4XE0A

Idelalisib bound to the p110 subunit of pi3k delta
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
917
structure length
815
Chain Sequence
VKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNLWSLEQPFSIELIEGRKVNAMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVCPIAWANLMLFDYKDQLKTGERCLYMWPSVLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELLREILEYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNRVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic sub
publication title Structural, Biochemical, and Biophysical Characterization of Idelalisib Binding to Phosphoinositide 3-Kinase delta.
pubmed doi rcsb
source organism Mus musculus
total genus 263
structure length 815
sequence length 917
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4xe0A05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4xe0A01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4xe0A03
3.10.20.760 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xe0A02
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4xe0A04
4UWGA 2WXHA 5JHBA 1WFJA 2CJSA 3TWYA 4EZLA 1CJAA 3L4CA 3TJPA 4PS3A 4J6IA 3CSTA 4FJZA 4GB9A 3TL5A 3IM1A 2CHXA 4ANXA 2WXPA 4EZJA 4FADA 4UWFA 3RDJA 4F93B 3PREA 3APDA 2ZKMX 2WXLA 5CCHE 1RH8A 1W16A 4F92B 3OAWA 2WXQA 1YRKA 4FJYA 3R7QA 3IHYA 4IHBA 1UOWA 1TJXA 4HVBA 3ML9A 3QJZA 3QR1A 1BYNA 4LT7A 2YOAA 4AJWA 2CM6A 2ISDA 3PRZA 2WXNA 1WFMA 2I9CA 2WXIA 2UZPA 2X38A 3PS6A 4IQHA 5H4ZA 1A25A 4URKA 4KZCA 4WWNA 1E7UA 3PFQA 3F01A 2D8KA 4OYSA 4XE0A 2ENQA 4BFRA 3L16A 3F00A 4QJ5B 2NCEA 4QAMB 4ANVA 1DQVA 4WEEA 3L54A 2N1TE 2WXMA 2ENPA 3L08A 2B3RA 2DMGA 1E8ZA 1DJIA 4ICXA 4NS0A 1HE8A 2NSQA 1RSYA 4L1LA 2DMHA 2K8MA 2EP6A 4PH4B 4G11A 4DK5A 1DJXA 2WXRA 1TJMA 1K5WA 4WWOA 2NQ3A 3FBKA 3M7FB 3QAQA 3ML8A 3S2AA 2K3HA 3F04A 3KWTA 3APCA 4WAFA 2WXGA 2Y3AA 4BGDA 4ANWA 1UOVA 2WXFA 4KZ0A 2JQZA 2V4LA 3ENEA 3APFA 2WXKA 3ZVVA 2QZ5A 3ZW3A 1BDYA 4FA6A 4ANUA 1DJWA 4LDCA 5H4YA 1DJZA 5CCJA 4Y1SA 1E7VA 3LJ3A 4TUUA 1GMIA 3SD5A 3MJWA 3OHMB 3LS8A 4NPKA 3JZYA 1DSYA 2CHZA 2ENJA 5JHAA 3R7RA 2YRBA 3GPEA 3L13A 4LCVA 5T8IA 1DJGA 4XZ4A 3HHMA 3F05A 5EDSA 2FJUB 1E90A 1E8XA 2A4ZA 4Y1TA 4L1BA 2CJTA 3NZUA 4QJ3B 4L23A 4OVUA 3IBEA 2LHAA 3W57A 2FK9A 3QARA 2K45A 2Z0UA 1CJYA 4UWLA 1W15A 2CHDA 4FHJA 4F91B 2WXJA 3QK0A 4EZKA 1RLWA 4XX5A 1E8WA 2CHWA 5G2NA 2X6KA 1DJYA 5G55A 3ZIMA 2R83A 4JPSA 3DPDA 2BWQA 3FDWA 4NPJA 4FLHA 3T8MA 2A5UA 4GNKB 3NSJA 4DNLA 1BCIA 2CM5A 4L2YA 3RPBA 2KI6A 4PS7A 2RD0A 3N5AA 2X6HA 5KJ7E 5ANLA 1QATA 2WXOA 1UGKA 2K4AA 3NZSA 4FULA 3P2BA 2X6JA 4MJJA 4QJ4B 4OVVA 1QASA 5CCGE 3DBSA 3L17A 3PYCA 2Q0ZX 3HN8A 1E8YA 3L9BA 3B7YA 4WWPA 3QR0A 3W56A 1V27A 4UWHA 3CSFA 4ICWA 5ENNA 4KITB 4TS6A 4UWKA 2QZQA 2X6IA 4A55A 4F1SA 1DJHA 4V11A 4AOFA 4FHKA 2Q3XA 3KWUA 4PS8A 4TV3A 4HLEA 3HIZA 4NP9A 2X6FA
chains in the Genus database with same CATH superfamily
3IS1X 2WXHA 5TTRA 1YMMB 3EGSA 2X6VA 3MFFB 3L3KA 3SGDH 3RTQD 5FK9C 5LBSH 2K78A 3T2PA 4BUQA 3GC3A 3EOAB 1CT8A 3DC0A 5D5ME 4D9QD 3KPTA 2R05A 1G7JB 4X6DF 4PWKA 5IHUH 1NZNA 1OWNA 3UO1H 2O6PA 2YSSA 3BD5A 3CDGA 3IKCA 1DOYA 2NYYC 4LT7A 2IFFH 4I1OB 1SJXA 2DWXA 1LNUB 3S5LB 4OM1L 1XGRB 3RGVB 2HTME 1A1NA 4NZLB 2YHGA 4U1LB 2PO6D 4Y4HA 3RDTB 1ZE3D 2WB2A 4BFNA 1JQ4A 1MDAA 5DMJB 1M53A 5EEZA 1PFOA 1UACH 2TSAA 4H0LC 4NQSB 4Z5RB 4ZMOA 4I1PA 4QTHA 2NY7H 4M3OA 5KYUA 1SE3A 2FCSA 3CFCH 4FTVD 5J17A 3AS2A 1ZA6B 2Z4QB 3QUXD 4CVXA 3IU4H 4F2FA 1XGYL 4KBQA 2F9BT 2YR3A 5DURD 1JFHA 2V8MA 5ES4B 3BXNA 1RZKC 5HI3C 1T0NB 2ADYA 1T0PB 3D0VB 3T2OA 4F8TA 2L9BA 3FOLA 2IF7A 1BLXB 3M7FB 2F74B 3DTUB 4GSDH 2QVKA 5EBMA 2IADA 4WNFA 2DJ4A 5HP5A 1EPUA 4ZRJA 3ARWA 3O6LL 3BUTA 1XO3A 1A3ZA 4LLUA 3NF1A 4N1EA 3FFCD 2J1XA 2ZKYA 3WTXA 3AM8C 4ZUTA 5DJ8A 2Q86B 2V9RA 1BPLB 3EYFA 4LVNC 4NNPL 3UPRB 4GZ3A 2AZAA 4LP5A 1T5WB 3JCKC 3HMWL 4E9LA 2H26B 5BRZE 5FFOA 4N2GA 1S6NA 4YBQC 1PC2A 4LQFH 2KHWB 2QR0A 2C7HA 4GXUN 4JPWL 3BVVA 4ZQKA 2IEPA 3WAMA 1MXGA 5I76A 2OJEA 3AWEA 1INEL 4KAQL 5AB1A 2J44A 4OI7A 3WE6B 2EH7L 2M83A 1IC1A 2BWQA 1M05A 4Y9FA 5K9KB 2XENA 1JZ3A 3H8HA 3QQXA 3FH8A 2P4AB 2VAAB 3BEWA 4PPTA 1QRNA 5AL0A 1JNHA 1DFBH 5CEYB 4FQCL 5ETUA 5FM4A 3WTTA 4DP6X 2J4WH 5JZEB 1N2RA 1L5GA 1PZ5B 4XCCH 4Z0XA 3OBAA 3MV8E 4G80A 3NGBC 1X3DA 2JKSA 4ZFGL 1LE5A 1S3KH 5F8QC 3D0AA 4LEUA 1UB5A 3MXWL 1FRGL 4YE4L 4ICWA 4UMGA 5GGUB 2V2TB 2IC2A 2APFA 2DD8H 3RWHA 1JV5B 4E9RA 1U8MA 3SDCA 4N8CL 1FCLA 1OM3L 5A2KH 2EDWA 1N5AB 4JVSA 4PYGA 3WO4B 3E30A 4A2EA 1WYGA 3LY8A 2EXWD 2JJSA 3C9NA 3TTYA 1E0OB 3VXQB 2KC2A 4HUKB 1RERA 5DFVC 1L0YA 4AUYA 4L29B 3Q5YA 2VR7A 3L4CA 2CG3A 1OCCB 2APTA 1AANA 1WAO1 3TL5A 1TZOA 3GHEH 4GFTB 3LY7A 3ARFA 4B9YA 1XCQB 2EINE 1G9MC 1F97A 1K3ZA 3FB6B 2YGVA 4P07A 3D18A 1D4BA 5GGVY 4DVRL 5TQ2H 5B1KA 4OTXL 3U1PA 5DVPA 4Z3HA 3JBG7 3DBRI 3V52L 2YEVB 1WT5C 1JVKA 3IFOB 4XVUC 1FDLH 2D0HA 3UBGA 1KELH 2YOAA 2GG1A 1BOYA 1YYLL 3DHIC 3NFPA 4PRNA 3NQIA 5SV3A 5DA4A 3KJ6H 2LVPA 1I4FA 2BFGA 2VC2B 3QULA 4JRFA 4APQB 1I8LA 5CX3A 3VDAA 3KPNB 2VMEA 4V3IA 1OSZB 1BM3L 2IGFL 3PY9A 1JCQA 4H7YA 2H5UA 4IU3A 3SCMD 4BH7A 5L9DL 4NJ6A 3UTSD 1H8LA 1C5CH 2VLRE 2YS4A 5CHWA 2HFGH 5GMVA 1IB5A 5JORB 2M4NA 3L9TA 3Q2LA 5J08A 3F7VA 4PJHB 5AOIA 5KAQG 5I5RA 1N4XL 3FQ1A 4YHIB 4B9JA 3JUEA 1N8ZB 2FX8H 4HFWA 1CFSB 1XQQA 2X8XX 2FD6L 4QUOA 3V6FA 1HDMA 3ZR5A 3QI9D 4Z7IA 3GIZL 1GTNA 1T1XA 5D1XE 2DLEA 2X2IA 2Y4TA 2NR6D 5FM5M 3VFOB 1T89A 3MR9A 4MXQC 1JXJA 1XT5A 4O2FB 5LG1A 3U0WH 1I3VA 2V7NB 4IHOB 2IO3B 2VDQH 4YSXB 2BS4B 1U21A 2ZCBA 2OZNA 2YOCA 3ZTJH 4KJWC 5AAPA 3DO7B 5AW2B 3OKNB 4IS6A 2PE6B 4N6QA 5TK2A 2VL5A 4I0PC 2C9AA 1GZHA 1UM5H 1U3HC 1BQKA 1OKEA 5T3XD 4HHWA 3S7DA 2N7EA 1Y6NR 1CVRA 3DSTA 1VFAA 5EZLA 1OAYL 3EHQA 5FYLH 5J90A 4JAMA 1HAWA 4XVSL 1CZ8H 1Y0LA 4RNRA 1BX2B 5HGAA 3A5VA 5I1GH 3S3CB 3DRQB 2A1WL 2ZXWE 4OQ1A 5I8EA 1X5AA 3UFIA 5I18H 4GAJL 1NICA 4OUOA 2FYYB 1NCGA 1FH5L 2GRNB 2B08A 1M57B 3W82A 2AERT 3EJYC 1PGBA 2IY0B 5DYOA 5BRZD 5BOPA 1VLBA 4OLYH 2YRLA 2VSXE 3BW9B 2FO4A 2A5UA 1KXHA 2MWCA 3AB0B 4HHAB 1E4XI 2R0KH 3RVXC 3HE6C 4DP4X 4MMZA 3NN8B 3IE4A 1D9KD 1X5YA 1PKQA 5EU4A 3GBEA 3VXSD 2X9ZA 4MMYA 2MKWA 1H6FA 3FEYA 5K9OB 3BGMB 3TXNA 4AWJC 2OX5B 4CNIB 9CGTA 3ULUC 5AYUH 1IP9A 3NP4A 1I7TA 1Z3GL 2QZQA 4NRYA 2HG5B 3UGUA 2I32A 4APXA 1IGMH 2OW7A 1CDBA 1GA2A 2BSBA 1G6VK 2I60L 3AEBB 3KMDA 2AJYH 4G6JH 4JO5A 4TVPE 3IB4A 3SOTA 3I3TB 2XUWA 3DUHA 1J8HA 4A3TA 1KN4L 4TLUA 1MI0A 1GOFA 2K25A 3IN0A 5T3XH 4A1SA 1UWEH 4OZHA 4XP1H 1BBDH 2DJMA 4HH8A 5FHBH 4RIRB 1ACCA 3N6YA 5T1MB 1SMOA 4KPHL 4JFQA 1U8KB 4LEOA 1F1DA 2GSIB 3CUPB 3MUY1 3OKOA 1NEUA 2D9CA 4H8WL 4KTEL 4RRPG 1MDTA 4FQ2L 2EECA 1NKRA 4P4KD 1H6TA 1I7RA 4MWFA 2DAJA 3VLDA 4CW1B 3UTOA 3I9V1 4OLUL 3O11B 3KEHA 5KN5B 2FX9H 4P04A 1HHHB 1YEGH 1EAPA 2FHCA 3CVHL 2PP8A 4LIQE 1RULH 1WD8A 3SY0B 5JA9A 3IT4B 2FR4B 2H45A 1QFOA 3L54A 5IUSA 1UQSA 3RWIB 1X4XA 2XV3A 2CMRH 3D2TA 3QORD 4NQEE 1E2VA 3GGWB 1IGCL 4AMKL 5ID0B 4CYEA 4HFGA 4H13C 1NC4B 2APSA 4OM0L 1PQSA 4DK5A 3T5VA 2R2LA 1XLPA 1HKLL 5C09A 3AFLA 4AW7A 5I71C 1F11A 1SLVA 2VLRD 3AU0A 4N0FA 3VYPA 2ZOKB 3QC8B 1QYGH 3APCA 3TWRA 3T4AA 2OR7A 3UZEC 2X70A 1JXFA 4GP8B 3C3QA 4JDVA 3MLZL 4K5MA 2YEPF 1MHEB 4BK8A 2HUEA 1WM2A 3TJEH 2Y0SA 3WO3B 4U8YD 2JMRA 3AG1B 1FT2A 1D2OA 2YBRB 3VI3E 1AJ7L 3MUJA 5AEAA 3EUVA 3GEFA 2H6PB 3N1XC 4XMLL 3P4NA 3STZA 4DW2H 3QIUC 4PRBB 4YHNB 3X1BA 2R2BA 4NOFA 4BCYA 4FJVB 2WGXA 2W65B 3LTVA 15C8H 1QFWM 2XFXA 4LQ1A 4QOKB 1JALA 1AIZA 4EOYA 4DCQA 2CJTA 1JPLA 4GMSH 2P58C 4EQFA 4XGAB 3VXUB 5JQHC 4M1CD 2DWDB 5AOKA 2C3WA 3KJ4B 4OJFL 4A3PA 4XX5A 3G5WA 4YHLH 4M93C 2Q10A 4JZJA 1F2RC 2ZNVC 2R83A 4IC7B 5A16B 3DARA 5C08E 5I15H 3ZHEB 3VH4B 3U64A 3FMGL 5JIIA 4IBVA 2CRIA 3GSQB 2QIEB 2VR4A 4RAVB 3CPLB 4FHBD 3P77B 1TYJA 2ITDB 2K8CA 1JGLH 2LJIA 1C4AA 5EOQL 3C6LB 3H9DA 3V0DA 2XY2A 3B7YA 5TDPB 1ZXIA 1WZ1L 1HHJA 3T3NA 4DT2A 4AYID 4YX2H 3ATBA 1IJ9A 5T1LD 4FL4C 4KGLA 2V4IB 2J5LB 5D2LA 1HCYA 4F53A 1QBML 5FQ8A 5T5NG 2K6DB 3ZPJA 2A73A 3CLWA 4JREB 5I0DA 3DJ9A 4X6CB 1CFQA 3LNHA 1ZPUA 4X7DC 3WDJA 1ZOYB 4NZUL 3RIAF 3D48R 4NY0A 3V0VA 4Y4FB 4QXGH 1UASA 4FTDA 3U4AA 5BUPA 1ACXA 1N62A 2BSSB 3FKYA 1FFNA 5DRXA 2V3DA 9PCYA 1EJOH 3HNVH 2J0MA 3FH5A 1VESA 5JHDE 1HXYA 2NMSA 4N6RA 5IF0A 2GUOB 3B4NA 1ZW7A 3KVQA 5D6JB 4L1HA 8CGTA 5DI8B 4YSDA 2H47C 2KMCA 3QWZB 5L88L 1WX7A 1EJFA 3KW8A 2KLGA 2M17A 2WWZA 6FABL 1X9LA 3E7JA 1XSIA 5CRUA 1RURL 2AW2A 3MXVL 4UM9B 1J7AA 3SE8L 2LU3A 5D7JC 4AIZA 2VDOB 2H9GA 5BO1H 2PEAA 4L4VB 4PJAB 3SNXA 1NFIB 5C0GA 1ZIBA 1FNEB 3CDFA 3O9WA 3AH7A 5IJVA 1TJIH 3GSUB 1UKQA 1M94A 4MJ2A 3US0A 3OJ3A 4B0MB 1BPVA 3PU7A 1RY7B 4PRDB 4YK4C 5C6WH 2O6VD 4GUQA 4M00A 1UA6L 1DVFD 4JY6B 5KANI 2C9WB 3VWKB 2RB8A 3X2QE 4HOWA 1WIAA 1FC1A 3J9CA 1XGQA 4LSQH 2ESVB 3MV11 5AOZA 2N7DA 2XTJE 3EKCA 1ZV9A 1S46A 5FW6A 2MBQA 2LT9A 3CXFA 4DP7X 3CV5A 2EKSA 2Z64C 1IVLA 3L95A 4U1SA 4CDGC 3ZVVA 4IKKA 3C8HA 2RDGA 3P4SB 3PRPB 1U30A 2DQEL 1KXQA 1LEGB 3CVCA 3DWMA 1GYWA 3GSOA 1T03H 2F15A 1JCRA 1NP7A 4PJGF 3KYNB 4G8IB 1BU9A 2X4SA 2CKNA 1MVYA 4DWFA 2W91A 3L82A 3WKNA 2R69L 4HFUL 5FECB 3GRWL 2WPGA 4O02B 1H0DA 1ZA3B 2XCCA 1JS4A 2CO7A 4MQXD 5DR5L 2F8XC 4KJPD 3J8F7 1A6PA 4GKSA 5CD5D 2NUPB 1Y8RC 4HQQL 4KZDL 1JWSD 2GSMB 1FPYA 2IYDB 2R4SL 3TMPB 2XX1A 1WBXB 5E8DH 2I5YL 3D9AH 3ZTJG 3EFDH 5JXAL 5GRZA 3RD2A 1LO0H 5IW6A 1DL7H 1DBBH 2FB4L 3HC3L 4N68A 3MREA 4FQQB 3HS0C 4HIJB 4HKZB 1BD2A 3N5AA 3N50A 1GY2A 4MFHA 5CLZA 3Q7FA 1FJ1B 3BKJL 2E7CA 4YIQB 2WXOA 1QSED 2RR3A 2AJXL 5I1DB 5I9QC 5KVEE 2CS4A 2A9DA 4HOXA 1WYWB 1RFDL 2ICES 4UI9J 3TC9A 1O0VA 3QWPA 3DHMA 1L6VA 2UVFA 3ZPDA 4L8SB 2GAZB 3OLGA 3MNZA 4NACA 1H3TA 1JRHI 1SMDA 2XVBA 1OB0A 1KIPA 3Q9QA 4H8PA 5CILL 1ETB1 5DO2D 4A3OA 3O2WL 5C2YA 1KIRB 1BFVL 1CGWA 3Q6FB 1UXSB 1R33A 2D03H 4NKOA 4PBWD 4X7SL 4XT1C 5F89A 3FQNA 4KNSA 1KCUL 1TTRA 3DRTA 4X6EB 2ITCB 3DX6B 3LKPA 1P4IL 4GXVH 4ELDA 7FABH 3TWUA 1EF5A 1F41A 3IMTA 5JHBA 5C2TB 2HVKB 2HPOA 4DZBA 3FY4A 4LARH 4PTUA 3SE4C 4KVCH 1BQRA 4XMPL 2IANB 3WIIH 4FG6C 4EDWL 2OL3L 5JDSB 1JGUH 3NABH 1YEWA 5JUEL 4JUTA 2XDHA 4TQIA 3VXPB 4M4RB 3VG0H 4F92B 3OAWA 2XPGA 2PCPB 2HO1A 5DJAA 1Z0NA 5SV4A 3NH7L 3NBNA 1I1AB 1AR1C 2J8HA 4WZ9A 1WSST 3ZNHB 5B1BE 3O0RH 2P5WB 3H7BA 1QLFA 5JHDD 2O2VB 3L3GA 4UT9H 2DJUA 1FZOA 4JKNA 5FGBC 1GYAA 1SEBB 3TBWA 4O1NA 2CJNA 4OAWB 2VABB 4JFWA 1NDMB 3PWUA 3U4EA 4MNGE 3VD9A 4LDTD 4N6EB 3BPOB 1EWHA 3MOAH 3CXDH 3CC5B 4HIHB 2H6GA 4R3SB 4AENB 1RK0B 5FQ7A 4KOBA 1KFAH 3ZO0A 3PVLA 4ATTA 3SF4A 4EQ2A 4LCDE 1AYRA 3M7OA 3HLAA 3LZPA 3MRKA 4AYFA 3QGVA 4W93A 1LD7A 2CE6A 3TO4D 1HAUA 3EJCA 1V6EA 2IPUG 3I63C 5E5MB 5IESL 1GUAB 1ILSA 3GHBL 4B9GA 1DVPA 3MLYL 2G75B 5ERWA 4GTPA 1GY1A 4Z18A 2UYLB 1O6SB 2I9LA 2L1AA 1OZUA 3FRUB 1D5IL 4LOVA 4I13B 4ZXBB 3VWJB 1FL3B 2IQ9L 2JTYA 3LDZA 3S7BA 1MFMA 5E0FA 2A83A 3MC0A 5FZSA 3UC0L 3FO9A 3CFKA 2MOGA 1PQZB 4FXGA 4MJSA 4DGVL 1UG9A 3HB3D 3QDGB 4HUXA 3FB8B 1TN6A 1BAGA 1YJDL 1IBDA 5CJXA 1KZPA 1PLGH 4FQHA 3MHSD 4NIYE 2I2YA 2ZJSH 1YEHH 4UQ3A 4XXDB 2ARJA 3FYIB 4G71B 1TZ8A 4WEUD 2CO1A 4D7BA 3WEOA 1ZLEA 4N3AA 1IT9H 2CBQA 2VISA 3PWNB 3FOMB 3QUZC 3ZHNA 4D9LL 4AJYV 2QKIB 3Q44A 1ESFA 3OLMD 1ZT1B 3R8BA 2BNRB 4HSQA 3V5HA 4XZUB 4E0RA 1JWMA 2WKLA 2BINA 5JJTA 3RJVA 1G9NH 1I4QA 1DCLA 2WAHA 1KTJA 2EYSB 4LSVH 4NOBA 1MCFA 3HPLB 3PYCA 2WY3B 2UXVA 3OKEB 2WZPD 1UT2A 1M2OA 1NIDA 2E9GA 4FTVB 4P2OA 3QUXB 4M5ZL 2DX5B 2YAQA 5DURB 1K8DB 4XPHH 1ZLVH 3JWDL 1F4YH 1SHXA 1TU2B 3I75B 4FE9A 1Q9OB 4N86A 5D3IB 3JQ0A 1IKNC 4JFEB 2OYLA 3S35X 3GXPA 1TZIA 3EJPA 2P24A 2FF4A 4O2CB 2W5PA 5J6HA 1V5JA 1KENL 2GHZA 2KPNA 3CQQA 5C0IA 2DQDL 1NGQL 5F1KC 1DSFL 2P5EE 5F7WC 3O4OC 4XCFL 5FV1L 2X4QB 4KX8A 1TTNA 1B0RB 4KY1L 4BIKA 1VFBA 3FFCB 1T04A 5E8EA 2GKIA 5HVFB 4PW3A 3MRPA 3RTQC 2A9NH 5BV0A 2K8HA 3C2SA 1QQEA 4GEJA 2DQTH 4YC2B 4HRLA 5F7KC 3ZYJA 2J6EL 4ODVL 3QJZA 3L3OB 3CFEA 1SJEA 4HYTB 3UC2A 3O45A 2WXIA 2EMSA 1KY6A 1IFHL 3FB5B 3D85B 3VFVB 2X38A 5E00A 2HJ1A 2EDBA 4QHUB 5D6CA 2BBCA 1P4UA 4H7XA 5KHQA 1I3GL 1MI5E 3UCQA 3L4VA 3SO3B 2AJZA 3ZNGC 4P1CC 3RRUA 3HZKB 3TWVA 2PO6C 2GBNA 3LXFA 2FWUA 2Q8BL 4J6RL 2CAKA 4MNHB 1SPDA 1ANUA 3KYKH 1E6OL 2WWOA 3V6OC 3C5SB 1P69B 3ISWA 3S7FA 3CH8A 1U4EA 3CBRA 4X6DB 5F6HJ 4UINH 2PL2A 1UD8A 1MJ7H 4L3AA 4RGOL 2LOEA 3OHXB 3DXAE 4HWBL 5CJ8A 2I27N 2XWBA 1AY1L 2WBJA 3LKOB 4FQXA 4XCEA 3CVQA 3CVYA 5F1NB 3RJOA 4G1EB 3GRWA 4G3XB 5DRZB 3GUTB 3QJOA 3ZTNH 2GK0B 3NDYE 3GBMH 1DN2A 2YD6A 3GTNA 4DHJB 4ZUSA 3MODL 5DVLA 3V4LA 1FAKT 1DDTA 2C3XA 2XKNA 3PGDB 3QCVL 1D5MC 3GXIA 1FF5A 4CMMA 5GZNC 3TBCA 1K53A 5AEKB 1NI2A 4Z7VE 1IKFL 4LGRB 1HOEA 2DWEA 5E5UB 1ZDXA 3BO8B 5BO4B 3CVLA 3ILPA 1I1FB 3EJZC 1A14L 1XR8B 5DHVH 4KKCC 5IO9A 1J0GA 3KNBB 3H9ZA 3H6JA 1MJJA 5DJXA 1SB3C 1RIVL 2XXGA 3HRAA 1D9SA 4NJAH 4JN1H 1KCBA 2BYTA 5HGDB 5FHAL 3NJIA 4OT1H 2PM7A 3TYFB 4PD4J 4USAA 1MREL 3CHXA 4A7UA 2X9YA 1RJLA 3QK0A 4WI0A 5ANMA 3IEAA 1R17A 3F58L 1MWAB 2G60L 2YBGA 4IOFD 2OFQA 3S6CA 3CZSA 2DH2A 4B9KA 2GBRA 1KBWA 3MHZA 1IHBA 3HZ3A 3BPLB 5D5MB 2HT4D 1FVEB 4KDWA 5CMWA 1A7PL 3FONB 2WQUA 2QHRL 4UT7H 4JM0A 2PYFB 4MZIA 4MJJA 5DGQA 3KXFA 4W9KC 2R2QA 1TNUA 1KIQA 5EIBE 4BT9A 3SCMB 4CEMA 5F9WB 4UQBA 3VFWB 3U9PH 4GW1B 1CLYH 4S1RH 2Z35A 1NOLA 5LXVA 1AD9B 1A17A 1QYMA 1YEKH 3QQDB 2IH3B 3VGAB 1HZKA 5GIRA 1SLUA 4WGVB 4W9LA 1L7IL 3QI9B 4J3OF 5L2KA 4JA7A 1ZWIB 2AXUA 3FAXA 2HKAA 3FL7A 2HUHA 4MXWH 1A4AA 1NSNL 4Z7VF 5DSCB 2M26A 1R3LA 4K7PY 2BRRL 2FJGB 5HYSB 2QC9A 2JI1A 4JR9L 1NCCL 4A6YB 1GC1H 4P5MA 4QLWA 1GPOL 2X1OA 1P7QB 2DMCA 4U1NB 2NSZA 3GMPB 3X3FL 3DPBA 3DBXB 3UGXA 1TO4A 3LHPH 5A43C 5F70A 5FF6A 3N2JA 1PDKB 3V79C 1OWWA 2P5ED 4LSUH 2C1OA 1A1OB 5E8PA 3KHOA 2X5PA 5DD1L 3SY6A 3G9VA 4HJ1A 1SUJA 3IN2A 3QNXB 4WIQA 4BEPA 2V17L 1P7KB 3ARED 4ZQTA 2G5BB 2Y1LE 4KK5D 3GQFA 3OJ4B 4H8HA 4EN2A 5B8CA 2ICWJ 4A9AA 3LRSB 3EHBD 2YD2A 5BRZB 3LKRB 3ARBB 4W9IC 2K0PA 4IOSD 1YHPA 3KDMA 3NZ8A 2IOLA 1QG3A 2ZXBA 3OB0K 4ZTPL 4ZPTB 3X3GH 5T33H 4GXUM 4HT1L 1N4SA 4N3UA 1D9KB 1H3PH 1JZEA 1L0QA 4H4NA 4F3FA 1I1RA 4F8PA 4LESA 1EUUA 5L7XH 5KVDL 3J27A 2SEBD 3TN0B 2D07B 3LRKA 3L5IA 1TQBB 1TXKA 4GIAA 4UWQB 4CJ1A 1PG7H 1N5YL 2WVIA 2K70A 3CQFA 5I1HL 4RM8A 1AACA 3C5ZC 5ESQA 1NDDA 3O8XA 4NBYB 3DXAD 3HJEA 1EZVY 3BH9B 3NZHL 3C6SB 3MBXL 4WWKD 4Y2NA 4ZO9A 1IX2A 1TZGH 3CGHA 1E4XH 3G6DL 3MV8B 1JGDB 3RNEC 2WS3B 3BVNA 2GTWA 4JM2A 1BF8A 3CLEL 3JVGC 4WV1A 4Y19E 3ZRCC 4TRQA 3ASGA 2NXYC 4J3OD 4Y16D 3WENA 2WIMA 4OZIA 2XGSA 3GSRB 4K9EL 2PTUA 5AJDA 3IJ8A 1ZT7A 1SOSA 2HX8A 1X5GA 2V7HB 3ARGA 5D1ZD 3QEHA 3LVQE 1OY3D 1I75A 1HHGA 4WUKH 1HHIB 1A0QL 1FGNH 4ZMTA 2WPVA 4ODSH 2EINB 4XDDA 3IGFA 5I6OA 1KLVA 5LCVH 4JDEA 3W39B 4BZ2A 2D3AA 2FIDA 3RB5A 3R1GL 1QATA 2JJTA 1N64L 4DN4H 3FU5A 3JV4B 1TGZB 4EBQH 4G24A 3SDAD 1J5OL 5BXFA 1SHSA 3QPQD 3B9KD 4IIQB 4N2AA 1AHWA 3BH8B 4GG6E 5EC2A 3V6CB 4ELMF 1Z9MA 1BECA 1TTCA 2QFPA 1JRPA 4WJQA 1WXAA 5LP0A 4UWKA 2YK1L 5KYXB 3QORB 4OFQA 3P9MA 2R56H 3FSAA 1FCGA 4UAOC 3K1KC 4NQXB 1FO0H 2DAFA 5L4FA 5HHQB 2VLRB 5DJDB 1EIBA 1R5WB 2L7RA 4PS3A 5CCLA 1WC7B 3V62A 3P2DA 2R0LH 3WFDH 3FN3A 4FNSA 3RDJA 3RBGA 3WUWA 5C0RL 1BAFH 5ALBH 4HBCH 2LAGB 4QO1A 2F8VA 4AVXA 5ECJE 1RZKL 3VFRB 3VTTA 3SJVA 3VU2A 5D1XB 4NXSA 1FL6A 3MACL 2IO5A 3TASA 3PHAA 1HCVA 3QXAB 4PREA 3CVWA 1QP1A 2C3GA 4YFLI 4HUWA 4A63A 3LRGA 1AHMA 3GJEA 2CKBH 4AMXA 3OWEB 4IRSD 2XICA 5DD3L 4NQLB 3BKCH 5HBBA 5F1OB 4H8QA 2VGXB 4P4KC 4JIOU 2AWIA 3U9WA 3BYTA 5FGCE 3HR5B 5DO8A 2LXMA 3TJHC 3IEGA 1Y18A 4Z77B 1XX9C 1E9QA 3BP6A 5FC9A 2HLAB 4ZRQA 1NWOA 5G5DA 3MTXA 1WX8A 1Z6JT 1EZLA 2MHAB 4P23D 3HVDA 4RISL 4PJ8A 5FKPB 4XMXA 1BLNB 5L4JA 4U33A 3GKZA 2BVQB 2RCSH 5FJYA 5T3RA 1U2CA 2ZXWB 5EIIA 4GG6F 3V8OA 5K9JH 4DIXA 4KOCA 3SFDB 4LLDA 4UT6A 4WK2B 4JFXA 3A6CL 3Q6GL 3X13B 2DRUA 4HWUA 3TBSA 1VEOA 5KYYB 1FVDB 3PJSA 5GZOA 5KS9A 1SXBA 3NK4A 1O9VA 5C23A 5T1LB 1KTKA 2R7EA 4LU5L 3DHUA 1LP9A 2R5SA 5IIEA 1KCWA 4UBDD 4BHUA 2DI7A 1MQKH 5DTFA 5KSBF 3ASOE 8PAZA 4PV9A 5E99L 3AS3A 4ZMXA 1OF2A 1W72H 1KBPA 1JPSH 1CQYA 1R19A 2DQHH 3DX8B 3P3RA 4IJ3C 4LE8A 3VFSA 3R3MA 5BZXA 2JELL 3BP4B 5C0FA 3V31A 5CP3H 3V2XA 5JO5A 2R8SH 5K69A 2J2ZB 4R4FH 2HFFA 1ET8A 4G2VA 2MHJA 4KH9A 2Y22A 3AITA 5FZRA 1DR9A 5C0DB 2YEPB 4MJ4A 1T1ZA 3MA9L 4YPJA 3VUYA 4BV1A 3MJ9L 2G3NA 3IMBA 4JNXA 3DO4A 4XWOD 4BKLA 3EYOB 2GJRA 3SGHA 3MFGB 1HX8A 3NUHB 1MHQA 2FWLB 4J8FA 2ARJQ 2BW2A 1G9ML 2VSNA 4ZYKB 1DEEA 1CDCA 4GSUA 3AAZB 2WUBH 1W0WA 4H1LH 5B1AE 4F7PB 3D09A 3IDXL 4GUPB 3CLFL 5DD0H 3TEUA 4ZMYA 3EJTA 4V1DE 3KWWB 1KTLA 3WEXB 4I18C 5DCCA 4C4KO 3HAEH 5DHYA 6PCYA 3LCYA 5I17A 1B90A 1NBCA 3EFFA 2O6VB 1E6JL 4LLVA 1DVFB 4WI9A 1UELA 1DYQA 2YVCA 3VH8G 1T4KA 4E71A 3WNKA 4X5WB 2GROB 1R5VA 4LASH 2WD0A 1JPTH 1RV6X 4RMAA 1M71B 2MTAA 4HEMA 5DFTA 3EOTL 5IFAL 1WFJA 3CZEA 4XMUA 2HZHA 4TSCH 2MCG1 5IKCM 2VDKB 3EHRA 3G5YA 4XGZA 1OW0C 4ORGA 5INDB 3AG3E 4NQEB 3MX0A 3DX2A 3Q4AB 1EO5A 3HZVB 2YZ8A 1NA8A 2XRAL 4U3CA 1W16A 5E7FA 2ED9A 3LQZA 5IW1B 3S96A 3FTSA 3HVNA 3CVNA 1C9FA 2MJDA 1TJHL 4GSWA 2DQCL 2Y7OA 2DLGA 5EO9A 4ZT1A 5EA0L 5H35B 2JXXA 3S8FB 4QGTA 1IZJA 4OZFB 1FVFA 3K72B 1E5YA 3CVDA 1U8CB 5JTWA 5KSAA 3WKPA 3PS6A 4ERSH 4IBWA 4OCWL 3WNJA 1SN0A 3B1LX 3ABKE 3QIBB 3VI3B 5DJ0A 1UYWL 4JO4H 3PZ2A 3EDTB 1BXUA 4BKTC 5H37H 2UWEE 5K33A 1TTBA 4H5SA 2NZ9D 2AJVL 2GRPB 1XIWD 3V6ZA 3WFEL 2DQIH 2EC8A 1N68A 3Q15A 3BINA 4KDLB 1FHGA 2WINA 4TMPA 5B3JE 4NS0A 4GW5A 5GGTH 2EKIA 4LSTH 2XGMA 2WVVA 3DX9A 5HI4C 4YL8A 3C2AL 3QDME 3HMXH 3FPXA 4FFYH 4B6WA 4E5XB 5L4IA 2IOOA 3T4YA 2GFBA 3WN5C 3Q7AA 1N0LA 2KS0A 1TQCB 1OAKL 3CXHJ 5E6RB 5F7DB 4QXUH 2CDFA 3T6QC 1I4RA 1U58A 4N9GB 4ES8A 1S7RB 4WO4D 3AEAB 2QZ5A 4FNUA 3TYGL 1B88A 4JCLA 4KO9A 4PUBH 4RDQF 2GBKA 4NERA 4HHGA 3GSXA 1QEXA 3MRHA 4Y5XB 2PXYD 2BYFA 4U04A 3FHEA 2CHZA 2VJ0A 4K5PA 3LEVH 4JO1L 2L0FA 5CIPB 3U82B 1M7IB 5IM7B 5E9DD 3V2AR 3IDIA 4EF3A 4J4PC 3ETSA 2VLJA 5EUKB 2EE9A 4XBMA 4CMHC 3VUAA 3VD2A 1HH6A 1I7ZA 4FQLH 4YO0B 3L4UA 5DRWB 5ADOH 5J1SC 4B6ZA 3FFDA 5JMRA 1VRAB 2MEJB 1G87A 3D50A 4ZNCD 1JRHH 1BQHA 2OMTA 3QUKB 4FHJA 4LNRA 4PB9H 4Z68A 2NY4D 1IGJA 2LTQB 1P5QA 3O2VH 3O4LA 1QZ1A 4K55A 3FQWB 5FYJE 3SD2A 4BZ1A 4FLQA 2UWEF 5JHDB 2AGJL 4GLRI 4PJCA 4I3RH 5CF3A 2RQ8A 3BUIA 2IDQA 2ZYRA 3SDDA 3LMJL 2JB6A 3T1FB 3ATEA 2CLZB 4NT6A 4GPMA 5D93B 1BOGA 3DBSA 4XNAA 2OTUA 4FFZH 2QSTA 2DIEA 2GUYA 4LDTB 2Y4UA 3KVPA 1OAQL 5G04C 1VZHA 5D7IA 1J05A 3IDJA 4ZZKA 2JQMA 5JPNC 1KLUD 5IVXE 5DF0A 1MVKA 5GS3A 2A9AA 3QT2A 4AIEA 4BDVB 3EO1A 5IB3A 2P9NG 2Z0EB 3LKSB 2P9KG 4N85A 2GGFA 3VXWA 4XH2A 2GCYA 4ORZC 5DO2C 3BQUD 3HRZB 5F2FA 5LBVA 3NEXA 1VZ8A 4PMEA 4JJOA 4WJ5B 3FUEA 3FUFA 3ASWA 3T9WA 1ZPLA 1HOCA 4V1DD 1JGEA 5LN8A 3WL9A 4U1MB 3F7LA 2G9HD 1ZHLB 3S36X 2EEFA 5FKAC 1YMMA 4OJAA 3FT4B 4LKXA 1NCIA 3VRIB 3WHXB 2DHZA 2B1AH 1KJTA 3X2QB 4JHVA 2W07B 4Q6IC 3W2DA 3EOAA 3HRPA 1HT6A 1KF9B 3TWTA 2XEWA 5B1JC 3FEXA 4JG5A 2XTJB 2E2EA 3MV7E 3RVWD 4KBPA 5FO9B 2EDYA 3BWAB 4TPRH 3ZYLA 3VYOA 1A25A 1LNUA 3S5LA 1XLOA 4RFBA 1XGRA 3TA3C 1NLDL 3HB3B 1NGXA 4U1LA 2PCXA 1U4FA 3RDTA 3V7AG 4A1RA 4AKOA 2QEJC 3N20C 3PPAA 2Q5BA 3PRMB 1IVTA 3M8OH 1P98A 3QIWC 4LRZA 4NQSA 1Q94B 5BMHA 3G6AB 3KUZA 2WQRA 5G05J 1T3FB 4APFA 1EQWA 1ZA6A 2Z4QA 4PVLA 3QVAA 3T9KA 3HZYB 1ZXHA 4M6NH 2X0WA 3EGRA 5IVXF 3LNDA 1PEWA 3LEYH 4Y2DD 1G9NC 3AROA 3AJIA 5DJ2B 3TBBA 5E1QA 1E28B 1AG0A 1HWHB 3D0VA 3RNKB 3GMLB 2PP9A 5F0MB 2FT8A 4X5XB 3ZDZE 2FJHB 4XP9H 2ZEQA 1KZOA 3LKUA 1MCIA 2C5LC 3EO0A 2Y1AA 4GEIA 1WHOA 2F74A 4ZYNA 4Y6WA 3O2DH 4ATGA 5AQ0A 1U8PA 3TO4C 3QDMD 1WF9A 3W1YA 1I9JL 3S37H 1G84A 4EXPX 3MJ9A 1KB5L 3JZYA 3DMMB 2Q86A 2OZ4H 1MELA 1IGFL 2BNUB 4PWFA 3UPRA 1X4YA 3RYTA 4AJVA 1XVSA 4YDKL 1SN5A 4J8SA 4GYBA 4YDNA 2H26A 5HPOA 3IPBA 3CWIA 3N30A 2ZCKL 3N40F 1AGEA 4IBYA 4DHLA 5ESAB 3G2UA 2YXVA 2EVJA 4U96D 1PYWD 4KK8C 1ES0B 3K6SA 4B95A 1K8IB 4J5VA 4CC4C 2GOWA 5FDYA 1G6RL 3KS0J 3N1MC 5D4QA 1G9EA 3SI5A 4DDGD 1DHKA 5EN5D 4V2CB 3RVTC 3CQCB 1I1YB 1OCOE 3BWSA 3WE6A 2OJ1A 2J7QB 4QDGA 2AV1A 1E4WL 1X5MA 3K46A 5K9KA 3U3WA 2VUKA 3UF8A 5LNK1 2EKJA 4YXKL 1ZLVK 2KO3A 3SGKA 5CEYA 1U4AA 5FZQA 1NQBA 4HF5H 4G3YH 3TZVD 5FYJD 5B1BB 1PZ5A 5I8OL 1DCEA 1EO8L 1M6OB 4ZPVB 3PV7A 1MY5A 3K91A 2BVYA 4F1SA 4OF5A 3QXWA 2PVGC 1KTCA 1AQHA 3QCUL 4IM3A 5LOZA 5GGUA 2V2TA 1HA5A 1OO2A 1N9PA 1JV5A 5CTRC 1CU4H 2A6JB 1N6ZA 2YUVA 1N5AA 4XC1L 2KZ1B 3F83A 1CMOA 4MB1A 3VXQA 2NPTB 1QNZL 5KOVC 2KT7A 4Q96A 4JFUA 2V3EA 5E24E 4MYWB 2ZYSA 3CZFA 3DKHA 1J9RA 3ZE1E 4IRZL 1XCQA 1YN4A 3FB6A 5ENOD 3DIVA 1CCZA 4MJ6B 4E2OA 4ALAH 2NY0B 3IFOA 3US1A 5DZVA 5H7PA 5ICUA 1V81A 4AG4H 3VI4F 4NUMA 2J1YA 2JIXB 3A1QB 1KJ2B 5IP4A 4R90L 3G04B 4RH4A 4JFOB 5L6YH 1ZMYA 4XAWH 2LU5A 3U6RB 3DWGC 3F8UB 3EYSH 2YGPA 3QWOB 1OQOA 2FO1E 1MHPL 2CK0L 4KVGB 5GSRB 1YA5A 5KJRH 5C71A 4KGSA 3RPKA 2ZOWA 2GIYA 4PRPE 3GBNL 3HE6A 3NS1A 3AMZA 1RUKH 5HVGB 1I85C 1RZJH 3SU8X 4PJHA 1RYJA 5K93A 4G11A 4HK3N 1CFSA 4NO3A 1JNNL 4PBXA 2NCNA 4JFYB 1MX6A 1T2QL 1NCDL 1WWAX 2GIMA 3VFOA 3QEQA 3NJKA 2B2XH 1RU9H 3ILEA 3L3JB 4UV7H 4O2FA 3CSBA 4JVUA 3RNGC 3DHJA 2V7NA 2WIIB 2K6YA 1G7HB 2X2HA 3RZCC 3WXVH 4ONHB 1XMWA 1EMTL 1ET5A 3ZE1F 3ZT5A 3T1WA 3DO7A 2IOMA 3OKNA 5BV1A 2IV8A 4JPVH 2WYZA 3RCZA 5GRWA 1UCBL 3ZRSA 3LDBB 4QF1B 1W8OA 5HS0A 2IDUA 3WEAA 4MB3A 1GC1C 4O58H 5I82A 1R4MB 3C8DA 3KUCB 1BX2A 3GZNI 1SEQL 3I9AA 4OZGF 3IFLL 5EF1A 2R0ZL 2Z1PA 1ASOA 1S9WB 2FYYA 3AS8A 1D5BA 4XP4L 2P5EB 3HG2A 4FOMA 3QFJE 2HE7A 4FG2A 1L7YA 4U6HA 1A7RL 3BJ91 3E37A 1WDYA 1LDPH 3CNKA 1BVNP 4HHAA 4BK4A 4PMFA 4OIAA 2R1WB 4WY7L 4HKXB 1XCXA 1XF5L 5DWUL 3AREB 5IJDC 2NQDA 4HOQA 3KH0A 4II2B 3NN8A 3UAJC 2HT4C 4MJ5B 3DVFA 4DZ8B 3KL5A 3EHBB 4D8PB 4UWHA 4UILL 5BVPH 2V0AA 2WW8A 1CDUA 4NCC1 1MFUA 3W3BA 2KLRA 3OKMB 5FR3A 3BGMA 4GO6B 3PE9A 4PW4A 1MI5B 4KMTL 4MJIE 2OX5A 1ICTA 4TULH 3FO2B 4NYLA 4K7PH 4CNIA 1G3NB 4AP2A 1K8RB 2H1PH 1E3FA 4RMBA 2SEBB 2UVEA 4X0KA 4S10A 3X12A 1SE4A 1ZUD2 2WX0A 5FYJU 4PS4H 3GSNH 3HZMA 1UC6A 4H7VA 1FIQA 2KN4A 5HHDG 2TRYA 5T5FA 2HJFB 4JFHD 2X9XA 4UDUB 1JF5A 3V0FA 4TNVK 4JKWA 1W0YT 3DXAB 1VKXB 1H0AA 2V37A 3NEEA 2R4RH 4WWKB 1NMAL 5K1VA 4UIKH 1AQMA 5JHLL 3BZEB 1BG9A 3EW3B 2AEQL 2ZCLL 3TXAA 3P73B 2IV9A 3H9SA 3DVGX 1U92B 4KX7A 2GSIA 2XHEA 3RGVC 1D8EA 4S1SL 25C8H 3DUUB 1PNDA 1VPOH 3PAZA 3F84A 3G6JE 4LBEB 5KCMA 2K6QA 1U91A 3CVIH 4I6PA 1IGYB 3FZUC 4AJ0A 2VR3A 1HL5A 4L1SA 1NOAA 3O11A 4Z7VB 1XF2B 5KN5A 3C19A 1KOTA 3L3DB 4Q7DA 5D1ZB 1WAPA 1OY3B 1U95A 1HHHA 1YY8B 1DNPA 2D7QA 2N1TE 3SY0A 3FILA 2FDBP 3OSKA 2FR4A 1R5IB 5LBSL 4HCPB 2ZP9A 3BCDA 3M95A 3RWIA 1PD1A 4ODBD 3QCAA 1DQJB 2WTRA 3CIQA 4RWYH 3GGWA 1M7XA 4R7DB 1JRUA 3WXWH 1V1PB 2ETBA 1OB1B 3SDAB 1NC4A 3UO1L 4AQ1C 5IHUL 1OGWA 1IC7L 3B9KB 2E74C 1UCTA 4PRPD 4PV8B 4AZUA 2IFFL 2ZOKA 2VCOA 3B9VA 4ZRIA 2CCVA 1XF4B 5DMKA 1YVLA 3ZXAC 3DURB 1R47A 4FD0A 4NQVB 1AGDB 3Q69A 4Y7MA 4O60A 4JL1A 3ECVA 5FDWB 1UACL 1AP7A 4XPAH 2YBRA 2J12B 5DQDL 1ZLSH 3VGEA 2NY7L 1CB4A 5GJTH 4JRXE 2CR5A 1GAQB 3CFCL 3OGOE 2EKEC 1M9WA 2H6PA 3OJDB 3ILDA 3P3TA 5KJ4A 1U6AH 1MPAH 4ISVB 3PLYA 1HNFA 2W65A 4QOKA 3WJJA 4Y16C 1J5CA 4H8VA 2N1WA 4XTRD 2H0PA 4DX2A 1D6EB 3H7SA 4IMKA 1CO1A 3DHPA 2P9UG 3GB1A 3VXUA 3D9IA 1UFGA 1B1ZA 3RL2B 2DWDA 5D7JA 3L5XH 4HV8B 4GSDL 5AYTA 4IRSB 1I3RB 4YTNB 4ARIA 3ZHEA 4FRWA 3GE3C 3CFIC 3Q8FA 4R5VA 3IDMB 5CGMA 2DM4A 1A65A 1XH1A 2XFGB 5ENSD 3UKRG 1QFUH 4PJXA 4MGKE 3B7UX 1NUDA 3D2UD 4LOUD 3BOVA 3CPLA 2QILA 1MCJA 4WEBH 3P77A 2LGIA 2XYCA 3QR0A 3GZOA 3QFJD 1TFHA 1AO7E 1EH9A 1YQ4B 4KGRA 4P23B 1E30A 3C6LA 4LHQB 3PUCA 1KB9J 4KTYA 5TDPA 3QPQC 4J8DA 4LQFL 4CVWA 2L04A 5HI7A 3RY4A 4AE1A 3GS2A 3C08H 1AZVA 2YMXH 4WNJA 4BT8A 5B39G 3HBQA 2E9WA 1GGCH 1MH5B 3HXEA 5HHNB 3GMQB 2EDEA 4X6CA 4ZX6A 1N3NB 1Q2ZA 5JR1H 4FXTA 2IGGA 4MSMB 3FUIA 2R0WH 4P2QD 3EJNA 2KJ6A 4Y4FA 4MJID 1BFOB 2BSSA 4TVSa 2DYBA 1EEUA 1S64A 4NQCD 4F7TB 2GT9A 2HD5B 1DFBL 5D2NE 2DZNA 5EUOE 3ULVE 2GUOA 2J4WL 1OTTC 5F7LB 4Z3EA 1J87A 4XCCL 1PF3A 2E86A 5DI8A 3OXSB 4TUJB 1S3KL 1U2YA 1TNMA 1MY7A 5A3ID 4UM9A 2DD8L 2J4BA 1A9BB 2DMKA 3ARRA 4R2GD 3D51A 3LAFA 3C60B 4BTAA 3UG5A 1HG5A 1GAFH 4DX1A 4M6MH 3V0JA 1SGKA 4L4VA 4PJAA 1UJ3C 2PCYA 1NFIA 2O6DA 2ZG2A 1TSHA 2ZX8A 5D4JA 2Y0BG 4Z7WE 3L1FA 3UABA 3DYPA 1R4MI 3IXEA 1MHCA 2E9BA 3GSUA 5L95C 4XHJD 4HJKA 3FHQA 4B0MA 4F27A 4X6BB 4U0RB 4KI1A 1RZFH 5TQ2L 2P3YA 4PRDA 4DESA 4H88H 1E50A 2BZDA 2GJ6E 4XXCA 3TFKC 5DJ6B 3W9CB 3UX4A 1N0XH 3GO1H 3LQAH 3TEYA 4DX6D 2H6UA 1FDLL 1HSAB 4N0UE 5D96C 5TE7H 2NTFB 1KELL 2ESVA 5CWSB 2XNAA 3KH3A 3ZKJA 1EX0A 3NOGD 1HNGA 3KJ6L 1NMCC 1WISA 3BSZA 4DQAA 1NIBA 4AGNA 4OF7A 3BRFA 1UF0A 4WTWA 5FUOH 1LEGA 1T7YA 5D1QC 3RX7A 5J6GA 2ZG3A 4GG6B 5EUOF 1SJMA 2ZX7A 4JL0A 3ZOAA 3KYNA 1C5CL 1B6DA 2VL4A 4G8IA 2ZAGA 2HFGL 2FHFA 3ZZLA 4YDWA 1F86A 4PGZA 4XO5A 1S7QA 2ODHA 3MLXH 2FX8L 4EPSA 3HG0D 1NGZA 2KLSA 3K74B 4MSWB 4O02A 1ZA3A 4JFPA 4YOKA 5DK2B 4YJZL 4NUGH 4JRXD 3X1NA 2IY0C 2D7PA 2VH5L 3UDWC 3IFPB 3ASDA 1OT2A 3U0WL 5FPIA 1QRNE 4Z7WF 2VDQL 1W6WA 1AI1H 1KGWA 2OJZH 3EDJA 4DEWA 2FVNA 5C3TA 4HS6B 1OCWH 4FQQA 2JWYA 4HIJA 3VX0A 4BFJA 3K9OB 2BP0B 3MKQB 1FXTB 3KM1A 1FJ1A 5JIKA 1UM5L 2DWSA 4YIQA 1I4XA 1MW2A 5I1DA 1HTQA 2VSOE 2ZVNA 3IJEB 1XIWB 1WRDB 5FYLL 4L8SA 2GAZA 1CZ8L 4O51B 4X7CC 2X0VA 5FGCB 2EVIA 1RJZB 3OX8B 5I1GL 1TKGA 1KIRA 3MCKB 1S63A 1UXSA 3Q6FA 1EFXA 4Z76B 3ASFA 3GYRA 4R97B 5TF0A 1SBSL 1YG9A 2ITCA 3CFDB 1A7NH 4JY5H 5FIOA 1L9NA 3IT6B 4OLYL 5F6HI 2HVKA 4NFCA 2D3JA 2R0KL 1SLWA 5ABDE 4WNSA 2ICEB 2Z8RA 3EH1A 2LGDA 3RX5A 5JDSA 1JHKH 4LCYB 4PW9A 3OWRA 4X7FC 1VEPA 5DMIH 1DP0A 2PXYB 3DROB 4ZAKD 3FFLA 1DVSA 1TJGH 3VXPA 5K9QI 1DUZA 3MYVA 4M4RA 3KLAA 2VWEE 2Z91A 2ONQA 4HXDA 2PCPA 2DWQA 1WXMA 3QO1A 1QSFA 1P1VA 4XNQA 1QQRA 1E5AA 1X5ZA 2H6FA 4TUMA 3B2VH 1I1AA 4L48A 3VDCA 2BT6A 4GMVA 3GLDA 1CD8A 5AYUL 3KEDA 2YD4A 1ML0A 2P5WA 4E85A 2BSEA 3AXIA 2O2VA 4B60A 4ZHPA 1RAMA 4MDIB 3ASOB 5IMOB 1IGML 4P46D 2O5ZH 4GAYB 5E4IA 1DLHB 2AQ1B 2HKFH 2NY4B 4ZJ9A 3SOBH 4C47A 4WK0B 4OAWA 2VABA 1NDMA 2AJYL 3GMRB 4G6JL 2ETWA 1EHKB 4JDZA 1JXGA 4HIHA 4R3SA 2LFIA 2A6IB 3CC5A 4AENA 5T3XL 1UWEL 3ABLE 2WQ7A 1L9MA 4XP1L 1BBDL 3V0HA 4ZI8A 5FHBL 4EO5A 1EGJH 1WXQA 2M63A 1V3LA 2AI0H 2W1NA 4M7ZB 2ZGGA 4OGZA 5AAWC 2NDFA 3II1A 3V6BR 5C0JB 3H54A 2ATPB 5HDRA 1IIIA 3DVIA 4BA8A 1K8KG 3CN3A 3QC6X 2HVBA 3VXMA 3GMMB 4YTPB 4UNTA 4U7KA 2GJ6D 3D7PA 3F12A 2FX9L 3AY4A 2B6CA 3ZZ1A 2CIKA 3BQUB 2HKHH 4NUJB 4WO4C 2G75A 5B1AB 3SKOB 5KTEH 5JHAA 4GLRH 5GGSA 1O6SA 2DWTA 2G9KA 2JLPA 4CC1A 1RULL 5IT2H 2WDTB 4HX1A 3FRUA 3Q8BA 4V1DB 5AVXB 3ZL1A 1V54E 1DJGA 1S5HB 3MV01 4WI5A 2CWRA 2G9HB 4UQIM 4EBAA 1CICC 1FL3A 3IF1A 5CUSH 3UBXB 3DUSA 1AG6A 3VWJA 2HT2C 3RO2A 5J11B 1OWRM 4OZAA 3RTQA 4LTUA 2CMRL 3M6DA 1WITA 4HJUA 1PQZA 2N4IA 4OGQC 3RU8H 1NAMH 3UYRH 1B2YA 3L1GA 2NQCA 4POYA 4GDLA 3CH1B 1QKZH 3FB8A 5JPMC 3TBYB 1QYGL 1JZDC 1H2TC 5CS7A 3AG3B 3VO0A 4OJEH 4J3TA 2OKMA 3JWNH 4XXDA 3TJEL 4G83A 2XVLA 3FBQA 1PKQE 2UZYA 4BERA 3PWNA 4WFFE 1T5KA 1K72A 2VW4A 2PO6A 4Q97A 5IMMB 1ZT1A 1VEMA 4QRTA 4XZUA 1IV8A 5AUIA 2Z92A 4CBPA 4DW2L 3DJZA 3OKEA 4L37B 3V2OA 4FTVA 1EO6A 3EYVB 3QUXA 3AS0A 15C8L 5AW9B 3L3HB 1K8DA 4N8VG 2JI2A 4GMSL 2Q7YB 1S7TA 4Y2DB 3VMNA 3WFCH 2ICWI 4CGUB 1TU2A 3I75A 1A70A 4CDMA 1Q9OA 3RA7H 4NNJB 2UWEB 2EUXA 3OMAB 3NRFA 5CMAA 3PUKA 3P4PB 1J8HE 3CSTA 2BIPA 4N8PA 4XOBA 2Y4SA 3EF7A 4QEGA 2C7UB 3VMPA 4YHLL 3IJ9A 3JSVA 5DFAA 2AMUA 4OZHE 5I15L 3UT7A 2DBJA 4L9DA 3UEQA 1ZLWH 2Y9RT 3QDMB 1Z5YD 1G5GA 4M3KB 5LB1A 2AF2A 2X4QA 4LVOB 3F6JA 4RGNE 1B0RA 4WFHE 3FFCA 3NCMA 4X5RA 5D4IA 2A9BA 4MMXB 2BY0A 3MSPA 1K9TA 2RACA 3WJLA 3LXCA 2YFNA 4TVPH 3Q2VA 4JA9A 4M1DL 2Q1EA 5CU9A 4YX2L 3CFTA 3RVWC 2FCBA 5JOFB 4KFZC 3BEVA 3S88H 2WYHA 3VFVA 2NTSA 5G4NA 2HLFD 1PYWB 1W3BA 3AJ7A 1V3MA 5GGQH 2HB0A 1EK3A 2MOQA 3TV3H 2NLJB 3HZKA 4C4KT 1QR1A 3GSVA 3K1DA 4QXGL 1I8IB 4ZS6D 2R59A 1P6AB 4P59H 1EJOL 3E32A 1JPEA 3HNVL 2XKSA 1T1YB 2QJLA 1MVUB 2MH4A 5HFYA 4LIQH 3QAQA 5J12B 1ORSA 5HHVH 2EO1A 1FFOB 3HHRB 4WHTA 3LKOA 4NKDB 3CZUB 1OHQA 4W9HA 3SHFA 4G1EA 2BP5M 5DRZA 3JTSB 2R29H 1QQDA 1E43A 3D9NA 3BAXA 1U8HB 5AVQB 3GUTA 3KWLA 4HLLA 1OALA 5CCJA 2D3VA 5BO1L 2VDNH 4OZHF 2V3SA 4JFZH 3BT0A 5CZKA 1PIFA 4YXHH 4WJNA 3BI9X 4XP6H 5HHOD 1MCWM 5GXGB 3PGDA 3DTDA 1DBKH 3AQYA 5I6KA 5IBLD 1KEMH 1TJIL 5IVXB 3HNTH 4N26A 4U1HB 4GA0A 1LO5D 2C9PA 1I1FA 4OLZH 4I17A 2YNQA 2I2OA 3BIKB 4K8RD 1JZ4A 3KNBA 4DGWC 2XZDG 4Z0BH 4MAYB 3BG1B 3MLPA 2K1MA 4W9JA 1CXLA 1RUPH 4ALAC 4PSRA 3I3NA 3TYFA 5I19H 4LSQL 2LAAA 1OT8A 1LYQA 2VXSH 4GFXA 4H2AA 1PZ3A 1TLMA 4UF7C 2IAMC 1MWAA 4HC1H 2FL5B 3KSLA 2OXGB 4PJFF 5C7XL 4TSSA 4EI5D 1GB4A 1VSCA 2FCQA 5SWQB 1FVEA 2L7UA 1T03L 1K1BA 3HG1D 4HPMB 2NW2B 3FN0H 5J13B 4W9IA 4OBSA 3PCYA 2OR9H 3QAZB 2R1XB 1WR1A 5EZPA 3SCMA 5D2LE 4R4BB 3VFWA 4AQEA 3UTSA 2UZXB 3BVMA 2MQGA 1RZJC 5GS0H 2YRPA 3TZVC 2Q3XA 3MZGB 3T8VA 4G23A 4I7ZC 1AD9A 4JGUA 4DLQA 1Z5LA 2DM3A 3G08B 5MEPB 2IH3A 2KM4A 3C98A 5CJOH 3QA3B 2LNIA 1XTMA 3M17B 3QI9A 4HKBB 4JCMA 5CM1A 1J48A 1XR9B 2IO0B 3EFDL 2NR6A 3NCYS 4N0RA 1FLRH 1LO0L 4BWTA 1DL7L 1DBBL 5DSCA 3TWCH 3NESA 3CGTA 4U3HA 2X2YA 2FJGA 3B7BA 3D12B 5HYSA 4MVBD 4HUUB 4HVBA 4PYHA 3ZLQC 4A6YA 4J8RB 2DQGH 3BCFA 1NDGA 5C6TH 3ZDZB 4U1NA 3GI8H 3GMPA 4AJWA 1FSKB 3AQDA 1TEYA 2R9HD 3TGXA 1RPUA 2LRUA 2F61A 1MCBA 2V4HC 1PDKA 2DEYX 3IRPX 4F1PA 5CSBA 3CHPA 4RGND 1A1OA 1F3JA 1MIEH 2X12A 3SDYH 2D03L 5EF0A 4JPKL 4WFHD 1M2VB 1FN4B 3KPOB 4GXVL 3RGBA 2VZVA 1GCFA 1ET6A 4OCXH 7FABL 2B3AA 1P7KA 4GRMB 5IUCA 4PWIA 3E2HC 3W5UB 4XNMB 4LNOA 4X98B 1U8QB 4M3HA 1C7SA 2XN9C 1DJIA 3NIGE 4KVCL 5BRZA 3LKRA 1JGUL 4Q9QH 5DCNA 5LG6A 1AXSB 1C8QA 1UH4A 2WGNB 1GGYA 3EG9A 5E23A 3VU1A 1A4KB 4XO4A 4U3SB 4UIMB 3VG0L 1K5WA 4PFEA 3VI4B 1D9KA 4P48A 3FCSA 4BGLA 3KE0A 1AS8A 2Z31D 2V9TA 5I5IA 1HK6A 1OCOB 3VXSA 2INNE 2BX5A 5FWQA 1KXQE 2DM2A 4UI2A 4C56E 1YYCA 3O0RL 4K07A 2X4NB 2BTEA 4UT9L 2N1VA 2Y7LA 2N9PC 2BEDA 3K9IA 4M7LL 5BV7B 4FNLL 3VQLA 4QJ5B 1JIBA 1ONQB 1OQQA 4GOSA 3C6SA 2LD9A 3CKCA 1A4JB 2WLHA 4OM1H 1JGDA 1U8NB 1JYVA 1A1MB 1XLQA 3MOAL 5HI5C 4A2DA 3NJGA 3V0WL 1L9SA 3ZXVA 3ULEG 2NYKA 2PETA 4GKNB 4OAUC 1MCSA 4KWUA 5KUMA 3GSRA 3CZGA 1T20B 5F8RC 1KBKA 1MZYA 4HIQA 1KEGH 2VXQH 3V30A 2V7HA 4KXKB 2J4DA 2OVBA 3EADA 3EU9A 3VE0B 2BQQA 2E27L 1K4DB 2ZAHA 5LX8A 1TNNA 1DDHA 4N2BA 3I6SA 3TVMB 3G5XB 4I3SL 3ZE1B 3LRLA 4CN6A 4P4KA 4FZ8H 2JY6A 2D7OA 3O65B 3NIGF 4NIKA 4OVVA 3PGCB 1KWGA 3W39A 1P5UC 1L3NA 4YHKH 3BYYB 1DBMH 2A9CA 2VMDA 4A20A 3MRFA 1ULVA 3JV4A 1BMGA 3LZLA 4OZGB 4IIQA 2X3AA 2K7PA 3BH8A 3OJVC 3ZRCA 2P28B 3CSGA 3OKYA 1P5VA 1G9HA 2A74C 5CLWA 1BA9A 3BESR 5KYXA 1FVCB 3DOSB 3HMWH 3QORA 2DWZA 3Q0HA 3D39D 1AYFA 3FAWA 1PLBA 3JWNG 1N4RA 4CN1A 2D3GA 1PLGL 1MJUH 1JI1A 1G5AA 4NQXA 1H8OA 4PRPB 5IREA 1YEHL 4MTMA 2L7QA 5HHQA 2VLRA 1NAKH 5DJDA 1FXIA 4NO5B 4BFBD 1IT9L 1NGYB 2W0PA 3BP7A 2J0KA 1KGCE 2CQVA 2EQXA 5LUMA 1ZHBB 4YZWA 1Y8MA 1G9NL 4FX5A 3VFPB 4LSVL 3UOAB 2WQXA 1ASPA 3QXAA 2WX1A 4LKCB 3LZNA 1KB3A 4FQCH 1TNOA 3OWEA 4G6FD 3QUYC 1NWPA 1O1SA 3ORJA 2E9IA 4XR8C 3V55A 3QNZB 2H6OA 1UH6A 1TVDA 2VGXA 4HJSA 4ZFOB 3ZN6A 3HR5A 3UKUG 4Z77A 2CJUH 4HZ1A 2AXGA 2HLAA 1TS3A 1VFUA 1TNYA 2VXTH 2MHAA 4UUJB 5FKPA 1OM3H 4Y8DC 3QDAA 2QPUA 2CLVB 1BLNA 3L3IB 4RMUA 2CU1A 2BVQA 3OHXC 4WLCA 2OCFD 5D7KE 1JUQA 2A9NL 3D2UB 4YBLB 3E4BA 3GNMH 4JMNA 2DQTL 4LBAA 4NFDA 3ZGQA 1BIIB 1WDAA 3QFJB 4PLJC 2B16A 1VF5C 3FF8A 2B20A 5IQ9B 4GAGH 3ILQC 4AH2B 5KYYA 1FVDA 4NN6B 3P11H 1FO4A 4B9IA 3OJ2C 4LEBA 4MCZB 3N41F 4LNNA 3VFUB 1ZVSB 3H2QA 4G82A 5DZPA 1Z9SB 5JIPA 5T1LA 5B4MC 1FG9C 2RDBC 3DHGC 3LDZE 3N43B 3LVEA 2H2PD 4G7SB 1NBYB 1QO3A 4YHYB 1BEXA 2XKUA 3IGLA 1SVZA 3BN3B 3KYKL 1L6XA 4C56D 3SEBA 3O6FB 1V8CA 3DX8A 4ESKA 2ZQKA 4FFWD 3WJMA 4MJIB 4E41D 3TURA 3T6WA 3BP4A 4GAFB 4N0YH 4UINL 2YMOA 1BM3H 4ODWB 5CLXA 2IGFH 3KW7A 5F97E 4L18A 1Z5SB 1XSOA 5L9DH 4KXDA 2VDPB 4P5KB 1ZSHA 1GKEA 3CBJB 2FEZA 2B5IB 1UA7A 3ZTNL 3FUKA 3GBML 3SYAA 2VM3A 3MBWB 4L3CB 3Q6BA 5HKHA 4HWNA 4H25A 3EYOA 4OJCA 4RETB 4CILA 4QTFA 4R2GB 3ARVA 3GJFH 1L3WA 3PL6C 4OZFG 1CFNB 4BBNF 1P84J 1VZGA 4BA0A 3D0LB 5ANHA 2MCPH 3MAWA 1ZGLB 4F7PA 3I2CL 4Y9CA 1CIUA 2WO2B 4J1UB 3G6JB 3MUGA 4GUPA 1TQTA 5IB2B 5IKCA 1T2JA 3KWWA 4Q58C 3EGXB 4G6AD 4HJIA 5FM8A 5LDSA 4TTGA 5EU5A 3T77A 2BCKB 4MASA 1BXTA 4M62H 2O6VA 2H89B 4OT1L 1PAQA 1DVFA 4JQIA 3LQAC 5DUPH 3WN5A 2Y7MA 4X5WA 1OAYH 3V4PB 2HMID 2UUDK 3RG1C 2IBZX 4PJEE 1M71A 4YLBA 4ICUA 2OSLB 4F93B 2GBUA 4FU3A 4WQMA 2N4FA 1JD7A 2P8LB 4KKLD 3RN9C 1Z9LA 1EEYB 2NSMA 1ZV2A 4CJ0A 2LFGA 5E2WH 3HZVA 4HCRH 5KBMA 1ADWA 4U8VD 4NN5B 4A8XC 2VITB 4K0RA 1BJ1J 4XN8A 1XSJA 4KDTC 4S2SB 3K8MA 3RUGE 3U9PL 1C1YB 1SJHD 2V3NA 5H35A 3BLBA 1CLYL 1RUQL 4S1RL 4KX6B 4R4ND 1KGCD 3EJUA 1W91A 3K72A 1HCZA 1R3KA 1U8CA 1URZA 4W70A 4DPRA 4KQ3H 1XXFC 3ZR6A 1AZBA 2EDNA 5A3IC 1KTBA 3BWZA 4HB5A 1H5BB 3IAS1 4JRXB 4HWIB 4WEEA 1JWSA 2VLME 5A2CA 1Z3GH 2VIRA 4MXWL 4XNZC 3NVZA 1TQSA 4ICXA 3LH9A 3FTVA 3HE7D 2F58H 4BFFA 3CR3A 5EN2B 2IQAB 4M6AA 3AN1A 4BE6A 1OE3A 2E7LA 1ADQH 1M3JA 1QSEA 4K71C 4QRRD 4E5XA 2O6CA 3LHPL 7CGTA 2DYOA 3AEGB 4MLPA 4HJ0C 4LSUL 4UZGA 2QQNH 1CLOH 4PJEF 5DU7A 1CTNA 2JKXA 3VNZA 3TXMA 1KN2H 3UINB 2X7LA 5D3DA 5KHOA 1S7RA 3SR6A 5EHFA 2VDMB 5ITBH 3ECBB 1FAIH 4JPQA 1AO7B 5DYFA 1XXGA 4Y5XA 1SY6A 1HKFA 4OLUH 1M7IA 5IM7A 2FE0A 1A2YB 4GTQA 1IKOP 2KXPC 4X7TA 4DUIA 3RUGF 4OVUA 2F54D 3SKNB 3X3GL 2FK9A 5T33L 4BFEA 1REIA 2VQ1B 3CVHH 2I07B 5ANME 4UWLA 1J1XH 5EUKA 3WNIA 5B1JA 3IAGC 4YO0A 2DIWA 5T1JA 4ZAKB 5L7XL 1RP9A 3MLRH 2WB1A 1ZV5A 1LGVA 3QUKA 1N6QH 2CGZA 3N85L 1CT8B 5J4MA 1QD0A 3ZTEA 1PG7L 1DN0A 5CGYD 4AMKH 2XPZA 4EN3C 4EUTA 1UWYA 3TFBA 1E2ZA 1E5CA 2M56B 3FQWA 1TEFA 3ARZA 5JHDA 1FZJA 2DY2A 5D2NB 3CDGB 4I85A 5EUOB 3IKCB 4PJGA 3CG8A 5EIQA 3UZQB 4XX1E 3SBTB 1GOGA 1B0WA 3FSZA 1E4XL 1KIUA 2CLZA 3LD8C 2QGDA 3B2PA 5GS1C 3VGFA 1XO8A 4PVNA 3KBPA 4MRBA 5L2KE 2XT1B 4QTHB 5KYUB 3WALA 2VR8A 3VXNA 5K39A 2BB5A 3E9TA 1E4KC 3LKSA 4Z7WB 3L9YA 3BXNB 3NFNB 3IVFA 3HRZA 1EV2E 1CXKA 1RSFA 4WUKL 1E65A 1FGNL 2DLFL 1LQBA 4ODSL 3TO4A 2MTPA 3VTMA 5AN8A 4A7QA 4BFKA 3GZ1A 3JXAA 2Y23A 5LCVL 1ZHLA 3GTTA 4YMPA 3VB8A 1RZGB 2GJ6B 1JNLH 5D1XC 3WHXA 3TT1H 1YMPA 3F7QA 4NP4H 1R1CA 4ILDA 3RYMA 4XP5H 2J0JA 2I9TB 4I77H 4N0UB 2VGEA 3P0GB 3AECB 2RH0A 4RGTA 4R7VA 4MGIE 4LPCA 2V5RA 3BVWA 1S9YA 5AARA 3EYFB 2RKKA 1PGRB 3BFWA 5FO9A 1AZCA 1AH1A 1DE4B 3KSQA 3BWAA 1XGUB 1ACYH 2R56L 4WJG3 2HE0A 4G7YL 1TT6A 3MVSA 4LPXA 2RBLA 4HG4J 3IWVA 1Q0WB 3ARXA 1FO0L 3TUOA 1WZ1H 3GBDA 4HZLA 4JLRB 2J57A 3SO5A 4OR1A 1S9VB 5FQ6A 4P46C 4LZKA 3JWNC 1N95A 4ETYA 2R0LL 4MGXA 3IXAA 5FW7A 1Q94A 3WFDL 3WAKA 4NPYA 1BAFL 1E3XA 5ALBL 5E1GA 3HZYA 3LPFA 4ZMAT 1M05B 4NAWB 2FEEI 5DJ2A 4WK4B 1E28A 2VLMD 3RNQB 3KLDA 1QRNB 3GMLA 2WZPA 2R39A 4D3CH 2BVUA 5ETUB 4W9EA 2CKBL 4X5XA 2LV4A 3IVKB 5FEBA 1N2RB 1Y6MR 2FJHA 3SFXA 2GITA 2P46B 1WA1X 4Z0XB 1ITBB 4PHXA 4MBGA 2NXZD 3LS8A 4LPVA 1XGPA 4W6XB 2BS8A 1KCSH 5A6CA 1YEIH 3LN9A 2YHEA 1RURH 2ETAA 2HTKC 4J3BA 3KVFB 3RWHB 2WUCH 3S97C 1U8MB 1B0GA 2BNUA 4I3GA 1WJNA 3DEPA 3WSQH 3QISA 1CI5A 2WP3T 3NSCA 2V5YA 2B76B 1RK1B 5HY9A 2VJXA 3NA4A 5K9JL 5ENPD 2HT3C 4IBTA 4F9LC 4WFEE 1IPGA 3A4EA 3ZYQA 5AVVB 4Z7OE 1FNUA 2W60B 3D18B 1CF8H 4J28A 1JZ8A 2EXTA 3K6FA 5D7EA 4LCCC 3T0VA 4LCWD 2K7QA 4UM8B 1RI8A 2B3IA 4M8MA 3D25A 1I1YA 1UM6H 4KNTA 3SPVB 4XMZA 3B9EA 5AZFA 3HDXA 3NFPB 2EYRB 3OAUH 1V3KA 1JTPA 1UUNA 1W72L 1JPSL 3BUAA 2DQHL 1CGVA 1I85A 2Q6WB 2Z8SA 4V11A 1GOHA 3MRRA 2R8SL 4NQQA 4R96B 5HYEA 1VHPA 1M6OA 4ZPVA 4Y4KD 4R4FL 3U30C 4BH7B 4E9VA 1X9UA 1WGYA 3LEXB 4GGQA 2PWEA 2XV2A 2DW5A 4GY4A 2FUHB 5D7LD 3SZKC 2R69H 2ALAA 3BDXA 1BGXH 4KKAD 2A6JA 3V6FB 3FW6A 4J23A 2VLLB 3R06A 3VA2C 4PQXA 2NPTA 1NTDA 3ABLB 4GS7B 2BOCB 2EICA 3KBFA 3MR9B 3O6KH 3CFMA 2ZONA 3SHSA 4ZX4A 2WUBL 5HHOB 5E1IA 3CX5J 2A3TA 4JVPA 1USQA 5BYRA 1GJWA 3ZRFA 1MFCH 4NFBA 1FIGH 2UZPA 2YPLE 2YWYA 1LO5B 4MJ6A 4UQAA 5D71H 5DD0L 3VR8B 1JD9A 3A3YB 5EYPF 4Z7OF 2D3BA 1DCQA 3BKJH 1NGWA 4QXWA 3KS2A 2RJMA 5F6IB 1J0KA 4LL1A 1RFDH 1JCSA 1IM3D 1IQRA 3JUIA 4O2EB 1NL0H 3G04A 1VFAB 2ZWYA 4JFOA 4PCYA 4ZOCA 5ICXB 3U6XS 4LASL 4GXFA 1JPTL 3UAFA 4C8XA 1Y0LB 1ZK9A 3U6RA 8FABB 4QHMA 1V54B 2BWIA 2MQJA 2MQ0A 4N2HA 2HLFC 3QWOA 4TSCL 1XCTA 4ZMQA 2ZWLT 3IG3A 5GSRA 1LMKA 3E3QE 1FM0D 1SJVA 4L1LA 1P4IH 4H0IA 32C2B 4FQIL 5DJYB 1VZIA 4UOW0 3RPBA 5KS9E 3OAYK 3CFNA 5AW8B 4N9F4 1HXIA 2ZIRA 1MLCB 1XQ4A 2AXFB 4NZJA 4ONFH 4MMZB 4QI3A 4DSYA 1KTKE 1T0YA 5DPSA 1JZGA 1LP9E 2F7IA 5KSVB 5GS0C 1QOGA 1A8ZA 1PKQB 3QQ9D 2O26U 4TNGA 4ERSL 5JXEC 4D0BB 2BO0A 2HAZA 2YN3A 2BY1A 3TBLD 1Q1OA 1PKOA 4JO4L 6TAAA 3H4HA 4ONHA 4TKNA 1KPRA 4L8BB 1JZHA 3BH4A 4BFIA 3VJ6B 2DQIL 2IFUA 3DVGB 2WCPA 1QI3A 4QF1A 2KFKB 4FC8A 2VTFA 3NCYP 5GGTL 4FLBA 1FFTB 4LSTL 3DX0A 2F2HA 3UTMA 4W9DC 4FFYL 4D0DB 1E8WA 5TGBA 2G0KA 2KXJA 1J8HB 1CL7I 1QI4A 1UATA 3MBED 3NSJA 4OZHB 3UERA 2P42B 4IDIA 3BWUF 3FQXA 4QXUL 5IBUG 3RLSA 2P5EA 4HSAC 4V33A 1AMYA 3OKOB 1MAKA 1MF2L 1A6VH 3FWVA 2F53D 4RGNB 1MZCA 3L5WB 4PUBL 2H7WA 4QXTB 4WFED 3RL1B 5I6XB 1WRIA 3L17A 3N3KB 1I7RB 2Y6TE 2R1WA 2FECI 3NCCB 4HKXA 1EWCA 3AREA 3K9PB 3LEVL 4WHYG 4EI5C 3S35H 2PZIA 4LFHD 5KS9F 4MAUH 4MJ5A 3MLUL 3O3AB 2CPCA 3B9DA 5IROD 4D8PA 3Q5MA 1WUNT 1XWVA 3RVVD 4DKTA 4AQ7A 1EAPB 4XPBH 5FOJA 2Z6FA 4IOSA 3NOCD 1IRAY 1LP9F 1QUPA 4FQLL 4HEME 1TKWB 3OKMA 2OVFA 5ADOL 4ODHH 4AQ1A 3RJDA 3RWCB 1JRHL 3FO2A 4L9PA 4PB9L 4PBVC 3EA6A 3UC0H 1S1QB 1QOBA 2OEVA 2OAAA 2SEBA 2PCFA 5DWPA 1RW2A 3GYZA 1HEJC 3O2VL 2Y5BB 5ICZA 2FWSA 2ZP0T 4JN2B 4AEHL 2GW1A 4J8YA 4TUOB 4I3RL 4N0FB 3IHYA 2WTPA 3U79A 3RMKC 4UDUA 2GB2A 3T4AB 1OAZH 2X70B 2B1HH 2ZOUA 3DXAA 1IM9D 1VKXA 4M7JH 4WWKA 4FFZL 5K9QG 2WLIA 4BSWA 3SQOH 4MVBC 2PM6A 4DKEH 4BD4A 3OKKB 5C0CD 5KVDE 3ALWA 3BUDA 3GM0A 3QRLA 1U92A 3GFUA 1Z3YA 5JQ6H 2XZZA 4Y16A 1BEYH 1NH6A 4OYSA 3A21A 3STZB 1N61A 3KYDD 3DUUA 2ZUQB 3IDUA 4JJ5A 1JP5A 2R2BB 4HU2A 1NPUA 2AKRB 1KYAA 1B9KA 1IGYA 3I5PA 1SYVA 2BNQE 2E4FA 2H0FA 3IJ7A 2YPLD 3N1GC 4Z7VA 3L3DA 5D1ZA 4OQTH 1FG2B 2J08A 4YDIH 4XN1A 5AOJA 2WO4A 5C1DA 3WN6A 1YY8A 1DSWA 2CDGA 3HNSH 3IE9A 3MKKA 4ILIA 3RSEG 5AW1B 1XZ0B 4GG8B 2X09A 2B1AL 4JZJB 1R5IA 3UT4A 2V5MA 3BWUD 1NMBH 1OANA 1X5JA 1NGQH 1DQJA 1WJ4A 4K5LA 3UP1A 4GW4A 3EFOB 1V1PA 5E6OA 3SDAA 1OB1A 4YEFA 2A0LC 2FULA 3GE8C 4I9EA 1IXVA 4WF7A 3B9KA 1RP8A 5EX3A 4TPRL 4KO6A 3UP6A 4RG9A 3GDBA 3O3UN 2NY6D 4U1GC 4X5PA 2Z31C 3HA0A 3Q2AC 3H3BC 2ACZB 3E1ZA 4ODVH 2J55A 4N25A 5DJCB 2EIME 3DHHC 4A7VA 4QNPE 4U31A 4AK2A 3DURA 2VLJE 1L7TL 3LNEA 4NQVA 4GMRA 5L83A 4ZFHA 3M8OL 5FDWA 3L7FB 2QGBA 4JL9A 4C7ZA 4EXKA 3EJSA 2AV7B 4PLOB 4YDVA 4LAJH 2OYPA 4BCZA 1OCRB 3OJDA 4XN2A 4M6NL 5LQBH 3LEYL 4ISVA 4JWSC 3LV3B 4KI5D 5ILTH 1FFNB 2XZTG 3O4LE 1IQDA 1HXYB 2Y06L 4N6RB 5IF0B 1D6EA 3FO1B 3BK1A 5DHXB 4PJCE 1RM6C 2ZXEB 4XP9L 4C80A 4CYMD 2DVWA 3RL2A 4HV8A 3O2DL 4ZMLA 3OG6B 4IRSA 2X4PB 1I3RA 2CA4A 4N2LA 1TJFA 3R18A 1AY1H 4ZUVB 5BZWA 5KJNA 3IDMA 4G1MB 1XT9B 2IFGA 1P9MC 3CSFA 4UI9C 5MEOA 1TTAA 2BM3A 1S7VB 4KXZI 5C0GB 4IM8A 1Q72H 4P23A 1LK3H 3LKNA 4M1GH 3G5ZB 4QWWC 3GI9L 3WLBB 5IJKC 1PY9A 2AXHA 2K3TA 1KBVA 1LVEA 4H1LA 1UG3A 1UZGA 5JH5C 1P6FA 4PR5B 4YVNA 1HWWA 1MW3A 4JO2L 1A14H 1CVSC 1NEZB 3H85A 4IGBC 4QR7A 1S3SG 3HAEA 1R4NI 5LGHH 4QNPF 4YGVA 3NIGB 3SBRA 3QZWA 4HOUA 3U36B 1KXTB 5BOZG 1MH5A 3GMQA 3QWRD 2J42A 1N3NA 1XGQB 3SYCA 1THAA 4JPIA 5HHME 2PPAA 1BFOA 1GZPA 4PM1A 3VQIA 4ZS7L 3IGKA 3HFFA 4LPTA 3L95B 2VSMB 3WANA 1DTUA 2X6BA 4ELMA 4HF5L 1Z9NA 4G3YL 4C56B 2EDXA 1S7WB 3GSOB 2UXTA 1A7PH 4E41B 4PJCF 3AEDB 1XXDC 4TUJA 2X4SB 2NT0A 2DKSA 2EXYC 3F00A 5LFAA 1G7QB 1M7UA 1L9QA 2OOEA 1HXKA 1VLXA 4A1GA 1CU4L 3BVUA 3UDWA 1H0DB 5F7HA 3VW3H 2BVOB 1GS6X 3WAJA 3FRPG 3CJJA 4GT0A 4HA1A 4L4JA 4OZ4A 5SX4I 3LZFH 3FC4A 1VD2A 5CHEE 3HVEB 1QFHA 2Q20A 1T22B 5H37A 4D94A 1DANT 2NQ3A 4MH8A 1AIFB 4X6BA 2BNQD 5D7SH 1NSNH 4QYOA 3MREB 5DJ6A 3MZTA 3M88A 4ALAL 1R6VA 3KL0A 1HYRC 2LHDA 1KDIA 3QG7L 4JR9H 4UANA 5GGTA 4WTQA 5A2IH 1KUMA 4KKJA 1HSAA 3HMXA 1B9ZA 1IIKA 2BSRB 1O7DC 1M4KA 1EU3A 2JQRB 3UYOD 4CT0A 3ZDXE 5L6YL 3NS8A 3HN3A 2J4XA 4XAWL 2HX9A 3MNZB 5J9PB 3HM6X 1ODUA 3GPEA 3EYSL 2G3XA 3WELA 3NJJA 5IVNA 2KJHB 3E38A 1NEPA 4KHXH 4NKOB 5EC1B 5KJRL 4WNGA 3DRTB 2WMOA 3LKPB 3N1FC 4WCYH 2H2PC 1UD7A 3MOBH 1JE6A 1WFUA 4BUGA 1RUKL 4XPTH 3K2MC 5I26A 5B38G 1RZJL 4GUOA 4DZBB 4JLCA 3LZOA 1BWWA 5F44A 2M1MA 5CSZB 1WR6E 3D1MC 3OLDA 1STEA 4QRUA 2KWVB 3KVDD 5GRUH 5DK2A 4C83B 1X44A 3WY1A 1QOKA 3JXIA 5CINH 1SJHB 3GJFK 3E8UL 4AYGA 2B2XL 1RU9L 4HT1H 4UV7L 3U2SC 1UB6B 1ZEAH 3KPLA 2NYYD 3QJXA 7TAAA 1SDAB 5KSBA 4GRWH 2JKWA 4S0TD 1AVAA 4ZW8A 3WXVL 4HS6A 2E75C 3DRAA 3S4SG 2OS7A 4JPVL 2BP0A 1CC3A 4TYUA 2P9LG 2R23B 5AFAA 4Q2JA 4ZD3H 1YQVL 5IOKA 2YRZA 3IJEA 5L2JA 4FHKA 1XIWA 3HE7B 2P5PA 4LLYB 3I3BA 3B5TA 3G6DH 5IEKB 1HJBC 2JNZA 3MGTB 2XVGA 5ELIA 2R02A 5MHSD 3U9UB 5AAWA 1RJZA 1E9PB 3OX8A 2LLNA 3ZDXF 2W0FA 4G6AC 4ANXA 1QWUA 4MDJA 2ZSVA 4LRNH 2BOLA 4PY7B 3CFDA 4HKQA 5CHVC 4U8HA 3U7AA 2WLLB 3MRKB 2RFXB 3I6LE 3MC8A 1D5ZB 4PY8J 5H94B 1LDPL 4ZMZA 2QDFA 2Q5WD 4GQRA 4WO4A 2V1YA 5EU6E 1EANA 2ICEA 4QIRA 5HGBA 3ZKSD 3Q3GB 1ETJA 4NN7C 3UH8A 1IYGA 5EFIA 4UQZA 2PXYA 2UWJG 2UXFA 1CD9B 2W82A 5ERWB 2RAMA 4NC2B 3EGDB 5BVPL 1HJCA 3I3DA 3KWXA 1I8MB 3H53A 3KYCD 5E9DA 3MRIB 5HHMD 2KUTA 4IMLA 3HI5H 4PVMA 4P8QA 5HD8C 2DWYA 3FU3A 4TULL 3TNNB 4K7PL 4YBQD 1J5OH 3VD3A 4MEMA 3MC0B 2H1PL 3CVPA 1AKJD 2N7BA 5JPMA 3AKJA 3FO9B 4DJMA 3CFKB 3PSEB 4MDIA 5IMOA 1BQLH 4MJSB 2XQBH 4PS4L 3GSNL 1G0DA 1DLHA 4GAYA 3MYZA 5CN1A 1IGTB 2NSQA 1A5FH 1VERA 3GMRA 4FQHB 4XN9A 3UEZA 4N2MA 3RAJH 3P4LA 4EVNB 5I4DA 2KWDA 4UQ3B 2ENSA 4JRYD 2A6IA 4AQAA 2R4RL 2JRIB 4HCFA 2GSGB 4UIKL 3QEQE 3ULUE 2BK8A 2BLFA 3IMUA 1U93A 3ZQ4A 3R8BB 4FJ6A 3WKMH 4KK6C 1KGYE 3FCUB 4E0RB 2OXHB 4XN7A 1D2PA 2LXCA 1F4XL 1UW4B 3UIOB 1KLUA 3MI6A 2NY5H 4EUPH 5BW7A 25C8L 1FE8H 3HEIB 2QMKA 5E6IC 3CVIL 1TMQA 4F33A