3DXMG

Structure of bos taurus arp2/3 complex with bound inhibitor ck0993548
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
137
Chain Sequence
ARFRKVDVGEYDENKFVDEEDGGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
total genus 41
structure length 137
sequence length 142
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3dxmG00
2P9PG 2P9KG 2P9SG 3RSEG 2P9IG 2P9NG 2P9LG 3ULEG 1U2VG 3DXMG 3UKUG 3DXKG 4XEIG 4JD2G 2P9UG 1K8KG 3UKRG 3DWLG 1TYQG
chains in the Genus database with same CATH superfamily
3B7BA 4J8SA 2X6IA 1N4PA 3MCXA 4UWHA 2X6HA 1DCQA 5LCWJ 3L13A 2B0OE 3ZYQA 5FINA 3QOUA 3QWPA 3S7FA 2F37A 4U96D 3DPDA 4O1PA 5FTPA 1OCOE 4OVVA 3ISMC 4NIKA 5HKPA 4IULA 3RRNB 2ONDA 3CVUA 4BSXA 2GRMA 4PS7A 3SBTB 3MA5A 3U4TA 4AP2A 3D9NA 3ZYKA 1KT0A 2VTBB 3Q7FA 3T5XA 4XE0A 1ELRA 1FPPA 3PZ1A 5FJYA 3D9IA 4A1SA 3N71A 1H19A 1SZAA 2LNIA 2AJAA 2I1JA 4GTQA 2A5UA 2WXFA 3SI5A 3VTYA 4HQDA 1NA3A 2H6IA 4NRHB 3Q49B 1OT8A 2HYZA 2RFMA 2UWJG 4AXHA 4ANWA 2XEEA 2BKKB 3UPVA 4PS8A 3PDNA 4C0MA 3L6AA 4DX1A 1DC2A 1FVFA 2AXVA 1E90A 5G55A 1UJJA 3TWUA 4BFRA 4CZ2D 3L9TA 3T8MA 5EYPF 3B13A 1UW4B 1Y8MA 3FTXA 2OVFA 5B3SE 2P9SG 3D9HA 3MV3B 4JB8P 1WG0A 2ETBA 1HO8A 2VSXE 2H6FA 4XI9A 4HORA 4U8HA 1BU9A 2ETAA 1KT1A 3FUKA 5E75A 1U3CA 1OCRE 3QC1A 2XS1A 5EDSA 5CEAA 3U64A 5G04C 4JEUA 1N4RA 2L9BA 4URKA 2DCPA 1SA5A 1FT1A 4U8YD 3SHFA 5LFAA 4HBDA 4YVQC 2Y0BG 4FADA 2KC7A 1N0QA 4FJYA 2FEZA 2XEVA 4JHJA 2AWIA 3FUMA 4DLOA 3G2TA 5EIBE 4NACA 1Z3XA 1TR4A 4WUYA 1OWLA 1TYQG 4G1TA 2XQ0A 2L6JA 4DJAA 2LAHA 1TNYA 1VDYA 4YVOA 2EIKE 2MHKA 1ELKA 3OXGA 1DVPA 5ENPD 5JJTA 3URZA 4ANXA 2VSOE 3CVLA 2WQ6A 1NFIE 2NC9A 5AQAA 2XS8A 1WDYA 3NAWA 2RG8A 2CG2A 2VTBA 3E30A 4ILIA 2Y3AA 2P9PG 3I4RB 4RQIA 3NB2A 1TNUA 3V2OA 4D10C 1HF8A 3ZYMA 5ENSD 3GZ2A 1K8KG 3C98A 4Y6CA 2GRRB 3B7SA 1WAO1 4BT9A 3ZGQA 3ASOE 4UQYA 4O60A 4KT6B 3TJPA 1OUVA 4I9CA 4V3IA 2XZDG 1E8WA 4FHJA 4GAAA 3QJZA 1N95A 2XHEA 4DLQA 3T8KA 4BEPA 2BF0X 4B94A 3PE3A 4L7TA 1V54E 4TV3A 1OWNA 1P5QA 4GPKA 2LSUA 1K1AA 3MKQB 3ML8A 1HG5A 1TN6A 2J49A 2YQ8A 2H6HA 2XEHA 2VSNA 2E0IA 1NP7A 3ZIMA 5D0OD 1ELWA 3ZKJA 3KSQA 3HVEB 2QFCA 1DNPA 3WG7E 4DK5A 1JCQA 3HDXA 3G2SA 3ULEG 3LY8A 5CRUA 4FHKA 4J7WA 3D9OA 4ANVA 3FY4A 4DUIA 2XRZA 3G2VA 4N3CA 4ACKA 4DX6D 3MEKA 2FF4A 1BI8B 1N4SA 2Y69E 4PUCA 4B0ZA 4ATZD 3PE4A 1PY1A 2P9KG 1E96B 3RAUA 4C48B 5LX8A 1MX6A 5EX0A 4QFVA 4L2LA 4ME2A 3B7TA 4PS3A 1QNFA 1IQUA 1HFAA 3AU5A 4AM9A 3FP3A 3DSUA 4F6RD 4P29A 4EHMA 2XPIA 3ABKE 4U7EB 1OWOA 4G25A 3SFZA 3TWQA 5J08A 3ZW3A 2DZNA 4JHRA 5CHEE 3UQ3A 4BERA 1G3NB 5A23A 5BV1A 5G04J 3PUJA 3S7BA 3UM2A 3LVQE 1IXVA 4K03A 4WNGA 2XZTG 4E6HA 3QB2A 3S7JA 3UT8A 2LUHA 3SO8A 4MS6A 3JQ1A 4ABNA 4TUMA 4G23A 5CCMA 2ZXWE 3RRUA 3T5VA 3FULA 4HLLA 2QC9A 3J5QB 1TNZA 4HOSA 4GZ5A 1D8EA 2DVWA 1NZNA 4ZHBA 3CVXA 3CK8A 3JYSA 5FIOA 5G2NA 1MZCA 4KBQA 4FU3A 3C72A 3OXFA 3MX3A 2NSZA 2XGOA 3PZDA 3FTUA 4N3AA 4IRUA 3G2UA 4GYWA 3CHOA 4G8KA 1L5JA 4A1GA 1D9SA 5H7PA 1AP7A 1KLXA 4GB9A 4GTMA 4KVOA 3R9AB 4WWNA 5KBAA 3EDTB 4GU5A 4RSYA 2EQXA 3R7QA 5CBNA 5HQ8A 3HVEA 1XNFA 4I6JA 3LS8A 4NURA 3UM0A 4EZKA 5DIZA 5KCMA 4GA0A 2F0YA 3O48A 3QAQA 2WPVA 3C3OA 2IOSA 3FU5A 1OY3D 2KM4A 3FH5A 4DX5D 2DYRE 5ARFA 3DWLG 2VJ8A 4DI4A 4GCOA 3S7DA 4G2VA 2P9IG 4I17A 2WXGA 4XIFA 3PEVB 1K1BA 1MYOA 1HE8A 4F1SA 4L23A 1A5EA 3DPYA 3LY9A 5EN5D 3ASGA 4HI8A 5AENA 4YDWA 5AQBA 4Q69A 3HHMA 5T8IA 4GTRA 5T4YA 3BUAA 5KJMA 3EIQC 4JPSA 4HXIA 2HE0A 3LPZA 3HXBA 3B7RL 3MV2B 3QWVA 4LNBA 3DEOA 2WXMA 3RSEG 3DXMG 4U04A 1LTXA 3ZNGA 2WXQA 3PNTB 3CSTA 5FQ7A 4F3VA 2IY0C 4JZYA 1TN7A 4Y6WA 4G8LA 2V8SE 4JC8A 5KWDA 2HO1A 2ZISA 4CGWA 3NOCD 3O4ZA 1IYGA 3LEWA 4RG9A 4L9PA 5AQ7A 3FWVA 4KMOA 2P58C 2JLBA 2KCVA 3ML9A 2AXUA 3I5PA 4W9RA 1TJFA 3P2BA 4K0RA 3SGHA 2WXHA 2R59A 1H6PA 4DRXE 2R03A 4EZJA 4ZFHA 1TN8A 3MYVA 3ULQA 4DX2A 5CMWA 3TWXA 1FVHA 3D9MA 2GROB 4JA7A 3NZUA 2P2CP 2KXPC 2EILE 4WNFA 4BY6A 5BNWA 3CVPA 3JUIA 1N52A 1E7VA 3CK9A 4YDYA 1MHQA 4I6EA 5BPPA 1H6OA 5KNHD 4I6GA 4YDEA 2UY1B 1MX4A 1O1RA 3NZSA 2X3MA 3CSFA 3E34A 3UUXA 4JW1A 4RVBA 3ASFA 1TEZA 3AG4E 4AVXA 4MBGA 4EPZA 4B89A 4HOUA 3UMVA 4GZ6A 3FU6A 1WM5A 4I1AA 3CVNA 4GTPA 2P9UG 3ESKA 4LG6A 3SY2A 4J8YA 5KJKA 1NA0A 4CT0A 3G2WA 1O1TA 3RRMB 1IQRA 2A5EA 1H2UA 3JCKC 4HB5A 4TXQA 2PL2A 3FUEA 3RO3A 5FQ4A 2KCKA 3ONKA 2VSYA 3AJIA 2R02A 2WXRA 3Q9NC 3SD5A 4N2SA 1IKND 2LO6A 4MRUA 2BEDA 2GGFA 3FTVA 2NYJA 4U07A 3DSTA 4L1BA 3KEAA 3V2XA 2DWZA 2YHCA 3TWWA 4HNAD 3LYAA 3OXLA 1MQSA 3SFYA 1Q2ZA 3ASHA 3ASNE 3FTWA 3IKOB 5A6CA 3CHSA 3W9GA 1MJ0A 4I2ZA 5BXOA 1V55E 3IV0A 1MX2A 2I9CA 1N11A 2VGEA 4CRWA 3D9PA 3B7UX 3KEZA 3FDHA 5KJNA 5BXUA 5EX3A 3RK6A 3SZ7A 3AU4A 3Q5MA 3CQGB 2OOEA 3LY7A 2I1KA 2R5SA 4EBAG 3U3WA 3Q9UC 4TXRA 1SW6A 5ENNA 4GPMA 2AW6A 5E76A 3PZ4A 1HG2A 4B8CB 5ENOD 3KAEA 4K5CA 3GW4A 1FCHA 3LCAA 1SVXA 2WXKA 3AS5A 4GZ3A 5CECB 3QWWA 2X6JA 3JXIA 3PEUB 2XCCA 1HZ4A 4UQXA 1H6KA 2GRQB 5C2YA 4OAUC 3MKRA 3PREA 3UT4A 5ENQD 5AJDA 4JD2G 5ANLA 2UY1A 1B89A 3NBNB 1E8XA 3J5PA 4EZLA 3BU8A 3UKRG 1FT2A 2VQ2A 1H0AA 3VLFA 2ZGDA 4EQFA 3Q47B 4UQZA 2QYJA 2KCLA 3CVYA 4WNDA 1TNBA 4U63A 5ARGA 1K3ZD 3QNKA 4GMJA 3V30A 1KZOA 5CCLA 5BV0A 4PH4B 3CIAA 4GZCA 1GW6A 3DSWA 1HS6A 2P9NG 4KVMA 3TWRA 2IO3C 4XZ4A 2M63A 1UN9A 1JCSA 1IHGA 2HR2A 2PM7A 3UIOC 4BX8A 4FJZA 5CRVA 5LP0A 3OTNA 4R7LA 2X6KA 3GZSA 2J4DA 2AVPA 2EINE 3TL5A 4N2QA 5AJLA 2WQHA 3FHEA 1E8YA 5BT1A 5IY5E 4XI0A 5CMYA 2R05A 4GA2A 1KPSB 4GMRA 2VGXB 3IHYA 3EU9A 3L54A 1Y6IA 2YINA 3APFA 2BKGA 3HXFA 2OVBA 3ULYA 4KXKB 2IF4A 4ANUA 1W3BA 1E7UA 5B1AE 5B1BE 4AJWA 3ZPJA 2CFZA 2DYSE 1N0RA 3FTSA 1HU3A 2GW1A 3CHRA 3Q4AB 2OV8A 1S70B 5BW8C 4H7YA 5HS0A 5D2MC 3AG3E 3EHNA 2FO1E 1DCEA 4GTVA 4XX5A 3EU5A 4Q94A 4CCAA 2WXOA 3AG2E 4CDMA 4WWOA 3EHMA 1Z5SC 1U2VG 3E32A 2RFAA 2E2EA 2CG3A 2V5QC 5EYLA 1A17A 4U0ZA 2L0IA 4WNEA 2LSVA 3MKQA 5AYWD 2KATA 4BX9A 4I2WA 4N39A 3Q15A 2XRYA 2CHWA 4X8QA 3ZVVA 4GA1A 4XEIG 2EIJE 4HRNA 3AS4A 1JWGA 5FZSA 1O1SA 2WXNA 2L6BA 4GTSA 2XGSA 3RJVA 4UWGA 2LXLA 2WQ7A 4JA9A 2IFUA 3NOGD 4U0SA 1H2VC 2Y4TA 4HS2A 3PS6A 5FZRA 4G26A 5JA4D 4GYOA 4MLPA 4HVBA 1RW2A 5AIJA 2WXJA 3TWVA 2WXIA 2PNNA 4CT4A 3DSSA 5JHAA 2NXPA 4HOQA 3RIBA 3OAWA 1SQMA 4YNDA 3UKUG 3T9KA 4WAFA 1RZ4A 3CLJA 3KSLA 1OCZE 4KYOB 5EKQD 4UI9C 4AIFA 4BSZB 3SFXA 4BWRA 4Z68A 5AN8A 4HOTA 2OEWA 1Z3YA 2GRNB 2ZIRA 3F6QA 2WMOA 2XGMA 3DSVA 5FZQA 1YA0A 5LOZA 3PUKA 3LJNA 4FULA 1JWFA 1BLXB 3CK7A 3ABME 3RO2A 4GCNA 5CBOA 2J08A 3L22A 1SZ9A 5J90A 2F8YA 4AEZC 1Z6TA 3CHPA 4O1OA 4FA6A 4LEUA 4JVSA 3CVQA 5JHBA 3BQOA 4C0EA 2IU1A 4LERA 5JMND 1LD8A 3S2AA 3Q78A 3D9KA 2WVIA 1BI7B 3UT7A 2KZTB 4WWPA 3TAXA 4DPRA 3ZFWA 4APFA 1EF1C 2J09A 3L16A 2J8SD 1S64A 4F1PA 2A4ZA 4Q96A 3KS2A 1ZU2A 2WXPA 1JUQA 4OYSA 4APOA 3UM1A 4ILGA 3D9LA 2C2LA 5M72A 4U0UA 3ZHEB 3V79K 3D3MA 3ZRHA 4AY5A 3CR3A 2X6FA 4J0UA 2I6HA 1E8ZA 1QBQA 2PQNA 3ZXSA 3TG4A 1EYHA 3X2QE 3CEQA 4A55A 3CKBA 4DX7D 1HH8A 1NL4A 3C3RA 3EIJA 1AWCB 3SBSA 3CQCB 1N94A 3GZ1A 3L17A 3QKYA 3HIZA 3ABLE 2DZOA 3TGOA 4H7XA 3ZYLA 3L82A 1OWMA 3PNLB 2XPZA 2WXLA 3APCA 1BD8A 4LNUD 2JABA 4A63B 4FLBA 2IJGX 3UINC 3D9JA 2EIME 3MGBA 4FLHA 5CERB 3AG1E 5G05C 4HLEA 4QQIA 4B8AA 1IHBA 3ONLA 5ANRA 2IOLA 2ZU6B 3HYMB 3UTMA 4JXTA 3TXNA 4FP7A 3FUJA 2PM6A 1LF8A 1N4QA 2IONA 3CVVA 3HG0D 4HFGA 3IBEA 3FH8A 2PQRA 2FO7A 4HI9A 3R7RA 3PRZA 5CEDB 1QYMA 3WXXA 4CYMD 2WM9A 4XKBA 1H2TC 3BG1B 4UI9J 2XCBA 2V4HC 2BUGA 4I1MA 3ZEFA 2FULA 4EBAA 4CEMA 2KZTA 5AQ9A 5D66A 2ZGGA 3FFLA 4BTBA 3E37A 2YHEA 4GMLA 1ZBPA 3LVRE 2CFUA 3E33A 4J8DA 3UIPC 3U9WA 3EHRA 3FTYA 3TWTA 3FTZA 2L0TB 3CHMA 4L2YA 4ACLA 3Q73A 4GTOA 2BTDA 3C5RA 2AXZA 1EDUA 4UUCA 4LRZA 1PC2A 3ZHEA 1S0PA 5EILA 3GYZA 5BUZA 4LSZE 1XGWA 1WY6A 2JEKA 4YDOA 4CDRA 1N9AA 4JEHA 5C1DA 4N5QA 3HRAA 4TUUA 1UN8A 2DBAA 2R2LA 4A3VA 3ZN3A 3FUFA 4OVUA 3LXUX 2DIWA 2FBNA 5FT9A 3DEPA 4OAVB 3FU3A 4HRMB 3RU0A 2MYOA 3Q79A 1N54A 3DRAA 4U8VD 3UXGA 5ITZF 3HXDA 4AOFA 2GRLA 4LNGA 3U66A 5EIDA 3HXCA 3CV0A 3FEXA 3HXEA 4BESA 4M3OA 3IEGA 4HRLA 4F53A 4LCTA 1QZ2A 3VTXA 5FWQA 1YCSB 4XKCA 2Y1LE 1D8DA 4C9BB 4N3BA 3DBSA 3B95A 3NQPA 1YYHA 1KZPA 2Q7FA 5AARA 3EUVA 2KBXA 4UWFA 3E4BA 4J6IA 2QY7A 3CHQA 2ILRA 4M7CA 1EPUA 3IHVA 3FUNA 1X81A 2LAIA 2J4BA 2WB2A 4E85A 3LJ3A 5LCWC 2IQCA 4K5AB 3IXEA 1UG3A 3FUIA 1LD7A 4UI9K 5FQ6A 3LDZA 2VGYA 4I43A 4EECA 2R17C 1JCRA 2X38A 5A7DB 2V0PA 4J8EA 3ENEA 2XENA 3DXKG 4CDNA 5G05J 3MZLB 2OCCE 2C0MA 3FUDA 4KZ0A 4JL0A 1JPLA 3CGHA 3NF1A 4F7AA 2QZAA 2J9QA 1UOHA 2PZIA 3AAAC 1UJKA 1O5MA 2H6GA 4BETA 2QYUA 3ZU7B 1QQEA 2CHZA 1OWPA 2MOWA 2XPYA 2F8XK 4ILHB 4ATGA 4B93B 3FUHA 3W9FA 4AY6A 3PVLA 3TG5A 3EJNA 2MRIA 3DSXA 4TRQA 4U95D 4FC8A 3JXJA 2VYIA 1PAQA 2V4LA 2IO2C 1INZA 4N5CA 1OCCE 4J8FA 5T3RA 3K9IA 4UWLA 3I4GA 4KZCA 5HI7A 2V5FA 3R9MA 4IYPA 1HXIA 5AAOA 2Y4UA 1NI1A 3ASDA 1TJCA 2GRPB 4TXPA 3MJWA 3CKCA 2P9LG 3ZUVB 2I2OA 3BG0B 5FQ8A 3EHQA 3JQ0A 2WMNA 4LUNU 5ENTD 1OXJA 3QDNA 3ZXPA 5ENRD 4G11A 3FEYA 1S63A 3L08A 4RG6A 1TNOA 1HX8A 5KJLA 1SA4A 3PH0C 3SNXA 2FI7A 4A3TA 3ESLA 3TWSA 2CHXA 3FU0A 3VLDA 2J07A 4I1OB 4IN3B 3UI2A 3CVWA 4UWKA 2RD0A 2YNQA 4PDXA 1BPOA 4G24A 3PZ3A 3JUEA 4AV7A 2RKKA 3Q75A 4GTTA 3UX4A 3P1UA 4BTAA 3PZ2A 1ZB1A 3Q7AA 4CGVA 2C0LA 1X5BA 4O6FA 5JJ7A 3SF4A 2LXMA 3RKVA 3I3NA 3BEEA 3C3QA 5D0QD 3APDA 3TXMA 3KD7A 5HRYA 3FH7A 3UM3A 2VGXA 4JHKA 1U3DA 2IEJA 4DI3A 4BT8A 2OEVA 5JJ6A 3SQVA 4I9EA 3V31A 4MKTA 3VLEA 5KNGA 4NQ0A 2ETCA 2B6CA 4GYYA 4K5BA 3AS8A 3QK0A 2HM8A 1YMPA 5DBKA 3QARA 4RLYA 3LKUA 4GZDA
chains in the Genus database with same CATH topology
2P9PG 2P9KG 2P9SG 3RSEG 2P9IG 2P9NG 2P9LG 3ULEG 1U2VG 3DXMG 3UKUG 3DXKG 4XEIG 4JD2G 2P9UG 1K8KG 3UKRG 3DWLG 1TYQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P G;  2P9K G;  2P9S G;  3RSE G;  2P9I G;  2P9N G;  2P9L G;  3ULE G;  1U2V G;  3DXM G;  3UKU G;  3DXK G;  4XEI G;  4JD2 G;  2P9U G;  1K8K G;  3UKR G;  3DWL G;  1TYQ G; 
#chains in the Genus database with same CATH topology
 3B7B A;  4J8S A;  2X6I A;  1N4P A;  3MCX A;  4UWH A;  2X6H A;  1DCQ A;  5LCW J;  3L13 A;  2B0O E;  3ZYQ A;  5FIN A;  3QOU A;  3QWP A;  3S7F A;  2F37 A;  4U96 D;  3DPD A;  4O1P A;  5FTP A;  1OCO E;  4OVV A;  3ISM C;  4NIK A;  5HKP A;  4IUL A;  3RRN B;  2OND A;  3CVU A;  4BSX A;  2GRM A;  4PS7 A;  3SBT B;  3MA5 A;  3U4T A;  4AP2 A;  3D9N A;  3ZYK A;  1KT0 A;  2VTB B;  3Q7F A;  3T5X A;  4XE0 A;  1ELR A;  1FPP A;  3PZ1 A;  5FJY A;  3D9I A;  4A1S A;  3N71 A;  1H19 A;  1SZA A;  2LNI A;  2AJA A;  2I1J A;  4GTQ A;  2A5U A;  2WXF A;  3SI5 A;  3VTY A;  4HQD A;  1NA3 A;  2H6I A;  4NRH B;  3Q49 B;  1OT8 A;  2HYZ A;  2RFM A;  2UWJ G;  4AXH A;  4ANW A;  2XEE A;  2BKK B;  3UPV A;  4PS8 A;  3PDN A;  4C0M A;  3L6A A;  4DX1 A;  1DC2 A;  1FVF A;  2AXV A;  1E90 A;  5G55 A;  1UJJ A;  3TWU A;  4BFR A;  4CZ2 D;  3L9T A;  3T8M A;  5EYP F;  3B13 A;  1UW4 B;  1Y8M A;  3FTX A;  2OVF A;  5B3S E;  2P9S G;  3D9H A;  3MV3 B;  4JB8 P;  1WG0 A;  2ETB A;  1HO8 A;  2VSX E;  2H6F A;  4XI9 A;  4HOR A;  4U8H A;  1BU9 A;  2ETA A;  1KT1 A;  3FUK A;  5E75 A;  1U3C A;  1OCR E;  3QC1 A;  2XS1 A;  5EDS A;  5CEA A;  3U64 A;  5G04 C;  4JEU A;  1N4R A;  2L9B A;  4URK A;  2DCP A;  1SA5 A;  1FT1 A;  4U8Y D;  3SHF A;  5LFA A;  4HBD A;  4YVQ C;  2Y0B G;  4FAD A;  2KC7 A;  1N0Q A;  4FJY A;  2FEZ A;  2XEV A;  4JHJ A;  2AWI A;  3FUM A;  4DLO A;  3G2T A;  5EIB E;  4NAC A;  1Z3X A;  1TR4 A;  4WUY A;  1OWL A;  1TYQ G;  4G1T A;  2XQ0 A;  2L6J A;  4DJA A;  2LAH A;  1TNY A;  1VDY A;  4YVO A;  2EIK E;  2MHK A;  1ELK A;  3OXG A;  1DVP A;  5ENP D;  5JJT A;  3URZ A;  4ANX A;  2VSO E;  3CVL A;  2WQ6 A;  1NFI E;  2NC9 A;  5AQA A;  2XS8 A;  1WDY A;  3NAW A;  2RG8 A;  2CG2 A;  2VTB A;  3E30 A;  4ILI A;  2Y3A A;  2P9P G;  3I4R B;  4RQI A;  3NB2 A;  1TNU A;  3V2O A;  4D10 C;  1HF8 A;  3ZYM A;  5ENS D;  3GZ2 A;  1K8K G;  3C98 A;  4Y6C A;  2GRR B;  3B7S A;  1WAO 1;  4BT9 A;  3ZGQ A;  3ASO E;  4UQY A;  4O60 A;  4KT6 B;  3TJP A;  1OUV A;  4I9C A;  4V3I A;  2XZD G;  1E8W A;  4FHJ A;  4GAA A;  3QJZ A;  1N95 A;  2XHE A;  4DLQ A;  3T8K A;  4BEP A;  2BF0 X;  4B94 A;  3PE3 A;  4L7T A;  1V54 E;  4TV3 A;  1OWN A;  1P5Q A;  4GPK A;  2LSU A;  1K1A A;  3MKQ B;  3ML8 A;  1HG5 A;  1TN6 A;  2J49 A;  2YQ8 A;  2H6H A;  2XEH A;  2VSN A;  2E0I A;  1NP7 A;  3ZIM A;  5D0O D;  1ELW A;  3ZKJ A;  3KSQ A;  3HVE B;  2QFC A;  1DNP A;  3WG7 E;  4DK5 A;  1JCQ A;  3HDX A;  3G2S A;  3ULE G;  3LY8 A;  5CRU A;  4FHK A;  4J7W A;  3D9O A;  4ANV A;  3FY4 A;  4DUI A;  2XRZ A;  3G2V A;  4N3C A;  4ACK A;  4DX6 D;  3MEK A;  2FF4 A;  1BI8 B;  1N4S A;  2Y69 E;  4PUC A;  4B0Z A;  4ATZ D;  3PE4 A;  1PY1 A;  2P9K G;  1E96 B;  3RAU A;  4C48 B;  5LX8 A;  1MX6 A;  5EX0 A;  4QFV A;  4L2L A;  4ME2 A;  3B7T A;  4PS3 A;  1QNF A;  1IQU A;  1HFA A;  3AU5 A;  4AM9 A;  3FP3 A;  3DSU A;  4F6R D;  4P29 A;  4EHM A;  2XPI A;  3ABK E;  4U7E B;  1OWO A;  4G25 A;  3SFZ A;  3TWQ A;  5J08 A;  3ZW3 A;  2DZN A;  4JHR A;  5CHE E;  3UQ3 A;  4BER A;  1G3N B;  5A23 A;  5BV1 A;  5G04 J;  3PUJ A;  3S7B A;  3UM2 A;  3LVQ E;  1IXV A;  4K03 A;  4WNG A;  2XZT G;  4E6H A;  3QB2 A;  3S7J A;  3UT8 A;  2LUH A;  3SO8 A;  4MS6 A;  3JQ1 A;  4ABN A;  4TUM A;  4G23 A;  5CCM A;  2ZXW E;  3RRU A;  3T5V A;  3FUL A;  4HLL A;  2QC9 A;  3J5Q B;  1TNZ A;  4HOS A;  4GZ5 A;  1D8E A;  2DVW A;  1NZN A;  4ZHB A;  3CVX A;  3CK8 A;  3JYS A;  5FIO A;  5G2N A;  1MZC A;  4KBQ A;  4FU3 A;  3C72 A;  3OXF A;  3MX3 A;  2NSZ A;  2XGO A;  3PZD A;  3FTU A;  4N3A A;  4IRU A;  3G2U A;  4GYW A;  3CHO A;  4G8K A;  1L5J A;  4A1G A;  1D9S A;  5H7P A;  1AP7 A;  1KLX A;  4GB9 A;  4GTM A;  4KVO A;  3R9A B;  4WWN A;  5KBA A;  3EDT B;  4GU5 A;  4RSY A;  2EQX A;  3R7Q A;  5CBN A;  5HQ8 A;  3HVE A;  1XNF A;  4I6J A;  3LS8 A;  4NUR A;  3UM0 A;  4EZK A;  5DIZ A;  5KCM A;  4GA0 A;  2F0Y A;  3O48 A;  3QAQ A;  2WPV A;  3C3O A;  2IOS A;  3FU5 A;  1OY3 D;  2KM4 A;  3FH5 A;  4DX5 D;  2DYR E;  5ARF A;  3DWL G;  2VJ8 A;  4DI4 A;  4GCO A;  3S7D A;  4G2V A;  2P9I G;  4I17 A;  2WXG A;  4XIF A;  3PEV B;  1K1B A;  1MYO A;  1HE8 A;  4F1S A;  4L23 A;  1A5E A;  3DPY A;  3LY9 A;  5EN5 D;  3ASG A;  4HI8 A;  5AEN A;  4YDW A;  5AQB A;  4Q69 A;  3HHM A;  5T8I A;  4GTR A;  5T4Y A;  3BUA A;  5KJM A;  3EIQ C;  4JPS A;  4HXI A;  2HE0 A;  3LPZ A;  3HXB A;  3B7R L;  3MV2 B;  3QWV A;  4LNB A;  3DEO A;  2WXM A;  3RSE G;  3DXM G;  4U04 A;  1LTX A;  3ZNG A;  2WXQ A;  3PNT B;  3CST A;  5FQ7 A;  4F3V A;  2IY0 C;  4JZY A;  1TN7 A;  4Y6W A;  4G8L A;  2V8S E;  4JC8 A;  5KWD A;  2HO1 A;  2ZIS A;  4CGW A;  3NOC D;  3O4Z A;  1IYG A;  3LEW A;  4RG9 A;  4L9P A;  5AQ7 A;  3FWV A;  4KMO A;  2P58 C;  2JLB A;  2KCV A;  3ML9 A;  2AXU A;  3I5P A;  4W9R A;  1TJF A;  3P2B A;  4K0R A;  3SGH A;  2WXH A;  2R59 A;  1H6P A;  4DRX E;  2R03 A;  4EZJ A;  4ZFH A;  1TN8 A;  3MYV A;  3ULQ A;  4DX2 A;  5CMW A;  3TWX A;  1FVH A;  3D9M A;  2GRO B;  4JA7 A;  3NZU A;  2P2C P;  2KXP C;  2EIL E;  4WNF A;  4BY6 A;  5BNW A;  3CVP A;  3JUI A;  1N52 A;  1E7V A;  3CK9 A;  4YDY A;  1MHQ A;  4I6E A;  5BPP A;  1H6O A;  5KNH D;  4I6G A;  4YDE A;  2UY1 B;  1MX4 A;  1O1R A;  3NZS A;  2X3M A;  3CSF A;  3E34 A;  3UUX A;  4JW1 A;  4RVB A;  3ASF A;  1TEZ A;  3AG4 E;  4AVX A;  4MBG A;  4EPZ A;  4B89 A;  4HOU A;  3UMV A;  4GZ6 A;  3FU6 A;  1WM5 A;  4I1A A;  3CVN A;  4GTP A;  2P9U G;  3ESK A;  4LG6 A;  3SY2 A;  4J8Y A;  5KJK A;  1NA0 A;  4CT0 A;  3G2W A;  1O1T A;  3RRM B;  1IQR A;  2A5E A;  1H2U A;  3JCK C;  4HB5 A;  4TXQ A;  2PL2 A;  3FUE A;  3RO3 A;  5FQ4 A;  2KCK A;  3ONK A;  2VSY A;  3AJI A;  2R02 A;  2WXR A;  3Q9N C;  3SD5 A;  4N2S A;  1IKN D;  2LO6 A;  4MRU A;  2BED A;  2GGF A;  3FTV A;  2NYJ A;  4U07 A;  3DST A;  4L1B A;  3KEA A;  3V2X A;  2DWZ A;  2YHC A;  3TWW A;  4HNA D;  3LYA A;  3OXL A;  1MQS A;  3SFY A;  1Q2Z A;  3ASH A;  3ASN E;  3FTW A;  3IKO B;  5A6C A;  3CHS A;  3W9G A;  1MJ0 A;  4I2Z A;  5BXO A;  1V55 E;  3IV0 A;  1MX2 A;  2I9C A;  1N11 A;  2VGE A;  4CRW A;  3D9P A;  3B7U X;  3KEZ A;  3FDH A;  5KJN A;  5BXU A;  5EX3 A;  3RK6 A;  3SZ7 A;  3AU4 A;  3Q5M A;  3CQG B;  2OOE A;  3LY7 A;  2I1K A;  2R5S A;  4EBA G;  3U3W A;  3Q9U C;  4TXR A;  1SW6 A;  5ENN A;  4GPM A;  2AW6 A;  5E76 A;  3PZ4 A;  1HG2 A;  4B8C B;  5ENO D;  3KAE A;  4K5C A;  3GW4 A;  1FCH A;  3LCA A;  1SVX A;  2WXK A;  3AS5 A;  4GZ3 A;  5CEC B;  3QWW A;  2X6J A;  3JXI A;  3PEU B;  2XCC A;  1HZ4 A;  4UQX A;  1H6K A;  2GRQ B;  5C2Y A;  4OAU C;  3MKR A;  3PRE A;  3UT4 A;  5ENQ D;  5AJD A;  4JD2 G;  5ANL A;  2UY1 A;  1B89 A;  3NBN B;  1E8X A;  3J5P A;  4EZL A;  3BU8 A;  3UKR G;  1FT2 A;  2VQ2 A;  1H0A A;  3VLF A;  2ZGD A;  4EQF A;  3Q47 B;  4UQZ A;  2QYJ A;  2KCL A;  3CVY A;  4WND A;  1TNB A;  4U63 A;  5ARG A;  1K3Z D;  3QNK A;  4GMJ A;  3V30 A;  1KZO A;  5CCL A;  5BV0 A;  4PH4 B;  3CIA A;  4GZC A;  1GW6 A;  3DSW A;  1HS6 A;  2P9N G;  4KVM A;  3TWR A;  2IO3 C;  4XZ4 A;  2M63 A;  1UN9 A;  1JCS A;  1IHG A;  2HR2 A;  2PM7 A;  3UIO C;  4BX8 A;  4FJZ A;  5CRV A;  5LP0 A;  3OTN A;  4R7L A;  2X6K A;  3GZS A;  2J4D A;  2AVP A;  2EIN E;  3TL5 A;  4N2Q A;  5AJL A;  2WQH A;  3FHE A;  1E8Y A;  5BT1 A;  5IY5 E;  4XI0 A;  5CMY A;  2R05 A;  4GA2 A;  1KPS B;  4GMR A;  2VGX B;  3IHY A;  3EU9 A;  3L54 A;  1Y6I A;  2YIN A;  3APF A;  2BKG A;  3HXF A;  2OVB A;  3ULY A;  4KXK B;  2IF4 A;  4ANU A;  1W3B A;  1E7U A;  5B1A E;  5B1B E;  4AJW A;  3ZPJ A;  2CFZ A;  2DYS E;  1N0R A;  3FTS A;  1HU3 A;  2GW1 A;  3CHR A;  3Q4A B;  2OV8 A;  1S70 B;  5BW8 C;  4H7Y A;  5HS0 A;  5D2M C;  3AG3 E;  3EHN A;  2FO1 E;  1DCE A;  4GTV A;  4XX5 A;  3EU5 A;  4Q94 A;  4CCA A;  2WXO A;  3AG2 E;  4CDM A;  4WWO A;  3EHM A;  1Z5S C;  1U2V G;  3E32 A;  2RFA A;  2E2E A;  2CG3 A;  2V5Q C;  5EYL A;  1A17 A;  4U0Z A;  2L0I A;  4WNE A;  2LSV A;  3MKQ A;  5AYW D;  2KAT A;  4BX9 A;  4I2W A;  4N39 A;  3Q15 A;  2XRY A;  2CHW A;  4X8Q A;  3ZVV A;  4GA1 A;  4XEI G;  2EIJ E;  4HRN A;  3AS4 A;  1JWG A;  5FZS A;  1O1S A;  2WXN A;  2L6B A;  4GTS A;  2XGS A;  3RJV A;  4UWG A;  2LXL A;  2WQ7 A;  4JA9 A;  2IFU A;  3NOG D;  4U0S A;  1H2V C;  2Y4T A;  4HS2 A;  3PS6 A;  5FZR A;  4G26 A;  5JA4 D;  4GYO A;  4MLP A;  4HVB A;  1RW2 A;  5AIJ A;  2WXJ A;  3TWV A;  2WXI A;  2PNN A;  4CT4 A;  3DSS A;  5JHA A;  2NXP A;  4HOQ A;  3RIB A;  3OAW A;  1SQM A;  4YND A;  3UKU G;  3T9K A;  4WAF A;  1RZ4 A;  3CLJ A;  3KSL A;  1OCZ E;  4KYO B;  5EKQ D;  4UI9 C;  4AIF A;  4BSZ B;  3SFX A;  4BWR A;  4Z68 A;  5AN8 A;  4HOT A;  2OEW A;  1Z3Y A;  2GRN B;  2ZIR A;  3F6Q A;  2WMO A;  2XGM A;  3DSV A;  5FZQ A;  1YA0 A;  5LOZ A;  3PUK A;  3LJN A;  4FUL A;  1JWF A;  1BLX B;  3CK7 A;  3ABM E;  3RO2 A;  4GCN A;  5CBO A;  2J08 A;  3L22 A;  1SZ9 A;  5J90 A;  2F8Y A;  4AEZ C;  1Z6T A;  3CHP A;  4O1O A;  4FA6 A;  4LEU A;  4JVS A;  3CVQ A;  5JHB A;  3BQO A;  4C0E A;  2IU1 A;  4LER A;  5JMN D;  1LD8 A;  3S2A A;  3Q78 A;  3D9K A;  2WVI A;  1BI7 B;  3UT7 A;  2KZT B;  4WWP A;  3TAX A;  4DPR A;  3ZFW A;  4APF A;  1EF1 C;  2J09 A;  3L16 A;  2J8S D;  1S64 A;  4F1P A;  2A4Z A;  4Q96 A;  3KS2 A;  1ZU2 A;  2WXP A;  1JUQ A;  4OYS A;  4APO A;  3UM1 A;  4ILG A;  3D9L A;  2C2L A;  5M72 A;  4U0U A;  3ZHE B;  3V79 K;  3D3M A;  3ZRH A;  4AY5 A;  3CR3 A;  2X6F A;  4J0U A;  2I6H A;  1E8Z A;  1QBQ A;  2PQN A;  3ZXS A;  3TG4 A;  1EYH A;  3X2Q E;  3CEQ A;  4A55 A;  3CKB A;  4DX7 D;  1HH8 A;  1NL4 A;  3C3R A;  3EIJ A;  1AWC B;  3SBS A;  3CQC B;  1N94 A;  3GZ1 A;  3L17 A;  3QKY A;  3HIZ A;  3ABL E;  2DZO A;  3TGO A;  4H7X A;  3ZYL A;  3L82 A;  1OWM A;  3PNL B;  2XPZ A;  2WXL A;  3APC A;  1BD8 A;  4LNU D;  2JAB A;  4A63 B;  4FLB A;  2IJG X;  3UIN C;  3D9J A;  2EIM E;  3MGB A;  4FLH A;  5CER B;  3AG1 E;  5G05 C;  4HLE A;  4QQI A;  4B8A A;  1IHB A;  3ONL A;  5ANR A;  2IOL A;  2ZU6 B;  3HYM B;  3UTM A;  4JXT A;  3TXN A;  4FP7 A;  3FUJ A;  2PM6 A;  1LF8 A;  1N4Q A;  2ION A;  3CVV A;  3HG0 D;  4HFG A;  3IBE A;  3FH8 A;  2PQR A;  2FO7 A;  4HI9 A;  3R7R A;  3PRZ A;  5CED B;  1QYM A;  3WXX A;  4CYM D;  2WM9 A;  4XKB A;  1H2T C;  3BG1 B;  4UI9 J;  2XCB A;  2V4H C;  2BUG A;  4I1M A;  3ZEF A;  2FUL A;  4EBA A;  4CEM A;  2KZT A;  5AQ9 A;  5D66 A;  2ZGG A;  3FFL A;  4BTB A;  3E37 A;  2YHE A;  4GML A;  1ZBP A;  3LVR E;  2CFU A;  3E33 A;  4J8D A;  3UIP C;  3U9W A;  3EHR A;  3FTY A;  3TWT A;  3FTZ A;  2L0T B;  3CHM A;  4L2Y A;  4ACL A;  3Q73 A;  4GTO A;  2BTD A;  3C5R A;  2AXZ A;  1EDU A;  4UUC A;  4LRZ A;  1PC2 A;  3ZHE A;  1S0P A;  5EIL A;  3GYZ A;  5BUZ A;  4LSZ E;  1XGW A;  1WY6 A;  2JEK A;  4YDO A;  4CDR A;  1N9A A;  4JEH A;  5C1D A;  4N5Q A;  3HRA A;  4TUU A;  1UN8 A;  2DBA A;  2R2L A;  4A3V A;  3ZN3 A;  3FUF A;  4OVU A;  3LXU X;  2DIW A;  2FBN A;  5FT9 A;  3DEP A;  4OAV B;  3FU3 A;  4HRM B;  3RU0 A;  2MYO A;  3Q79 A;  1N54 A;  3DRA A;  4U8V D;  3UXG A;  5ITZ F;  3HXD A;  4AOF A;  2GRL A;  4LNG A;  3U66 A;  5EID A;  3HXC A;  3CV0 A;  3FEX A;  3HXE A;  4BES A;  4M3O A;  3IEG A;  4HRL A;  4F53 A;  4LCT A;  1QZ2 A;  3VTX A;  5FWQ A;  1YCS B;  4XKC A;  2Y1L E;  1D8D A;  4C9B B;  4N3B A;  3DBS A;  3B95 A;  3NQP A;  1YYH A;  1KZP A;  2Q7F A;  5AAR A;  3EUV A;  2KBX A;  4UWF A;  3E4B A;  4J6I A;  2QY7 A;  3CHQ A;  2ILR A;  4M7C A;  1EPU A;  3IHV A;  3FUN A;  1X81 A;  2LAI A;  2J4B A;  2WB2 A;  4E85 A;  3LJ3 A;  5LCW C;  2IQC A;  4K5A B;  3IXE A;  1UG3 A;  3FUI A;  1LD7 A;  4UI9 K;  5FQ6 A;  3LDZ A;  2VGY A;  4I43 A;  4EEC A;  2R17 C;  1JCR A;  2X38 A;  5A7D B;  2V0P A;  4J8E A;  3ENE A;  2XEN A;  3DXK G;  4CDN A;  5G05 J;  3MZL B;  2OCC E;  2C0M A;  3FUD A;  4KZ0 A;  4JL0 A;  1JPL A;  3CGH A;  3NF1 A;  4F7A A;  2QZA A;  2J9Q A;  1UOH A;  2PZI A;  3AAA C;  1UJK A;  1O5M A;  2H6G A;  4BET A;  2QYU A;  3ZU7 B;  1QQE A;  2CHZ A;  1OWP A;  2MOW A;  2XPY A;  2F8X K;  4ILH B;  4ATG A;  4B93 B;  3FUH A;  3W9F A;  4AY6 A;  3PVL A;  3TG5 A;  3EJN A;  2MRI A;  3DSX A;  4TRQ A;  4U95 D;  4FC8 A;  3JXJ A;  2VYI A;  1PAQ A;  2V4L A;  2IO2 C;  1INZ A;  4N5C A;  1OCC E;  4J8F A;  5T3R A;  3K9I A;  4UWL A;  3I4G A;  4KZC A;  5HI7 A;  2V5F A;  3R9M A;  4IYP A;  1HXI A;  5AAO A;  2Y4U A;  1NI1 A;  3ASD A;  1TJC A;  2GRP B;  4TXP A;  3MJW A;  3CKC A;  2P9L G;  3ZUV B;  2I2O A;  3BG0 B;  5FQ8 A;  3EHQ A;  3JQ0 A;  2WMN A;  4LUN U;  5ENT D;  1OXJ A;  3QDN A;  3ZXP A;  5ENR D;  4G11 A;  3FEY A;  1S63 A;  3L08 A;  4RG6 A;  1TNO A;  1HX8 A;  5KJL A;  1SA4 A;  3PH0 C;  3SNX A;  2FI7 A;  4A3T A;  3ESL A;  3TWS A;  2CHX A;  3FU0 A;  3VLD A;  2J07 A;  4I1O B;  4IN3 B;  3UI2 A;  3CVW A;  4UWK A;  2RD0 A;  2YNQ A;  4PDX A;  1BPO A;  4G24 A;  3PZ3 A;  3JUE A;  4AV7 A;  2RKK A;  3Q75 A;  4GTT A;  3UX4 A;  3P1U A;  4BTA A;  3PZ2 A;  1ZB1 A;  3Q7A A;  4CGV A;  2C0L A;  1X5B A;  4O6F A;  5JJ7 A;  3SF4 A;  2LXM A;  3RKV A;  3I3N A;  3BEE A;  3C3Q A;  5D0Q D;  3APD A;  3TXM A;  3KD7 A;  5HRY A;  3FH7 A;  3UM3 A;  2VGX A;  4JHK A;  1U3D A;  2IEJ A;  4DI3 A;  4BT8 A;  2OEV A;  5JJ6 A;  3SQV A;  4I9E A;  3V31 A;  4MKT A;  3VLE A;  5KNG A;  4NQ0 A;  2ETC A;  2B6C A;  4GYY A;  4K5B A;  3AS8 A;  3QK0 A;  2HM8 A;  1YMP A;  5DBK A;  3QAR A;  4RLY A;  3LKU A;  4GZD A; 
#chains in the Genus database with same CATH homology
 2P9P G;  2P9K G;  2P9S G;  3RSE G;  2P9I G;  2P9N G;  2P9L G;  3ULE G;  1U2V G;  3DXM G;  3UKU G;  3DXK G;  4XEI G;  4JD2 G;  2P9U G;  1K8K G;  3UKR G;  3DWL G;  1TYQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...