4XE0A

Idelalisib bound to the p110 subunit of pi3k delta
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
917
structure length
815
Chain Sequence
b'VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
publication title Structural, Biochemical, and Biophysical Characterization of Idelalisib Binding to Phosphoinositide 3-Kinase delta.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 263
structure length 815
sequence length 917
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4xe0A05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xe0A01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4xe0A03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xe0A02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4xe0A04
2Y3AA 2N1TE 1TJXA 4KITB 4ICWA 1BCIA 3KWTA 3HIZA 4QJ4B 1DJXA 2X38A 4KZCA 1DQVA 1TJMA 2I9CA 2NQ3A 4IHBA 2FK9A 2YOAA 3F01A 5ANLA 3R7RA 1UOWA 2A5UA 2DMHA 4PH4B 4PS8A 3MJWA 4FHJA 2WXHA 3LS8A 2ENQA 1YRKA 3M7FB 4Y1TA 2K3HA 1E8ZA 1CJYA 5KJ7E 2WXRA 3TJPA 2K45A 3QJZA 4FJZA 2LHAA 4EZLA 4TUUA 2WXIA 2CHZA 3L9BA 2X6JA 2D8KA 3L13A 4WWOA 4QJ3B 4EZJA 3QR1A 5H4ZA 2CM5A 4UWGA 2CHDA 2FJUB 5CCHE 2V4LA 3L17A 5EDSA 1DJYA 2EP6A 1DJZA 1DJWA 3HN8A 3QARA 3NZSA 3GPEA 5G2NA 1E8WA 4OVUA 4LT7A 3DPDA 2ISDA 1E8YA 1DJIA 2CJTA 2A4ZA 4L2YA 2ENJA 1BDYA 3OAWA 2WXMA 3HHMA 4URKA 1UOVA 4KZ0A 4XZ4A 4PS3A 3ZW3A 3B7YA 4QAMB 3FBKA 3W57A 4DNLA 5T8IA 4F92B 3ML8A 3L08A 5CCGE 2QZ5A 3S2AA 2WXNA 1V27A 2CM6A 2R83A 2Q3XA 5G55A 4DK5A 4TS6A 2CHWA 1WFMA 4G11A 4WEEA 2WXOA 2X6KA 3IHYA 2RD0A 2WXPA 3F04A 3F05A 4L1LA 4QJ5B 4FHKA 1QASA 3ML9A 2WXFA 1UGKA 4LDCA 1WFJA 5CCJA 3IBEA 3PREA 5ENNA 4AJWA 4LCVA 1HE8A 3LJ3A 4WWNA 3JZYA 3APDA 3R7QA 4A55A 1A25A 1RSYA 1W15A 1BYNA 3CSFA 4WAFA 3ZVVA 4IQHA 2X6HA 3L16A 3PS6A 2WXJA 1E7UA 3FDWA 4MJJA 4OVVA 2ZKMX 3OHMB 3ZIMA 3SD5A 4NP9A 2WXLA 4UWKA 2KI6A 4Y1SA 4TV3A 3TWYA 4V11A 4L23A 1CJAA 4WWPA 4AOFA 2K4AA 2CHXA 2NCEA 3TL5A 2NSQA 4PS7A 2Z0UA 5H4YA 4L1BA 3KWUA 3RDJA 4XX5A 4FADA 3QR0A 3CSTA 2QZQA 1E90A 5JHAA 3QK0A 1DJGA 2Q0ZX 2ENPA 4UWHA 4HVBA 3NSJA 3N5AA 4ICXA 4GNKB 2WXGA 3T8MA 4JPSA 2WXQA 3L4CA 4NPJA 2JQZA 1DJHA 3NZUA 3P2BA 1GMIA 3ENEA 3F00A 4BGDA 4J6IA 2K8MA 3PFQA 3APCA 4NPKA 4OYSA 4ANVA 4UWLA 1RH8A 4ANUA 3W56A 2WXKA 4FJYA 4FLHA 4HLEA 3PRZA 3L54A 1K5WA 4ANWA 2X6IA 3DBSA 4XE0A 4F1SA 3IM1A 2B3RA 3PYCA 3APFA 4FULA 4BFRA 2YRBA 2UZPA 2X6FA 1RLWA 1W16A 4EZKA 2CJSA 2DMGA 4GB9A 4F91B 4F93B 5JHBA 2BWQA 1E7VA 1E8XA 3QAQA 1DSYA 4UWFA 1QATA 3RPBA 4NS0A 4ANXA 4FA6A
chains in the Genus database with same CATH superfamily
4YSRA 2G4EA 4P2CG 3WUWA 1MX4A 2VLJE 3D2UB 4HIXL 4KZDL 4FA8A 1KJMB 4GXVH 3ZPDA 5AZEL 4R4FL 3DX9A 2F0YA 5IM7B 3RX7A 4UTAH 4GG6E 1A7NL 1XD0A 1C4CA 2P42B 4XZUB 5H92C 2HT3D 4YFLF 1ZW7A 1MCEA 5JA9A 2F1AA 2PYEA 3BP7B 3HC4L 5DVNA 3UX9B 5DEGA 3S4SG 5ITBH 5KJ7E 3QJTB 3RDTC 4MAUL 2VDKH 4P2RE 4KROC 3P4QB 4I18B 1XLQA 1OY3B 4LG6A 1LYQA 2CQVA 5I5MA 4AIFA 2BP5M 2IH8A 3JWOH 3FUNA 2BW4A 2KLGA 1UCTA 3F3HA 5CWSA 1FNVA 2MSED 3LZLA 3RRMB 5C0EB 1KGUA 4PJIE 3HXDA 1R0AH 3EKCA 3HVZA 1WCQA 1FIEA 1KCRL 3NA9H 5SWSB 3MC0B 4J8EA 2PR4H 3A4EA 2QPUA 4JRXB 4NHCH 4JRYD 3VD0A 1TVHB 3VXSD 5DWPA 2VW6A 5E1GA 4WWKA 2CO7A 4GXVL 4PLKD 5FF6A 2FIDA 1I7ZA 5FHAL 4H8UA 4I3RH 5DD3L 5BUAA 3MKRA 4S0TD 5T8IA 4PW3A 3HR5A 4L4VE 4Z18A 2CM6A 3DROA 4HV8A 3W9DB 5CMAB 3Q8EA 2RG8A 3SKJH 4ZO9A 4PYGA 2YMXH 4WK2B 1KULA 1CK0L 1FC1A 2QV2A 2Y5TA 1DLFL 3ZHKA 3SB3A 2IDFA 3T0AA 2F7IA 1TFHA 5CBOA 2O6FA 4YXKH 2XHEA 1WFJA 2J21A 5HI3C 2WDRB 5GJSH 4B50A 3Q4AB 4I43A 1KCWA 2V5TA 2KH2B 3MYZA 5D9SA 3ZDYF 2NZ1A 4H0HB 3KCWA 2NCMA 4EIUA 5JPNB 4AYID 4PG2A 3T3MF 2XWBA 3I57A 2WXJA 3U7WL 1F6AA 2M19A 4TSAH 4Y2LA 1FFQA 3MLVH 5CJOH 4HKJB 2GJZB 4Q69A 4LDLB 2ZE0A 1QR4A 3CHXA 3PABA 3MRKA 3TZVB 4L23A 5MP6L 3IK2A 3VGAB 1WZ3A 2CHXA 1L6PA 4WDIA 4F7PB 3B0AA 3PNTB 5A2KH 2CO4A 4K5BA 5D7SH 1XZ0B 1UVQA 3CV5A 3U82B 4ZUVB 1MW0A 3KYOB 3GZKA 2R69A 3GJFA 3B2VL 5KWDA 4M1CC 2HPOA 5HRYA 5CJ8A 3LZOA 1QBLL 2ADFH 1EAQA 4GZCA 3HMXH 3V6OC 1N19A 5FYLH 1LQSR 1SSNA 2EC9T 1NSNH 3PAZA 3TMPB 2MOQA 5E2UL 4HFUH 5IMKB 5IJDC 2QKSA 4MD0B 4XX1G 3CQCB 2HP4A 1CIUA 3SDYH 1QT9A 1Z9SB 4OH2A 3WHE1 2AJYL 2ZSVA 1JWUD 2BNRE 4OKDA 3KBFA 4Q6KA 1E96B 1H0DA 3VFWB 2VDRB 5C0FB 4KKCC 1YNKL 1I9IL 2G4DB 1OTTD 4Z7WE 4KJPC 4PD4J 3A67L 2WQ6A 3K0WA 3SZ6A 1ZWIA 2CA3A 3VGDA 1OSZB 3ZYJA 5CM1A 2F53B 1CBVL 4I0KA 4QGTA 4YE4H 1XLNA 5J8OA 4HBCH 4PHZA 4J6RL 2CDGA 3NGBB 4MSWB 4ZQTA 3UQAA 4X0KA 1HINH 1PG7H 43C9A 1R3HA 3MI6A 4KSKC 5G5GA 2ADFL 1WGHA 4NJ7A 4OGAC 3M1OA 1U3JA 1G6VK 3MA7A 3QRGH 3QZLA 3EO9L 3VH8A 3MVSA 3P0YH 4XC1L 3MLUH 4HFUL 4G8EA 3V7AG 2AQTA 2DRUA 4X50A 5KAQF 4AJVA 5EIIA 4HMCA 3L9BA 4GIAA 3VXUD 5MERA 3QVAA 4LNOA 1RZKC 4QJ3B 3IN0A 3I9GH 3NCXA 5HDRA 2CUAA 1WBYA 1PFDA 2DNFA 1RJLB 2DX5B 3ZE2F 1UC6A 2D7TH 2XZQL 1F11B 3BRDA 3QUKB 5JXVA 1F90H 3D9JA 1FE8H 3FTXA 1KCKA 3QA3B 3DYMA 4Y2OB 4WW1B 4XNQB 3B2MA 1ZV5A 2LJ5A 3EJTA 5KBNC 3C87A 2O1AA 1JGEA 3VFNA 1XGUA 1MFWA 1VDVA 1XF5B 3RI7C 4U1HB 1E4KC 5AYTA 3VWKD 5ENRD 3O4LA 3O3BB 4PRAB 1MX2A 3KMDA 3FB5B 4OLVL 2DLIA 1F1HA 3UI2A 3DWTA 4ELMA 1SDAB 2Y5QA 1Q1JH 3O11A 3P0YL 5CIPH 5EV7A 5CEYB 5C1ZA 1CFBA 1JJUA 3TIEB 4YHLL 2NCNA 1GZPA 4CN4A 2Z91B 4G72B 1JGVL 1RHFA 2A6DA 2JI2A 1SDYA 2VM3A 2I07A 4OY9A 4RBPH 4XMLL 4JQIH 5JZ7C 1KTJA 2OV0A 2VSYA 2YEZB 4IDJH 3W3BA 1DJSA 3GTVA 3H7BA 1BREA 4JPQA 3KWLA 2CR3A 2E9GA 4WTXA 1Q5WB 2CO3A 2D7TL 4FZ8H 4L3CA 4PWIA 2IQAB 1H3PH 4IEFB 3DTDA 5GRZA 3DSXA 1OWOA 2J5LB 1O1TA 1I1AB 3AVEA 4PJ7F 3OKKA 1HHKB 4PUBL 3L3JB 5EEVA 1ROEA 3NP4A 2EDNA 3DUSA 4M7ZB 3RVWD 4G9DB 3CZKA 3ARBA 3QB2A 4V11A 4Q9RL 4Z76B 5DUJA 1F56A 4ODSH 2HE7A 4M6ML 3NIFB 4BWWA 4HT1L 4BSJA 3CFBA 3RKDD 3BZEA 1K51A 4MLIA 2RGFA 1EZVY 2MBEA 3AT8A 4W4OA 3U30A 1NCDL 2JNZA 1SYSA 3SFZA 3C75A 1TIFA 3VQMA 3KGTA 1SJHB 4N1CA 2X6MA 1RZPA 2PPEA 5EH1A 4IDJL 4IRJC 3RX9A 1FVEB 2A6JB 4S1DC 4ZMTA 3SOTA 2D03H 3JYUA 2AEQH 2IU1A 1A6AB 1CR9L 3U2IA 5BV7B 4K3JL 1QRND 4JVWA 4S1RH 1DOYA 1ADWA 3KPSB 1YNLH 1FVDB 1H3VA 2DWEB 5J12C 1C12A 5JJ6A 2XFGB 4IJ3C 3WEXA 4LAJH 1MCKA 4X5LA 4DGIH 2OOBB 3M63B 2X6AA 2DLTA 3K2UH 1A7PL 1B6DA 3SY0B 3WAOA 5E5LA 1GOZA 2VL4A 1TYGB 2VW7A 1FIGL 4TSCL 2V7HB 3OMZA 3WXVH 1QOBA 4B9FA 1EFXA 4NQDB 4GOSA 5EO1A 2N0MA 1FEHA 3TJEL 4DN3H 5GS2D 4GUPB 2PMZA 3GZNI 2F5BL 2OEDA 5C3LD 1ID2A 3P1MA 5HFYA 4TMAB 1KPRA 1ZS8A 1NAMH 2B1HL 4X4XB 2Y07H 5F1NA 4MX7B 1J9QA 1XH0A 5KBDA 1BVKB 2IGFH 5JW4M 2L8JA 3QO1B 3IJHB 5EOTB 5JW4N 1EXUB 4ZK8A 4YLQT 4D0DA 1YY9D 3D39A 1Y0LA 2HTLD 1H5BB 2ICWB 2JJUA 1OGTB 2FEJA 3D50A 4RSVA 4A7UA 3O65B 4HWIB 4GTOA 5C9KA 3MLZL 2W65A 2JCCE 4XXWC 3VACA 2H89B 3PHXB 4M9OA 5FK9C 3T2PA 4B7LA 2XTSA 2BNUB 3WDIA 3QDJD 4H8WC 2QDFA 3D06A 3GINA 4EUPA 1IVLA 1E3ZA 4ODXA 5DMGC 2FWOA 5EOQL 4MH0E 1AQKH 3VQ2C 4Z7NE 4CMHB 2NSMA 2XG4A 4WFGE 1FORL 2OTUA 1G1OA 3R1GH 3TT1H 3AG3E 2VABB 2EMTA 4KOCA 4M8QA 2NUPA 3U4BL 3F83A 4G8FB 3D3VE 4YBQD 3ZR6A 2XV3A 1MLCB 4UINH 1R5WB 1YMHB 1ZE3C 2DF3A 2MEJB 1GJZA 4YDOA 4NUQA 5E94B 5I1CL 5EN3A 3NN8A 3P4LA 1FXAA 1GAQB 5F93C 1NCBH 5I1HH 2OMUB 4RAVA 4LHUB 4X6DA 3ZTEA 3SCMD 3U30C 3ZLQC 3PS6A 1PKQE 5D7IF 2TRYA 5HHDG 4I6EA 1IM3A 4XWGH 1X5XA 3DGGA 4CHKA 4HUWA 1EZSA 2J1KA 3U4EA 1XAKA 4ECNA 1FG2B 4R3SB 3TURA 1MCWW 3OZ9H 3QPXL 3IFOA 2WNKA 2O5NA 4L37B 4JK0D 3V61A 4HLZG 2C9PA 1J0IA 1FJ1B 2QDVA 3EOAB 2XJLA 4EQ3A 2ZXWB 4LCWE 3I75B 3FQTA 3SGDH 4ONHB 5CD3B 3NSDA 2Q0ZX 2GIXA 3UJTL 2K6QA 3TUOA 2P48B 3P4MB 3QEQB 2K9FB 5HVHC 1OWMA 3U1QA 1P1AA 5KVFH 3EO1A 2AXFB 1JGDA 4KXZH 3WL9A 3GIVA 3GRBA 2PXYA 1BX2A 2QGDA 1L6XA 1VFOA 1LO4H 4WV1B 3V55A 4DVRH 5F3BA 2R2QA 5IKCA 2M17A 1CFTB 2W5PA 3MV7E 5K9QI 4OB5H 3ZDZE 4NO5A 4GAYB 3ARWA 1KIRB 5TQ0L 3HZYB 1HDMB 1JRUA 3LX9A 4MDIB 5I18L 3QCTH 1UQSA 3OZ9L 1QSFD 1S8DA 4GB9A 1RZ4A 4ITKA 4JHRA 4WHYG 5D2NB 2I9LB 1LK3H 1CGXA 2BYFA 3URYA 1OXJA 4JGHB 1N64H 5G05J 1TETH 2ZXQA 2Q8BL 2FBNA 2DZNA 1KXVA 2OMXB 4HJEA 4PCSA 1IGJB 2WYIA 3N50A 4KMQA 1M2VA 3C8KA 4GIOA 4WUUD 4DX5D 2D7MA 4GPKA 1F58H 3EO0A 3JWDL 4CMMB 1I8IA 2L7QA 5IFJB 1VPOL 1H3XA 4MQSB 4RIRB 4YDVB 5C9JA 1Y56A 2BP0A 1J88A 3EAKA 4CC1A 1L0YA 1V80A 1E28A 3JUEA 3H85A 4PGZA 4R3DA 3D7PA 1F6FB 2R39A 4PS4H 5HP5A 4RVBA 5CECB 3SJVE 4KO9A 2LLGA 5L7XH 5MEQA 3E32A 2P8PA 2VLLB 3QPKA 1E40A 4IGBA 4N2GA 4Y7MA 3UTSE 4GQRA 3UGUA 3RDTD 1LQBC 3S5LA 1WQVT 4KROD 2WOYA 4DGVH 1X44A 4G6MH 5C0RL 2OPCA 5J6GB 1QLEL 4P46C 3ETRA 4XPAL 2XGOA 3VB9A 1XXGA 5E76A 2JKRM 4X4KA 4EDWH 4LNRB 2CJTA 4EMZA 1B9ZA 4FNUA 1EBPA 3BVUA 3AM9A 1ETA1 1T22A 4O4YH 5ADPH 3N32A 1NCCH 4ZUTA 3W57A 4F3FB 3ML8A 1ZXIA 3QZBA 1OF0A 2CJ3A 1N5XA 4XO5A 3ULQA 5ALBH 1MIEH 4DK5A 4AQAB 4P3CL 4Z6AT 1WMHB 4MS6A 4AQEB 5C2BL 1WYGA 4JRYB 3SKNA 4GXBA 2GTZB 1WFIA 3HLAA 3VXSB 5BO4B 3FSAA 3OPZL 4KTGA 1A5EA 1ACYL 1J12A 3CLJA 2A4EA 3BVVA 4YX2H 4ZFOA 5C09A 1W15A 2FT7A 4LKCA 4NDMA 1P1VA 2P5EE 4EEWA 1TVBA 2CU9A 2WLMA 1ZMYA 3NCCB 3BSZL 5F9JA 4CVZA 5HI3D 3U83A 4ACFA 3DI2B 2G3NA 4U4IA 3MLPA 5JMND 1N0LB 3H6NA 1XSIA 4Q97A 4TL5A 2YKKA 5SV3A 3F7YB 3NAAH 3TL5A 4N2KA 2J88H 3LVTA 4QRRA 2X88A 3V9FA 5IESL 4HDOA 1Q72H 5ALBL 5ESQB 5DPSA 5HKHA 5CLWA 1FYTA 3CXDH 5C07E 1T7YA 4IMKA 1CLOL 2EEDA 4QRSA 2V6HA 3BO8A 3ULUL 3PDOB 3BPNB 3AWEA 3ECBB 2O6EA 3LPWA 1UKTA 2YLHA 3QJHA 4G6KH 1HXMA 1SUHA 5IQNA 4AW4A 1I7RA 4N3TA 3NY5A 1M94A 3GEFA 4EDXB 1UOHA 5C92A 1A7BA 2D3JA 4G7QB 3V05A 4XBMA 1MQKH 2J07A 1Q0YL 3MYJA 1R24A 3C19A 3OC5A 3PUJA 5IMOB 2OCCB 1OEYJ 4H2CA 4MD5B 3JTSB 5AW9B 1GB1A 4HLJA 1JCSA 5H37A 4OZIB 2WMPB 1MWOA 1Q72L 3A6CH 1E67A 3H6JA 3FQ4A 5CZXC 3J8F7 2PYED 3GZQA 4KKCD 4L8BA 1JWUB 5E1AA 1PUTA 1A1MB 2XA8H 2VWEE 4AKQA 4NJAL 4KJPD 4WTZG 3P1VA 2HJKB 3KLDA 5E2VH 4FHJA 2PL2A 3AXLB 3D69B 3AS3A 3P69A 4K7PH 4OM1H 3UO1L 5CJXA 1HCYA 5KYWA 1U2CA 4MCYB 1QTYT 2FX9H 2WWOA 2JELL 3HC3H 2BB5A 3AC0A 4JKPL 4XNZC 1W0YT 3OSVA 4OGAD 3DVGY 2IAMB 1I1YA 1JFQL 2OJZH 3LDBC 3MXVH 1KOTA 4DZBB 1WE6A 1LP9B 1MCDA 1S5HA 1TQTA 3ZKQD 4A20A 1OANA 4I5BB 1IAMA 1R4MB 1FPTH 4ZUWB 5IGXH 4BETA 3N42F 1AD0B 5CCMA 1FV1B 3FN0H 2J1WA 2NTTA 3IKCB 2RGSA 5CFAA 2CXKA 1YN6A 3FH5A 3MKGA 2FUG1 1OZUA 3EYSL 1P84J 5IFHH 1BW8A 1J1OH 3HVEB 1JG9A 1LEGB 2K9XA 2XV2A 2MW5A 5C1DA 3VXUB 5EU4A 2DICA 1AE6L 3O2DL 2Q76A 1B4TA 2IFUA 5AB2A 2DKUA 3MZGB 4OZGE 1GSKA 4LSQH 4OM1L 5G55A 3EBHA 5DMKA 1GJIA 1KN2L 2AJZB 4KKQA 4AM9A 2Y06L 2ZXAA 4ENEC 1H15B 1BD2A 1TZ1A 5JHMA 3VSQA 1U58B 2FEEI 4XCNA 5IWLC 2Q6WA 2E74C 1CN4A 1KTDB 3FCTA 1KBGH 3WD5H 1VACA 3ZTNL 4CSSA 4A7GA 3NG0A 3K6OA 1ZLUK 2TSAA 1CDYA 4M4PA 3VWKB 4EI6A 5J13B 4CSTA 1BG9A 5AUMB 2UY1A 3WY3A 3FN0L 4ZS7L 5JZ7D 3FQRA 2BKRB 1JHTA 1IC7L 1BD8A 4M5ZH 2DBAA 1A1OA 3L16A 5KHOA 1CGWA 3AECB 3L6AA 2I1KA 2X2YA 5AQAA 3DOIA 2AZAA 1CGSL 2YD1A 4YOKA 4N5EC 1WGGA 3HNSL 1U8NB 4XAWL 4DGYL 2WNGA 5JA4D 4X2UA 1QO3A 3OJDA 4LSQL 5T5FA 5A6IA 1BFSA 3AMKA 4LESA 25C8L 2NXPA 4EIGB 6PAZA 3WNMA 4N59A 4ZXBA 1WXQA 3JUZA 2NNAA 5EHFA 3NFSL 1BLIA 1L0XA 1XR9A 4LL4A 4G83A 3G9VA 3X13B 2K7PA 2QDWA 3DA0A 5B1BB 3STLA 4HB5A 4R8WL 3MNDA 4FMKA 5CZVL 1MXGA 5I76A 3OAUH 4TQIA 3LZRA 1ZAGA 5FYKE 5HYJD 2FYVA 1DBMH 1NBZA 3H9ZA 4KAQH 5IQLA 3V0FA 1J9SA 1NOFA 2DWDB 3FTZA 2XZAH 4IRJD 4OD1H 2C7NB 4PJGA 4C00A 4S1DD 1JK8B 1X4XA 3V0EA 2E8YA 2W59A 4XVJL 2HTME 4AEZC 2VDRH 1S3SG 4XXCA 5E4EB 3ARFA 2X9XA 1WIAA 4Z3FA 3GHBH 2J0MA 2WMNA 4Y1AE 5LB1A 1SQ2N 1EK3A 4XP4H 3CQGB 4Y4KC 3HAEA 5D96B 1LM8V 2K78A 3OKDB 5CILL 5ISZA 2FO7A 4NKOB 1FZJB 4ZZKA 4HCPB 2BCKB 3SKOA 3EHQA 5ENQD 3FU3A 4KVGB 3ZE0F 2BIIA 4PJXA 2C0LA 2XRAH 1MI5E 1Z5LB 1NANH 4W1TA 4HMEA 4N85A 5EC1A 3IT6B 5E1QA 4Z1PA 2ETWA 2Y4UA 3PZ4A 1JGIA 3ULYA 3QQDB 4H40A 4WRLA 3ZIYA 3AN1A 2DLGA 1ZHLA 1MEXH 1K5NA 5FGBC 2YPLE 2LU4A 3FZUD 4AQ8C 5C0DB 4YWGL 1QG3A 2PLPA 4ZAKA 1OIOA 4MMXB 4BH8B 2IDCA 4P5SA 4C83B 1UH2A 3JSVA 3K4DA 3C12A 3L17A 1T0MA 2EEBA 3NACL 4LSUL 4G8GE 1FCLA 2QVFB 4F8CB 4KX9A 1L0QA 2KPNA 1OCRE 5CZRA 3T08A 4GY4A 3RKVA 1DBJH 1YECL 2AQSA 5DD0L 2A83B 2V5YA 3K1DA 1KENH 2HUEA 5C08D 2AXUA 2IOIA 2KHWB 3BVGA 1CD1B 5LUMA 1CGUA 2WWNA 4Y89A 2CIIB 3RUGF 5KW9H 3ALPA 1FUNA 1BBJB 5DMGD 4R5TA 4XOEA 1G87A 1F0ZA 4PJFB 3HUJB 2J49A 1C08B 1JPGB 4M9PA 3MUJA 2DWZA 3DWMA 1ZVSA 3U1PA 3QDJB 3P30L 2I6HA 5CHNA 3B37A 3HHSB 4GBXC 2CNZA 3ZUCA 1G0XA 2X4QA 5DTFA 4DOHE 1KIQB 2JQMA 1MIML 2EXYC 1N3NA 1V05A 3I6LE 1ZPUA 1KC5H 4NQEE 3V6EB 4NRYA 1ZE3D 2O5YL 4Y19A 3L4YA 4UQYA 5I5IA 1ZY9A 4FXKB 4MCMA 1E7UA 4G24A 1KGWA 2BF0X 4LGSB 4MNHB 3GZ1A 4IBUA 2X6UA 2BYEA 1KYDA 4Y5VA 1H9DA 3BINA 4UWKA 2FUQA 3EF4A 3L1FA 1AGBA 1WSST 2WCGA 3HRPA 2FGZA 5BVJB 1IEBB 3VH3B 3QNZA 4KGRA 2OXHB 4LMQI 3UGBB 1G0YR 3BESR 4ODWA 1AO7D 3NYKA 2DLFH 5BZWB 2PVGC 1LDPL 2K6YA 4U0RB 3RWDB 5AUKA 1MHEA 2VLKD 3SCMB 5FINA 1GGCH 3GGWA 2KBGA 2VGXB 5CRVA 2ZISA 1MUJA 2WUCL 4K71C 3CFIC 1PCXA 2XYCA 3HPJA 2UWEF 4XXCC 3MFFA 5G05C 2BFGA 4AGOA 2FCNA 1WYWB 4W9JC 1QR1B 2YUZA 3HN5A 4RGTA 5BV7H 3PFQA 5AVZB 1CXHA 1F4HA 3QG6A 2INNE 1BOGA 5EZIH 2LW3A 4PBWD 1VF5C 7FABL 3LKOB 2GKIA 3W0WE 1QSEA 4L3AA 3QUHA 3HE7C 3P73A 1OCOE 3RAJL 1T1ZA 4GMSL 4WEUD 3VXPA 2KJHB 5M94B 4AP4C 1S0PA 3S2CA 5KJKA 4P23C 4XN7A 4OD3L 3QP3A 1S7VA 4E5XB 3WTVA 1SHMA 1JK9A 3DOWA 1V86A 3B2DC 3BFWA 1QWUA 1DJXA 1GGCL 1KFAL 1C8QA 1NAKH 1P4UA 5AEAA 5LXGL 2EIMB 2HX9A 2JUOA 4G7YL 4C8XA 4DX6D 6FABL 3APNA 5M95B 1BYOA 2EYRB 1MVYA 4HA1A 4RGOS 2IEPA 2O5ZL 3GW4A 1QSFB 4OI8A 2MTAA 3NEEA 3ARTA 3KNBB 1BVNT 4GTTA 4XOCA 5ACZA 1GYAA 2CKBB 4JFYA 2TRHA 4XVSH 1J8HA 5CCLA 4KTYA 3BQUC 1TLMA 1LHZA 4P3DA 4RZCB 1UN9A 3CVYA 1TNMA 3ALWA 4HSQA 1XO3A 2RALA 4KT6B 1ENFA 4L8DB 1I4PA 4OHJA 4K2UH 1E27A 4HI9A 1J0ZA 3T09A 3ONSA 1AQMA 4LRIA 1OD9A 4WUUB 2P4AB 2D2QA 2WN2A 3CK0H 5SX5K 4QYOA 1S7TA 2AXGA 3FAWA 4EE2A 3LEYH 4FLBA 4FNPA 3I3EA 1ULVA 2IWFA 4WAAA 4AEHH 1C76A 1INDH 2HVBA 3AREC 2F7OA 3P4PB 1CQVA 4Q0XL 4UQEA 1FL5B 2KCLA 5TK4A 5I1JL 4P46D 1SLUA 4KPHH 4HSAC 5IJKC 2QQNL 4KROB 4ZMNA 1NEZA 2Z0DB 3WIFA 4DLQA 4IYPA 2OSWA 1P7FA 1UWGH 5I5JA 5HHQA 1MCPH 2VMDA 1A4CA 3PV7A 2J8HA 4Y5VC 5GISH 5LXHA 1ZTMA 3PHAA 1YEDB 1ZA3A 5AVQB 4X42A 4ZW5A 2HM8A 4KXAA 4ABQA 3LJ3A 1KSRA 5IY5B 4AZ8A 1WI0A 3KPRB 2FRGP 3BEVB 5E6YA 4YJZL 1EGJL 2IDTA 4XO3A 3T9LA 3O6FA 3P2TA 4M29A 1GGYA 4NN5C 4QOKB 1FD6A 2EYSA 1A4KB 2YD2A 4O00A 4PLJC 3GI9L 1WEJH 5I1LB 3A24A 2MCAA 1H3TA 4JXTA 4FXLA 1YC7A 2QVKA 4KPHL 4I1AA 4RQQB 5F6HJ 3ZYMA 4V3IA 4NAJA 4ADGA 1WF5A 2QZQA 2R0ZH 3TV8A 5DCCA 1CE1H 4E36A 1JDCA 3H1UA 2DQDL 2WX0A 4P04A 1P1ZB 4JFFD 4YAQB 3JXAA 4ACPA 3TG4A 3RFZB 4OIBA 1TTRA 2I7OA 3GSWA 2BMKA 1S3KH 3EADA 2X4TB 1MKFA 4XNYH 4AWJA 5I71C 5IO9A 3T5XA 2XK5B 5A2FA 3VD2A 4MNQD 3TXAA 2R23A 4WI2A 2ITFA 2B2XH 1ADQA 4UQ2B 1U8HA 4L0ZA 2OR8A 2LE9A 2FCBA 5DI8B 1UGNA 4ZFZA 4Z5RA 3O41B 4XB3A 5B3SB 2WJ7A 3CZUB 5GRJH 4TF4A 3S8FB 1AMYA 2XZZA 2FX8H 3MBEA 3A4SC 1UZ8B 3KH4A 3BP6B 5IBUB 4PY7A 4ESKA 4E42A 4QNPE 5C1MB 2P49B 2NY5C 3AG2B 2X5PA 3UMNA 2GBTA 3OPUA 3SPVA 4JHWL 4OGXH 3WGVB 4LRIC 5CZXD 4KH9A 2DMHA 3RTQA 3ZKNC 3G04A 1MI0A 3WUWB 1XGRB 1WUZA 2IAND 2V0AA 2VQ2A 3ZO9A 2GBRA 4K7FA 1SN0A 2Y23A 1X4ZA 4G7VH 4LZKA 3T4AA 3VXME 3GBDA 2PYEB 12E8L 3CMOL 5BZZA 3QR1A 2BTEA 2BS8A 4G80B 5IJVA 1V54E 1UENA 3FO9A 5D7JC 5DRWB 3WY1A 4WU7A 3A33B 3NHEB 2QY7A 4IK7A 5GRJL 4BK5C 1HOEA 4UOJA 5CU9A 3O3EB 2PNDA 1JF1A 5DFTA 5L4JA 1UXSA 2KQNA 1OCCE 3MA9L 4YZWA 3ZU8A 1AP2A 2XQBH 3A9KA 4KZ0A 3ZW3A 3GI8L 3IE4A 4PGJA 5JW5B 1OOAA 4R7NB 3NAWA 4PJEF 4AS1A 3A3YB 2G60L 4GTVA 2DI7A 5D93C 5F8QC 4N8VA 3TXMA 2CO2A 4NQXB 4N3AA 2JMRA 2WXOA 3BUQA 1B4JH 2CO7B 2YO3A 1WCBB 5FF6B 4ELDA 4DUXA 1I7ZB 2EVHA 3MPCA 5CO1A 3K71B 2DM3A 5DQDH 2R29H 1XLOA 4HV8B 4MRCA 3FUKA 3ZL4H 4JVPA 3E0GA 4ENED 2IADA 3NIGF 4TTDC 1A7OL 2AQ2B 3TCLA 3ZK0A 3MO1A 1CGVA 4YR6A 2ZNVB 1J7AA 3V0AC 4FI6A 4HDQA 1GPOH 1U8CB 2Y5TB 1RERA 1AGDA 3D4CA 4Y5XC 3ZDMC 5E75A 1CQKA 3QEUA 4YL8A 1KDJA 4OV5A 2IFFH 2HE0A 4HEPA 4V2BA 2VR6A 5C71A 5B3JE 5D9SB 3GLZA 2XQBL 3CVUA 3I85A 1FYTD 4K5CA 1D5RA 4KUCD 4DJMA 3TWXA 2KERA 5C6WH 4KNQA 5EYLA 5AAMA 3WGUB 5H7PA 2XWBB 5FO8A 1MQSA 4TKNA 5KVDH 5CN1A 5E7FA 4P9HL 2BFVH 3CFQA 3HK0A 5GGVY 5J7CC 4N5ED 1G4MA 3EU9A 2DJSA 3VI3F 3PABB 4PGBB 4BTBA 3MRKB 2OZ4A 2CBQA 3HXBA 2VXSL 2YRLA 4EQ2A 4IG7B 5DJ2B 1Z6TA 3ZL4L 3V5KB 4TUOB 1NA0A 1XSJA 1UVQB 4WQOA 3VRJB 3QDMD 3ENEA 4L4JA 3GJFB 1A6UL 1GPOL 2CUIA 4M48L 3Q0HA 4WF7A 4IC7B 2H2SC 2FR4A 2DZJA 1K5WA 1I4HA 3BAJA 3DJZA 3IM1A 3AAZA 3A0OA 2D4FA 1J0YA 3DEPA 3RTQC 4ZNEA 1EO7A 3NJGA 3BWUF 4LPCA 3NOGD 4XMPH 4BFEA 4OM0H 2X9ZA 3CQPA 1OP5H 5B1AB 1OEZW 4FOMA 1GGBL 3GRWA 1VESA 2UYZB 1YJIA 1AR1C 5HYJB 3GK8L 5DS8B 1S1QB 1BCIA 1C5DA 1H0DB 1FVHA 3IXAB 5LQBH 3PQYA 2JXTA 3AB5A 2BVQB 4PJ7A 4ZMZA 3WHXB 1FNFA 3L45A 1EUVB 1ERNA 2E7BA 1ZWIB 4ACLA 1PLGL 2UUDK 2ZJSH 3FCSA 4Y4KD 3VXRA 2FWUA 3ULVC 2JJVA 1XGYH 2HFEB 2XN9E 4X0KB 3O48A 2LHAA 3SBQA 3PRPB 1N4XL 1CDCA 3TEXA 4IJ3B 5SWZA 3MA7B 2PYFA 5HGAB 5I6NA 3VH8B 1KDIA 4ZYNA 5MPOA 1T5KA 2GCYA 4NZTH 3WKYA 3ZTJG 4UV4L 5CR1A 2H88B 5EIIB 5KEZA 3MOAH 5FCSH 4DGUA 2FCMA 3O0LA 1OW0A 4RESB 3RPIA 2L3ZA 3NZSA 3RWIA 1GC1H 4NJCA 2JZ3B 1U95B 1OO2A 2KKCA 1NGYB 5LQBL 4K5MA 1HEZA 3CU1A 2MOGA 3VWJC 4ZW8A 2HMIC 2ATKA 1BD2D 3U52E 3NIDB 4Y0GA 1GW0A 4I3SL 3CFMA 5LCWJ 3IFNL 3NJJA 2AANA 4IRUA 4DDID 2ZWYA 3BH4A 4YH6A 1XGYL 4M00A 4MM3A 1JGEB 1Z3XA 1XGUB 4GP5B 4V1DE 4XCCH 4S2SA 3T65B 2UZYA 3MLSL 4DAGH 3O4LB 1K1AA 3CDFA 1AW7A 3FRPA 1B88A 3IDXL 1W72A 4QT5B 4ELMB 1BQHG 4LDCA 4CJ1A 3VR9B 3H8NA 2NY2C 4NKIL 5FA4B 4F8QA 1GZPB 1OPOA 4A55A 3P11H 4H8VA 1WM5A 4LAQL 3TWCL 3UJIL 4W68A 2I07B 2WQSA 4P48A 1QEWB 1QLFA 3Q1SH 2VO8A 1YDPB 2EH8H 4PVMA 3TO4A 4GBXD 2ATAA 1R4XA 2QHOA 4WZ9A 1A8JH 3CG8A 1XF3B 2YZ8A 4IRZA 3IDUA 5J1TC 4WJNA 2EXYD 5KVEL 1EZLA 4RLDA 1NUGA 2ZIRA 4L3CB 3US1A 2I5YH 3ISMC 4XN5A 5DUBA 1TY0A 4F58L 3WTUA 3SE4C 4ETQA 3K6FA 3KYKL 3KWWB 3OKKB 1K1BA 1AI1L 4QI3A 5E0FA 4FI7A 4O1PA 5JR1L 1MF2H 5GGVH 5AG8A 4NNXB 4R0LA 3TEWA 2B9BA 1QACA 2WJ5A 1J7VR 2JVUA 3CVHL 4IBTA 4R7VA 4ZUSA 5FB8B 3VQIA 2DV6A 5E00A 4JPSA 3BLPX 4M6AA 3BZEB 4O60A 1RI8A 2YHGA 4LEXH 4K3BA 3PWJA 3U30B 4DHZE 3ASOE 1SYSB 3SD2A 3IHPC 2C3VA 1MHCA 1AN8A 4OCNC 1AO7B 3AACA 2WBJA 4JJOA 1RMFL 1CZ8H 2VLKB 2LFEA 4AKOA 5K1NA 2UY6B 3TSSA 3SYCA 1GA2A 1NEUA 4MELA 1BMGA 1XBDA 3ZXSA 4YNYB 3X12B 2YQBA 4DQOL 5I75C 3ZKJA 5JORA 4UWFA 4NO2A 4JPWH 1UD8A 2XTJE 1QUNB 1Z1WA 3KLQA 3HE7D 4FX5A 3WEXB 3TBWB 1RLBA 1DQVA 3AS4A 4DKFH 1QMUA 4I7ZC 5HVHB 2LRUA 1TQVA 4P23D 4PBVC 2DQIH 4GSDH 4K9EC 4OQTL 1PX4A 3D4ZA 4KKBC 2KATA 1PSKH 2YD6A 5EO1B 4Y1TA 3LV3A 2HA1A 2V17H 1Q8MA 1S7QA 4F9LA 1FHNA 3ZHEA 1L9RA 2K45A 1AAJA 3MRJA 2UZIH 4IOIA 2ZYHA 4KMTL 1T20B 4LASH 1IFHL 4C48B 2ZX7A 4FN2A 3AUWB 2EZ0C 1IAIH 1QBMH 3SHSA 4HS8L 4DSYA 1H6FA 4GIVA 1AZCA 4E68A 4LOFA 5EE0A 4MVBC 4UV7L 2YAEA 1EJ6A 5DGRA 4NJ9L 4DCQA 4KTEH 4AX3A 3S4SA 4G50A 3BQUD 3RO3A 1IJNA 3T2LA 4BCZA 3D39B 2N7BA 3L2MA 1CCZA 2R0LL 4L0YA 4Z68A 3VAWA 4TNEA 3MKKA 1YEIH 3V79C 3X0WA 5LCVH 3THML 2DQIL 4GSDL 1VZ8A 4AYFA 3PV6B 5BZXA 4K3EH 4XI9A 1VDGA 2QZ5A 4TNWK 2QADB 5GQBA 2BVOB 5CU5A 4KIKB 2WYQA 2C3HA 3ARED 3C5ZC 4QHPA 2FWOB 3NCYP 3T2OA 3UYRL 1P4IH 4GW1A 2VIRA 1X7SA 2XG4B 4J4PA 4HGKC 4LCIH 3SU8X 2BC4B 2BKFA 5DYFA 3DHPA 2MRPA 3CK7A 3VFSB 2H47C 3ATAA 4KSLC 4KKRA 4Y19D 4M8QB 4WHCA 5HGBA 2NUPB 1WGDA 2BVCA 1RIHH 1QBQA 2KDGA 1MFEL 1NBYB 2JXMA 3BD4A 2Y2YA 4P46B 4RFNC 4N0YH 1RJCA 2L04A 2IDQA 4OCYL 5L4FA 4B5ZA 4K3DL 1ET8A 5CLTA 3WTTA 4PRID 3H7PA 3PEUB 3FU6A 1I4QA 2IQCA 3LRLA 5E7BA 5DJXB 4X6DB 3NOCD 1JNLL 3VI4F 2Q86A 4JGUA 3LH2L 3O45A 2LAHA 3FEXA 3T3PE 4XP6H 3KWUA 4PLJD 5AOZA 1E7PB 3DSVA 2CR5A 3DGGB 1U8QA 4HUWB 3E30A 5CEZD 1NFDF 1KCUL 4ATZD 3GIZH 2AW6A 2PTTA 3IFOB 3Q79A 4FQJL 1F45A 4C47A 3WEMA 1P4LA 5JPMC 1HJCA 3FUEA 1DJHA 4JHBA 1BM3L 1PZ2A 4BGDA 1RXLA 2ONQA 5BZDB 1QSED 1VFAA 4Z7AA 3ROOA 2YKLH 2M4NA 1OWWA 2M1KA 1V5OA 2DQTL 4JDEB 1I3RA 3O6MH 4UWLA 1Q9OB 4MJIA 1XCQL 2NY0C 3EO1B 5IJCC 1BPOA 4LCUA 3RA7H 1LFDA 1DNPA 1R3KA 2AJ3A 2AJAA 5IKCB 2JJWA 2PUQT 5D3DA 2GSMB 5E5UB 2UX6A 4NO5B 3E8UH 1U8MA 2ZONA 1A21A 2X6BA 4IRSA 5AVTB 3TVMC 4AENB 3EHVA 2OMZB 5CN2A 4ICUA 3H2PA 1UQSB 3OXSA 4FQLH 4HXDA 1B9RA 2WOBA 3KEDA 4YSEA 3LSOA 1UOWA 1NINA 4A7QA 4LDOB 4ASWC 4IDLA 2QQLL 4FP8H 2HFTA 3T2QA 4DK3A 3I3BA 4OGYH 1KPSB 3EHBC 2EDDA 4PJCE 5FUZH 4AEIL 4D7PA 3G5XA 1LO5D 4JPIA 4AJ0A 4OZFA 3MSPA 2YKLL 4EZLA 3TIDA 3QIWC 2CKBH 2GQHA 3OD3A 4RGNE 4IMLA 5C0CD 2JB5H 4QMEA 2BW2A 2KWUB 3OX8A 3ZKND 2NUTA 2E75C 5C9JB 4JRLA 4G1EB 3QKYA 3JV6A 1E28B 3CVCA 3JQOB 3K5RA 3FT0A 1ZHKA 4HALA 4XMTA 1A7QH 1QHOA 3QRBA 3HB3B 5MEQB 1SE9A 2P8PB 2IANB 2WB7A 2GB1A 4K5AB 4IGBB 3CFEA 1I7UA 3HFFA 5D7JD 3H3PL 5A2IH 4KMOA 4X4YA 3BMWA 1BPVA 3CDGB 4CGUB 3BDYH 4MMYA 3J7HA 4Y5YC 2MTPA 2XXFA 2XIIA 3N30A 1ZEAH 5FFLA 3NF1A 2AJSL 3AM8A 4XNZB 3W9FA 3RGVA 3VXOA 3MV9D 4XP9H 1T22B 3P3UA 2WKOF 2F54D 4TM9A 4W9DC 5IZ7A 4L8CA 4R4NC 1LTXA 3PEVB 4LUNU 1NMBH 1Y07A 3L1EA 2EH7H 3X14A 1IPGA 3O0RH 5KTEH 2QC9A 3QJOA 5IHLB 2BSRA 1BYNA 4A2GA 3GMQA 1ZHNA 4U3CA 3VSVA 1HQ4A 5I1EH 3CSFA 4N58A 3SKNB 4A6QA 3BH9A 3VFVA 2DH2A 2XT1B 3DRTA 1FZKA 2I60H 3LIZH 4TTDD 4BTAA 5AKTA 4ZFOB 4BRVA 1VJKA 3ZNGC 2V2WB 1D8DA 2YXMA 4NDMB 4QO1B 1IZJA 3U0PA 2Z8VC 4YTNB 2VUKA 3ARDC 4ZMVA 4X7FC 1U4FA 2NCEA 2ZCZA 5EOCJ 2ZF9A 4LEBA 5F9JB 4CVZB 3KGRA 1GYVA 4UTCA 3FU9A 3IJEA 5JIMA 3DX6B 4GUOA 5D1XE 4HJKA 4CT4A 4HXBL 1ONQB 4GMLA 4NQUA 5D2LB 3DBXA 4KHXL 1OT1A 3FF8A 4XRCA 5IBLC 4BYHA 2LGYA 4QXUH 3OJ4B 5EEZA 2L0TB 2AABH 4FCAA 4QRRB 3T1FA 4B9ZA 1KGJA 3JSSA 3GBMH 4PJ9A 5TPWL 1FYTB 2NYYC 4GYYA 4NPJA 1SMDA 5DVLA 1RZFH 3IGLA 4QRSB 1A8ZA 4UBDC 5IG7B 4IRSC 4L1SA 4N4YB 2KX0A 4PJIF 1EMTH 2P46B 1Y1UA 3TC9A 2NY1C 4UB0L 4E9RA 1FRRA 3UM1A 1I7RB 1DZ0A 5ABAA 3T0BA 4TPRL 2FLMA 1RLWA 2GROB 3P9MB 2H2SD 2HLAA 4P57A 3EIJA 5DHYB 1WS7A 4YVNA 2HWZH 3IMTA 4FKHA 4X98A 4Z7OB 4KYOB 3MYJB 1WTGT 3KM1A 4EIBA 3RTQD 3Q47B 3IXEA 1NGQL 4HUXA 5TDOA 1OAKH 4IBWA 5DFVC 2D10A 1AR1D 4EKXA 4Y4HC 2H3NA 3HHRB 3P2DA 4G8KA 4XNBA 4NSKA 3TYFA 1PL3A 3L3DA 1RZFL 3CFNA 3PL6A 2WXRA 3ZMEA 2CPUA 1BAWA 1I9RL 1F4AA 1S5IH 2Z8SA 4HS6A 5DRXA 4F7EA 3AB0C 3BKCL 3NDYE 3PF2A 3ULVD 3A5VA 1R7SA 5LCWC 5F7UA 4C59B 1ZTXH 1TR7A 5ICXA 5KYWB 2OSXA 3ZKMC 4M61B 4Z95H 2J8OA 1FCCA 5FCUL 1WGRA 2DQEH 2NW2A 4OIFA 2CJNA 3OLMD 4KVNH 3IU4H 4LSSL 4OJFH 5GGRB 1I1YB 4U6XB 2V1YA 2FHFA 5EEUA 1HHGA 4N2LA 1LO0H 1NCHA 3K2KA 1U2YA 3LXUX 1QTSA 1MFAH 3WG7E 3ULVF 2L7RA 1N0RA 2Z0BA 4JPKH 1OL0A 4QLWA 4TNWF 1KLUD 1Y18A 2J4BA 1VZ6A 1N8ZA 4CT0A 1A4AA 4DERA 1OT8A 3KGUA 3VWJD 5LVEA 2HMID 2M1MA 1AGEB 3WKML 2EDBA 1J1XH 1UBQA 1BHGA 4YBLC 3WO3B 3VU2A 2AK4E 5IV2B 3II2A 2X9YA 4FFYA 1PZAA 3I50H 4K0RA 4Y6WA 5EN2B 5DMKB 5ENNA 4B94A 1WTLA 3AE2B 1BD2B 1ETJA 4WWNA 4M8RA 4DFHA 1BF2A 2NX5D 2Q6WB 4ZZFA 1C7TA 3FCTB 3RB7A 1AIFB 4EQFA 4X80H 4U1JB 2LJIA 3OXRB 2NY2D 3BGMA 3IMVA 1PS3A 4EI6B 3QULB 2PQNA 5EWIH 5GS3A 2ARJQ 2UY1B 1D7BA 1X5ZA 5TE7L 4MQXC 2VUOA 1JHTB 5SWQA 1EU4A 2Z35B 4B0MA 5AEKB 4I0PA 2NMQA 4LLMB 3UAFA 5LHDA 2VH2A 2VLME 4ME2A 3RU0A 5IB5A 4KVCL 4MJ5A 3QQ4B 1UM6H 3DV6A 1ZS2A 5CSZA 3VG0H 2WPGA 2CDFA 4E9LA 4YL9A 1X9QA 4GBXB 2XWXA 2HFGL 1X5FA 3F5WA 4Y2DA 1SHXA 3OJDB 2GFBA 1X7QA 2YAHA 3FPYA 3CHPA 1MN4A 2ITCA 3KPQB 3NABH 4HLLA 3SGJA 3IS0X 3V4PA 2MBBB 1CVSC 1PIGA 4YUEH 3RUGA 5JOFA 1QFWL 2EIKB 4U7KA 1IGFL 2R69H 2RACA 3E9UA 1DVZA 3GJFH 3MLXL 3QEHA 3BAEH 4C4KO 4NM8H 5GS0C 1L0XB 2EUWA 2W07B 3GB7A 2VJ8A 1WWWX 4F7MB 1KN4H 2J08A 3CZFA 3KHQA 2XETA 5KVFE 3SE9L 3STLB 1IQWL 1O9WA 5IW6A 5INDA 2QQQA 5I76B 1TUPA 1DGJA 3I3DA 4ZRJA 1EHLH 7PAZA 1NCAH 5IT2L 3BG1B 4MA8H 2I38A 4K3CA 4NPNA 2VE6A 1D5IH 1HIMH 4PJDE 4Q9QH 1P7BA 3CSYA 2WZ0A 5H2BA 2AF2A 1GHFH 3I02B 2IPTL 3MJ6A 1CL7I 1E4XL 3UIOC 4K71B 3VXRD 1L4ZB 3Q78A 4DPCX 1D4BA 2LFGA 1KGCE 2CGZA 3VDCA 4BESA 1OGAA 3MRNA 5GSVA 1TSHA 4ATWA 5FW6A 2IY0C 3NABL 3E1F1 5IA7A 1T6WA 1F86A 1ZHBB 2R69L 4BBNF 3L2LA 3SKOB 3BAEL 1F5WA 3ZRCC 4JY4A 4UZSA 3GHPA 3KGSA 3KVDD 4KKBD 4MAYA 4N9OB 4HHWA 5E8NB 5T33H 4DPBX 3G5WA 4U0ZA 3LNFA 3RNAC 1GJWA 3ASHA 5C0GB 3QFGA 1IQUA 4FKEA 3HNVH 1PX8A 1KPVB 4P23B 1HKLH 2FJGA 4WFED 5IVNA 3GSXA 2HYZA 4Y9GA 3TH3T 5BO0D 5BOPA 2EP6A 1EJOH 1YN3A 2OA9A 3HN8A 1MJ8L 4FXGC 1ZHLB 3WNPA 4N2FA 2EZ0D 2FE8A 5HHMD 5HHOE 2ZXGA 4GAJL 1SOXA 1H0AA 3AAAC 1D7DA 4ZMYA 4NKMB 3C0RB 4MVBD 5FO2A 1M7DB 2ADIA 1T0MB 1S7XA 1XQ4A 3CPUA 5DJZA 2DLEA 1EAPA 3FQUB 4WCYH 1D7CA 3ARYA 1Q4NX 1WC7A 2X3AA 4H8QA 4XVUC 5DVPA 4ISVA 1NH6A 3MR9A 5KNGA 5FHBH 1OWNA 2H9GA 2BVUA 2GABA 3DIVA 1MCCA 4H1LB 4AGPA 1UB6B 3C5ZD 4PFEA 3K6SB 4F7TA 3OTTA 1KYUA 3IN2A 2R15A 2XIBA 3AE5B 2P2CP 1ZVSB 3KYMA 1A65A 4H8WH 3DBLI 5EU6D 3EH5B 3H4HA 2G3ZA 4XAKD 5CHNB 3WAKA 2X4QB 1AHWA 1A2YA 2YWZA 3BK2A 1TKWB 3SGJC 1DDHA 3V6CB 4NRYB 4KI5C 4Y19B 2G5RA 4BZ2A 3S88H 1ZGLA 1KBWA 4OVZA 1ORSA 1T7VA 4L9LA 4P9MH 4YHZL 4Y5VB 5DR5H 2AWTA 2EE9A 1ZE3H 2Z8WC 1D5BA 3GSOA 4I8DA 3GD1C 1PZ3A 5FQ4A 4D9LL 3QNZB 5FYJE 4FQCH 3H9HB 3RBSA 2ED9A 3G2UA 3L4CA 2INCC 5F1IA 4X9GA 2KVZA 4ZOAA 1RZIA 4Q74A 4NN5B 4G59C 2X4SB 4AH2B 3FFDA 3IDJB 5C0AE 4AI7A 2ZYRA 4RFEA 2LO6A 4YZFE 3DBSA 4DP0X 2Z8LA 4MJSA 5F9OH 3EYVA 2ALWA 1ASOA 1P2CB 2JV6A 2X53A 2DIAA 3QG6B 4I2XE 1BOGB 1PYWA 5IEKA 5IHBA 4RF1A 2NY0D 3MV8D 2YAOA 1EH9A 3X17A 3T1WA 1QSEB 1GW6A 3P73B 3VXPB 1BVZA 5HY9B 4KDWA 4F2ME 5C3JB 5CHFA 1E5YA 4J1UB 3MGTA 1S7VB 3PHQA 4M62H 2ZOOA 3CX5J 4XPHL 3WOVA 4U2YA 5I71B 1MPAH 4X5QA 3TVMD 2WD0A 4TLSA 4OT1H 4DEUA 2DKMA 1RM6C 2XU9A 1GMEA 1QI5A 1F2QA 4WWID 3LDZE 1A4JB 1SJMA 4UT7L 5DO2C 1U8JA 5FUOL 3SODB 2BSTB 4NO3A 2QPFA 1H8NA 2CCVA 1PLCA 3EHBD 1N63A 3ZLZA 4K73A 2CUMA 4WTZA 3DHGC 4B6ZA 5ACZB 3QIWD 1O6SA 1I3VA 3MV3B 2DQCL 1XZWA 4JFYB 2OYMA 5F7EL 4O58H 5GPRA 1UFUA 3NFPB 3VW3L 2X2JA 4P3DB 5I19L 1LO5B 1AQDB 5IFAL 1A5RA 1D8EA 3SBRA 3LRSA 4G6JH 5IROA 1FZMB 3CQFA 4NI3A 1ELRA 3VYOA 3MROA 1IIKA 2AXGB 3L6FA 2A9DA 2Z59B 4ZT1A 4L1HA 5E9DA 5SWSE 3WSQH 4AQ1C 3ETBF 5K33A 3QWZB 1UXWB 2YAQA 4JO4L 2VXQA 3QW9A 1UTDA 1N18A 1RUMH 3QCUL 3KJ4C 5B1JC 4RNAA 1OSYA 3TBTA 4NN6C 2F5AH 3GKWL 2HG5A 5D7JB 3G2SA 3M17A 3WXWH 1NEZB 3ESKA 2OQJB 3OGOE 3PWVA 2FBOJ 4IS6A 3WIFB 3ZDZF 43CAB 4DZ8A 3FFCA 5GRVK 5HHQB 2BIMA 3D48R 4R4ND 4P2QD 3U4KA 4KOBA 2XZCL 3DBRB 3ZYQA 3OMAB 1ZA3B 1H3GA 2Q5WD 2F54B 5ITFA 2VAJA 3ZIMA 3GLEA 4NC2B 2HKFH 4WFFE 1U8OB 4NBYB 5D93B 1Z3RA 5MEPA 2KWCA 1IUZA 3D6GA 2JIXA 2GUYA 2Z0UA 3AE4B 3O6KL 3NQIA 4N5CA 5ILTL 5D0QD 3QISA 4ODVL 1AY1H 4JM2C 2FO4A 1KWKA 3QC5X 3ARDD 4Q8BA 2PO6A 2PP8A 4N2IA 5E2TL 1N5WA 4WSKA 2CMRH 3AGWA 4EBQH 1OQRA 3TWRA 4Y5XB 3J5QB 3F00A 2H6PA 4P5KB 4FJVB 5IBLD 4F57L 4XMZA 1KEML 4ANUA 1OQXA 4NY0A 1E5AA 1NFAA 2NYYD 4JO3H 4O02A 4BSVB 5AFAA 2RR9A 2Y1AA 3DMMA 3GSWB 1E9OA 3RWCA 2XI9A 4BA8A 4BKLA 2L32A 3NJKA 1VAHA 4DIXA 1QD0A 1IGTA 2F1BA 2Q7YA 3HE6A 4R90L 1QNIA 5C0BA 2B14A 3EC8A 2CBPA 2NY1D 2R23B 3BXNA 3GMMB 3MRIB 1V27A 1T7WA 4FABH 5KSVA 3EDJA 4X8JB 4JFDD 1YMPA 1H8SA 4JFEA 2WLLB 4K4KA 4BE6A 5IVXA 2C1PA 2HJLA 5DDHA 3E7JA 3HRZC 4UQIM 3U6RB 4QRPA 4BOZB 2O26U 1RZJC 4XIFA 3GS4A 4EBQL 4DO5A 2F53E 2O93L 2VDPL 4E42B 2N9EB 2J25A 3M46A 5JOPD 3ZXPA 3PWNB 5DFVD 3F6LA 3VI3A 1SXNA 4OF0A 4X7DC 5DIZA 1HXYA 3RTQB 5D2MC 2OTPA 4Y4HD 1MJUH 3G04B 4WIQA 1GIGL 5DRZA 2XPZA 2OEWA 5HHVH 1SN2A 2X70A 5GGRY 4M3OA 4JFXA 1AR1B 1NFIA 5HYEA 3SFYA 5L2JB 2MKWA 2ZPYA 2PTLA 2BIHA 3T4AB 1ZLSH 2KLRA 1CBJA 3IU3A 3FO1B 3PNWA 3UTZA 3ZKMD 1MY5A 3FO9B 2N4FA 5I8OH 4OLWH 4PJHA 1HAUA 3VRAB 3PLYA 3QEGH 1UOVA 2YUXA 3MX3A 4N3BA 4PS3A 3N85L 5I1GH 5HTSA 1CXLA 1KNOA 3CGHA 3LZFL 1JYNA 2IONA 5AJDA 3AXIA 4J8QA 4B95A 1UXSB 2VSCA 5E99H 3TEYA 4PYUA 4G82A 5E03A 3MRCB 3NH7L 1Z0MA 3MNMA 3SDXE 1NDMA 5KYUA 5FYJL 5I2IB 1PVHA 5CINH 2L76A 4HOWA 1CC3A 3NSFA 4M1DH 5HJBA 3HMWL 1WT5C 4Y9CA 1KLUB 3CVWA 3P9LA 3N40P 4K8RC 4PJAA 5KSBF 2A74C 4N0UA 3PUKA 1NCTA 2KT7A 2JYTA 5J3HC 3K6NA 1ZLSL 1YUKB 3VWJB 1VFMA 2IADB 1DBBL 2R1XB 3DHUA 4XO9A 4WUKH 4M8MA 3MO1B 1KCVL 4ORGA 3CHRA 5K39A 1AGDB 3N3KB 5T1MB 4MA7L 4UQCA 3DRQA 4KQ4H 2YGNA 5CN3A 4OV5B 2AEPH 5BMHA 1WITA 3B2GA 2NX5B 4U8YD 5FTPA 4MGYE 1R5VA 2BLFA 4ZHPA 5L2KD 4MQXD 4I3GA 2EIEA 5CRUA 3DC0A 2XXGA 2E9WA 2NY2B 4EECA 3QUZC 1N59B 1PY0A 1KB5L 3K6DA 4EUTA 4LLQA 3NIFE 3NZ8A 1EFQA 2CAKA 4GEIA 1DBKL 2WLIA 4K07A 3ZO5B 2J20A 3O9WA 3D05A 1A02N 3IDGB 5I30H 1E6JH 4NI6A 3CFDB 2R0KL 2BOCA 2JK5A 4EF3A 3SDAA 4KKAC 4NZJA 2IBGA 2A7BA 3L7FA 5L9DL 3FONB 4PEEA 5GS0D 4AQ7A 3CK8A 4OQ1A 4A66A 5EPMA 1C7SA 2FR4B 5F97E 3ME0B 1AR2A 5FV2A 4PRPA 3PPSA 3RY4A 2RPVA 1EEQA 4MBGA 1TPXB 1OM3H 2FF4A 3UDWA 4DKEH 5JQ6L 1YX5B 3C3RA 4FG2A 4KXKB 4G25A 2XLLA 2OVFA 5FO7A 1T83A 5I1KH 5H37H 5D7LA 3DRAA 4PDXA 4NQDE 4D9RD 3GLDA 4PGEB 1TQCB 2Q5BA 3BKMH 5FECA 3PQYB 1WAAF 3QJZA 3IEAA 4KH2A 5AAWA 4F9PC 2WAHA 1BUIC 4HJJH 2ZOUA 1F3JB 4NP4L 3MGBA 1RK0B 2CKHB 2F7QA 1U33A 2VLRE 3VXRB 2HUHA 2QBWA 3OM3B 3V60A 3T3NA 1WLHA 5H4ZA 5BXUA 5I75B 2VR3A 4B95C 4ODTL 5SWZB 2K8HA 3MEKA 1ZANL 3V0HA 1FAIH 3EYUL 3SGEI 2GSIB 4FTVE 1MFUA 4PV9A 2GY5A 1G7PA 4J27A 1BF5A 2OAAA 4B9KC 4L2YA 1RIVH 4W9LA 5L83A 3IFWB 4OBRA 1Y8RC 1MLBA 1FA4A 1T0QC 3UBHA 4DNLA 2CRYA 1H6UA 2GJRA 1AZVA 2D0FA 1FN4A 3ILDA 3WIAA 4U6YB 3BKML 3SGKA 5A2AA 1C1EL 3L4VA 4GU2A 4WI3A 2ATKB 5HI5C 5HHMB 1EVUA 1ET6A 1WZ1L 3ZE1F 4BKSC 2HKHL 2FCQA 2INDC 5KWYC 4APXA 2Z7YA 4XVUD 4YDZA 3MBXH 4G1MA 1QNZL 2JQAA 1XXFC 5DC4B 5EA0L 2BVEA 4J8DA 3BMVA 3HBPA 3QA8A 2VCOA 4OVVA 1SFDA 3PE4A 4H0LC 3BK1A 4XNDA 1N7ML 1NUDA 1LGVA 3JZ7A 3ZYOA 4DUWA 4X6BA 1WXMA 1IKNA 3V2OA 1N6QH 3UP1A 4KUZH 1YPZF 4YVQC 4C54A 3TO4B 3C5ZB 1E3XA 1MVFA 1OAXH 5DGQA 1MSPA 3S96B 3VUWA 3WE6B 2FJFB 2XVGA 1GOHA 2M63A 4FQ2H 4P5TA 3ARXA 1UT9A 1VCAA 1T1YA 3GBEA 2ED8A 3OKYA 2D7QA 2CK0L 4OJDH 4XPFH 5EU6B 1M2OA 4KI5D 5DUBB 3W1ZA 7TAAA 5KSUB 4I6NB 1E2ZA 5EU5B 1KF6B 4UT9H 2X12A 4A3OA 2RFAA 5JW4R 2JLLA 1XB8A 2AGJH 2ZXWE 2DTMH 4RFNB 3GBLA 3MBXL 2X1PA 1UASA 3G5ZB 4MMZC 1FFPB 2ZW1A 4S1QL 1P5UC 1W6WA 4YGVA 1G84A 4ZUSB 4CRWA 3OXFA 2OW7A 5E00B 3AH7A 3QEQE 4FL4B 3RJOA 3HJEA 4KI5F 4LOVA 1G7JA 3PWJB 2Q20A 4J8YA 1JUQA 1UGMA 4G1TA 5D72H 4AVIA 1YEGH 2M8XA 4Z3JA 2Y72A 4KX8A 3UYOD 1FGNL 2PCFB 1BSIA 1H6TA 2FSDA 2V3NA 5DD1L 2ZEQA 2BPBA 3V3XA 1JZ6A 4GN1A 1BXTA 2C9UA 3EBIA 2L8AA 5JPMB 5JORB 2KQ7A 5HGGS 3SEBA 5T5FL 4D0BB 1CFVH 2VN7A 4UTBA 4MQ7B 2LVQA 1CG9A 4H20L 3CVPA 1T21A 1U6AL 2LAGB 2NY0B 4K0OA 1G9MC 4CVXB 5A2BA 3VFPA 2WCSA 2RFXA 4WKZB 5ERWA 5L6YH 1RFDL 2R56H 2NOYA 3H9SE 3IJ8A 5KVGH 4LNIA 3O3DA 3IAQA 3MRJB 4U7MA 3TP4A 5EDSA 4IOIB 1ZVNA 2GRIA 5ETUB 3UTTE 5DO2D 4HXIA 3TVMB 4JX1C 4LCYA 3PXLA 4XBGA 3M8OH 4GQQA 3VTVA 1Q94A 1YA0A 2MMXA 3V0IA 4QXTB 1KB9K 5EBLA 2BGFA 1OAYH 4AITA 4DCQB 5K1JA 5ANMA 5D4IA 1WUNT 3EHBB 2W60A 2E7LC 1UH6A 2J8SD 1Z9LA 3TU6A 2VTBB 3T0EA 2OW6A 3QIWB 5C3IA 1XCTB 1AH1A 4PJBB 4AM0Q 1P98A 4X6FA 3BT2L 2GTWA 3FAHA 3NZ3A 1CTOA 4UNIA 1BZOA 5TQ2L 5HS0A 5IQ9B 1UD6A 2DQGH 4EAEA 3RGHA 4AG4H 5HYQA 1JCKB 4H1LH 4YBHA 2DOCA 1JRHH 4LNVA 1X3DA 3QNFA 4GW1B 2FEEL 4CGTA 2VIRB 3D5OF 2H3KA 1VCBC 4QRQA 4JRYE 1YEFH 2ZCLL 3PWUB 1NCWH 3VXSE 4JPVL 2BNQD 4DVBA 1RP8A 3RK6A 1WVZA 3VRIB 3FQNB 2JEKA 2COVD 3PWPA 1DBAH 1XAUA 2JXMB 2CUHA 3ZDYE 4DKDC 4HCRA 1DVFA 1G7QA 5E8EA 1OGSA 1PX3A 4RZKA 5FM5M 2BO0A 4I9EA 4KVPA 2KCKA 4WLCA 2ENPA 3WELA 1P7KA 3EJPA 4O9HL 3AZUA 3FULA 3TM6A 2I27N 1C4PA 5ENOD 1FO4A 3M88A 1D5MC 4JM2D 3OXGA 2KVRA 1J9CT 3F7LA 1RAMA 5A1AA 4WNQB 4AM0A 1YD8U 2BZ7A 3B08A 4XCYB 2XZTG 2P9RA 2WKOA 5CEZH 1WXAA 4PB9H 1M53A 4AGNA 2JB6A 5IF0A 3ARDB 3NCMA 4H7XA 4LARH 1Q2ZA 4LU5H 3H9DA 2P9PG 1DBAL 4F91B 3LQAH 4BZAA 2CR0A 4NO0D 2HD5B 2CR6A 1JZ8A 5JHBA 1I3RB 1VZGA 2WLBA 4WI8A 5MENA 1S7UA 3WN6A 1M05B 4FZEH 1OB1A 4JM2F 1UGKA 1J5OL 4HF5H 4LCUB 5IHZA 5JW3L 2C7HA 3M95A 1R3KB 4H88L 2ALAA 1UXMA 1HX8A 4JVUA 2OCCE 4K55A 2XBBC 1VGKA 2VLJA 2A5UA 5F6IB 1CLCA 3Q3GB 4OLZL 4WW2A 4IRSB 4GG6A 1E8ZA 1XD3B 3OKNB 1UWYA 1HHIA 1BQUA 5D4HA 4P59L 4UDTA 3OXSB 2GK2A 2ZCHL 5BRQA 1P0RA 2HVJB 1V1PB 3DHJA 3I84A 4P2YA 5D1ZI 2KC7A 1P4BH 2PR9A 4F3VA 4JFDB 2BM3A 4NHUB 4XKBA 2VERA 3GMOA 4J3XA 4P2RA 5AALA 1UM5H 3QIBA 1GGIL 3S7JA 2AVGA 4S11A 1AFVL 4PRBA 4OCRH 3RUIB 5KYXB 3HDXA 3UPVA 2RR3A 3LQAL 4OZFB 3E33A 3T0EC 4CKVX 1S7SA 4DP9X 2NS5A 3PJSB 3MRMB 1L5PA 5I1AB 1MHQA 4IBQA 2YPKA 3FTSA 3NVYA 3OX8B 3BU8A 4WNEA 5IOIA 4PJIA 2NY5H 2R2BA 5LNDA 1LP9E 1AC6A 2YWYA 3JV6B 3MBWA 3Q2WA 4J2QA 2BKGA 3HHMA 5LBSA 3WTSA 2COQA 1ZHKB 3ZE2E 4QTIL 1MWAL 3ZNZB 3QXDB 4N6RB 4Y4HB 1DN0A 3M1BA 3RZFA 1YYML 3CFEB 3N41F 3TNNA 3AB0B 2Q2EB 2D31B 3DPBA 4NLHA 3VM7A 3QG7L 4X4YB 4L4VA 4LLUB 3K9PB 2F08A 2GBVA 5J18A 1RUAL 3QNXA 1JXKA 5K9KA 1EZVX 1ZU2A 2EIJB 4NLAA 1HSAA 3EFCA 5DC2A 1ZDQA 3R0NA 4JUTA 1Y6IA 4Q6IC 1E5WA 4OCRL 3VXOB 3HG2A 4I0CC 5FLUA 3MRHB 4YN3A 1J05B 4APQA 2FQFA 3NRPA 3S35L 3W5NA 1V10A 2ZWLT 5FWQA 1XR8A 1ZHNB 3GMQB 1T04B 1BQHA 4K8RD 4QNPF 3VGFA 3SKMA 1YEHL 4PVLA 5J3HD 1MG8A 3BH9B 1IAIM 4NQLB 3OJ3A 4IWQA 3MLRH 2E3TA 1FZKB 4GAGL 4LIQL 2VDMB 4BQ6A 3UP6A 2WVIA 3FCBA 4ZQKB 4NAQA 3CZNA 4KVMA 5JHDD 1EXHA 2MA9B 1SA5A 1NCOA 4YHOH 1HNFA 3JWNC 5B38G 4QWWC 1JYXA 4IU2A 2ZYIA 2BHFA 3INUL 4WKXA 5FOBB 1IGIL 5D5MB 1MW2A 1WJUA 1A5FH 3CH1A 1ZGLP 2Y24A 3UKUG 2EDOA 2FIKB 2PN5A 3QUZD 4M02A 4DF9A 2DWYA 2E46A 5D1ZA 4GKSA 2VGEA 3C9NA 3Q2VA 4U1IA 3T1FB 3EFFB 1N0XL 1MHPL 1OXYA 3SPCA 5L2KB 3ZGZA 5B1BE 3FYIB 5JJTA 3IJSB 1CMXB 2BNRA 1IGML 5E5MA 2CJSA 3CN4A 3AW5A 4K5PA 1BJ1J 4WW2C 3CXHJ 4JFED 3RWFB 5C70A 3U36B 3FWVA 5BUGA 2YXWA 3P4NA 3ARVA 4BUQA 2YGOA 4KKAD 3MLYH 4BAXA 3IXSA 1ADQH 4Z7WA 3FRUB 1R4NI 4KO5A 4H26A 5ID1B 3OJ2C 4N68A 3QCAA 1Z3YA 3HXFA 4P57B 1H9VA 1X5AA 1YQ3B 3LKPB 2XPGA 3EGDA 3TBYA 1YEKL 3P1UA 3R9AB 5AW3B 1NGWA 2J4DA 1P6AB 2DYPA 1QRNE 1HXYD 2XOTA 3ABKB 1DL7L 5H35A 1IBXA 2R05A 2N0SB 1FPPA 5TDOB 4GINA 3OQRA 3D08A 3Q06A 3S6CA 3SR6A 4US8A 5AWNL 5HYSG 2WQ8A 4GRWB 4HC1L 2H3NB 1AC0A 2CFUA 3L3DB 3B1UA 1FZOA 4M43H 2DB8A 5B3JF 1JWMD 3NCJL 4NRHB 2G3MA 4WI9A 4RWYH 4JGJA 3UIOB 4Z78A 1S7WA 2ZU6B 1ADQL 5ICXB 3EJRA 1RIUL 5ICYA 3RAUA 2ENJA 2K3TA 2NW2B 4MLPA 2GUOB 3KEZA 4M93C 4U6VL 4XB8A 5FW7A 1LXMA 1CFNB 3U25A 3TWQA 3KBHE 2D3VA 2NRDA 3HFML 1HHGB 2APFA 3QQ3B 3HBQA 3VFGH 3CJJA 4HPOH 4APQC 3DX7B 3BVNA 1TXKA 3IHYA 3B1LX 1BFVH 3HG5A 4JKKA 1ZPLA 3QDAA 4GXUN 5DQ9A 2WXFA 3BP4A 1HEHC 4XP5H 3HG4A 1OWRM 1N8ZB 4IBYA 3B2FA 3GZOA 3SPJA 1L4IA 6PCYA 4ZG1A 3ETSA 4NBZB 1F02I 2QT6A 4FXGB 4NYLA 3I6SA 5HI5D 4BKSD 1KJVB 3CN3A 4BJLA 4KMLB 5C7XH 3PAYA 1VB9A 2N9XA 4A38A 2D3LA 2P8LA 3QDJE 3K5SA 4NAWB 5BMIA 2JI3A 5K59F 4G71B 1RSFA 3S37L 3WFDH 4AIZA 2WWKO 4QHKJ 5BJTB 3MZTA 2GB2A 2DQ6A 4Z8FL 1NC2D 3MRQA 4CBZA 1YPZB 4AGMA 2QFPA 3L81A 5D7IE 1AXIB 2BKKB 4W9IA 3V0JA 2FYYA 3Q1EA 3UT4A 3DX8A 4FQ1H 4CL7A 2O2VA 4TSBH 1N6VA 1A70A 3EYFA 4L4TD 4U63A 1SYVA 4NBXB 2VDOL 4N2SA 4FNQA 3IG3A 2Z7UA 3NVQA 5D71H 4XWOC 4WJQA 1KJ2A 2ZOLB 3MUGB 5IB5B 1UJJA 2WO2B 2WQWA 4JFOA 4JL1A 4MJ5B 3EJNA 1FC2D 1O7SA 4NX0A 5CSZB 2G9KA 4CYMD 2K8MA 3GUTA 1U3HC 2IG2H 2LI5A 1QWNA 4TL4A 3UYPB 1NI2A 3F8UB 2ITCB 1TN7A 1Q90A 1EX0A 5KBMA 5IEHA 1QBAA 3QUML 3FOLA 2XEWA 5JOFB 2GOWA 4ZD3H 4PRPD 3DXAD 1VFUA 4HMDA 4R96A 1IZKA 4GJTB 4NNYA 2CLZA 4WIPA 2XTLA 4MRUA 5IW6B 4YPGB 5FKPB 3UQBA 3B7TA 1MCLA 1TJMA 1XBRA 4BELD 3H42L 1WBXA 3EF7A 1S9WA 2VW4A 5EBWA 2P5PA 3GRWH 5EU3A 5H2BB 2JLBA 4JZYA 4R5XA 2H8PA 4I89A 1J0JA 1IT9H 3RI5K 1LNUA 2OZ4L 4YDKH 4HZLB 2ARJB 2EIME 3L7EB 1WY6A 3QJRB 4HNAD 2DQFB 1F4XL 4LFHD 1IMHC 4RBPK 3DCGA 4DP8X 1WAO1 2W80C 3KQ4A 1X5YA 1ACXA 5C86A 1QSFE 4ZNCD 3HRAA 1YX6B 2UU7A 1X5KA 1P69B 4QRUA 3MCXA 3Q01A 1SDDA 1GY2A 3CD4A 4FNLH 1FNGA 3TONA 2DAVA 2QHRL 3S5YA 4NIKA 2IIJA 3GOEA 4YDIL 2JCCA 3TN0C 2J3SA 2PPFA 1E2WA 3CVIH 1HI6B 4WUUE 1X6LA 4ORZC 2Z93A 1OE1A 4JRFA 4OGQC 3F7PC 3Q15A 3GRWL 1WA1X 2AQ1A 2RQ8A 1RU9L 3EG9A 4BK4A 5LWYL 1PAZA 1IT9L 3ILEA 4HWBH 1BQLH 1S7XB 5DJZB 4XBEH 4W9GC 1G7MA 2E4TA 1DQDH 2XFXA 1AOHA 3F58L 4P4KA 3KSQA 2W38A 3D3VA 3REVB 1GZHC 1D5ZC 1HCFX 1VZHA 1WC7B 5D70H 4JKWA 3BZFA 3QHZH 2HFFB 3MR9B 2LD9A 2PLTA 2H9GB 2NTSP 2MKLC 2NZIA 1CU4H 3IDIB 2VRRB 1T2JA 2KFKA 4JRWA 2CGRL 1I8AA 2QSCH 5JYLA 1I8LC 1IBFA 1PKQA 3N1PC 3RNQA 3DYPA 4WHDA 5IY5E 1TNOA 2GJ6D 4AQ1B 2K3UA 1SMAA 2FIFA 4PB0H 1Z9PA 2NSQA 2M2DA 3RURA 4N2MA 4Z7UB 1JZ4A 4XVOA 1PDXA 3KJ4B 2VDLL 1N9PA 4LKXA 1JNJA 3P77B 4NN6B 2YPVA 3TX4A 2C4FU 3LN4B 2OMWB 3FHQA 3MTNB 1DDHB 4TXPA 3I4RB 4LCWA 5F7HA 4NZDA 3V95A 1ZGLB 3Q5MA 5B8CA 1ORSB 1VJSA 3EDEA 3LQZB 3BZ4A 1NGZB 4A9AA 4EBAG 2YJQA 1TZGH 1LVEA 2ZOWA 5BO1H 5FKAC 2OV8A 1SXCA 3NJXA 5L95C 2VJ0A 2WWKT 3F12A 1W72L 5JIKA 3V0WL 1TS4A 3C08L 4ZW7A 1GGUA 3MRPB 5TE4H 4XE0A 1B2WH 4PV8A 5F1IB 3AEBB 3MV7A 1RZIB 3EIFA 3LXAA 3UTTD 3AXHA 3ULUC 1XGZA 4A2MA 3FFDB 3QXUA 5AW0B 3UTPD 3DPYA 4J8RA 3VYNA 2Q8AH 2CIKA 4BOSC 4RFEB 4ANXA 2HTKC 5BQDA 1IC5H 1ESOA 1EEZB 4JO2H 3TCXA 1QFUL 3EYVB 4IRZL 1UEYA 5I1IL 3HIZA 4YDEA 4RF0A 3MCLL 3CVVA 2ZUTA 2Z65C 1QILA 1DE4B 2OYPA 3UX4A 1U3DA 2OULB 2VAAA 4HHGA 1RUQH 5IEKB 3FB6A 4UIKL 4DT2A 4MAZA 1JPST 3QWRD 4NO0B 3EYQC 3TGXA 3KH3A 1AQ8A 3DO7A 3I4GA 3PZ1A 1OAUH 1TJHL 4M1GL 3LS5H 1WWTA 3V6OE 1MCNA 3W5MA 4M7LL 1X5HA 3AG2E 4JANB 2CRZA 4PJ5D 2JF5A 4BT9A 5CR8A 4BEIA 2CE6A 2JPHA 1KXQE 1JZHA 5K59E 3SJVA 1DANU 2OVBA 4L3ED 3DDCB 2VDNB 3UTSA 3VFRA 2JKWA 3IFPB 5GXBB 2AQ3B 1JD9A 1KG0A 1NC4D 2H1PH 4QHUB 4Y16D 4GTQA 1U8JB 3VG9C 3VU1A 4NO3B 5JLZA 3T3PF 4XHQA 1XF2A 2N1WA 1FDLL 1ZTXE 2PYEE 2Y7SA 3V0VA 4P4KC 2E27L 1M57B 2MCMA 3T0ED 1WHOA 1ZOYB 1A14H 1O6SB 3GO1H 4YSAA 4GAFB 1E3FA 2GEQA 1BJMA 2NT0A 3SO3B 2P9NG 3EHNA 2CALA 4X6CB 3AJIA 2X7LA 3STBA 1CUOA 1AXTH 4U1MB 3WBDA 2C3XA 3F05A 3ZDWA 3OGCA 3WY2A 2VSMB 5D2MB 3W1SC 1GB4A 5FIOA 2XKNA 3MU3A 3MROB 4MTMA 4X99B 3PXJA 4QHLA 4LNNA 1TN6A 1JZJA 3CH8A 1T5XD 3ZN6A 2ASQA 3GHEL 1TZIB 4XCEA 1Z32X 2DEWX 1KTCA 4OFQA 3QQNA 2ZPKL 5G4NA 3IT4B 1RD6A 2EQDA 2HG5B 3RNKA 3HG3A 3M17B 2KZTA 1JCVA 2P5EA 4G2VA 4YFDB 5EZLA 5EU7C 3MXWH 5KN5A 3O2VH 2NVUI 1C3TA 5B8CC 1WGOA 5LAPA 1GPXA 3DUUA 3GO1L 2IO3C 2KDMA 1FBIH 4DBGA 3MLTA 1QKZA 4MRBA 4FP7A 2WTRB 5ANRA 1JPEA 3QJSB 4JHAL 5HVGB 1NA8A 1ZSDB 4K94L 4B9CA 1I7TA 1QSVA 5ITFB 5LGHH 1TEZA 2FATL 4PJCF 2ZAHA 4XNMA 4PP2B 3QK0A 5E4IA 2XC8A 1MNUH 2CD0A 1OE3A 3ZZ1A 2YSSB 3QWQB 5C07A 3T8MA 3VTXA 1AHMA 1CI3M 1IGDA 2DQUL 1JNNH 2A38A 4N3UA 4OCLC 4P07A 3V4VA 1N0QA 1KLGA 1CFSA 4PGCA 4LSPH 1OTUC 3V5DB 1MVUA 2FO4B 2MLBA 3FP3A 1HG2A 3TWTA 4LB8A 2LGDA 3N44F 2L3BA 4HIEA 3L48A 3SE3A 4HSCX 4QWWD 5GGSA 2IPUG 3O2VL 3D87B 2H0EA 3B9AA 3E6FA 2WLHA 4MDJA 5JHDB 5KUKA 1NL0H 1YC8A 2ESVA 1U3NA 2WIIB 4UMSA 2BWDA 4B41A 2FX7H 4LP4A 3C2AL 1WYJA 4A37A 4O02B 1TNYA 2VLJD 1UZ6E 5L88L 2R1WB 3QUZB 1E9OB 3G5VB 3GE3C 3D85A 4BKLB 1I35A 2Q7YB 5C0BB 3WN5A 1JVOA 4JCWA 3BXNB 2O61A 4GOCA 4F8PA 5HYJE 1H2TC 2BWES 1M4VA 4JFEB 2VZVA 3RI5F 5J57B 1OGPA 2ORBL 2Z1KA 5IVXB 1B3IA 3IDYB 4FHBD 2DTSA 2P24A 5DDHB 2E0PA 4G9FD 4ZTPH 4QRPB 2BRRH 1UUNA 1TQBC 5LAXA 1SHWA 3GXIA 4TRPH 3WKPA 5AQ9A 4PJ8A 4OZFH 3VXWA 4MT5A 4DHJD 2VZTA 5D7GA 2FX7L 2X44D 2JKJA 3QOUA 4MZIA 1HXYB 3UPAA 3UF8A 4IKNA 3QYCA 4U1KA 5FUCC 4E0RB 5DRZB 2OMVB 1ASPA 2AI0L 5ECJE 5C7ZA 2X70B 4JGNA 1NFIB 3EZ8A 6TAAA 3UROR 1E5CA 2BYVE 4Z9KB 1NLBL 4HU2A 5HJDA 4U1LA 1ELKA 3MLWH 2VYIA 3PNWB 2PETA 4HCFA 3DO4A 32C2A 3UTZB 2NYJA 4PJHB 4OZGA 4K3HA 2WYZA 2OEVA 1B0RB 4L1LA 4OLYL 2BYTA 1N5YH 4X8GA 1G7IB 5INCB 3ML9A 1MRCH 3NIDE 1G1YA 1WRFA 4JQXA 3AE6B 3MCG1 4OIIH 1XSOA 4APQD 5K9OA 1N4PA 5FZRA 1EAOA 4KGLA 5TSSA 1Z5SC 4HUUA 3CQQA 3S3DB 2H32A 1NDMB 1E9PA 4DW2H 5JQIB 1UM4H 4F5CE 3AEFB 1JHLH 2F7RA 1TGZB 2XCMC 4HORA 5GRYA 1KIPB 4GSQA 1CDUA 2IOLA 1RZGB 1VSCA 2IPUK 3P9LB 4KDTC 4PJAB 5C08E 5IQ7H 4RMAA 4N0UB 3VDBA 2NR6A 1SBSL 3PIQA 2KQ4X 1PU0A 5M72A 5BS0D 4ALAL 1SM3H 1RHHA 2PPAA 1KH0A 1FYHB 2VDMH 1SY6A 1LMKA 3C60C 3QR0A 2HRHA 4HDIA 4WEBL 3QWOA 3N20C 2EIZB 5K39B 4YNDA 9PCYA 2OBGA 3WNJA 1TMQA 4HJTA 1AGCA 4OZHF 2ATPA 5T1LA 1K85A 3NZUA 1JN6A 1SNRA 1NC2B 4C4BA 4PHXA 3CC5B 3IVFA 2E9IA 2BNRD 5FXCH 1A9BB 3DO3A 4XWOD 4Y4FC 1RURL 1JOIA 1EGJA 4TNGA 2UWEE 5HJ3A 3BE1H 1W0VB 3OB0H 1U3HD 1ZT1A 1D6EA 2XDHA 3GLAA 3QFJD 5EULV 3L95A 1AO7E 2ZXCA 2BOCB 2JK5B 4KY2A 3TEUA 2ETAA 1JWSD 4HJGE 3SDAB 2VLKE 1KT2A 1ICTA 1CXEA 1FFTB 1RUPL 4XE5B 5CHVC 3CXFA 4ICWA 1LK2B 5F7DB 4Y1AA 3UG5A 1YQVH 5LG1A 1WE5A 2W1NA 2EIBA 5EPMB 1NL4A 3LRKA 3MACH 4MNGB 2J5LC 3QRFM 2ZCKL 4PRPB 3DXAB 5GS0H 1P5UB 1WG0A 2EC8A 2FB4H 1MI5A 3V52L 1D9SA 4PWKA 4RMVA 3IXTB 1L7IH 2HLEB 4IHOA 4XP1H 3AS8A 3RZCC 4OCSH 5FOJA 3FH7A 4UQZA 2ZP9A 4GRWH 4QTFA 1NMCC 3PHWB 4OAUC 3FUIA 2G75B 4YHIA 3DVNB 4ZRGA 3ZDTA 2M0XA 1EEYA 2YPLA 1Z5YD 4QRAA 1WDAA 1P6FA 3U2SC 2MQ3A 3L3GA 3SYOA 1BZ8A 1JUFA 4RFOH 4G8GA 1V55E 1DJIA 1OE2A 1M6OA 5IMMA 3BPOB 3OG4B 5TF1L 5GZOC 4GKNA 2CHNA 1I3GL 4HRSA 1KT0A 3B83A 1FGVH 4GMTL 4XNXL 5IK3B 4N1EA 3UG4A 4TQPA 2Q3XA 3WIHA 1L0PA 3B3IB 3GSUA 2FULA 3QC1A 4B0ZA 1G7PB 2F19L 2P47B 3LCYA 3MRBB 3TN0D 1FM0D 5IKCM 1P9MA 1MDAA 1L7IL 1MLBB 3L9RA 2QKIC 1UOLA 4NWUH 2DDQH 5T3ZL 3NVZA 2Y4TA 3T6ZA 5D7HA 3UC0L 4D0CA 3MAWA 4NZUH 3WLBA 3N1MC 5HJGA 1FN4B 1QLRB 1UHVA 5DEFB 1C9SA 2BWFA 1H3WM 1RSYA 1IYFA 2YVCA 1F8TL 5DRNA 3EZJB 1AKJD 4FFYH 4PJDF 3UH8A 1BZ7A 4AMKL 4APXB 1MFDL 4NQEA 3EW3B 2I2OA 4XHJC 4NKDB 1UYWH 1NMAH 3ELAT 4G1MB 2ZJDA 4JN1H 5J4MA 4ZYKA 2ADJB 5T3XH 1CJAA 3FEYA 3PHOA 1FGVL 1Z9OA 2JRIB 3N0PB 2V3PA 3PLVA 4NWTL 2YZ1A 1T3FA 1GOFA 2BS2B 3W2DL 3C3OA 3NRQA 3WKQA 4X6BB 1J0KA 4RNRA 2MHKA 4DTGH 3G7TA 4C56C 1IAOB 2DJMA 3N5AA 3QJFA 1P7QA 1BEYH 3U7YH 2MSPA 4HUKB 4NZUL 2GI9A 1Y6MR 3RIAK 4H0GA 3IJYA 4AGQA 2GJ6B 3BUAA 2DBJA 3G6JB 2DJUA 3VE0A 3GJEA 3QGVA 4IIQA 2F15A 1BVNP 1QOFA 2RMNA 1BAFH 4QAWA 3WJMA 2PP9A 1CF8H 3VFTA 1MAMH 4Q7DA 5SX4H 3O6LH 2Y1LE 2W0LA 2P5WD 3B56A