1Q2ZA

The 3d solution structure of the c-terminal region of ku86
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
GPVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3D Solution Structure of the C-terminal Region of Ku86 (Ku86CTR)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords ATP-dependent DNA helicase II, 80 kDa subunit
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08785 Ku_PK_bind Ku C terminal domain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 1q2zA00
1RW2A 3ISMC 1Q2ZA
chains in the Genus database with same CATH superfamily
5A7DB 4AVXA 3MV3B 2IO3C 3ZPJA 1NZNA 2X6HA 4BSZB 3MEKA 4RVBA 4N3BA 1H2UA 3JCKC 4HI9A 2IEJA 3ABKE 4J8DA 4BFRA 2IOSA 5LX8A 3PNTB 1IHBA 4Z68A 3UKUG 2Y1LE 1A5EA 1DC2A 4Q94A 2BUGA 3PZ2A 1U3DA 2OV8A 4AV7A 5BNWA 4U8HA 3C72A 4BETA 4HBDA 4YNDA 3BQOA 4DX7D 5FINA 1N11A 3I4GA 2VQ2A 2R59A 3G2WA 3RAUA 5D0OD 4GTOA 1E8WA 4KXKB 4G26A 3ZYLA 3PNLB 4CGVA 3QDNA 5BXOA 2OEVA 4XI0A 2XGSA 5BV0A 1BD8A 2R05A 2B0OE 3C98A 4QQIA 2XQ0A 3FTXA 2EILE 4ACLA 2GRLA 3PRZA 2L0TB 5JHBA 2OVFA 1E8YA 4MS6A 3I4RB 3IV0A 5LP0A 1DNPA 4UQXA 3DWLG 4EBAA 1QZ2A 1TJCA 4OVVA 3Q15A 1K1AA 2CHXA 4GA0A 4YDYA 3C3OA 3LS8A 4BERA 3DSXA 3ZHEB 3U66A 1N4PA 1N0RA 4I6JA 1SA5A 4DLOA 1OWLA 3D9HA 3MX3A 1IQRA 2VSNA 2GROB 2WXQA 3CKCA 2J4BA 4F6RD 2P2CP 4U7EB 5KJKA 1KT1A 4BT8A 4F7AA 4GZCA 2CHWA 4I17A 2UWJG 2L6JA 5E76A 1OCOE 3ISMC 4GMRA 2WXHA 4GZ6A 5D0QD 3ZFWA 3LJ3A 2HO1A 3VLEA 2Y3AA 4OVUA 3QARA 5B1AE 4MRUA 4KVOA 1L5JA 3DSUA 5JJTA 2X6JA 3ZRHA 4CRWA 2ZGDA 1FPPA 5FWQA 2NC9A 4XE0A 3MZLB 3APDA 3PEUB 4ILIA 4GTPA 4PDXA 3ZHEA 2YINA 3WG7E 4U63A 2JEKA 3PUJA 2R02A 4GYYA 3SI5A 3NZSA 3FWVA 3CQGB 2OVBA 3CVPA 3Q9UC 3EJNA 4MLPA 2JABA 4JPSA 4HLEA 1TEZA 2VJ8A 3SO8A 5CBOA 4GA2A 3PZ4A 4TXPA 2FEZA 1TN7A 3TGOA 1E7VA 4PS8A 3ASFA 2IU1A 2C0MA 3UT7A 2Y4TA 2VGXB 4KZCA 1TNZA 3C3QA 1WY6A 4HLLA 2XEVA 3KSQA 3ML9A 4U8YD 1Y6IA 5BUZA 1K3ZD 4K5AB 5T3RA 3RO3A 3R9AB 1UN8A 3RK6A 3KSLA 3NBNB 3U4TA 1AWCB 3AAAC 4HQDA 1MX4A 2KXPC 4EPZA 3FTYA 3ZKJA 4OYSA 4JA7A 5EX3A 5JMND 5CEAA 3I5PA 5AQ9A 5T8IA 2R17C 4G23A 3FUMA 2VSXE 4I1AA 3D9PA 3AU5A 2WXGA 3SBTB 4N3CA 3APFA 4KYOB 3ZUVB 3X2QE 3EHRA 3FFLA 3T9KA 4YDOA 4HOQA 4UQZA 4ZHBA 3ASDA 4B8CB 5ENRD 4E6HA 3HVEA 2FULA 1N4QA 2PM7A 4UI9C 3ESKA 4WNEA 5KWDA 2WXOA 2YHCA 4D10C 1DVPA 5LCWJ 3T5VA 2XZDG 4XI9A 3DSTA 1NP7A 2XS1A 4A63B 1VDYA 3V31A 1XNFA 3LYAA 3PREA 4AP2A 3CVVA 4AY5A 4GZ3A 1TNOA 5EYPF 4BWRA 3HXEA 4UWHA 1IHGA 2LXLA 4GTTA 1UJJA 3MA5A 2DWZA 3UUXA 2DZNA 3UM0A 4DI4A 2GRPB 3J5PA 4PS3A 4B0ZA 4U07A 3V2OA 4U0ZA 1N9AA 4JXTA 3S7DA 3HVEB 3DPYA 3CVUA 4I2WA 1OT8A 1HG5A 3ZYKA 5FT9A 3D3MA 3TWTA 3PDNA 4HOUA 3HHMA 4FHKA 4FJYA 2GRMA 2WMNA 4J6IA 1O1TA 4APFA 4U0SA 4FU3A 5EDSA 3LKUA 4MBGA 2J8SD 4AEZC 2KZTB 1H2VC 4UWFA 2WXNA 4EQFA 4HNAD 2WXFA 4RQIA 1HG2A 2ILRA 5D2MC 4FP7A 4O60A 2FBNA 5B1BE 3KEAA 5KNGA 3RRMB 3FUDA 5AJDA 5D66A 5G05J 1DCQA 3FUKA 1N52A 2A5UA 4O1PA 1TNYA 5HI7A 3G2TA 3HXDA 1H6PA 2WVIA 3QJZA 2WQ6A 4I9EA 3BG1B 5H7PA 1QNFA 2Y0BG 4LEUA 3LVRE 1EYHA 3S7BA 1HO8A 3E34A 2RFMA 1H19A 4HXIA 3VLFA 4F1PA 4GZDA 4HI8A 2IY0C 2P9NG 4FJZA 1QYMA 1IKND 4Q96A 4KMOA 4UWLA 4G8KA 4CDMA 4CDNA 4A1GA 3QWPA 3G2VA 4LNBA 2Y4UA 3P1UA 5AN8A 3ASHA 1SZ9A 1Z3YA 3UKRG 3LY8A 3FULA 5E75A 3FTWA 2VSOE 4W9RA 4YDEA 2XPIA 3QKYA 4TXRA 4DRXE 2KCLA 2IF4A 3UM2A 1V54E 3LEWA 3D9MA 2GGFA 2VYIA 3Q7AA 2XHEA 4A55A 4GZ5A 5C1DA 2WMOA 1LF8A 3EU9A 4DX5D 2LXMA 2AJAA 4G2VA 1LD7A 3CSFA 5BW8C 4WNDA 3IBEA 4Y6CA 5LFAA 1QBQA 3MCXA 4L7TA 3ONLA 2XCBA 3FTSA 1BLXB 2X6FA 4RLYA 1SW6A 3TXMA 2HE0A 5JHAA 3RIBA 3Q49B 4PH4B 3D9KA 3CVWA 3UI2A 2E2EA 4ANUA 4DLQA 2WXMA 3Q4AB 2VGEA 4GMLA 3RJVA 1YCSB 1ZB1A 4U96D 2B6CA 1O1RA 3AS8A 5ENTD 3FDHA 3QOUA 4JB8P 5CECB 3AS5A 4GU5A 2DZOA 3JYSA 4WUYA 1IXVA 3PZ1A 1D8EA 2V5FA 2J07A 1OWOA 2R5SA 3L82A 4FLHA 3EHMA 2DYSE 3KS2A 4FHJA 4GTMA 4HOTA 1TNUA 3EIQC 1MJ0A 3QC1A 5IY5E 4APOA 1HFAA 2HYZA 4JEUA 5CRUA 4AOFA 4ANWA 3PEVB 5ENNA 3BU8A 2IOLA 4HS2A 3F6QA 4GTSA 3DSSA 4GTQA 4XX5A 3Q78A 4HVBA 3ABME 3DSVA 4NIKA 3APCA 2KATA 4HRNA 1H6OA 5ENOD 2I1JA 2PZIA 1JCRA 3EHQA 1MQSA 1N4RA 3HXBA 4DX2A 4O1OA 1N4SA 4YDWA 1N94A 1FT2A 4C9BB 3CHMA 2XGOA 3Q75A 4K5CA 4UWGA 1GW6A 2GRRB 1N54A 2IO2C 5FQ4A 1FT1A 4FADA 1UW4B 2CHZA 4H7YA 2PM6A 2LSUA 3EU5A 3L22A 1IQUA 3FH8A 3UX4A 3QWWA 3U3WA 4K03A 4KT6B 3CGHA 3DEOA 5HQ8A 4R7LA 3GZ1A 1HH8A 5DBKA 4L2LA 4J8YA 4KZ0A 2NYJA 3FUNA 4J0UA 2J08A 2QYJA 4GAAA 3TWXA 3FUHA 4JC8A 3QK0A 4DUIA 1NFIE 4N2SA 4A3TA 3GZ2A 4NQ0A 3FH5A 2EIJE 3R7QA 3C5RA 2CG3A 1N0QA 3TWRA 2QZAA 1E7UA 2YHEA 4I6GA 1D8DA 3AU4A 2XEHA 4CDRA 2Q7FA 5CCLA 2AW6A 3NB2A 4C48B 3OXLA 4IULA 2RG8A 2MHKA 3B7SA 3SBSA 5ENSD 3O48A 2J4DA 3ESLA 4BTBA 3GYZA 3FHEA 5LOZA 2WXKA 1FVHA 2ETAA 4ILHB 3W9FA 1HF8A 3FEYA 5G2NA 4EZLA 4DK5A 2PQNA 1E8XA 4WWPA 3VTYA 4FLBA 5CEDB 2FO1E 2BKKB 4WNGA 5AARA 3C3RA 2ETBA 3FU0A 4P29A 1ZU2A 5J08A 1UG3A 4U04A 3Q79A 3U64A 3PE4A 3CK8A 3AS4A 4BT9A 5KJNA 3URZA 3RSEG 1P5QA 3FTZA 3CR3A 3FU6A 4ZFHA 1OWNA 2DCPA 2BTDA 5BT1A 2L9BA 4UWKA 2XENA 4QFVA 2J49A 3FH7A 3VTXA 3CHSA 4UI9K 3ZGQA 5AENA 3JQ1A 3T5XA 1SA4A 1MX6A 4NRHB 2OCCE 3FEXA 3EHNA 1OXJA 1K1BA 4OAVB 3TAXA 5ITZF 1TJFA 1S63A 4G25A 2QFCA 2PQRA 2ONDA 3TWWA 4B89A 4N5CA 3V30A 4BEPA 3LJNA 2P9SG 3R9MA 2H6GA 3Q7FA 3LDZA 3UT8A 3NF1A 1S64A 3E33A 3CSTA 3CVXA 1RZ4A 2DIWA 2DYRE 1SVXA 2CFUA 1TR4A 4DJAA 3Q47B 4Y6WA 2LUHA 3D9NA 2H6IA 3CIAA 2VGXA 4EZKA 3UXGA 3TWSA 1Y8MA 2VTBA 5AQBA 5ENQD 5AYWD 3JUEA 3S7FA 3U9WA 4JZYA 3IXEA 5EX0A 2R03A 1ELWA 4GYWA 5EIDA 4A1SA 2AXVA 5G55A 3FUFA 2KM4A 4XKBA 2IONA 3ZU7B 3B7BA 1E96B 4AM9A 2LNIA 5T4YA 4HRLA 5BXUA 4BX8A 3ASOE 3TG4A 3SFYA 3FUEA 1HU3A 4PUCA 4G8LA 2RKKA 1E8ZA 1JPLA 1U2VG 3NQPA 1TN6A 4JEHA 4B8AA 2YNQA 1EPUA 5FIOA 4XKCA 1TN8A 4RG9A 1OWPA 2ZXWE 2IJGX 2WXLA 3DXMG 4F3VA 4Q69A 2NSZA 4J8FA 2WQ7A 4XEIG 4N39A 4LUNU 2ZIRA 1OY3D 3ENEA 3CVLA 3IKOB 1AP7A 4K0RA 2L6BA 4FULA 3MGBA 3ZW3A 4TUUA 3LVQE 4JW1A 1MX2A 3CV0A 2MOWA 5AQ7A 3B13A 2JLBA 2EINE 2X6KA 2OOEA 2V4LA 3UM1A 2A5EA 3B95A 1S70B 4RG6A 1HZ4A 3BUAA 5EILA 2F37A 1ZBPA 1RW2A 1WAO1 1KLXA 2V0PA 4L9PA 3QNKA 3MYVA 3B7TA 3OAWA 5EYLA 3PZ3A 5FQ7A 3PZDA 3EUVA 4L23A 3ULEG 2WPVA 1ELRA 2I2OA 5HRYA 2J09A 5ARFA 3L54A 3N71A 1EF1C 3AJIA 4G1TA 4N2QA 2AXZA 3P2BA 4LSZE 4U95D 3OXFA 2V4HC 5AJLA 2H6HA 3RKVA 4U0UA 2XPZA 2QY7A 1QQEA 1BPOA 2XEEA 4LRZA 4AJWA 2KC7A 1LD8A 1ELKA 2GRQB 3DRAA 4GMJA 5AAOA 3G2UA 4XZ4A 4EHMA 5FTPA 4M7CA 5ANRA 4AXHA 4KBQA 2KBXA 2CFZA 3PS6A 3ZN3A 1TYQG 2ETCA 4EZJA 1G3NB 2A4ZA 3OTNA 5ARGA 5JA4D 4RSYA 2V5QC 3NOGD 3UM3A 4HB5A 1PC2A 1HS6A 4ATZD 3UPVA 2I1KA 5C2YA 4J7WA 2VGYA 3RRUA 2WQHA 3SFZA 2P9KG 4B94A 2XCCA 3UIPC 1HXIA 2VTBB 4ABNA 2WXJA 2RFAA 1JWGA 3HXFA 5EN5D 3HRAA 3HDXA 2UY1B 4L2YA 5DIZA 4DPRA 3CLJA 1TNBA 5FJYA 1KZPA 1X5BA 2LAHA 4DI3A 5AIJA 4L1BA 2QYUA 2AVPA 2AXUA 3UINC 3CVQA 3CQCB 5JJ7A 3Q5MA 2QC9A 5FZSA 2R2LA 1WG0A 3LCAA 3D9IA 1FCHA 1S0PA 2C2LA 4BX9A 4JD2G 4H7XA 3ZXSA 3SY2A 3WXXA 4MKTA 4CYMD 3FUJA 3JXJA 2XPYA 3FU3A 4ILGA 4CEMA 4HORA 2F0YA 3CKBA 2ZGGA 4FA6A 3W9GA 3MKQB 1W3BA 1SQMA 3L08A 4HOSA 3HXCA 5HS0A 4WWNA 3MJWA 4WAFA 1Q2ZA 3RU0A 3I3NA 3V2XA 2LO6A 3PUKA 4IRUA 4I9CA 1OUVA 3L16A 3ZVVA 4IYPA 3LY7A 1WM5A 2E0IA 3SZ7A 3ZYMA 3ASGA 4I6EA 4XIFA 4GA1A 1H2TC 2M63A 1OCRE 4GPMA 3ABLE 3UMVA 3DXKG 4A3VA 3ZIMA 4ANVA 2XS8A 1INZA 2P58C 1E90A 4WNFA 4C0EA 1YA0A 3L9TA 5HKPA 1JCSA 1U3CA 1IYGA 5ENPD 2DBAA 3AG2E 2RD0A 1KT0A 2P9IG 3TJPA 1KPSB 4BTAA 4V3IA 2BF0X 5LCWC 3S7JA 3LPZA 3ZXPA 1Z6TA 3D9OA 4JVSA 3HIZA 3J5QB 1JCQA 3O4ZA 2KZTA 3L6AA 3FTVA 4FC8A 3D9JA 2OEWA 3NOCD 2X6IA 3AG4E 3D9LA 5G04C 5CMWA 4CCAA 4WWOA 2X3MA 2IQCA 1Z3XA 4UUCA 2AWIA 1HE8A 5CRVA 5CBNA 4N5QA 4K5BA 1UJKA 1O5MA 1JWFA 5A23A 3RRNB 1K8KG 5CERB 3SQVA 4GYOA 4HFGA 4BSXA 1PAQA 2XRYA 4TUMA 3GW4A 2LAIA 2BKGA 5G05C 3ASNE 3S2AA 3QB2A 5ANLA 2WM9A 3E32A 3MKQA 4HRMB 4JHRA 2F8YA 1OCCE 3DSWA 3R7RA 4F53A 4OAUC 3IEGA 1NA0A 3JQ0A 5KNHD 3L17A 2IFUA 3SFXA 4C0MA 3KD7A 4LNUD 4BESA 4O6FA 3ULYA 3FP3A 3UT4A 5BPPA 5CCMA 3CHRA 5KBAA 3Q9NC 1BI7B 1D9SA 2HM8A 4LG6A 3DEPA 3SF4A 4AY6A 3K9IA 3FY4A 4GTRA 3PE3A 2WXPA 4E85A 3JXIA 3CK9A 5A6CA 4CZ2D 2C0LA 1NA3A 3EIJA 1UN9A 2P9LG 3LXUX 3TG5A 3HYMB 2WXIA 4GB9A 3DBSA 1NL4A 3VLDA 4I43A 3L13A 3G2SA 3KAEA 3NAWA 3ML8A 2PNNA 1YMPA 3ZEFA 5M72A 5B3SE 3MKRA 3ZNGA 3NZUA 5KCMA 4GCNA 2FI7A 3IHYA 3AG3E 1OWMA 3UIOC 5FQ6A 4NACA 2GW1A 3OXGA 4NURA 3CHQA 1DCEA 3SNXA 3UQ3A 5FZQA 2EIKE 2EIME 1KZOA 1A17A 1JUQA 2KCVA 4IN3B 3CK7A 3FUIA 3Q73A 2WXRA 4ATGA 2J9QA 2P9PG 2ZISA 3V79K 3CVNA 3AG1E 4I1MA 1LTXA 4ACKA 3TWVA 2V8SE 2F8XK 2GRNB 1MHQA 3ULQA 1UOHA 3FU5A 3GZSA 3JUIA 4JL0A 4EBAG 3SGHA 3SHFA 1NI1A 4M3OA 1V55E 4DX6D 4CT4A 4LCTA 4LERA 4LNGA 2X38A 4CT0A 4EECA 1Z5SC 2FO7A 5CMYA 2NXPA 1MZCA 4YVQC 2I9CA 1BU9A 4J8EA 4YVOA 4I2ZA 1H6KA 2P9UG 4GPKA 2BEDA 2WB2A 3B7RL 5JJ6A 4GTVA 3ONKA 4G24A 3FTUA 5AQAA 4DX1A 2YQ8A 3E30A 4I1OB 1X81A 1OCZE 3CHPA 4JHJA 3IHVA 2CG2A 2I6HA 1FVFA 2XZTG 2VSYA 1EDUA 3DPDA 3RO2A 5KJMA 2EQXA 2LSVA 5EKQD 1HX8A 3TWQA 3E37A 4TV3A 3B7UX 3ZYQA 5J90A 2XGMA 2DVWA 3T8MA 3PVLA 5G04J 3UTMA 3T8KA 1BI8B 4BY6A 3TL5A 1YYHA 4CGWA 4N3AA 4UQYA 2L0IA 4F1SA 2FF4A 2Y69E 3SD5A 4ME2A 4X8QA 4AIFA 3HG0D 4JA9A 4TXQA 5KJLA 1SZAA 2KCKA 4B93B 3EDTB 4TRQA 2MYOA 4ANXA 1PY1A 3BEEA 3CEQA 1N95A 4UI9J 4PS7A 2UY1A 3KEZA 3LY9A 5CHEE 4J8SA 2H6FA 1B89A 3CHOA 3MV2B 1MYOA 1O1SA 1XGWA 5BV1A 4GCOA 4URKA 2ZU6B 3CVYA 4JHKA 3BG0B 2HR2A 3QWVA 1H0AA 5EIBE 3TXNA 2MRIA 4U8VD 4G11A 5FQ8A 2PL2A 1WDYA 3QAQA 2XRZA 5FZRA 3E4BA 3PH0C 4KVMA 3TWUA
chains in the Genus database with same CATH topology
1RW2A 3ISMC 1Q2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RW2 A;  3ISM C;  1Q2Z A; 
#chains in the Genus database with same CATH topology
 5A7D B;  4AVX A;  3MV3 B;  2IO3 C;  3ZPJ A;  1NZN A;  2X6H A;  4BSZ B;  3MEK A;  4RVB A;  4N3B A;  1H2U A;  3JCK C;  4HI9 A;  2IEJ A;  3ABK E;  4J8D A;  4BFR A;  2IOS A;  5LX8 A;  3PNT B;  1IHB A;  4Z68 A;  3UKU G;  2Y1L E;  1A5E A;  1DC2 A;  4Q94 A;  2BUG A;  3PZ2 A;  1U3D A;  2OV8 A;  4AV7 A;  5BNW A;  4U8H A;  3C72 A;  4BET A;  4HBD A;  4YND A;  3BQO A;  4DX7 D;  5FIN A;  1N11 A;  3I4G A;  2VQ2 A;  2R59 A;  3G2W A;  3RAU A;  5D0O D;  4GTO A;  1E8W A;  4KXK B;  4G26 A;  3ZYL A;  3PNL B;  4CGV A;  3QDN A;  5BXO A;  2OEV A;  4XI0 A;  2XGS A;  5BV0 A;  1BD8 A;  2R05 A;  2B0O E;  3C98 A;  4QQI A;  2XQ0 A;  3FTX A;  2EIL E;  4ACL A;  2GRL A;  3PRZ A;  2L0T B;  5JHB A;  2OVF A;  1E8Y A;  4MS6 A;  3I4R B;  3IV0 A;  5LP0 A;  1DNP A;  4UQX A;  3DWL G;  4EBA A;  1QZ2 A;  1TJC A;  4OVV A;  3Q15 A;  1K1A A;  2CHX A;  4GA0 A;  4YDY A;  3C3O A;  3LS8 A;  4BER A;  3DSX A;  3ZHE B;  3U66 A;  1N4P A;  1N0R A;  4I6J A;  1SA5 A;  4DLO A;  1OWL A;  3D9H A;  3MX3 A;  1IQR A;  2VSN A;  2GRO B;  2WXQ A;  3CKC A;  2J4B A;  4F6R D;  2P2C P;  4U7E B;  5KJK A;  1KT1 A;  4BT8 A;  4F7A A;  4GZC A;  2CHW A;  4I17 A;  2UWJ G;  2L6J A;  5E76 A;  1OCO E;  3ISM C;  4GMR A;  2WXH A;  4GZ6 A;  5D0Q D;  3ZFW A;  3LJ3 A;  2HO1 A;  3VLE A;  2Y3A A;  4OVU A;  3QAR A;  5B1A E;  4MRU A;  4KVO A;  1L5J A;  3DSU A;  5JJT A;  2X6J A;  3ZRH A;  4CRW A;  2ZGD A;  1FPP A;  5FWQ A;  2NC9 A;  4XE0 A;  3MZL B;  3APD A;  3PEU B;  4ILI A;  4GTP A;  4PDX A;  3ZHE A;  2YIN A;  3WG7 E;  4U63 A;  2JEK A;  3PUJ A;  2R02 A;  4GYY A;  3SI5 A;  3NZS A;  3FWV A;  3CQG B;  2OVB A;  3CVP A;  3Q9U C;  3EJN A;  4MLP A;  2JAB A;  4JPS A;  4HLE A;  1TEZ A;  2VJ8 A;  3SO8 A;  5CBO A;  4GA2 A;  3PZ4 A;  4TXP A;  2FEZ A;  1TN7 A;  3TGO A;  1E7V A;  4PS8 A;  3ASF A;  2IU1 A;  2C0M A;  3UT7 A;  2Y4T A;  2VGX B;  4KZC A;  1TNZ A;  3C3Q A;  1WY6 A;  4HLL A;  2XEV A;  3KSQ A;  3ML9 A;  4U8Y D;  1Y6I A;  5BUZ A;  1K3Z D;  4K5A B;  5T3R A;  3RO3 A;  3R9A B;  1UN8 A;  3RK6 A;  3KSL A;  3NBN B;  3U4T A;  1AWC B;  3AAA C;  4HQD A;  1MX4 A;  2KXP C;  4EPZ A;  3FTY A;  3ZKJ A;  4OYS A;  4JA7 A;  5EX3 A;  5JMN D;  5CEA A;  3I5P A;  5AQ9 A;  5T8I A;  2R17 C;  4G23 A;  3FUM A;  2VSX E;  4I1A A;  3D9P A;  3AU5 A;  2WXG A;  3SBT B;  4N3C A;  3APF A;  4KYO B;  3ZUV B;  3X2Q E;  3EHR A;  3FFL A;  3T9K A;  4YDO A;  4HOQ A;  4UQZ A;  4ZHB A;  3ASD A;  4B8C B;  5ENR D;  4E6H A;  3HVE A;  2FUL A;  1N4Q A;  2PM7 A;  4UI9 C;  3ESK A;  4WNE A;  5KWD A;  2WXO A;  2YHC A;  4D10 C;  1DVP A;  5LCW J;  3T5V A;  2XZD G;  4XI9 A;  3DST A;  1NP7 A;  2XS1 A;  4A63 B;  1VDY A;  3V31 A;  1XNF A;  3LYA A;  3PRE A;  4AP2 A;  3CVV A;  4AY5 A;  4GZ3 A;  1TNO A;  5EYP F;  4BWR A;  3HXE A;  4UWH A;  1IHG A;  2LXL A;  4GTT A;  1UJJ A;  3MA5 A;  2DWZ A;  3UUX A;  2DZN A;  3UM0 A;  4DI4 A;  2GRP B;  3J5P A;  4PS3 A;  4B0Z A;  4U07 A;  3V2O A;  4U0Z A;  1N9A A;  4JXT A;  3S7D A;  3HVE B;  3DPY A;  3CVU A;  4I2W A;  1OT8 A;  1HG5 A;  3ZYK A;  5FT9 A;  3D3M A;  3TWT A;  3PDN A;  4HOU A;  3HHM A;  4FHK A;  4FJY A;  2GRM A;  2WMN A;  4J6I A;  1O1T A;  4APF A;  4U0S A;  4FU3 A;  5EDS A;  3LKU A;  4MBG A;  2J8S D;  4AEZ C;  2KZT B;  1H2V C;  4UWF A;  2WXN A;  4EQF A;  4HNA D;  2WXF A;  4RQI A;  1HG2 A;  2ILR A;  5D2M C;  4FP7 A;  4O60 A;  2FBN A;  5B1B E;  3KEA A;  5KNG A;  3RRM B;  3FUD A;  5AJD A;  5D66 A;  5G05 J;  1DCQ A;  3FUK A;  1N52 A;  2A5U A;  4O1P A;  1TNY A;  5HI7 A;  3G2T A;  3HXD A;  1H6P A;  2WVI A;  3QJZ A;  2WQ6 A;  4I9E A;  3BG1 B;  5H7P A;  1QNF A;  2Y0B G;  4LEU A;  3LVR E;  1EYH A;  3S7B A;  1HO8 A;  3E34 A;  2RFM A;  1H19 A;  4HXI A;  3VLF A;  4F1P A;  4GZD A;  4HI8 A;  2IY0 C;  2P9N G;  4FJZ A;  1QYM A;  1IKN D;  4Q96 A;  4KMO A;  4UWL A;  4G8K A;  4CDM A;  4CDN A;  4A1G A;  3QWP A;  3G2V A;  4LNB A;  2Y4U A;  3P1U A;  5AN8 A;  3ASH A;  1SZ9 A;  1Z3Y A;  3UKR G;  3LY8 A;  3FUL A;  5E75 A;  3FTW A;  2VSO E;  4W9R A;  4YDE A;  2XPI A;  3QKY A;  4TXR A;  4DRX E;  2KCL A;  2IF4 A;  3UM2 A;  1V54 E;  3LEW A;  3D9M A;  2GGF A;  2VYI A;  3Q7A A;  2XHE A;  4A55 A;  4GZ5 A;  5C1D A;  2WMO A;  1LF8 A;  3EU9 A;  4DX5 D;  2LXM A;  2AJA A;  4G2V A;  1LD7 A;  3CSF A;  5BW8 C;  4WND A;  3IBE A;  4Y6C A;  5LFA A;  1QBQ A;  3MCX A;  4L7T A;  3ONL A;  2XCB A;  3FTS A;  1BLX B;  2X6F A;  4RLY A;  1SW6 A;  3TXM A;  2HE0 A;  5JHA A;  3RIB A;  3Q49 B;  4PH4 B;  3D9K A;  3CVW A;  3UI2 A;  2E2E A;  4ANU A;  4DLQ A;  2WXM A;  3Q4A B;  2VGE A;  4GML A;  3RJV A;  1YCS B;  1ZB1 A;  4U96 D;  2B6C A;  1O1R A;  3AS8 A;  5ENT D;  3FDH A;  3QOU A;  4JB8 P;  5CEC B;  3AS5 A;  4GU5 A;  2DZO A;  3JYS A;  4WUY A;  1IXV A;  3PZ1 A;  1D8E A;  2V5F A;  2J07 A;  1OWO A;  2R5S A;  3L82 A;  4FLH A;  3EHM A;  2DYS E;  3KS2 A;  4FHJ A;  4GTM A;  4HOT A;  1TNU A;  3EIQ C;  1MJ0 A;  3QC1 A;  5IY5 E;  4APO A;  1HFA A;  2HYZ A;  4JEU A;  5CRU A;  4AOF A;  4ANW A;  3PEV B;  5ENN A;  3BU8 A;  2IOL A;  4HS2 A;  3F6Q A;  4GTS A;  3DSS A;  4GTQ A;  4XX5 A;  3Q78 A;  4HVB A;  3ABM E;  3DSV A;  4NIK A;  3APC A;  2KAT A;  4HRN A;  1H6O A;  5ENO D;  2I1J A;  2PZI A;  1JCR A;  3EHQ A;  1MQS A;  1N4R A;  3HXB A;  4DX2 A;  4O1O A;  1N4S A;  4YDW A;  1N94 A;  1FT2 A;  4C9B B;  3CHM A;  2XGO A;  3Q75 A;  4K5C A;  4UWG A;  1GW6 A;  2GRR B;  1N54 A;  2IO2 C;  5FQ4 A;  1FT1 A;  4FAD A;  1UW4 B;  2CHZ A;  4H7Y A;  2PM6 A;  2LSU A;  3EU5 A;  3L22 A;  1IQU A;  3FH8 A;  3UX4 A;  3QWW A;  3U3W A;  4K03 A;  4KT6 B;  3CGH A;  3DEO A;  5HQ8 A;  4R7L A;  3GZ1 A;  1HH8 A;  5DBK A;  4L2L A;  4J8Y A;  4KZ0 A;  2NYJ A;  3FUN A;  4J0U A;  2J08 A;  2QYJ A;  4GAA A;  3TWX A;  3FUH A;  4JC8 A;  3QK0 A;  4DUI A;  1NFI E;  4N2S A;  4A3T A;  3GZ2 A;  4NQ0 A;  3FH5 A;  2EIJ E;  3R7Q A;  3C5R A;  2CG3 A;  1N0Q A;  3TWR A;  2QZA A;  1E7U A;  2YHE A;  4I6G A;  1D8D A;  3AU4 A;  2XEH A;  4CDR A;  2Q7F A;  5CCL A;  2AW6 A;  3NB2 A;  4C48 B;  3OXL A;  4IUL A;  2RG8 A;  2MHK A;  3B7S A;  3SBS A;  5ENS D;  3O48 A;  2J4D A;  3ESL A;  4BTB A;  3GYZ A;  3FHE A;  5LOZ A;  2WXK A;  1FVH A;  2ETA A;  4ILH B;  3W9F A;  1HF8 A;  3FEY A;  5G2N A;  4EZL A;  4DK5 A;  2PQN A;  1E8X A;  4WWP A;  3VTY A;  4FLB A;  5CED B;  2FO1 E;  2BKK B;  4WNG A;  5AAR A;  3C3R A;  2ETB A;  3FU0 A;  4P29 A;  1ZU2 A;  5J08 A;  1UG3 A;  4U04 A;  3Q79 A;  3U64 A;  3PE4 A;  3CK8 A;  3AS4 A;  4BT9 A;  5KJN A;  3URZ A;  3RSE G;  1P5Q A;  3FTZ A;  3CR3 A;  3FU6 A;  4ZFH A;  1OWN A;  2DCP A;  2BTD A;  5BT1 A;  2L9B A;  4UWK A;  2XEN A;  4QFV A;  2J49 A;  3FH7 A;  3VTX A;  3CHS A;  4UI9 K;  3ZGQ A;  5AEN A;  3JQ1 A;  3T5X A;  1SA4 A;  1MX6 A;  4NRH B;  2OCC E;  3FEX A;  3EHN A;  1OXJ A;  1K1B A;  4OAV B;  3TAX A;  5ITZ F;  1TJF A;  1S63 A;  4G25 A;  2QFC A;  2PQR A;  2OND A;  3TWW A;  4B89 A;  4N5C A;  3V30 A;  4BEP A;  3LJN A;  2P9S G;  3R9M A;  2H6G A;  3Q7F A;  3LDZ A;  3UT8 A;  3NF1 A;  1S64 A;  3E33 A;  3CST A;  3CVX A;  1RZ4 A;  2DIW A;  2DYR E;  1SVX A;  2CFU A;  1TR4 A;  4DJA A;  3Q47 B;  4Y6W A;  2LUH A;  3D9N A;  2H6I A;  3CIA A;  2VGX A;  4EZK A;  3UXG A;  3TWS A;  1Y8M A;  2VTB A;  5AQB A;  5ENQ D;  5AYW D;  3JUE A;  3S7F A;  3U9W A;  4JZY A;  3IXE A;  5EX0 A;  2R03 A;  1ELW A;  4GYW A;  5EID A;  4A1S A;  2AXV A;  5G55 A;  3FUF A;  2KM4 A;  4XKB A;  2ION A;  3ZU7 B;  3B7B A;  1E96 B;  4AM9 A;  2LNI A;  5T4Y A;  4HRL A;  5BXU A;  4BX8 A;  3ASO E;  3TG4 A;  3SFY A;  3FUE A;  1HU3 A;  4PUC A;  4G8L A;  2RKK A;  1E8Z A;  1JPL A;  1U2V G;  3NQP A;  1TN6 A;  4JEH A;  4B8A A;  2YNQ A;  1EPU A;  5FIO A;  4XKC A;  1TN8 A;  4RG9 A;  1OWP A;  2ZXW E;  2IJG X;  2WXL A;  3DXM G;  4F3V A;  4Q69 A;  2NSZ A;  4J8F A;  2WQ7 A;  4XEI G;  4N39 A;  4LUN U;  2ZIR A;  1OY3 D;  3ENE A;  3CVL A;  3IKO B;  1AP7 A;  4K0R A;  2L6B A;  4FUL A;  3MGB A;  3ZW3 A;  4TUU A;  3LVQ E;  4JW1 A;  1MX2 A;  3CV0 A;  2MOW A;  5AQ7 A;  3B13 A;  2JLB A;  2EIN E;  2X6K A;  2OOE A;  2V4L A;  3UM1 A;  2A5E A;  3B95 A;  1S70 B;  4RG6 A;  1HZ4 A;  3BUA A;  5EIL A;  2F37 A;  1ZBP A;  1RW2 A;  1WAO 1;  1KLX A;  2V0P A;  4L9P A;  3QNK A;  3MYV A;  3B7T A;  3OAW A;  5EYL A;  3PZ3 A;  5FQ7 A;  3PZD A;  3EUV A;  4L23 A;  3ULE G;  2WPV A;  1ELR A;  2I2O A;  5HRY A;  2J09 A;  5ARF A;  3L54 A;  3N71 A;  1EF1 C;  3AJI A;  4G1T A;  4N2Q A;  2AXZ A;  3P2B A;  4LSZ E;  4U95 D;  3OXF A;  2V4H C;  5AJL A;  2H6H A;  3RKV A;  4U0U A;  2XPZ A;  2QY7 A;  1QQE A;  1BPO A;  2XEE A;  4LRZ A;  4AJW A;  2KC7 A;  1LD8 A;  1ELK A;  2GRQ B;  3DRA A;  4GMJ A;  5AAO A;  3G2U A;  4XZ4 A;  4EHM A;  5FTP A;  4M7C A;  5ANR A;  4AXH A;  4KBQ A;  2KBX A;  2CFZ A;  3PS6 A;  3ZN3 A;  1TYQ G;  2ETC A;  4EZJ A;  1G3N B;  2A4Z A;  3OTN A;  5ARG A;  5JA4 D;  4RSY A;  2V5Q C;  3NOG D;  3UM3 A;  4HB5 A;  1PC2 A;  1HS6 A;  4ATZ D;  3UPV A;  2I1K A;  5C2Y A;  4J7W A;  2VGY A;  3RRU A;  2WQH A;  3SFZ A;  2P9K G;  4B94 A;  2XCC A;  3UIP C;  1HXI A;  2VTB B;  4ABN A;  2WXJ A;  2RFA A;  1JWG A;  3HXF A;  5EN5 D;  3HRA A;  3HDX A;  2UY1 B;  4L2Y A;  5DIZ A;  4DPR A;  3CLJ A;  1TNB A;  5FJY A;  1KZP A;  1X5B A;  2LAH A;  4DI3 A;  5AIJ A;  4L1B A;  2QYU A;  2AVP A;  2AXU A;  3UIN C;  3CVQ A;  3CQC B;  5JJ7 A;  3Q5M A;  2QC9 A;  5FZS A;  2R2L A;  1WG0 A;  3LCA A;  3D9I A;  1FCH A;  1S0P A;  2C2L A;  4BX9 A;  4JD2 G;  4H7X A;  3ZXS A;  3SY2 A;  3WXX A;  4MKT A;  4CYM D;  3FUJ A;  3JXJ A;  2XPY A;  3FU3 A;  4ILG A;  4CEM A;  4HOR A;  2F0Y A;  3CKB A;  2ZGG A;  4FA6 A;  3W9G A;  3MKQ B;  1W3B A;  1SQM A;  3L08 A;  4HOS A;  3HXC A;  5HS0 A;  4WWN A;  3MJW A;  4WAF A;  1Q2Z A;  3RU0 A;  3I3N A;  3V2X A;  2LO6 A;  3PUK A;  4IRU A;  4I9C A;  1OUV A;  3L16 A;  3ZVV A;  4IYP A;  3LY7 A;  1WM5 A;  2E0I A;  3SZ7 A;  3ZYM A;  3ASG A;  4I6E A;  4XIF A;  4GA1 A;  1H2T C;  2M63 A;  1OCR E;  4GPM A;  3ABL E;  3UMV A;  3DXK G;  4A3V A;  3ZIM A;  4ANV A;  2XS8 A;  1INZ A;  2P58 C;  1E90 A;  4WNF A;  4C0E A;  1YA0 A;  3L9T A;  5HKP A;  1JCS A;  1U3C A;  1IYG A;  5ENP D;  2DBA A;  3AG2 E;  2RD0 A;  1KT0 A;  2P9I G;  3TJP A;  1KPS B;  4BTA A;  4V3I A;  2BF0 X;  5LCW C;  3S7J A;  3LPZ A;  3ZXP A;  1Z6T A;  3D9O A;  4JVS A;  3HIZ A;  3J5Q B;  1JCQ A;  3O4Z A;  2KZT A;  3L6A A;  3FTV A;  4FC8 A;  3D9J A;  2OEW A;  3NOC D;  2X6I A;  3AG4 E;  3D9L A;  5G04 C;  5CMW A;  4CCA A;  4WWO A;  2X3M A;  2IQC A;  1Z3X A;  4UUC A;  2AWI A;  1HE8 A;  5CRV A;  5CBN A;  4N5Q A;  4K5B A;  1UJK A;  1O5M A;  1JWF A;  5A23 A;  3RRN B;  1K8K G;  5CER B;  3SQV A;  4GYO A;  4HFG A;  4BSX A;  1PAQ A;  2XRY A;  4TUM A;  3GW4 A;  2LAI A;  2BKG A;  5G05 C;  3ASN E;  3S2A A;  3QB2 A;  5ANL A;  2WM9 A;  3E32 A;  3MKQ A;  4HRM B;  4JHR A;  2F8Y A;  1OCC E;  3DSW A;  3R7R A;  4F53 A;  4OAU C;  3IEG A;  1NA0 A;  3JQ0 A;  5KNH D;  3L17 A;  2IFU A;  3SFX A;  4C0M A;  3KD7 A;  4LNU D;  4BES A;  4O6F A;  3ULY A;  3FP3 A;  3UT4 A;  5BPP A;  5CCM A;  3CHR A;  5KBA A;  3Q9N C;  1BI7 B;  1D9S A;  2HM8 A;  4LG6 A;  3DEP A;  3SF4 A;  4AY6 A;  3K9I A;  3FY4 A;  4GTR A;  3PE3 A;  2WXP A;  4E85 A;  3JXI A;  3CK9 A;  5A6C A;  4CZ2 D;  2C0L A;  1NA3 A;  3EIJ A;  1UN9 A;  2P9L G;  3LXU X;  3TG5 A;  3HYM B;  2WXI A;  4GB9 A;  3DBS A;  1NL4 A;  3VLD A;  4I43 A;  3L13 A;  3G2S A;  3KAE A;  3NAW A;  3ML8 A;  2PNN A;  1YMP A;  3ZEF A;  5M72 A;  5B3S E;  3MKR A;  3ZNG A;  3NZU A;  5KCM A;  4GCN A;  2FI7 A;  3IHY A;  3AG3 E;  1OWM A;  3UIO C;  5FQ6 A;  4NAC A;  2GW1 A;  3OXG A;  4NUR A;  3CHQ A;  1DCE A;  3SNX A;  3UQ3 A;  5FZQ A;  2EIK E;  2EIM E;  1KZO A;  1A17 A;  1JUQ A;  2KCV A;  4IN3 B;  3CK7 A;  3FUI A;  3Q73 A;  2WXR A;  4ATG A;  2J9Q A;  2P9P G;  2ZIS A;  3V79 K;  3CVN A;  3AG1 E;  4I1M A;  1LTX A;  4ACK A;  3TWV A;  2V8S E;  2F8X K;  2GRN B;  1MHQ A;  3ULQ A;  1UOH A;  3FU5 A;  3GZS A;  3JUI A;  4JL0 A;  4EBA G;  3SGH A;  3SHF A;  1NI1 A;  4M3O A;  1V55 E;  4DX6 D;  4CT4 A;  4LCT A;  4LER A;  4LNG A;  2X38 A;  4CT0 A;  4EEC A;  1Z5S C;  2FO7 A;  5CMY A;  2NXP A;  1MZC A;  4YVQ C;  2I9C A;  1BU9 A;  4J8E A;  4YVO A;  4I2Z A;  1H6K A;  2P9U G;  4GPK A;  2BED A;  2WB2 A;  3B7R L;  5JJ6 A;  4GTV A;  3ONK A;  4G24 A;  3FTU A;  5AQA A;  4DX1 A;  2YQ8 A;  3E30 A;  4I1O B;  1X81 A;  1OCZ E;  3CHP A;  4JHJ A;  3IHV A;  2CG2 A;  2I6H A;  1FVF A;  2XZT G;  2VSY A;  1EDU A;  3DPD A;  3RO2 A;  5KJM A;  2EQX A;  2LSV A;  5EKQ D;  1HX8 A;  3TWQ A;  3E37 A;  4TV3 A;  3B7U X;  3ZYQ A;  5J90 A;  2XGM A;  2DVW A;  3T8M A;  3PVL A;  5G04 J;  3UTM A;  3T8K A;  1BI8 B;  4BY6 A;  3TL5 A;  1YYH A;  4CGW A;  4N3A A;  4UQY A;  2L0I A;  4F1S A;  2FF4 A;  2Y69 E;  3SD5 A;  4ME2 A;  4X8Q A;  4AIF A;  3HG0 D;  4JA9 A;  4TXQ A;  5KJL A;  1SZA A;  2KCK A;  4B93 B;  3EDT B;  4TRQ A;  2MYO A;  4ANX A;  1PY1 A;  3BEE A;  3CEQ A;  1N95 A;  4UI9 J;  4PS7 A;  2UY1 A;  3KEZ A;  3LY9 A;  5CHE E;  4J8S A;  2H6F A;  1B89 A;  3CHO A;  3MV2 B;  1MYO A;  1O1S A;  1XGW A;  5BV1 A;  4GCO A;  4URK A;  2ZU6 B;  3CVY A;  4JHK A;  3BG0 B;  2HR2 A;  3QWV A;  1H0A A;  5EIB E;  3TXN A;  2MRI A;  4U8V D;  4G11 A;  5FQ8 A;  2PL2 A;  1WDY A;  3QAQ A;  2XRZ A;  5FZR A;  3E4B A;  3PH0 C;  4KVM A;  3TWU A; 
#chains in the Genus database with same CATH homology
 1RW2 A;  3ISM C;  1Q2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...