3DXMG

Structure of bos taurus arp2/3 complex with bound inhibitor ck0993548
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
137
Chain Sequence
ARFRKVDVGEYDENKFVDEEDGGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of two classes of small molecule inhibitors of Arp2/3 complex
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 41
structure length 137
sequence length 142
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3dxmG00
2P9KG 4JD2G 3UKUG 2P9SG 1U2VG 1K8KG 1TYQG 2P9IG 3UKRG 2P9LG 4XEIG 3DXMG 3RSEG 2P9UG 3ULEG 2P9NG 3DXKG 2P9PG 3DWLG
chains in the Genus database with same CATH superfamily
3QWWA 1E8XA 4JEHA 1K1BA 1QBQA 2HYZA 2E0IA 5KBAA 3L6AA 2OCCE 4DX1A 5B1BE 3LXUX 4ANWA 1E8ZA 4Q69A 2QY7A 3TWXA 3FH5A 5EYPF 3S7FA 2J9QA 1IYGA 3PS6A 3ZN3A 1UOHA 1EDUA 2RFAA 2XENA 4AV7A 5B1AE 4F53A 4HB5A 3EUVA 1WM5A 3L22A 4JW1A 1P5QA 4LNBA 2E2EA 3PZ3A 5AIJA 2NXPA 3O48A 4GTQA 4FLBA 2R17C 5BPPA 1TNOA 1JCQA 5T3RA 3IHYA 3B7SA 4YVOA 1B89A 1K1AA 4GZDA 1E7VA 5ARGA 5KJMA 3LYAA 2AWIA 5FT9A 3L54A 3LS8A 1ZU2A 4GZ6A 5CCLA 2MOWA 1NA0A 3MKQA 1MZCA 4FHJA 5EX3A 2QZAA 2J09A 4P29A 2ZGGA 4BSZB 4IRUA 3LCAA 2WPVA 3FTZA 4G26A 4J7WA 4DX5D 1WDYA 1S64A 2IFUA 1BI7B 2WXQA 2OVFA 4E85A 3KAEA 3PZ2A 3AG2E 1O1TA 1VDYA 5CHEE 3ML9A 2VQ2A 3FTSA 3Q9NC 3CHOA 3URZA 4EZJA 3KSQA 5LX8A 3U66A 4GMJA 2QFCA 4XI0A 5FZSA 1TR4A 2Y1LE 4TUMA 4BESA 3PNTB 5M72A 2AXVA 1DC2A 3ZW3A 3HXCA 1Z6TA 3V79K 1Z5SC 2PM6A 2WM9A 1O1RA 1U3DA 1N95A 4UI9K 4XKCA 4Y6CA 2IQCA 2GRRB 5IY5E 1S63A 3UKUG 1KLXA 3IKOB 2DWZA 1HU3A 3DSVA 4U0ZA 4HNAD 2ETBA 2FI7A 3HRAA 3IEGA 3ULYA 4B8CB 3J5QB 1TN7A 3QWPA 4R7LA 5CERB 3SO8A 1OWLA 5FZQA 3ML8A 1XNFA 2J4DA 3DWLG 3FH8A 5CBNA 2I2OA 4GU5A 3UT7A 3KSLA 3V30A 3FP3A 4EZKA 4XIFA 2R05A 3PRZA 2XEEA 3ZYMA 4WNDA 4ANVA 2ZGDA 4U04A 3IBEA 3Q4AB 3C3QA 4DRXE 4X8QA 4HQDA 2AXZA 3CHRA 2LXLA 2FEZA 4WWOA 2DBAA 4BWRA 3AG4E 2MHKA 5KJKA 2YINA 4GCOA 1FCHA 4GTVA 5D2MC 5FQ4A 4ANXA 5ENRD 3UXGA 1DCQA 4EZLA 2H6FA 2P58C 3UM2A 3ZU7B 1H2UA 4CCAA 5CMWA 3C3RA 2QC9A 5BXUA 1SZAA 2P9PG 4PS7A 2XPYA 4G1TA 3CR3A 1Z3XA 4UWHA 4GZ5A 3FU3A 3BU8A 2WQ6A 4KT6B 4DUIA 2PL2A 2Y69E 4CGWA 2CHXA 2UY1B 3R9AB 1HX8A 2M63A 4G11A 4OVVA 3Q73A 4MKTA 4FA6A 4KMOA 1ELRA 3NBNB 3TGOA 2JABA 2EINE 3FEXA 2WXFA 4YVQC 4FLHA 3ASHA 3G2TA 3SI5A 2YQ8A 3PNLB 1JPLA 4MRUA 3B13A 3ESKA 2IY0C 4JHRA 4HRLA 3SD5A 4AJWA 3CK9A 2X38A 2IU1A 4KVOA 4J8SA 3TXNA 3PUKA 1NL4A 3EIJA 2GRNB 3AJIA 3C5RA 2IO2C 5BXOA 3FTYA 4FP7A 4LNGA 3UIOC 4DK5A 5EX0A 3CHQA 3ISMC 3SBSA 2Y0BG 3D9KA 5LOZA 3FDHA 4ATZD 3APFA 2IOSA 3GZ1A 3C3OA 2KZTB 4OAVB 3ZGQA 3B95A 4N39A 4HI8A 5G05J 5G04J 4B89A 4N3AA 1BLXB 1A17A 2IO3C 3DEOA 1KZPA 2FULA 3AS4A 3PE4A 3R7RA 1UG3A 5FWQA 1D9SA 3D9NA 3ZHEB 3RIBA 5FINA 5DIZA 2YHCA 4CDRA 4GPKA 3FUMA 1DCEA 3FU0A 4JHKA 3LVQE 3UINC 3RJVA 3CVYA 4BX9A 1HO8A 2L0IA 3CQGB 2WXJA 1MX4A 3P1UA 3SFYA 3PVLA 3B7RL 2GGFA 2WMOA 1V55E 1TN8A 1YCSB 4J8YA 3V2XA 3ESLA 2J8SD 5AJLA 2WXLA 5ENQD 2BUGA 4I2ZA 4UWGA 3E37A 3TWSA 3RRNB 3ULEG 3Q9UC 5AQ7A 2FF4A 1HF8A 2LUHA 1TJFA 4A55A 4EBAA 3HVEB 4AEZC 2UWJG 3CK7A 4L9PA 4BY6A 2GW1A 1N54A 4U7EB 3CK8A 2C0LA 2GRMA 3Q79A 2Y4UA 3PDNA 2VTBA 5J08A 3MEKA 2I1JA 2EILE 2MRIA 1S70B 4XEIG 4IN3B 3DPDA 4HOQA 2WVIA 1E96B 5AQAA 3W9FA 4I43A 2XGOA 4CDNA 4M3OA 4DPRA 4DX2A 3RO3A 5KWDA 1K3ZD 3SHFA 4HI9A 4UWKA 2RKKA 4HLEA 4JD2G 1WAO1 1TJCA 4LERA 4J6IA 4JL0A 2LO6A 3ZHEA 4JB8P 3MX3A 2VSOE 3NQPA 4C0EA 1N94A 3SGHA 4TUUA 5G2NA 3ZYQA 4O1OA 3AG3E 2P9NG 4ILIA 4FADA 1EF1C 1O1SA 2XPIA 4AVXA 3FULA 1N4RA 3QAQA 3FTXA 1N0QA 2XRYA 3SQVA 3U9WA 1GW6A 2XEHA 3LVRE 1A5EA 2BKKB 4EQFA 3LPZA 3TWWA 3Q5MA 2XPZA 1FT1A 1BD8A 2ETAA 5JJTA 3OAWA 5JJ6A 3UI2A 2BKGA 3UQ3A 4N3CA 4CZ2D 3SBTB 5BV0A 5G04C 2YHEA 4WNGA 4KVMA 3KEAA 1IKND 2CG3A 2C2LA 3CVPA 5FQ6A 4NIKA 4CRWA 1H6KA 4DI4A 2WQHA 3W9GA 2P9KG 4F1SA 4WAFA 5A6CA 1OCOE 4CT4A 5D0OD 3CSTA 4C9BB 2XGMA 3CLJA 4D10C 4NRHB 2VGXA 2PZIA 2LAHA 2OEVA 4UUCA 2V8SE 3Q7AA 4KXKB 2V0PA 3QNKA 1H19A 3TAXA 5LCWJ 3PZDA 2PM7A 5EILA 1QNFA 2KC7A 3J5PA 1TYQG 4NQ0A 5BNWA 4L23A 2OOEA 1X5BA 3ABLE 1AWCB 1INZA 3HG0D 3EHMA 3MKQB 2EQXA 5JHBA 2L6JA 2R2LA 1PY1A 1FVHA 2NYJA 3L13A 2P9UG 5HRYA 3FHEA 4WNEA 3SFZA 5AAOA 5D0QD 3TG5A 4ANUA 2ETCA 3P2BA 2F0YA 4GCNA 1ZBPA 5EN5D 4ME2A 1N4QA 2AVPA 4CYMD 1IHBA 3LJNA 2BF0X 1RW2A 4G8KA 3FUIA 5EYLA 4E6HA 4B93B 1SQMA 4B8AA 1OY3D 2L0TB 3DPYA 4A3VA 5AENA 3OXLA 4ILGA 4UI9C 4GAAA 3ZYKA 1TNYA 4YNDA 4ACLA 4MLPA 4YDEA 4JPSA 3RSEG 3Q15A 1N52A 1OWNA 4DLQA 5CMYA 2ZXWE 4HORA 4KZ0A 4U07A 4I1MA 2KZTA 3DEPA 4JEUA 1RZ4A 1HXIA 4FU3A 5JJ7A 3T8KA 1WG0A 1NP7A 4NURA 2CFZA 3G2WA 2X3MA 3PUJA 2V4LA 3O4ZA 2P9SG 1H0AA 4A63B 1OUVA 3B7BA 4PS8A 3CKBA 2XZTG 2F8XK 2J49A 4LEUA 4N5CA 3ABME 4AXHA 5ENPD 2LXMA 2PQRA 2EIKE 5AJDA 2VSNA 1O5MA 1TEZA 3E30A 1U2VG 3L16A 5A23A 3FUKA 4ZFHA 2WXMA 3JUIA 5HKPA 4Q96A 5KCMA 4APFA 4U63A 3AS8A 1H2TC 4GPMA 1H6OA 1SW6A 4UWFA 2FO1E 3AU4A 3L82A 4H7XA 2WXPA 4RLYA 1IQRA 3FU6A 4XI9A 3FUFA 1UJKA 3APDA 4Z68A 5KNGA 3NZSA 4CEMA 3ZVVA 3E4BA 3K9IA 3E32A 5B3SE 2BEDA 4OVUA 3HVEA 2VGXB 4PS3A 1NI1A 4QFVA 3LDZA 4HOUA 5CRUA 2CHZA 4YDYA 4GA2A 2A5UA 5CECB 3FY4A 4B0ZA 1KZOA 3ABKE 1BPOA 3V31A 3Q49B 5AN8A 3DRAA 3EDTB 4K5CA 3D9JA 4LUNU 2KM4A 2J08A 5HS0A 3RU0A 4YDOA 3ENEA 5FIOA 4I17A 3APCA 2C0MA 3I5PA 4LG6A 4EBAG 5EIDA 3ZRHA 3RRUA 4GB9A 3ZYLA 4J8EA 2HE0A 3L9TA 4HVBA 1HS6A 2L9BA 3WXXA 4AY6A 3JUEA 3QKYA 5ENNA 5BW8C 4C48B 4I6GA 4I1AA 5KNHD 3GW4A 5JMND 4UQYA 4J0UA 3RKVA 5C2YA 4GYYA 1SZ9A 4A3TA 3UIPC 1LD7A 2WXGA 4U0UA 3LY7A 3D9OA 2JEKA 4AIFA 4TXPA 3JQ0A 3HXEA 3HXBA 3QARA 3QK0A 4N3BA 5CEAA 3NOGD 3S2AA 2XCCA 2DCPA 2DZNA 4AY5A 4GMRA 3JYSA 4AOFA 4PDXA 1HG5A 1BU9A 3T9KA 1TN6A 3RK6A 2KCKA 2Y3AA 3UPVA 2B6CA 1Y6IA 4TRQA 2J07A 4L2YA 1TNUA 3CVUA 1UJJA 1EPUA 4B94A 4DJAA 4U0SA 3UKRG 3DBSA 2ONDA 3DSTA 2QYJA 4BSXA 3CHPA 4GA0A 1E8YA 1TNBA 3KEZA 3ZIMA 3UM1A 2IF4A 3CVQA 3DSUA 4GTOA 1OWMA 1QZ2A 2P9IG 3NZUA 4UQXA 4ZHBA 1N9AA 3ZFWA 3UM0A 1E8WA 4HRNA 2WXIA 5ENSD 1WY6A 3QWVA 1MX2A 4RQIA 3AG1E 4W9RA 3Q7FA 5JHAA 3SZ7A 3HXDA 1FT2A 4DX7D 3TWRA 4JHJA 2X6HA 3MGBA 4BEPA 1YMPA 4A1GA 3UX4A 4K5AB 5EIBE 4CDMA 2V5QC 3MZLB 1Q2ZA 3CHMA 3Q75A 3PEVB 3MCXA 4G25A 1HH8A 4AP2A 3DXMG 3SFXA 2OVBA 4I9CA 4I6JA 5CEDB 4C0MA 3BUAA 2GRQB 3Q47B 3DSXA 2R02A 4G2VA 3PZ4A 2V4HC 3TL5A 3JXJA 1X81A 3G2SA 5ENTD 4EECA 4IYPA 2I6HA 1ELWA 5AQBA 5LCWC 4RG6A 2JLBA 3ONKA 1S0PA 4IULA 3E33A 3ASDA 1MQSA 4WUYA 1JWGA 5EKQD 2XCBA 4HFGA 1QYMA 3KD7A 2CHWA 2LSUA 3QC1A 5LFAA 1YYHA 2KCVA 1K8KG 3ZEFA 4MS6A 4UI9J 3SF4A 4O1PA 3MV3B 1MYOA 3E34A 2VGEA 3EU9A 4JVSA 3VTXA 3EHQA 3HDXA 3NB2A 3RO2A 3ZUVB 3HHMA 4O60A 3UM3A 1JCSA 5BUZA 3FEYA 1LD8A 3F6QA 3C72A 1UN8A 4BTAA 3L17A 3ZXSA 2WXOA 3HXFA 1Y8MA 3QDNA 3VLEA 3GZ2A 5DBKA 3UT4A 3VTYA 2UY1A 4GTSA 5FZRA 1N4SA 3T8MA 1SVXA 3BG1B 2X6IA 4HOTA 2R5SA 3ZNGA 2H6GA 2DYRE 3UMVA 4EHMA 2NC9A 2MYOA 5H7PA 4TXQA 4JZYA 2VYIA 5CCMA 4URKA 2P9LG 3CVLA 4FULA 3D9HA 4ACKA 4PUCA 3FUNA 2OEWA 2WXHA 3JQ1A 3CKCA 3EHRA 2ILRA 4XX5A 1NA3A 2BTDA 4KYOB 4H7YA 1OCCE 3MKRA 3FUJA 4GTPA 4J8FA 4U8YD 2CG2A 3TXMA 2FBNA 3C98A 3VLFA 4LNUD 4JC8A 1Z3YA 2DZOA 2RG8A 1UN9A 1DVPA 4LSZE 1YA0A 5KJLA 1ZB1A 3TWUA 3VLDA 4Q94A 2VSYA 4CT0A 1OCZE 4V3IA 5BT1A 3G2VA 3S7BA 2WXRA 4L1BA 2IEJA 4QQIA 5D66A 3PE3A 3GZSA 4KBQA 3EIQC 1D8EA 3D9MA 2EIME 5CRVA 4GYOA 4XKBA 1NFIE 2B0OE 3CSFA 4BX8A 1PAQA 4TV3A 2XEVA 2PNNA 4I9EA 2Y4TA 4HS2A 1OXJA 2XS8A 2HM8A 3ASFA 3TG4A 5E75A 3X2QE 1U3CA 4KZCA 2FO7A 3OXFA 5C1DA 4GTTA 2A5EA 3FTWA 1H2VC 2DYSE 5G05C 4WWPA 4TXRA 3N71A 1UW4B 4CGVA 5AARA 2XZDG 4JXTA 4BERA 1E7UA 3S7DA 3GYZA 2IJGX 2Q7FA 1OCRE 4K0RA 4MBGA 3LEWA 4DLOA 1LF8A 4GTMA 3JXIA 2R59A 4BT9A 3WG7E 4N2SA 2A4ZA 3R7QA 2KXPC 4BFRA 1XGWA 2KATA 4I2WA 4BETA 4U8HA 3BQOA 4RG9A 4DX6D 4XZ4A 2KBXA 3IHVA 4BTBA 1HFAA 2XRZA 1IHGA 2XS1A 3MJWA 4UQZA 3HYMB 3MV2B 4LRZA 2L6BA 2DVWA 5AQ9A 4M7CA 4HOSA 3ZKJA 3ZPJA 3HIZA 4L2LA 2V5FA 3ULQA 4GZ3A 3TWTA 4GZCA 5FJYA 5ARFA 1HZ4A 4U95D 1N11A 3TWQA 4I1OB 3LJ3A 3TWVA 2H6HA 3CIAA 3D9IA 3DSSA 5ANLA 3ZXPA 3CVVA 2WB2A 5AYWD 3CHSA 2AXUA 3T5VA 1FVFA 3UUXA 2WQ7A 4L7TA 2LSVA 1MJ0A 4GMLA 1MX6A 5T4YA 4OAUC 4UWLA 4J8DA 4GTRA 1ELKA 1SA5A 3FWVA 3CEQA 1QQEA 5G55A 1BI8B 4FJZA 2ZIRA 4N2QA 4HLLA 3TJPA 4HRMB 2KCLA 4FHKA 3QJZA 3U64A 1HE8A 2AJAA 2GRPB 2VGYA 3R9MA 1JUQA 3OXGA 4WWNA 2WXNA 2LNIA 4JA9A 4JA7A 5HQ8A 4RSYA 1N0RA 3MA5A 4FC8A 3PREA 1JCRA 2ZU6B 5BV1A 3FH7A 3B7TA 4F3VA 4G24A 2QYUA 4ILHB 4HXIA 3UTMA 1KT1A 2WXKA 5LP0A 1H6PA 1HG2A 1OT8A 2VJ8A 1OWOA 2DIWA 2RD0A 3ASOE 3MYVA 3SNXA 3D9LA 3AS5A 4LCTA 1AP7A 5FTPA 3CGHA 4AM9A 3CVNA 3FU5A 3U4TA 3PZ1A 2HO1A 3I3NA 3BG0B 1KT0A 3NAWA 2XGSA 3FFLA 1KPSB 4YDWA 2HR2A 5KJNA 3UT8A 4K5BA 1SA4A 4K03A 4Y6WA 5JA4D 5J90A 1MHQA 4HBDA 5FQ8A 3FTUA 1OWPA 3DSWA 1V54E 3S7JA 4EPZA 4DI3A 2AW6A 4NACA 2XQ0A 4OYSA 5FQ7A 1IXVA 4I6EA 2LAIA 1EYHA 1W3BA 5EDSA 3EU5A 4APOA 2F8YA 3FTVA 2XHEA 2X6KA 3ASNE 2PQNA 3OTNA 2F37A 1N4PA 3ONLA 3IV0A 3AU5A 3RAUA 4GA1A 2WMNA 4F7AA 3T5XA 2RFMA 5T8IA 4O6FA 4N5QA 1PC2A 4U96D 3I4RB 4ABNA 3QB2A 5ENOD 2OV8A 4G8LA 1D8DA 4ATGA 3CVWA 3D3MA 5HI7A 5CBOA 1G3NB 4WNFA 2J4BA 3IXEA 3L08A 3CVXA 2I9CA 2YNQA 2IONA 3EJNA 4RVBA 4F1PA 3AAAC 2VSXE 4GYWA 4G23A 3EHNA 3I4GA 5ITZF 4U8VD 1IQUA 4BT8A 3Q78A 3SY2A 2GROB 2IOLA 3LKUA 3PEUB 3FUDA 4PH4B 3V2OA 2EIJE 5E76A 3KS2A 2GRLA 3NOCD 3LY8A 3LY9A 1JWFA 3JCKC 3D9PA 5A7DB 3RRMB 1LTXA 2ZISA 5ANRA 2CFUA 2I1KA 2VTBB 1DNPA 4A1SA 2X6FA 2NSZA 3QOUA 1FPPA 1E90A 3CQCB 2R03A 3CV0A 2P2CP 2H6IA 3ASGA 4FJYA 3BEEA 3PH0C 1L5JA 4F6RD 3FUHA 3FUEA 3B7UX 3G2UA 1TNZA 3NF1A 1NZNA 2X6JA 4XE0A 3U3WA 3DXKG
chains in the Genus database with same CATH topology
2P9KG 4JD2G 3UKUG 2P9SG 1U2VG 1K8KG 1TYQG 2P9IG 3UKRG 2P9LG 4XEIG 3DXMG 3RSEG 2P9UG 3ULEG 2P9NG 3DXKG 2P9PG 3DWLG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9K G;  4JD2 G;  3UKU G;  2P9S G;  1U2V G;  1K8K G;  1TYQ G;  2P9I G;  3UKR G;  2P9L G;  4XEI G;  3DXM G;  3RSE G;  2P9U G;  3ULE G;  2P9N G;  3DXK G;  2P9P G;  3DWL G; 
#chains in the Genus database with same CATH topology
 3QWW A;  1E8X A;  4JEH A;  1K1B A;  1QBQ A;  2HYZ A;  2E0I A;  5KBA A;  3L6A A;  2OCC E;  4DX1 A;  5B1B E;  3LXU X;  4ANW A;  1E8Z A;  4Q69 A;  2QY7 A;  3TWX A;  3FH5 A;  5EYP F;  3S7F A;  2J9Q A;  1IYG A;  3PS6 A;  3ZN3 A;  1UOH A;  1EDU A;  2RFA A;  2XEN A;  4AV7 A;  5B1A E;  4F53 A;  4HB5 A;  3EUV A;  1WM5 A;  3L22 A;  4JW1 A;  1P5Q A;  4LNB A;  2E2E A;  3PZ3 A;  5AIJ A;  2NXP A;  3O48 A;  4GTQ A;  4FLB A;  2R17 C;  5BPP A;  1TNO A;  1JCQ A;  5T3R A;  3IHY A;  3B7S A;  4YVO A;  1B89 A;  1K1A A;  4GZD A;  1E7V A;  5ARG A;  5KJM A;  3LYA A;  2AWI A;  5FT9 A;  3L54 A;  3LS8 A;  1ZU2 A;  4GZ6 A;  5CCL A;  2MOW A;  1NA0 A;  3MKQ A;  1MZC A;  4FHJ A;  5EX3 A;  2QZA A;  2J09 A;  4P29 A;  2ZGG A;  4BSZ B;  4IRU A;  3LCA A;  2WPV A;  3FTZ A;  4G26 A;  4J7W A;  4DX5 D;  1WDY A;  1S64 A;  2IFU A;  1BI7 B;  2WXQ A;  2OVF A;  4E85 A;  3KAE A;  3PZ2 A;  3AG2 E;  1O1T A;  1VDY A;  5CHE E;  3ML9 A;  2VQ2 A;  3FTS A;  3Q9N C;  3CHO A;  3URZ A;  4EZJ A;  3KSQ A;  5LX8 A;  3U66 A;  4GMJ A;  2QFC A;  4XI0 A;  5FZS A;  1TR4 A;  2Y1L E;  4TUM A;  4BES A;  3PNT B;  5M72 A;  2AXV A;  1DC2 A;  3ZW3 A;  3HXC A;  1Z6T A;  3V79 K;  1Z5S C;  2PM6 A;  2WM9 A;  1O1R A;  1U3D A;  1N95 A;  4UI9 K;  4XKC A;  4Y6C A;  2IQC A;  2GRR B;  5IY5 E;  1S63 A;  3UKU G;  1KLX A;  3IKO B;  2DWZ A;  1HU3 A;  3DSV A;  4U0Z A;  4HNA D;  2ETB A;  2FI7 A;  3HRA A;  3IEG A;  3ULY A;  4B8C B;  3J5Q B;  1TN7 A;  3QWP A;  4R7L A;  5CER B;  3SO8 A;  1OWL A;  5FZQ A;  3ML8 A;  1XNF A;  2J4D A;  3DWL G;  3FH8 A;  5CBN A;  2I2O A;  4GU5 A;  3UT7 A;  3KSL A;  3V30 A;  3FP3 A;  4EZK A;  4XIF A;  2R05 A;  3PRZ A;  2XEE A;  3ZYM A;  4WND A;  4ANV A;  2ZGD A;  4U04 A;  3IBE A;  3Q4A B;  3C3Q A;  4DRX E;  4X8Q A;  4HQD A;  2AXZ A;  3CHR A;  2LXL A;  2FEZ A;  4WWO A;  2DBA A;  4BWR A;  3AG4 E;  2MHK A;  5KJK A;  2YIN A;  4GCO A;  1FCH A;  4GTV A;  5D2M C;  5FQ4 A;  4ANX A;  5ENR D;  3UXG A;  1DCQ A;  4EZL A;  2H6F A;  2P58 C;  3UM2 A;  3ZU7 B;  1H2U A;  4CCA A;  5CMW A;  3C3R A;  2QC9 A;  5BXU A;  1SZA A;  2P9P G;  4PS7 A;  2XPY A;  4G1T A;  3CR3 A;  1Z3X A;  4UWH A;  4GZ5 A;  3FU3 A;  3BU8 A;  2WQ6 A;  4KT6 B;  4DUI A;  2PL2 A;  2Y69 E;  4CGW A;  2CHX A;  2UY1 B;  3R9A B;  1HX8 A;  2M63 A;  4G11 A;  4OVV A;  3Q73 A;  4MKT A;  4FA6 A;  4KMO A;  1ELR A;  3NBN B;  3TGO A;  2JAB A;  2EIN E;  3FEX A;  2WXF A;  4YVQ C;  4FLH A;  3ASH A;  3G2T A;  3SI5 A;  2YQ8 A;  3PNL B;  1JPL A;  4MRU A;  3B13 A;  3ESK A;  2IY0 C;  4JHR A;  4HRL A;  3SD5 A;  4AJW A;  3CK9 A;  2X38 A;  2IU1 A;  4KVO A;  4J8S A;  3TXN A;  3PUK A;  1NL4 A;  3EIJ A;  2GRN B;  3AJI A;  3C5R A;  2IO2 C;  5BXO A;  3FTY A;  4FP7 A;  4LNG A;  3UIO C;  4DK5 A;  5EX0 A;  3CHQ A;  3ISM C;  3SBS A;  2Y0B G;  3D9K A;  5LOZ A;  3FDH A;  4ATZ D;  3APF A;  2IOS A;  3GZ1 A;  3C3O A;  2KZT B;  4OAV B;  3ZGQ A;  3B95 A;  4N39 A;  4HI8 A;  5G05 J;  5G04 J;  4B89 A;  4N3A A;  1BLX B;  1A17 A;  2IO3 C;  3DEO A;  1KZP A;  2FUL A;  3AS4 A;  3PE4 A;  3R7R A;  1UG3 A;  5FWQ A;  1D9S A;  3D9N A;  3ZHE B;  3RIB A;  5FIN A;  5DIZ A;  2YHC A;  4CDR A;  4GPK A;  3FUM A;  1DCE A;  3FU0 A;  4JHK A;  3LVQ E;  3UIN C;  3RJV A;  3CVY A;  4BX9 A;  1HO8 A;  2L0I A;  3CQG B;  2WXJ A;  1MX4 A;  3P1U A;  3SFY A;  3PVL A;  3B7R L;  2GGF A;  2WMO A;  1V55 E;  1TN8 A;  1YCS B;  4J8Y A;  3V2X A;  3ESL A;  2J8S D;  5AJL A;  2WXL A;  5ENQ D;  2BUG A;  4I2Z A;  4UWG A;  3E37 A;  3TWS A;  3RRN B;  3ULE G;  3Q9U C;  5AQ7 A;  2FF4 A;  1HF8 A;  2LUH A;  1TJF A;  4A55 A;  4EBA A;  3HVE B;  4AEZ C;  2UWJ G;  3CK7 A;  4L9P A;  4BY6 A;  2GW1 A;  1N54 A;  4U7E B;  3CK8 A;  2C0L A;  2GRM A;  3Q79 A;  2Y4U A;  3PDN A;  2VTB A;  5J08 A;  3MEK A;  2I1J A;  2EIL E;  2MRI A;  1S70 B;  4XEI G;  4IN3 B;  3DPD A;  4HOQ A;  2WVI A;  1E96 B;  5AQA A;  3W9F A;  4I43 A;  2XGO A;  4CDN A;  4M3O A;  4DPR A;  4DX2 A;  3RO3 A;  5KWD A;  1K3Z D;  3SHF A;  4HI9 A;  4UWK A;  2RKK A;  4HLE A;  4JD2 G;  1WAO 1;  1TJC A;  4LER A;  4J6I A;  4JL0 A;  2LO6 A;  3ZHE A;  4JB8 P;  3MX3 A;  2VSO E;  3NQP A;  4C0E A;  1N94 A;  3SGH A;  4TUU A;  5G2N A;  3ZYQ A;  4O1O A;  3AG3 E;  2P9N G;  4ILI A;  4FAD A;  1EF1 C;  1O1S A;  2XPI A;  4AVX A;  3FUL A;  1N4R A;  3QAQ A;  3FTX A;  1N0Q A;  2XRY A;  3SQV A;  3U9W A;  1GW6 A;  2XEH A;  3LVR E;  1A5E A;  2BKK B;  4EQF A;  3LPZ A;  3TWW A;  3Q5M A;  2XPZ A;  1FT1 A;  1BD8 A;  2ETA A;  5JJT A;  3OAW A;  5JJ6 A;  3UI2 A;  2BKG A;  3UQ3 A;  4N3C A;  4CZ2 D;  3SBT B;  5BV0 A;  5G04 C;  2YHE A;  4WNG A;  4KVM A;  3KEA A;  1IKN D;  2CG3 A;  2C2L A;  3CVP A;  5FQ6 A;  4NIK A;  4CRW A;  1H6K A;  4DI4 A;  2WQH A;  3W9G A;  2P9K G;  4F1S A;  4WAF A;  5A6C A;  1OCO E;  4CT4 A;  5D0O D;  3CST A;  4C9B B;  2XGM A;  3CLJ A;  4D10 C;  4NRH B;  2VGX A;  2PZI A;  2LAH A;  2OEV A;  4UUC A;  2V8S E;  3Q7A A;  4KXK B;  2V0P A;  3QNK A;  1H19 A;  3TAX A;  5LCW J;  3PZD A;  2PM7 A;  5EIL A;  1QNF A;  2KC7 A;  3J5P A;  1TYQ G;  4NQ0 A;  5BNW A;  4L23 A;  2OOE A;  1X5B A;  3ABL E;  1AWC B;  1INZ A;  3HG0 D;  3EHM A;  3MKQ B;  2EQX A;  5JHB A;  2L6J A;  2R2L A;  1PY1 A;  1FVH A;  2NYJ A;  3L13 A;  2P9U G;  5HRY A;  3FHE A;  4WNE A;  3SFZ A;  5AAO A;  5D0Q D;  3TG5 A;  4ANU A;  2ETC A;  3P2B A;  2F0Y A;  4GCN A;  1ZBP A;  5EN5 D;  4ME2 A;  1N4Q A;  2AVP A;  4CYM D;  1IHB A;  3LJN A;  2BF0 X;  1RW2 A;  4G8K A;  3FUI A;  5EYL A;  4E6H A;  4B93 B;  1SQM A;  4B8A A;  1OY3 D;  2L0T B;  3DPY A;  4A3V A;  5AEN A;  3OXL A;  4ILG A;  4UI9 C;  4GAA A;  3ZYK A;  1TNY A;  4YND A;  4ACL A;  4MLP A;  4YDE A;  4JPS A;  3RSE G;  3Q15 A;  1N52 A;  1OWN A;  4DLQ A;  5CMY A;  2ZXW E;  4HOR A;  4KZ0 A;  4U07 A;  4I1M A;  2KZT A;  3DEP A;  4JEU A;  1RZ4 A;  1HXI A;  4FU3 A;  5JJ7 A;  3T8K A;  1WG0 A;  1NP7 A;  4NUR A;  2CFZ A;  3G2W A;  2X3M A;  3PUJ A;  2V4L A;  3O4Z A;  2P9S G;  1H0A A;  4A63 B;  1OUV A;  3B7B A;  4PS8 A;  3CKB A;  2XZT G;  2F8X K;  2J49 A;  4LEU A;  4N5C A;  3ABM E;  4AXH A;  5ENP D;  2LXM A;  2PQR A;  2EIK E;  5AJD A;  2VSN A;  1O5M A;  1TEZ A;  3E30 A;  1U2V G;  3L16 A;  5A23 A;  3FUK A;  4ZFH A;  2WXM A;  3JUI A;  5HKP A;  4Q96 A;  5KCM A;  4APF A;  4U63 A;  3AS8 A;  1H2T C;  4GPM A;  1H6O A;  1SW6 A;  4UWF A;  2FO1 E;  3AU4 A;  3L82 A;  4H7X A;  2WXP A;  4RLY A;  1IQR A;  3FU6 A;  4XI9 A;  3FUF A;  1UJK A;  3APD A;  4Z68 A;  5KNG A;  3NZS A;  4CEM A;  3ZVV A;  3E4B A;  3K9I A;  3E32 A;  5B3S E;  2BED A;  4OVU A;  3HVE A;  2VGX B;  4PS3 A;  1NI1 A;  4QFV A;  3LDZ A;  4HOU A;  5CRU A;  2CHZ A;  4YDY A;  4GA2 A;  2A5U A;  5CEC B;  3FY4 A;  4B0Z A;  1KZO A;  3ABK E;  1BPO A;  3V31 A;  3Q49 B;  5AN8 A;  3DRA A;  3EDT B;  4K5C A;  3D9J A;  4LUN U;  2KM4 A;  2J08 A;  5HS0 A;  3RU0 A;  4YDO A;  3ENE A;  5FIO A;  4I17 A;  3APC A;  2C0M A;  3I5P A;  4LG6 A;  4EBA G;  5EID A;  3ZRH A;  3RRU A;  4GB9 A;  3ZYL A;  4J8E A;  2HE0 A;  3L9T A;  4HVB A;  1HS6 A;  2L9B A;  3WXX A;  4AY6 A;  3JUE A;  3QKY A;  5ENN A;  5BW8 C;  4C48 B;  4I6G A;  4I1A A;  5KNH D;  3GW4 A;  5JMN D;  4UQY A;  4J0U A;  3RKV A;  5C2Y A;  4GYY A;  1SZ9 A;  4A3T A;  3UIP C;  1LD7 A;  2WXG A;  4U0U A;  3LY7 A;  3D9O A;  2JEK A;  4AIF A;  4TXP A;  3JQ0 A;  3HXE A;  3HXB A;  3QAR A;  3QK0 A;  4N3B A;  5CEA A;  3NOG D;  3S2A A;  2XCC A;  2DCP A;  2DZN A;  4AY5 A;  4GMR A;  3JYS A;  4AOF A;  4PDX A;  1HG5 A;  1BU9 A;  3T9K A;  1TN6 A;  3RK6 A;  2KCK A;  2Y3A A;  3UPV A;  2B6C A;  1Y6I A;  4TRQ A;  2J07 A;  4L2Y A;  1TNU A;  3CVU A;  1UJJ A;  1EPU A;  4B94 A;  4DJA A;  4U0S A;  3UKR G;  3DBS A;  2OND A;  3DST A;  2QYJ A;  4BSX A;  3CHP A;  4GA0 A;  1E8Y A;  1TNB A;  3KEZ A;  3ZIM A;  3UM1 A;  2IF4 A;  3CVQ A;  3DSU A;  4GTO A;  1OWM A;  1QZ2 A;  2P9I G;  3NZU A;  4UQX A;  4ZHB A;  1N9A A;  3ZFW A;  3UM0 A;  1E8W A;  4HRN A;  2WXI A;  5ENS D;  1WY6 A;  3QWV A;  1MX2 A;  4RQI A;  3AG1 E;  4W9R A;  3Q7F A;  5JHA A;  3SZ7 A;  3HXD A;  1FT2 A;  4DX7 D;  3TWR A;  4JHJ A;  2X6H A;  3MGB A;  4BEP A;  1YMP A;  4A1G A;  3UX4 A;  4K5A B;  5EIB E;  4CDM A;  2V5Q C;  3MZL B;  1Q2Z A;  3CHM A;  3Q75 A;  3PEV B;  3MCX A;  4G25 A;  1HH8 A;  4AP2 A;  3DXM G;  3SFX A;  2OVB A;  4I9C A;  4I6J A;  5CED B;  4C0M A;  3BUA A;  2GRQ B;  3Q47 B;  3DSX A;  2R02 A;  4G2V A;  3PZ4 A;  2V4H C;  3TL5 A;  3JXJ A;  1X81 A;  3G2S A;  5ENT D;  4EEC A;  4IYP A;  2I6H A;  1ELW A;  5AQB A;  5LCW C;  4RG6 A;  2JLB A;  3ONK A;  1S0P A;  4IUL A;  3E33 A;  3ASD A;  1MQS A;  4WUY A;  1JWG A;  5EKQ D;  2XCB A;  4HFG A;  1QYM A;  3KD7 A;  2CHW A;  2LSU A;  3QC1 A;  5LFA A;  1YYH A;  2KCV A;  1K8K G;  3ZEF A;  4MS6 A;  4UI9 J;  3SF4 A;  4O1P A;  3MV3 B;  1MYO A;  3E34 A;  2VGE A;  3EU9 A;  4JVS A;  3VTX A;  3EHQ A;  3HDX A;  3NB2 A;  3RO2 A;  3ZUV B;  3HHM A;  4O60 A;  3UM3 A;  1JCS A;  5BUZ A;  3FEY A;  1LD8 A;  3F6Q A;  3C72 A;  1UN8 A;  4BTA A;  3L17 A;  3ZXS A;  2WXO A;  3HXF A;  1Y8M A;  3QDN A;  3VLE A;  3GZ2 A;  5DBK A;  3UT4 A;  3VTY A;  2UY1 A;  4GTS A;  5FZR A;  1N4S A;  3T8M A;  1SVX A;  3BG1 B;  2X6I A;  4HOT A;  2R5S A;  3ZNG A;  2H6G A;  2DYR E;  3UMV A;  4EHM A;  2NC9 A;  2MYO A;  5H7P A;  4TXQ A;  4JZY A;  2VYI A;  5CCM A;  4URK A;  2P9L G;  3CVL A;  4FUL A;  3D9H A;  4ACK A;  4PUC A;  3FUN A;  2OEW A;  2WXH A;  3JQ1 A;  3CKC A;  3EHR A;  2ILR A;  4XX5 A;  1NA3 A;  2BTD A;  4KYO B;  4H7Y A;  1OCC E;  3MKR A;  3FUJ A;  4GTP A;  4J8F A;  4U8Y D;  2CG2 A;  3TXM A;  2FBN A;  3C98 A;  3VLF A;  4LNU D;  4JC8 A;  1Z3Y A;  2DZO A;  2RG8 A;  1UN9 A;  1DVP A;  4LSZ E;  1YA0 A;  5KJL A;  1ZB1 A;  3TWU A;  3VLD A;  4Q94 A;  2VSY A;  4CT0 A;  1OCZ E;  4V3I A;  5BT1 A;  3G2V A;  3S7B A;  2WXR A;  4L1B A;  2IEJ A;  4QQI A;  5D66 A;  3PE3 A;  3GZS A;  4KBQ A;  3EIQ C;  1D8E A;  3D9M A;  2EIM E;  5CRV A;  4GYO A;  4XKB A;  1NFI E;  2B0O E;  3CSF A;  4BX8 A;  1PAQ A;  4TV3 A;  2XEV A;  2PNN A;  4I9E A;  2Y4T A;  4HS2 A;  1OXJ A;  2XS8 A;  2HM8 A;  3ASF A;  3TG4 A;  5E75 A;  3X2Q E;  1U3C A;  4KZC A;  2FO7 A;  3OXF A;  5C1D A;  4GTT A;  2A5E A;  3FTW A;  1H2V C;  2DYS E;  5G05 C;  4WWP A;  4TXR A;  3N71 A;  1UW4 B;  4CGV A;  5AAR A;  2XZD G;  4JXT A;  4BER A;  1E7U A;  3S7D A;  3GYZ A;  2IJG X;  2Q7F A;  1OCR E;  4K0R A;  4MBG A;  3LEW A;  4DLO A;  1LF8 A;  4GTM A;  3JXI A;  2R59 A;  4BT9 A;  3WG7 E;  4N2S A;  2A4Z A;  3R7Q A;  2KXP C;  4BFR A;  1XGW A;  2KAT A;  4I2W A;  4BET A;  4U8H A;  3BQO A;  4RG9 A;  4DX6 D;  4XZ4 A;  2KBX A;  3IHV A;  4BTB A;  1HFA A;  2XRZ A;  1IHG A;  2XS1 A;  3MJW A;  4UQZ A;  3HYM B;  3MV2 B;  4LRZ A;  2L6B A;  2DVW A;  5AQ9 A;  4M7C A;  4HOS A;  3ZKJ A;  3ZPJ A;  3HIZ A;  4L2L A;  2V5F A;  3ULQ A;  4GZ3 A;  3TWT A;  4GZC A;  5FJY A;  5ARF A;  1HZ4 A;  4U95 D;  1N11 A;  3TWQ A;  4I1O B;  3LJ3 A;  3TWV A;  2H6H A;  3CIA A;  3D9I A;  3DSS A;  5ANL A;  3ZXP A;  3CVV A;  2WB2 A;  5AYW D;  3CHS A;  2AXU A;  3T5V A;  1FVF A;  3UUX A;  2WQ7 A;  4L7T A;  2LSV A;  1MJ0 A;  4GML A;  1MX6 A;  5T4Y A;  4OAU C;  4UWL A;  4J8D A;  4GTR A;  1ELK A;  1SA5 A;  3FWV A;  3CEQ A;  1QQE A;  5G55 A;  1BI8 B;  4FJZ A;  2ZIR A;  4N2Q A;  4HLL A;  3TJP A;  4HRM B;  2KCL A;  4FHK A;  3QJZ A;  3U64 A;  1HE8 A;  2AJA A;  2GRP B;  2VGY A;  3R9M A;  1JUQ A;  3OXG A;  4WWN A;  2WXN A;  2LNI A;  4JA9 A;  4JA7 A;  5HQ8 A;  4RSY A;  1N0R A;  3MA5 A;  4FC8 A;  3PRE A;  1JCR A;  2ZU6 B;  5BV1 A;  3FH7 A;  3B7T A;  4F3V A;  4G24 A;  2QYU A;  4ILH B;  4HXI A;  3UTM A;  1KT1 A;  2WXK A;  5LP0 A;  1H6P A;  1HG2 A;  1OT8 A;  2VJ8 A;  1OWO A;  2DIW A;  2RD0 A;  3ASO E;  3MYV A;  3SNX A;  3D9L A;  3AS5 A;  4LCT A;  1AP7 A;  5FTP A;  3CGH A;  4AM9 A;  3CVN A;  3FU5 A;  3U4T A;  3PZ1 A;  2HO1 A;  3I3N A;  3BG0 B;  1KT0 A;  3NAW A;  2XGS A;  3FFL A;  1KPS B;  4YDW A;  2HR2 A;  5KJN A;  3UT8 A;  4K5B A;  1SA4 A;  4K03 A;  4Y6W A;  5JA4 D;  5J90 A;  1MHQ A;  4HBD A;  5FQ8 A;  3FTU A;  1OWP A;  3DSW A;  1V54 E;  3S7J A;  4EPZ A;  4DI3 A;  2AW6 A;  4NAC A;  2XQ0 A;  4OYS A;  5FQ7 A;  1IXV A;  4I6E A;  2LAI A;  1EYH A;  1W3B A;  5EDS A;  3EU5 A;  4APO A;  2F8Y A;  3FTV A;  2XHE A;  2X6K A;  3ASN E;  2PQN A;  3OTN A;  2F37 A;  1N4P A;  3ONL A;  3IV0 A;  3AU5 A;  3RAU A;  4GA1 A;  2WMN A;  4F7A A;  3T5X A;  2RFM A;  5T8I A;  4O6F A;  4N5Q A;  1PC2 A;  4U96 D;  3I4R B;  4ABN A;  3QB2 A;  5ENO D;  2OV8 A;  4G8L A;  1D8D A;  4ATG A;  3CVW A;  3D3M A;  5HI7 A;  5CBO A;  1G3N B;  4WNF A;  2J4B A;  3IXE A;  3L08 A;  3CVX A;  2I9C A;  2YNQ A;  2ION A;  3EJN A;  4RVB A;  4F1P A;  3AAA C;  2VSX E;  4GYW A;  4G23 A;  3EHN A;  3I4G A;  5ITZ F;  4U8V D;  1IQU A;  4BT8 A;  3Q78 A;  3SY2 A;  2GRO B;  2IOL A;  3LKU A;  3PEU B;  3FUD A;  4PH4 B;  3V2O A;  2EIJ E;  5E76 A;  3KS2 A;  2GRL A;  3NOC D;  3LY8 A;  3LY9 A;  1JWF A;  3JCK C;  3D9P A;  5A7D B;  3RRM B;  1LTX A;  2ZIS A;  5ANR A;  2CFU A;  2I1K A;  2VTB B;  1DNP A;  4A1S A;  2X6F A;  2NSZ A;  3QOU A;  1FPP A;  1E90 A;  3CQC B;  2R03 A;  3CV0 A;  2P2C P;  2H6I A;  3ASG A;  4FJY A;  3BEE A;  3PH0 C;  1L5J A;  4F6R D;  3FUH A;  3FUE A;  3B7U X;  3G2U A;  1TNZ A;  3NF1 A;  1NZN A;  2X6J A;  4XE0 A;  3U3W A;  3DXK G; 
#chains in the Genus database with same CATH homology
 2P9K G;  4JD2 G;  3UKU G;  2P9S G;  1U2V G;  1K8K G;  1TYQ G;  2P9I G;  3UKR G;  2P9L G;  4XEI G;  3DXM G;  3RSE G;  2P9U G;  3ULE G;  2P9N G;  3DXK G;  2P9P G;  3DWL G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...