1Q2ZA

The 3d solution structure of the c-terminal region of ku86
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
GPVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent DNA helicase II, 80 kDa subunit
publication title The 3D Solution Structure of the C-terminal Region of Ku86 (Ku86CTR)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08785 Ku_PK_bind Ku C terminal domain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 1q2zA00
1RW2A 3ISMC 1Q2ZA
chains in the Genus database with same CATH superfamily
3FUEA 3OXGA 2Q7FA 2P9NG 1DVPA 4UWLA 3ZKJA 2RFAA 3NQPA 3QKYA 3T8MA 1LF8A 5JJ6A 3LVQE 1KZPA 2HYZA 3QDNA 3RU0A 3D9MA 2XENA 1SA4A 1Z3XA 4H7XA 4KZ0A 3LXUX 1JCRA 4LG6A 1W3BA 4KXKB 3JCKC 3G2UA 3PH0C 3BG1B 2WMOA 2MYOA 4RG6A 1AWCB 2UY1A 3JXIA 2ETCA 4J8SA 3LY9A 2XRYA 2AVPA 1EF1C 5JJTA 2XCCA 3MZLB 2OEVA 3EU5A 2CFZA 3NOGD 2BTDA 4URKA 3ABME 2C2LA 3ZYQA 4HNAD 4HOSA 4NRHB 2P9LG 3LJNA 3WXXA 3CHPA 1E7VA 3E34A 3FULA 2OV8A 3DXMG 4J8FA 4AY5A 3ZYKA 4P29A 1U2VG 4GA1A 3WG7E 4DI4A 4U96D 3HG0D 4Z68A 5T8IA 4ILIA 4GTPA 2DYSE 4I6JA 4DLOA 3D9IA 5HKPA 4GYOA 5EYLA 1HS6A 5BV0A 2V5QC 3KAEA 4TRQA 1X81A 1S63A 2Y0BG 4I2WA 2CHWA 4GMJA 2VSXE 3DSSA 3FY4A 2DZOA 2ETBA 4U0ZA 2GRNB 4GTMA 4CDNA 3CVNA 3RKVA 3QAQA 4DI3A 3PZ4A 2WXFA 3RAUA 2UY1B 3QARA 5EX0A 4EZJA 3MCXA 2DZNA 5D0OD 4ATZD 3VTYA 2QY7A 3DPYA 3MGBA 3BEEA 2Y4UA 2C0LA 4YDOA 2DWZA 3QJZA 1INZA 3L9TA 4LUNU 2OVBA 3QC1A 3V2XA 2V4HC 1A5EA 4B0ZA 4UQXA 1N0RA 5FQ4A 3APDA 3PVLA 3T5XA 1N95A 2PM6A 4CT0A 3K9IA 5FJYA 4UUCA 2YINA 5H7PA 2YQ8A 4UI9J 4B94A 4PS8A 1H6PA 5CCMA 2RD0A 2LNIA 5A23A 1UG3A 3OAWA 1XNFA 3AS8A 3R7QA 1K3ZD 3BG0B 3CVLA 4GB9A 5BPPA 5FQ7A 1K1BA 2QFCA 3DXKG 4B8AA 2OCCE 4GPKA 1ELWA 4GTQA 4AY6A 4BX8A 1H2TC 1HXIA 5AAOA 3AAAC 1JWGA 3CGHA 3FUKA 3VLFA 3QB2A 1IHGA 1KT1A 3OXFA 2FEZA 3ZVVA 4L1BA 2KBXA 3D9LA 1UW4B 4C9BB 2XGOA 1A17A 1D8EA 4I43A 3UQ3A 3O48A 2LUHA 3V30A 3MV2B 4ZHBA 2HO1A 4G25A 2CFUA 1TJCA 3Q47B 3ZXSA 2EILE 4FU3A 2NYJA 5KJMA 4PS7A 4BTAA 2WXPA 4GA2A 2RFMA 3ZYLA 3DSXA 4DJAA 4OAVB 3CSTA 2EIME 2L6JA 3FEYA 3VLDA 4GTOA 4IYPA 4CT4A 3FTZA 3I5PA 4CEMA 4LCTA 5FZQA 1BD8A 5IY5E 5BXOA 3KEAA 5ANLA 3UKUG 4DX7D 1KZOA 1H0AA 3PUKA 4N3AA 5B1BE 1HG2A 4F6RD 2ILRA 4L7TA 3E32A 3PNLB 4U63A 4WWNA 3Q9UC 2P9SG 2XZDG 2WXKA 3ZNGA 1Q2ZA 3UTMA 4JHJA 3G2TA 4MKTA 2A5EA 1H2UA 3SD5A 3SI5A 2LSVA 3CVUA 3NB2A 3FU6A 2MHKA 5CMWA 4FULA 1TR4A 3SNXA 4BT8A 2ZXWE 3ISMC 2WXRA 3NAWA 2OEWA 3PDNA 4JVSA 3Q79A 1O1TA 3FH8A 3N71A 5DBKA 4BT9A 5LCWJ 4HS2A 4B8CB 1QQEA 3EJNA 2VGEA 3SFZA 3Q73A 5KJNA 3FUDA 5EILA 4HOUA 2X6FA 1EYHA 1U3DA 3T8KA 4BWRA 3CV0A 3RRNB 5T4YA 2I6HA 1HFAA 2H6IA 2WXGA 4TXQA 2L0TB 1KLXA 3FUNA 2EQXA 5ENOD 4BERA 3GZSA 1BI7B 2AWIA 3D3MA 1IQRA 4BFRA 5M72A 3S7FA 3Q49B 2A5UA 3CIAA 3U66A 3UT7A 4JL0A 2VGYA 5KBAA 5KJKA 2IO2C 2A4ZA 3IXEA 1S0PA 1X5BA 3CEQA 3TWWA 2BKGA 5T3RA 3BU8A 2OVFA 3ZUVB 3UXGA 1FVHA 1TYQG 2EIJE 1FCHA 4GTTA 4APFA 3FUJA 3NZSA 4U0SA 4A1SA 2YNQA 2Y3AA 3JUEA 2E2EA 2GRQB 3PZ3A 4KVMA 4KYOB 1QBQA 3HVEA 1S70B 2DYRE 2P58C 4N2QA 1FT1A 3EIQC 2X6KA 1OT8A 3FTWA 1Z5SC 1OCZE 5BV1A 2GW1A 4J0UA 3ZU7B 3Q78A 3HXEA 3D9HA 4U8YD 1SW6A 2XGSA 3NOCD 5D66A 5CCLA 4Y6WA 2LAHA 3D9NA 5ENNA 1PAQA 2QZAA 2CHXA 4JPSA 5C2YA 4EECA 2L6BA 5A6CA 3FU0A 1N11A 3DEOA 3UIPC 4WWPA 2J4BA 3TWQA 3DSWA 2P9IG 1NA3A 2VSNA 1EDUA 5EYPF 1QNFA 2F8YA 1WG0A 4HOQA 2Y1LE 1Y6IA 4AEZC 1NA0A 5E75A 5KNGA 4ACKA 4F53A 1MZCA 3DSUA 4WNGA 4J6IA 3JQ0A 1ZB1A 2VTBA 4DX2A 5E76A 2ZGDA 3ZXPA 2M63A 2J8SD 3T5VA 3LEWA 3CLJA 2F8XK 1WDYA 3C72A 3ZHEA 3HVEB 4LEUA 3C3RA 4CGWA 3UT4A 4U0UA 3OTNA 4KZCA 4J8EA 5LOZA 3D9JA 4BX9A 3R7RA 3URZA 4FADA 1MYOA 3B13A 5EN5D 4NQ0A 1V54E 2XGMA 3CK7A 3FU5A 5CERB 3LKUA 1B89A 3G2VA 1HX8A 3UPVA 4AOFA 3TGOA 5G05J 5BNWA 5FQ8A 4IRUA 3UUXA 4A55A 1MHQA 3LJ3A 1WY6A 3IEGA 3MEKA 3TL5A 2R03A 1MQSA 5AN8A 5LFAA 4OAUC 4F7AA 4HOTA 2FO7A 3ASHA 4GZ6A 5DIZA 4KVOA 4TXPA 2DCPA 3QOUA 1IYGA 3HXBA 4L2LA 4XI9A 3ML8A 4LRZA 2KC7A 4WUYA 3PE3A 5AQ7A 2RG8A 2VTBB 3CHRA 4I6GA 4GTSA 5B1AE 4CYMD 3ULYA 3EUVA 4M3OA 5EIDA 3ZYMA 3ZHEB 4F1PA 3D9OA 3FTSA 3LDZA 2KCKA 3AS4A 3DRAA 2V8SE 3IHYA 3DBSA 1H2VC 2GRMA 3Q7FA 1JPLA 5D0QD 5G55A 4GCOA 3ENEA 4CCAA 3ZN3A 1IHBA 2WXOA 4EPZA 2LXLA 1K8KG 4MBGA 3AU4A 5JHBA 3J5PA 2XCBA 1YCSB 2Y69E 4ANXA 1S64A 2XRZA 2PM7A 3L6AA 3SBTB 2QYUA 1UJKA 4GZDA 4C0MA 4I9EA 4FP7A 1SA5A 1FPPA 4HVBA 3TWSA 4H7YA 4DPRA 4A1GA 4NIKA 2X6IA 1XGWA 4C48B 2PQNA 2IOSA 3TG4A 4XZ4A 1QZ2A 4CDMA 1V55E 2VYIA 2ZISA 1OY3D 2YHCA 3W9FA 4YDYA 2BEDA 3AG4E 4U04A 2WXIA 1WAO1 1DNPA 3KS2A 3TWTA 4K5AB 3RO3A 2IU1A 2VJ8A 3E30A 1LD8A 4ILHB 2E0IA 4G8KA 4K0RA 4JHRA 4UI9C 3KSLA 4I1AA 5FTPA 3FTVA 1H6KA 1MX2A 1TNUA 1N94A 2WQ6A 2R2LA 3SY2A 3L17A 1UOHA 1OWLA 4O1OA 4HB5A 4G8LA 3ABKE 4GYWA 3L54A 3V31A 2P2CP 2GRPB 3PREA 4JA9A 2MRIA 2X6JA 2C0MA 5J08A 3TWXA 4RLYA 1TNBA 3DSVA 4EZLA 2IONA 1OWPA 3HXDA 1Z6TA 4XKBA 1L5JA 3T9KA 1KPSB 4G11A 5ENSD 5B3SE 3NZUA 4G23A 4AP2A 3HDXA 4CZ2D 2WQHA 3BQOA 2V4LA 5JHAA 5AENA 4N3CA 1FT2A 3ZPJA 1DCQA 3PZDA 4JEUA 2KZTA 3LCAA 4TV3A 1HH8A 1HG5A 2H6HA 2RKKA 3APFA 3G2SA 3CVVA 3KEZA 2XEVA 4K5CA 3W9GA 5ARGA 1IQUA 4G2VA 2IF4A 3PZ2A 3O4ZA 3RRMB 2XS1A 2NXPA 1YA0A 3TXNA 3J5QB 4KBQA 1IKND 4YVQC 4J8YA 5G04C 5FINA 1OCRE 4AVXA 2WXMA 4ATGA 4U7EB 5HQ8A 5FQ6A 3E37A 1K1AA 4GTVA 4I2ZA 3CVQA 2QC9A 5JMND 3EU9A 4FHJA 1OCCE 2WQ7A 2FBNA 3JUIA 1JUQA 4GZ5A 2IO3C 1N4PA 2DBAA 4FC8A 4AV7A 5FWQA 2WXHA 2R02A 3FEXA 1SVXA 1N0QA 4BESA 4BSXA 4HRMB 4X8QA 4F3VA 2PZIA 5AIJA 3CKBA 2Y4TA 2BUGA 1NL4A 5HI7A 3AG1E 4DLQA 2H6GA 4YNDA 2J07A 4HLLA 3ASFA 3TJPA 4JXTA 1N4SA 1ELRA 4BTBA 4XI0A 4LNBA 2F0YA 2V5FA 3CHOA 3QWPA 2XPYA 2KZTB 2R17C 1OCOE 1BI8B 3B7UX 4I1MA 3Q75A 1N52A 3UX4A 2GRRB 1G3NB 3AU5A 1LTXA 3MKQB 3S7DA 1MJ0A 2BKKB 4GMLA 2L9BA 2X3MA 3SZ7A 3UMVA 5FZSA 2KATA 1D8DA 4GTRA 2ONDA 3SFYA 1SZAA 4FJYA 5CEAA 4AIFA 2F37A 3UI2A 4N39A 4DX6D 1NP7A 3CVYA 3B7SA 3EHRA 3HYMB 4EQFA 4W9RA 3RSEG 4N3BA 1YMPA 3HIZA 4O6FA 4DX1A 1KT0A 4U8VD 3Q4AB 4D10C 3CVWA 3DWLG 3EHNA 5BUZA 4O1PA 2DVWA 3LYAA 3RJVA 3PRZA 5ITZF 3AJIA 1HO8A 4JA7A 1E8WA 3NBNB 3C98A 3RRUA 3EDTB 4ABNA 3DPDA 3APCA 4CDRA 4UQYA 2CG2A 5KNHD 3VLEA 3HXCA 4E85A 2FO1E 3CVXA 4UQZA 3FFLA 2LAIA 3U9WA 1PC2A 4G1TA 4NACA 4PS3A 1PY1A 4UWGA 4LNUD 3DEPA 3FDHA 3QK0A 5AYWD 3SFXA 1OUVA 3FTYA 4JW1A 1VDYA 2VGXA 2PQRA 3ASGA 5EKQD 2XS8A 2NC9A 3KSQA 1E8ZA 4XX5A 3GZ1A 4YDEA 2GGFA 5JA4D 2J9QA 3E33A 5C1DA 2WXQA 4CRWA 3CQCB 4FHKA 3ULQA 3SO8A 4NURA 1BPOA 3LPZA 2CHZA 4WNDA 4YVOA 4UWHA 1TNZA 1QYMA 3C3OA 2AW6A 3B7TA 3JXJA 2HR2A 2FI7A 2XEHA 4QFVA 2AJAA 1E7UA 1TNOA 4LNGA 2KM4A 4K5BA 1AP7A 1TN8A 3FWVA 3EHQA 3ASDA 3SQVA 3I4RB 3Q15A 3ONLA 1ZBPA 5G2NA 3FH7A 4WAFA 4JC8A 3UM1A 4B93B 2YHEA 5ARFA 2XQ0A 2WXNA 1RZ4A 3LY8A 5A7DB 3HXFA 2GRLA 1HU3A 1GW6A 2V0PA 4DK5A 2I9CA 5CECB 3V79K 1HZ4A 1UN8A 4UI9K 1RW2A 5EIBE 1H19A 4B89A 1E96B 4HI9A 4G26A 2VGXB 4KMOA 4PUCA 5CMYA 4AM9A 2GROB 2P9KG 4BY6A 1LD7A 2WPVA 4JZYA 3Q7AA 5G05C 2MOWA 5BT1A 4I17A 4RVBA 1JCSA 3VTXA 3ASNE 4UWKA 1E8XA 2I1KA 4TUMA 4GAAA 4GZCA 3GZ2A 5HRYA 5AJDA 1JWFA 3Q9NC 3X2QE 2R5SA 2X6HA 3G2WA 1N4QA 4YDWA 3L13A 3RK6A 2JEKA 3B7RL 4LERA 3SHFA 2IY0C 4J7WA 5AJLA 4FLBA 3ESKA 3AS5A 4BEPA 2WVIA 3FU3A 3UM3A 1EPUA 2IFUA 3FUMA 4MS6A 1D9SA 4JD2G 3V2OA 4MLPA 4XE0A 3PE4A 5FIOA 4U95D 3S7JA 1MX4A 3ZEFA 5AARA 3PEVB 4HI8A 5BXUA 4JEHA 2KXPC 3R9MA 1TN7A 4Q69A 3TWRA 2EIKE 3CK8A 4Q94A 3U4TA 4HBDA 2UWJG 5ENQD 2I2OA 4EBAA 3IBEA 5ANRA 2VQ2A 3C3QA 4L9PA 2FULA 4EZKA 1OWOA 2XPZA 3L82A 4KT6B 3LY7A 1YYHA 3FTXA 2B6CA 3PZ1A 2J4DA 3B95A 4GCNA 4I1OB 4XIFA 5CBOA 1SZ9A 4ILGA 4I9CA 4FJZA 4WNEA 1UN9A 4OYSA 2KCLA 3UM2A 2WMNA 4AJWA 3LVRE 3CSFA 4HFGA 1NZNA 4EHMA 2IEJA 3FUIA 3ABLE 3B7BA 1Z3YA 2P9UG 3F6QA 5EX3A 3CHMA 4LSZE 3GYZA 3MYVA 3L16A 3SF4A 3DSTA 3QNKA 1IXVA 4HORA 4ANUA 3MKRA 2J08A 4J8DA 4ZFHA 5AQ9A 4OVUA 3ESLA 3IV0A 4RG9A 3QWWA 2AXUA 2OOEA 4HLEA 2ZU6B 2ZIRA 1TN6A 2QYJA 4IULA 5CBNA 3MA5A 2JLBA 3FTUA 4Y6CA 1HE8A 4TUUA 4U07A 2PNNA 1N4RA 2LXMA 3IKOB 5FZRA 5G04J 1O1SA 5AQBA 4BETA 2JABA 4ME2A 3UINC 2CG3A 4U8HA 1H6OA 3UKRG 1UJJA 1DC2A 3PUJA 4JB8P 3CVPA 3PNTB 3U64A 3PEUB 4IN3B 1SQMA 2AXVA 1U3CA 4ANWA 2WB2A 3MKQA 2X38A 3ULEG 3ZFWA 3ZW3A 2B0OE 4GA0A 3MV3B 4XKCA 1DCEA 5HS0A 3HRAA 2VSOE 5CRUA 3Q5MA 5LX8A 2WM9A 3FUFA 4GZ3A 3FP3A 1E8YA 3AG3E 4I6EA 2ETAA 5FT9A 1OWNA 2I1JA 2XZTG 3ZIMA 4Q96A 2IJGX 3LS8A 2LO6A 3UM0A 4OVVA 2ZGGA 1HF8A 2HM8A 4ACLA 4QQIA 1OXJA 4HXIA 3P1UA 3S7BA 2LSUA 3UIOC 4TXRA 4APOA 4MRUA 1WM5A 3BUAA 3D9KA 3RO2A 3MJWA 5ENPD 3ASOE 4N5QA 1O1RA 3CQGB 4A63B 3U3WA 3CHSA 2J09A 4FLHA 4ANVA 3NF1A 1MX6A 3EIJA 3C5RA 1NFIE 3ZRHA 3D9PA 2DIWA 4N5CA 2L0IA 3OXLA 1ZU2A 4PH4B 4V3IA 4CGVA 5KCMA 2WXJA 3ML9A 3TWUA 3AG2E 5LCWC 5ENRD 3SGHA 3PS6A 2IQCA 5JJ7A 3CK9A 1TNYA 3I3NA 4EBAG 2KCVA 4UWFA 5CHEE 3TWVA 3SBSA 4A3TA 2P9PG 4RSYA 1BU9A 3IHVA 5CEDB 4L2YA 1E90A 2R59A 3KD7A 4L23A 2IOLA 1O5MA 4F1SA 4GMRA 2NSZA 2R05A 1NI1A 3MX3A 3QWVA 2BF0X 3CR3A 4GU5A 5ENTD 2FF4A 3R9AB 4WWOA 2PL2A 1TJFA 2VSYA 3JQ1A 1N54A 4GYYA 3GW4A 4DX5D 1Y8MA 4RQIA 5EDSA 2XPIA 4AXHA 2XHEA 4K03A 1BLXB 4HRNA 3CKCA 3I4GA 5AQAA 4C0EA 1ELKA 5CRVA 3UT8A 4DRXE 2EINE 3L22A 3ONKA 4HQDA 4O60A 1N9AA 3TG5A 5KWDA 4BSZB 4E6HA 3FHEA 1FVFA 3HHMA 2J49A 3E4BA 3TXMA 1JCQA 3P2BA 4PDXA 3CHQA 4N2SA 1OWMA 4M7CA 4WNFA 3RIBA 3S2AA 4A3VA 3ZGQA 1TEZA 4HRLA 4JHKA 3EHMA 3FH5A 1P5QA 3L08A 4XEIG 4DUIA 3JYSA 2HE0A 5BW8C 2XEEA 5KJLA 4GPMA 4R7LA 2WXLA 2AXZA 3TAXA 4FA6A 3FUHA 2H6FA 5LP0A 5D2MC 5J90A 4G24A
chains in the Genus database with same CATH topology
1RW2A 3ISMC 1Q2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RW2 A;  3ISM C;  1Q2Z A; 
#chains in the Genus database with same CATH topology
 3FUE A;  3OXG A;  2Q7F A;  2P9N G;  1DVP A;  4UWL A;  3ZKJ A;  2RFA A;  3NQP A;  3QKY A;  3T8M A;  1LF8 A;  5JJ6 A;  3LVQ E;  1KZP A;  2HYZ A;  3QDN A;  3RU0 A;  3D9M A;  2XEN A;  1SA4 A;  1Z3X A;  4H7X A;  4KZ0 A;  3LXU X;  1JCR A;  4LG6 A;  1W3B A;  4KXK B;  3JCK C;  3G2U A;  3PH0 C;  3BG1 B;  2WMO A;  2MYO A;  4RG6 A;  1AWC B;  2UY1 A;  3JXI A;  2ETC A;  4J8S A;  3LY9 A;  2XRY A;  2AVP A;  1EF1 C;  5JJT A;  2XCC A;  3MZL B;  2OEV A;  3EU5 A;  2CFZ A;  3NOG D;  2BTD A;  4URK A;  3ABM E;  2C2L A;  3ZYQ A;  4HNA D;  4HOS A;  4NRH B;  2P9L G;  3LJN A;  3WXX A;  3CHP A;  1E7V A;  3E34 A;  3FUL A;  2OV8 A;  3DXM G;  4J8F A;  4AY5 A;  3ZYK A;  4P29 A;  1U2V G;  4GA1 A;  3WG7 E;  4DI4 A;  4U96 D;  3HG0 D;  4Z68 A;  5T8I A;  4ILI A;  4GTP A;  2DYS E;  4I6J A;  4DLO A;  3D9I A;  5HKP A;  4GYO A;  5EYL A;  1HS6 A;  5BV0 A;  2V5Q C;  3KAE A;  4TRQ A;  1X81 A;  1S63 A;  2Y0B G;  4I2W A;  2CHW A;  4GMJ A;  2VSX E;  3DSS A;  3FY4 A;  2DZO A;  2ETB A;  4U0Z A;  2GRN B;  4GTM A;  4CDN A;  3CVN A;  3RKV A;  3QAQ A;  4DI3 A;  3PZ4 A;  2WXF A;  3RAU A;  2UY1 B;  3QAR A;  5EX0 A;  4EZJ A;  3MCX A;  2DZN A;  5D0O D;  4ATZ D;  3VTY A;  2QY7 A;  3DPY A;  3MGB A;  3BEE A;  2Y4U A;  2C0L A;  4YDO A;  2DWZ A;  3QJZ A;  1INZ A;  3L9T A;  4LUN U;  2OVB A;  3QC1 A;  3V2X A;  2V4H C;  1A5E A;  4B0Z A;  4UQX A;  1N0R A;  5FQ4 A;  3APD A;  3PVL A;  3T5X A;  1N95 A;  2PM6 A;  4CT0 A;  3K9I A;  5FJY A;  4UUC A;  2YIN A;  5H7P A;  2YQ8 A;  4UI9 J;  4B94 A;  4PS8 A;  1H6P A;  5CCM A;  2RD0 A;  2LNI A;  5A23 A;  1UG3 A;  3OAW A;  1XNF A;  3AS8 A;  3R7Q A;  1K3Z D;  3BG0 B;  3CVL A;  4GB9 A;  5BPP A;  5FQ7 A;  1K1B A;  2QFC A;  3DXK G;  4B8A A;  2OCC E;  4GPK A;  1ELW A;  4GTQ A;  4AY6 A;  4BX8 A;  1H2T C;  1HXI A;  5AAO A;  3AAA C;  1JWG A;  3CGH A;  3FUK A;  3VLF A;  3QB2 A;  1IHG A;  1KT1 A;  3OXF A;  2FEZ A;  3ZVV A;  4L1B A;  2KBX A;  3D9L A;  1UW4 B;  4C9B B;  2XGO A;  1A17 A;  1D8E A;  4I43 A;  3UQ3 A;  3O48 A;  2LUH A;  3V30 A;  3MV2 B;  4ZHB A;  2HO1 A;  4G25 A;  2CFU A;  1TJC A;  3Q47 B;  3ZXS A;  2EIL E;  4FU3 A;  2NYJ A;  5KJM A;  4PS7 A;  4BTA A;  2WXP A;  4GA2 A;  2RFM A;  3ZYL A;  3DSX A;  4DJA A;  4OAV B;  3CST A;  2EIM E;  2L6J A;  3FEY A;  3VLD A;  4GTO A;  4IYP A;  4CT4 A;  3FTZ A;  3I5P A;  4CEM A;  4LCT A;  5FZQ A;  1BD8 A;  5IY5 E;  5BXO A;  3KEA A;  5ANL A;  3UKU G;  4DX7 D;  1KZO A;  1H0A A;  3PUK A;  4N3A A;  5B1B E;  1HG2 A;  4F6R D;  2ILR A;  4L7T A;  3E32 A;  3PNL B;  4U63 A;  4WWN A;  3Q9U C;  2P9S G;  2XZD G;  2WXK A;  3ZNG A;  1Q2Z A;  3UTM A;  4JHJ A;  3G2T A;  4MKT A;  2A5E A;  1H2U A;  3SD5 A;  3SI5 A;  2LSV A;  3CVU A;  3NB2 A;  3FU6 A;  2MHK A;  5CMW A;  4FUL A;  1TR4 A;  3SNX A;  4BT8 A;  2ZXW E;  3ISM C;  2WXR A;  3NAW A;  2OEW A;  3PDN A;  4JVS A;  3Q79 A;  1O1T A;  3FH8 A;  3N71 A;  5DBK A;  4BT9 A;  5LCW J;  4HS2 A;  4B8C B;  1QQE A;  3EJN A;  2VGE A;  3SFZ A;  3Q73 A;  5KJN A;  3FUD A;  5EIL A;  4HOU A;  2X6F A;  1EYH A;  1U3D A;  3T8K A;  4BWR A;  3CV0 A;  3RRN B;  5T4Y A;  2I6H A;  1HFA A;  2H6I A;  2WXG A;  4TXQ A;  2L0T B;  1KLX A;  3FUN A;  2EQX A;  5ENO D;  4BER A;  3GZS A;  1BI7 B;  2AWI A;  3D3M A;  1IQR A;  4BFR A;  5M72 A;  3S7F A;  3Q49 B;  2A5U A;  3CIA A;  3U66 A;  3UT7 A;  4JL0 A;  2VGY A;  5KBA A;  5KJK A;  2IO2 C;  2A4Z A;  3IXE A;  1S0P A;  1X5B A;  3CEQ A;  3TWW A;  2BKG A;  5T3R A;  3BU8 A;  2OVF A;  3ZUV B;  3UXG A;  1FVH A;  1TYQ G;  2EIJ E;  1FCH A;  4GTT A;  4APF A;  3FUJ A;  3NZS A;  4U0S A;  4A1S A;  2YNQ A;  2Y3A A;  3JUE A;  2E2E A;  2GRQ B;  3PZ3 A;  4KVM A;  4KYO B;  1QBQ A;  3HVE A;  1S70 B;  2DYR E;  2P58 C;  4N2Q A;  1FT1 A;  3EIQ C;  2X6K A;  1OT8 A;  3FTW A;  1Z5S C;  1OCZ E;  5BV1 A;  2GW1 A;  4J0U A;  3ZU7 B;  3Q78 A;  3HXE A;  3D9H A;  4U8Y D;  1SW6 A;  2XGS A;  3NOC D;  5D66 A;  5CCL A;  4Y6W A;  2LAH A;  3D9N A;  5ENN A;  1PAQ A;  2QZA A;  2CHX A;  4JPS A;  5C2Y A;  4EEC A;  2L6B A;  5A6C A;  3FU0 A;  1N11 A;  3DEO A;  3UIP C;  4WWP A;  2J4B A;  3TWQ A;  3DSW A;  2P9I G;  1NA3 A;  2VSN A;  1EDU A;  5EYP F;  1QNF A;  2F8Y A;  1WG0 A;  4HOQ A;  2Y1L E;  1Y6I A;  4AEZ C;  1NA0 A;  5E75 A;  5KNG A;  4ACK A;  4F53 A;  1MZC A;  3DSU A;  4WNG A;  4J6I A;  3JQ0 A;  1ZB1 A;  2VTB A;  4DX2 A;  5E76 A;  2ZGD A;  3ZXP A;  2M63 A;  2J8S D;  3T5V A;  3LEW A;  3CLJ A;  2F8X K;  1WDY A;  3C72 A;  3ZHE A;  3HVE B;  4LEU A;  3C3R A;  4CGW A;  3UT4 A;  4U0U A;  3OTN A;  4KZC A;  4J8E A;  5LOZ A;  3D9J A;  4BX9 A;  3R7R A;  3URZ A;  4FAD A;  1MYO A;  3B13 A;  5EN5 D;  4NQ0 A;  1V54 E;  2XGM A;  3CK7 A;  3FU5 A;  5CER B;  3LKU A;  1B89 A;  3G2V A;  1HX8 A;  3UPV A;  4AOF A;  3TGO A;  5G05 J;  5BNW A;  5FQ8 A;  4IRU A;  3UUX A;  4A55 A;  1MHQ A;  3LJ3 A;  1WY6 A;  3IEG A;  3MEK A;  3TL5 A;  2R03 A;  1MQS A;  5AN8 A;  5LFA A;  4OAU C;  4F7A A;  4HOT A;  2FO7 A;  3ASH A;  4GZ6 A;  5DIZ A;  4KVO A;  4TXP A;  2DCP A;  3QOU A;  1IYG A;  3HXB A;  4L2L A;  4XI9 A;  3ML8 A;  4LRZ A;  2KC7 A;  4WUY A;  3PE3 A;  5AQ7 A;  2RG8 A;  2VTB B;  3CHR A;  4I6G A;  4GTS A;  5B1A E;  4CYM D;  3ULY A;  3EUV A;  4M3O A;  5EID A;  3ZYM A;  3ZHE B;  4F1P A;  3D9O A;  3FTS A;  3LDZ A;  2KCK A;  3AS4 A;  3DRA A;  2V8S E;  3IHY A;  3DBS A;  1H2V C;  2GRM A;  3Q7F A;  1JPL A;  5D0Q D;  5G55 A;  4GCO A;  3ENE A;  4CCA A;  3ZN3 A;  1IHB A;  2WXO A;  4EPZ A;  2LXL A;  1K8K G;  4MBG A;  3AU4 A;  5JHB A;  3J5P A;  2XCB A;  1YCS B;  2Y69 E;  4ANX A;  1S64 A;  2XRZ A;  2PM7 A;  3L6A A;  3SBT B;  2QYU A;  1UJK A;  4GZD A;  4C0M A;  4I9E A;  4FP7 A;  1SA5 A;  1FPP A;  4HVB A;  3TWS A;  4H7Y A;  4DPR A;  4A1G A;  4NIK A;  2X6I A;  1XGW A;  4C48 B;  2PQN A;  2IOS A;  3TG4 A;  4XZ4 A;  1QZ2 A;  4CDM A;  1V55 E;  2VYI A;  2ZIS A;  1OY3 D;  2YHC A;  3W9F A;  4YDY A;  2BED A;  3AG4 E;  4U04 A;  2WXI A;  1WAO 1;  1DNP A;  3KS2 A;  3TWT A;  4K5A B;  3RO3 A;  2IU1 A;  2VJ8 A;  3E30 A;  1LD8 A;  4ILH B;  2E0I A;  4G8K A;  4K0R A;  4JHR A;  4UI9 C;  3KSL A;  4I1A A;  5FTP A;  3FTV A;  1H6K A;  1MX2 A;  1TNU A;  1N94 A;  2WQ6 A;  2R2L A;  3SY2 A;  3L17 A;  1UOH A;  1OWL A;  4O1O A;  4HB5 A;  4G8L A;  3ABK E;  4GYW A;  3L54 A;  3V31 A;  2P2C P;  2GRP B;  3PRE A;  4JA9 A;  2MRI A;  2X6J A;  2C0M A;  5J08 A;  3TWX A;  4RLY A;  1TNB A;  3DSV A;  4EZL A;  2ION A;  1OWP A;  3HXD A;  1Z6T A;  4XKB A;  1L5J A;  3T9K A;  1KPS B;  4G11 A;  5ENS D;  5B3S E;  3NZU A;  4G23 A;  4AP2 A;  3HDX A;  4CZ2 D;  2WQH A;  3BQO A;  2V4L A;  5JHA A;  5AEN A;  4N3C A;  1FT2 A;  3ZPJ A;  1DCQ A;  3PZD A;  4JEU A;  2KZT A;  3LCA A;  4TV3 A;  1HH8 A;  1HG5 A;  2H6H A;  2RKK A;  3APF A;  3G2S A;  3CVV A;  3KEZ A;  2XEV A;  4K5C A;  3W9G A;  5ARG A;  1IQU A;  4G2V A;  2IF4 A;  3PZ2 A;  3O4Z A;  3RRM B;  2XS1 A;  2NXP A;  1YA0 A;  3TXN A;  3J5Q B;  4KBQ A;  1IKN D;  4YVQ C;  4J8Y A;  5G04 C;  5FIN A;  1OCR E;  4AVX A;  2WXM A;  4ATG A;  4U7E B;  5HQ8 A;  5FQ6 A;  3E37 A;  1K1A A;  4GTV A;  4I2Z A;  3CVQ A;  2QC9 A;  5JMN D;  3EU9 A;  4FHJ A;  1OCC E;  2WQ7 A;  2FBN A;  3JUI A;  1JUQ A;  4GZ5 A;  2IO3 C;  1N4P A;  2DBA A;  4FC8 A;  4AV7 A;  5FWQ A;  2WXH A;  2R02 A;  3FEX A;  1SVX A;  1N0Q A;  4BES A;  4BSX A;  4HRM B;  4X8Q A;  4F3V A;  2PZI A;  5AIJ A;  3CKB A;  2Y4T A;  2BUG A;  1NL4 A;  5HI7 A;  3AG1 E;  4DLQ A;  2H6G A;  4YND A;  2J07 A;  4HLL A;  3ASF A;  3TJP A;  4JXT A;  1N4S A;  1ELR A;  4BTB A;  4XI0 A;  4LNB A;  2F0Y A;  2V5F A;  3CHO A;  3QWP A;  2XPY A;  2KZT B;  2R17 C;  1OCO E;  1BI8 B;  3B7U X;  4I1M A;  3Q75 A;  1N52 A;  3UX4 A;  2GRR B;  1G3N B;  3AU5 A;  1LTX A;  3MKQ B;  3S7D A;  1MJ0 A;  2BKK B;  4GML A;  2L9B A;  2X3M A;  3SZ7 A;  3UMV A;  5FZS A;  2KAT A;  1D8D A;  4GTR A;  2OND A;  3SFY A;  1SZA A;  4FJY A;  5CEA A;  4AIF A;  2F37 A;  3UI2 A;  4N39 A;  4DX6 D;  1NP7 A;  3CVY A;  3B7S A;  3EHR A;  3HYM B;  4EQF A;  4W9R A;  3RSE G;  4N3B A;  1YMP A;  3HIZ A;  4O6F A;  4DX1 A;  1KT0 A;  4U8V D;  3Q4A B;  4D10 C;  3CVW A;  3DWL G;  3EHN A;  5BUZ A;  4O1P A;  2DVW A;  3LYA A;  3RJV A;  3PRZ A;  5ITZ F;  3AJI A;  1HO8 A;  4JA7 A;  1E8W A;  3NBN B;  3C98 A;  3RRU A;  3EDT B;  4ABN A;  3DPD A;  3APC A;  4CDR A;  4UQY A;  2CG2 A;  5KNH D;  3VLE A;  3HXC A;  4E85 A;  2FO1 E;  3CVX A;  4UQZ A;  3FFL A;  2LAI A;  3U9W A;  1PC2 A;  4G1T A;  4NAC A;  4PS3 A;  1PY1 A;  4UWG A;  4LNU D;  3DEP A;  3FDH A;  3QK0 A;  5AYW D;  3SFX A;  1OUV A;  3FTY A;  4JW1 A;  1VDY A;  2VGX A;  2PQR A;  3ASG A;  5EKQ D;  2XS8 A;  2NC9 A;  3KSQ A;  1E8Z A;  4XX5 A;  3GZ1 A;  4YDE A;  2GGF A;  5JA4 D;  2J9Q A;  3E33 A;  5C1D A;  2WXQ A;  4CRW A;  3CQC B;  4FHK A;  3ULQ A;  3SO8 A;  4NUR A;  1BPO A;  3LPZ A;  2CHZ A;  4WND A;  4YVO A;  4UWH A;  1TNZ A;  1QYM A;  3C3O A;  2AW6 A;  3B7T A;  3JXJ A;  2HR2 A;  2FI7 A;  2XEH A;  4QFV A;  2AJA A;  1E7U A;  1TNO A;  4LNG A;  2KM4 A;  4K5B A;  1AP7 A;  1TN8 A;  3FWV A;  3EHQ A;  3ASD A;  3SQV A;  3I4R B;  3Q15 A;  3ONL A;  1ZBP A;  5G2N A;  3FH7 A;  4WAF A;  4JC8 A;  3UM1 A;  4B93 B;  2YHE A;  5ARF A;  2XQ0 A;  2WXN A;  1RZ4 A;  3LY8 A;  5A7D B;  3HXF A;  2GRL A;  1HU3 A;  1GW6 A;  2V0P A;  4DK5 A;  2I9C A;  5CEC B;  3V79 K;  1HZ4 A;  1UN8 A;  4UI9 K;  1RW2 A;  5EIB E;  1H19 A;  4B89 A;  1E96 B;  4HI9 A;  4G26 A;  2VGX B;  4KMO A;  4PUC A;  5CMY A;  4AM9 A;  2GRO B;  2P9K G;  4BY6 A;  1LD7 A;  2WPV A;  4JZY A;  3Q7A A;  5G05 C;  2MOW A;  5BT1 A;  4I17 A;  4RVB A;  1JCS A;  3VTX A;  3ASN E;  4UWK A;  1E8X A;  2I1K A;  4TUM A;  4GAA A;  4GZC A;  3GZ2 A;  5HRY A;  5AJD A;  1JWF A;  3Q9N C;  3X2Q E;  2R5S A;  2X6H A;  3G2W A;  1N4Q A;  4YDW A;  3L13 A;  3RK6 A;  2JEK A;  3B7R L;  4LER A;  3SHF A;  2IY0 C;  4J7W A;  5AJL A;  4FLB A;  3ESK A;  3AS5 A;  4BEP A;  2WVI A;  3FU3 A;  3UM3 A;  1EPU A;  2IFU A;  3FUM A;  4MS6 A;  1D9S A;  4JD2 G;  3V2O A;  4MLP A;  4XE0 A;  3PE4 A;  5FIO A;  4U95 D;  3S7J A;  1MX4 A;  3ZEF A;  5AAR A;  3PEV B;  4HI8 A;  5BXU A;  4JEH A;  2KXP C;  3R9M A;  1TN7 A;  4Q69 A;  3TWR A;  2EIK E;  3CK8 A;  4Q94 A;  3U4T A;  4HBD A;  2UWJ G;  5ENQ D;  2I2O A;  4EBA A;  3IBE A;  5ANR A;  2VQ2 A;  3C3Q A;  4L9P A;  2FUL A;  4EZK A;  1OWO A;  2XPZ A;  3L82 A;  4KT6 B;  3LY7 A;  1YYH A;  3FTX A;  2B6C A;  3PZ1 A;  2J4D A;  3B95 A;  4GCN A;  4I1O B;  4XIF A;  5CBO A;  1SZ9 A;  4ILG A;  4I9C A;  4FJZ A;  4WNE A;  1UN9 A;  4OYS A;  2KCL A;  3UM2 A;  2WMN A;  4AJW A;  3LVR E;  3CSF A;  4HFG A;  1NZN A;  4EHM A;  2IEJ A;  3FUI A;  3ABL E;  3B7B A;  1Z3Y A;  2P9U G;  3F6Q A;  5EX3 A;  3CHM A;  4LSZ E;  3GYZ A;  3MYV A;  3L16 A;  3SF4 A;  3DST A;  3QNK A;  1IXV A;  4HOR A;  4ANU A;  3MKR A;  2J08 A;  4J8D A;  4ZFH A;  5AQ9 A;  4OVU A;  3ESL A;  3IV0 A;  4RG9 A;  3QWW A;  2AXU A;  2OOE A;  4HLE A;  2ZU6 B;  2ZIR A;  1TN6 A;  2QYJ A;  4IUL A;  5CBN A;  3MA5 A;  2JLB A;  3FTU A;  4Y6C A;  1HE8 A;  4TUU A;  4U07 A;  2PNN A;  1N4R A;  2LXM A;  3IKO B;  5FZR A;  5G04 J;  1O1S A;  5AQB A;  4BET A;  2JAB A;  4ME2 A;  3UIN C;  2CG3 A;  4U8H A;  1H6O A;  3UKR G;  1UJJ A;  1DC2 A;  3PUJ A;  4JB8 P;  3CVP A;  3PNT B;  3U64 A;  3PEU B;  4IN3 B;  1SQM A;  2AXV A;  1U3C A;  4ANW A;  2WB2 A;  3MKQ A;  2X38 A;  3ULE G;  3ZFW A;  3ZW3 A;  2B0O E;  4GA0 A;  3MV3 B;  4XKC A;  1DCE A;  5HS0 A;  3HRA A;  2VSO E;  5CRU A;  3Q5M A;  5LX8 A;  2WM9 A;  3FUF A;  4GZ3 A;  3FP3 A;  1E8Y A;  3AG3 E;  4I6E A;  2ETA A;  5FT9 A;  1OWN A;  2I1J A;  2XZT G;  3ZIM A;  4Q96 A;  2IJG X;  3LS8 A;  2LO6 A;  3UM0 A;  4OVV A;  2ZGG A;  1HF8 A;  2HM8 A;  4ACL A;  4QQI A;  1OXJ A;  4HXI A;  3P1U A;  3S7B A;  2LSU A;  3UIO C;  4TXR A;  4APO A;  4MRU A;  1WM5 A;  3BUA A;  3D9K A;  3RO2 A;  3MJW A;  5ENP D;  3ASO E;  4N5Q A;  1O1R A;  3CQG B;  4A63 B;  3U3W A;  3CHS A;  2J09 A;  4FLH A;  4ANV A;  3NF1 A;  1MX6 A;  3EIJ A;  3C5R A;  1NFI E;  3ZRH A;  3D9P A;  2DIW A;  4N5C A;  2L0I A;  3OXL A;  1ZU2 A;  4PH4 B;  4V3I A;  4CGV A;  5KCM A;  2WXJ A;  3ML9 A;  3TWU A;  3AG2 E;  5LCW C;  5ENR D;  3SGH A;  3PS6 A;  2IQC A;  5JJ7 A;  3CK9 A;  1TNY A;  3I3N A;  4EBA G;  2KCV A;  4UWF A;  5CHE E;  3TWV A;  3SBS A;  4A3T A;  2P9P G;  4RSY A;  1BU9 A;  3IHV A;  5CED B;  4L2Y A;  1E90 A;  2R59 A;  3KD7 A;  4L23 A;  2IOL A;  1O5M A;  4F1S A;  4GMR A;  2NSZ A;  2R05 A;  1NI1 A;  3MX3 A;  3QWV A;  2BF0 X;  3CR3 A;  4GU5 A;  5ENT D;  2FF4 A;  3R9A B;  4WWO A;  2PL2 A;  1TJF A;  2VSY A;  3JQ1 A;  1N54 A;  4GYY A;  3GW4 A;  4DX5 D;  1Y8M A;  4RQI A;  5EDS A;  2XPI A;  4AXH A;  2XHE A;  4K03 A;  1BLX B;  4HRN A;  3CKC A;  3I4G A;  5AQA A;  4C0E A;  1ELK A;  5CRV A;  3UT8 A;  4DRX E;  2EIN E;  3L22 A;  3ONK A;  4HQD A;  4O60 A;  1N9A A;  3TG5 A;  5KWD A;  4BSZ B;  4E6H A;  3FHE A;  1FVF A;  3HHM A;  2J49 A;  3E4B A;  3TXM A;  1JCQ A;  3P2B A;  4PDX A;  3CHQ A;  4N2S A;  1OWM A;  4M7C A;  4WNF A;  3RIB A;  3S2A A;  4A3V A;  3ZGQ A;  1TEZ A;  4HRL A;  4JHK A;  3EHM A;  3FH5 A;  1P5Q A;  3L08 A;  4XEI G;  4DUI A;  3JYS A;  2HE0 A;  5BW8 C;  2XEE A;  5KJL A;  4GPM A;  4R7L A;  2WXL A;  2AXZ A;  3TAX A;  4FA6 A;  3FUH A;  2H6F A;  5LP0 A;  5D2M C;  5J90 A;  4G24 A; 
#chains in the Genus database with same CATH homology
 1RW2 A;  3ISM C;  1Q2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...