3VTXA

Crystal structure of mama protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
181
structure length
181
Chain Sequence
TTTIYMDIGDKKRTKGDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAVKYFKKALEKEEKKAKYELALVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords MamA
publication title Inter-phylum structural conservation of the magnetosome-associated TPR-containing protein, MamA
pubmed doi rcsb
source organism Candidatus magnetobacterium bavaricum
total genus 75
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13414 TPR_11 TPR repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vtxA00
3TG4A 3CVNA 3PE3A 3ESKA 2C0LA 3OXLA 2IFUA 3PDNA 5M72A 2UY1B 3FWVA 3RU0A 4I1AA 4I9EA 2OOEA 4GYWA 3MV2B 2KCKA 2FEZA 5A7DB 3AS4A 1P5QA 5KJKA 5JJTA 4GCNA 5EX0A 4XIFA 4YNDA 2MHKA 4U07A 2Y4UA 4AY6A 3OXFA 3Q47B 2FO7A 3U3WA 5DIZA 3S7FA 3ZHEB 3VTXA 2VSYA 3LY8A 4YVQC 2VYIA 4GPKA 5EX3A 4NRHB 2YHCA 1ZBPA 2JLBA 4B94A 2AVPA 4UQYA 3OXGA 2PQRA 4I2ZA 4F3VA 3ZGQA 4BWRA 4GZ6A 1Y8MA 3RKVA 1A17A 5HI7A 4YVOA 2KATA 3N71A 3ZFWA 4WNGA 3CKCA 5BT1A 4GA1A 1NA3A 1OUVA 3ASDA 4WNDA 3CK8A 5FTPA 1PC2A 3Q5MA 5EKQD 3ZN3A 4H7YA 4XI0A 1WAO1 5FZSA 3ULQA 5FZRA 2FBNA 3CKBA 3LY7A 4GA2A 4ABNA 4G1TA 4HOQA 2HR2A 5FZQA 3EDTB 3QWWA 2VGXA 2C2LA 2HO1A 1B89A 2VSNA 3RO2A 4BT8A 3Q15A 3KS2A 2V5FA 3GYZA 2XGSA 4G2VA 2E2EA 3UUXA 4UI9C 2ONDA 5ARGA 2WPVA 1E96B 4CGVA 1KT0A 2HYZA 2LSVA 4WNFA 3UQ3A 3K9IA 1NA0A 2IF4A 4N5CA 3ASGA 2P58C 4HOSA 4N3BA 1IHGA 2XEVA 2XCCA 2Q7FA 4J8DA 3U4TA 2XCBA 5G05C 3KAEA 3AS8A 4Y6WA 3Q49B 2VQ2A 3JYSA 4G23A 3CEQA 1NZNA 3GZ1A 3AS5A 3CVPA 1TJCA 4HOTA 3QKYA 2NC9A 4O6FA 1QZ2A 3CVLA 3PE4A 3SZ7A 3FP3A 5LCWC 4GZ3A 4UQXA 2UY1A 4RG6A 5KJNA 3ASFA 3S7DA 1KLXA 3E4BA 5JJ6A 2PQNA 2GW1A 2BUGA 5D0OD 5D0QD 5G04C 4KYOB 5CCMA 4IN3B 5CCLA 3CVQA 5BW8C 3TG5A 4GYOA 4WNEA 4UI9J 1W3BA 4NQ0A 4JA9A 3ZHEA 1QQEA 1KT1A 2L6JA 4HOUA 4H7XA 3S7JA 3MKRA 3MA5A 1FCHA 2PL2A 1ZU2A 2LSUA 1ELWA 3QOUA 4BTBA 3R9AB 5BNWA 3URZA 4HORA 2YQ8A 4GA0A 4CGWA 4U0ZA 5ARFA 4APOA 3Q4AB 5KJMA 4JHRA 2I6HA 4AY5A 4XI9A 4N3CA 2R5SA 3MEKA 2DBAA 2LNIA 4ME2A 4WUYA 2FF4A 4EQFA 2J9QA 4Y6CA 4KXKB 1HZ4A 3RO3A 3ASHA 4W9RA 4KBQA 3RIBA 5LCWJ 1HH8A 1HXIA 2KCVA 3VTYA 3SF4A 2VGYA 4JL0A 3LCAA 5DBKA 5C1DA 4I2WA 4U04A 2XGOA 3NF1A 1ELRA 4AM9A 3CK7A 3GW4A 5FJYA 2WQHA 4BT9A 3LPZA 3RJVA 4G24A 4CDRA 4GCOA 4A1SA 3CV0A 5G04J 2VGXB 1IYGA 2QFCA 4RG9A 4N39A 1YA0A 4UQZA 4U0SA 3S7BA 4N3AA 2PZIA 2XPIA 5FT9A 4BTAA 4J8EA 4G25A 3LKUA 4JA7A 5KJLA 4U0UA 3QWVA 4UI9K 3LYAA 3FFLA 4N2SA 5A6CA 2KCLA 3BEEA 1WM5A 3MV3B 2C0MA 3ZPJA 3UPVA 4I9CA 4GZ5A 5JJ7A 3KD7A 4LEUA 4J8FA 4N2QA 2FI7A 3QDNA 4GYYA 5CHEE 3HYMB 1XNFA 2XGMA 2KC7A 3TGOA 4G26A 3TAXA 5G05J 3GZ2A 3IEGA 3QWPA 2Y4TA 3WXXA 4AIFA 3O48A 4J0UA 5HQ8A 3LY9A 3CK9A 4I17A 2UWJG 5AYWD
chains in the Genus database with same CATH superfamily
3TG4A 3GZSA 4UWFA 2WXPA 4A3VA 3OXLA 3CQGB 4RQIA 1U2VG 3Q7AA 2CFZA 1HU3A 1DVPA 2KM4A 2OOEA 3BG1B 4GYWA 4GTQA 4FJYA 4RLYA 4JPSA 4GTSA 2KCKA 2WXKA 5KJKA 5JJTA 2IOSA 3FTXA 5E76A 4GCNA 1JPLA 5EX0A 4LRZA 2IQCA 3ASOE 1UG3A 3AAAC 1N4SA 4AY6A 5ITZF 4AOFA 3Q47B 1HF8A 3DSVA 3G2UA 3ZHEB 3ABKE 4F53A 5CERB 2VYIA 4ZHBA 5JMND 2WXIA 4ANWA 4DX6D 1HG5A 3P1UA 4TXQA 5ENQD 1IXVA 3RRNB 1O1RA 2JLBA 2AVPA 5AJLA 2F8YA 3V2OA 4GZCA 5T3RA 4BETA 4F7AA 1N0QA 4L2LA 4GTPA 2DYRE 3LDZA 4NACA 3ASDA 4FU3A 1PC2A 1IHBA 3ZN3A 3UMVA 5AQ9A 4DLQA 4EZJA 2BEDA 3LY7A 4I6EA 5AARA 4DI4A 3V79K 4HRNA 1FT2A 1OCCE 5EN5D 2VGXA 3B95A 5BUZA 2V5QC 1B89A 5G2NA 4BT8A 3JUEA 3GYZA 2I9CA 2E2EA 1AWCB 2ONDA 4LCTA 3ZUVB 4CGVA 1FVHA 1KT0A 5ENOD 2LSVA 3K9IA 3ASGA 2GRMA 2DVWA 1E7UA 1OWPA 5FINA 3G2WA 3TL5A 4L7TA 3HXEA 1Z3YA 2H6FA 3IKOB 2Q7FA 3D9JA 5EIBE 5CBOA 3DSTA 2RG8A 3AS8A 4XEIG 1MJ0A 1UW4B 3VLEA 4A3TA 4TXPA 4GMJA 3LXUX 4AXHA 3RSEG 3T5VA 4CT0A 3JXIA 3AS5A 3CVPA 4URKA 3HVEB 3CHMA 4KT6B 3UXGA 3BQOA 1BI7B 4KZCA 4Q96A 2ZIRA 1LD8A 2MYOA 4WWNA 1QNFA 2UY1A 1TYQG 4RG6A 4CZ2D 5KJNA 4FA6A 3PNTB 1MZCA 3O4ZA 3VLFA 3FTVA 1HS6A 2DZNA 3FEYA 2CHZA 4I1MA 2XS8A 4I43A 2NXPA 5G04C 4LNGA 4KYOB 5CCMA 4J7WA 4ATGA 4B8CB 4CCAA 3TG5A 4K5CA 4WNEA 3KSLA 4I6GA 4GZDA 4JA9A 3JCKC 1EYHA 1JCSA 4UUCA 2L6JA 3PRZA 4H7XA 2LXMA 1EPUA 1DCEA 4GB9A 3FULA 1ZU2A 3HVEA 2VJ8A 2XENA 2EIME 4L2YA 3PVLA 5BNWA 4CGWA 4U0ZA 3CVVA 2WXFA 2R17C 4FHKA 3Q4AB 3CVUA 1OWOA 3I3NA 4HB5A 5LOZA 2OEVA 3HXFA 4JZYA 3ZRHA 4GTOA 4MRUA 2R05A 4N3CA 2DBAA 1MHQA 4WUYA 2OEWA 3DPDA 4EQFA 2J9QA 4Y6CA 3R9MA 3CGHA 3RO3A 3C3RA 4XZ4A 3ASHA 4C0MA 3HXCA 2P9PG 3L22A 4KBQA 5KNGA 4C9BB 2PM7A 5KNHD 3CHOA 4GU5A 3SF4A 2VGYA 4B93B 4TUMA 4B0ZA 4QQIA 4U04A 4AP2A 4AM9A 1UJKA 3PEUB 3GW4A 3KEAA 4TV3A 3EHRA 2R2LA 2QZAA 3CHQA 4A1SA 2B0OE 1IYGA 2QFCA 3AG3E 4JEUA 4RG9A 3TWUA 4U63A 2IU1A 3AU4A 1D8DA 4TXRA 2OV8A 2P2CP 4J8YA 4HNAD 2I1KA 3FEXA 3LKUA 2HE0A 3HRAA 1N9AA 3D9KA 4DX5D 3PEVB 4JA7A 1V54E 3D9HA 3FUNA 3LYAA 5JA4D 4KVOA 2VTBB 5A6CA 3IHVA 4CDNA 4EBAG 3UPVA 2X6KA 4I9CA 4K5AB 1HE8A 3IXEA 3QDNA 3MX3A 5CHEE 3C5RA 3CVYA 2NYJA 1SVXA 2Y0BG 3TAXA 3DXKG 2JABA 4DX7D 2J07A 3FU5A 2AW6A 1TNUA 4U8VD 3QWPA 2Y4TA 3AJIA 4BERA 3O48A 5HQ8A 3ESLA 4Q69A 2UWJG 2P9SG 4XKCA 4R7LA 1IQRA 4U8YD 2KZTA 3ESKA 5H7PA 3HHMA 4FLHA 4ANXA 3FU6A 3RU0A 1N4RA 4EBAA 3FTWA 1UJJA 1N54A 3MV2B 3NOGD 2WXOA 5FQ4A 2V0PA 3APDA 4JHKA 5BXOA 1K8KG 3JUIA 4FP7A 4ZFHA 4XIFA 4YNDA 2MHKA 4WAFA 2Y4UA 4U95D 4HI9A 3EHQA 3U3WA 2VSXE 4AV7A 2ZGDA 3L08A 5HKPA 4XE0A 4G8LA 4YVQC 2X38A 4GPKA 2ETAA 5EX3A 2X6JA 4DLOA 4CDMA 1ZBPA 1MX2A 2YINA 5KWDA 2PQRA 4F3VA 5J90A 4GZ6A 1Y8MA 2QC9A 1SZ9A 2X6HA 5HI7A 1FT1A 1PAQA 1Q2ZA 4PUCA 4G8KA 3DPYA 1JCRA 3ZFWA 4WNGA 2WXMA 3SO8A 3CK8A 2EIKE 2YHEA 4H7YA 2BKKB 3MGBA 4MBGA 2OVBA 2IONA 3PZ1A 5FZRA 3E37A 5LP0A 2XPZA 3DWLG 2H6HA 1TNBA 1NL4A 4A55A 2LAIA 4GA2A 1SW6A 4G1TA 5AIJA 2HR2A 3QWWA 1DNPA 2VSNA 1H19A 3RO2A 4GTMA 3CHSA 3UUXA 5ARGA 2WPVA 1E96B 2JEKA 3G2TA 3Q9UC 2V4HC 3EIQC 3C3OA 3CHPA 4WNFA 3RRMB 3UQ3A 2IF4A 4N5CA 1KZOA 2P58C 3TWVA 2DCPA 2GRPB 2XEVA 3FUMA 4I6JA 2WQ6A 2XZDG 5EIDA 3KEZA 4J8DA 4APFA 4A1GA 5G05C 4FADA 4I1OB 3JXJA 1K1AA 4JHJA 2VQ2A 3JYSA 3LVQE 1H0AA 4G23A 3C3QA 1DC2A 4JD2G 4D10C 3NAWA 3FTYA 3LJ3A 2J4DA 4Q94A 3AG1E 3ZYLA 2NC9A 5ENSD 3S2AA 4K03A 1QZ2A 5AQ7A 5HRYA 1VDYA 4ILGA 3SZ7A 4UQXA 4HRLA 2WMOA 4CT4A 3ZXPA 3UIPC 3SNXA 2VSOE 2VGEA 3SI5A 4C0EA 5JJ6A 4O1OA 2GRRB 2BUGA 5KBAA 3EHMA 2ZISA 5CCLA 5BPPA 4PDXA 3WG7E 3UKRG 3CVQA 1LTXA 2RFMA 3TWWA 4UI9J 3ZHEA 3FUDA 2R02A 1QQEA 3L9TA 4HOUA 2F8XK 3NZSA 1Y6IA 1U3CA 2P9LG 3PH0C 1FCHA 2PL2A 1SQMA 2LSUA 4KVMA 1Z6TA 1ELWA 3QOUA 4BX8A 1RW2A 3PZ3A 3R9AB 2P9KG 3ULYA 3FH5A 1MQSA 3W9FA 4LUNU 4HORA 2V8SE 3PZDA 5FQ8A 3FUIA 4APOA 3TWQA 1XGWA 2LXLA 3IHYA 4JHRA 4AJWA 3J5QB 4XI9A 3Q9NC 4G11A 2LNIA 3Q7FA 3SY2A 2FF4A 1E8YA 4LNUD 5AQBA 2OCCE 4UWLA 3SGHA 4EECA 3B13A 3RIBA 1S0PA 4BSZB 4B89A 1HXIA 2KCVA 3SFXA 5DBKA 4LG6A 4I2WA 3EU9A 2FO1E 3NF1A 4BFRA 2WXLA 3R7RA 1UN8A 1L5JA 5FJYA 4ILIA 4BT9A 3V2XA 1S70B 3B7BA 5B1BE 1SA5A 3LVRE 1TNOA 4N39A 3QJZA 4UQZA 2BF0X 4ANVA 2WVIA 2BKGA 2XPIA 3LS8A 3UM0A 4HS2A 4LNBA 2CFUA 3SD5A 2AWIA 3DSSA 3I4GA 4U0UA 3QWVA 4ANUA 1S64A 5B3SE 3B7TA 4GTRA 3E34A 3ML9A 1ELKA 5CRVA 2KCLA 4N2SA 3BEEA 4GMLA 1WM5A 5AJDA 3MV3B 2C0MA 2P9NG 3FH8A 3L16A 1H2TC 4GZ5A 3APFA 4EPZA 2FI7A 4BSXA 2J49A 3U66A 3CQCB 4UWHA 5G05J 3APCA 3B7SA 5AENA 3WXXA 1E90A 4AIFA 3T5XA 3LY9A 3CK9A 4I17A 5AYWD 2Y3AA 3CVNA 1N4PA 2IY0C 2WXJA 2C0LA 2QY7A 5D2MC 4EZLA 2QYJA 5M72A 4JXTA 4J6IA 3UT4A 3FWVA 4I1AA 4B8AA 2I2OA 1QYMA 5FWQA 3UM2A 3ONKA 4JB8P 3C72A 4N5QA 5CECB 3TWRA 1EDUA 2RKKA 5A7DB 3AS4A 1P5QA 4YDYA 3ISMC 3ML8A 3FU0A 5EYLA 1WG0A 2ZXWE 4CEMA 5CRUA 1NI1A 2ZU6B 3CSTA 2FO7A 3D9OA 4OAVB 3S7FA 1JCQA 3VTXA 2AXUA 4GAAA 4BY6A 1OWMA 4MS6A 3OAWA 4K5BA 3LY8A 2WXQA 3W9GA 1KPSB 3NBNB 4NRHB 4AEZC 3SQVA 1JUQA 2L0TB 4B94A 3PUKA 4UQYA 3I5PA 3F6QA 4RSYA 3UM3A 2GRNB 2I1JA 2P9IG 1RZ4A 3TWXA 2XHEA 5D66A 3N71A 3HDXA 2X6IA 4OVVA 2IO2C 1K3ZD 3MJWA 3CKCA 4GA1A 1OUVA 4WNDA 5FTPA 3Q5MA 4XI0A 2EILE 1HFAA 1WAO1 1YMPA 3ZVVA 4HVBA 3D9PA 1SZAA 3J5PA 2CG3A 4JC8A 4ABNA 1HX8A 2H6IA 5ENNA 3LEWA 4ILHB 4HOQA 5IY5E 2CHWA 5A23A 3ABLE 2C2LA 4HFGA 3KS2A 2XGSA 3KSQA 3PREA 2BTDA 2FULA 3AG2E 4UI9C 2XRYA 3EUVA 4DI3A 2DYSE 2HYZA 3VLDA 3PZ2A 3NB2A 3V31A 3L54A 1KZPA 3B7RL 4QFVA 2Y69E 3TXMA 4HOSA 1IHGA 2B6CA 2P9UG 3ZEFA 2XCCA 2KXPC 4XKBA 2VTBA 3UT8A 3U4TA 2RFAA 2ILRA 1E8ZA 2XCBA 1TN8A 3EJNA 3KAEA 3TJPA 4HRMB 2RD0A 3ZYQA 1H2UA 1BPOA 1TEZA 1IQUA 1V55E 4DRXE 4TRQA 3AG4E 1BLXB 1NZNA 3OTNA 3NZUA 1AP7A 2AXVA 4BX9A 3SBTB 3E30A 4HOTA 3MKQB 4ACKA 4IULA 2XZTG 1BU9A 1H6OA 2MRIA 3CSFA 3ZNGA 4MKTA 3NQPA 4A63B 5BV0A 2LUHA 4UWKA 2HM8A 2X3MA 3PE4A 4EZKA 3FP3A 4GZ3A 1TNZA 2L6BA 3BUAA 1KLXA 4OVUA 3T8KA 2XS1A 1A5EA 3E4BA 2YNQA 2PQNA 4BEPA 3IBEA 5D0QD 3QB2A 3CLJA 4IN3B 1N11A 3DSWA 3B7UX 5BW8C 2XPYA 4GYOA 4HBDA 4F1SA 5EILA 5ANLA 4RVBA 1W3BA 3Q79A 4NQ0A 1K1BA 5T8IA 4U8HA 3D9MA 4HI8A 2XEHA 3MKRA 1Z5SC 4LERA 3HXBA 4E85A 2X6FA 3ZU7B 4DPRA 4BTBA 2M63A 2IO3C 5J08A 3URZA 1D9SA 3CIAA 3FTUA 5G55A 5KJMA 5EDSA 4L23A 3G2SA 4NIKA 4IYPA 2I6HA 1OCRE 4AY5A 1OCOE 4K0RA 4E6HA 3MEKA 5FQ7A 3IV0A 4ME2A 2AJAA 3TWTA 2F37A 2WB2A 1HZ4A 2CG2A 4CYMD 2A4ZA 3CVWA 4W9RA 4ATZD 5LCWJ 1HH8A 4PS3A 2WXRA 4JL0A 3LCAA 3MCXA 2IJGX 3FDHA 2XGOA 1ELRA 3FU3A 5ENTD 3UI2A 3CK7A 3ENEA 3MZLB 3FY4A 3LPZA 4G24A 1N52A 4GCOA 3CV0A 2VGXB 1GW6A 2GRLA 4HLEA 2WMNA 3L82A 2L0IA 3R7QA 1OT8A 2IOLA 1H2VC 1YA0A 4OYSA 2WM9A 2PZIA 5FT9A 1OWLA 3JQ0A 4F1PA 5T4YA 2R59A 2AXZA 4J8EA 4G25A 1PY1A 3PZ4A 4M3OA 4U7EB 2IEJA 4UI9K 1OWNA 2WXNA 1O1SA 1YYHA 3FFLA 1TN7A 4GTTA 4O1PA 3DBSA 3ABME 3ZPJA 5EYPF 4HXIA 5JJ7A 3DEPA 1S63A 3KD7A 4LEUA 4GYYA 2KC7A 4G26A 2EIJE 1UN9A 2MOWA 1NP7A 5AN8A 3CVXA 2F0YA 4JW1A 3ZYKA 4JVSA 4J0UA 4GPMA 3FTSA 4DUIA 3EIJA 3I4RB 3PE3A 3ZIMA 2IFUA 3PDNA 4ACLA 3G2VA 2UY1B 1N95A 4WWOA 3CR3A 4I9EA 1INZA 1N0RA 3P2BA 3UKUG 2J08A 1MX4A 2FEZA 2H6GA 4FLBA 1H6KA 4UWGA 4U07A 1D8EA 1HG2A 3JQ1A 4O60A 3OXFA 5BV1A 3BG0B 3L13A 5DIZA 3UT7A 5LX8A 3DSXA 5CEDB 1OY3D 2VSYA 2DZOA 2WXGA 4M7CA 3NOCD 1NFIE 4FULA 2PM6A 2A5EA 2YHCA 1LD7A 2OVFA 1G3NB 1Z3XA 3OXGA 4I2ZA 3ZGQA 3FUJA 4V3IA 4BWRA 4XX5A 3RKVA 1A17A 4C48B 4YVOA 2KATA 3UM1A 1YCSB 5AAOA 1TNYA 3EU5A 2CHXA 5BT1A 4AVXA 1JWGA 1X81A 3FHEA 1NA3A 4PS8A 4J8SA 5FIOA 5EKQD 5FZSA 3ULQA 2FBNA 3FUFA 3CKBA 4OAUC 5AQAA 5JHBA 5HS0A 3ZW3A 4GTVA 3DRAA 2XEEA 2ETBA 1JWFA 3QNKA 1TR4A 3UTMA 1TJFA 3SBSA 5FZQA 3EDTB 2HO1A 4WWPA 1FVFA 4MLPA 4KZ0A 3FTZA 3Q15A 3Q75A 4G2VA 2V5FA 4FJZA 1N4QA 5CEAA 2EINE 2ETCA 4LSZE 1E8XA 3SFYA 3E32A 2PNNA 3SHFA 1NA0A 5C2YA 3C98A 4HQDA 4N3BA 2WXHA 2GROB 4IRUA 5ANRA 3UX4A 5ENPD 1IKND 3PS6A 2LAHA 3ZKJA 4Y6WA 3PUJA 1X5BA 4L1BA 3Q49B 2DIWA 3ULEG 1OCZE 1SA4A 3CEQA 3T8MA 3DSUA 4YDWA 4BESA 3GZ1A 5FQ6A 2R03A 1TJCA 3D9LA 4FHJA 1ZB1A 4HLLA 5E75A 1WDYA 4DJAA 1HO8A 3EHNA 3QKYA 3E33A 4DX1A 4O6FA 3CVLA 2KBXA 4YDOA 4X8QA 5LCWC 2LO6A 2L9BA 3RK6A 3ASFA 3S7DA 2A5UA 3D9IA 5CMWA 3CHRA 2KZTB 2XQ0A 2WQ7A 2GW1A 5D0OD 2V4LA 4PS7A 3HG0D 2E0IA 4P29A 1TN6A 3TXNA 4L9PA 4YDEA 3X2QE 5KCMA 3L6AA 2NSZA 3D9NA 1KT1A 3Q73A 3L17A 3MYVA 3S7JA 4PH4B 3MA5A 3ASNE 3Q78A 1BD8A 2ZGGA 5JHAA 3FUHA 3QC1A 3SFZA 3RRUA 2YQ8A 4GA0A 5ARFA 4FC8A 3LJNA 3FUEA 1OXJA 5BXUA 3DEOA 3T9KA 2GRQB 2EQXA 3QARA 4DX2A 2R5SA 1E7VA 1QBQA 1EF1C 3BU8A 4KXKB 1E8WA 3HXDA 3U64A 1UOHA 3VTYA 5CBNA 2GGFA 1WY6A 3ONLA 3HIZA 5C1DA 4JEHA 5B1AE 4CRWA 3ZYMA 2WQHA 1O5MA 3AU5A 4TUUA 1N94A 3RJVA 4F6RD 3FH7A 4CDRA 3FUKA 2J8SD 5G04J 4KMOA 3RAUA 3ZXSA 1MX6A 4U0SA 3S7BA 3QAQA 4N3AA 2XRZA 4DK5A 4BTAA 3PNLB 4NURA 5CMYA 1H6PA 1MYOA 2J4BA 1U3DA 5ENRD 5KJLA 4EHMA 3U9WA 1DCQA 2Y1LE 3UINC 3V30A 3TWSA 4N2QA 4J8FA 4U96D 3HYMB 1XNFA 2XGMA 3MKQA 3QK0A 3TGOA 4Z68A 5LFAA 4GMRA 2DWZA 3GZ2A 3UIOC 3IEGA 3D3MA 1O1TA 3DXMG 2QYUA 2J09A 1BI8B 1FPPA 1LF8A
chains in the Genus database with same CATH topology
2Y3AA 3TG4A 3FTSA 4XKCA 4R7LA 3GZSA 4UWFA 1IQRA 2KZTA 2WXPA 3CVNA 3EIJA 2WXJA 3I4RB 3PE3A 3ESKA 2C0LA 3HHMA 3OXLA 4A3VA 2IFUA 3PDNA 4FLHA 4ACLA 2QY7A 3CQGB 3G2VA 4EZLA 2UY1B 4ANXA 4JXTA 5M72A 3FU6A 4J6IA 3UT4A 3FWVA 3RU0A 4WWOA 3CR3A 4EBAA 4I1AA 4I9EA 4B8AA 1INZA 2CFZA 3FTWA 1HU3A 1UJJA 1DVPA 2I2OA 2KM4A 1N54A 2OOEA 5FWQA 3BG1B 3ONKA 4GYWA 3P2BA 3MV2B 4FJYA 4JPSA 2WXOA 2J08A 5FQ4A 2V0PA 2KCKA 2WXKA 3APDA 2FEZA 1EDUA 5A7DB 4JHKA 3AS4A 1P5QA 5KJKA 5JJTA 2IOSA 3FTXA 3JUIA 3ML8A 3FU0A 4FP7A 4FLBA 4GCNA 5E76A 1JPLA 5EX0A 4LRZA 4CEMA 4XIFA 2IQCA 4YNDA 1H6KA 2MHKA 4WAFA 1UG3A 4UWGA 4U07A 1HG2A 2Y4UA 4AY6A 3JQ1A 4AOFA 2ZU6B 3OXFA 3CSTA 5BV1A 3Q47B 2FO7A 3BG0B 3U3WA 3D9OA 1HF8A 3L13A 2VSXE 5DIZA 3S7FA 4AV7A 3L08A 3UT7A 3G2UA 3ZHEB 5LX8A 4XE0A 3VTXA 2AXUA 4GAAA 4BY6A 1OWMA 4MS6A 3OAWA 4F53A 2VSYA 3LY8A 4YVQC 2WXQA 2X38A 2VYIA 4GPKA 2WXGA 2WXIA 5EX3A 4ANWA 2X6JA 4FULA 2PM6A 4NRHB 4DLOA 1HG5A 2YHCA 3P1UA 4AEZC 1JUQA 2OVFA 4CDMA 3RRNB 2L0TB 1ZBPA 2YINA 2JLBA 4B94A 1Z3XA 2AVPA 3PUKA 4UQYA 5AJLA 3OXGA 3I5PA 2PQRA 4I2ZA 4F3VA 3ZGQA 4RSYA 4GZCA 5T3RA 2I1JA 5J90A 3FUJA 4V3IA 4BWRA 4GZ6A 2XHEA 4F7AA 1Y8MA 4XX5A 3RKVA 1A17A 4L2LA 1SZ9A 2X6HA 5HI7A 4YVOA 2KATA 3N71A 3HDXA 2X6IA 4OVVA 1PAQA 4PUCA 3LDZA 3MJWA 3ZFWA 2CHXA 3CKCA 4WNGA 4AVXA 1JWGA 5BT1A 2WXMA 3FHEA 4NACA 4GA1A 1NA3A 1OUVA 3ASDA 4PS8A 4WNDA 3CK8A 4FU3A 4J8SA 1PC2A 5FTPA 3Q5MA 2YHEA 5EKQD 3ZN3A 4H7YA 4XI0A 1HFAA 3MGBA 1WAO1 5FZSA 3ULQA 2OVBA 2IONA 3UMVA 5FZRA 2FBNA 5LP0A 2XPZA 3FUFA 3ZVVA 4DLQA 3D9PA 4HVBA 1SZAA 3CKBA 4EZJA 4A55A 2LAIA 5JHBA 3ZW3A 2CG3A 3LY7A 4GA2A 4I6EA 4JC8A 4ABNA 1HX8A 1JWFA 4G1TA 3QNKA 5ENNA 4DI4A 5AIJA 3LEWA 1TJFA 4HOQA 2HR2A 4ILHB 2CHWA 3SBSA 5A23A 5FZQA 3EDTB 3QWWA 1DNPA 2VGXA 2C2LA 2HO1A 5BUZA 1B89A 4WWPA 2VSNA 1H19A 1FVFA 4MLPA 3RO2A 4HFGA 4KZ0A 5G2NA 4BT8A 3FTZA 3Q15A 4FJZA 3KS2A 2V5FA 3GYZA 2I9CA 2XGSA 4G2VA 3CHSA 2E2EA 3PREA 2BTDA 2FULA 3UUXA 4UI9C 2ONDA 2XRYA 5ARGA 2WPVA 4LCTA 1E96B 4DI3A 1E8XA 4CGVA 1FVHA 1KT0A 2JEKA 3G2TA 2HYZA 3VLDA 3EIQC 2LSVA 3CHPA 4WNFA 3RRMB 3SHFA 3L54A 3K9IA 1NA0A 2IF4A 3B7RL 3UQ3A 4N5CA 4QFVA 3ASGA 2GRMA 5C2YA 2P58C 3C98A 3TXMA 4HOSA 4N3BA 1IHGA 2WXHA 2DCPA 1E7UA 2XEVA 1OWPA 3G2WA 4IRUA 3TL5A 4L7TA 5ANRA 3ZEFA 2XCCA 3FUMA 1Z3YA 3IKOB 4I6JA 3UX4A 2WQ6A 4XKBA 2Q7FA 3KEZA 2VTBA 3UT8A 4J8DA 3D9JA 3U4TA 4APFA 3PS6A 2XCBA 2ILRA 1E8ZA 2LAHA 4A1GA 4Q69A 5G05C 4FADA 3EJNA 3KAEA 4I1OB 3TJPA 2RG8A 3AS8A 4Y6WA 3PUJA 2RD0A 1X5BA 4L1BA 1H2UA 3Q49B 1BPOA 1UW4B 3ZYQA 1IQUA 3VLEA 1TEZA 2DIWA 4A3TA 4JHJA 2VQ2A 3JYSA 4TRQA 4GMJA 3LVQE 3LXUX 1H0AA 4G23A 4AXHA 3CEQA 3T8MA 1NZNA 3T5VA 3OTNA 4CT0A 3NZUA 2AXVA 3GZ1A 5FQ6A 3AS5A 4BX9A 3SBTB 4D10C 3CVPA 1TJCA 3D9LA 3FTYA 3LJ3A 4URKA 3HVEB 2J4DA 4HOTA 4Q94A 4FHJA 3CHMA 3MKQB 5E75A 3ZYLA 4ACKA 4IULA 4DJAA 2MRIA 1HO8A 3CSFA 3EHNA 4KT6B 3QKYA 4MKTA 2NC9A 4O6FA 4KZCA 3NQPA 3S2AA 5BV0A 4K03A 1QZ2A 4UWKA 2HM8A 2X3MA 3CVLA 4Q96A 3PE4A 4EZKA 1VDYA 4ILGA 4WWNA 3SZ7A 3FP3A 5LCWC 4GZ3A 4UQXA 2LO6A 1QNFA 2L9BA 3RK6A 2UY1A 4RG6A 5KJNA 4FA6A 2WMOA 3PNTB 3ASFA 3S7DA 4CT4A 2A5UA 3D9IA 5CMWA 3O4ZA 1KLXA 4OVUA 3CHRA 2KZTB 3VLFA 3FTVA 1HS6A 3SNXA 2VSOE 2XQ0A 3FEYA 3SI5A 2WQ7A 4C0EA 3E4BA 2YNQA 2CHZA 5JJ6A 2PQNA 4I1MA 2GW1A 2BUGA 5D0OD 4I43A 3IBEA 2V4LA 5D0QD 4PS7A 2NXPA 3EHMA 5G04C 3QB2A 3CLJA 2E0IA 4IN3B 4KYOB 5BPPA 4PDXA 5CCMA 5CCLA 3B7UX 4ATGA 4P29A 3CVQA 5BW8C 3TXNA 4B8CB 4CCAA 3TG5A 2XPYA 4GYOA 4WNEA 4F1SA 4I6GA 4UI9J 5ANLA 5KCMA 4RVBA 1W3BA 3L6AA 4NQ0A 4GZDA 4JA9A 2NSZA 3FUDA 3ZHEA 1QQEA 3D9NA 3JCKC 1EYHA 5T8IA 4U8HA 1KT1A 2L6JA 3D9MA 3PRZA 4HOUA 4H7XA 3NZSA 3L17A 1EPUA 1Y6IA 3MYVA 3S7JA 1U3CA 3MKRA 4PH4B 3MA5A 3PH0C 1FCHA 4GB9A 4LERA 2PL2A 3FULA 1SQMA 1ZU2A 2LSUA 4KVMA 4E85A 1Z6TA 3HVEA 1ELWA 2VJ8A 2X6FA 3QOUA 4DPRA 4BX8A 4BTBA 4L2YA 3R9AB 3PVLA 5JHAA 2M63A 3FUHA 5BNWA 5J08A 3QC1A 3FH5A 3URZA 1MQSA 3SFZA 4LUNU 4HORA 3RRUA 2YQ8A 4GA0A 4CGWA 2V8SE 3PZDA 4U0ZA 5ARFA 3CVVA 5FQ8A 3CIAA 3FTUA 3FUIA 4APOA 2WXFA 5G55A 4FC8A 2R17C 1XGWA 3FUEA 4FHKA 3Q4AB 5AYWD 5EDSA 5KJMA 4L23A 3G2SA 3IHYA 3CVUA 1OWOA 3I3NA 4IYPA 4JHRA 4AJWA 2I6HA 5LOZA 4AY5A 4XI9A 4JZYA 3ZRHA 4MRUA 4K0RA 2EQXA 3QARA 4N3CA 2R5SA 4E6HA 4G11A 3MEKA 5FQ7A 2DBAA 1E7VA 3IV0A 1MHQA 2LNIA 4ME2A 4WUYA 1EF1C 3DPDA 2FF4A 2WB2A 4EQFA 2J9QA 1E8YA 4Y6CA 4KXKB 1HZ4A 2CG2A 3CGHA 2A4ZA 3RO3A 4XZ4A 3ASHA 1E8WA 4UWLA 3SGHA 4C0MA 4EECA 3CVWA 4W9RA 3L22A 4KBQA 3B13A 3RIBA 1S0PA 4C9BB 5LCWJ 2PM7A 3U64A 1HH8A 4B89A 1HXIA 2KCVA 3CHOA 4GU5A 4PS3A 3VTYA 3SF4A 2WXRA 2VGYA 4JL0A 2GGFA 3LCAA 1WY6A 3MCXA 3ONLA 2IJGX 3FDHA 5DBKA 3HIZA 5C1DA 4JEHA 4B0ZA 4I2WA 4U04A 2XGOA 3NF1A 4AP2A 1ELRA 3FU3A 4BFRA 4AM9A 2WXLA 4CRWA 1UJKA 3CK7A 3PEUB 3GW4A 4TV3A 3R7RA 1UN8A 3ZYMA 1L5JA 2WQHA 3ENEA 4ILIA 5FJYA 3MZLB 3AU5A 4BT9A 3FY4A 4TUUA 3LPZA 3RJVA 4G24A 3FH7A 3CHQA 3ZIMA 1N52A 4GCOA 3CV0A 4A1SA 3FUKA 5G04J 4CDRA 2VGXB 1IYGA 1GW6A 4KMOA 2QFCA 2GRLA 4HLEA 2WMNA 2L0IA 3R7QA 3ZXSA 3LVRE 4JEUA 4RG9A 2IOLA 1H2VC 4N39A 1YA0A 3QJZA 4UQZA 4U63A 2BF0X 4U0SA 4ANVA 2IU1A 4OYSA 3AU4A 2WM9A 2WVIA 3QAQA 4N3AA 3S7BA 2XRZA 2PZIA 2XPIA 2OV8A 3LS8A 5FT9A 3PNLB 4BTAA 4DK5A 4HS2A 1OWLA 3JQ0A 4NURA 5T4YA 2R59A 5CMYA 2AXZA 2J4BA 2CFUA 2I1KA 4J8EA 1U3DA 3FEXA 4G25A 3LKUA 3SD5A 1PY1A 2AWIA 3D9KA 3PEVB 3I4GA 4JA7A 5KJLA 4U0UA 3QWVA 3U9WA 4M3OA 4ANUA 3B7TA 3FUNA 4UI9K 1OWNA 2WXNA 3LYAA 3FFLA 4KVOA 2VTBB 3ML9A 1ELKA 5A6CA 2KCLA 4N2SA 3DBSA 3BEEA 3IHVA 1WM5A 4GMLA 5AJDA 3MV3B 4CDNA 4EBAG 2C0MA 3ZPJA 3UPVA 2X6KA 3FH8A 4HXIA 4I9CA 3L16A 1H2TC 4GZ5A 5JJ7A 3APFA 4EPZA 3KD7A 1HE8A 4LEUA 4J8FA 4N2QA 2FI7A 3QDNA 4GYYA 4BSXA 3MX3A 5CHEE 3HYMB 2J49A 3U66A 3CVYA 1XNFA 3CQCB 4UWHA 2XGMA 2KC7A 3MKQA 3QK0A 3TGOA 4G26A 3TAXA 1UN9A 2MOWA 5G05J 5LFAA 1NP7A 2J07A 3APCA 3FU5A 3GZ2A 3CVXA 2AW6A 3IEGA 3D3MA 4JW1A 3B7SA 3QWPA 2Y4TA 3ZYKA 2J09A 5AENA 3WXXA 1E90A 4AIFA 3O48A 4JVSA 4J0UA 3T5XA 5HQ8A 3LY9A 3ESLA 3CK9A 4I17A 2UWJG 1LF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TG4 A;  3CVN A;  3PE3 A;  3ESK A;  2C0L A;  3OXL A;  2IFU A;  3PDN A;  5M72 A;  2UY1 B;  3FWV A;  3RU0 A;  4I1A A;  4I9E A;  2OOE A;  4GYW A;  3MV2 B;  2KCK A;  2FEZ A;  5A7D B;  3AS4 A;  1P5Q A;  5KJK A;  5JJT A;  4GCN A;  5EX0 A;  4XIF A;  4YND A;  2MHK A;  4U07 A;  2Y4U A;  4AY6 A;  3OXF A;  3Q47 B;  2FO7 A;  3U3W A;  5DIZ A;  3S7F A;  3ZHE B;  3VTX A;  2VSY A;  3LY8 A;  4YVQ C;  2VYI A;  4GPK A;  5EX3 A;  4NRH B;  2YHC A;  1ZBP A;  2JLB A;  4B94 A;  2AVP A;  4UQY A;  3OXG A;  2PQR A;  4I2Z A;  4F3V A;  3ZGQ A;  4BWR A;  4GZ6 A;  1Y8M A;  3RKV A;  1A17 A;  5HI7 A;  4YVO A;  2KAT A;  3N71 A;  3ZFW A;  4WNG A;  3CKC A;  5BT1 A;  4GA1 A;  1NA3 A;  1OUV A;  3ASD A;  4WND A;  3CK8 A;  5FTP A;  1PC2 A;  3Q5M A;  5EKQ D;  3ZN3 A;  4H7Y A;  4XI0 A;  1WAO 1;  5FZS A;  3ULQ A;  5FZR A;  2FBN A;  3CKB A;  3LY7 A;  4GA2 A;  4ABN A;  4G1T A;  4HOQ A;  2HR2 A;  5FZQ A;  3EDT B;  3QWW A;  2VGX A;  2C2L A;  2HO1 A;  1B89 A;  2VSN A;  3RO2 A;  4BT8 A;  3Q15 A;  3KS2 A;  2V5F A;  3GYZ A;  2XGS A;  4G2V A;  2E2E A;  3UUX A;  4UI9 C;  2OND A;  5ARG A;  2WPV A;  1E96 B;  4CGV A;  1KT0 A;  2HYZ A;  2LSV A;  4WNF A;  3UQ3 A;  3K9I A;  1NA0 A;  2IF4 A;  4N5C A;  3ASG A;  2P58 C;  4HOS A;  4N3B A;  1IHG A;  2XEV A;  2XCC A;  2Q7F A;  4J8D A;  3U4T A;  2XCB A;  5G05 C;  3KAE A;  3AS8 A;  4Y6W A;  3Q49 B;  2VQ2 A;  3JYS A;  4G23 A;  3CEQ A;  1NZN A;  3GZ1 A;  3AS5 A;  3CVP A;  1TJC A;  4HOT A;  3QKY A;  2NC9 A;  4O6F A;  1QZ2 A;  3CVL A;  3PE4 A;  3SZ7 A;  3FP3 A;  5LCW C;  4GZ3 A;  4UQX A;  2UY1 A;  4RG6 A;  5KJN A;  3ASF A;  3S7D A;  1KLX A;  3E4B A;  5JJ6 A;  2PQN A;  2GW1 A;  2BUG A;  5D0O D;  5D0Q D;  5G04 C;  4KYO B;  5CCM A;  4IN3 B;  5CCL A;  3CVQ A;  5BW8 C;  3TG5 A;  4GYO A;  4WNE A;  4UI9 J;  1W3B A;  4NQ0 A;  4JA9 A;  3ZHE A;  1QQE A;  1KT1 A;  2L6J A;  4HOU A;  4H7X A;  3S7J A;  3MKR A;  3MA5 A;  1FCH A;  2PL2 A;  1ZU2 A;  2LSU A;  1ELW A;  3QOU A;  4BTB A;  3R9A B;  5BNW A;  3URZ A;  4HOR A;  2YQ8 A;  4GA0 A;  4CGW A;  4U0Z A;  5ARF A;  4APO A;  3Q4A B;  5KJM A;  4JHR A;  2I6H A;  4AY5 A;  4XI9 A;  4N3C A;  2R5S A;  3MEK A;  2DBA A;  2LNI A;  4ME2 A;  4WUY A;  2FF4 A;  4EQF A;  2J9Q A;  4Y6C A;  4KXK B;  1HZ4 A;  3RO3 A;  3ASH A;  4W9R A;  4KBQ A;  3RIB A;  5LCW J;  1HH8 A;  1HXI A;  2KCV A;  3VTY A;  3SF4 A;  2VGY A;  4JL0 A;  3LCA A;  5DBK A;  5C1D A;  4I2W A;  4U04 A;  2XGO A;  3NF1 A;  1ELR A;  4AM9 A;  3CK7 A;  3GW4 A;  5FJY A;  2WQH A;  4BT9 A;  3LPZ A;  3RJV A;  4G24 A;  4CDR A;  4GCO A;  4A1S A;  3CV0 A;  5G04 J;  2VGX B;  1IYG A;  2QFC A;  4RG9 A;  4N39 A;  1YA0 A;  4UQZ A;  4U0S A;  3S7B A;  4N3A A;  2PZI A;  2XPI A;  5FT9 A;  4BTA A;  4J8E A;  4G25 A;  3LKU A;  4JA7 A;  5KJL A;  4U0U A;  3QWV A;  4UI9 K;  3LYA A;  3FFL A;  4N2S A;  5A6C A;  2KCL A;  3BEE A;  1WM5 A;  3MV3 B;  2C0M A;  3ZPJ A;  3UPV A;  4I9C A;  4GZ5 A;  5JJ7 A;  3KD7 A;  4LEU A;  4J8F A;  4N2Q A;  2FI7 A;  3QDN A;  4GYY A;  5CHE E;  3HYM B;  1XNF A;  2XGM A;  2KC7 A;  3TGO A;  4G26 A;  3TAX A;  5G05 J;  3GZ2 A;  3IEG A;  3QWP A;  2Y4T A;  3WXX A;  4AIF A;  3O48 A;  4J0U A;  5HQ8 A;  3LY9 A;  3CK9 A;  4I17 A;  2UWJ G;  5AYW D; 
#chains in the Genus database with same CATH topology
 3TG4 A;  3GZS A;  4UWF A;  2WXP A;  4A3V A;  3OXL A;  3CQG B;  4RQI A;  1U2V G;  3Q7A A;  2CFZ A;  1HU3 A;  1DVP A;  2KM4 A;  2OOE A;  3BG1 B;  4GYW A;  4GTQ A;  4FJY A;  4RLY A;  4JPS A;  4GTS A;  2KCK A;  2WXK A;  5KJK A;  5JJT A;  2IOS A;  3FTX A;  5E76 A;  4GCN A;  1JPL A;  5EX0 A;  4LRZ A;  2IQC A;  3ASO E;  1UG3 A;  3AAA C;  1N4S A;  4AY6 A;  5ITZ F;  4AOF A;  3Q47 B;  1HF8 A;  3DSV A;  3G2U A;  3ZHE B;  3ABK E;  4F53 A;  5CER B;  2VYI A;  4ZHB A;  5JMN D;  2WXI A;  4ANW A;  4DX6 D;  1HG5 A;  3P1U A;  4TXQ A;  5ENQ D;  1IXV A;  3RRN B;  1O1R A;  2JLB A;  2AVP A;  5AJL A;  2F8Y A;  3V2O A;  4GZC A;  5T3R A;  4BET A;  4F7A A;  1N0Q A;  4L2L A;  4GTP A;  2DYR E;  3LDZ A;  4NAC A;  3ASD A;  4FU3 A;  1PC2 A;  1IHB A;  3ZN3 A;  3UMV A;  5AQ9 A;  4DLQ A;  4EZJ A;  2BED A;  3LY7 A;  4I6E A;  5AAR A;  4DI4 A;  3V79 K;  4HRN A;  1FT2 A;  1OCC E;  5EN5 D;  2VGX A;  3B95 A;  5BUZ A;  2V5Q C;  1B89 A;  5G2N A;  4BT8 A;  3JUE A;  3GYZ A;  2I9C A;  2E2E A;  1AWC B;  2OND A;  4LCT A;  3ZUV B;  4CGV A;  1FVH A;  1KT0 A;  5ENO D;  2LSV A;  3K9I A;  3ASG A;  2GRM A;  2DVW A;  1E7U A;  1OWP A;  5FIN A;  3G2W A;  3TL5 A;  4L7T A;  3HXE A;  1Z3Y A;  2H6F A;  3IKO B;  2Q7F A;  3D9J A;  5EIB E;  5CBO A;  3DST A;  2RG8 A;  3AS8 A;  4XEI G;  1MJ0 A;  1UW4 B;  3VLE A;  4A3T A;  4TXP A;  4GMJ A;  3LXU X;  4AXH A;  3RSE G;  3T5V A;  4CT0 A;  3JXI A;  3AS5 A;  3CVP A;  4URK A;  3HVE B;  3CHM A;  4KT6 B;  3UXG A;  3BQO A;  1BI7 B;  4KZC A;  4Q96 A;  2ZIR A;  1LD8 A;  2MYO A;  4WWN A;  1QNF A;  2UY1 A;  1TYQ G;  4RG6 A;  4CZ2 D;  5KJN A;  4FA6 A;  3PNT B;  1MZC A;  3O4Z A;  3VLF A;  3FTV A;  1HS6 A;  2DZN A;  3FEY A;  2CHZ A;  4I1M A;  2XS8 A;  4I43 A;  2NXP A;  5G04 C;  4LNG A;  4KYO B;  5CCM A;  4J7W A;  4ATG A;  4B8C B;  4CCA A;  3TG5 A;  4K5C A;  4WNE A;  3KSL A;  4I6G A;  4GZD A;  4JA9 A;  3JCK C;  1EYH A;  1JCS A;  4UUC A;  2L6J A;  3PRZ A;  4H7X A;  2LXM A;  1EPU A;  1DCE A;  4GB9 A;  3FUL A;  1ZU2 A;  3HVE A;  2VJ8 A;  2XEN A;  2EIM E;  4L2Y A;  3PVL A;  5BNW A;  4CGW A;  4U0Z A;  3CVV A;  2WXF A;  2R17 C;  4FHK A;  3Q4A B;  3CVU A;  1OWO A;  3I3N A;  4HB5 A;  5LOZ A;  2OEV A;  3HXF A;  4JZY A;  3ZRH A;  4GTO A;  4MRU A;  2R05 A;  4N3C A;  2DBA A;  1MHQ A;  4WUY A;  2OEW A;  3DPD A;  4EQF A;  2J9Q A;  4Y6C A;  3R9M A;  3CGH A;  3RO3 A;  3C3R A;  4XZ4 A;  3ASH A;  4C0M A;  3HXC A;  2P9P G;  3L22 A;  4KBQ A;  5KNG A;  4C9B B;  2PM7 A;  5KNH D;  3CHO A;  4GU5 A;  3SF4 A;  2VGY A;  4B93 B;  4TUM A;  4B0Z A;  4QQI A;  4U04 A;  4AP2 A;  4AM9 A;  1UJK A;  3PEU B;  3GW4 A;  3KEA A;  4TV3 A;  3EHR A;  2R2L A;  2QZA A;  3CHQ A;  4A1S A;  2B0O E;  1IYG A;  2QFC A;  3AG3 E;  4JEU A;  4RG9 A;  3TWU A;  4U63 A;  2IU1 A;  3AU4 A;  1D8D A;  4TXR A;  2OV8 A;  2P2C P;  4J8Y A;  4HNA D;  2I1K A;  3FEX A;  3LKU A;  2HE0 A;  3HRA A;  1N9A A;  3D9K A;  4DX5 D;  3PEV B;  4JA7 A;  1V54 E;  3D9H A;  3FUN A;  3LYA A;  5JA4 D;  4KVO A;  2VTB B;  5A6C A;  3IHV A;  4CDN A;  4EBA G;  3UPV A;  2X6K A;  4I9C A;  4K5A B;  1HE8 A;  3IXE A;  3QDN A;  3MX3 A;  5CHE E;  3C5R A;  3CVY A;  2NYJ A;  1SVX A;  2Y0B G;  3TAX A;  3DXK G;  2JAB A;  4DX7 D;  2J07 A;  3FU5 A;  2AW6 A;  1TNU A;  4U8V D;  3QWP A;  2Y4T A;  3AJI A;  4BER A;  3O48 A;  5HQ8 A;  3ESL A;  4Q69 A;  2UWJ G;  2P9S G;  4XKC A;  4R7L A;  1IQR A;  4U8Y D;  2KZT A;  3ESK A;  5H7P A;  3HHM A;  4FLH A;  4ANX A;  3FU6 A;  3RU0 A;  1N4R A;  4EBA A;  3FTW A;  1UJJ A;  1N54 A;  3MV2 B;  3NOG D;  2WXO A;  5FQ4 A;  2V0P A;  3APD A;  4JHK A;  5BXO A;  1K8K G;  3JUI A;  4FP7 A;  4ZFH A;  4XIF A;  4YND A;  2MHK A;  4WAF A;  2Y4U A;  4U95 D;  4HI9 A;  3EHQ A;  3U3W A;  2VSX E;  4AV7 A;  2ZGD A;  3L08 A;  5HKP A;  4XE0 A;  4G8L A;  4YVQ C;  2X38 A;  4GPK A;  2ETA A;  5EX3 A;  2X6J A;  4DLO A;  4CDM A;  1ZBP A;  1MX2 A;  2YIN A;  5KWD A;  2PQR A;  4F3V A;  5J90 A;  4GZ6 A;  1Y8M A;  2QC9 A;  1SZ9 A;  2X6H A;  5HI7 A;  1FT1 A;  1PAQ A;  1Q2Z A;  4PUC A;  4G8K A;  3DPY A;  1JCR A;  3ZFW A;  4WNG A;  2WXM A;  3SO8 A;  3CK8 A;  2EIK E;  2YHE A;  4H7Y A;  2BKK B;  3MGB A;  4MBG A;  2OVB A;  2ION A;  3PZ1 A;  5FZR A;  3E37 A;  5LP0 A;  2XPZ A;  3DWL G;  2H6H A;  1TNB A;  1NL4 A;  4A55 A;  2LAI A;  4GA2 A;  1SW6 A;  4G1T A;  5AIJ A;  2HR2 A;  3QWW A;  1DNP A;  2VSN A;  1H19 A;  3RO2 A;  4GTM A;  3CHS A;  3UUX A;  5ARG A;  2WPV A;  1E96 B;  2JEK A;  3G2T A;  3Q9U C;  2V4H C;  3EIQ C;  3C3O A;  3CHP A;  4WNF A;  3RRM B;  3UQ3 A;  2IF4 A;  4N5C A;  1KZO A;  2P58 C;  3TWV A;  2DCP A;  2GRP B;  2XEV A;  3FUM A;  4I6J A;  2WQ6 A;  2XZD G;  5EID A;  3KEZ A;  4J8D A;  4APF A;  4A1G A;  5G05 C;  4FAD A;  4I1O B;  3JXJ A;  1K1A A;  4JHJ A;  2VQ2 A;  3JYS A;  3LVQ E;  1H0A A;  4G23 A;  3C3Q A;  1DC2 A;  4JD2 G;  4D10 C;  3NAW A;  3FTY A;  3LJ3 A;  2J4D A;  4Q94 A;  3AG1 E;  3ZYL A;  2NC9 A;  5ENS D;  3S2A A;  4K03 A;  1QZ2 A;  5AQ7 A;  5HRY A;  1VDY A;  4ILG A;  3SZ7 A;  4UQX A;  4HRL A;  2WMO A;  4CT4 A;  3ZXP A;  3UIP C;  3SNX A;  2VSO E;  2VGE A;  3SI5 A;  4C0E A;  5JJ6 A;  4O1O A;  2GRR B;  2BUG A;  5KBA A;  3EHM A;  2ZIS A;  5CCL A;  5BPP A;  4PDX A;  3WG7 E;  3UKR G;  3CVQ A;  1LTX A;  2RFM A;  3TWW A;  4UI9 J;  3ZHE A;  3FUD A;  2R02 A;  1QQE A;  3L9T A;  4HOU A;  2F8X K;  3NZS A;  1Y6I A;  1U3C A;  2P9L G;  3PH0 C;  1FCH A;  2PL2 A;  1SQM A;  2LSU A;  4KVM A;  1Z6T A;  1ELW A;  3QOU A;  4BX8 A;  1RW2 A;  3PZ3 A;  3R9A B;  2P9K G;  3ULY A;  3FH5 A;  1MQS A;  3W9F A;  4LUN U;  4HOR A;  2V8S E;  3PZD A;  5FQ8 A;  3FUI A;  4APO A;  3TWQ A;  1XGW A;  2LXL A;  3IHY A;  4JHR A;  4AJW A;  3J5Q B;  4XI9 A;  3Q9N C;  4G11 A;  2LNI A;  3Q7F A;  3SY2 A;  2FF4 A;  1E8Y A;  4LNU D;  5AQB A;  2OCC E;  4UWL A;  3SGH A;  4EEC A;  3B13 A;  3RIB A;  1S0P A;  4BSZ B;  4B89 A;  1HXI A;  2KCV A;  3SFX A;  5DBK A;  4LG6 A;  4I2W A;  3EU9 A;  2FO1 E;  3NF1 A;  4BFR A;  2WXL A;  3R7R A;  1UN8 A;  1L5J A;  5FJY A;  4ILI A;  4BT9 A;  3V2X A;  1S70 B;  3B7B A;  5B1B E;  1SA5 A;  3LVR E;  1TNO A;  4N39 A;  3QJZ A;  4UQZ A;  2BF0 X;  4ANV A;  2WVI A;  2BKG A;  2XPI A;  3LS8 A;  3UM0 A;  4HS2 A;  4LNB A;  2CFU A;  3SD5 A;  2AWI A;  3DSS A;  3I4G A;  4U0U A;  3QWV A;  4ANU A;  1S64 A;  5B3S E;  3B7T A;  4GTR A;  3E34 A;  3ML9 A;  1ELK A;  5CRV A;  2KCL A;  4N2S A;  3BEE A;  4GML A;  1WM5 A;  5AJD A;  3MV3 B;  2C0M A;  2P9N G;  3FH8 A;  3L16 A;  1H2T C;  4GZ5 A;  3APF A;  4EPZ A;  2FI7 A;  4BSX A;  2J49 A;  3U66 A;  3CQC B;  4UWH A;  5G05 J;  3APC A;  3B7S A;  5AEN A;  3WXX A;  1E90 A;  4AIF A;  3T5X A;  3LY9 A;  3CK9 A;  4I17 A;  5AYW D;  2Y3A A;  3CVN A;  1N4P A;  2IY0 C;  2WXJ A;  2C0L A;  2QY7 A;  5D2M C;  4EZL A;  2QYJ A;  5M72 A;  4JXT A;  4J6I A;  3UT4 A;  3FWV A;  4I1A A;  4B8A A;  2I2O A;  1QYM A;  5FWQ A;  3UM2 A;  3ONK A;  4JB8 P;  3C72 A;  4N5Q A;  5CEC B;  3TWR A;  1EDU A;  2RKK A;  5A7D B;  3AS4 A;  1P5Q A;  4YDY A;  3ISM C;  3ML8 A;  3FU0 A;  5EYL A;  1WG0 A;  2ZXW E;  4CEM A;  5CRU A;  1NI1 A;  2ZU6 B;  3CST A;  2FO7 A;  3D9O A;  4OAV B;  3S7F A;  1JCQ A;  3VTX A;  2AXU A;  4GAA A;  4BY6 A;  1OWM A;  4MS6 A;  3OAW A;  4K5B A;  3LY8 A;  2WXQ A;  3W9G A;  1KPS B;  3NBN B;  4NRH B;  4AEZ C;  3SQV A;  1JUQ A;  2L0T B;  4B94 A;  3PUK A;  4UQY A;  3I5P A;  3F6Q A;  4RSY A;  3UM3 A;  2GRN B;  2I1J A;  2P9I G;  1RZ4 A;  3TWX A;  2XHE A;  5D66 A;  3N71 A;  3HDX A;  2X6I A;  4OVV A;  2IO2 C;  1K3Z D;  3MJW A;  3CKC A;  4GA1 A;  1OUV A;  4WND A;  5FTP A;  3Q5M A;  4XI0 A;  2EIL E;  1HFA A;  1WAO 1;  1YMP A;  3ZVV A;  4HVB A;  3D9P A;  1SZA A;  3J5P A;  2CG3 A;  4JC8 A;  4ABN A;  1HX8 A;  2H6I A;  5ENN A;  3LEW A;  4ILH B;  4HOQ A;  5IY5 E;  2CHW A;  5A23 A;  3ABL E;  2C2L A;  4HFG A;  3KS2 A;  2XGS A;  3KSQ A;  3PRE A;  2BTD A;  2FUL A;  3AG2 E;  4UI9 C;  2XRY A;  3EUV A;  4DI3 A;  2DYS E;  2HYZ A;  3VLD A;  3PZ2 A;  3NB2 A;  3V31 A;  3L54 A;  1KZP A;  3B7R L;  4QFV A;  2Y69 E;  3TXM A;  4HOS A;  1IHG A;  2B6C A;  2P9U G;  3ZEF A;  2XCC A;  2KXP C;  4XKB A;  2VTB A;  3UT8 A;  3U4T A;  2RFA A;  2ILR A;  1E8Z A;  2XCB A;  1TN8 A;  3EJN A;  3KAE A;  3TJP A;  4HRM B;  2RD0 A;  3ZYQ A;  1H2U A;  1BPO A;  1TEZ A;  1IQU A;  1V55 E;  4DRX E;  4TRQ A;  3AG4 E;  1BLX B;  1NZN A;  3OTN A;  3NZU A;  1AP7 A;  2AXV A;  4BX9 A;  3SBT B;  3E30 A;  4HOT A;  3MKQ B;  4ACK A;  4IUL A;  2XZT G;  1BU9 A;  1H6O A;  2MRI A;  3CSF A;  3ZNG A;  4MKT A;  3NQP A;  4A63 B;  5BV0 A;  2LUH A;  4UWK A;  2HM8 A;  2X3M A;  3PE4 A;  4EZK A;  3FP3 A;  4GZ3 A;  1TNZ A;  2L6B A;  3BUA A;  1KLX A;  4OVU A;  3T8K A;  2XS1 A;  1A5E A;  3E4B A;  2YNQ A;  2PQN A;  4BEP A;  3IBE A;  5D0Q D;  3QB2 A;  3CLJ A;  4IN3 B;  1N11 A;  3DSW A;  3B7U X;  5BW8 C;  2XPY A;  4GYO A;  4HBD A;  4F1S A;  5EIL A;  5ANL A;  4RVB A;  1W3B A;  3Q79 A;  4NQ0 A;  1K1B A;  5T8I A;  4U8H A;  3D9M A;  4HI8 A;  2XEH A;  3MKR A;  1Z5S C;  4LER A;  3HXB A;  4E85 A;  2X6F A;  3ZU7 B;  4DPR A;  4BTB A;  2M63 A;  2IO3 C;  5J08 A;  3URZ A;  1D9S A;  3CIA A;  3FTU A;  5G55 A;  5KJM A;  5EDS A;  4L23 A;  3G2S A;  4NIK A;  4IYP A;  2I6H A;  1OCR E;  4AY5 A;  1OCO E;  4K0R A;  4E6H A;  3MEK A;  5FQ7 A;  3IV0 A;  4ME2 A;  2AJA A;  3TWT A;  2F37 A;  2WB2 A;  1HZ4 A;  2CG2 A;  4CYM D;  2A4Z A;  3CVW A;  4W9R A;  4ATZ D;  5LCW J;  1HH8 A;  4PS3 A;  2WXR A;  4JL0 A;  3LCA A;  3MCX A;  2IJG X;  3FDH A;  2XGO A;  1ELR A;  3FU3 A;  5ENT D;  3UI2 A;  3CK7 A;  3ENE A;  3MZL B;  3FY4 A;  3LPZ A;  4G24 A;  1N52 A;  4GCO A;  3CV0 A;  2VGX B;  1GW6 A;  2GRL A;  4HLE A;  2WMN A;  3L82 A;  2L0I A;  3R7Q A;  1OT8 A;  2IOL A;  1H2V C;  1YA0 A;  4OYS A;  2WM9 A;  2PZI A;  5FT9 A;  1OWL A;  3JQ0 A;  4F1P A;  5T4Y A;  2R59 A;  2AXZ A;  4J8E A;  4G25 A;  1PY1 A;  3PZ4 A;  4M3O A;  4U7E B;  2IEJ A;  4UI9 K;  1OWN A;  2WXN A;  1O1S A;  1YYH A;  3FFL A;  1TN7 A;  4GTT A;  4O1P A;  3DBS A;  3ABM E;  3ZPJ A;  5EYP F;  4HXI A;  5JJ7 A;  3DEP A;  1S63 A;  3KD7 A;  4LEU A;  4GYY A;  2KC7 A;  4G26 A;  2EIJ E;  1UN9 A;  2MOW A;  1NP7 A;  5AN8 A;  3CVX A;  2F0Y A;  4JW1 A;  3ZYK A;  4JVS A;  4J0U A;  4GPM A;  3FTS A;  4DUI A;  3EIJ A;  3I4R B;  3PE3 A;  3ZIM A;  2IFU A;  3PDN A;  4ACL A;  3G2V A;  2UY1 B;  1N95 A;  4WWO A;  3CR3 A;  4I9E A;  1INZ A;  1N0R A;  3P2B A;  3UKU G;  2J08 A;  1MX4 A;  2FEZ A;  2H6G A;  4FLB A;  1H6K A;  4UWG A;  4U07 A;  1D8E A;  1HG2 A;  3JQ1 A;  4O60 A;  3OXF A;  5BV1 A;  3BG0 B;  3L13 A;  5DIZ A;  3UT7 A;  5LX8 A;  3DSX A;  5CED B;  1OY3 D;  2VSY A;  2DZO A;  2WXG A;  4M7C A;  3NOC D;  1NFI E;  4FUL A;  2PM6 A;  2A5E A;  2YHC A;  1LD7 A;  2OVF A;  1G3N B;  1Z3X A;  3OXG A;  4I2Z A;  3ZGQ A;  3FUJ A;  4V3I A;  4BWR A;  4XX5 A;  3RKV A;  1A17 A;  4C48 B;  4YVO A;  2KAT A;  3UM1 A;  1YCS B;  5AAO A;  1TNY A;  3EU5 A;  2CHX A;  5BT1 A;  4AVX A;  1JWG A;  1X81 A;  3FHE A;  1NA3 A;  4PS8 A;  4J8S A;  5FIO A;  5EKQ D;  5FZS A;  3ULQ A;  2FBN A;  3FUF A;  3CKB A;  4OAU C;  5AQA A;  5JHB A;  5HS0 A;  3ZW3 A;  4GTV A;  3DRA A;  2XEE A;  2ETB A;  1JWF A;  3QNK A;  1TR4 A;  3UTM A;  1TJF A;  3SBS A;  5FZQ A;  3EDT B;  2HO1 A;  4WWP A;  1FVF A;  4MLP A;  4KZ0 A;  3FTZ A;  3Q15 A;  3Q75 A;  4G2V A;  2V5F A;  4FJZ A;  1N4Q A;  5CEA A;  2EIN E;  2ETC A;  4LSZ E;  1E8X A;  3SFY A;  3E32 A;  2PNN A;  3SHF A;  1NA0 A;  5C2Y A;  3C98 A;  4HQD A;  4N3B A;  2WXH A;  2GRO B;  4IRU A;  5ANR A;  3UX4 A;  5ENP D;  1IKN D;  3PS6 A;  2LAH A;  3ZKJ A;  4Y6W A;  3PUJ A;  1X5B A;  4L1B A;  3Q49 B;  2DIW A;  3ULE G;  1OCZ E;  1SA4 A;  3CEQ A;  3T8M A;  3DSU A;  4YDW A;  4BES A;  3GZ1 A;  5FQ6 A;  2R03 A;  1TJC A;  3D9L A;  4FHJ A;  1ZB1 A;  4HLL A;  5E75 A;  1WDY A;  4DJA A;  1HO8 A;  3EHN A;  3QKY A;  3E33 A;  4DX1 A;  4O6F A;  3CVL A;  2KBX A;  4YDO A;  4X8Q A;  5LCW C;  2LO6 A;  2L9B A;  3RK6 A;  3ASF A;  3S7D A;  2A5U A;  3D9I A;  5CMW A;  3CHR A;  2KZT B;  2XQ0 A;  2WQ7 A;  2GW1 A;  5D0O D;  2V4L A;  4PS7 A;  3HG0 D;  2E0I A;  4P29 A;  1TN6 A;  3TXN A;  4L9P A;  4YDE A;  3X2Q E;  5KCM A;  3L6A A;  2NSZ A;  3D9N A;  1KT1 A;  3Q73 A;  3L17 A;  3MYV A;  3S7J A;  4PH4 B;  3MA5 A;  3ASN E;  3Q78 A;  1BD8 A;  2ZGG A;  5JHA A;  3FUH A;  3QC1 A;  3SFZ A;  3RRU A;  2YQ8 A;  4GA0 A;  5ARF A;  4FC8 A;  3LJN A;  3FUE A;  1OXJ A;  5BXU A;  3DEO A;  3T9K A;  2GRQ B;  2EQX A;  3QAR A;  4DX2 A;  2R5S A;  1E7V A;  1QBQ A;  1EF1 C;  3BU8 A;  4KXK B;  1E8W A;  3HXD A;  3U64 A;  1UOH A;  3VTY A;  5CBN A;  2GGF A;  1WY6 A;  3ONL A;  3HIZ A;  5C1D A;  4JEH A;  5B1A E;  4CRW A;  3ZYM A;  2WQH A;  1O5M A;  3AU5 A;  4TUU A;  1N94 A;  3RJV A;  4F6R D;  3FH7 A;  4CDR A;  3FUK A;  2J8S D;  5G04 J;  4KMO A;  3RAU A;  3ZXS A;  1MX6 A;  4U0S A;  3S7B A;  3QAQ A;  4N3A A;  2XRZ A;  4DK5 A;  4BTA A;  3PNL B;  4NUR A;  5CMY A;  1H6P A;  1MYO A;  2J4B A;  1U3D A;  5ENR D;  5KJL A;  4EHM A;  3U9W A;  1DCQ A;  2Y1L E;  3UIN C;  3V30 A;  3TWS A;  4N2Q A;  4J8F A;  4U96 D;  3HYM B;  1XNF A;  2XGM A;  3MKQ A;  3QK0 A;  3TGO A;  4Z68 A;  5LFA A;  4GMR A;  2DWZ A;  3GZ2 A;  3UIO C;  3IEG A;  3D3M A;  1O1T A;  3DXM G;  2QYU A;  2J09 A;  1BI8 B;  1FPP A;  1LF8 A; 
#chains in the Genus database with same CATH homology
 2Y3A A;  3TG4 A;  3FTS A;  4XKC A;  4R7L A;  3GZS A;  4UWF A;  1IQR A;  2KZT A;  2WXP A;  3CVN A;  3EIJ A;  2WXJ A;  3I4R B;  3PE3 A;  3ESK A;  2C0L A;  3HHM A;  3OXL A;  4A3V A;  2IFU A;  3PDN A;  4FLH A;  4ACL A;  2QY7 A;  3CQG B;  3G2V A;  4EZL A;  2UY1 B;  4ANX A;  4JXT A;  5M72 A;  3FU6 A;  4J6I A;  3UT4 A;  3FWV A;  3RU0 A;  4WWO A;  3CR3 A;  4EBA A;  4I1A A;  4I9E A;  4B8A A;  1INZ A;  2CFZ A;  3FTW A;  1HU3 A;  1UJJ A;  1DVP A;  2I2O A;  2KM4 A;  1N54 A;  2OOE A;  5FWQ A;  3BG1 B;  3ONK A;  4GYW A;  3P2B A;  3MV2 B;  4FJY A;  4JPS A;  2WXO A;  2J08 A;  5FQ4 A;  2V0P A;  2KCK A;  2WXK A;  3APD A;  2FEZ A;  1EDU A;  5A7D B;  4JHK A;  3AS4 A;  1P5Q A;  5KJK A;  5JJT A;  2IOS A;  3FTX A;  3JUI A;  3ML8 A;  3FU0 A;  4FP7 A;  4FLB A;  4GCN A;  5E76 A;  1JPL A;  5EX0 A;  4LRZ A;  4CEM A;  4XIF A;  2IQC A;  4YND A;  1H6K A;  2MHK A;  4WAF A;  1UG3 A;  4UWG A;  4U07 A;  1HG2 A;  2Y4U A;  4AY6 A;  3JQ1 A;  4AOF A;  2ZU6 B;  3OXF A;  3CST A;  5BV1 A;  3Q47 B;  2FO7 A;  3BG0 B;  3U3W A;  3D9O A;  1HF8 A;  3L13 A;  2VSX E;  5DIZ A;  3S7F A;  4AV7 A;  3L08 A;  3UT7 A;  3G2U A;  3ZHE B;  5LX8 A;  4XE0 A;  3VTX A;  2AXU A;  4GAA A;  4BY6 A;  1OWM A;  4MS6 A;  3OAW A;  4F53 A;  2VSY A;  3LY8 A;  4YVQ C;  2WXQ A;  2X38 A;  2VYI A;  4GPK A;  2WXG A;  2WXI A;  5EX3 A;  4ANW A;  2X6J A;  4FUL A;  2PM6 A;  4NRH B;  4DLO A;  1HG5 A;  2YHC A;  3P1U A;  4AEZ C;  1JUQ A;  2OVF A;  4CDM A;  3RRN B;  2L0T B;  1ZBP A;  2YIN A;  2JLB A;  4B94 A;  1Z3X A;  2AVP A;  3PUK A;  4UQY A;  5AJL A;  3OXG A;  3I5P A;  2PQR A;  4I2Z A;  4F3V A;  3ZGQ A;  4RSY A;  4GZC A;  5T3R A;  2I1J A;  5J90 A;  3FUJ A;  4V3I A;  4BWR A;  4GZ6 A;  2XHE A;  4F7A A;  1Y8M A;  4XX5 A;  3RKV A;  1A17 A;  4L2L A;  1SZ9 A;  2X6H A;  5HI7 A;  4YVO A;  2KAT A;  3N71 A;  3HDX A;  2X6I A;  4OVV A;  1PAQ A;  4PUC A;  3LDZ A;  3MJW A;  3ZFW A;  2CHX A;  3CKC A;  4WNG A;  4AVX A;  1JWG A;  5BT1 A;  2WXM A;  3FHE A;  4NAC A;  4GA1 A;  1NA3 A;  1OUV A;  3ASD A;  4PS8 A;  4WND A;  3CK8 A;  4FU3 A;  4J8S A;  1PC2 A;  5FTP A;  3Q5M A;  2YHE A;  5EKQ D;  3ZN3 A;  4H7Y A;  4XI0 A;  1HFA A;  3MGB A;  1WAO 1;  5FZS A;  3ULQ A;  2OVB A;  2ION A;  3UMV A;  5FZR A;  2FBN A;  5LP0 A;  2XPZ A;  3FUF A;  3ZVV A;  4DLQ A;  3D9P A;  4HVB A;  1SZA A;  3CKB A;  4EZJ A;  4A55 A;  2LAI A;  5JHB A;  3ZW3 A;  2CG3 A;  3LY7 A;  4GA2 A;  4I6E A;  4JC8 A;  4ABN A;  1HX8 A;  1JWF A;  4G1T A;  3QNK A;  5ENN A;  4DI4 A;  5AIJ A;  3LEW A;  1TJF A;  4HOQ A;  2HR2 A;  4ILH B;  2CHW A;  3SBS A;  5A23 A;  5FZQ A;  3EDT B;  3QWW A;  1DNP A;  2VGX A;  2C2L A;  2HO1 A;  5BUZ A;  1B89 A;  4WWP A;  2VSN A;  1H19 A;  1FVF A;  4MLP A;  3RO2 A;  4HFG A;  4KZ0 A;  5G2N A;  4BT8 A;  3FTZ A;  3Q15 A;  4FJZ A;  3KS2 A;  2V5F A;  3GYZ A;  2I9C A;  2XGS A;  4G2V A;  3CHS A;  2E2E A;  3PRE A;  2BTD A;  2FUL A;  3UUX A;  4UI9 C;  2OND A;  2XRY A;  5ARG A;  2WPV A;  4LCT A;  1E96 B;  4DI3 A;  1E8X A;  4CGV A;  1FVH A;  1KT0 A;  2JEK A;  3G2T A;  2HYZ A;  3VLD A;  3EIQ C;  2LSV A;  3CHP A;  4WNF A;  3RRM B;  3SHF A;  3L54 A;  3K9I A;  1NA0 A;  2IF4 A;  3B7R L;  3UQ3 A;  4N5C A;  4QFV A;  3ASG A;  2GRM A;  5C2Y A;  2P58 C;  3C98 A;  3TXM A;  4HOS A;  4N3B A;  1IHG A;  2WXH A;  2DCP A;  1E7U A;  2XEV A;  1OWP A;  3G2W A;  4IRU A;  3TL5 A;  4L7T A;  5ANR A;  3ZEF A;  2XCC A;  3FUM A;  1Z3Y A;  3IKO B;  4I6J A;  3UX4 A;  2WQ6 A;  4XKB A;  2Q7F A;  3KEZ A;  2VTB A;  3UT8 A;  4J8D A;  3D9J A;  3U4T A;  4APF A;  3PS6 A;  2XCB A;  2ILR A;  1E8Z A;  2LAH A;  4A1G A;  4Q69 A;  5G05 C;  4FAD A;  3EJN A;  3KAE A;  4I1O B;  3TJP A;  2RG8 A;  3AS8 A;  4Y6W A;  3PUJ A;  2RD0 A;  1X5B A;  4L1B A;  1H2U A;  3Q49 B;  1BPO A;  1UW4 B;  3ZYQ A;  1IQU A;  3VLE A;  1TEZ A;  2DIW A;  4A3T A;  4JHJ A;  2VQ2 A;  3JYS A;  4TRQ A;  4GMJ A;  3LVQ E;  3LXU X;  1H0A A;  4G23 A;  4AXH A;  3CEQ A;  3T8M A;  1NZN A;  3T5V A;  3OTN A;  4CT0 A;  3NZU A;  2AXV A;  3GZ1 A;  5FQ6 A;  3AS5 A;  4BX9 A;  3SBT B;  4D10 C;  3CVP A;  1TJC A;  3D9L A;  3FTY A;  3LJ3 A;  4URK A;  3HVE B;  2J4D A;  4HOT A;  4Q94 A;  4FHJ A;  3CHM A;  3MKQ B;  5E75 A;  3ZYL A;  4ACK A;  4IUL A;  4DJA A;  2MRI A;  1HO8 A;  3CSF A;  3EHN A;  4KT6 B;  3QKY A;  4MKT A;  2NC9 A;  4O6F A;  4KZC A;  3NQP A;  3S2A A;  5BV0 A;  4K03 A;  1QZ2 A;  4UWK A;  2HM8 A;  2X3M A;  3CVL A;  4Q96 A;  3PE4 A;  4EZK A;  1VDY A;  4ILG A;  4WWN A;  3SZ7 A;  3FP3 A;  5LCW C;  4GZ3 A;  4UQX A;  2LO6 A;  1QNF A;  2L9B A;  3RK6 A;  2UY1 A;  4RG6 A;  5KJN A;  4FA6 A;  2WMO A;  3PNT B;  3ASF A;  3S7D A;  4CT4 A;  2A5U A;  3D9I A;  5CMW A;  3O4Z A;  1KLX A;  4OVU A;  3CHR A;  2KZT B;  3VLF A;  3FTV A;  1HS6 A;  3SNX A;  2VSO E;  2XQ0 A;  3FEY A;  3SI5 A;  2WQ7 A;  4C0E A;  3E4B A;  2YNQ A;  2CHZ A;  5JJ6 A;  2PQN A;  4I1M A;  2GW1 A;  2BUG A;  5D0O D;  4I43 A;  3IBE A;  2V4L A;  5D0Q D;  4PS7 A;  2NXP A;  3EHM A;  5G04 C;  3QB2 A;  3CLJ A;  2E0I A;  4IN3 B;  4KYO B;  5BPP A;  4PDX A;  5CCM A;  5CCL A;  3B7U X;  4ATG A;  4P29 A;  3CVQ A;  5BW8 C;  3TXN A;  4B8C B;  4CCA A;  3TG5 A;  2XPY A;  4GYO A;  4WNE A;  4F1S A;  4I6G A;  4UI9 J;  5ANL A;  5KCM A;  4RVB A;  1W3B A;  3L6A A;  4NQ0 A;  4GZD A;  4JA9 A;  2NSZ A;  3FUD A;  3ZHE A;  1QQE A;  3D9N A;  3JCK C;  1EYH A;  5T8I A;  4U8H A;  1KT1 A;  2L6J A;  3D9M A;  3PRZ A;  4HOU A;  4H7X A;  3NZS A;  3L17 A;  1EPU A;  1Y6I A;  3MYV A;  3S7J A;  1U3C A;  3MKR A;  4PH4 B;  3MA5 A;  3PH0 C;  1FCH A;  4GB9 A;  4LER A;  2PL2 A;  3FUL A;  1SQM A;  1ZU2 A;  2LSU A;  4KVM A;  4E85 A;  1Z6T A;  3HVE A;  1ELW A;  2VJ8 A;  2X6F A;  3QOU A;  4DPR A;  4BX8 A;  4BTB A;  4L2Y A;  3R9A B;  3PVL A;  5JHA A;  2M63 A;  3FUH A;  5BNW A;  5J08 A;  3QC1 A;  3FH5 A;  3URZ A;  1MQS A;  3SFZ A;  4LUN U;  4HOR A;  3RRU A;  2YQ8 A;  4GA0 A;  4CGW A;  2V8S E;  3PZD A;  4U0Z A;  5ARF A;  3CVV A;  5FQ8 A;  3CIA A;  3FTU A;  3FUI A;  4APO A;  2WXF A;  5G55 A;  4FC8 A;  2R17 C;  1XGW A;  3FUE A;  4FHK A;  3Q4A B;  5AYW D;  5EDS A;  5KJM A;  4L23 A;  3G2S A;  3IHY A;  3CVU A;  1OWO A;  3I3N A;  4IYP A;  4JHR A;  4AJW A;  2I6H A;  5LOZ A;  4AY5 A;  4XI9 A;  4JZY A;  3ZRH A;  4MRU A;  4K0R A;  2EQX A;  3QAR A;  4N3C A;  2R5S A;  4E6H A;  4G11 A;  3MEK A;  5FQ7 A;  2DBA A;  1E7V A;  3IV0 A;  1MHQ A;  2LNI A;  4ME2 A;  4WUY A;  1EF1 C;  3DPD A;  2FF4 A;  2WB2 A;  4EQF A;  2J9Q A;  1E8Y A;  4Y6C A;  4KXK B;  1HZ4 A;  2CG2 A;  3CGH A;  2A4Z A;  3RO3 A;  4XZ4 A;  3ASH A;  1E8W A;  4UWL A;  3SGH A;  4C0M A;  4EEC A;  3CVW A;  4W9R A;  3L22 A;  4KBQ A;  3B13 A;  3RIB A;  1S0P A;  4C9B B;  5LCW J;  2PM7 A;  3U64 A;  1HH8 A;  4B89 A;  1HXI A;  2KCV A;  3CHO A;  4GU5 A;  4PS3 A;  3VTY A;  3SF4 A;  2WXR A;  2VGY A;  4JL0 A;  2GGF A;  3LCA A;  1WY6 A;  3MCX A;  3ONL A;  2IJG X;  3FDH A;  5DBK A;  3HIZ A;  5C1D A;  4JEH A;  4B0Z A;  4I2W A;  4U04 A;  2XGO A;  3NF1 A;  4AP2 A;  1ELR A;  3FU3 A;  4BFR A;  4AM9 A;  2WXL A;  4CRW A;  1UJK A;  3CK7 A;  3PEU B;  3GW4 A;  4TV3 A;  3R7R A;  1UN8 A;  3ZYM A;  1L5J A;  2WQH A;  3ENE A;  4ILI A;  5FJY A;  3MZL B;  3AU5 A;  4BT9 A;  3FY4 A;  4TUU A;  3LPZ A;  3RJV A;  4G24 A;  3FH7 A;  3CHQ A;  3ZIM A;  1N52 A;  4GCO A;  3CV0 A;  4A1S A;  3FUK A;  5G04 J;  4CDR A;  2VGX B;  1IYG A;  1GW6 A;  4KMO A;  2QFC A;  2GRL A;  4HLE A;  2WMN A;  2L0I A;  3R7Q A;  3ZXS A;  3LVR E;  4JEU A;  4RG9 A;  2IOL A;  1H2V C;  4N39 A;  1YA0 A;  3QJZ A;  4UQZ A;  4U63 A;  2BF0 X;  4U0S A;  4ANV A;  2IU1 A;  4OYS A;  3AU4 A;  2WM9 A;  2WVI A;  3QAQ A;  4N3A A;  3S7B A;  2XRZ A;  2PZI A;  2XPI A;  2OV8 A;  3LS8 A;  5FT9 A;  3PNL B;  4BTA A;  4DK5 A;  4HS2 A;  1OWL A;  3JQ0 A;  4NUR A;  5T4Y A;  2R59 A;  5CMY A;  2AXZ A;  2J4B A;  2CFU A;  2I1K A;  4J8E A;  1U3D A;  3FEX A;  4G25 A;  3LKU A;  3SD5 A;  1PY1 A;  2AWI A;  3D9K A;  3PEV B;  3I4G A;  4JA7 A;  5KJL A;  4U0U A;  3QWV A;  3U9W A;  4M3O A;  4ANU A;  3B7T A;  3FUN A;  4UI9 K;  1OWN A;  2WXN A;  3LYA A;  3FFL A;  4KVO A;  2VTB B;  3ML9 A;  1ELK A;  5A6C A;  2KCL A;  4N2S A;  3DBS A;  3BEE A;  3IHV A;  1WM5 A;  4GML A;  5AJD A;  3MV3 B;  4CDN A;  4EBA G;  2C0M A;  3ZPJ A;  3UPV A;  2X6K A;  3FH8 A;  4HXI A;  4I9C A;  3L16 A;  1H2T C;  4GZ5 A;  5JJ7 A;  3APF A;  4EPZ A;  3KD7 A;  1HE8 A;  4LEU A;  4J8F A;  4N2Q A;  2FI7 A;  3QDN A;  4GYY A;  4BSX A;  3MX3 A;  5CHE E;  3HYM B;  2J49 A;  3U66 A;  3CVY A;  1XNF A;  3CQC B;  4UWH A;  2XGM A;  2KC7 A;  3MKQ A;  3QK0 A;  3TGO A;  4G26 A;  3TAX A;  1UN9 A;  2MOW A;  5G05 J;  5LFA A;  1NP7 A;  2J07 A;  3APC A;  3FU5 A;  3GZ2 A;  3CVX A;  2AW6 A;  3IEG A;  3D3M A;  4JW1 A;  3B7S A;  3QWP A;  2Y4T A;  3ZYK A;  2J09 A;  5AEN A;  3WXX A;  1E90 A;  4AIF A;  3O48 A;  4JVS A;  4J0U A;  3T5X A;  5HQ8 A;  3LY9 A;  3ESL A;  3CK9 A;  4I17 A;  2UWJ G;  1LF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...