 2L04A 3OR6B 5EORL 4XZ4A 1GR7A 3QP3A 5FYJU 4ACKA 3PZ8A 4KGSA 1I3GL 3WA0A 3LRMA 5BV7L 4W9KA 4QHUB 2YHEA 1YMPA 2GJ6D 4PJBE 3T09A 3MKKA 4Z77A 3NCYS 4GZ6A 3UXGA 3Q8BA 1FGVL 4ODWB 3SF4A 4WWKA 4Z7VF 2YPKB 1U8PB 5E1IA 2A99A 2H32H 1XTLA 4M7LT 4MQXC 3DHJA 4QYOB 4U3CA 3S3JA 4C83B 2J42A 3IN0A 4IKNA 2WANA 2EIJE 1X5MA 3LEXA 4LKXA 4AUUA 3QWWA 3DWGC 4HCGA 5KVFE 1RUKH 3ZL4H 3KD7A 4K8RL 5SWQA 2NBUA 1SM3L 3Q78A 4LSRL 4KROD 2I32A 4NWUH 4X6DA 3AWEA 1T0RC 1PGXA 5G05J 1GA2A 2KDGA 2WYIA 2YD5A 3RBGA 1MLCA 1Z2MA 4BUQA 3NVZA 3B7UX 3BKCL 3KPOB 4AQOA 1DBAL 3GTVA 5G4OA 1MG4A 5FGCE 8CGTA 1G5GA 1T83C 2VLLB 3MGAA 1AI1L 1I1AB 1NCBL 1ZT4B 4I48B 4DX6D 4EUPH 1F11B 2BXZA 1JGEA 1N0LA 3OSVA 2WQRA 1UACL 2FX8L 5TF0A 1NCNA 2ACZB 1KCUL 5LQBH 1U41A 2QVTA 3G2TA 4OZ4B 2WMOA 3BQOA 1M1XB 5BRZD 3D9KA 3BLPX 4ZAKD 4Z7OF 3GJFA 1QBLH 2HZHA 4ZTOH 2L7JA 1KPRB 2YRZA 3ABZA 3BT0A 2VDQB 5EWIH 1RMFH 1G1KA 4AT6B 1T2JA 3ZXSA 4CDMA 2ZPKH 4ZW8A 4K23L 5I17B 2KC0A 3RNCC 1AXTH 3MRMA 1WXSA 4MJHA 4O2EB 1NDGA 3LKNA 2ZGDA 4FQQB 4KH2A 2LJ5A 3ZUVB 1INZA 3I74A 2QYJA 4TL4A 2AF2A 3AU4A 3B2UD 1AJ7H 3UPRA 3VXQA 2GRMA 1A3ZA 2WHVA 3SZ6A 4DP0X 2ZPNA 4B9CA 1DJZA 3CVHL 2GTZB 2Y06H 4BDVA 1WRDB 5JPNB 4EXKA 4U31A 2VSKB 3GMOB 4U0UA 1H8NA 2NY6B 2IQCA 5DPSA 3MLXH 3KW7A 1P5VA 1HJBC 4IGBB 1J8HB 2AVPA 1OAQL 3VCLB 1KIUB 3KMDA 3QQ3B 4Z3FA 5EBLA 1H2VC 3B5GA 5CNHA 4D9RE 5I8CA 3U4BL 3ALPA 2K8MA 3T4YB 3FTYA 4EI5A 2DQTL 4DZ8B 5KANG 1IUEA 2K39A 2VLLA 4ZQTA 2E6PA 3EOBB 5L0QC 2EIKE 5G5DA 3EF4A 2E46A 4X80L 3EHQA 1A14L 4D0BB 4F37F 2G2RB 1QTSA 4JFFB 3RVXC 5C0CA 2VDLH 4HFGA 1O7SA 2OXHB 1I8LA 2E7LA 4QHLB 3VTMA 4BQ6A 3OLDA 3SJVD 4K5NA 3O2DA 3TASA 4NAWB 4YHNA 2A73A 3CBRA 1EQWA 3EDFA 5CEZE 1C5CH 4F91B 4BQ9A 3IT8D 3P9MA 1HDMA 3DI2B 4UINL 4EVNB 2XPZA 1R5WB 4NN6C 4EKXA 4FABL 5GGTL 2QV2A 4M4RA 4YDJA 3EYUH 4YDVB 2HMID 1EH9A 3CHRA 5TQ0L 5CXPA 5FM4A 1HYRC 2P52A 2DLBA 2JJTC 2VW6A 4H13C 3WS6C 1FC1A 4BFOA 4ENZA 3JXAA 5C6TL 1CFTB 1UD7A 4NZ8A 1AS7A 1IGCL 4U7SA 1BLNA 2OJEB 4U4IA 3TWCL 4CUCA 4YSEA 5KANI 3B7SA 2Y36L 3TYGH 4Q58C 2WBJD 5HGBA 1RFKA 4DCQA 1BF5A 5EBWA 4Y1AD 3I2CH 4H8WL 3GP7A 2R0WH 3SB3A 1UH4A 3BKYL 1KZYA 1CYWA 2GIXA 2YC1B 1F41A 3FO2B 5GRXG 2WUBH 1JRUA 1AS8A 1G7JB 2D2CC 4YIQA 4XNYL 3QQNA 2GW5A 2C9QA 2UWQA 4AKOA 2DLFL 2W59A 5LCWC 3K7UA 2IH3B 3S98A 1BF2A 2GITB 3AM8A 5JQ6H 5MHSE 3A1QB 1II4E 5KSUB 4ZFOA 1L5PA 5C08E 2F19L 1U33A 2J8HA 1JNJA 3ASNE 5E75A 1H3WM 3LIZL 4H20H 4BCZA 3IB4A 1UA3A 1OAYH 1NVID 3BUPA 3I9GH 4NB7A 1D7CA 3TBTB 4N2AA 3UZQB 2L0TB 3I6SA 3Q2WA 2EH7H 3FQ2A 3H9HB 3QQ4B 4OTXL 2G4GA 4K5OA 2BO0A 3TBYB 1AACA 1KXHA 3K1DA 3VTXA 2F7OA 4M6NH 1RP9A 4NFDA 5AL0A 5I1CH 3RUIB 1GS6X 4FQQA 4YHZL 2WXQA 1F56A 4WU7B 2OX5B 3AV8A 1FAIH 5K33A 2A74A 4QRRE 4B3EA 4L23A 1IKND 4GW5A 5HHQB 3IAQA 3V6CB 5MERA 1IGIH 2ENYA 2AJZA 2TSSA 3HC4H 4RMRA 2DEXX 3H42L 1YYLH 3QCVL 2E7LC 5AZGA 1UB5A 2OM5A 4HKXB 2FL5A 2ZCCA 4BSWA 2XHNA 4HRLA 4YBLC 5D1XE 4D0CB 4XB8A 5D7KD 4E9WA 1JUFA 1R3IH 4HDOA 2XZAL 2DKSA 5I18L 4YDIH 4GU5A 1BIIA 5DD3L 2DDQL 1LO0L 1WRFA 2RMNA 1PG7X 3MYVA 1ACYH 1KGCE 2OMYB 2ZX9A 3ASWA 3RLSA 4ILDA 2FR4A 1CLZH 3US1A 1PLAA 2EE2A 5F8RC 1SJXA 3RRMB 4GYYA 4JW1A 1U30A 5C1ZA 1FP5A 1T6BX 5KG9B 3RWDA 4ONGH 3QZWA 4IDJL 4N9GA 4KTGA 4CL7A 3ASGA 3RSEG 2JZPA 2G2RA 3NCBB 3L82A 2L00B 5CJ5A 3RKVA 1PCSA 3D07A 3OAZK 5D6DA 1X9QA 4WJNA 3B56A 4RIRA 5BT1A 1KBBA 5HI4C 5IROC 2APXA 4EKJA 4NBXB 5SWZE 5JTWA 1TZGL 3Q9PA 2CHNA 4FZEH 4HC1A 3QI9C 2JEKA 1FE8L 3IJHB 2YHCA 4PTUB 4R4FL 5HVHB 2BSRA 4QRUA 1BBDH 1HNGA 5E6YA 5DHVA 2G2NA 2DWTA 4MQTB 2UWEB 2MWSB 2HG5A 4L0PB 2NW2A 3EJZD 3TONA 3NY5A 2Y4SA 1RUQL 1PX4A 3UM2A 1ZDSA 5F9WC 4ZUVB 2AEHA 1E2VA 3DUSB 4E9TA 3MFGB 5K9OA 1OWNA 2VGEA 1EAQA 5AZEH 5BJTB 1RZJL 2CA3A 4I8DA 5HSFA 1C12A 2L05A 1TKYA 1EZVX 1YN6A 1SXTA 2IOLA 1H3TA 4QI3A 4B95C 3NJIA 1KJ2B 3D12B 1W0WB 5B1JA 1ZY9A 3FAHA 4ZRPA 3VUXA 4XCCL 3EHNA 4EZJA 1NCGA 2EJ1A 2JKWA 3PWJB 4MJJA 2E74C 2X4RA 1XGPA 2YQ3A 4NCC2 1LK3L 2Z31A 3MLVH 1V80A 1WGDA 5CF3A 3DTDA 1DYZA 3MCLH 4X57B 2I9LB 1D9KD 1HZHL 2EIKB 3K9OB 3ZU7B 5IFHH 2AX5A 3RD2A 3I6LE 1IM3D 4OLZH 3P3RA 3C5ZC 1JGVH 1G4RA 3BVNB 1B0GB 4WUYA 3GZ2A 3S7BA 1YO4A 2F5BH 4GW4A 4K3JH 3GXTA 5E6RB 3TTYA 3UADA 2B1AL 4XWTA 1EVUA 1UQSB 3S4SB 4H0LC 4CQNA 4MB1A 1DUZA 4Q7DA 1YMMA 3SU8X 4P5TC 2EINE 5E2UH 1CICA 5A1AA 4GBXD 2HFEA 4EECA 5AVRB 2EKSB 3EO0A 3LH2H 4Q94A 3DKHA 5IREA 3EXJA 4QTHA 3AAZA 1DSYA 5FFGA 3VE0B 1KLUB 4AYSA 2Z7YA 4DQOH 2EYTA 3ES6B 1J5OH 1MHCA 2X89D 2DQJH 4DHJD 2Z8LA 5FYJE 1P7HL 2NY5C 4LBEA 3BKML 3WELA 1I82A 2MJDA 2EDLA 2R5SA 5DPWA 3MHSD 3E9TA 4H0HB 3C09C 4W9HC 3KSQA 4DWFA 5HYJD 1FIEA 3ABMB 3BC9A 3BSGA 4N86A 2AJ3A 5T3XL 3FTZA 4FP8L 3RCZA 2JCCF 5IMKA 1M6OA 4GI6A 1MDAA 1A7PL 1JUFB 5E08L 3UTPE 5E51A 5JW4N 5T1DL 1RFAA 1H5BA 1E8ZA 1BCIA 2DYSB 3AUWB 3FTGB 3UJIL 4IW4C 4AV0A 1Z5YD 1MRCH 2JSVX 1IXVA 3RT3B 2FUTA 1WBYB 3OWEA 4I85A 1JZEA 2J4XA 1CFVH 1XIWC 3M1CA 5B39A 4YHPA 2Y6SD 4ODUB 3DWTA 3VRBB 4NNYB 3AG2B 3O6ML 4WV1A 4Z7VE 4MA1C 2M1MA 3ARGD 5E94B 1EWYC 4ASWC 2LMCA 4GTOA 1CWVA 1UM4H 1JFHA 4OCNC 1AO7A 4O4YL 2BVQA 2AKRA 5BCAA 3RVWD 2NUPA 3OXRB 5DHDA 1BOGB 4YFLF 3KS2A 1CYXA 4KY1L 4F7TB 5IJVA 1DJWA 3O3EA 1UBQA 2HJKB 2NY3B 2GTQA 3PWVB 3RULA 2Q5WD 3VH3B 2QDWA 1XQ4A 2UZPA 4DEUA 1QILA 3QEQD 4CDHA 4K3CA 5EKQD 3JT2A 1VACA 2IANE 2C7NB 1J9QA 4JFYA 3WJJC 5KBMA 5CIPA 1RLBA 2MQCA 4LLVA 2WP9B 3CD4A 1IM9D 1C9FA 2QY7A 3KW8A 4GIAA 5KUMA 3QVAA 5IROA 1HF8A 4HXBL 1ZTXH 4UTAH 4IK7A 4EIUA 1KEGH 1KB9J 2XKSA 2G5BA 1MFEH 3DLQR 2AQQA 1SHMA 2E7CA 1CE1H 4KQ3H 2X4RB 5EZIL 2DIBA 2HTKC 3H54A 3P54A 3AU0A 1JMXA 1YJ1A 1U8JA 5BO1L 5MEOA 4KX8A 3OKLA 3D9OA 3GMLB 1YNTA 3V2AR 2JKXA 2V5RA 2X7LA 3MMEA 1U0QA 1I7TB 3SDCC 2HRPL 3X23A 1IC0A 3IXAA 1T5KA 3RFZB 1FO0L 4UILH 1SZNA 1KG0B 1GOZA 2YVCA 2QFCA 5JJTA 2INCC 3IHYA 2YRLA 4MEMA 1XNFA 3BQUA 1QLFB 3BVUA 3JTSB 2HG5B 4EO5A 5E2TL 5BV7B 3ILQD 3H8HA 1P2CA 5KVDH 4GUOA 2NNCA 1BW8A 2HX9A 3G5VB 5IVZB 2FBNA 4X9IA 2CDEB 5DC9B 2A2QT 4LLMB 4N2IA 4CU7A 1C78A 3TSSA 5D7HA 1XGYH 3X3GH 3JWNE 5T5FH 2PP7A 4A2HA 2FEEI 3ME0B 1WLHA 2OVBA 4FQCL 3QHTC 4JY4B 1UT2A 1S46A 1TZHB 4IBZA 3CFTA 3QPKA 2YLKA 4NJAL 4HPHA 5DPTA 3PWLA 4OIIL 5CGTA 5E8NB 2ADYA 3ZLQC 2OMXA 4UMSA 1S7WA 3SHSA 1J8HD 5K1VA 4YL4A 5IMMA 2K5PA 2H6PA 2ZP9A 3MRHA 4XPHH 2Y5TA 5D93B 2IGFL 3LQZA 3ROOA 5GXBB 1QTYT 1IEAB 3QPXL 3EBGA 1BQLH 3A4RA 1GB1A 1CDJA 2UVFA 4L1DA 2X53A 2ZCLH 3LPWA 4NENB 4WUUB 1OGPA 2YEVB 4FTDA 5C92A 1IC5H 1AC6A 1NMBL 2WBKA 1V1PA 1BAGA 2L7RA 3U7ZA 1CXIA 3VFNA 2HAZA 4Y4HA 3U9UA 1JHLH 3KWXA 3UROR 2KC7A 4BKSC 1GS7A 1XH3B 5EF3A 4DX5D 2WNXA 1TETL 4UT9H 5D96C 3B2FA 3ZNGC 3LH9A 2HLAB 5KSAD 2OTPA 3BQUB 4LDCA 1DVZA 2BHZA 5BV1A 3BAWA 3BSHA 5E9DE 1HOCA 1NBCA 4L4VD 3VI4E 3VFGL 1CUOA 1OHZA 2V2XB 4UTBH 1AQDB 1E9PA 1E9MA 1VFUA 1M7DB 2ETBA 1ZWIA 2X70B 3H8NA 2Q7FA 4QGYA 4QOKA 2Z34A 4ZFGH 2QKIA 2NCMA 1NCUA 2Z0BA 3MA5A 3MVSA 4II3B 1GOFA 1TO5A 1YNLH 3MRCB 4HCNB 3EJNA 2F37A 2YMTA 1DVSA 3ZHDA 3L3HA 2AJXH 4OLXH 5EEUA 4PJCE 4MYPA 4PMFA 2PCPA 1BVKA 2BSTA 4M02A 4ERSL 4F8LA 1Z9PA 3NDYE 1IVLA 4ES9A 3HYMB 1G6RB 3QNXB 5JIHA 4G8FA 3EXLA 3WIHH 4YAQA 4LASL 2FUQA 2GYSA 1KSRA 4MQSB 1HHHB 4CHKA 3B9AA 4XZUA 5DZNA 4IKLA 5K39A 1ZXHA 1TNMA 3G5XA 1KYUA 1TZIB 3DRTA 5FO7B 5IEHB 5JHDD 5JZ7D 3TEWA 2IADA 3PQYD 4JRYB 1QA9A 2P9NG 2C9WB 3S2AA 2DQDL 3CWGA 2B1HH 2B59B 5HHOB 2BPSA 5HGHB 1RUML 1ASQA 3RVTD 1Z9SA 4GSDH 2IBZX 1JWSA 3C98A 2EVGA 4OZAA 5K9KB 4JDZB 1XR9B 1WFMA 4UOQA 3CF6E 3F05A 5IMOA 5TE6H 4UI9C 4JA9A 4X7DC 5JJ6A 2NUPB 3OXRA 4DETA 1ZOXA 2YD3A 4NJ9L 5E6OA 4QRRD 1NC4B 4KNSA 2P5WA 1WXMA 5BW7A 1K3IA 3HHSA 4U1MA 5AAWC 1TMQA 1HYSC 1MI0A 1PG7H 2JF5A 2UY1A 3JV6B 3I5JC 5ITZF 4OD1H 3T8VA 3FAXA 1F86A 4N90E 3IFLH 1BXAA 3FU7B 5HJDA 4RAUA 4XAWH 2CO7A 3SBSA 4HZAA 2VDRB 4M48H 2P44B 4NN6B 5H94A 2G2PA 4LAQH 3MRKA 3KLDA 5LBVA 5I15L 3BH9B 3R8BA 3BZ4A 3ZYMA 3X14B 4AI7A 2CUIA 2NR2A 3VH4B 3KD4A 2CJ3A 2DLGA 3D2UB 4AQ8C 3FPXA 4FDWA 2QTVA 2Q8BH 3KPRB 2ZG3A 4APQD 5L88L 1JDCA 5EOQL 1WD9A 1E96B 1ZDXA 1HSAB 4OJYA 3SD2A 2MHKA 4GZ3A 1BPLB 1YEDA 1C8QA 3OKEB 4YDLB 1V5OA 3I6GA 1CICD 4N4YB 5B22A 2YXVA 4BYHA 3UGBB 3E2HB 1S7RA 2AQRA 5EF2A 2ENSA 4M8NA 2J55A 3FUMA 2VDML 3MO1A 3J9CA 1Q94B 3EIQC 1GGCH 3E1F1 4YEEA 3VXSA 2N1WA 2A6DB 1BX2A 4UOZA 4IM0A 4YT0B 3RY6A 2ESVE 4UAOC 3IAPA 2XZQL 1DEEB 2J8OA 1D9KA 1FDLH 4E6HA 2JKNA 3IS1X 2J49A 4YHLL 1HE8A 3BAEH 5SV4A 5HYSB 4F9PA 5MENB 1FRGH 4HFWB 4GT7A 1WZ1L 1N0XL 2V2XA 5IVOA 2QGBA 1PZUB 2VT0A 3UI2A 2ZXAA 1L6PA 4N3UA 4L1BA 3ESPA 5ALCL 3DVNV 1YEKL 3ZR6A 3X12B 2V5MA 4IOSA 1RD6A 1IBBA 1A70A 3HMXA 2BWIA 3RUGE 2ZKHL 1NAMH 3BP4B 4RX4A 4QD2E 1HOEA 3AWGA 1FL3A 1OD7A 1MQKL 1BIHA 2IQ9H 3GSVA 4JAMB 4JZJC 5D7IE 3U6XA 3FQTB 4YSOA 2OFQA 4P46A 2P46B 1RERA 4YDLC 2MYOA 1YEEH 3CBJB 3IGFA 4CDNA 2GVYA 4I1MA 3LJ3A 3I3NA 1AC0A 4RDBA 5INCA 4DHZE 1AVAA 1NCOA 2CPUA 2R0ZH 5ANLA 1TLKA 3QCTH 3JZ7A 4IBTA 3GIZL 3IDJB 4PRAA 4DWHA 1KCSL 2XJLA 4HJ1A 2EECA 1J05A 1JYWA 1J1XH 3IAM1 3B2UC 4H25A 1BXTA 4O2FB 4FLBA 2XNAC 3FFLA 3N2JA 3DX6B 3IJ8A 4HGWB 1W8EA 4LU5L 5CCKH 3OAUH 4ELMA 1B4TA 3FOLA 5IUCA 3B3IA 3G5YA 2WINB 3TCAA 2AW2A 3GBML 1TSHA 1YEFL 5GGSA 3LKOB 4HALA 4IIQA 5TH2B 4YDKH 5FDWB 1PKOA 4CKQA 4DVBB 1OCZE 3N91A 2CJTA 4Q9RL 4AIXA 2DI9A 3CZFA 4DKTA 1K6QH 2VDQL 2QPSA 3JV0A 1MCNA 4AM0B 5C71A 2XWTA 1V86A 1GTNA 1NGPH 1I4FB 2Y23A 3UDWC 1U9KA 4GA2A 4OI8A 2XBZA 2ICWI 4XRCA 1TTUA 3BZEA 3UAJD 2B76B 5E24E 4U6VL 3SPCA 4YSAA 2X2YA 3MNWA 4MJ2A 4HPMB 5DYFA 3S37L 1QSFE 4FHBD 5ANHA 1S7XA 2DMKA 4OZIA 3CX2A 2WHIA 3D1MC 1V7NH 2F54D 1P6WA 3L1GA 5EC2A 4P46B 2NTSP 2NXYC 3QT2A 4KIKB 5F7BA 3V6FA 3HKZA 3KPQA 5AW7B 1NUFA 4KYOB 4TLUA 1YYHA 3T65B 5I6NA 3B7TA 4TVPD 5EU3B 1IAOB 4M1DH 5F71A 5C0RL 1IGMH 3OG5A 4C80A 1HNFA 4PJDA 2W0LA 1VLXA 1B3JA 3GBNH 2AK4B 3O8XB 3QHZL 5C7XH 1DDHA 5EA0H 4TUOB 4NKDA 1XGPB 2EE6A 4LVEA 1HH6B 3H1UA 3NJVA 3S88H 4W93A 2IBBA 4YTNB 1DJSA 4CAGA 1A1OB 3DBXA 4A2GA 3SR6A 2LABA 4IRZL 2MBEA 2IMMA 4I18B 1ELRA 4GBXC 2ZYRA 5F7EH 1S2EA 3JV6A 3PH0C 5IMLB 1A02N 2C7FA 3L1FA 3FCSB 1GHFH 4OFVA 4QRQB 3O2DH 4LKCB 5DFWH 3IRZA 4J2QA 1JCQA 4K7SA 5F93C 5I75B 4GMSH 5F44A 3I57A 1MELA 3WAOA 4HOZA 1NZRA 3NIGB 4YNYB 3VI3F 1BA9A 4QLRA 3MLUH 4P5RA 3CWIA 5J1TC 4OD3H 3L3JB 2YPKA 2HH0H 2AQ2B 3DSTA 2FX9L 1L9TA 1GC6A 4I2XA 1W72L 2YN3A 4NZRH 2PUQT 1DQJA 3AREA 4V1DE 2PWHA 5I82A 3LNEA 3ZKMC 1PNCA 3A6CH 3C8KA 2DZOA 1SE4A 2W91A 4AKQA 1FFNB 5EC1A 5D6JB 4MD5A 1IAIL 3PFQA 3S3CB 2IZVB 4ZUVA 4IHBA 3IAGC 4MJIE 2EDNA 5FKAA 1KBPA 2A5EA 1THCA 2QEJA 4XI9A 5ISZB 1T22A 1SYVA 4DT2A 2HTHA 5I8KH 3UJJL 3U36B 3KAAA 5I8OL 5D1ZB 5GRUH 3QEGH 2KJRA 4JJ5B 3IG3A 4IOIE 25C8L 2BF0X 4AQ1B 32C2B 5ERWA 5BZDA 3TEYA 5IIEA 5A6CA 4DJAA 2IAMC 3GPEA 3MLXL 4HJTA 1W8NA 2OLDA 2R4SH 3A67L 3ZDZF 4FC3E 1BLXB 1EXGA 1BFVL 4FEIA 1AYFA 4GG8B 3MXWL 4YEFA 3UF8A 2UU7A 2XEEA 1ZHKA 3HZKA 4OBRA 4P2OD 4KKQA 4J3XA 1Q90A 3RVVD 2P1YA 4XVSL 4EI5D 2PWFA 1WT5A 5I1HL 3ZNGA 2V3FA 3FH7A 4EUPA 2YD6A 2OS7A 2BH0A 1A14H 3FILA 3VTUA 1WBXB 1GKOA 2YAEA 4GXFA 3NSCA 2GC4C 3IMVA 5CRVA 1D5BB 3JWOH 1BOGA 3T2PA 5F0MB 3MYZA 4LSSL 3ZT7A 2KAJA 5FQ4A 3DHIC 4DX2A 2FCBA 2NR6D 3K4DA 4PRIB 4PJCB 3S3BB 1JMLA 3HZYA 4G1EA 3C60B 4JZOA 4GTPA 3BPLB 5EUOB 4PB9H 5CUSH 1C5BH 2P9IG 3OZ9H 2MA9B 1WG0A 1WMHA 4AGMA 3TJPA 1HZ4A 1UASA 3GDCA 1REIA 3L6FB 4H1LG 2ZNVC 5I5RA 1WH3A 2GBAA 2LTQB 3PABA 1JYNA 2BSBA 3ZO0A 3FT3B 5L0QB 5KYYB 1QNIA 1S9WB 1J9TA 1IAOA 5FJYA 3N50A 1LP9F 2KC2A 1G87A 2H45A 4AH2B 4W6XB 1A6UH 2XFGB 3SKOB 2Y5PA 3BUYB 3DX9B 4FJ6A 2F9BT 2G30A 4XNXH 1HQ4A 3EHBB 3L5XL 3OD3A 2OJ1A 2R39A 5IJDC 3CPUA 4IGBC 4ZOBA 3IDUA 1UGKA 5I2IB 4Z3GA 3HG5A 4P06A 1P7QD 4U2ZA 3ERXA 5AQ0A 4XOAA 1LD9B 1WAEA 1DEDA 3I2CL 4KK9C 4OQTA 1M42A 5DK0A 2VQ2A 3VD5A 3VSVA 4FS0A 5CGBA 1AE6H 1J0IA 5I1KL 1S7VA 4M61B 2CKBB 4UT9A 1RYJA 4G7YH 1F3RB 1X5HA 1IGYB 1DN2A 2LV4A 5FYKH 1DVXA 4CILA 3C5ZB 2ZUYA 1EPUA 3QS2A 2BVTA 1J0HA 4ITKA 1VSCA 3WUWA 3SDCA 4TXQA 4H8WC 4X6FB 5HI5C 3L10B 4A7TA 4ETQA 4WJ5A 4JC8A 4KIKA 2CBOA 3NZHH 3GXMA 2W55A 1RJYA 2CLRA 4H88L 5DGQA 4P5KA 3QOUA 3ATFA 3RWHB 1JI2A 3WIIL 4H20L 3JCKC 3DIVA 3V79C 1OAYL 3VTWA 5I71C 2WVSA 1A8ZA 2L7UA 2AJ3B 2WOYA 5IG7A 3C9NB 2A0LD 4JY4A 2NZ9C 2AK4A 3O8XA 4YE4H 3EOAB 4OD2A 3V6BR 4A6YB 5BMFL 1M6OB 2ICCA 2LAIA 3PEVB 4RG9A 4WI6A 3B8YA 4IM2A 5JHDB 4RZKA 4QLWA 4N8VB 4DP6X 4G8LA 4MACA 2PO6D 1T1XB 2XBTA 3FQWB 5CD3B 5KVFH 1JPFB 3ZX1A 5CIPB 3PHAA 4LQFL 4KVGB 1XFPA 4NRHB 2ZSVB 1I9JH 2KMWA 4JGMA 2FGZA 3MA9L 4XPAL 4PJFF 3WEXA 3MCKA 1M1SA 5I73B 2MMXA 3LY6A 2KERA 3ZRCA 4CN1A 1Q0YH 2IH3A 1RH8A 3HLKA 3DVNB 3QCVH 1U3HC 5B39B 2IGGA 4NUPA 4I6EA 4P9HH 3BZDB 1D5ZA 2WB2A 4LKCA 3UMNA 1LP9E 1VGKA 4LL1A 3W3BA 3MRLA 2VLKE 2NY0B 1CE6A 3CDZA 2M1KA 4P9HC 5DD3H 4DPAX 3UZVA 3US0A 3GMLA 1QFWL 1QX1A 3AE8B 1TZ8A 1U3DA 2NY0C 2VR5A 1DZBA 3TBLD 1QAWA 4XPBH 4S2SB 1EWCA 2JWUA 1FC2D 3UZQA 3NVYA 4K9JA 3MRGA 4Q56A 2CNZA 3IFOA 3MGTB 1AQDA 1E9PB 1WCQA 1M4KA 4OUOA 4JG0L 1XGZA 4GMLA 1ZA3A 4GXVL 5DWPA 5I8CB 3LEWA 4NKOA 3KL0A 1ZLEA 4NUGL 2KLCA 4JBSA 3FCUB 4ZMWA 1XO8A 4IGBA 4P9ML 1G1CA 4IIZA 4BXVA 1BPVA 3D34A 5E8DH 5C8JA 1FUNA 3RTQD 1AGBA 1E3XA 3R7RA 1F90H 1UVQA 5DJ8B 3UJTH 4WAAA 3UBFA 1IEHA 5G2NA 4PJXA 4U3HA 5I28A 2W82A 2Y07L 1MWAH 1CXKA 4R96B 4LB8A 3N0PB 1TYJA 3T3ME 1QBQA 3BDBA 3FTWA 4YNDA 2CM5A 2VLMD 4ZRGA 3P0YL 1UENA 4XC3L 3LV3A 2E9IA 4QJ3B 2FR4B 2F6AA 3CDYA 5IHUL 2VDPB 5KBKA 3WHXB 4W9EA 1IGTA 4Y9GA 1WWBX 1T1WA 3RIFF 4ABUA 4FE9A 5I1JH 4KHXH 2CGYA 2IOOA 3KEDA 3MKGA 3U1SH 3B08A 1V3KA 2E7HA 2N4IA 3DX9A 3GNMH 3QDHA 4WJQA 1KY7A 4YHML 4FYQA 1HHIB 2C1PA 2IPUK 4K5AB 4MAYA 2ADGA 3BUIA 4L4VA 3VD0A 1QWHA 1R1CA 4OBSA 4KKAD 3V0GA 1PC2A 4JPKH 2ITDB 3UEQA 3LKQB 1J1OL 1GGUA 4MX7B 3E37A 1URZA 2F53E 4RZCA 5IFJA 1OANA 1NC2A 5E5UB 2XX1A 1YEHH 4J6RL 1IGDA 4OKDA 4CDGC 3K6SB 1P2CB 2VN3A 4TQ0A 2GC7C 3C5ZA 2RCSL 5CJOL 4PJCA 4YDNA 4OLZL 4M1CD 2WVVA 3RU0A 4FYTA 1QLRA 1QOGA 3ZE1B 5IAAC 2CO2A 1ZKAA 2N0KA 5J11C 3Q4AB 1DQML 3RL2B 4X98A 1KXTA 5I76B 3NZ8A 4JQXC 4D8PA 4HXIA 4ZOEA 3V0WL 1K8RB 2E3TA 3ZUNC 2Z31C 3GSNA 1RFDH 2C9XA 5E2UL 3BZFA 4XP6L 5EBWB 2UXGA 1D5RA 1DUYB 5BO4B 4HGMA 4ZUSA 2VB5A 4PJDE 1Z1WA 3SYPA 2J6EH 2V9RA 1JCKB 4B95A 1KXQA 3D3MA 3GK8L 4L1TA 4M62L 3JVGA 3MLZH 5A16B 4D7BA 3MYJA 2I7SA 3PZDA 3VGDA 3QG6A 2BJMH 3ESMA 2CPCA 4UTAA 3D2UA 3JTBA 1EGJH 3IU4L 2HA1A 1UADC 1I7ZA 3QUZB 5AVXB 2PP8A 1QQDB 3IXTA 5IVXA 4A66A 2V5FA 1V9JA 1G43A 3EYFB 2QC8A 4MXWH 5D1XD 4D9LL 2VJ8A 2HT2C 2A9BA 4JKNA 2H0FA 2GROB 2J1ZA 3CVUA 1L9OA 4FFZH 3NCFB 4JFOB 1JHTA 4JM2D 4MT5A 2DBAA 4LT7A 1NKGA 2WMPA 4R4ND 1A7PH 5ESAB 4J4PD 5T3ZE 2NY5L 4XI0A 1OGAA 3ZYQA 1BEXA 4QOKB 1EBAA 1DTUA 3KYOB 3DXAD 4JFEB 1ZGLP 4OM0L 5HHVH 3NSDA 1OAXL 2DX5B 1P5UC 3R18A 3ZDYF 1IE4A 2Y5EA 4RGND 1MSPA 3SDXE 1UF0A 4MSMB 2ZP8A 3ZJVA 4NHCL 3ATEA 3FY4A 4QHPA 1UOKA 2C9RA 3WTWA 1AMXA 1F0ZA 1TTFA 4JO8A 2FHFA 3NG0A 3CEQA 2MX2A 3N71A 3FUNA 1ZPLA 4HA1A 3ESKA 3GEWB 3C2SA 5KUKA 3V4PL 1QA9B 3L4YA 1G7IA 3MXVH 1W6LA 1BQHB 1CDHA 2VZSA 2YD4A 4UQZA 1FCLA 3FUIA 2Y69B 3C3RA 3BT2H 2IJGX 3IPBA 2M26A 4K9EL 4AIFA 3JYCA 3PZ4A 1HXYA 1XR8B 4D8OA 4ZSOB 2RFAA 4ZYNA 2BIHA 2R2HB 4N26A 2BMKB 1SIJA 4DXAB 5A3IC 2D7TH 1KBGL 4YHYB 1PFOA 2IY0C 2KL6A 1RU9L 4KHTH 4G9FB 4ORZC 4YPGB 2GRLA 5DR5H 3RX5A 3JZYA 1I9IH 3VG9B 2P4AB 4NKMA 3RVUC 4Q2ZA 2Y6TE 4L3CB 3DUUB 2ZOOA 4PB0L 1YSOA 5E9AA 3Q1SH 1YEJL 2F74B 3AB0B 2C7HA 4NWUL 2NCNA 1JK9B 3FO1A 5CBAA 1ZA3B 1G9ML 1T4WA 5IF0A 3L9BA 4N1CA 2NTFB 4LNNA 3O41B 5HGAA 4BRVA 1TYGB 4UYQA 3C72A 1N68A 4AJYV 3GRGA 4XWOD 2NSQA 1UWMA 1MCBA 4HJGE 2HRPH 4HCFA 4K94L 1J0GA 5DHXB 4N2BA 3TTSA 1X7SA 5I5JA 1F8TL 1HHKB 2DQUH 3NRQA 3KZ8A 2FX8H 1YY9D 4YFEA 4Z7OE 1U8MB 4JM0A 1NGQL 5GSVA 1T0QC 2LGDA 1BPOA 3MJ9L 1OP5K 2BCKA 4X9GA 1P1VA 4FHKA 1OAKL 4IBYA 4R26L 4WF7A 1QBLL 4XMLL 4Z7VA 4N0CD 4R5TA 4AGPA 3LB6C 4JCMA 3UX9B 2NY3D 3T3NA 3SPJA 3KPPA 3C5SA 5L9DL 4QFVA 1HHIA 1HXYB 1TR7A 4FFYH 5K59E 4ODHH 4JFWA 4GO9A 3MRFA 5L2KA 1SMAA 3IRPX 5CZXD 1SVCP 5IESL 1WJ6A 5E95B 2DVWA 2C9VA 2V4HC 2AXGB 1WE5A 2G0KA 4OGXL 3V0VA 2NZIA 1KLUA 1KN4H 3ZE2B 5EUKB 3P9LA 1YN3A 2COQA 4XX5A 4R7DB 5EX0A 3V4PA 2UV3A 2VN6A 3KWLA 4RBPH 4QGTA 4WFFD 1LDSA 3AAAC 3GZPA 2X6MA 2CKBL 1DFBL 1TNZA 2D7OA 2NLJA 1O6SB 3HA0A 4G6KH 3VXOA 1BVOA 3FO1B 1U3YA 5CBAB 2H88B 1G1YA 1NDMA 4JUSA 3REVA 3K9PB 3R2IA 1IC5L 1NMBH 2I9TB 3C6LB 4F9PC 2VXQH 4LHQB 2IALA 1VB9A 4AEIH 3LXUX 1JZFA 3BAXA 3MUUA 1H9VA 3LCAA 4X80H 2KZ1B 1ZPUA 1MKFA 3WTUA 2FEDD 3D18B 4UT9L 2X9ZA 4POUB 3D3VB 5MEPB 4OQTL 3QPQC 5EBGA 1MJ7L 2X4QB 4NUJA 1TG8A 2D3LA 4Q74A 1YAIA 5DEZA 3G3LA 4UU9B 4MJIB 4AOFA 5IR1B 2RFMA 3PRMB 4GLSC 4KITB 5EU5A 4LLUB 3WLWD 5JXVA 5D70H 2VJXA 2LUHA 2EE3A 1IAKB 1L9SA 1TVDA 2VDMB 4HCRL 5LJYH 5TPWH 5J3HD 4P5TD 3SQVA 3W1YA 4PK1A 2XWBB 3PHOB 4RRPG 1V3JA 2WGSA 5HHXH 4UINH 4TULH 2H32B 3N5AA 5KS9E 4M1CC 3PU7A 4FOMA 4A6YL 5F3BA 3PS6A 4JQIL 4F58L 3RRQA 2X2UA 3VXUA 3M1BA 1C1EH 4G5ZL 5TDNA 2EYRA 1J8SA 2YSSA 3QI9D 3QHFH 5C6TH 2HTLD 2CHWA 2CO6A 4G9FA 1P7QB 2W0FA 3EJPA 2N1VA 3ZXRA 4UWFA 1R4NI 3EBHA 3RRUA 4D3CH 2C0LA 4KQ4H 4I6NB 3DBRI 2HJKA 3VB8A 3LQAL 2YJQA 3QR1A 4LVHC 4TOYH 3BRFA 5KVGE 2Y5CA 2A7BA 2C4XA 4X7TB 1DVFC 5DO8A 2D3VA 4F3FA 4PN6A 1E28B 2DIWA 4YX2L 4PW3A 3SJVE 4E42A 2LW3A 1PZSA 2YEQA 4RWYH 5FF6B 4QXTA 4XOBA 1WK0A 3OGOE 4HVBA 4Y5YA 5IBLC 3KPSB 2G5BB 4XCEB 3DX8B 2DMBA 4Y4KD 5IVXF 4XNMB 1TZ1A 3KYKL 3V0JA 5H35B 3WKYA 1VCBC 2G5RA 3B0AA 4X6CA 5AVWB 3VSTA 2DQFB 3BUBA 2XQ0A 3OJ3A 4FQPA 2ZUQC 2ZWYA 1VPOL 5D7JA 3TN0D 5CEZD 3SE3C 1IYFA 1G7LB 2IEPA 3VWJB 3K81A 3MNDA 2H32A 2JTYA 4G11A 4IBQA 1NLBL 1C79A 2YEPB 2J44A 2YKKA 2BM3A 2IDQA 5C97A 1AIFA 5BRZE 4P2QE 1CLCA 1JHKH 4IRSC 3AS5A 1OAQH 4PVBA 3VFUB 1A4BA 1AS6A 3H0TB 1JWSB 3LZPA 4YHZH 5FKAB 4HJ0C 5ISZA 5K1JA 4DP1X 1MJUL 2GI0A 1J88A 5AW2B 4EBQH 1VKXB 1ETJA 2DHZA 1A7RL 1A64A 2V9UA 3UP6A 3DX7A 1CXEA 2V8LA 3FONB 5H4ZA 4I17A 2CRYA 3VFKA 3KXFB 4IEFA 4XE5B 3H42H 1MY7A 2Q8BL 4L3EB 1JZ5A 5L88H 2RGFA 3KR3L 2DZIA 1A6ZB 2WVTA 3DJRA 3L9RB 2QKIC 4QNPE 1X44A 4IU3A 4TRPL 4L8DA 5DIZA 2NY6C 5AYWD 3G5VA 3P1MA 4PJEE 4ONHA 2G5UA 5TE7L 4CU8A 2ZOTA 3CXHJ 1SVBA 3DXKG 1QRNE 5AZHA 3RIAF 3SE6A 2F7IA 4K3EL 1R33A 3EJRA 2ZXWB 2EELA 4OGQC 5C0AA 2D11A 1QPKA 3N1GC 2Z91B 4GTMA 3H9HA 4J3SA 4LSPH 2L76A 4UV4L 2N7JA 1N11A 2BEDA 4MDJA 4Y4HC 1YN7B 1WBXA 2NZ9D 1UG3A 3RDTB 1DO5A 4M3JA 2VUYA 1AR1B 1FHGA 1QKZH 4L8BB 3LEYL 1H6KA 4X8XA 4QYAA 1EO8L 4DRXE 2F5AH 3C5JB 3RGHA 5L2KB 3GE3C 1TZGH 4FZEL 4BZ1H 5D1QC 4UOW1 2GOWA 2XBBC 3BYTA 3P02A 1F97A 1GCYA 5EO1A 5FUZL 1GW0A 3L48A 4FCHA 1V1PB 1WMHB 3V2XA 1IGCH 3GMNA 3MNZB 3PPEA 4F9LA 2ZKHH 3NAWA 3KBHE 3U9UB 4CC0A 1K8IA 1MXGA 2CXGA 5CD3A 4ZDVA 5IHZB 2R0WL 3O3AA 2QLVB 4P4KB 1VJKA 5DJ6A 3QHTA 4PR5B 1N4XH 2YAPA 2P48B 3D05A 4IEFB 1QFUH 2JCCB 3IDXL 1QOBA 3UC2A 4WO4D 3NSJA 1FGNH 3KHQA 1SDDA 3FKUS 4FQHB 4DH2A 5DSCB 3MLTA 3WJLA 4J8EA 3DHPA 2Q2EB 3N1XC 4JO3L 2VLJE 1HXIA 3W2DL 4RNRA 4B6WA 1KYOJ 4KU1A 3P77B 4MYWB 3SDCD 1SM3H 1WXVA 4YBQC 5DQDL 1W2KT 4M8RA 3K71A 1JRHH 3UIPC 1FNAA 2CJUH 2I27N 3IJEA 1I7UA 4N5EC 4XVTH 1T21B 1NDDA 2J4BA 5KYUA 5BUZA 5ETUA 3NS8A 5E4AA 3NZ3A 4Q6YA 2PW1A 5DUJA 4EN3D 5L6YH 2Z91A 5C3TA 5A6IA 4JRYA 1N8ZB 4IRJB 1LYQA 2BRQA 1AD9A 3PL6C 1CD0A 4MMZA 1XIWB 1LEIB 1JGVL 1Q72H 3OQ3B 3I84A 4W4OC 3V4VB 2VXSH 4P04A 3UBXG 3QQXA 1DE4B 3GDBA 1KCRL 3FO0H 4HAGA 4YDMA 1B89A 1MW3A 3P4PB 1T7YA 4PJHA 3DC0A 4BFIB 5CEXB 3N1ZC 1NL0L 4Y4KC 1T6VN 5JIIA 1I4PA 3PL6A 4PGDA 1L5JA 5IB2A 4NQED 1F4WL 2YPLA 3K72B 3MX0B 4F8CB 1GAFH 5IG7B 3GB1A 1J05B 4AH2A 5I1EL 2LHDA 3U7DA 4PRDA 5EF1A 2AV7B 1FFOA 3MROB 2IPKD 4U6XA 5BS0E 3OHMB 4KDIC 4PJ9C 4R7XA 4YWGG 4LERA 1IBGH 1U8QB 3RY4A 1OPGL 1ZANL 2HB0A 3R7QA 1CXFA 4AP4C 1LO0H 3KLHC 2P26A 4PS7A 4Y2DB 2PKOA 4ICVA 2J6WA 4M1DL 3GMPB 2DOCA 2Y06L 4LMQE 2ADGB 3AITA 3UTSE 4NEHB 4KKRA 2ZOLB 3UO8B 1BMGA 4AZ8A 3BKJL 2PWEA 4ONGL 2BKFA 3QHZH 2J09A 1AGEA 4YLQT 4Z77B 4GRMB 3CR3A 5C7XL 5FZSA 3ABGA 5E6NA 5EA0L 1VDVA 5ETUB 4KJQC 4YWGL 3P30L 4GIOA 4LP4A 5C08B 4D9RD 2LJIA 2UWEF 4XNMA 5DYOA 4AX3A 3OLGA 3HNSH 5ISZE 4FXCA 4XCYB 1RSYA 4C8XA 4F9LC 1U4FA 5C09D 1H6EA 3HNVL 4P2QA 3U7YL 1S7SB 2ZD0A 3K2UH 5BRQA 3E0GA 3QDAA 1GJWA 2ZICA 3DO3A 4S17A 3ZKQD 1M05A 1SBBA 3K8MA 3AE1B 4E71A 2W95A 1QRND 4KY2A 4X6DB 3SDDB 2KYWA 1T7XA 3DOIA 3ULSB 4QNPF 5PAZA 3HZ3A 4V11A 1ZT7B 1JYXA 1NJ9B 5HHME 2R1YA 4PFEA 1BYPA 1E7UA 3R06B 1FZOB 4RSVA 4A20A 4B0ZA 3LZNA 3JTTB 3DRAA 4FTVB 5F88A 5AZEL 3ULUE 3GZNB 3BRGC 4B27A 3ETRA 4JDEB 4WEBL 1XXFC 1K8DA 5F7KC 2GK0A 1YIWA 4JHRA 4Z95L 4PWIA 3GM0A 4Y5XA 3OG6B 4WTZG 2J25A 4Y7OC 1CFNA 4NHUA 2HN7B 1LD8A 1CCZA 4JPVL 5ESQB 2XKUA 1H19A 5F2FA 1KTDA 4OLUL 1KFAH 1YECH 4U1KB 3UJJH 4DP7X 4Z6AT 5JH5C 3WFEH 1Y07A 5CWSA 3VMNA 4BWUA 3L3DA 3DO7B 1FFPA 1MRFH 4YMPA 2AK4D 3J07A 3O8XD 3ZBMA 3CV5A 4TLKA 4R4BA 1XCTA 3BVXA 4YVNA 1WXAA 3BKYH 4PJEA 5EZIH 1UTDA 1CPUA 3VXUE 5HDRA 2AKRB 2X3BA 5LCVA 5CD5C 4WU5A 4ZOAA 1BMZA 1TU2A 2ARJB 2N9PC 4LL4A 4ENEC 3DX2A 2JB5L 2VW7A 2WXIA 3DHUA 1KV3A 3K2MC 2J52A 3EG9A 1EAOA 2WVVB 4NZDA 2WQ8A 3HMWL 4M7ZB 1UUPA 3ULSA 5C23A 5I1HH 1CLYH 1PZ5B 4PBVC 2F7RA 3NCCB 3KYNA 2Z31D 4J27A 4KJYA 4M8QA 1BFSA 1MUJA 3CNKA 4S1DD 3VD4A 5EEXA 3T4YA 1EJ6A 4D9QE 2GJ6B 1ZCRA 3MOAH 5EBLB 4AENA 1H2UA 2AXJA 1BYNA 1KTLA 3RZWC 4P4KA 1AR1D 5DVMA 2DQHL 4MNQB 3HG1B 4OVVA 4OCMC 5H7PA 2A9NH 4AC2A 3NFPA 4OTXH 1D3ZA 3ROLA 1QZEA 3SY2A 2H0PA 2FWOB 4JLRA 3RNKB 1HXMA 4ACLA 1HL9A 4NO3B 2FATH 5CUSL 4JLCA 4X6CE 1CFNB 2VCOA 4GRLA 2WPVA 3NACH 3TCTA 2ICEC 3BZ5A 3TV8A 5A2FA 1I8MA 3PDNA 1NFKA 2KZWA 3QZMA 1M56B 1OT2A 3HVEA 4ILHB 2EIZB 2E6QA 3DTXB 3GLEA 1FBIH 1S5HA 3WNMA 5CWSB 1FVHA 4I5BA 1ADWA 3D0VB 2YFOA 1UJKA 1FNEB 2KUTA 1CGSH 1UYWL 5B7FA 1MCHA 3NIFF 3BD5A 2F53B 4G6JL 5AW1B 2B0SL 1OM9A 4ATTA 1OEYA 3QB2A 4XGAB 3AG3B 3L9EA 3VXRB 3K91A 4DI3A 4RFNC 1KLFB 1D5BA 1USZA 3WHE1 3D7PA 4PJAE 2ESVB 2FSEA 4LRIC 1CLZL 2NR6A 3QH3A 5JOPD 2WDVB 4KKIA 4ZRQA 4JRLA 5KZCD 2DLEA 2WBXA 1A47A 3PNRB 3DX1A 1BF8A 1NBZB 2K9FB 2WNKA 5JUEH 5AWNL 5CINL 4XTRC 1ZS8A 5TDOB 1TR4A 2VLRD 2JWZA 4P5TB 3WI9A 5BMHA 4XNUL 2VLKD 1IBDA 2WZ0A 3O9WA 4AXWB 3FSOA 5EO9B 4ZMTA 1DQIA 2HKAA 4HJ0D 4L1LA 1HINH 5GGSY 2XRAH 3FQXB 1BQKA 5I30H 4CNIB 5CHVC 1JPLA 4N3TA 3QDJB 1E4WL 3DJTA 1I9RL 2WAQA 3D39B 3NFPB 4YDZA 4WI4A 4KNUA 5FS5A 1BBDL 3BEWA 2MCPL 4BE6A 1OWRM 1A5FL 2R0LH 5ENOD 4F92B 1ZTXL 4UTAL 1Y8MA 3TGOA 2EIDA 4TSCH 2VAJA 2WPGA 2CU9A 3A1QA 3BXNA 5JOFA 1UD6A 3RB5A 4KRPD 4N2QA 2GIMA 5EN2B 5E8OA 4X0NA 2FYVA 4WDIA 2L4OA 2WJ7A 5J89A 3ZJUA 1F02I 3QJTB 2PJHA 5CKGA 3ZRFA 2NSZA 2X6FA 5FGBA 1TJIL 1GS8A 5D7JD 2YD9A 4IU2B 4G8IA 1FI8C 1DQJB 3AREB 4QPEA 3TN0A 4PJHF 4E36A 2B1HL 4ANXA 3HBZA 4I2XB 1P0SE 5FHAL 4ARCA 3RWIB 2A74B 1BUIC 3TH2T 2PIAA 3TBYA 5C0CE 2O6CA 1T22B 1CDUA 1WAAF 3BG1B 1U8HB 1GC1L 3KPSD 3KS0J 3MODH 1R3LB 1ZHBB 3AM8C 1JV5B 5C9JA 3N30A 1S9XA 4M7KL 4HWEL 3D18A 2WDQB 2KLSA 4JFXA 2YINA 4HH9B 3P4NB 1J0JA 1AGCA 4D0BA 4E41E 1VR9A 3L7EA 4ONFL 2XX0A 2OXHA 5H4YA 1D3CA 3AQDA 4I88A 4FQCH 3CUPA 5L2KE 1PG7L 4HIXH 3U82B 2VH2A 1F0LA 2J8SD 3IDYC 4XH2A 3QRGL 3VLEA 5DJZB 3T0EB 2RR3A 4U95D 2RTTA 3MCKB 5CEZL 3HK0A 1ZK9A 1YG9A 1CGXA 4XVJL 4MGXA 5E8DL 2L0IA 1UZ8B 5K93A 3KYCD 4I4WA 2DQJL 3DVNU 3QJSB 3MC0A 1BQLL 3H2QA 2KLGA 5I15H 4UI9J 4ZO7A 3HN5A 3NQIA 5DI8A 4HEA1 1TQUA 2ADJA 2VMDA 4WW1A 3IU3B 3S35H 4R97C 4A3OA 3FFOA 2BIIA 5G4MA 2BWDA 3E7JA 1N52A 1DR9A 2J5LC 3N41B 3O6FB 5AW6B 4APFA 2B2XH 2MNJB 4U04A 4ZPVA 2BT6A 4JE4B 4LDTB 2JIXD 3F00A 3VFVB 2GB2A 3JV4B 4JFZL 4O60A 5T1MB 1AHWB 3KL3A 1I4QA 3D50A 4GCOA 1A2YB 1MRCL 6TAAA 5F0LB 2EEXA 2OAAA 2V9HA 3AKKA 1YPZB 3JUZA 4PUBH 4X5RA 3TF7C 1BM3H 2CSPA 4PDXA 2L6BA 1OF0A 5JQIB 3D51A 1WWCA 3MRDB 2W07B 4FN0A 3RWJA 9CGTA 5F96L 2EE9A 4KRPC 3GMMB 2EADA 1CZPA 3D9PA 1LD9A 3PXLA 4K15A 3J8F7 3SYCA 4CN4A 1JERA 3ARBA 2SODB 1MHHE 2CBPA 5D5MA 1LNUB 3PGCA 2WCSA 5G5HA 1J7CA 1KIPB 1U8IA 1P9MC 1FORL 4OY9A 3BVNA 1IBHA 1RP8A 4N20A 2CLVB 3EUUA 2ZUUA 1V7MH 2FO4A 3BGFB 4I7ZC 1AW7A 5J2RA 1KB5A 5DDHB 5JNYA 4GG6F 3AUVA 4QRPE 2J53A 3MC0B 4TSSA 4CJ1A 1OZUA 3DROB 3ARFA 3VRLF 4MGYE 3CHOA 4PVLA 1S7RB 3QXVA 3AS0A 4F15B 1KJVA 3CSBA 2ED7A 3IS0X 2BJML 3EIFA 4PRBA 4QRAA 3SKNB 4JQXA 2MJ3A 3SDCB 1TJGH 5I1IH 4QKXB 3NB2A 4OR1A 4HQQH 4K73A 4E9VA 2WYTA 4G8IB 5J12B 4BBNC 3L3IB 2R51A 3VE0A 3LN4B 3CVXA 4RGTA 1CGUA 1FMAD 4LNBA 3C9NA 2WWMC 4ZX4A 4JKLA 1T3FA 3GXPA 4CMMB 2HT3C 3HIZA 2JK5A 1AKJD 3NCYP 4H4NA 4NBZB 2X6BA 4RGMB 2BOCB 1KXVA 1ZB1A 3MRDA 1QT9A 2BKKB 5AVUB 2IGDA 2FRGP 4PJXE 2I5YL 3D39A 4NERA 4HOSA 4TNWF 2DQCL 1Z0MA 3DJ9A 3M6DA 3BYYA 3TJEH 2KN4A 3ZUNA 5JPNC 1TJXA 3AE4B 2D9CA 4C4KO 3UCRA 4EN3A 3SGEH 5GXGB 3GD1C 5FX3A 4U6VH 4PV1C 4HULB 4JFQA 1OTSC 1D7BA 3LY8A 1XGYL 1D5IL 5LN4A 2O2VA 3RHWF 5EOQH 1NGWB 4GEJA 3AG3E 1IGFL 4O2FA 1MHQA 2CIIA 4KZEH 4KRMB 3V4PH 4PG9B 5C2TB 4BT9A 4G7QB 5JA8B 5FK9C 4X4YA 4WI0A 4BSXA 5GQBA 3ZTEA 4MGIE 4X0KA 4RAVB 3ZK0A 3ECWA 1IGML 2WQVA 1PQZB 2OI9B 1WDYA 2X1WL 3SO3C 3KPMA 3EJTA 5E7BA 4WRLA 3BD3A 3T3MF 3CZFB 3H7LA 2MTAA 1R34A 5AUMB 2ZNWA 5JO5B 3OPUA 1USQA 3N06B 4GXUN 2ZCLL 2GBJA 2YMXL 4P49A 3DX8A 4N2GA 4NPYA 1B1ZA 1D8EA 1AANA 2NXYD 4GQQA 4UAHA 4ZPTB 5C70A 1JHLL 4U63A 1KIQA 5D2NB 1N3NA 1IQDA 2VQ1B 2KZTA 5MI0C 5ALCH 3T2NL 2XG4A 5GGVH 2EABA 2FSDA 4ZO6A 1U3HA 1E4XI 2CBMA 2FJGB 2JJVA 2OYMA 1FO0A 3H53A 1X5YA 3DRQA 4ZS6D 4LTUA 3QUML 1IGTB 3LN5B 5G04C 5J57B 1DANT 3I3DA 1N5YH 1UWEH 1SBSH 5MEOB 2BERA 5KYNA 5I71B 2NS5A 1F8TH 2A83B 2E4FA 4TUKH 1OCRE 1E30A 2A9AA 4P0DA 4C56B 1XDTT 3CX5J 3Q01A 2ICWB 4M29A 1Q9LA 4JKPL 3V4VH 4K5CA 2PW9A 3L5WA 3N32A 4H8UA 1XF5A 5AN8A 4K4KA 3ARGC 1SFHA 2JXMA 3QIBA 4NKMB 3KXFA 4PYGA 4FKEA 3AROA 2Y1AA 1XTMA 7FABL 5IHHA 4HK2A 3SE4A 4Y7MA 3E56A 2YA1A 1FVEB 3A9JA 2IGTA 1DYQA 5J8OA 3IK2A 2K9UA 2FTAA 3V05A 1BREA 3MRJA 3ZXVA 3MACL 1G6JA 2XYBA 1YEFH 2PXYC 4MZ3A 5F9AC 3GS0A 2P8PA 2AVFA 2JI3A 3OXGA 4X98B 4B5EA 4ZYSA 1J5HA 5I1LB 7TAAA 1D6EC 3PAZA 1MLCB 1E4KA 3OLEA 1RHFA 1QR1A 5EF0A 3BK2A 2IDTA 3FFCD 1CC3A 4OFDA 1LO5B 1OCOB 2W92A 3DK0A 3NOIA 5GRVK 5KSAA 4XGZB 5B3JE 5JHMA 1OAUL 1N3NB 3QO1A 1CBVH 4NQCA 4DGVL 4Z7UF 1G6RH 3PL6D 3BIAX 4HLZH 4GG6A 3DSSA 4AY5A 1Q9OB 3JVFC 4WHTB 1RIHL 2CRMA 5C0IA 5M7QA 1YY8A 4B9IA 2IONA 1LJMA 2MJWA 3BYTB 5ALBH 2ZWZA 2UYLB 2NY4D 2P24A 2FO4B 5EV7A 1QQRA 2KMMA 4E0RB 1AOZA 5DRNB 5K5YA 4OI7A 1QQEA 4F7MA 5DF0A 2WLIB 2LXAA 3GW4A 4Z7WB 3W1SA 2IO3C 3UMTA 3FFDB 3QWNA 4ZQKB 4NQCE 4JZNA 5DWUH 5TF1H 2HPTA 3IFLL 4IW0A 4L29A 1NCWL 3CLEL 3LKNB 4P99A 4BH7B 2W38A 3I3TB 4PCYA 4HK3N 3QIUD 1EUTA 4HCRH 2BY1A 2EDEA 3GBNL 3CFDB 1WS8A 3L2LA 2HJLB 3PWVA 1FVEA 1SDDB 5DSCA 4GBXB 5IJKC 3A9JB 1OTRB 2AEQH 5D55A 4JFEE 4PHXA 5DRZA 3LPFA 4F33A 2ZJDA 1MJ8H 1VFAA 3MV3B 2R2BB 2XA8L 1RHHB 4PV8A 5EOCH 5F9WB 4A6YH 1HEZE 3PUKA 4FERA 5EZOH 1J8HA 3CFKB 4UNIA 1YZZA 5AZ2L 4JDTL 3N1YC 5KYUB 3RTQA 3L8QA 2ARWA 3QO0A 3QORC 5C07B 1XLQA 3TCXA 2ZKMX 3TFKD 4KOCA 5AAMA 2XN0A 1BG9A 3CK0H 1K2DA 4C7YA 2WXLA 4XX1G 2ETAA 1HTQA 3M17B 2QSTA 2EDYA 3HKFA 4A2MA 3RAUA 3ZE2F 1VENA 3MBEC 3RBSA 5EX3A 3QUHA 5A2KH 1P69B 3CSFA 2FX9H 2XTJB 1X5IA 4BFIA 5HHOA 2HVBA 3HRAA 5AAOA 2XG4B 4LF3B 1ZLSL 3BVGA 4LRIA 2JQZA 3ASDA 4TNVK 4PGDB 4XBEL 2KD0A 2DQGH 3CVBA 4JCLA 4V1DA 4MBOA 4NUQA 3FU0A 3ZKND 1YX5B 5IO9A 2B59A 3E3QC 3VW3L 1F3JA 3CPLA 5DMGD 1KB3A 2EEDA 1JK9A 4R97B 1N5XA 2GAZA 3TWUA 3IJSA 4TVPH 4BESA 3UTPD 3UIPB 1OTUD 2Y2WA 1HILA 1MCKA 4ZMLA 3ARRA 1KENH 5HHDG 3MCG1 2QHRH 3UO1H 4JLRB 2VSYA 4WURA 3QUZD 2WZ6A 3FYIB 3ZZ1A 1HQ4B 1ITCA 1ACZA 4P57B 1DVFB 2ZCKH 3GLZA 3AREC 2OTWA 1INEH 1WD8A 3MBWB 4PJ5B 5BMFH 4Z3IA 3ESVF 2EDRA 4WQOA 4NHUB 5BV7C 4RAUB 1S8DB 1XZ0A 4LQFH 3QCTL 2LVCA 4HWBA 5E8NA 2MQGA 5E4OA 4Z7NB 5C0NC 2WW8A 3BVVA 1BWMA 4OJCA 1EXUA 1KTKA 2FIDA 3QFJD 4X8GA 1Q0YL 3V6OE 4KVPA 4BELD 3DETD 1M7IB 2H6IA 1WGVA 5D0QD 1RW2A 3DSFL 3LVEA 2GITA 4C9BB 1UM6L 5EIIA 3VLFA 2FHBA 5H35A 4F8OA 2HX7A 1YUHA 3T5WA 2G60L 4AV4A 3FZUD 3A4FA 3L7FA 4KZCA 5C0ND 1I1FA 2I38A 4WEEA 3H6AA 4NZLB 1EXHA 4MDIB 2ZG2A 3L4VA 3DSWA 1K6QL 2BW5A 3AN1A 1Y0LA 5D2LB 5AOMA 1GPOL 4QXUH 3X13A 4IRSD 2PPAA 2VZKB 3LEVH 3NK3A 2CWRA 4U7KA 3DMMB 3SBWC 4CNIA 4NN7C 1ELWA 4CW1B 2JYEA 1CU4L 2EDJA 5FXCH 3ULVD 2WDTB 2KWVB 1PDKA 1DEEA 2BTEA 4ELKB 1DBJL 2LVOA 2V2WA 3R2TA 2EILB 3F6JA 8FABA 4BZ1L 1QSFD 1FHNA 2F8YA 2KS0A 4PP2B 2F58L 4AK2A 4YDYA 4GS7C 3DHHC 1Q0XL 3AG4B 3FEYA 3V0IA 3L9RA 3MLYH 1D5ZB 3N04A 4ESKA 1ILSA 1NFIE 3F5WA 5EN2A 2BVCA 1WZMA 3C2AH 2YUWA 5KNGA 1JGLH 3VU2A 4NQEA 1IL1B 4FQXC 3DV4B 4HSAC 3LHAA 5J6GA 1FNUA 2EO7A 3KH3A 3QRLA 3AACA 1KCKA 1IC7L 5T1KB 3FAWA 3VVWB 2MNUA 3NYKA 3VI3B 1ZE3D 3C6EA 2F1AA 2OP4H 5GRZA 2YGPA 5FIOA 2FJFA 3ZTCC 4HRNA 1J1PL 4XPGH 4APQC 5ENQD 2VXUH 3NAAL 1JVLA 4XMZA 4H2AA 3RDTA 3Q3NC 2O5NA 3MA7B 1QRKA 4DW2L 3S88L 4NT6B 1WUZA 3OHXB 3LYAA 4JX0A 3M17A 1P4BL 1IHBA 1YCSB 1SRDA 1Z9SB 3CFCL 4MGKE 2XV6B 3VDAA 2D03H 1JZ4A 3QQDA 3IV0A 3FB8B 4L8CA 1CFQA 1FNLA 3S7FA 1MNUH 2VIRA 3ZSTA 4I1PA 3B9EA 1W91A 1F2RC 5JIPA 5CJOH 1VZ7A 3KJ6L 1J8HE 2WINA 4QQIA 2ZJSL 4P3DB 4TNEA 5B39G 3D9AL 4NLAA 4GTRA 2BNQB 3IBOA 3QYNA 3V0WH 1KFYB 1YQ4B 1OF2B 2BS3B 1TTCA 4NQDB 4O00A 4QTIH 1QBAA 1FFTB 2EDTA 2OL3L 4UT6A 1I9JL 2EACA 2BX5A 3KPRD 4UQ2B 4S1QL 3BEWB 4KJPD 3BLBA 3ULVC 4A39A 3DXMG 1FAKT 1QASA 1AR2A 3FDWA 1A7OL 4PI2A 4NCDA 2N7SA 1ZDQA 2OCFD 5FK9B 5FO2A 4H40A 1ROWA 3A4DA 2VXTH 4QRTB 4AM0A 3CVHB 1WI0A 1UD8A 4UUJB 1TKWA 5TGBA 1JVKA 2JF1A 5ENSD 4P4KD 5CECB 3MR9A 3K6SA 4K3DL 3KDPB 4GSWA 5GGTA 2X4TB 1D9SA 4KKBD 4ZDHA 4GOCA 2XQBH 2B9AA 3PXJA 4CYMD 3V9CA 2MHJA 1J0ZA 2H1LM 2DYPD 3S8FB 2JZZA 3ZDYB 3D4ZA 1UELA 4HC1H 3X3FH 4OZIF 4CADB 1GGIL 1KDJA 2OSXA 4GP4B 4GUCA 4Y4FD 1ZHBA 1I8IA 1T0PB 3O9WD 4LHUA 1RIVL 4XVSH 1K3ZA 4ZUTB 2A6DA 2GI7A 5JR1H 5HS0A 2Y5QA 1F90L 1A25A 3PJSA 4CVZA 1WXQA 1X7QB 5HYSA 1N67A 3ARBB 1CO1A 1GTFA 5CU9A 1X4ZA 2X0UA 1FVDB 3GSOB 4N25A 2E7DA 5ENTD 1LGVA 1MY5A 3T77A 2APTA 3PE3A 5D7IA 5IBTL 2K3TA 5FZQA 3P0YH 4WWKB 4P2YA 5I1JL 3TVMD 1QNZH 2GEQA 1VD2A 1MCRA 1OVZA 3AMZA 2XQYK 3D9JA 3L4CA 3NFNB 4NP9A 5DHEA 4HEMA 4KK5D 2GBRA 2HJFB 3PUCA 3NEXA 1MFCL 3IJ9A 4HAKA 4YSZB 3OMZA 4U7MA 1WWTA 5CHWA 4TPRH 2QYUA 2B77A 5IA7A 5FINA 3VI3A 4MD4A 1A6UL 3TPUA 1Z2KA 2C9UA 4NM4L 1JWAD 1NDTA 3CQQA 3FT2A 5J3HC 4EBAG 1SXNA 2EQDA 2H2SC 4HS8L 4PJ6A 4W9DC 5CLXA 5I6KA 3LKRA 1A3RL 3NFSH 1EO6A 4N0FB 2KBXA 2QCZA 3O13A 3DBSA 1XB8A 2G0LA 3T2QA 2L7QA 3MQIA 4L37B 2ZVNA 2WK2A 3PREA 2WN2A 2XN1A 4GKNA 1UHVA 4GKOA 2EVJA 1E50A 4N8CH 2R1YB 3IFPA 5GS2H 1FZMB 4XP6H 4UIMB 3G04B 5MP6H 4ZI8A 1GMIA 1PLGH 4JL0A 2NSMA 5FUOL 1K4DB 3ULUL 2E9JA 3LNIA 4L4TE 1CMOA 2WSDA 2EE0A 2NX5D 2Z7UA 3OKKA 4C55A 3GK8H 1TITA 2JFCA 3ILEA 4M62H 3MTRA 3MLZL 3TF4A 1WZ0A 1XH2A 2Y0SA 2O6VA 1F00I 3X1NA 3CDFA 3OB0H 3OR6A 5D5MB 4XP4L 5BW7C 2O6FA 4Z9KB 2WLBA 3LVRE 5EE0A 3SFYA 3G2SA 5T1KA 3J5QB 4YS4A 2CA4A 3ALWA 4S11A 3C6SA 5DJAA 3TO4A 1JTTA 2FJFB 2WQAA 1OAZH 43C9A 4F93B 1HCYA 5FV2A 1ANUA 4AXHA 5JDSB 3QUXD 1KIUA 4UM8A 2O30A 4HPYH 3IFNL 1ACXA 4XNZB 3ZHKA 3U7WH 2JXXA 5D7SH 2ZUTA 4G1EB 2X87A 4JQIA 3S35X 3SBPA 4HOQA 3DPBA 1ZJBA 4B96A 4E5XA 4YTPB 2X1OA 5CRUA 1X5ZA 4QWWC 3VGFA 3L6FA 4ZNEA 2DZEA 1SE9A 1TS4A 2DZMA 2KTRA 2O5ZL 4XN5A 4OM0H 4GXBA 4BINA 5ACZB 4Q9QH 3BP7A 1WZAA 4AGQA 1C16A 1YPZE 4MGZE 4F8PA 4KPHH 3WKML 3FTGA 2XPYA 4R8WH 4DUXA 1B2WH 1HZ6A 1R4MI 5TR5A 4GKZA 4OGZA 5E2VH 4LNRA 1AR1C 5KAQF 1SJHD 3AE7B 3O4OB 1XWVA 2RIKA 3SDXF 2YK1L 2ZOLA 3ZYYX 5KJKA 1M1XA 2ITCB 4JN2A 4Z18A 4BWTA 2O6VB 4GRMA 3O45B 4G59C 2QL1A 5KYWB 4OZBA 1B0WA 5ECGA 3C08H 4XX1E 4XNUH 5CJ8A 4FXGC 2JX5A 2O5XL 4X9YA 2PTVA 3NVWA 3D25A 1D5MB 3FB7B 4WI2A 5AAMC 1D6EB 3KG5A 4YSTA 2DH3A 1UN9A 3P9LB 1SEQH 2JI1A 3AI5A 2I26N 3PGFL 1A4CA 5D5ME 1KTBA 3HTLX 2WXNA 3FOMA 1MHHA 5LN8A 4ISVB 4DTGH 2GK2A 5I0YA 1FT2A 4WW2F 5B38B 1P98A 4N2CA 1OSZB 1Y1DA 2GRRB 2P8PB 3EDKA 4LSTL 3FP3A 3OAYH 3W9DB 3QZLA 3GBLA 3QHFL 5DZPA 3L5IA 4I1RA 4E68A 4K7UA 5D2MB 3PAVA 2JKLA 2NT1A 2KCVA 1FYTE 4N0FA 4R2GD 5CJBA 4MBGA 4RX4D 3S4SG 2CU3A 5GJSH 1CS6A 1O7DC 2XU9A 4WFHE 3D9MA 5FHAH 3ESUF 4OFYA 2XTJC 2DQUL 4RMBA 2F53D 4DK5A 2FEZA 3WE6B 3CMGA 4N2LA 5GZOD 2M56B 2BVPA 5D7IB 4QKTA 4W4OA 2Z0UA 3RWDB 4DGIH 1URIA 1HT6A 3BVMA 4ZRKA 1OAKH 4YDEA 4GQPH 3W0WA 4R84A 3K6NA 2HVJA 4FMKA 3CVVA 1YEWA 4HP5A 1JXDA 4LCWB 4YSPA 4DK3A 1UURA 3LN9A 4NNXA 1NIEA 1UXSA 1JK8B 4F8TA 1NLDH 2Y24A 1JGDB 3M63B 1MVFA 1WISA 4YDJB 5F3FA 1JXFA 2P3YA 4FFTA 5HHQA 1P0RA 4OGXH 3CIAA 1LHZA 2A38A 4GW1A 5IOPA 2AJZB 1CDCA 1ZS2A 2NXZC 4JPWH 3U4EB 1UOHA 4WWKD 1DOYA 4U1LA 2W0KA 3O4ZA 2VYIA 2XN9D 4UNUA 43C9B 3DA0A 1FCCC 1ML0A 1Z7JA 1KYAA 1QUPA 3QFJB 4Z7UE 5D8JL 1DFBH 1QEWA 2J21A 2XCBA 1AMYA 5KTEL 4G6KL 3V9EA 2QDFA 3NJNA 2GCYB 3PXHA 4JB8P 4I0PD 3QQ9C 2IDYA 5E2WH 2Q5BA 2Y1YA 3TA3C 3WFCH 2V5TA 1RV6X 2HXAA 1LVEA 1C12B 1EHNA 2L3BA 1T1YA 1I3VA 2PCXA 1UXMA 2NY7H 3T8XB 4WQMA 3CFJA 4OUUA 3ZKXB 1XEDA 2VH5L 5KG9A 5JMND 3VWKD 1UD4A 3W82A 4JO2L 1J5DA 3VU1A 5LNDA 3TWWA 4PJXB 3OKKB 1IM9B 4JFZH 1PJ9A 2YD1A 3H7BA 4V1DD 2VDOB 3CK9A 3NA4A 1ZAGA 2AEPH 5DUPH 4HKZB 1QUNA 1FWXA 4P29A 1MCPH 3T6WA 3LPOA 4F7KA 2Y25A 4HMEA 5JW5B 4WHTA 4MJ6A 4PY7B 4K0RA 1RK7A 2ADIA 3LZLA 2QGDA 1F4AA 4YSQA 4KQ0A 3BPCA 3CV0A 2ZXEB 4DQAA 4F7AA 3P69A 1AZCA 4TULL 5J6HA 2XK5B 2NUTB 4KK9D 2IANA 3PUUA 5HYEA 3MV01 2K7QA 2C1PB 3N1MC 5IQLA 3QQ8B 3LXCA 4W9JA 3L95A 4U07A 2WO4A 1HEJC 3EDEA 1ZTMA 1QSZA 1YMME 3IDNA 4F58H 1VKXA 1J7AA 2KX0A 1EBPA 3UM1A 3DGDA 3OKNB 4HIIA 2MBBB 4MFHA 2G9HD 4HOMA 3L54A 4Q8BA 3IE9A 3MBWA 2VR3A 4PS4H 4WFED 4CC4C 2UZIH 1IC4H 4LLAA 4XMPH 1OP5H 3WGUB 2RG8A 3TNNB 4XKCA 1XSOA 4JFHE 5HKPA 1AZZC 1XSJA 3WIFB 1AO7E 2YZ8A 2CDFA 1FYHB 2WIIA 1JN6A 1YEDB 3EJCA 3OKEA 4PV8B 1SDAB 5JHLL 2R2LA 1ESOA 2ODHA 1ET5A 3BESR 4P5TA 3U2SA 3V6OC 1BM7A 4LGPB 1N4XL 4A7VA 4AQZA 4NFCA 4GAGH 2YXMA 3GJFH 4HS3B 2GMIC 5AVVB 4RWYL 3PDOA 3QRFM 4PLKD 2WXGA 5D72H 4F2MA 3WEXB 1Q9OA 3TZVD 5I19L 2BIQA 4W81A 3O6FD 4KXCA 3UL4A 2MRPA 4JO3H 3W2DH 2XVGA 3SYQA 2KQNA 3GSQA 1YLBB 1YN7A 1OP3K 4Q4IA 3T3OA 3SE3A 4ZOHC 5DJ0B 1NP7A 4PIBA 5J56B 1E6JH 5HJGA 2MNWA 1UQSA 1NINA 2VITB 3UC0H 1UOLA 2AEOA 4F7MB 5ECJE 4L0ZA 3VTTA 1AXIB 1V5TA 3KEZA 1QSEB 2OMTA 3UZVB 4YUEL 4OZCA 1VPOH 3JWOC 3RL1A 4J8RB 2PW2A 4Z68A 1D5MA 3FB7A 2GFBA 4C0MA 2OYPA 1JOIA 4JHUA 4MS8D 4PI0A 1FCHA 3EYOA 3O3BB 2EC9T 3SDAA 3BX7C 1I1YA 3HHSB 3IMTA 4U1MB 3APFA 3LEXB 5LLIA 1TVBA 2HVKB 2J5WA 3O3AB 1T89A 1FLTX 1JWFA 1X7TA 3FQNA 3LH8A 3KWWA 2DY2A 5GRJH 4NYLA 3WAJA 3LX9A 4GRWF 2BPBA 4U1IA 1MJUH 3P40A 4FF9A 5EZPA 3KCPA 3VXQB 4YVQC 4J8FA 2DWXA 1KLGB 4M7LH 4ODVL 1FH5L 4WKXA 1TQBC 1N6VA 3LZOA 4Y1AA 3ZHNA 5ILTH 3V61A 2BY0A 3WY3A 3L3OB 1D6VL 1CIDA 2FULA 1C7SA 3CFUA 1WAAA 2Y69E 2N7BA 1JPTL 1TEYA 5IP4A 4NQXA 4UDTB 4MKMA 4QHKJ 4IRUA 1HHGA 3S7JA 5IESH 5HYJB 1JNLH 3MBED 4TS6A 5GZNC 3QDMB 3X14A 2MEJB 5IUSA 1E0ZA 3OMNB 1YQ2A 1Q0WB 4BOZB 2Y1LE 4OAWB 3KYMB 4OCSL 3JWDL 3PZ2A 3II1A 2X38A 4F5CE 3UBHA 4XIFA 3LZFL 1R5VA 4Z23A 1ES0A 4XNQB 3V0EA 5DQ9A 1FCCA 2PYEB 4QXGL 1C7TA 2R69H 5D4JA 4L9PA 4HUVA 1QKZL 3ARPA 4FFVD 4NWTH 4KKJA 3TOPA 2HP4A 5KSBB 4LSRH 3LSOB 2L8JA 2V17H 3ZMNA 3BN9C 3NS1A 1A1MB 3Q06A 1KTRL 5GHWH 5A40E 4F7CA 4LGSB 4GQZA 3MNWB 3JQ1A 4N0RA 4FBJB 3DETC 5CBOA