3VTXA

Crystal structure of mama protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
181
structure length
181
Chain Sequence
TTTIYMDIGDKKRTKGDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAVKYFKKALEKEEKKAKYELALVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Inter-phylum structural conservation of the magnetosome-associated TPR-containing protein, MamA
pubmed doi rcsb
source organism Candidatus magnetobacterium bavaricum
molecule tags Protein binding
total genus 75
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13414 TPR_11 TPR repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vtxA00
3TAXA 2V5FA 3JYSA 1W3BA 2LNIA 2XGSA 2HO1A 2C0LA 4WNFA 1WAO1 4GA1A 3U3WA 4BWRA 4W9RA 4ABNA 4U04A 2Q7FA 4G2VA 4BT9A 3LKUA 2VGXA 3MV2B 5G04C 5C1DA 4JA9A 2Y4TA 4UQZA 4H7XA 1OUVA 4NQ0A 5KJNA 4J0UA 4JA7A 2UY1A 2XPIA 4HOSA 4WNEA 5LCWC 3Q5MA 1P5QA 4WNGA 3OXLA 4NRHB 3GYZA 4G25A 3S7BA 2PQNA 4JHRA 2KATA 3S7JA 3BEEA 2HYZA 3MV3B 1A17A 3VTYA 4AY5A 5JJTA 2P58C 4KYOB 2HR2A 4UI9K 4N2QA 3LY8A 1TJCA 4HOQA 3CVQA 4N3BA 1WM5A 4XI9A 3HYMB 1HH8A 2XCCA 4CGVA 3IEGA 3ASDA 5KJMA 4J8EA 4AM9A 3Q47B 5FZQA 3QWWA 3E4BA 2Y4UA 5JJ7A 5HI7A 3ULQA 3QWVA 3OXGA 3LY9A 5DBKA 2VYIA 1KLXA 3K9IA 4Y6CA 4GCOA 4GZ3A 3CVLA 3Q49B 3FFLA 2VSYA 1IYGA 2FBNA 1Y8MA 3ZHEA 4G26A 4A1SA 4U07A 2L6JA 3LYAA 3RO2A 2KC7A 3Q4AB 4CDRA 2YQ8A 5CCMA 1KT0A 2J9QA 2VQ2A 3LCAA 1FCHA 3RJVA 2JLBA 4XI0A 3NF1A 4BT8A 4WNDA 4XIFA 4YVQC 3CVNA 5EX0A 2UWJG 2AVPA 5CHEE 2I6HA 5G05J 2C0MA 3ESKA 4BTBA 3GW4A 4G23A 4J8DA 3AS8A 3ASGA 4U0SA 3EDTB 1ZU2A 4I17A 2PZIA 4HOTA 2XCBA 4I9EA 5A6CA 3TG4A 4G1TA 4UQXA 3QOUA 3ZPJA 4I9CA 3QKYA 3R9AB 1HZ4A 2ONDA 2PL2A 5ARFA 5BW8C 5FZSA 4WUYA 1QQEA 4UI9J 1YA0A 2BUGA 2WQHA 3CV0A 3KAEA 2KCLA 5BNWA 2XEVA 5CCLA 3PE3A 3RIBA 3MKRA 4GA0A 2KCKA 5A7DB 3ASFA 4RG9A 1NA3A 4JL0A 3SF4A 4J8FA 3TGOA 2R5SA 5FJYA 4B94A 5EKQD 3WXXA 2UY1B 4KBQA 5D0OD 4YVOA 4BTAA 3MA5A 3FWVA 4O6FA 3RKVA 2QFCA 5G05C 3CKBA 4GYYA 4I2WA 1E96B 2LSVA 1ZBPA 4LEUA 2OOEA 3FP3A 2PQRA 3S7FA 3UUXA 4GCNA 1XNFA 3TG5A 3CK9A 3UQ3A 5BT1A 2VGYA 2XGOA 4F3VA 4AIFA 2FI7A 3QWPA 3QDNA 3LY7A 4IN3B 3MEKA 1HXIA 4N39A 4UI9C 4GZ6A 3CKCA 2YHCA 4GA2A 4N3CA 5DIZA 3PE4A 3URZA 4GYOA 4U0UA 5D0QD 3KD7A 4YNDA 3LPZA 3VTXA 3U4TA 1ELWA 1QZ2A 3ZHEB 4H7YA 1NZNA 4RG6A 3Q15A 2GW1A 4HORA 1KT1A 3CK8A 3SZ7A 2VSNA 5KJKA 2XGMA 4G24A 1PC2A 3UPVA 2FF4A 5EX3A 3AS5A 1B89A 2DBAA 4GYWA 2KCVA 3PDNA 5FT9A 4ME2A 4KXKB 3KS2A 3ASHA 2FO7A 2VGXB 5G04J 3O48A 4Y6WA 4EQFA 4N2SA 1NA0A 5JJ6A 2LSUA 5FTPA 3OXFA 3AS4A 4UQYA 2C2LA 4I1AA 2FEZA 3RO3A 4GPKA 5LCWJ 2MHKA 3ZN3A 3ZGQA 3ZFWA 4AY6A 1ELRA 3RU0A 4N3AA 4HOUA 2IF4A 2WPVA 3GZ2A 4U0ZA 3CK7A 4I2ZA 1IHGA 2NC9A 3CVPA 5HQ8A 5ARGA 5KJLA 4GZ5A 4N5CA 5AYWD 3GZ1A 2IFUA 4CGWA 3S7DA 4APOA 3N71A 3CEQA 5M72A 5FZRA 2E2EA
chains in the Genus database with same CATH superfamily
3JYSA 1K3ZD 2LNIA 2XGSA 3D9MA 5ENPD 2GRRB 3PZ2A 4GA1A 1H2VC 3LJNA 4AXHA 5KBAA 5ITZF 1INZA 4LSZE 3ZKJA 4EBAG 2JEKA 5AN8A 3I3NA 3NOGD 3DEOA 1DNPA 4H7XA 2A5EA 1OUVA 4RVBA 1BLXB 1FT1A 4CZ2D 1JUQA 2WXFA 3CVUA 1DC2A 3IKOB 4UWLA 3IHVA 4GMJA 1MJ0A 3S7BA 3J5QB 1OY3D 5G2NA 2KATA 3JUIA 2WXOA 1TNBA 1E90A 1WDYA 2HYZA 3FU6A 3VTYA 2VSXE 4B93B 2AJAA 2QY7A 3UM3A 1H2UA 2P58C 3FUJA 3PEVB 4UI9K 1YCSB 3ZXSA 3PUKA 3C5RA 2DYRE 3UTMA 3HYMB 3PH0C 3HXEA 5JHBA 2Y4UA 4GMRA 1D8EA 2CHWA 5JJ7A 3ABME 5EIDA 2IY0C 4EPZA 3K9IA 5JMND 3CVLA 5HRYA 2IONA 3SQVA 5LP0A 3L16A 2FBNA 3D9IA 4A1SA 5AJLA 4XE0A 3TWRA 3X2QE 2L6JA 2KC7A 1WG0A 1U2VG 4BETA 4MLPA 3L9TA 3DSSA 1KT0A 3GZSA 4YDOA 2WXPA 3JXJA 2J08A 4GMLA 4Z68A 4XI0A 2V8SE 3FUMA 3CQCB 4BT8A 1D9SA 2LUHA 5AENA 5ENTD 5CHEE 2OCCE 3E37A 2IEJA 2GRLA 2C0MA 4K0RA 4G23A 3AS8A 4U0SA 4F7AA 4HRLA 2GRNB 4OAVB 5EILA 3EDTB 1AWCB 1LTXA 1HU3A 4I17A 3FUHA 1SA4A 1N9AA 5C2YA 4BX9A 4UWKA 4UQXA 3CVYA 4I9CA 4TXQA 5CBOA 1H6PA 3FDHA 3VLEA 2PL2A 5ARFA 1E7UA 3EHMA 5FZSA 1H19A 1QQEA 5BV0A 5E76A 3KAEA 3IBEA 3PE3A 3RIBA 4DLQA 3ASFA 3ZU7B 4JL0A 2QYUA 3SF4A 4ILGA 3TGOA 1UOHA 5CMWA 1YYHA 4KBQA 5IY5E 5B1AE 5D0OD 4HB5A 4AP2A 3HXDA 4I6JA 3TWSA 3FWVA 4HS2A 3RKVA 2P9PG 5G05C 5D2MC 4GYYA 2X6HA 2Y0BG 1KZPA 2IQCA 2LSVA 4L1BA 3LVQE 3S7FA 3AU4A 3UUXA 4JEUA 4JEHA 1S0PA 3ESLA 4O1PA 5ENQD 4A3VA 3FU5A 4E6HA 3B13A 4GTVA 4ACKA 1HFAA 4F1PA 3JQ0A 3TWWA 3QDNA 3MEKA 5CMYA 4N39A 3RAUA 4FHJA 4N3CA 2JABA 3LEWA 3PE4A 5AQ9A 3URZA 4A1GA 4U0UA 3FUKA 5D0QD 2EINE 3V79K 2OEWA 5CEDB 3CR3A 1SW6A 4CCAA 1TN7A 4HI8A 3CHRA 4RG6A 3Q15A 2WB2A 4AEZC 2KZTA 4FADA 3AG2E 4XKBA 4BSXA 3VLDA 1XGWA 3CK8A 1A5EA 3UMVA 4GTRA 1TJFA 3UPVA 2FF4A 3TWXA 2WXJA 5FT9A 4ME2A 4KXKB 4JVSA 5AQBA 2ETBA 3V30A 4TUUA 3D9KA 3ASHA 4JB8P 4Q96A 1VDYA 4GTTA 5FTPA 3RRUA 1OWPA 2C2LA 4I1AA 4JZYA 2FEZA 3RO3A 3BQOA 2XPYA 5LCWJ 3T5VA 3DPYA 3ZN3A 3ZGQA 3ZFWA 5JHAA 4AY6A 4EZLA 5CECB 3QNKA 3FUIA 3HDXA 4WWNA 1FVFA 1SZAA 4U0ZA 4HRNA 3FH5A 3D9NA 2NC9A 3CVPA 5ARGA 3ZYLA 5KJLA 2M63A 2P2CP 4CYMD 3GZ1A 3UT8A 2A5UA 4ANWA 4GTQA 4CGWA 1YMPA 4APOA 5BXOA 5JA4D 4B8AA 3TWUA 1PY1A 4HLEA 4YDWA 1Z6TA 1W3BA 2PNNA 2HO1A 2C0LA 3ZVVA 3DSXA 3SBTB 4BWRA 3G2SA 3FULA 2I2OA 5B3SE 3APDA 1O1TA 4JXTA 1V54E 5AQAA 4FLHA 4CEMA 3LKUA 3AG4E 3C3OA 4WWPA 4J8YA 5G04C 5C1DA 2Y4TA 4UQZA 2WMOA 3R7QA 4JPSA 4NQ0A 3S2AA 4DUIA 1N94A 4MKTA 5KJNA 4GTMA 2EIKE 2E0IA 4HOSA 2HE0A 5AAOA 2XEEA 3Q9UC 1NL4A 2LAIA 1BI8B 1MQSA 4JHRA 3ASNE 4MRUA 3S7JA 5ENOD 3EHNA 5ANLA 3BEEA 3MV3B 1A17A 2J4BA 1Z5SC 4AY5A 3L6AA 2ZXWE 1E8XA 4ILHB 2HR2A 4N2QA 3LY8A 2WXKA 2CG3A 5A23A 1X81A 2WXMA 1IKND 1TN8A 4N3BA 1QYMA 1UW4B 2IO3C 5EYPF 1TN6A 1WM5A 4XI9A 2QZAA 3KEAA 2XCCA 4CGVA 4DI4A 3IEGA 4AM9A 3QWWA 3E4BA 3ABKE 3FY4A 2I1JA 4ANXA 4FP7A 2OEVA 2DWZA 2KZTB 4HFGA 2OVBA 2VYIA 2X6IA 5BUZA 1MZCA 1JCSA 3SI5A 1E8YA 3Q49B 5FQ7A 4L2YA 2VSYA 2ETAA 4K5AB 4BFRA 1Y8MA 1SVXA 4U07A 3LYAA 3RO2A 1L5JA 5LFAA 3NB2A 2Y3AA 3RJVA 5D66A 3FUDA 2P9IG 3ZW3A 2J07A 3PZ1A 3WG7E 4WNDA 5KCMA 2YINA 1G3NB 2UWJG 3Q7AA 3Q73A 2KM4A 3ESKA 5EN5D 4BTBA 1FT2A 2AXVA 3GW4A 3ASGA 2MRIA 3ZIMA 2XZDG 4LCTA 4ATGA 1LF8A 3TWVA 1ZU2A 1V55E 4KMOA 5J90A 2PZIA 2LXLA 3KSQA 3BG0B 3TJPA 4B89A 4G1TA 3SO8A 5LOZA 4FLBA 3QK0A 1N4QA 1MX2A 4B0ZA 3UT7A 5BW8C 1Z3YA 3SNXA 3JUEA 4PUCA 3C72A 1RZ4A 4WUYA 3APFA 4FA6A 4UI9J 1YA0A 5CBNA 4BERA 1UJJA 3PZ3A 5BNWA 5CCLA 2IOSA 2P9LG 3MKRA 4GA0A 2KCKA 3HXCA 4ILIA 1H0AA 1E8WA 2BEDA 3FUEA 2AWIA 2GROB 5EKQD 3CVVA 4HI9A 3FUFA 4KT6B 3UM1A 2YHEA 1HO8A 1WY6A 4O6FA 3BG1B 3MZLB 2QFCA 1H6KA 2L0TB 3ASOE 3CKBA 1JWGA 2OV8A 2V5QC 4F6RD 3PNLB 5BXUA 1ZBPA 3MKQB 3B7BA 4LEUA 3FP3A 3I5PA 4ATZD 3T8MA 4G8KA 3FU0A 2AW6A 2H6IA 1OCZE 3TG5A 3UQ3A 4URKA 3DPDA 4PS8A 1EDUA 4LUNU 3OAWA 2VGYA 1N4RA 4F3VA 5H7PA 5T4YA 5E75A 3B7TA 4XEIG 3P1UA 4JHKA 4N5QA 1K8KG 3Q9NC 4FHKA 3Q7FA 1OCOE 1NP7A 5FWQA 5AARA 1OWMA 4AVXA 4CT0A 4GZ6A 3CKCA 2YHCA 4GA2A 5DIZA 4K03A 1HG5A 2XS1A 1OWLA 3CQGB 3KD7A 4PDXA 5BV1A 3LPZA 3CHSA 5ENSD 4CDMA 2B0OE 4H7YA 4CT4A 3QJZA 3FH7A 4GTSA 3E34A 2GW1A 3EU9A 2VTBA 4I43A 2MYOA 1Y6IA 3FTSA 3SZ7A 1BI7B 3R7RA 1MHQA 1PC2A 1BPOA 3ULEG 5EX3A 1Z3XA 3B7UX 5FIOA 3PDNA 3KS2A 4LNUD 2FO7A 4DX2A 2EQXA 4GTOA 3UXGA 5AQ7A 3O48A 4EQFA 4N2SA 1NA0A 2LSUA 3OXFA 3B7RL 3EIJA 2PM7A 4GPKA 4APFA 5CERB 4F1SA 3V31A 3RU0A 4V3IA 2IF4A 2WPVA 3BU8A 2V4HC 3CHPA 3CK7A 4I2ZA 5FINA 2RFMA 4DI3A 2LXMA 2Y1LE 2XRYA 5AYWD 2GRPB 1H6OA 3G2VA 2VJ8A 2B6CA 2GRQB 3JQ1A 2FULA 2XHEA 4GU5A 5M72A 1K1BA 5FZRA 2V5FA 4ACLA 2DVWA 3T5XA 3ZUVB 4ABNA 3EUVA 3TL5A 2Q7FA 4O1OA 1N4SA 5T3RA 4P29A 2VGXA 3CHOA 4JA9A 3ONLA 4U7EB 3I4RB 3MCXA 4I6EA 2BF0X 3PEUB 4I6GA 2UY1A 2XPIA 5LCWC 4FJZA 2NYJA 3HXFA 4WNGA 4WWOA 3NAWA 1BU9A 2ILRA 2P9UG 4UWHA 1HG2A 3TXMA 4TRQA 4ANVA 2XPZA 3DSVA 3AJIA 4L9PA 3UM0A 4F53A 3B95A 4A3TA 4GZCA 4KYOB 1TJCA 4HOQA 4J7WA 3CVQA 4X8QA 4DRXE 4KZ0A 3RRNB 2J49A 3D9OA 3EIQC 5FQ4A 3EJNA 3ASDA 4GPMA 3SFXA 1TR4A 3RK6A 5CRVA 3V2XA 3KEZA 2XEHA 2BTDA 2L0IA 5HI7A 3ENEA 3ULQA 3J5PA 3QWVA 3VLFA 4FC8A 3OXGA 3LY9A 5DBKA 2XS8A 4YDYA 5EIBE 3DRAA 3MJWA 4GCOA 4GZ3A 3PZDA 3CHQA 3UI2A 1OWNA 3FFLA 4L2LA 3ZHEA 4G26A 3EHQA 2VGEA 4IULA 3Q4AB 3CSTA 4CDRA 4A55A 2YQ8A 5ANRA 1O1SA 3LCAA 1MX6A 4M3OA 2JLBA 3UKUG 4HRMB 3U64A 1TYQG 3DXKG 3PVLA 3FUNA 3C3QA 2WXIA 4YVQC 3ISMC 4EZJA 1O5MA 2XENA 3B7SA 4I1OB 3F6QA 4J8DA 1OCCE 5EYLA 3FHEA 4CDNA 1TNZA 3L17A 4K5BA 4DPRA 4LRZA 2R17C 4HOTA 2XCBA 4O60A 4I9EA 5A6CA 4EBAA 3IXEA 4XKCA 4J8SA 3ZPJA 1TEZA 3FTYA 1TNYA 4GTPA 5T8IA 1N11A 3QKYA 2XRZA 3PNTB 1HZ4A 2ONDA 1N0RA 4GB9A 1JWFA 2IO2C 3TXNA 4PH4B 4JHJA 3CV0A 1FPPA 2KCLA 2XEVA 3UM2A 4IYPA 2XZTG 3T8KA 4RG9A 3JCKC 2WM9A 1NA3A 4J8FA 2R5SA 5FJYA 3WXXA 1NFIE 2UY1B 4WAFA 1SZ9A 1HE8A 2GGFA 1TNOA 4U63A 2WXGA 4I2WA 3V2OA 1E96B 1FVHA 1IXVA 2CFUA 2KXPC 3UINC 2L9BA 2QC9A 1PAQA 3E33A 3NQPA 3O4ZA 1RW2A 3CK9A 1HS6A 4B8CB 5BT1A 4AV7A 3EU5A 4IRUA 3W9GA 5LX8A 4PS3A 4AIFA 4LG6A 2FI7A 2V0PA 5ENRD 4DX1A 4EHMA 4UI9C 3CVWA 2X3MA 2NXPA 4EECA 5EDSA 3FU3A 2CFZA 3OTNA 3DXMG 4YNDA 2P9SG 3Q75A 3VTXA 3U4TA 1JCRA 1OCRE 2WQ7A 3ZHEB 2F8XK 2ZGGA 1NZNA 1EPUA 1MYOA 2L6BA 1U3CA 3FEXA 3W9FA 3DSTA 4ANUA 1OXJA 4JC8A 1KT1A 1ZB1A 5AJDA 3ML8A 4UWGA 2VSNA 2XGMA 3PZ4A 4G24A 3D3MA 3ZEFA 3AS5A 2DBAA 1NI1A 3SGHA 3KSLA 4RSYA 1EF1C 3DWLG 3DEPA 1OT8A 5JJ6A 1HF8A 3AS4A 4UQYA 3FTWA 4R7LA 3AG1E 3MYVA 2WXRA 4DX5D 2I1KA 3IV0A 2F0YA 3LDZA 1SA5A 1DCQA 1D8DA 5HS0A 2LAHA 1ELRA 3G2UA 4Q69A 1O1RA 3AG3E 3SHFA 3LVRE 4HOUA 3D9LA 3HIZA 4DX6D 2R05A 3GZ2A 3L82A 3L13A 1GW6A 5KNHD 2BKKB 4DX7D 4C9BB 2H6GA 2WXNA 3JXIA 4U96D 4L23A 2RD0A 3CLJA 3C3RA 2YNQA 3QARA 3CEQA 5KNGA 3ZYKA 5BPPA 4JW1A 2X6KA 2E2EA 3TAXA 4TXPA 2GRMA 4WNFA 3LS8A 1WAO1 3U9WA 3U3WA 4W9RA 3NBNB 1OWOA 2WXLA 1IHBA 4U04A 4G2VA 4BT9A 3BUAA 3RSEG 4MBGA 3D9PA 3E30A 1ELKA 4KVOA 3MV2B 2VSOE 1N54A 4OVUA 2DYSE 3PS6A 3SY2A 5CEAA 5CRUA 1BD8A 4J0UA 4JA7A 4HNAD 4C48B 4WNEA 3HXBA 2IJGX 3Q5MA 4LNBA 3SD5A 1P5QA 3HRAA 3UIPC 5KWDA 4FJYA 1KPSB 2F37A 3OXLA 4NRHB 3GYZA 1IQRA 4G25A 2J8SD 2PQNA 4DK5A 3SBSA 3CSFA 2WVIA 5JJTA 3SFYA 3NOCD 4MS6A 1AP7A 1UN9A 4PS7A 4Q94A 2ETCA 4NACA 3HVEA 4I1MA 4UWFA 4DLOA 4NURA 3C98A 2P9KG 1HH8A 3TWQA 5KJMA 4J8EA 3Q47B 5FZQA 2WXQA 2EIJE 3AU5A 3I4GA 4UUCA 4HQDA 2LO6A 4HBDA 4NIKA 4BEPA 1KLXA 4Y6CA 3L54A 2A4ZA 1IYGA 3G2TA 2R02A 4U8YD 2DCPA 4G8LA 4ZFHA 4LNGA 2NSZA 3ABLE 1S70B 2RG8A 2H6HA 5CCMA 2J9QA 2VQ2A 3NZUA 1FCHA 3MGBA 3UKRG 3DBSA 3RRMB 4TXRA 4BY6A 2PM6A 3HG0D 3L08A 2RFAA 3D9HA 3UIOC 3NF1A 4XIFA 3SFZA 3CVNA 5EX0A 2AVPA 1N4PA 2I6HA 3E32A 5G05J 1Q2ZA 4M7CA 5AIJA 3ZYMA 2DZOA 2ZIRA 1X5BA 2IU1A 4XZ4A 3L22A 4RQIA 5G55A 5FQ6A 2R59A 3U66A 4C0EA 3AAAC 4C0MA 3Q79A 3TG4A 4JD2G 3QOUA 2P9NG 2FO1E 2X38A 4YDEA 3IHYA 4XX5A 3R9AB 2F8YA 4A63B 3G2WA 2BUGA 2WQHA 4KZCA 2ZGDA 4D10C 2AXUA 3LXUX 1UG3A 1DVPA 5A7DB 2R03A 3FTVA 4J6IA 3MX3A 2J09A 2CHXA 1SQMA 3FTUA 4BX8A 4B94A 4EZKA 3PREA 1U3DA 2OVFA 4HLLA 4ZHBA 1H2TC 2V4LA 4OAUC 2VTBB 4BSZB 2H6FA 4YVOA 4BTAA 2AXZA 1LD8A 3MA5A 3APCA 4G11A 3FH8A 2KBXA 5FQ8A 2R2LA 2DIWA 3DSWA 1MX4A 2Y69E 2OOEA 3QB2A 2PQRA 3FTZA 4U95D 4DJAA 2HM8A 1JPLA 3ZYQA 4GCNA 3HHMA 1S63A 1JCQA 1XNFA 3CHMA 2ZISA 1S64A 1QNFA 3HVEB 2XGOA 3DSUA 2IOLA 3ULYA 2EIME 5ENNA 3PUJA 5J08A 3ZXPA 4HVBA 2WXHA 3QWPA 3LY7A 4IN3B 3FTXA 1QBQA 1HXIA 3TWTA 2WMNA 2J4DA 3CGHA 2EILE 1N52A 1E7VA 3R9MA 3CIAA 1KZOA 3QAQA 4GYOA 1EYHA 3NZSA 2X6FA 4TV3A 1ELWA 1QZ2A 3ONKA 2I9CA 3CVXA 4OVVA 2XQ0A 4K5CA 4HORA 5HKPA 1TNUA 3PRZA 1N0QA 2BKGA 3LJ3A 5KJKA 1HX8A 2X6JA 3ML9A 1B89A 3MKQA 4RLYA 1UJKA 2KCVA 4GZDA 2QYJA 3FEYA 4GYWA 3ZNGA 1UN8A 2VGXB 1N95A 5G04J 4Y6WA 2RKKA 4BESA 4L7TA 3D9JA 3ZRHA 4E85A 2WQ6A 1LD7A 4LERA 2MHKA 4GAAA 4U8HA 4FULA 4N3AA 4AJWA 3UX4A 3Q78A 3T9KA 2CG2A 3EHRA 1E8ZA 1K1AA 1IHGA 4TUMA 4QQIA 3P2BA 4U8VD 5HQ8A 4AOFA 4OYSA 5B1BE 4GZ5A 4N5CA 3UT4A 4KVMA 1IQUA 2CHZA 3QC1A 4HXIA 2IFUA 3S7DA 2ZU6B 4QFVA 1DCEA 3N71A 4CRWA 4FU3A 2DZNA 2MOWA
chains in the Genus database with same CATH topology
3TAXA 2GRMA 1PY1A 4HLEA 1Z6TA 2V5FA 3JYSA 1W3BA 2LNIA 2XGSA 3D9MA 2HO1A 4ACLA 2C0LA 3ZVVA 4WNFA 3LS8A 3SBTB 1WAO1 3T5XA 4GA1A 1H2VC 3U9WA 3U3WA 4BWRA 3G2SA 4W9RA 4AXHA 1OWOA 2WXLA 4ABNA 3TL5A 4U04A 2Q7FA 3FULA 4G2VA 2I2OA 4BT9A 3APDA 4JXTA 1INZA 3D9PA 4FLHA 4P29A 5T3RA 4EBAG 2JEKA 4CEMA 3LKUA 1ELKA 2VGXA 3I3NA 3MV2B 4KVOA 4WWPA 5G04C 5C1DA 2VSOE 3CHOA 4JA9A 1N54A 3ONLA 2Y4TA 4UQZA 2WMOA 1DNPA 4JPSA 4H7XA 3R7QA 1OUVA 3I4RB 4OVUA 4RVBA 3MCXA 3PS6A 4NQ0A 3S2AA 4I6EA 2BF0X 3PEUB 4MKTA 5KJNA 4J0UA 1JUQA 4I6GA 4JA7A 2UY1A 2E0IA 2XPIA 4HOSA 4WNEA 5LCWC 2IJGX 3Q5MA 3SD5A 4FJZA 1P5QA 2WXFA 3CVUA 4WNGA 4WWOA 3IKOB 4UWLA 2ILRA 2LAIA 3IHVA 4FJYA 4UWHA 3OXLA 4GMJA 4NRHB 3GYZA 1HG2A 1IQRA 3TXMA 4G25A 3S7BA 4TRQA 1MQSA 4ANVA 2PQNA 4JHRA 2XPZA 4DK5A 3SBSA 5G2NA 4MRUA 2KATA 3JUIA 3S7JA 4F53A 2WXOA 3EHNA 1E90A 5ANLA 3BEEA 3CSFA 2HYZA 3MV3B 2WVIA 1A17A 2J4BA 3FU6A 3VTYA 2VSXE 4AY5A 5JJTA 3L6AA 4A3TA 1E8XA 2QY7A 4GZCA 1H2UA 2P58C 3FUJA 4ILHB 2HR2A 3PEVB 4KYOB 4UI9K 4N2QA 3LY8A 1TJCA 2WXKA 2CG3A 3ZXSA 5A23A 3PUKA 2WXMA 4HOQA 4MS6A 3CVQA 1UN9A 4N3BA 4PS7A 1UW4B 4Q94A 4KZ0A 4NACA 3RRNB 3HVEA 1WM5A 2J49A 4I1MA 4UWFA 3D9OA 4DLOA 4NURA 4XI9A 3C98A 3HYMB 1HH8A 2XCCA 3EIQC 5FQ4A 4CGVA 4DI4A 3EJNA 3IEGA 3ASDA 3PH0C 5KJMA 4J8EA 4AM9A 3Q47B 5FZQA 3QWWA 3RK6A 2WXQA 3E4BA 5JHBA 3FY4A 2Y4UA 2CHWA 3AU5A 3KEZA 3I4GA 2I1JA 5JJ7A 4ANXA 2BTDA 2L0IA 4FP7A 5HI7A 3ENEA 3ULQA 3QWVA 3VLFA 4FC8A 3OXGA 2KZTB 4HFGA 2LO6A 3LY9A 5DBKA 4EPZA 2OVBA 2VYIA 1KLXA 2X6IA 5BUZA 3K9IA 4Y6CA 3MJWA 4GCOA 3L54A 4GZ3A 3SI5A 3PZDA 2A4ZA 3CHQA 1E8YA 3CVLA 2IONA 3Q49B 5FQ7A 1OWNA 3FFLA 5LP0A 3L16A 4L2LA 4L2YA 2VSYA 1IYGA 2FBNA 4BFRA 3D9IA 1Y8MA 3G2TA 4G26A 3ZHEA 4A1SA 5AJLA 4XE0A 4IULA 2DCPA 2L6JA 3LYAA 4U07A 3RO2A 1L5JA 2KC7A 3Q4AB 3CSTA 2NSZA 4CDRA 4A55A 2YQ8A 5LFAA 2RG8A 5ANRA 5CCMA 4MLPA 1KT0A 2J9QA 2VQ2A 3NZUA 3GZSA 2Y3AA 3LCAA 2WXPA 1FCHA 4GMLA 2J08A 3RJVA 3MGBA 3DBSA 4M3OA 3RRMB 2JLBA 3FUDA 4BY6A 2PM6A 3ZW3A 3L08A 2J07A 4XI0A 2V8SE 3FUMA 3CQCB 3U64A 3NF1A 3PVLA 4BT8A 3FUNA 4WNDA 4XIFA 2WXIA 3SFZA 4YVQC 5KCMA 5AENA 3CVNA 2YINA 5EX0A 2UWJG 2AVPA 5CHEE 4EZJA 2I6HA 2KM4A 5G05J 2GRLA 2C0MA 3ESKA 4K0RA 4BTBA 5AIJA 3ZYMA 3B7SA 4I1OB 2AXVA 3GW4A 4G23A 1X5BA 4J8DA 2IU1A 3AS8A 3ASGA 2MRIA 4U0SA 4XZ4A 3L22A 4F7AA 3ZIMA 3FHEA 4LCTA 3L17A 4ATGA 4CDNA 1LF8A 3EDTB 4DPRA 5G55A 4LRZA 1ZU2A 2R17C 5FQ6A 1HU3A 4I17A 3FUHA 2R59A 4KMOA 3U66A 5J90A 2PZIA 4HOTA 4C0EA 2XCBA 3BG0B 4I9EA 5A6CA 4EBAA 4C0MA 4XKCA 4J8SA 5C2YA 3TJPA 3TG4A 4G1TA 4B89A 4BX9A 4UWKA 4UQXA 3QOUA 3ZPJA 3FTYA 3CVYA 1TEZA 4I9CA 5LOZA 2X38A 4FLBA 3QK0A 5T8IA 3QKYA 2XRZA 3IHYA 3PNTB 4XX5A 3FDHA 3R9AB 1HZ4A 2ONDA 4B0ZA 3UT7A 3VLEA 2PL2A 5ARFA 5BW8C 1Z3YA 1E7UA 3SNXA 3EHMA 4GB9A 1JWFA 4PUCA 5FZSA 1H19A 4WUYA 1QQEA 3APFA 3TXNA 4FA6A 4UI9J 5BV0A 3G2WA 1YA0A 2BUGA 2WQHA 4KZCA 4PH4B 5E76A 4JHJA 4D10C 2AXUA 1UJJA 3CV0A 3IBEA 3KAEA 2KCLA 5BNWA 2XEVA 5CCLA 3PE3A 3LXUX 1UG3A 2IOSA 3RIBA 1DVPA 3MKRA 4IYPA 4GA0A 2KCKA 4DLQA 5A7DB 3ASFA 4J6IA 3FTVA 4RG9A 4ILIA 3MX3A 3JCKC 2J09A 2CHXA 2WM9A 1H0AA 1SQMA 1NA3A 3FTUA 4JL0A 3SF4A 1E8WA 4J8FA 4ILGA 4BX8A 2R5SA 3TGOA 5FJYA 4B94A 3FUEA 2AWIA 5EKQD 4EZKA 3CVVA 3PREA 1U3DA 5CMWA 2OVFA 3FUFA 3WXXA 2UY1B 1H2TC 4KBQA 4WAFA 2V4LA 5D0OD 1SZ9A 4KT6B 4AP2A 2VTBB 2YHEA 4YVOA 4I6JA 1HO8A 1WY6A 1HE8A 4BTAA 2GGFA 2AXZA 4U63A 3MA5A 3FWVA 4HS2A 4O6FA 3BG1B 3MZLB 3RKVA 2QFCA 3APCA 5G05C 1H6KA 2L0TB 2WXGA 3CKBA 1JWGA 2OV8A 4G11A 2X6HA 4GYYA 3FH8A 1E96B 1FVHA 4I2WA 5FQ8A 2CFUA 2IQCA 3PNLB 2DIWA 2LSVA 1ZBPA 3MKQB 4L1BA 4LEUA 2OOEA 3FP3A 3I5PA 2PQRA 3LVQE 2L9BA 3FTZA 3QB2A 3S7FA 4DJAA 2HM8A 3T8MA 1PAQA 3AU4A 3UUXA 1JPLA 3ZYQA 3FU0A 4JEUA 4JEHA 4GCNA 2AW6A 3HHMA 1XNFA 3NQPA 3O4ZA 3TG5A 1S0PA 3CK9A 3UQ3A 1HS6A 4B8CB 5BT1A 4URKA 3DPDA 4PS8A 3CHMA 1EDUA 3ESLA 4LUNU 4A3VA 3OAWA 1QNFA 2VGYA 3FU5A 3HVEB 2XGOA 4AV7A 2IOLA 4F3VA 4IRUA 5T4YA 5E75A 3B13A 4E6HA 5ENNA 5LX8A 3B7TA 4PS3A 4AIFA 4ACKA 3PUJA 2FI7A 1HFAA 3P1UA 5J08A 4JHKA 3JQ0A 2V0PA 2WXHA 3QWPA 4HVBA 4FHKA 3QDNA 3LY7A 4IN3B 3FTXA 3MEKA 1HXIA 5CMYA 1NP7A 2WMNA 4N39A 4UI9C 5FWQA 1OWMA 2J4DA 4AVXA 3CVWA 3CGHA 2X3MA 4CT0A 1N52A 4GZ6A 3CKCA 2YHCA 2NXPA 1E7VA 4FHJA 4GA2A 4N3CA 3LEWA 5DIZA 3CIAA 3PE4A 4EECA 5EDSA 3FU3A 4K03A 3URZA 1HG5A 4A1GA 3QAQA 4GYOA 2CFZA 3OTNA 1OWLA 1EYHA 4U0UA 3CQGB 3NZSA 3FUKA 5D0QD 3KD7A 2X6FA 4PDXA 4YNDA 5BV1A 3LPZA 3VTXA 3CHSA 3U4TA 3CR3A 4TV3A 1ELWA 4CCAA 1QZ2A 4CDMA 2WQ7A 3ZHEB 4H7YA 1NZNA 1EPUA 3CHRA 4CT4A 3ONKA 3QJZA 4RG6A 3Q15A 3FH7A 2WB2A 1U3CA 2GW1A 2I9CA 3FEXA 4ANUA 3CVXA 4AEZC 2VTBA 4OVVA 2KZTA 4FADA 2XQ0A 4I43A 4HORA 4XKBA 4JC8A 1KT1A 4BSXA 3VLDA 3PRZA 1XGWA 1Y6IA 3CK8A 3FTSA 5AJDA 3ML8A 4UWGA 2VSNA 3LJ3A 3SZ7A 3UMVA 5KJKA 2XGMA 1MHQA 3R7RA 1TJFA 4G24A 1PC2A 1BPOA 1HX8A 3D3MA 3ZEFA 3UPVA 2X6JA 2FF4A 3ML9A 3AS5A 1B89A 2DBAA 5EX3A 3MKQA 1Z3XA 1UJKA 2WXJA 2KCVA 3B7UX 3FEYA 3PDNA 4GZDA 4GYWA 4ME2A 5FT9A 3SGHA 4KXKB 3KS2A 4JVSA 1UN8A 4TUUA 4RSYA 3D9KA 3ASHA 2FO7A 1EF1C 2VGXB 4Q96A 5G04J 2EQXA 3O48A 4Y6WA 4EQFA 4N2SA 1VDYA 1NA0A 5JJ6A 4L7TA 2LSUA 3D9JA 3ZRHA 5FTPA 1HF8A 2MOWA 3OXFA 3RRUA 3AS4A 3B7RL 4E85A 1OWPA 2C2LA 4UQYA 3FTWA 2WQ6A 4R7LA 4I1AA 4JZYA 2FEZA 3EIJA 3RO3A 3MYVA 2WXRA 2PM7A 4GPKA 2I1KA 2XPYA 3IV0A 4LERA 5LCWJ 4APFA 2MHKA 3LDZA 4GAAA 3T5VA 4F1SA 3ZN3A 3ZGQA 3ZFWA 5JHAA 4AY6A 4U8HA 2LAHA 1ELRA 3G2UA 4Q69A 4FULA 3RU0A 3SHFA 3LVRE 4N3AA 4V3IA 4EZLA 4AJWA 4HOUA 2IF4A 2WPVA 3FUIA 3QNKA 3D9LA 3UX4A 3HIZA 3GZ2A 3HDXA 2CG2A 4WWNA 1FVFA 1E8ZA 3CHPA 3L13A 1SZAA 1GW6A 4U0ZA 3CK7A 4I2ZA 1IHGA 4C9BB 3FH5A 3D9NA 2NC9A 3P2BA 2WXNA 3CVPA 5HQ8A 4DI3A 5ARGA 3ZYLA 4AOFA 4OYSA 5KJLA 2M63A 4L23A 2XRYA 4GZ5A 2RD0A 3CLJA 4N5CA 5AYWD 3UT4A 4KVMA 3GZ1A 3UT8A 1IQUA 2A5UA 2CHZA 2VJ8A 2YNQA 3G2VA 2IFUA 3QC1A 4HXIA 4ANWA 3S7DA 4CGWA 3JQ1A 2FULA 4APOA 2ZU6B 2XHEA 4QFVA 4GU5A 3QARA 3N71A 4CRWA 3CEQA 3ZYKA 4B8AA 5BPPA 5M72A 4FU3A 5FZRA 4JW1A 2X6KA 2E2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAX A;  2V5F A;  3JYS A;  1W3B A;  2LNI A;  2XGS A;  2HO1 A;  2C0L A;  4WNF A;  1WAO 1;  4GA1 A;  3U3W A;  4BWR A;  4W9R A;  4ABN A;  4U04 A;  2Q7F A;  4G2V A;  4BT9 A;  3LKU A;  2VGX A;  3MV2 B;  5G04 C;  5C1D A;  4JA9 A;  2Y4T A;  4UQZ A;  4H7X A;  1OUV A;  4NQ0 A;  5KJN A;  4J0U A;  4JA7 A;  2UY1 A;  2XPI A;  4HOS A;  4WNE A;  5LCW C;  3Q5M A;  1P5Q A;  4WNG A;  3OXL A;  4NRH B;  3GYZ A;  4G25 A;  3S7B A;  2PQN A;  4JHR A;  2KAT A;  3S7J A;  3BEE A;  2HYZ A;  3MV3 B;  1A17 A;  3VTY A;  4AY5 A;  5JJT A;  2P58 C;  4KYO B;  2HR2 A;  4UI9 K;  4N2Q A;  3LY8 A;  1TJC A;  4HOQ A;  3CVQ A;  4N3B A;  1WM5 A;  4XI9 A;  3HYM B;  1HH8 A;  2XCC A;  4CGV A;  3IEG A;  3ASD A;  5KJM A;  4J8E A;  4AM9 A;  3Q47 B;  5FZQ A;  3QWW A;  3E4B A;  2Y4U A;  5JJ7 A;  5HI7 A;  3ULQ A;  3QWV A;  3OXG A;  3LY9 A;  5DBK A;  2VYI A;  1KLX A;  3K9I A;  4Y6C A;  4GCO A;  4GZ3 A;  3CVL A;  3Q49 B;  3FFL A;  2VSY A;  1IYG A;  2FBN A;  1Y8M A;  3ZHE A;  4G26 A;  4A1S A;  4U07 A;  2L6J A;  3LYA A;  3RO2 A;  2KC7 A;  3Q4A B;  4CDR A;  2YQ8 A;  5CCM A;  1KT0 A;  2J9Q A;  2VQ2 A;  3LCA A;  1FCH A;  3RJV A;  2JLB A;  4XI0 A;  3NF1 A;  4BT8 A;  4WND A;  4XIF A;  4YVQ C;  3CVN A;  5EX0 A;  2UWJ G;  2AVP A;  5CHE E;  2I6H A;  5G05 J;  2C0M A;  3ESK A;  4BTB A;  3GW4 A;  4G23 A;  4J8D A;  3AS8 A;  3ASG A;  4U0S A;  3EDT B;  1ZU2 A;  4I17 A;  2PZI A;  4HOT A;  2XCB A;  4I9E A;  5A6C A;  3TG4 A;  4G1T A;  4UQX A;  3QOU A;  3ZPJ A;  4I9C A;  3QKY A;  3R9A B;  1HZ4 A;  2OND A;  2PL2 A;  5ARF A;  5BW8 C;  5FZS A;  4WUY A;  1QQE A;  4UI9 J;  1YA0 A;  2BUG A;  2WQH A;  3CV0 A;  3KAE A;  2KCL A;  5BNW A;  2XEV A;  5CCL A;  3PE3 A;  3RIB A;  3MKR A;  4GA0 A;  2KCK A;  5A7D B;  3ASF A;  4RG9 A;  1NA3 A;  4JL0 A;  3SF4 A;  4J8F A;  3TGO A;  2R5S A;  5FJY A;  4B94 A;  5EKQ D;  3WXX A;  2UY1 B;  4KBQ A;  5D0O D;  4YVO A;  4BTA A;  3MA5 A;  3FWV A;  4O6F A;  3RKV A;  2QFC A;  5G05 C;  3CKB A;  4GYY A;  4I2W A;  1E96 B;  2LSV A;  1ZBP A;  4LEU A;  2OOE A;  3FP3 A;  2PQR A;  3S7F A;  3UUX A;  4GCN A;  1XNF A;  3TG5 A;  3CK9 A;  3UQ3 A;  5BT1 A;  2VGY A;  2XGO A;  4F3V A;  4AIF A;  2FI7 A;  3QWP A;  3QDN A;  3LY7 A;  4IN3 B;  3MEK A;  1HXI A;  4N39 A;  4UI9 C;  4GZ6 A;  3CKC A;  2YHC A;  4GA2 A;  4N3C A;  5DIZ A;  3PE4 A;  3URZ A;  4GYO A;  4U0U A;  5D0Q D;  3KD7 A;  4YND A;  3LPZ A;  3VTX A;  3U4T A;  1ELW A;  1QZ2 A;  3ZHE B;  4H7Y A;  1NZN A;  4RG6 A;  3Q15 A;  2GW1 A;  4HOR A;  1KT1 A;  3CK8 A;  3SZ7 A;  2VSN A;  5KJK A;  2XGM A;  4G24 A;  1PC2 A;  3UPV A;  2FF4 A;  5EX3 A;  3AS5 A;  1B89 A;  2DBA A;  4GYW A;  2KCV A;  3PDN A;  5FT9 A;  4ME2 A;  4KXK B;  3KS2 A;  3ASH A;  2FO7 A;  2VGX B;  5G04 J;  3O48 A;  4Y6W A;  4EQF A;  4N2S A;  1NA0 A;  5JJ6 A;  2LSU A;  5FTP A;  3OXF A;  3AS4 A;  4UQY A;  2C2L A;  4I1A A;  2FEZ A;  3RO3 A;  4GPK A;  5LCW J;  2MHK A;  3ZN3 A;  3ZGQ A;  3ZFW A;  4AY6 A;  1ELR A;  3RU0 A;  4N3A A;  4HOU A;  2IF4 A;  2WPV A;  3GZ2 A;  4U0Z A;  3CK7 A;  4I2Z A;  1IHG A;  2NC9 A;  3CVP A;  5HQ8 A;  5ARG A;  5KJL A;  4GZ5 A;  4N5C A;  5AYW D;  3GZ1 A;  2IFU A;  4CGW A;  3S7D A;  4APO A;  3N71 A;  3CEQ A;  5M72 A;  5FZR A;  2E2E A; 
#chains in the Genus database with same CATH topology
 3JYS A;  1K3Z D;  2LNI A;  2XGS A;  3D9M A;  5ENP D;  2GRR B;  3PZ2 A;  4GA1 A;  1H2V C;  3LJN A;  4AXH A;  5KBA A;  5ITZ F;  1INZ A;  4LSZ E;  3ZKJ A;  4EBA G;  2JEK A;  5AN8 A;  3I3N A;  3NOG D;  3DEO A;  1DNP A;  4H7X A;  2A5E A;  1OUV A;  4RVB A;  1BLX B;  1FT1 A;  4CZ2 D;  1JUQ A;  2WXF A;  3CVU A;  1DC2 A;  3IKO B;  4UWL A;  3IHV A;  4GMJ A;  1MJ0 A;  3S7B A;  3J5Q B;  1OY3 D;  5G2N A;  2KAT A;  3JUI A;  2WXO A;  1TNB A;  1E90 A;  1WDY A;  2HYZ A;  3FU6 A;  3VTY A;  2VSX E;  4B93 B;  2AJA A;  2QY7 A;  3UM3 A;  1H2U A;  2P58 C;  3FUJ A;  3PEV B;  4UI9 K;  1YCS B;  3ZXS A;  3PUK A;  3C5R A;  2DYR E;  3UTM A;  3HYM B;  3PH0 C;  3HXE A;  5JHB A;  2Y4U A;  4GMR A;  1D8E A;  2CHW A;  5JJ7 A;  3ABM E;  5EID A;  2IY0 C;  4EPZ A;  3K9I A;  5JMN D;  3CVL A;  5HRY A;  2ION A;  3SQV A;  5LP0 A;  3L16 A;  2FBN A;  3D9I A;  4A1S A;  5AJL A;  4XE0 A;  3TWR A;  3X2Q E;  2L6J A;  2KC7 A;  1WG0 A;  1U2V G;  4BET A;  4MLP A;  3L9T A;  3DSS A;  1KT0 A;  3GZS A;  4YDO A;  2WXP A;  3JXJ A;  2J08 A;  4GML A;  4Z68 A;  4XI0 A;  2V8S E;  3FUM A;  3CQC B;  4BT8 A;  1D9S A;  2LUH A;  5AEN A;  5ENT D;  5CHE E;  2OCC E;  3E37 A;  2IEJ A;  2GRL A;  2C0M A;  4K0R A;  4G23 A;  3AS8 A;  4U0S A;  4F7A A;  4HRL A;  2GRN B;  4OAV B;  5EIL A;  3EDT B;  1AWC B;  1LTX A;  1HU3 A;  4I17 A;  3FUH A;  1SA4 A;  1N9A A;  5C2Y A;  4BX9 A;  4UWK A;  4UQX A;  3CVY A;  4I9C A;  4TXQ A;  5CBO A;  1H6P A;  3FDH A;  3VLE A;  2PL2 A;  5ARF A;  1E7U A;  3EHM A;  5FZS A;  1H19 A;  1QQE A;  5BV0 A;  5E76 A;  3KAE A;  3IBE A;  3PE3 A;  3RIB A;  4DLQ A;  3ASF A;  3ZU7 B;  4JL0 A;  2QYU A;  3SF4 A;  4ILG A;  3TGO A;  1UOH A;  5CMW A;  1YYH A;  4KBQ A;  5IY5 E;  5B1A E;  5D0O D;  4HB5 A;  4AP2 A;  3HXD A;  4I6J A;  3TWS A;  3FWV A;  4HS2 A;  3RKV A;  2P9P G;  5G05 C;  5D2M C;  4GYY A;  2X6H A;  2Y0B G;  1KZP A;  2IQC A;  2LSV A;  4L1B A;  3LVQ E;  3S7F A;  3AU4 A;  3UUX A;  4JEU A;  4JEH A;  1S0P A;  3ESL A;  4O1P A;  5ENQ D;  4A3V A;  3FU5 A;  4E6H A;  3B13 A;  4GTV A;  4ACK A;  1HFA A;  4F1P A;  3JQ0 A;  3TWW A;  3QDN A;  3MEK A;  5CMY A;  4N39 A;  3RAU A;  4FHJ A;  4N3C A;  2JAB A;  3LEW A;  3PE4 A;  5AQ9 A;  3URZ A;  4A1G A;  4U0U A;  3FUK A;  5D0Q D;  2EIN E;  3V79 K;  2OEW A;  5CED B;  3CR3 A;  1SW6 A;  4CCA A;  1TN7 A;  4HI8 A;  3CHR A;  4RG6 A;  3Q15 A;  2WB2 A;  4AEZ C;  2KZT A;  4FAD A;  3AG2 E;  4XKB A;  4BSX A;  3VLD A;  1XGW A;  3CK8 A;  1A5E A;  3UMV A;  4GTR A;  1TJF A;  3UPV A;  2FF4 A;  3TWX A;  2WXJ A;  5FT9 A;  4ME2 A;  4KXK B;  4JVS A;  5AQB A;  2ETB A;  3V30 A;  4TUU A;  3D9K A;  3ASH A;  4JB8 P;  4Q96 A;  1VDY A;  4GTT A;  5FTP A;  3RRU A;  1OWP A;  2C2L A;  4I1A A;  4JZY A;  2FEZ A;  3RO3 A;  3BQO A;  2XPY A;  5LCW J;  3T5V A;  3DPY A;  3ZN3 A;  3ZGQ A;  3ZFW A;  5JHA A;  4AY6 A;  4EZL A;  5CEC B;  3QNK A;  3FUI A;  3HDX A;  4WWN A;  1FVF A;  1SZA A;  4U0Z A;  4HRN A;  3FH5 A;  3D9N A;  2NC9 A;  3CVP A;  5ARG A;  3ZYL A;  5KJL A;  2M63 A;  2P2C P;  4CYM D;  3GZ1 A;  3UT8 A;  2A5U A;  4ANW A;  4GTQ A;  4CGW A;  1YMP A;  4APO A;  5BXO A;  5JA4 D;  4B8A A;  3TWU A;  1PY1 A;  4HLE A;  4YDW A;  1Z6T A;  1W3B A;  2PNN A;  2HO1 A;  2C0L A;  3ZVV A;  3DSX A;  3SBT B;  4BWR A;  3G2S A;  3FUL A;  2I2O A;  5B3S E;  3APD A;  1O1T A;  4JXT A;  1V54 E;  5AQA A;  4FLH A;  4CEM A;  3LKU A;  3AG4 E;  3C3O A;  4WWP A;  4J8Y A;  5G04 C;  5C1D A;  2Y4T A;  4UQZ A;  2WMO A;  3R7Q A;  4JPS A;  4NQ0 A;  3S2A A;  4DUI A;  1N94 A;  4MKT A;  5KJN A;  4GTM A;  2EIK E;  2E0I A;  4HOS A;  2HE0 A;  5AAO A;  2XEE A;  3Q9U C;  1NL4 A;  2LAI A;  1BI8 B;  1MQS A;  4JHR A;  3ASN E;  4MRU A;  3S7J A;  5ENO D;  3EHN A;  5ANL A;  3BEE A;  3MV3 B;  1A17 A;  2J4B A;  1Z5S C;  4AY5 A;  3L6A A;  2ZXW E;  1E8X A;  4ILH B;  2HR2 A;  4N2Q A;  3LY8 A;  2WXK A;  2CG3 A;  5A23 A;  1X81 A;  2WXM A;  1IKN D;  1TN8 A;  4N3B A;  1QYM A;  1UW4 B;  2IO3 C;  5EYP F;  1TN6 A;  1WM5 A;  4XI9 A;  2QZA A;  3KEA A;  2XCC A;  4CGV A;  4DI4 A;  3IEG A;  4AM9 A;  3QWW A;  3E4B A;  3ABK E;  3FY4 A;  2I1J A;  4ANX A;  4FP7 A;  2OEV A;  2DWZ A;  2KZT B;  4HFG A;  2OVB A;  2VYI A;  2X6I A;  5BUZ A;  1MZC A;  1JCS A;  3SI5 A;  1E8Y A;  3Q49 B;  5FQ7 A;  4L2Y A;  2VSY A;  2ETA A;  4K5A B;  4BFR A;  1Y8M A;  1SVX A;  4U07 A;  3LYA A;  3RO2 A;  1L5J A;  5LFA A;  3NB2 A;  2Y3A A;  3RJV A;  5D66 A;  3FUD A;  2P9I G;  3ZW3 A;  2J07 A;  3PZ1 A;  3WG7 E;  4WND A;  5KCM A;  2YIN A;  1G3N B;  2UWJ G;  3Q7A A;  3Q73 A;  2KM4 A;  3ESK A;  5EN5 D;  4BTB A;  1FT2 A;  2AXV A;  3GW4 A;  3ASG A;  2MRI A;  3ZIM A;  2XZD G;  4LCT A;  4ATG A;  1LF8 A;  3TWV A;  1ZU2 A;  1V55 E;  4KMO A;  5J90 A;  2PZI A;  2LXL A;  3KSQ A;  3BG0 B;  3TJP A;  4B89 A;  4G1T A;  3SO8 A;  5LOZ A;  4FLB A;  3QK0 A;  1N4Q A;  1MX2 A;  4B0Z A;  3UT7 A;  5BW8 C;  1Z3Y A;  3SNX A;  3JUE A;  4PUC A;  3C72 A;  1RZ4 A;  4WUY A;  3APF A;  4FA6 A;  4UI9 J;  1YA0 A;  5CBN A;  4BER A;  1UJJ A;  3PZ3 A;  5BNW A;  5CCL A;  2IOS A;  2P9L G;  3MKR A;  4GA0 A;  2KCK A;  3HXC A;  4ILI A;  1H0A A;  1E8W A;  2BED A;  3FUE A;  2AWI A;  2GRO B;  5EKQ D;  3CVV A;  4HI9 A;  3FUF A;  4KT6 B;  3UM1 A;  2YHE A;  1HO8 A;  1WY6 A;  4O6F A;  3BG1 B;  3MZL B;  2QFC A;  1H6K A;  2L0T B;  3ASO E;  3CKB A;  1JWG A;  2OV8 A;  2V5Q C;  4F6R D;  3PNL B;  5BXU A;  1ZBP A;  3MKQ B;  3B7B A;  4LEU A;  3FP3 A;  3I5P A;  4ATZ D;  3T8M A;  4G8K A;  3FU0 A;  2AW6 A;  2H6I A;  1OCZ E;  3TG5 A;  3UQ3 A;  4URK A;  3DPD A;  4PS8 A;  1EDU A;  4LUN U;  3OAW A;  2VGY A;  1N4R A;  4F3V A;  5H7P A;  5T4Y A;  5E75 A;  3B7T A;  4XEI G;  3P1U A;  4JHK A;  4N5Q A;  1K8K G;  3Q9N C;  4FHK A;  3Q7F A;  1OCO E;  1NP7 A;  5FWQ A;  5AAR A;  1OWM A;  4AVX A;  4CT0 A;  4GZ6 A;  3CKC A;  2YHC A;  4GA2 A;  5DIZ A;  4K03 A;  1HG5 A;  2XS1 A;  1OWL A;  3CQG B;  3KD7 A;  4PDX A;  5BV1 A;  3LPZ A;  3CHS A;  5ENS D;  4CDM A;  2B0O E;  4H7Y A;  4CT4 A;  3QJZ A;  3FH7 A;  4GTS A;  3E34 A;  2GW1 A;  3EU9 A;  2VTB A;  4I43 A;  2MYO A;  1Y6I A;  3FTS A;  3SZ7 A;  1BI7 B;  3R7R A;  1MHQ A;  1PC2 A;  1BPO A;  3ULE G;  5EX3 A;  1Z3X A;  3B7U X;  5FIO A;  3PDN A;  3KS2 A;  4LNU D;  2FO7 A;  4DX2 A;  2EQX A;  4GTO A;  3UXG A;  5AQ7 A;  3O48 A;  4EQF A;  4N2S A;  1NA0 A;  2LSU A;  3OXF A;  3B7R L;  3EIJ A;  2PM7 A;  4GPK A;  4APF A;  5CER B;  4F1S A;  3V31 A;  3RU0 A;  4V3I A;  2IF4 A;  2WPV A;  3BU8 A;  2V4H C;  3CHP A;  3CK7 A;  4I2Z A;  5FIN A;  2RFM A;  4DI3 A;  2LXM A;  2Y1L E;  2XRY A;  5AYW D;  2GRP B;  1H6O A;  3G2V A;  2VJ8 A;  2B6C A;  2GRQ B;  3JQ1 A;  2FUL A;  2XHE A;  4GU5 A;  5M72 A;  1K1B A;  5FZR A;  2V5F A;  4ACL A;  2DVW A;  3T5X A;  3ZUV B;  4ABN A;  3EUV A;  3TL5 A;  2Q7F A;  4O1O A;  1N4S A;  5T3R A;  4P29 A;  2VGX A;  3CHO A;  4JA9 A;  3ONL A;  4U7E B;  3I4R B;  3MCX A;  4I6E A;  2BF0 X;  3PEU B;  4I6G A;  2UY1 A;  2XPI A;  5LCW C;  4FJZ A;  2NYJ A;  3HXF A;  4WNG A;  4WWO A;  3NAW A;  1BU9 A;  2ILR A;  2P9U G;  4UWH A;  1HG2 A;  3TXM A;  4TRQ A;  4ANV A;  2XPZ A;  3DSV A;  3AJI A;  4L9P A;  3UM0 A;  4F53 A;  3B95 A;  4A3T A;  4GZC A;  4KYO B;  1TJC A;  4HOQ A;  4J7W A;  3CVQ A;  4X8Q A;  4DRX E;  4KZ0 A;  3RRN B;  2J49 A;  3D9O A;  3EIQ C;  5FQ4 A;  3EJN A;  3ASD A;  4GPM A;  3SFX A;  1TR4 A;  3RK6 A;  5CRV A;  3V2X A;  3KEZ A;  2XEH A;  2BTD A;  2L0I A;  5HI7 A;  3ENE A;  3ULQ A;  3J5P A;  3QWV A;  3VLF A;  4FC8 A;  3OXG A;  3LY9 A;  5DBK A;  2XS8 A;  4YDY A;  5EIB E;  3DRA A;  3MJW A;  4GCO A;  4GZ3 A;  3PZD A;  3CHQ A;  3UI2 A;  1OWN A;  3FFL A;  4L2L A;  3ZHE A;  4G26 A;  3EHQ A;  2VGE A;  4IUL A;  3Q4A B;  3CST A;  4CDR A;  4A55 A;  2YQ8 A;  5ANR A;  1O1S A;  3LCA A;  1MX6 A;  4M3O A;  2JLB A;  3UKU G;  4HRM B;  3U64 A;  1TYQ G;  3DXK G;  3PVL A;  3FUN A;  3C3Q A;  2WXI A;  4YVQ C;  3ISM C;  4EZJ A;  1O5M A;  2XEN A;  3B7S A;  4I1O B;  3F6Q A;  4J8D A;  1OCC E;  5EYL A;  3FHE A;  4CDN A;  1TNZ A;  3L17 A;  4K5B A;  4DPR A;  4LRZ A;  2R17 C;  4HOT A;  2XCB A;  4O60 A;  4I9E A;  5A6C A;  4EBA A;  3IXE A;  4XKC A;  4J8S A;  3ZPJ A;  1TEZ A;  3FTY A;  1TNY A;  4GTP A;  5T8I A;  1N11 A;  3QKY A;  2XRZ A;  3PNT B;  1HZ4 A;  2OND A;  1N0R A;  4GB9 A;  1JWF A;  2IO2 C;  3TXN A;  4PH4 B;  4JHJ A;  3CV0 A;  1FPP A;  2KCL A;  2XEV A;  3UM2 A;  4IYP A;  2XZT G;  3T8K A;  4RG9 A;  3JCK C;  2WM9 A;  1NA3 A;  4J8F A;  2R5S A;  5FJY A;  3WXX A;  1NFI E;  2UY1 B;  4WAF A;  1SZ9 A;  1HE8 A;  2GGF A;  1TNO A;  4U63 A;  2WXG A;  4I2W A;  3V2O A;  1E96 B;  1FVH A;  1IXV A;  2CFU A;  2KXP C;  3UIN C;  2L9B A;  2QC9 A;  1PAQ A;  3E33 A;  3NQP A;  3O4Z A;  1RW2 A;  3CK9 A;  1HS6 A;  4B8C B;  5BT1 A;  4AV7 A;  3EU5 A;  4IRU A;  3W9G A;  5LX8 A;  4PS3 A;  4AIF A;  4LG6 A;  2FI7 A;  2V0P A;  5ENR D;  4DX1 A;  4EHM A;  4UI9 C;  3CVW A;  2X3M A;  2NXP A;  4EEC A;  5EDS A;  3FU3 A;  2CFZ A;  3OTN A;  3DXM G;  4YND A;  2P9S G;  3Q75 A;  3VTX A;  3U4T A;  1JCR A;  1OCR E;  2WQ7 A;  3ZHE B;  2F8X K;  2ZGG A;  1NZN A;  1EPU A;  1MYO A;  2L6B A;  1U3C A;  3FEX A;  3W9F A;  3DST A;  4ANU A;  1OXJ A;  4JC8 A;  1KT1 A;  1ZB1 A;  5AJD A;  3ML8 A;  4UWG A;  2VSN A;  2XGM A;  3PZ4 A;  4G24 A;  3D3M A;  3ZEF A;  3AS5 A;  2DBA A;  1NI1 A;  3SGH A;  3KSL A;  4RSY A;  1EF1 C;  3DWL G;  3DEP A;  1OT8 A;  5JJ6 A;  1HF8 A;  3AS4 A;  4UQY A;  3FTW A;  4R7L A;  3AG1 E;  3MYV A;  2WXR A;  4DX5 D;  2I1K A;  3IV0 A;  2F0Y A;  3LDZ A;  1SA5 A;  1DCQ A;  1D8D A;  5HS0 A;  2LAH A;  1ELR A;  3G2U A;  4Q69 A;  1O1R A;  3AG3 E;  3SHF A;  3LVR E;  4HOU A;  3D9L A;  3HIZ A;  4DX6 D;  2R05 A;  3GZ2 A;  3L82 A;  3L13 A;  1GW6 A;  5KNH D;  2BKK B;  4DX7 D;  4C9B B;  2H6G A;  2WXN A;  3JXI A;  4U96 D;  4L23 A;  2RD0 A;  3CLJ A;  3C3R A;  2YNQ A;  3QAR A;  3CEQ A;  5KNG A;  3ZYK A;  5BPP A;  4JW1 A;  2X6K A;  2E2E A;  3TAX A;  4TXP A;  2GRM A;  4WNF A;  3LS8 A;  1WAO 1;  3U9W A;  3U3W A;  4W9R A;  3NBN B;  1OWO A;  2WXL A;  1IHB A;  4U04 A;  4G2V A;  4BT9 A;  3BUA A;  3RSE G;  4MBG A;  3D9P A;  3E30 A;  1ELK A;  4KVO A;  3MV2 B;  2VSO E;  1N54 A;  4OVU A;  2DYS E;  3PS6 A;  3SY2 A;  5CEA A;  5CRU A;  1BD8 A;  4J0U A;  4JA7 A;  4HNA D;  4C48 B;  4WNE A;  3HXB A;  2IJG X;  3Q5M A;  4LNB A;  3SD5 A;  1P5Q A;  3HRA A;  3UIP C;  5KWD A;  4FJY A;  1KPS B;  2F37 A;  3OXL A;  4NRH B;  3GYZ A;  1IQR A;  4G25 A;  2J8S D;  2PQN A;  4DK5 A;  3SBS A;  3CSF A;  2WVI A;  5JJT A;  3SFY A;  3NOC D;  4MS6 A;  1AP7 A;  1UN9 A;  4PS7 A;  4Q94 A;  2ETC A;  4NAC A;  3HVE A;  4I1M A;  4UWF A;  4DLO A;  4NUR A;  3C98 A;  2P9K G;  1HH8 A;  3TWQ A;  5KJM A;  4J8E A;  3Q47 B;  5FZQ A;  2WXQ A;  2EIJ E;  3AU5 A;  3I4G A;  4UUC A;  4HQD A;  2LO6 A;  4HBD A;  4NIK A;  4BEP A;  1KLX A;  4Y6C A;  3L54 A;  2A4Z A;  1IYG A;  3G2T A;  2R02 A;  4U8Y D;  2DCP A;  4G8L A;  4ZFH A;  4LNG A;  2NSZ A;  3ABL E;  1S70 B;  2RG8 A;  2H6H A;  5CCM A;  2J9Q A;  2VQ2 A;  3NZU A;  1FCH A;  3MGB A;  3UKR G;  3DBS A;  3RRM B;  4TXR A;  4BY6 A;  2PM6 A;  3HG0 D;  3L08 A;  2RFA A;  3D9H A;  3UIO C;  3NF1 A;  4XIF A;  3SFZ A;  3CVN A;  5EX0 A;  2AVP A;  1N4P A;  2I6H A;  3E32 A;  5G05 J;  1Q2Z A;  4M7C A;  5AIJ A;  3ZYM A;  2DZO A;  2ZIR A;  1X5B A;  2IU1 A;  4XZ4 A;  3L22 A;  4RQI A;  5G55 A;  5FQ6 A;  2R59 A;  3U66 A;  4C0E A;  3AAA C;  4C0M A;  3Q79 A;  3TG4 A;  4JD2 G;  3QOU A;  2P9N G;  2FO1 E;  2X38 A;  4YDE A;  3IHY A;  4XX5 A;  3R9A B;  2F8Y A;  4A63 B;  3G2W A;  2BUG A;  2WQH A;  4KZC A;  2ZGD A;  4D10 C;  2AXU A;  3LXU X;  1UG3 A;  1DVP A;  5A7D B;  2R03 A;  3FTV A;  4J6I A;  3MX3 A;  2J09 A;  2CHX A;  1SQM A;  3FTU A;  4BX8 A;  4B94 A;  4EZK A;  3PRE A;  1U3D A;  2OVF A;  4HLL A;  4ZHB A;  1H2T C;  2V4L A;  4OAU C;  2VTB B;  4BSZ B;  2H6F A;  4YVO A;  4BTA A;  2AXZ A;  1LD8 A;  3MA5 A;  3APC A;  4G11 A;  3FH8 A;  2KBX A;  5FQ8 A;  2R2L A;  2DIW A;  3DSW A;  1MX4 A;  2Y69 E;  2OOE A;  3QB2 A;  2PQR A;  3FTZ A;  4U95 D;  4DJA A;  2HM8 A;  1JPL A;  3ZYQ A;  4GCN A;  3HHM A;  1S63 A;  1JCQ A;  1XNF A;  3CHM A;  2ZIS A;  1S64 A;  1QNF A;  3HVE B;  2XGO A;  3DSU A;  2IOL A;  3ULY A;  2EIM E;  5ENN A;  3PUJ A;  5J08 A;  3ZXP A;  4HVB A;  2WXH A;  3QWP A;  3LY7 A;  4IN3 B;  3FTX A;  1QBQ A;  1HXI A;  3TWT A;  2WMN A;  2J4D A;  3CGH A;  2EIL E;  1N52 A;  1E7V A;  3R9M A;  3CIA A;  1KZO A;  3QAQ A;  4GYO A;  1EYH A;  3NZS A;  2X6F A;  4TV3 A;  1ELW A;  1QZ2 A;  3ONK A;  2I9C A;  3CVX A;  4OVV A;  2XQ0 A;  4K5C A;  4HOR A;  5HKP A;  1TNU A;  3PRZ A;  1N0Q A;  2BKG A;  3LJ3 A;  5KJK A;  1HX8 A;  2X6J A;  3ML9 A;  1B89 A;  3MKQ A;  4RLY A;  1UJK A;  2KCV A;  4GZD A;  2QYJ A;  3FEY A;  4GYW A;  3ZNG A;  1UN8 A;  2VGX B;  1N95 A;  5G04 J;  4Y6W A;  2RKK A;  4BES A;  4L7T A;  3D9J A;  3ZRH A;  4E85 A;  2WQ6 A;  1LD7 A;  4LER A;  2MHK A;  4GAA A;  4U8H A;  4FUL A;  4N3A A;  4AJW A;  3UX4 A;  3Q78 A;  3T9K A;  2CG2 A;  3EHR A;  1E8Z A;  1K1A A;  1IHG A;  4TUM A;  4QQI A;  3P2B A;  4U8V D;  5HQ8 A;  4AOF A;  4OYS A;  5B1B E;  4GZ5 A;  4N5C A;  3UT4 A;  4KVM A;  1IQU A;  2CHZ A;  3QC1 A;  4HXI A;  2IFU A;  3S7D A;  2ZU6 B;  4QFV A;  1DCE A;  3N71 A;  4CRW A;  4FU3 A;  2DZN A;  2MOW A; 
#chains in the Genus database with same CATH homology
 3TAX A;  2GRM A;  1PY1 A;  4HLE A;  1Z6T A;  2V5F A;  3JYS A;  1W3B A;  2LNI A;  2XGS A;  3D9M A;  2HO1 A;  4ACL A;  2C0L A;  3ZVV A;  4WNF A;  3LS8 A;  3SBT B;  1WAO 1;  3T5X A;  4GA1 A;  1H2V C;  3U9W A;  3U3W A;  4BWR A;  3G2S A;  4W9R A;  4AXH A;  1OWO A;  2WXL A;  4ABN A;  3TL5 A;  4U04 A;  2Q7F A;  3FUL A;  4G2V A;  2I2O A;  4BT9 A;  3APD A;  4JXT A;  1INZ A;  3D9P A;  4FLH A;  4P29 A;  5T3R A;  4EBA G;  2JEK A;  4CEM A;  3LKU A;  1ELK A;  2VGX A;  3I3N A;  3MV2 B;  4KVO A;  4WWP A;  5G04 C;  5C1D A;  2VSO E;  3CHO A;  4JA9 A;  1N54 A;  3ONL A;  2Y4T A;  4UQZ A;  2WMO A;  1DNP A;  4JPS A;  4H7X A;  3R7Q A;  1OUV A;  3I4R B;  4OVU A;  4RVB A;  3MCX A;  3PS6 A;  4NQ0 A;  3S2A A;  4I6E A;  2BF0 X;  3PEU B;  4MKT A;  5KJN A;  4J0U A;  1JUQ A;  4I6G A;  4JA7 A;  2UY1 A;  2E0I A;  2XPI A;  4HOS A;  4WNE A;  5LCW C;  2IJG X;  3Q5M A;  3SD5 A;  4FJZ A;  1P5Q A;  2WXF A;  3CVU A;  4WNG A;  4WWO A;  3IKO B;  4UWL A;  2ILR A;  2LAI A;  3IHV A;  4FJY A;  4UWH A;  3OXL A;  4GMJ A;  4NRH B;  3GYZ A;  1HG2 A;  1IQR A;  3TXM A;  4G25 A;  3S7B A;  4TRQ A;  1MQS A;  4ANV A;  2PQN A;  4JHR A;  2XPZ A;  4DK5 A;  3SBS A;  5G2N A;  4MRU A;  2KAT A;  3JUI A;  3S7J A;  4F53 A;  2WXO A;  3EHN A;  1E90 A;  5ANL A;  3BEE A;  3CSF A;  2HYZ A;  3MV3 B;  2WVI A;  1A17 A;  2J4B A;  3FU6 A;  3VTY A;  2VSX E;  4AY5 A;  5JJT A;  3L6A A;  4A3T A;  1E8X A;  2QY7 A;  4GZC A;  1H2U A;  2P58 C;  3FUJ A;  4ILH B;  2HR2 A;  3PEV B;  4KYO B;  4UI9 K;  4N2Q A;  3LY8 A;  1TJC A;  2WXK A;  2CG3 A;  3ZXS A;  5A23 A;  3PUK A;  2WXM A;  4HOQ A;  4MS6 A;  3CVQ A;  1UN9 A;  4N3B A;  4PS7 A;  1UW4 B;  4Q94 A;  4KZ0 A;  4NAC A;  3RRN B;  3HVE A;  1WM5 A;  2J49 A;  4I1M A;  4UWF A;  3D9O A;  4DLO A;  4NUR A;  4XI9 A;  3C98 A;  3HYM B;  1HH8 A;  2XCC A;  3EIQ C;  5FQ4 A;  4CGV A;  4DI4 A;  3EJN A;  3IEG A;  3ASD A;  3PH0 C;  5KJM A;  4J8E A;  4AM9 A;  3Q47 B;  5FZQ A;  3QWW A;  3RK6 A;  2WXQ A;  3E4B A;  5JHB A;  3FY4 A;  2Y4U A;  2CHW A;  3AU5 A;  3KEZ A;  3I4G A;  2I1J A;  5JJ7 A;  4ANX A;  2BTD A;  2L0I A;  4FP7 A;  5HI7 A;  3ENE A;  3ULQ A;  3QWV A;  3VLF A;  4FC8 A;  3OXG A;  2KZT B;  4HFG A;  2LO6 A;  3LY9 A;  5DBK A;  4EPZ A;  2OVB A;  2VYI A;  1KLX A;  2X6I A;  5BUZ A;  3K9I A;  4Y6C A;  3MJW A;  4GCO A;  3L54 A;  4GZ3 A;  3SI5 A;  3PZD A;  2A4Z A;  3CHQ A;  1E8Y A;  3CVL A;  2ION A;  3Q49 B;  5FQ7 A;  1OWN A;  3FFL A;  5LP0 A;  3L16 A;  4L2L A;  4L2Y A;  2VSY A;  1IYG A;  2FBN A;  4BFR A;  3D9I A;  1Y8M A;  3G2T A;  4G26 A;  3ZHE A;  4A1S A;  5AJL A;  4XE0 A;  4IUL A;  2DCP A;  2L6J A;  3LYA A;  4U07 A;  3RO2 A;  1L5J A;  2KC7 A;  3Q4A B;  3CST A;  2NSZ A;  4CDR A;  4A55 A;  2YQ8 A;  5LFA A;  2RG8 A;  5ANR A;  5CCM A;  4MLP A;  1KT0 A;  2J9Q A;  2VQ2 A;  3NZU A;  3GZS A;  2Y3A A;  3LCA A;  2WXP A;  1FCH A;  4GML A;  2J08 A;  3RJV A;  3MGB A;  3DBS A;  4M3O A;  3RRM B;  2JLB A;  3FUD A;  4BY6 A;  2PM6 A;  3ZW3 A;  3L08 A;  2J07 A;  4XI0 A;  2V8S E;  3FUM A;  3CQC B;  3U64 A;  3NF1 A;  3PVL A;  4BT8 A;  3FUN A;  4WND A;  4XIF A;  2WXI A;  3SFZ A;  4YVQ C;  5KCM A;  5AEN A;  3CVN A;  2YIN A;  5EX0 A;  2UWJ G;  2AVP A;  5CHE E;  4EZJ A;  2I6H A;  2KM4 A;  5G05 J;  2GRL A;  2C0M A;  3ESK A;  4K0R A;  4BTB A;  5AIJ A;  3ZYM A;  3B7S A;  4I1O B;  2AXV A;  3GW4 A;  4G23 A;  1X5B A;  4J8D A;  2IU1 A;  3AS8 A;  3ASG A;  2MRI A;  4U0S A;  4XZ4 A;  3L22 A;  4F7A A;  3ZIM A;  3FHE A;  4LCT A;  3L17 A;  4ATG A;  4CDN A;  1LF8 A;  3EDT B;  4DPR A;  5G55 A;  4LRZ A;  1ZU2 A;  2R17 C;  5FQ6 A;  1HU3 A;  4I17 A;  3FUH A;  2R59 A;  4KMO A;  3U66 A;  5J90 A;  2PZI A;  4HOT A;  4C0E A;  2XCB A;  3BG0 B;  4I9E A;  5A6C A;  4EBA A;  4C0M A;  4XKC A;  4J8S A;  5C2Y A;  3TJP A;  3TG4 A;  4G1T A;  4B89 A;  4BX9 A;  4UWK A;  4UQX A;  3QOU A;  3ZPJ A;  3FTY A;  3CVY A;  1TEZ A;  4I9C A;  5LOZ A;  2X38 A;  4FLB A;  3QK0 A;  5T8I A;  3QKY A;  2XRZ A;  3IHY A;  3PNT B;  4XX5 A;  3FDH A;  3R9A B;  1HZ4 A;  2OND A;  4B0Z A;  3UT7 A;  3VLE A;  2PL2 A;  5ARF A;  5BW8 C;  1Z3Y A;  1E7U A;  3SNX A;  3EHM A;  4GB9 A;  1JWF A;  4PUC A;  5FZS A;  1H19 A;  4WUY A;  1QQE A;  3APF A;  3TXN A;  4FA6 A;  4UI9 J;  5BV0 A;  3G2W A;  1YA0 A;  2BUG A;  2WQH A;  4KZC A;  4PH4 B;  5E76 A;  4JHJ A;  4D10 C;  2AXU A;  1UJJ A;  3CV0 A;  3IBE A;  3KAE A;  2KCL A;  5BNW A;  2XEV A;  5CCL A;  3PE3 A;  3LXU X;  1UG3 A;  2IOS A;  3RIB A;  1DVP A;  3MKR A;  4IYP A;  4GA0 A;  2KCK A;  4DLQ A;  5A7D B;  3ASF A;  4J6I A;  3FTV A;  4RG9 A;  4ILI A;  3MX3 A;  3JCK C;  2J09 A;  2CHX A;  2WM9 A;  1H0A A;  1SQM A;  1NA3 A;  3FTU A;  4JL0 A;  3SF4 A;  1E8W A;  4J8F A;  4ILG A;  4BX8 A;  2R5S A;  3TGO A;  5FJY A;  4B94 A;  3FUE A;  2AWI A;  5EKQ D;  4EZK A;  3CVV A;  3PRE A;  1U3D A;  5CMW A;  2OVF A;  3FUF A;  3WXX A;  2UY1 B;  1H2T C;  4KBQ A;  4WAF A;  2V4L A;  5D0O D;  1SZ9 A;  4KT6 B;  4AP2 A;  2VTB B;  2YHE A;  4YVO A;  4I6J A;  1HO8 A;  1WY6 A;  1HE8 A;  4BTA A;  2GGF A;  2AXZ A;  4U63 A;  3MA5 A;  3FWV A;  4HS2 A;  4O6F A;  3BG1 B;  3MZL B;  3RKV A;  2QFC A;  3APC A;  5G05 C;  1H6K A;  2L0T B;  2WXG A;  3CKB A;  1JWG A;  2OV8 A;  4G11 A;  2X6H A;  4GYY A;  3FH8 A;  1E96 B;  1FVH A;  4I2W A;  5FQ8 A;  2CFU A;  2IQC A;  3PNL B;  2DIW A;  2LSV A;  1ZBP A;  3MKQ B;  4L1B A;  4LEU A;  2OOE A;  3FP3 A;  3I5P A;  2PQR A;  3LVQ E;  2L9B A;  3FTZ A;  3QB2 A;  3S7F A;  4DJA A;  2HM8 A;  3T8M A;  1PAQ A;  3AU4 A;  3UUX A;  1JPL A;  3ZYQ A;  3FU0 A;  4JEU A;  4JEH A;  4GCN A;  2AW6 A;  3HHM A;  1XNF A;  3NQP A;  3O4Z A;  3TG5 A;  1S0P A;  3CK9 A;  3UQ3 A;  1HS6 A;  4B8C B;  5BT1 A;  4URK A;  3DPD A;  4PS8 A;  3CHM A;  1EDU A;  3ESL A;  4LUN U;  4A3V A;  3OAW A;  1QNF A;  2VGY A;  3FU5 A;  3HVE B;  2XGO A;  4AV7 A;  2IOL A;  4F3V A;  4IRU A;  5T4Y A;  5E75 A;  3B13 A;  4E6H A;  5ENN A;  5LX8 A;  3B7T A;  4PS3 A;  4AIF A;  4ACK A;  3PUJ A;  2FI7 A;  1HFA A;  3P1U A;  5J08 A;  4JHK A;  3JQ0 A;  2V0P A;  2WXH A;  3QWP A;  4HVB A;  4FHK A;  3QDN A;  3LY7 A;  4IN3 B;  3FTX A;  3MEK A;  1HXI A;  5CMY A;  1NP7 A;  2WMN A;  4N39 A;  4UI9 C;  5FWQ A;  1OWM A;  2J4D A;  4AVX A;  3CVW A;  3CGH A;  2X3M A;  4CT0 A;  1N52 A;  4GZ6 A;  3CKC A;  2YHC A;  2NXP A;  1E7V A;  4FHJ A;  4GA2 A;  4N3C A;  3LEW A;  5DIZ A;  3CIA A;  3PE4 A;  4EEC A;  5EDS A;  3FU3 A;  4K03 A;  3URZ A;  1HG5 A;  4A1G A;  3QAQ A;  4GYO A;  2CFZ A;  3OTN A;  1OWL A;  1EYH A;  4U0U A;  3CQG B;  3NZS A;  3FUK A;  5D0Q D;  3KD7 A;  2X6F A;  4PDX A;  4YND A;  5BV1 A;  3LPZ A;  3VTX A;  3CHS A;  3U4T A;  3CR3 A;  4TV3 A;  1ELW A;  4CCA A;  1QZ2 A;  4CDM A;  2WQ7 A;  3ZHE B;  4H7Y A;  1NZN A;  1EPU A;  3CHR A;  4CT4 A;  3ONK A;  3QJZ A;  4RG6 A;  3Q15 A;  3FH7 A;  2WB2 A;  1U3C A;  2GW1 A;  2I9C A;  3FEX A;  4ANU A;  3CVX A;  4AEZ C;  2VTB A;  4OVV A;  2KZT A;  4FAD A;  2XQ0 A;  4I43 A;  4HOR A;  4XKB A;  4JC8 A;  1KT1 A;  4BSX A;  3VLD A;  3PRZ A;  1XGW A;  1Y6I A;  3CK8 A;  3FTS A;  5AJD A;  3ML8 A;  4UWG A;  2VSN A;  3LJ3 A;  3SZ7 A;  3UMV A;  5KJK A;  2XGM A;  1MHQ A;  3R7R A;  1TJF A;  4G24 A;  1PC2 A;  1BPO A;  1HX8 A;  3D3M A;  3ZEF A;  3UPV A;  2X6J A;  2FF4 A;  3ML9 A;  3AS5 A;  1B89 A;  2DBA A;  5EX3 A;  3MKQ A;  1Z3X A;  1UJK A;  2WXJ A;  2KCV A;  3B7U X;  3FEY A;  3PDN A;  4GZD A;  4GYW A;  4ME2 A;  5FT9 A;  3SGH A;  4KXK B;  3KS2 A;  4JVS A;  1UN8 A;  4TUU A;  4RSY A;  3D9K A;  3ASH A;  2FO7 A;  1EF1 C;  2VGX B;  4Q96 A;  5G04 J;  2EQX A;  3O48 A;  4Y6W A;  4EQF A;  4N2S A;  1VDY A;  1NA0 A;  5JJ6 A;  4L7T A;  2LSU A;  3D9J A;  3ZRH A;  5FTP A;  1HF8 A;  2MOW A;  3OXF A;  3RRU A;  3AS4 A;  3B7R L;  4E85 A;  1OWP A;  2C2L A;  4UQY A;  3FTW A;  2WQ6 A;  4R7L A;  4I1A A;  4JZY A;  2FEZ A;  3EIJ A;  3RO3 A;  3MYV A;  2WXR A;  2PM7 A;  4GPK A;  2I1K A;  2XPY A;  3IV0 A;  4LER A;  5LCW J;  4APF A;  2MHK A;  3LDZ A;  4GAA A;  3T5V A;  4F1S A;  3ZN3 A;  3ZGQ A;  3ZFW A;  5JHA A;  4AY6 A;  4U8H A;  2LAH A;  1ELR A;  3G2U A;  4Q69 A;  4FUL A;  3RU0 A;  3SHF A;  3LVR E;  4N3A A;  4V3I A;  4EZL A;  4AJW A;  4HOU A;  2IF4 A;  2WPV A;  3FUI A;  3QNK A;  3D9L A;  3UX4 A;  3HIZ A;  3GZ2 A;  3HDX A;  2CG2 A;  4WWN A;  1FVF A;  1E8Z A;  3CHP A;  3L13 A;  1SZA A;  1GW6 A;  4U0Z A;  3CK7 A;  4I2Z A;  1IHG A;  4C9B B;  3FH5 A;  3D9N A;  2NC9 A;  3P2B A;  2WXN A;  3CVP A;  5HQ8 A;  4DI3 A;  5ARG A;  3ZYL A;  4AOF A;  4OYS A;  5KJL A;  2M63 A;  4L23 A;  2XRY A;  4GZ5 A;  2RD0 A;  3CLJ A;  4N5C A;  5AYW D;  3UT4 A;  4KVM A;  3GZ1 A;  3UT8 A;  1IQU A;  2A5U A;  2CHZ A;  2VJ8 A;  2YNQ A;  3G2V A;  2IFU A;  3QC1 A;  4HXI A;  4ANW A;  3S7D A;  4CGW A;  3JQ1 A;  2FUL A;  4APO A;  2ZU6 B;  2XHE A;  4QFV A;  4GU5 A;  3QAR A;  3N71 A;  4CRW A;  3CEQ A;  3ZYK A;  4B8A A;  5BPP A;  5M72 A;  4FU3 A;  5FZR A;  4JW1 A;  2X6K A;  2E2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...