1Q2ZA

The 3d solution structure of the c-terminal region of ku86
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
GPVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords ATP-dependent DNA helicase II, 80 kDa subunit
publication title The 3D Solution Structure of the C-terminal Region of Ku86 (Ku86CTR)
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08785 Ku_PK_bind Ku C terminal domain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 1q2zA00
1RW2A 1Q2ZA 3ISMC
chains in the Genus database with same CATH superfamily
1S64A 1IHGA 3L82A 3ONKA 2LSUA 4ANVA 2R03A 1EPUA 5EYLA 2L6BA 1H2VC 2J09A 1UG3A 3T9KA 2KCKA 2ETAA 3J5PA 3SFZA 2VGEA 3NB2A 4KMOA 1G3NB 4XX5A 5A23A 4JHRA 4FP7A 2ONDA 5CRUA 2EINE 4EQFA 4HI8A 5ENRD 2CG3A 3TWUA 2I1KA 3RRUA 2MHKA 4YDWA 1OWLA 4N5QA 2AWIA 3T5VA 2DWZA 5D2MC 3UM1A 3FULA 5ENSD 4DI3A 2GRRB 2PM7A 5EIDA 2BKKB 1N4SA 3TAXA 3CLJA 3EDTB 3MKQA 3FTYA 3CIAA 4ANXA 2OEVA 4TXQA 5EYPF 1HX8A 3AG4E 4EPZA 2A4ZA 4C0MA 3V30A 2AW6A 3Q75A 3UT4A 2J9QA 5T3RA 2H6GA 3ASDA 3U4TA 3ISMC 3BQOA 2Y4UA 3PZ4A 4O1PA 3RJVA 3S7FA 4ABNA 4UQZA 2V5QC 4JVSA 2WXQA 1IQRA 4Q96A 3ZHEB 5EX3A 3ZN3A 3T5XA 1HG2A 4BX8A 3E33A 3SQVA 3LY7A 3DSWA 3Q47B 3CVXA 3FUIA 5CERB 1KZPA 3SZ7A 4F6RD 2UY1B 4U63A 2XZDG 3ZUVB 3CVNA 4AV7A 2WXHA 1EDUA 1HS6A 2R05A 1E8XA 1Q2ZA 3LVQE 4HORA 5G05C 3ZIMA 4GCNA 4PDXA 3G2TA 4JD2G 4U96D 5AQBA 4CRWA 1LD8A 2L6JA 3ULEG 1TNYA 5HRYA 4GMJA 3ONLA 3CSTA 2VGYA 2FF4A 2XQ0A 5ARGA 3MYVA 1KT1A 1TN6A 4J8EA 2KCVA 1OCCE 2OEWA 4H7YA 3CQCB 2IO2C 4O6FA 1FCHA 4A55A 2VSYA 3W9GA 2WM9A 1LF8A 2X6FA 4G25A 2XGSA 1N0QA 3DSUA 4I1AA 4IULA 1MZCA 3FUKA 3TWWA 3O4ZA 4ZFHA 1KZOA 5EKQD 2FULA 3APFA 2C0LA 4WWOA 3MCXA 4K5CA 1QZ2A 3CHQA 4BFRA 3CVVA 1N4PA 1E7UA 3RO3A 1N52A 1MYOA 5BNWA 4URKA 1BLXB 1OCOE 3ASFA 5BW8C 4JA9A 1OWOA 3L54A 3ML8A 5BXUA 3SBTB 2YINA 5G04C 3HYMB 3HIZA 2F37A 2L0IA 3DSSA 2JABA 4EZKA 5E76A 1W3BA 5JMND 1HH8A 1E8WA 2RG8A 1FPPA 1IHBA 3CHMA 4BSXA 5EIBE 1K1BA 3V2OA 3KSLA 5FTPA 3TWXA 4GZDA 4G11A 2IOLA 5FQ7A 4QFVA 3LEWA 2RFMA 3CHSA 4J6IA 5CBNA 3VTXA 3GZSA 3JQ0A 3S7DA 3OAWA 1TJCA 2OVBA 2GRPB 4DX7D 3VLEA 3MA5A 2QZAA 3E4BA 4JZYA 4RVBA 3U64A 1D8DA 2ETBA 4CGVA 4N3BA 3EUVA 3FH5A 3TWQA 3B7UX 3VTYA 3RIBA 4L2YA 5AIJA 4U95D 3MV2B 4FLBA 3NZSA 2EILE 4BX9A 3FU0A 2VYIA 1SZ9A 3C98A 3Q7AA 2F8XK 3ZHEA 4P29A 5D0OD 3UT8A 4DK5A 2LXMA 4AY5A 5EDSA 4OVUA 3IHVA 3Q5MA 4K0RA 3RSEG 1PY1A 3HRAA 1A5EA 3J5QB 5CHEE 3EU9A 2KATA 3EHNA 2UY1A 4CZ2D 4AP2A 3UTMA 1SZAA 1O5MA 4GTTA 1E96B 1WG0A 5T8IA 2P9KG 2P2CP 1OXJA 1V55E 3NOGD 3Q9UC 2YHEA 3PUJA 1H0AA 3KSQA 2GROB 2NYJA 3ZYKA 4A3TA 2PQNA 4I6EA 2LSVA 4GA1A 5EX0A 2IU1A 1YYHA 2FBNA 4UWLA 1XNFA 2KXPC 3NBNB 5AYWD 4M7CA 1WY6A 3FTWA 3UI2A 4UQYA 4A3VA 1VDYA 3B7SA 2MYOA 5FINA 5FZRA 4TV3A 3GZ1A 3SF4A 3FTVA 2MRIA 4AJWA 3CK9A 3UMVA 3D9OA 4BTAA 3QWVA 1JUQA 3ABME 4I1MA 1PC2A 4FLHA 1HU3A 4XKBA 4B0ZA 3WG7E 3LJNA 2CHZA 4HS2A 1E8YA 3LKUA 2GW1A 1BD8A 4LG6A 1K3ZD 1IQUA 3D9KA 3SFYA 1DNPA 5JJ7A 5B3SE 3DEPA 2DIWA 2BEDA 2XENA 3EIQC 5FQ8A 5A7DB 3I3NA 4XE0A 4BY6A 2Y69E 4HQDA 4B93B 2CFZA 3JUIA 1S63A 4F1PA 4GMLA 4GB9A 3UX4A 3FTSA 3FEXA 3PRZA 3ABKE 3TWSA 2UWJG 3W9FA 3NZUA 4HRLA 1E8ZA 5KJMA 3D9HA 2OV8A 3CK8A 2A5UA 5BXOA 2VTBB 4ACKA 4HOSA 4HNAD 5AQ7A 3HXCA 4FULA 1ELKA 1JWGA 2L0TB 5LCWC 2YHCA 3KD7A 1Y6IA 1IKND 2J4DA 2X6JA 4RQIA 4G26A 4I9CA 3KAEA 2EIKE 5EILA 3TG5A 3V31A 5JJ6A 1H2UA 4GZ6A 1TNOA 4UQXA 4PS8A 3CKCA 4GCOA 2IF4A 1JCRA 1FVFA 3LPZA 3CSFA 1DCQA 1EYHA 4LUNU 5BV1A 3DSVA 5B1AE 3HXEA 3FUDA 5CCLA 2AVPA 2DBAA 3B7TA 3CVYA 4I2ZA 4WAFA 5FQ6A 5A6CA 3FUJA 4EECA 4GZ5A 1K8KG 1MQSA 5KCMA 1HXIA 2XEEA 4ILHB 4LCTA 4L23A 5LX8A 3EJNA 2XRZA 1TN8A 3SO8A 4DJAA 3I5PA 3G2WA 4IRUA 3D3MA 4GTRA 4DLOA 3OTNA 5CCMA 3UM0A 1MX6A 1JCSA 4PUCA 4APFA 3PZ2A 4HI9A 4JPSA 2F8YA 2J08A 1KLXA 4HB5A 3ZEFA 4UI9K 3UQ3A 4KVOA 1D8EA 3T8KA 2V8SE 2C0MA 2PQRA 4G24A 4DUIA 4B8CB 3U3WA 4GA2A 1YMPA 2XEVA 3CEQA 3N71A 1DC2A 4KZCA 3L13A 1RW2A 4JL0A 2HM8A 2DVWA 2IY0C 1QYMA 3VLFA 4Z68A 2XPIA 1DCEA 4EBAG 3Q4AB 4N5CA 3GZ2A 3QKYA 3VLDA 2JLBA 3LCAA 3V2XA 1X81A 4LEUA 1U3CA 3E32A 4UWFA 4K03A 2EIME 4L1BA 1UW4B 2P9LG 3ZGQA 4I6GA 3R9MA 4EZLA 1MX4A 3ABLE 1WM5A 4HLLA 2BUGA 2LXLA 2KCLA 2WQ7A 3HXBA 3T8MA 5JJTA 3JXJA 2X38A 3ZW3A 3ZU7B 4O1OA 4BWRA 4GPMA 3LDZA 2RD0A 2GRMA 4OVVA 5T4YA 5FIOA 1MJ0A 2I1JA 4GTMA 3FWVA 1N11A 4GU5A 5AN8A 5KJKA 2XGMA 5KWDA 1U3DA 1Y8MA 2E0IA 2CFUA 3ZKJA 5BPPA 3OXGA 3GYZA 4LSZE 3NOCD 3ZXPA 2WXIA 4MRUA 3ASOE 4GTSA 1JWFA 4A1SA 5ITZF 1XGWA 4TRQA 2WXFA 2MOWA 1A17A 1Z5SC 1V54E 1H19A 2IQCA 2FO7A 2WXRA 4K5AB 2GRLA 4XI9A 3HG0D 1OCRE 2VTBA 3FUHA 4GA0A 1QNFA 3L6AA 2ZU6B 2B6CA 4DI4A 5AJDA 4E6HA 4UWGA 3APDA 3KEZA 4IN3B 2H6HA 5AARA 4U7EB 4JEHA 2FO1E 5FT9A 1TNUA 5CEDB 3PS6A 4GTPA 2JEKA 3AAAC 3AS8A 3DPYA 4CEMA 1OT8A 3D9PA 1HO8A 4C0EA 4F1SA 4FJYA 3B7RL 2XRYA 3L9TA 3NQPA 2P58C 3CR3A 3AS5A 2RFAA 4GYWA 3FTZA 2NSZA 4UWKA 4YDEA 5D0QD 4CYMD 4AY6A 2LNIA 3SHFA 1Z6TA 2XPYA 2ZXWE 3IBEA 3FY4A 3FUMA 5JHBA 5AQAA 5FZQA 4RG6A 1HFAA 4PH4B 3DBSA 4B89A 3L08A 5B1BE 4Y6CA 3IXEA 4JEUA 4JB8P 3PNLB 2Y4TA 4D10C 4FADA 1JCQA 4GTVA 5JA4D 3SY2A 2CHXA 4FHKA 1TNZA 1UJKA 2J8SD 3ML9A 2X6KA 4GTOA 2WQ6A 3QWPA 4HXIA 3ZVVA 4DX2A 5EN5D 2WXKA 2V5FA 4O60A 2LO6A 5D66A 4ANWA 1KT0A 3LJ3A 4ATGA 1OWMA 5DBKA 3PEUB 4WUYA 4N2SA 4EHMA 3DWLG 3R7RA 3E37A 3S7JA 4HFGA 4Y6WA 4BT8A 2CG2A 3EHMA 2QYUA 4MBGA 3ENEA 4GYOA 4G1TA 3FUNA 4KZ0A 4N3CA 4WNGA 1UOHA 2AXVA 5ENTD 4K5BA 3FUFA 3G2UA 2P9IG 3UIPC 4MS6A 2GRQB 4TUMA 5ENQD 2P9NG 1UN8A 3BG0B 3F6QA 3QWWA 4B8AA 4HRNA 5C2YA 3IEGA 4JHKA 3LS8A 5AQ9A 4Q94A 2Y0BG 4DPRA 3PE4A 4JC8A 2E2EA 2AXZA 4J8DA 5HS0A 1HF8A 2VQ2A 3C3QA 5ENNA 2QY7A 3Q15A 5CMWA 4MKTA 1YCSB 4LERA 4I6JA 2WXNA 5ANRA 2R02A 3D9NA 1WDYA 1BI8B 3UIOC 1ZU2A 4KVMA 3Q9NC 1SA5A 3D9JA 3QJZA 4N2QA 1MHQA 4L2LA 2FI7A 3JXIA 4NURA 3UT7A 2HO1A 4U0SA 5KNGA 5E75A 4DLQA 1N94A 4PS7A 1NA0A 4WWPA 4EZJA 3FU5A 3MX3A 2LUHA 4F7AA 3HHMA 3RAUA 1Z3XA 4J8SA 4HBDA 4N39A 2BF0X 3LVRE 4B94A 3V79K 1OY3D 3RK6A 3TXMA 4FJZA 1IYGA 4UI9J 4F3VA 2XPZA 5FJYA 2ZISA 3CHRA 4CGWA 4FA6A 2DZOA 4YDYA 3U66A 3IKOB 3S7BA 2KZTB 3JQ1A 3AS4A 4ME2A 2X3MA 2FEZA 4XKCA 1KPSB 4CDNA 1NL4A 3TJPA 2R59A 3LY9A 3LYAA 1X5BA 3ZPJA 5HKPA 4ACLA 3UINC 4AM9A 1HG5A 4UUCA 5BV0A 2WXMA 1TYQG 1ELWA 4BETA 3MJWA 2R2LA 3QNKA 1TN7A 4G23A 2WVIA 3PDNA 2WXOA 2Q7FA 1L5JA 3ZYQA 4JXTA 4CCAA 3SNXA 5IY5E 2V4HC 4U07A 3C5RA 3ZNGA 2VSNA 2VGXB 3MEKA 1FT2A 3MKRA 3PUKA 1BI7B 3B95A 1FVHA 4A1GA 3BEEA 2WXLA 4BT9A 4XEIG 3QK0A 3KEAA 5G2NA 4UWHA 3KS2A 2X6IA 5KJLA 1TR4A 4Q69A 3BUAA 3G2SA 4BESA 2L9BA 2WXPA 3AJIA 4U8VD 4XZ4A 4TXPA 1N9AA 2DCPA 4APOA 2F0YA 3FDHA 2YNQA 4G8LA 5LFAA 4NIKA 2DYRE 2VSXE 4E85A 1H2TC 4X8QA 3FH8A 2KM4A 1OWPA 2AXUA 1N95A 4BERA 4TUUA 4NACA 4HOTA 3Q78A 4RLYA 3TWTA 3R7QA 3LY8A 1H6OA 4AEZC 3E34A 5ENPD 2BKGA 4FHJA 3OXFA 5G05J 4GPKA 4L7TA 4JW1A 5CMYA 3FEYA 1K1AA 4AIFA 3CQGB 3UUXA 2ILRA 3MV3B 4R7LA 2I6HA 3D9MA 2OCCE 4LNGA 2V4LA 4KBQA 3U9WA 3RRMB 3I4RB 2VSOE 4I1OB 2XEHA 3UXGA 5AENA 4V3IA 1ELRA 1FT1A 3PZ1A 2PNNA 3SFXA 4JA7A 3QDNA 5C1DA 3APCA 3CGHA 3P2BA 2ETCA 4U8YD 3ASNE 1GW6A 5FZSA 4GZCA 2XZTG 3TGOA 2C2LA 4I43A 2LAIA 3CVQA 5KBAA 1RZ4A 2NXPA 2I2OA 2IONA 2WXGA 1NP7A 3PH0C 3ULYA 2LAHA 3FU6A 3ZYMA 3PREA 2GRNB 4EBAA 3HDXA 4HOQA 5FWQA 3D9IA 3ZYLA 1YA0A 1SQMA 3TG4A 3L16A 4QQIA 5G04J 3SI5A 1AWCB 2IO3C 2KZTA 2PZIA 3MGBA 2HE0A 4J7WA 4ANUA 4OYSA 5JHAA 3NAWA 4NQ0A 4HOUA 4RG9A 5BUZA 2R5SA 1O1SA 4DX1A 2QC9A 3QB2A 1ZB1A 4GAAA 2V0PA 1E7VA 5LOZA 4DX6D 1D9SA 2B0OE 3P1UA 2QYJA 5FQ4A 1O1TA 3FTXA 4ZHBA 3C72A 3PVLA 4WNEA 2XHEA 4YVOA 3RU0A 4CT4A 1SA4A 1S0PA 3AU4A 1SVXA 1EF1C 1B89A 3HVEB 1N54A 1MX2A 4CT0A 1BPOA 4OAVB 3X2QE 3FP3A 2VGXA 3Q73A 4FU3A 4I9EA 1LTXA 3DSTA 4I17A 4LNUD 3DPDA 1NZNA 4U04A 2J4BA 2OOEA 4KXKB 3ASGA 1O1RA 3TXNA 3EHQA 4U8HA 3QAQA 1N0RA 1ZBPA 1TEZA 4CDRA 3CK7A 4PS3A 1IXVA 5LP0A 2OVFA 2ZIRA 2DYSE 4GTQA 4I2WA 4FC8A 2WB2A 1TJFA 4HRMB 4A63B 1U2VG 2AJAA 4MLPA 4L9PA 4KYOB 4KT6B 5AJLA 3CKBA 3SBSA 3URZA 3CHPA 3RRNB 2M63A 4J0UA 1BU9A 1JPLA 3DXKG 3Q7FA 5KNHD 2CHWA 4HVBA 3Q79A 3CHOA 3ASHA 5BT1A 1PAQA 2QFCA 4BEPA 4HLEA 2XCCA 2IJGX 3FHEA 3LXUX 3O48A 4BTBA 2H6IA 1H6PA 3ESKA 3IV0A 2YQ8A 3PNTB 2X6HA 2J07A 3JCKC 3TWVA 4GZ3A 5DIZA 2DZNA 2Y3AA 3UKUG 1NA3A 4W9RA 4C9BB 4TXRA 3FTUA 2Y1LE 4XI0A 4GYYA 3CVWA 1HZ4A 4J8YA 1S70B 4BSZB 4YNDA 3Q49B 4DRXE 5G55A 1E90A 2IEJA 1H6KA 4LRZA 1AP7A 3CVPA 1DVPA 1LD7A 3EHRA 5ARFA 2H6FA 3C3OA 1N4QA 3PZDA 3UPVA 3JYSA 5CRVA 2P9UG 4N3AA 3EIJA 2J49A 3AU5A 3ESLA 4M3OA 5CEAA 2WXJA 5M72A 4AOFA 4GMRA 3ZFWA 5ANLA 2ZGGA 3B13A 4WNDA 4WWNA 4YVQC 4RSYA 1N4RA 1UJJA 4C48B 3MKQB 4ILGA 3RO2A 2ZGDA 3R9AB 4ATZD 4H7XA 4WNFA 2WQHA 2XS1A 3OXLA 5AAOA 3E30A 3D9LA 4J8FA 3QARA 5HI7A 2P9SG 3ZXSA 3EU5A 4U0UA 2EIJE 4NRHB 3CVLA 2P9PG 3C3RA 3L22A 3UM3A 2XCBA 3JUEA 2RKKA 3G2VA 3RKVA 1QQEA 5LCWJ 3MZLB 2KBXA 5H7PA 3GW4A 4G8KA 3DEOA 3HVEA 2IFUA 5ENOD 4XIFA 3CVUA 2WPVA 2PM6A 3K9IA 3I4GA 2VJ8A 1SW6A 4F53A 3DXMG 4LNBA 3L17A 3HXDA 3PE3A 5J90A 3BG1B 4JHJA 5CECB 4CDMA 1OCZE 3IHYA 3UKRG 5KJNA 2WMOA 2XGOA 3AG3E 3SGHA 2IOSA 3HXFA 3PZ3A 3NF1A 2I9CA 1OUVA 3CV0A 3DRAA 3TWRA 3UM2A 4DX5D 1TNBA 3PEVB 2KC7A 4U0ZA 3WXXA 3QC1A 3QOUA 1HE8A 3DSXA 3TL5A 1INZA 2HR2A 3FUEA 1P5QA 3FH7A 2PL2A 4G2VA 3AG1E 4IYPA 2XS8A 2BTDA 3B7BA 4OAUC 3SD5A 2HYZA 1NFIE 1NI1A 1OWNA 2A5EA 4AVXA 2R17C 3FU3A 1Z3YA 5J08A 3BU8A 2WMNA 3S2AA 1QBQA 5CBOA 2NC9A 2GGFA 3ULQA 3ZRHA 1WAO1 3AG2E 3FFLA 4UI9C 5HQ8A 4AXHA 2EQXA 4YDOA 1UN9A 4ILIA
chains in the Genus database with same CATH topology
1RW2A 1Q2ZA 3ISMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RW2 A;  1Q2Z A;  3ISM C; 
#chains in the Genus database with same CATH topology
 1S64 A;  1IHG A;  3L82 A;  3ONK A;  2LSU A;  4ANV A;  2R03 A;  1EPU A;  5EYL A;  2L6B A;  1H2V C;  2J09 A;  1UG3 A;  3T9K A;  2KCK A;  2ETA A;  3J5P A;  3SFZ A;  2VGE A;  3NB2 A;  4KMO A;  1G3N B;  4XX5 A;  5A23 A;  4JHR A;  4FP7 A;  2OND A;  5CRU A;  2EIN E;  4EQF A;  4HI8 A;  5ENR D;  2CG3 A;  3TWU A;  2I1K A;  3RRU A;  2MHK A;  4YDW A;  1OWL A;  4N5Q A;  2AWI A;  3T5V A;  2DWZ A;  5D2M C;  3UM1 A;  3FUL A;  5ENS D;  4DI3 A;  2GRR B;  2PM7 A;  5EID A;  2BKK B;  1N4S A;  3TAX A;  3CLJ A;  3EDT B;  3MKQ A;  3FTY A;  3CIA A;  4ANX A;  2OEV A;  4TXQ A;  5EYP F;  1HX8 A;  3AG4 E;  4EPZ A;  2A4Z A;  4C0M A;  3V30 A;  2AW6 A;  3Q75 A;  3UT4 A;  2J9Q A;  5T3R A;  2H6G A;  3ASD A;  3U4T A;  3ISM C;  3BQO A;  2Y4U A;  3PZ4 A;  4O1P A;  3RJV A;  3S7F A;  4ABN A;  4UQZ A;  2V5Q C;  4JVS A;  2WXQ A;  1IQR A;  4Q96 A;  3ZHE B;  5EX3 A;  3ZN3 A;  3T5X A;  1HG2 A;  4BX8 A;  3E33 A;  3SQV A;  3LY7 A;  3DSW A;  3Q47 B;  3CVX A;  3FUI A;  5CER B;  1KZP A;  3SZ7 A;  4F6R D;  2UY1 B;  4U63 A;  2XZD G;  3ZUV B;  3CVN A;  4AV7 A;  2WXH A;  1EDU A;  1HS6 A;  2R05 A;  1E8X A;  1Q2Z A;  3LVQ E;  4HOR A;  5G05 C;  3ZIM A;  4GCN A;  4PDX A;  3G2T A;  4JD2 G;  4U96 D;  5AQB A;  4CRW A;  1LD8 A;  2L6J A;  3ULE G;  1TNY A;  5HRY A;  4GMJ A;  3ONL A;  3CST A;  2VGY A;  2FF4 A;  2XQ0 A;  5ARG A;  3MYV A;  1KT1 A;  1TN6 A;  4J8E A;  2KCV A;  1OCC E;  2OEW A;  4H7Y A;  3CQC B;  2IO2 C;  4O6F A;  1FCH A;  4A55 A;  2VSY A;  3W9G A;  2WM9 A;  1LF8 A;  2X6F A;  4G25 A;  2XGS A;  1N0Q A;  3DSU A;  4I1A A;  4IUL A;  1MZC A;  3FUK A;  3TWW A;  3O4Z A;  4ZFH A;  1KZO A;  5EKQ D;  2FUL A;  3APF A;  2C0L A;  4WWO A;  3MCX A;  4K5C A;  1QZ2 A;  3CHQ A;  4BFR A;  3CVV A;  1N4P A;  1E7U A;  3RO3 A;  1N52 A;  1MYO A;  5BNW A;  4URK A;  1BLX B;  1OCO E;  3ASF A;  5BW8 C;  4JA9 A;  1OWO A;  3L54 A;  3ML8 A;  5BXU A;  3SBT B;  2YIN A;  5G04 C;  3HYM B;  3HIZ A;  2F37 A;  2L0I A;  3DSS A;  2JAB A;  4EZK A;  5E76 A;  1W3B A;  5JMN D;  1HH8 A;  1E8W A;  2RG8 A;  1FPP A;  1IHB A;  3CHM A;  4BSX A;  5EIB E;  1K1B A;  3V2O A;  3KSL A;  5FTP A;  3TWX A;  4GZD A;  4G11 A;  2IOL A;  5FQ7 A;  4QFV A;  3LEW A;  2RFM A;  3CHS A;  4J6I A;  5CBN A;  3VTX A;  3GZS A;  3JQ0 A;  3S7D A;  3OAW A;  1TJC A;  2OVB A;  2GRP B;  4DX7 D;  3VLE A;  3MA5 A;  2QZA A;  3E4B A;  4JZY A;  4RVB A;  3U64 A;  1D8D A;  2ETB A;  4CGV A;  4N3B A;  3EUV A;  3FH5 A;  3TWQ A;  3B7U X;  3VTY A;  3RIB A;  4L2Y A;  5AIJ A;  4U95 D;  3MV2 B;  4FLB A;  3NZS A;  2EIL E;  4BX9 A;  3FU0 A;  2VYI A;  1SZ9 A;  3C98 A;  3Q7A A;  2F8X K;  3ZHE A;  4P29 A;  5D0O D;  3UT8 A;  4DK5 A;  2LXM A;  4AY5 A;  5EDS A;  4OVU A;  3IHV A;  3Q5M A;  4K0R A;  3RSE G;  1PY1 A;  3HRA A;  1A5E A;  3J5Q B;  5CHE E;  3EU9 A;  2KAT A;  3EHN A;  2UY1 A;  4CZ2 D;  4AP2 A;  3UTM A;  1SZA A;  1O5M A;  4GTT A;  1E96 B;  1WG0 A;  5T8I A;  2P9K G;  2P2C P;  1OXJ A;  1V55 E;  3NOG D;  3Q9U C;  2YHE A;  3PUJ A;  1H0A A;  3KSQ A;  2GRO B;  2NYJ A;  3ZYK A;  4A3T A;  2PQN A;  4I6E A;  2LSV A;  4GA1 A;  5EX0 A;  2IU1 A;  1YYH A;  2FBN A;  4UWL A;  1XNF A;  2KXP C;  3NBN B;  5AYW D;  4M7C A;  1WY6 A;  3FTW A;  3UI2 A;  4UQY A;  4A3V A;  1VDY A;  3B7S A;  2MYO A;  5FIN A;  5FZR A;  4TV3 A;  3GZ1 A;  3SF4 A;  3FTV A;  2MRI A;  4AJW A;  3CK9 A;  3UMV A;  3D9O A;  4BTA A;  3QWV A;  1JUQ A;  3ABM E;  4I1M A;  1PC2 A;  4FLH A;  1HU3 A;  4XKB A;  4B0Z A;  3WG7 E;  3LJN A;  2CHZ A;  4HS2 A;  1E8Y A;  3LKU A;  2GW1 A;  1BD8 A;  4LG6 A;  1K3Z D;  1IQU A;  3D9K A;  3SFY A;  1DNP A;  5JJ7 A;  5B3S E;  3DEP A;  2DIW A;  2BED A;  2XEN A;  3EIQ C;  5FQ8 A;  5A7D B;  3I3N A;  4XE0 A;  4BY6 A;  2Y69 E;  4HQD A;  4B93 B;  2CFZ A;  3JUI A;  1S63 A;  4F1P A;  4GML A;  4GB9 A;  3UX4 A;  3FTS A;  3FEX A;  3PRZ A;  3ABK E;  3TWS A;  2UWJ G;  3W9F A;  3NZU A;  4HRL A;  1E8Z A;  5KJM A;  3D9H A;  2OV8 A;  3CK8 A;  2A5U A;  5BXO A;  2VTB B;  4ACK A;  4HOS A;  4HNA D;  5AQ7 A;  3HXC A;  4FUL A;  1ELK A;  1JWG A;  2L0T B;  5LCW C;  2YHC A;  3KD7 A;  1Y6I A;  1IKN D;  2J4D A;  2X6J A;  4RQI A;  4G26 A;  4I9C A;  3KAE A;  2EIK E;  5EIL A;  3TG5 A;  3V31 A;  5JJ6 A;  1H2U A;  4GZ6 A;  1TNO A;  4UQX A;  4PS8 A;  3CKC A;  4GCO A;  2IF4 A;  1JCR A;  1FVF A;  3LPZ A;  3CSF A;  1DCQ A;  1EYH A;  4LUN U;  5BV1 A;  3DSV A;  5B1A E;  3HXE A;  3FUD A;  5CCL A;  2AVP A;  2DBA A;  3B7T A;  3CVY A;  4I2Z A;  4WAF A;  5FQ6 A;  5A6C A;  3FUJ A;  4EEC A;  4GZ5 A;  1K8K G;  1MQS A;  5KCM A;  1HXI A;  2XEE A;  4ILH B;  4LCT A;  4L23 A;  5LX8 A;  3EJN A;  2XRZ A;  1TN8 A;  3SO8 A;  4DJA A;  3I5P A;  3G2W A;  4IRU A;  3D3M A;  4GTR A;  4DLO A;  3OTN A;  5CCM A;  3UM0 A;  1MX6 A;  1JCS A;  4PUC A;  4APF A;  3PZ2 A;  4HI9 A;  4JPS A;  2F8Y A;  2J08 A;  1KLX A;  4HB5 A;  3ZEF A;  4UI9 K;  3UQ3 A;  4KVO A;  1D8E A;  3T8K A;  2V8S E;  2C0M A;  2PQR A;  4G24 A;  4DUI A;  4B8C B;  3U3W A;  4GA2 A;  1YMP A;  2XEV A;  3CEQ A;  3N71 A;  1DC2 A;  4KZC A;  3L13 A;  1RW2 A;  4JL0 A;  2HM8 A;  2DVW A;  2IY0 C;  1QYM A;  3VLF A;  4Z68 A;  2XPI A;  1DCE A;  4EBA G;  3Q4A B;  4N5C A;  3GZ2 A;  3QKY A;  3VLD A;  2JLB A;  3LCA A;  3V2X A;  1X81 A;  4LEU A;  1U3C A;  3E32 A;  4UWF A;  4K03 A;  2EIM E;  4L1B A;  1UW4 B;  2P9L G;  3ZGQ A;  4I6G A;  3R9M A;  4EZL A;  1MX4 A;  3ABL E;  1WM5 A;  4HLL A;  2BUG A;  2LXL A;  2KCL A;  2WQ7 A;  3HXB A;  3T8M A;  5JJT A;  3JXJ A;  2X38 A;  3ZW3 A;  3ZU7 B;  4O1O A;  4BWR A;  4GPM A;  3LDZ A;  2RD0 A;  2GRM A;  4OVV A;  5T4Y A;  5FIO A;  1MJ0 A;  2I1J A;  4GTM A;  3FWV A;  1N11 A;  4GU5 A;  5AN8 A;  5KJK A;  2XGM A;  5KWD A;  1U3D A;  1Y8M A;  2E0I A;  2CFU A;  3ZKJ A;  5BPP A;  3OXG A;  3GYZ A;  4LSZ E;  3NOC D;  3ZXP A;  2WXI A;  4MRU A;  3ASO E;  4GTS A;  1JWF A;  4A1S A;  5ITZ F;  1XGW A;  4TRQ A;  2WXF A;  2MOW A;  1A17 A;  1Z5S C;  1V54 E;  1H19 A;  2IQC A;  2FO7 A;  2WXR A;  4K5A B;  2GRL A;  4XI9 A;  3HG0 D;  1OCR E;  2VTB A;  3FUH A;  4GA0 A;  1QNF A;  3L6A A;  2ZU6 B;  2B6C A;  4DI4 A;  5AJD A;  4E6H A;  4UWG A;  3APD A;  3KEZ A;  4IN3 B;  2H6H A;  5AAR A;  4U7E B;  4JEH A;  2FO1 E;  5FT9 A;  1TNU A;  5CED B;  3PS6 A;  4GTP A;  2JEK A;  3AAA C;  3AS8 A;  3DPY A;  4CEM A;  1OT8 A;  3D9P A;  1HO8 A;  4C0E A;  4F1S A;  4FJY A;  3B7R L;  2XRY A;  3L9T A;  3NQP A;  2P58 C;  3CR3 A;  3AS5 A;  2RFA A;  4GYW A;  3FTZ A;  2NSZ A;  4UWK A;  4YDE A;  5D0Q D;  4CYM D;  4AY6 A;  2LNI A;  3SHF A;  1Z6T A;  2XPY A;  2ZXW E;  3IBE A;  3FY4 A;  3FUM A;  5JHB A;  5AQA A;  5FZQ A;  4RG6 A;  1HFA A;  4PH4 B;  3DBS A;  4B89 A;  3L08 A;  5B1B E;  4Y6C A;  3IXE A;  4JEU A;  4JB8 P;  3PNL B;  2Y4T A;  4D10 C;  4FAD A;  1JCQ A;  4GTV A;  5JA4 D;  3SY2 A;  2CHX A;  4FHK A;  1TNZ A;  1UJK A;  2J8S D;  3ML9 A;  2X6K A;  4GTO A;  2WQ6 A;  3QWP A;  4HXI A;  3ZVV A;  4DX2 A;  5EN5 D;  2WXK A;  2V5F A;  4O60 A;  2LO6 A;  5D66 A;  4ANW A;  1KT0 A;  3LJ3 A;  4ATG A;  1OWM A;  5DBK A;  3PEU B;  4WUY A;  4N2S A;  4EHM A;  3DWL G;  3R7R A;  3E37 A;  3S7J A;  4HFG A;  4Y6W A;  4BT8 A;  2CG2 A;  3EHM A;  2QYU A;  4MBG A;  3ENE A;  4GYO A;  4G1T A;  3FUN A;  4KZ0 A;  4N3C A;  4WNG A;  1UOH A;  2AXV A;  5ENT D;  4K5B A;  3FUF A;  3G2U A;  2P9I G;  3UIP C;  4MS6 A;  2GRQ B;  4TUM A;  5ENQ D;  2P9N G;  1UN8 A;  3BG0 B;  3F6Q A;  3QWW A;  4B8A A;  4HRN A;  5C2Y A;  3IEG A;  4JHK A;  3LS8 A;  5AQ9 A;  4Q94 A;  2Y0B G;  4DPR A;  3PE4 A;  4JC8 A;  2E2E A;  2AXZ A;  4J8D A;  5HS0 A;  1HF8 A;  2VQ2 A;  3C3Q A;  5ENN A;  2QY7 A;  3Q15 A;  5CMW A;  4MKT A;  1YCS B;  4LER A;  4I6J A;  2WXN A;  5ANR A;  2R02 A;  3D9N A;  1WDY A;  1BI8 B;  3UIO C;  1ZU2 A;  4KVM A;  3Q9N C;  1SA5 A;  3D9J A;  3QJZ A;  4N2Q A;  1MHQ A;  4L2L A;  2FI7 A;  3JXI A;  4NUR A;  3UT7 A;  2HO1 A;  4U0S A;  5KNG A;  5E75 A;  4DLQ A;  1N94 A;  4PS7 A;  1NA0 A;  4WWP A;  4EZJ A;  3FU5 A;  3MX3 A;  2LUH A;  4F7A A;  3HHM A;  3RAU A;  1Z3X A;  4J8S A;  4HBD A;  4N39 A;  2BF0 X;  3LVR E;  4B94 A;  3V79 K;  1OY3 D;  3RK6 A;  3TXM A;  4FJZ A;  1IYG A;  4UI9 J;  4F3V A;  2XPZ A;  5FJY A;  2ZIS A;  3CHR A;  4CGW A;  4FA6 A;  2DZO A;  4YDY A;  3U66 A;  3IKO B;  3S7B A;  2KZT B;  3JQ1 A;  3AS4 A;  4ME2 A;  2X3M A;  2FEZ A;  4XKC A;  1KPS B;  4CDN A;  1NL4 A;  3TJP A;  2R59 A;  3LY9 A;  3LYA A;  1X5B A;  3ZPJ A;  5HKP A;  4ACL A;  3UIN C;  4AM9 A;  1HG5 A;  4UUC A;  5BV0 A;  2WXM A;  1TYQ G;  1ELW A;  4BET A;  3MJW A;  2R2L A;  3QNK A;  1TN7 A;  4G23 A;  2WVI A;  3PDN A;  2WXO A;  2Q7F A;  1L5J A;  3ZYQ A;  4JXT A;  4CCA A;  3SNX A;  5IY5 E;  2V4H C;  4U07 A;  3C5R A;  3ZNG A;  2VSN A;  2VGX B;  3MEK A;  1FT2 A;  3MKR A;  3PUK A;  1BI7 B;  3B95 A;  1FVH A;  4A1G A;  3BEE A;  2WXL A;  4BT9 A;  4XEI G;  3QK0 A;  3KEA A;  5G2N A;  4UWH A;  3KS2 A;  2X6I A;  5KJL A;  1TR4 A;  4Q69 A;  3BUA A;  3G2S A;  4BES A;  2L9B A;  2WXP A;  3AJI A;  4U8V D;  4XZ4 A;  4TXP A;  1N9A A;  2DCP A;  4APO A;  2F0Y A;  3FDH A;  2YNQ A;  4G8L A;  5LFA A;  4NIK A;  2DYR E;  2VSX E;  4E85 A;  1H2T C;  4X8Q A;  3FH8 A;  2KM4 A;  1OWP A;  2AXU A;  1N95 A;  4BER A;  4TUU A;  4NAC A;  4HOT A;  3Q78 A;  4RLY A;  3TWT A;  3R7Q A;  3LY8 A;  1H6O A;  4AEZ C;  3E34 A;  5ENP D;  2BKG A;  4FHJ A;  3OXF A;  5G05 J;  4GPK A;  4L7T A;  4JW1 A;  5CMY A;  3FEY A;  1K1A A;  4AIF A;  3CQG B;  3UUX A;  2ILR A;  3MV3 B;  4R7L A;  2I6H A;  3D9M A;  2OCC E;  4LNG A;  2V4L A;  4KBQ A;  3U9W A;  3RRM B;  3I4R B;  2VSO E;  4I1O B;  2XEH A;  3UXG A;  5AEN A;  4V3I A;  1ELR A;  1FT1 A;  3PZ1 A;  2PNN A;  3SFX A;  4JA7 A;  3QDN A;  5C1D A;  3APC A;  3CGH A;  3P2B A;  2ETC A;  4U8Y D;  3ASN E;  1GW6 A;  5FZS A;  4GZC A;  2XZT G;  3TGO A;  2C2L A;  4I43 A;  2LAI A;  3CVQ A;  5KBA A;  1RZ4 A;  2NXP A;  2I2O A;  2ION A;  2WXG A;  1NP7 A;  3PH0 C;  3ULY A;  2LAH A;  3FU6 A;  3ZYM A;  3PRE A;  2GRN B;  4EBA A;  3HDX A;  4HOQ A;  5FWQ A;  3D9I A;  3ZYL A;  1YA0 A;  1SQM A;  3TG4 A;  3L16 A;  4QQI A;  5G04 J;  3SI5 A;  1AWC B;  2IO3 C;  2KZT A;  2PZI A;  3MGB A;  2HE0 A;  4J7W A;  4ANU A;  4OYS A;  5JHA A;  3NAW A;  4NQ0 A;  4HOU A;  4RG9 A;  5BUZ A;  2R5S A;  1O1S A;  4DX1 A;  2QC9 A;  3QB2 A;  1ZB1 A;  4GAA A;  2V0P A;  1E7V A;  5LOZ A;  4DX6 D;  1D9S A;  2B0O E;  3P1U A;  2QYJ A;  5FQ4 A;  1O1T A;  3FTX A;  4ZHB A;  3C72 A;  3PVL A;  4WNE A;  2XHE A;  4YVO A;  3RU0 A;  4CT4 A;  1SA4 A;  1S0P A;  3AU4 A;  1SVX A;  1EF1 C;  1B89 A;  3HVE B;  1N54 A;  1MX2 A;  4CT0 A;  1BPO A;  4OAV B;  3X2Q E;  3FP3 A;  2VGX A;  3Q73 A;  4FU3 A;  4I9E A;  1LTX A;  3DST A;  4I17 A;  4LNU D;  3DPD A;  1NZN A;  4U04 A;  2J4B A;  2OOE A;  4KXK B;  3ASG A;  1O1R A;  3TXN A;  3EHQ A;  4U8H A;  3QAQ A;  1N0R A;  1ZBP A;  1TEZ A;  4CDR A;  3CK7 A;  4PS3 A;  1IXV A;  5LP0 A;  2OVF A;  2ZIR A;  2DYS E;  4GTQ A;  4I2W A;  4FC8 A;  2WB2 A;  1TJF A;  4HRM B;  4A63 B;  1U2V G;  2AJA A;  4MLP A;  4L9P A;  4KYO B;  4KT6 B;  5AJL A;  3CKB A;  3SBS A;  3URZ A;  3CHP A;  3RRN B;  2M63 A;  4J0U A;  1BU9 A;  1JPL A;  3DXK G;  3Q7F A;  5KNH D;  2CHW A;  4HVB A;  3Q79 A;  3CHO A;  3ASH A;  5BT1 A;  1PAQ A;  2QFC A;  4BEP A;  4HLE A;  2XCC A;  2IJG X;  3FHE A;  3LXU X;  3O48 A;  4BTB A;  2H6I A;  1H6P A;  3ESK A;  3IV0 A;  2YQ8 A;  3PNT B;  2X6H A;  2J07 A;  3JCK C;  3TWV A;  4GZ3 A;  5DIZ A;  2DZN A;  2Y3A A;  3UKU G;  1NA3 A;  4W9R A;  4C9B B;  4TXR A;  3FTU A;  2Y1L E;  4XI0 A;  4GYY A;  3CVW A;  1HZ4 A;  4J8Y A;  1S70 B;  4BSZ B;  4YND A;  3Q49 B;  4DRX E;  5G55 A;  1E90 A;  2IEJ A;  1H6K A;  4LRZ A;  1AP7 A;  3CVP A;  1DVP A;  1LD7 A;  3EHR A;  5ARF A;  2H6F A;  3C3O A;  1N4Q A;  3PZD A;  3UPV A;  3JYS A;  5CRV A;  2P9U G;  4N3A A;  3EIJ A;  2J49 A;  3AU5 A;  3ESL A;  4M3O A;  5CEA A;  2WXJ A;  5M72 A;  4AOF A;  4GMR A;  3ZFW A;  5ANL A;  2ZGG A;  3B13 A;  4WND A;  4WWN A;  4YVQ C;  4RSY A;  1N4R A;  1UJJ A;  4C48 B;  3MKQ B;  4ILG A;  3RO2 A;  2ZGD A;  3R9A B;  4ATZ D;  4H7X A;  4WNF A;  2WQH A;  2XS1 A;  3OXL A;  5AAO A;  3E30 A;  3D9L A;  4J8F A;  3QAR A;  5HI7 A;  2P9S G;  3ZXS A;  3EU5 A;  4U0U A;  2EIJ E;  4NRH B;  3CVL A;  2P9P G;  3C3R A;  3L22 A;  3UM3 A;  2XCB A;  3JUE A;  2RKK A;  3G2V A;  3RKV A;  1QQE A;  5LCW J;  3MZL B;  2KBX A;  5H7P A;  3GW4 A;  4G8K A;  3DEO A;  3HVE A;  2IFU A;  5ENO D;  4XIF A;  3CVU A;  2WPV A;  2PM6 A;  3K9I A;  3I4G A;  2VJ8 A;  1SW6 A;  4F53 A;  3DXM G;  4LNB A;  3L17 A;  3HXD A;  3PE3 A;  5J90 A;  3BG1 B;  4JHJ A;  5CEC B;  4CDM A;  1OCZ E;  3IHY A;  3UKR G;  5KJN A;  2WMO A;  2XGO A;  3AG3 E;  3SGH A;  2IOS A;  3HXF A;  3PZ3 A;  3NF1 A;  2I9C A;  1OUV A;  3CV0 A;  3DRA A;  3TWR A;  3UM2 A;  4DX5 D;  1TNB A;  3PEV B;  2KC7 A;  4U0Z A;  3WXX A;  3QC1 A;  3QOU A;  1HE8 A;  3DSX A;  3TL5 A;  1INZ A;  2HR2 A;  3FUE A;  1P5Q A;  3FH7 A;  2PL2 A;  4G2V A;  3AG1 E;  4IYP A;  2XS8 A;  2BTD A;  3B7B A;  4OAU C;  3SD5 A;  2HYZ A;  1NFI E;  1NI1 A;  1OWN A;  2A5E A;  4AVX A;  2R17 C;  3FU3 A;  1Z3Y A;  5J08 A;  3BU8 A;  2WMN A;  3S2A A;  1QBQ A;  5CBO A;  2NC9 A;  2GGF A;  3ULQ A;  3ZRH A;  1WAO 1;  3AG2 E;  3FFL A;  4UI9 C;  5HQ8 A;  4AXH A;  2EQX A;  4YDO A;  1UN9 A;  4ILI A; 
#chains in the Genus database with same CATH homology
 1RW2 A;  1Q2Z A;  3ISM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...