4GTRA

Ftase in complex with bms analogue 13
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 112
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 4gtrA00
1O1RA 3DSTA 3DRAA 1D8DA 3HXEA 3DSWA 4LNBA 1N95A 3EUVA 1TN8A 1FPPA 3KSQA 3Q78A 2ZIRA 1TNUA 3HXFA 1N4PA 1TNYA 3DSXA 3Q7FA 4GTMA 2BEDA 3E30A 3E33A 1SA5A 1LD7A 1QBQA 3Q79A 1O1TA 3PZ1A 4GTRA 1SA4A 3C72A 2F0YA 4EHMA 3HXBA 1JCQA 2H6FA 1NI1A 1TNZA 1N9AA 3DSUA 1D8EA 4GTQA 4GTSA 1TN6A 1KZPA 3E34A 3EU5A 3DPYA 3SFYA 3Q7AA 4YDOA 1KZOA 1LD8A 3PZ4A 1LTXA 1N4RA 3DSSA 3HXDA 4YDEA 4GTTA 2H6HA 1JCSA 2ZISA 4LNGA 1N4QA 1NL4A 1N4SA 3KSLA 1TNBA 1FT2A 3E32A 3Q73A 1O1SA 3PZ3A 1S63A 4GTPA 2H6IA 1JCRA 3SFXA 1S64A 1DCEA 1O5MA 1TNOA 4MBGA 3Q75A 2R2LA 4L9PA 4GTVA 1FT1A 2IEJA 3E37A 1TN7A 1X81A 3DSVA 2H6GA 1MZCA 1N94A 4GTOA 3PZ2A 3HXCA
chains in the Genus database with same CATH superfamily
2F37A 2DZNA 4I6JA 1D8DA 4I6GA 5CEDB 1XNFA 2XENA 3PDNA 4J8FA 5AQAA 4LUNU 3NB2A 4LERA 4K5CA 4WUYA 5EYPF 3CHPA 3BU8A 1OCCE 3S2AA 2ZGDA 3PRZA 4U8HA 3Q7FA 4KT6B 5CHEE 3PEUB 5C1DA 3PNTB 4UI9C 3LKUA 2XRZA 4F1PA 4XI9A 5D66A 3FEYA 1O1TA 4DX5D 1INZA 5KCMA 5HKPA 2LSVA 4UWHA 4B94A 3SZ7A 3MKRA 1TN6A 3CHRA 3CR3A 4RVBA 4N5CA 3R7QA 3SFYA 5ENTD 3FH8A 2HR2A 4PS7A 5HI7A 5KJMA 1YCSB 1E7UA 3FTWA 4AV7A 4G24A 5EIDA 3LVQE 1MYOA 2V5FA 3L16A 3PZ3A 3GYZA 4JW1A 4I2ZA 4L2YA 4JXTA 1SZ9A 4ZFHA 3CK7A 3G2TA 4GU5A 3X2QE 2VQ2A 5LP0A 4I9CA 3DPDA 2J8SD 3CIAA 2WXIA 4DLQA 1OCOE 3HXEA 3RIBA 1QZ2A 4UWGA 4J8EA 3UT4A 4FC8A 3KSQA 2LO6A 3S7DA 3UM3A 4BX8A 4I6EA 3DEPA 2X3MA 2X6KA 4GA2A 3S7FA 3S7JA 1IQRA 3D9IA 3QNKA 3Q79A 2JABA 3RK6A 1KLXA 2CFUA 4J8SA 5FJYA 1IYGA 3FFLA 1MHQA 1H2UA 1EPUA 4LG6A 3HIZA 2C0LA 2R5SA 3QAQA 3VLFA 3BG0B 3CHSA 3NOGD 4KMOA 3FU5A 4HOUA 1H0AA 3B7RL 4FJZA 4UQZA 4HOSA 5CRVA 4HLLA 5EIBE 1U3DA 1JCSA 3MYVA 1U3CA 4ANUA 5KJNA 3KSLA 4BT8A 1KT0A 5HQ8A 3ZIMA 4GMRA 3PVLA 2PM6A 3ISMC 2MRIA 4YVOA 2HE0A 2RFMA 4ANXA 3QJZA 3FUJA 3CVQA 5BXUA 3Q4AB 5B1AE 3HYMB 5E75A 2CHZA 5G05C 3DSVA 4ATZD 3V2XA 3IHVA 4DI3A 3DSTA 3DRAA 2WB2A 4RG9A 3TWRA 3AS4A 3HVEA 5KJLA 2XHEA 3UUXA 4N2QA 4CCAA 4BETA 5EYLA 3QB2A 1Q2ZA 3CHQA 3ULQA 3CKBA 5FIOA 3FUIA 3CK9A 3ULEG 1OWMA 5FQ6A 5KNHD 3D9HA 3AU5A 2XS1A 2VGXB 2PQRA 3IBEA 3TG5A 5BT1A 3QOUA 2DBAA 1L5JA 2KBXA 4HB5A 4A55A 4TXRA 3TJPA 4HOQA 3L17A 2E2EA 5CEAA 3JXIA 4J0UA 4E85A 4PS8A 3HXDA 1E96B 5FT9A 2C0MA 2HM8A 4JB8P 4APOA 5FZQA 4TRQA 1TEZA 2HYZA 4I1OB 4AM9A 4G11A 3RKVA 4HVBA 3RAUA 1PAQA 3I3NA 5BNWA 4UQYA 3RSEG 3BUAA 2LSUA 1E8XA 4WWOA 4MBGA 4L23A 5AAOA 4FADA 5B3SE 4MKTA 3SNXA 1FT1A 3ABME 3J5PA 3TG4A 2GRNB 5D0OD 4B8CB 4U95D 3MV3B 2MOWA 3P1UA 3G2WA 2PM7A 1IXVA 4NQ0A 4U0SA 3PS6A 2OVFA 4LCTA 4DI4A 3NAWA 2XEHA 2ZU6B 2VSXE 2AXVA 4KBQA 2MHKA 3T8MA 3C5RA 4YNDA 2NYJA 3PZDA 3ZXSA 4PS3A 2DCPA 1QBQA 3ENEA 5ANRA 4B8AA 2EQXA 4WWNA 1BLXB 2WXQA 1UN9A 3TXNA 4JHKA 4J6IA 2RD0A 1U2VG 1KPSB 1KZOA 1JUQA 3UIPC 2R59A 3CHOA 1A17A 1SW6A 4JHRA 3LJ3A 3RRUA 4YDYA 3FUDA 3SI5A 2YHCA 4J8YA 2VYIA 4I17A 2BUGA 1BI7B 2VSOE 1DVPA 3Q73A 3SY2A 2J4BA 3FU0A 4GTPA 4K5AB 4CGVA 2EILE 3C3OA 3AG3E 3FTYA 2GRLA 1NFIE 4GAAA 2YNQA 3EU9A 3TWSA 3IKOB 3BG1B 3V30A 2RFAA 4Y6WA 4GTOA 4LNUD 3NBNB 3LYAA 1RW2A 3Q9UC 3MV2B 4JA9A 5KBAA 2IQCA 2Y3AA 3L22A 4U8YD 3EHNA 5EILA 4U96D 4ILIA 3AS5A 4KVMA 1TNYA 2WXGA 3KD7A 4JHJA 4P29A 4GYOA 2XZTG 2EIKE 1HU3A 1WM5A 4FHKA 4KZCA 2B6CA 3MA5A 4EBAA 1N0RA 4EECA 3IEGA 4NURA 4GTSA 5ARGA 5CCLA 4G8KA 4GZDA 4JA7A 5JJ7A 2I6HA 2EINE 5CBOA 2IF4A 3B13A 2GW1A 3D9NA 3ASGA 4GTTA 3L9TA 3B7BA 4HXIA 2L6JA 3LY8A 1TJCA 3TWQA 3JQ0A 4ANVA 1EYHA 1K8KG 5AQBA 4XIFA 1NZNA 2A5EA 4HRLA 1OCRE 2VGYA 3HDXA 3BEEA 2AW6A 4N3CA 5FZSA 4DRXE 4DX2A 3ZYKA 5D0QD 2GRMA 2P58C 2WXFA 5EX3A 3ABLE 4ACKA 1NP7A 2IFUA 2ETBA 1OUVA 1ELKA 3D3MA 5D2MC 5BV1A 1MQSA 1XGWA 4WWPA 3FY4A 4J8DA 1S0PA 4MRUA 2WXLA 2XRYA 5AJLA 3PNLB 3W9FA 1SZAA 1QYMA 4GA0A 4H7YA 2QYJA 2RG8A 1WG0A 3AG4E 3B7UX 5A6CA 4K03A 3CLJA 5BPPA 5IY5E 3ZHEB 4NACA 4XE0A 3Q49B 5AN8A 3FH7A 3UTMA 3FTZA 1K1BA 1RZ4A 3UM0A 3CVLA 5J08A 3DPYA 2AXZA 4KZ0A 1IQUA 3T9KA 3JUIA 1UN8A 3RJVA 3DSSA 4YDEA 2AJAA 3FUKA 2J9QA 3PE4A 2DVWA 3NQPA 3BQOA 2ZISA 1IHGA 5G04C 1N4SA 3NZUA 4PUCA 1V55E 1H19A 3CVVA 4H7XA 4DUIA 5CMWA 5AYWD 3MZLB 4JC8A 4UI9K 2HO1A 1ZBPA 1NA0A 3V31A 2WXNA 4KVOA 4K5BA 2XS8A 3J5QB 4OAUC 4CEMA 4U0ZA 3MKQA 2Q7FA 2CG3A 3FUFA 3ML8A 4EZJA 3ML9A 1N4PA 4GMLA 3RU0A 4XKCA 5G04J 4I1AA 2Y4TA 2LXLA 2P9IG 2VGEA 1PC2A 3L54A 3U4TA 3CSTA 3PZ1A 4GTRA 1PY1A 1SA4A 4TXPA 5LX8A 1N9AA 3FTSA 3UT8A 3VTYA 3VLDA 3MX3A 3S7BA 1Z5SC 3UKRG 5AARA 2QY7A 3IXEA 3SF4A 1OY3D 2I1KA 3CVPA 3WXXA 2GGFA 2H6HA 3O48A 2IO3C 2AXUA 5DBKA 2WXMA 4FP7A 3I4GA 3KS2A 4XI0A 3ZW3A 2VSYA 3FWVA 2WMOA 4TUUA 2QYUA 3PREA 3OXLA 3TAXA 2X6JA 4U7EB 2XEVA 1NA3A 2H6GA 3V79K 3UIOC 3HXCA 4HBDA 3CK8A 1N0QA 5KJKA 1N95A 4TXQA 1Y6IA 1FPPA 5BXOA 5J90A 3Q78A 3TWWA 2WM9A 4FJYA 5FQ8A 2GRPB 2IOLA 3TWTA 3SBTB 4DJAA 2WQHA 3CQCB 1SA5A 4XEIG 3ZYLA 2Y1LE 2I2OA 5EKQD 5CRUA 5AENA 3LJNA 2ILRA 1LF8A 4ME2A 3FULA 4ABNA 2WXKA 2LAIA 5JJ6A 2R05A 1FVFA 4YDWA 3ZYQA 3F6QA 4QFVA 3CVWA 3NOCD 2Y0BG 5FINA 4QQIA 1UOHA 2ONDA 4M7CA 4BSXA 3JCKC 1TNBA 3UQ3A 1H6KA 5AJDA 2OEWA 3FU3A 5FQ7A 3FEXA 3SFXA 4EBAG 4ZHBA 3EIQC 1G3NB 3EHMA 3UXGA 3DXMG 3MGBA 1N94A 3FU6A 3FTXA 1E8WA 1E90A 4WNGA 1QNFA 1HH8A 1BD8A 3RO3A 3TWXA 3ASDA 2DWZA 3LS8A 3CHMA 5LOZA 3HXFA 4GYWA 3ZEFA 3ULYA 4L7TA 2DYSE 4HORA 2F8XK 1OWOA 4GMJA 3D9PA 4DLOA 3LY9A 4G8LA 2KCLA 3RO2A 1E8ZA 3ONKA 5CMYA 3LEWA 3Q9NC 4CDRA 1D8EA 4RLYA 2C2LA 4AJWA 4MS6A 4FU3A 3PH0C 4CGWA 4C48B 3UI2A 2UY1B 4IYPA 1N11A 4BX9A 1UJJA 4LEUA 3AG2E 1D9SA 4CT4A 2DYRE 5C2YA 2MYOA 2CHWA 3EHRA 3G2VA 3JYSA 4ACLA 2LUHA 1JWFA 1OWPA 4E6HA 2NC9A 4IRUA 5BUZA 1S64A 2QC9A 5EN5D 5ARFA 2VSNA 4AVXA 1HS6A 3CVNA 5ENPD 1QQEA 5A7DB 5CERB 3KAEA 2GRQB 3U66A 4UWLA 4BEPA 1TR4A 3UX4A 2WPVA 4KXKB 4D10C 2PNNA 3HVEB 2KXPC 3KEAA 3FP3A 2FI7A 1DC2A 4UI9J 1HF8A 4JPSA 2XGMA 4KYOB 4B0ZA 4AEZC 1TJFA 4URKA 2KCVA 4RQIA 1AWCB 4A1GA 4BESA 2YQ8A 4DPRA 2Y69E 3UMVA 4AY5A 4DX7D 4GZ6A 3RRMB 4OVUA 4BFRA 3PE3A 3OXFA 4OVVA 3LPZA 3E34A 3EU5A 3T5VA 1K1AA 4JL0A 1OCZE 4UWFA 3V2OA 4UUCA 1YMPA 3PZ4A 1MX4A 3I4RB 4B93B 2BKGA 3VLEA 5KWDA 3UM1A 1N4QA 4F7AA 3URZA 2XGSA 1HFAA 2VTBA 4BWRA 2EIJE 4HQDA 3ESKA 4V3IA 4Q69A 2GROB 2OCCE 3P2BA 3B95A 3C98A 2UY1A 1JCRA 4I43A 5T4YA 4AXHA 2GRRB 2R2LA 2VJ8A 3GW4A 1Z3XA 3UKUG 5G05J 3ZNGA 3FTVA 5JA4D 3DWLG 3PEVB 1SQMA 3ONLA 2I9CA 5LFAA 2QZAA 2CFZA 4G26A 2X6HA 4I9EA 4JZYA 3RRNB 1ZU2A 2LNIA 3D9OA 4GTMA 1JWGA 2BEDA 3TL5A 1MX6A 3E33A 2E0IA 2XCBA 4A63B 4HRNA 3PUKA 2I1JA 1H6OA 3K9IA 5ENOD 1TYQG 4CDNA 2WXHA 3CKCA 5FQ4A 4O1PA 2KC7A 3Q7AA 4YDOA 2IONA 2KATA 4BERA 1HG5A 4HOTA 4A3VA 1A5EA 4LNGA 2R03A 3APFA 2XZDG 1DNPA 2CG2A 5JMND 5ENQD 4O1OA 2KCKA 4ANWA 4OAVB 4DK5A 3MKQB 1YYHA 1TNOA 1ELRA 5G2NA 3MEKA 4XZ4A 3CV0A 4Z68A 5JHBA 1BPOA 5FTPA 4UWKA 5AQ9A 1HXIA 5E76A 2L0TB 3G2SA 1WAO1 3DSWA 4G1TA 2R02A 1H6PA 5H7PA 4GA1A 3SD5A 3L82A 1TNUA 3AS8A 4B89A 3FUHA 3ZGQA 3C3QA 4PH4B 2BF0X 3QARA 4DX6D 5ENRD 3MJWA 3AJIA 2ETAA 2F0YA 3LVRE 4EHMA 3APDA 2V4LA 3CEQA 3R9MA 4A3TA 1TNZA 2P9SG 4BSZB 3ZKJA 4ILHB 1OWLA 5FZRA 3TWUA 2P9NG 4CT0A 2FF4A 5T8IA 3ASOE 3L6AA 1JPLA 4HI8A 2WVIA 3VTXA 2F8YA 2J07A 4Q94A 3ASHA 1UG3A 5CCMA 5ANLA 4F53A 4IN3B 1EF1C 2IO2C 3UT7A 3HRAA 2OV8A 3APCA 1OWNA 2B0OE 3FH5A 3DEOA 3FUMA 1O5MA 1B89A 1HX8A 3R7RA 2A5UA 4OYSA 4JVSA 5AQ7A 2OEVA 2IEJA 4GPMA 3E37A 3D9MA 4L2LA 5HRYA 3GZ1A 3QC1A 3GZSA 4FULA 4N39A 1BI8B 3JUEA 3EUVA 2LXMA 1TN8A 4MLPA 4O6FA 4N2SA 4HRMB 3Q47B 1H2TC 1MX2A 2XEEA 2KM4A 1HO8A 3OXGA 4EZKA 1EDUA 1UJKA 5JJTA 3U64A 3KEZA 4AOFA 4GZ5A 2QFCA 2ZGGA 3ZXPA 3SQVA 4L1BA 2IOSA 5A23A 1JCQA 2ETCA 1W3BA 4GZ3A 1Y8MA 4J7WA 2XPIA 3ZU7B 3T8KA 3UINC 4CRWA 2XGOA 4GTQA 3AU4A 2P2CP 2WXOA 4R7LA 3DXKG 4I2WA 1MJ0A 1UW4B 2M63A 1E8YA 1LD8A 5ITZF 3EIJA 1LTXA 1N54A 4FA6A 3ZUVB 4WAFA 1YA0A 4EQFA 4UQXA 2UWJG 2NXPA 4WNDA 3DBSA 4C9BB 4HI9A 3ZRHA 4K0RA 1E7VA 2L6BA 3AAAC 3FDHA 3CSFA 4FLBA 1DCQA 2YINA 4W9RA 3ASNE 2KZTA 4G2VA 2AVPA 2X6IA 4HS2A 1DCEA 4M3OA 2WXRA 4APFA 4BY6A 3Q75A 4GCNA 4Y6CA 3LY7A 4FHJA 4JEUA 1OT8A 2YHEA 4LNBA 4LSZE 4TV3A 3LXUX 1WDYA 5DIZA 4G25A 3TGOA 1AP7A 3IV0A 3C3RA 4NRHB 4RSYA 3ZFWA 1V54E 4WNEA 3SGHA 4C0MA 4G23A 1ZB1A 3SBSA 4BTBA 3FHEA 3WG7E 3E30A 2WMNA 2X6FA 4HFGA 4F3VA 1HG2A 2WXJA 2OOEA 2BTDA 1N52A 3AG1E 4O60A 4JEHA 2JLBA 2H6FA 2FEZA 3DSUA 4X8QA 5JHAA 3U3WA 5BW8C 4ATGA 4U0UA 3ZN3A 4C0EA 2J09A 4XX5A 3HHMA 3TXMA 1P5QA 3OTNA 2FO7A 3QWVA 4ILGA 5AIJA 5CBNA 4U8VD 3L08A 5LCWC 3B7TA 3D9JA 5EX0A 3CGHA 4EZLA 1O1SA 2DZOA 5M72A 2V4HC 3ZHEA 1HE8A 4RG6A 4LRZA 4CDMA 4DX1A 5EDSA 4HNAD 4GTVA 4CZ2D 1TN7A 1X81A 1MZCA 2V0PA 3ZYMA 4AP2A 3G2UA 3IHYA 2ZXWE 3Q5MA 2BKKB 2KZTB 4BTAA 3D9KA 2ZIRA 2FBNA 2NSZA 4IULA 2WXPA 5KNGA 2JEKA 1S70B 2Y4UA 3DSXA 3QWPA 2J08A 2RKKA 4N3BA 5ENSD 3C72A 5FWQA 3HXBA 1H2VC 2J4DA 3UM2A 1ELWA 1KZPA 4CYMD 3Q15A 4GZCA 3NZSA 4WNFA 2XPYA 5BV0A 3QKYA 1X5BA 1N4RA 3JQ1A 2IU1A 2IJGX 4U04A 3CVUA 4GPKA 1SVXA 2L9BA 3MCXA 2L0IA 1GW6A 4GCOA 4YVQC 4F1SA 4GYYA 2VGXA 2EIME 3D9LA 5T3RA 1OXJA 2AWIA 3E4BA 4AIFA 2P9LG 3JXJA 4U63A 3N71A 4XKBA 3U9WA 5G55A 3FUNA 3SFZA 4L9PA 2A4ZA 2P9UG 2J49A 1Z6TA 2WQ7A 2XPZA 1Z3YA 1IKND 5HS0A 3LCAA 4JD2G 3W9GA 1O1RA 2DIWA 2V8SE 3FTUA 2PQNA 3UPVA 5B1BE 1K3ZD 3CVYA 3L13A 4U07A 1FVHA 3ZPJA 3QK0A 2WQ6A 3FUEA 3I5PA 2VTBB 4TUMA 4A1SA 2R17C 3ABKE 4Q96A 2PL2A 3NF1A 1LD7A 2IY0C 4PDXA 3R9AB 4F6RD 2FULA 3ZVVA 3SHFA 3GZ2A 1NI1A 2X38A 3TWVA 3T5XA 3EDTB 3HG0D 3CQGB 3ESLA 3EHQA 3QWWA 2P9KG 3SO8A 2P9PG 1HZ4A 1BU9A 2LAHA 4FLHA 2FO1E 2PZIA 4AY6A 5LCWJ 1NL4A 3QDNA 1KT1A 4N5QA 1FT2A 1IHBA 3E32A 3ASFA 2XCCA 1WY6A 4EPZA 4BT9A 3B7SA 1FCHA 4GB9A 4HLEA 3EJNA 1S63A 2XQ0A 4NIKA 4N3AA 2H6IA 3LDZA 2OVBA 3OAWA 2V5QC 4I1MA 5CECB 1VDYA 5ENNA 3PUJA 2CHXA 3CVXA 3O4ZA 3PZ2A
chains in the Genus database with same CATH topology
1O1RA 3DSTA 3DRAA 1D8DA 3HXEA 3DSWA 4LNBA 1N95A 3EUVA 1TN8A 1FPPA 3KSQA 3Q78A 2ZIRA 1TNUA 3HXFA 1N4PA 1TNYA 3DSXA 3Q7FA 4GTMA 2BEDA 3E30A 3E33A 1SA5A 1LD7A 1QBQA 3Q79A 1O1TA 3PZ1A 4GTRA 1SA4A 3C72A 2F0YA 4EHMA 3HXBA 1JCQA 2H6FA 1NI1A 1TNZA 1N9AA 3DSUA 1D8EA 4GTQA 4GTSA 1TN6A 1KZPA 3E34A 3EU5A 3DPYA 3SFYA 3Q7AA 4YDOA 1KZOA 1LD8A 3PZ4A 1LTXA 1N4RA 3DSSA 3HXDA 4YDEA 4GTTA 2H6HA 1JCSA 2ZISA 4LNGA 1N4QA 1NL4A 1N4SA 3KSLA 1TNBA 1FT2A 3E32A 3Q73A 1O1SA 3PZ3A 1S63A 4GTPA 2H6IA 1JCRA 3SFXA 1S64A 1DCEA 1O5MA 1TNOA 4MBGA 3Q75A 2R2LA 4L9PA 4GTVA 1FT1A 2IEJA 3E37A 1TN7A 1X81A 3DSVA 2H6GA 1MZCA 1N94A 4GTOA 3PZ2A 3HXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1R A;  3DST A;  3DRA A;  1D8D A;  3HXE A;  3DSW A;  4LNB A;  1N95 A;  3EUV A;  1TN8 A;  1FPP A;  3KSQ A;  3Q78 A;  2ZIR A;  1TNU A;  3HXF A;  1N4P A;  1TNY A;  3DSX A;  3Q7F A;  4GTM A;  2BED A;  3E30 A;  3E33 A;  1SA5 A;  1LD7 A;  1QBQ A;  3Q79 A;  1O1T A;  3PZ1 A;  4GTR A;  1SA4 A;  3C72 A;  2F0Y A;  4EHM A;  3HXB A;  1JCQ A;  2H6F A;  1NI1 A;  1TNZ A;  1N9A A;  3DSU A;  1D8E A;  4GTQ A;  4GTS A;  1TN6 A;  1KZP A;  3E34 A;  3EU5 A;  3DPY A;  3SFY A;  3Q7A A;  4YDO A;  1KZO A;  1LD8 A;  3PZ4 A;  1LTX A;  1N4R A;  3DSS A;  3HXD A;  4YDE A;  4GTT A;  2H6H A;  1JCS A;  2ZIS A;  4LNG A;  1N4Q A;  1NL4 A;  1N4S A;  3KSL A;  1TNB A;  1FT2 A;  3E32 A;  3Q73 A;  1O1S A;  3PZ3 A;  1S63 A;  4GTP A;  2H6I A;  1JCR A;  3SFX A;  1S64 A;  1DCE A;  1O5M A;  1TNO A;  4MBG A;  3Q75 A;  2R2L A;  4L9P A;  4GTV A;  1FT1 A;  2IEJ A;  3E37 A;  1TN7 A;  1X81 A;  3DSV A;  2H6G A;  1MZC A;  1N94 A;  4GTO A;  3PZ2 A;  3HXC A; 
#chains in the Genus database with same CATH topology
 2F37 A;  2DZN A;  4I6J A;  1D8D A;  4I6G A;  5CED B;  1XNF A;  2XEN A;  3PDN A;  4J8F A;  5AQA A;  4LUN U;  3NB2 A;  4LER A;  4K5C A;  4WUY A;  5EYP F;  3CHP A;  3BU8 A;  1OCC E;  3S2A A;  2ZGD A;  3PRZ A;  4U8H A;  3Q7F A;  4KT6 B;  5CHE E;  3PEU B;  5C1D A;  3PNT B;  4UI9 C;  3LKU A;  2XRZ A;  4F1P A;  4XI9 A;  5D66 A;  3FEY A;  1O1T A;  4DX5 D;  1INZ A;  5KCM A;  5HKP A;  2LSV A;  4UWH A;  4B94 A;  3SZ7 A;  3MKR A;  1TN6 A;  3CHR A;  3CR3 A;  4RVB A;  4N5C A;  3R7Q A;  3SFY A;  5ENT D;  3FH8 A;  2HR2 A;  4PS7 A;  5HI7 A;  5KJM A;  1YCS B;  1E7U A;  3FTW A;  4AV7 A;  4G24 A;  5EID A;  3LVQ E;  1MYO A;  2V5F A;  3L16 A;  3PZ3 A;  3GYZ A;  4JW1 A;  4I2Z A;  4L2Y A;  4JXT A;  1SZ9 A;  4ZFH A;  3CK7 A;  3G2T A;  4GU5 A;  3X2Q E;  2VQ2 A;  5LP0 A;  4I9C A;  3DPD A;  2J8S D;  3CIA A;  2WXI A;  4DLQ A;  1OCO E;  3HXE A;  3RIB A;  1QZ2 A;  4UWG A;  4J8E A;  3UT4 A;  4FC8 A;  3KSQ A;  2LO6 A;  3S7D A;  3UM3 A;  4BX8 A;  4I6E A;  3DEP A;  2X3M A;  2X6K A;  4GA2 A;  3S7F A;  3S7J A;  1IQR A;  3D9I A;  3QNK A;  3Q79 A;  2JAB A;  3RK6 A;  1KLX A;  2CFU A;  4J8S A;  5FJY A;  1IYG A;  3FFL A;  1MHQ A;  1H2U A;  1EPU A;  4LG6 A;  3HIZ A;  2C0L A;  2R5S A;  3QAQ A;  3VLF A;  3BG0 B;  3CHS A;  3NOG D;  4KMO A;  3FU5 A;  4HOU A;  1H0A A;  3B7R L;  4FJZ A;  4UQZ A;  4HOS A;  5CRV A;  4HLL A;  5EIB E;  1U3D A;  1JCS A;  3MYV A;  1U3C A;  4ANU A;  5KJN A;  3KSL A;  4BT8 A;  1KT0 A;  5HQ8 A;  3ZIM A;  4GMR A;  3PVL A;  2PM6 A;  3ISM C;  2MRI A;  4YVO A;  2HE0 A;  2RFM A;  4ANX A;  3QJZ A;  3FUJ A;  3CVQ A;  5BXU A;  3Q4A B;  5B1A E;  3HYM B;  5E75 A;  2CHZ A;  5G05 C;  3DSV A;  4ATZ D;  3V2X A;  3IHV A;  4DI3 A;  3DST A;  3DRA A;  2WB2 A;  4RG9 A;  3TWR A;  3AS4 A;  3HVE A;  5KJL A;  2XHE A;  3UUX A;  4N2Q A;  4CCA A;  4BET A;  5EYL A;  3QB2 A;  1Q2Z A;  3CHQ A;  3ULQ A;  3CKB A;  5FIO A;  3FUI A;  3CK9 A;  3ULE G;  1OWM A;  5FQ6 A;  5KNH D;  3D9H A;  3AU5 A;  2XS1 A;  2VGX B;  2PQR A;  3IBE A;  3TG5 A;  5BT1 A;  3QOU A;  2DBA A;  1L5J A;  2KBX A;  4HB5 A;  4A55 A;  4TXR A;  3TJP A;  4HOQ A;  3L17 A;  2E2E A;  5CEA A;  3JXI A;  4J0U A;  4E85 A;  4PS8 A;  3HXD A;  1E96 B;  5FT9 A;  2C0M A;  2HM8 A;  4JB8 P;  4APO A;  5FZQ A;  4TRQ A;  1TEZ A;  2HYZ A;  4I1O B;  4AM9 A;  4G11 A;  3RKV A;  4HVB A;  3RAU A;  1PAQ A;  3I3N A;  5BNW A;  4UQY A;  3RSE G;  3BUA A;  2LSU A;  1E8X A;  4WWO A;  4MBG A;  4L23 A;  5AAO A;  4FAD A;  5B3S E;  4MKT A;  3SNX A;  1FT1 A;  3ABM E;  3J5P A;  3TG4 A;  2GRN B;  5D0O D;  4B8C B;  4U95 D;  3MV3 B;  2MOW A;  3P1U A;  3G2W A;  2PM7 A;  1IXV A;  4NQ0 A;  4U0S A;  3PS6 A;  2OVF A;  4LCT A;  4DI4 A;  3NAW A;  2XEH A;  2ZU6 B;  2VSX E;  2AXV A;  4KBQ A;  2MHK A;  3T8M A;  3C5R A;  4YND A;  2NYJ A;  3PZD A;  3ZXS A;  4PS3 A;  2DCP A;  1QBQ A;  3ENE A;  5ANR A;  4B8A A;  2EQX A;  4WWN A;  1BLX B;  2WXQ A;  1UN9 A;  3TXN A;  4JHK A;  4J6I A;  2RD0 A;  1U2V G;  1KPS B;  1KZO A;  1JUQ A;  3UIP C;  2R59 A;  3CHO A;  1A17 A;  1SW6 A;  4JHR A;  3LJ3 A;  3RRU A;  4YDY A;  3FUD A;  3SI5 A;  2YHC A;  4J8Y A;  2VYI A;  4I17 A;  2BUG A;  1BI7 B;  2VSO E;  1DVP A;  3Q73 A;  3SY2 A;  2J4B A;  3FU0 A;  4GTP A;  4K5A B;  4CGV A;  2EIL E;  3C3O A;  3AG3 E;  3FTY A;  2GRL A;  1NFI E;  4GAA A;  2YNQ A;  3EU9 A;  3TWS A;  3IKO B;  3BG1 B;  3V30 A;  2RFA A;  4Y6W A;  4GTO A;  4LNU D;  3NBN B;  3LYA A;  1RW2 A;  3Q9U C;  3MV2 B;  4JA9 A;  5KBA A;  2IQC A;  2Y3A A;  3L22 A;  4U8Y D;  3EHN A;  5EIL A;  4U96 D;  4ILI A;  3AS5 A;  4KVM A;  1TNY A;  2WXG A;  3KD7 A;  4JHJ A;  4P29 A;  4GYO A;  2XZT G;  2EIK E;  1HU3 A;  1WM5 A;  4FHK A;  4KZC A;  2B6C A;  3MA5 A;  4EBA A;  1N0R A;  4EEC A;  3IEG A;  4NUR A;  4GTS A;  5ARG A;  5CCL A;  4G8K A;  4GZD A;  4JA7 A;  5JJ7 A;  2I6H A;  2EIN E;  5CBO A;  2IF4 A;  3B13 A;  2GW1 A;  3D9N A;  3ASG A;  4GTT A;  3L9T A;  3B7B A;  4HXI A;  2L6J A;  3LY8 A;  1TJC A;  3TWQ A;  3JQ0 A;  4ANV A;  1EYH A;  1K8K G;  5AQB A;  4XIF A;  1NZN A;  2A5E A;  4HRL A;  1OCR E;  2VGY A;  3HDX A;  3BEE A;  2AW6 A;  4N3C A;  5FZS A;  4DRX E;  4DX2 A;  3ZYK A;  5D0Q D;  2GRM A;  2P58 C;  2WXF A;  5EX3 A;  3ABL E;  4ACK A;  1NP7 A;  2IFU A;  2ETB A;  1OUV A;  1ELK A;  3D3M A;  5D2M C;  5BV1 A;  1MQS A;  1XGW A;  4WWP A;  3FY4 A;  4J8D A;  1S0P A;  4MRU A;  2WXL A;  2XRY A;  5AJL A;  3PNL B;  3W9F A;  1SZA A;  1QYM A;  4GA0 A;  4H7Y A;  2QYJ A;  2RG8 A;  1WG0 A;  3AG4 E;  3B7U X;  5A6C A;  4K03 A;  3CLJ A;  5BPP A;  5IY5 E;  3ZHE B;  4NAC A;  4XE0 A;  3Q49 B;  5AN8 A;  3FH7 A;  3UTM A;  3FTZ A;  1K1B A;  1RZ4 A;  3UM0 A;  3CVL A;  5J08 A;  3DPY A;  2AXZ A;  4KZ0 A;  1IQU A;  3T9K A;  3JUI A;  1UN8 A;  3RJV A;  3DSS A;  4YDE A;  2AJA A;  3FUK A;  2J9Q A;  3PE4 A;  2DVW A;  3NQP A;  3BQO A;  2ZIS A;  1IHG A;  5G04 C;  1N4S A;  3NZU A;  4PUC A;  1V55 E;  1H19 A;  3CVV A;  4H7X A;  4DUI A;  5CMW A;  5AYW D;  3MZL B;  4JC8 A;  4UI9 K;  2HO1 A;  1ZBP A;  1NA0 A;  3V31 A;  2WXN A;  4KVO A;  4K5B A;  2XS8 A;  3J5Q B;  4OAU C;  4CEM A;  4U0Z A;  3MKQ A;  2Q7F A;  2CG3 A;  3FUF A;  3ML8 A;  4EZJ A;  3ML9 A;  1N4P A;  4GML A;  3RU0 A;  4XKC A;  5G04 J;  4I1A A;  2Y4T A;  2LXL A;  2P9I G;  2VGE A;  1PC2 A;  3L54 A;  3U4T A;  3CST A;  3PZ1 A;  4GTR A;  1PY1 A;  1SA4 A;  4TXP A;  5LX8 A;  1N9A A;  3FTS A;  3UT8 A;  3VTY A;  3VLD A;  3MX3 A;  3S7B A;  1Z5S C;  3UKR G;  5AAR A;  2QY7 A;  3IXE A;  3SF4 A;  1OY3 D;  2I1K A;  3CVP A;  3WXX A;  2GGF A;  2H6H A;  3O48 A;  2IO3 C;  2AXU A;  5DBK A;  2WXM A;  4FP7 A;  3I4G A;  3KS2 A;  4XI0 A;  3ZW3 A;  2VSY A;  3FWV A;  2WMO A;  4TUU A;  2QYU A;  3PRE A;  3OXL A;  3TAX A;  2X6J A;  4U7E B;  2XEV A;  1NA3 A;  2H6G A;  3V79 K;  3UIO C;  3HXC A;  4HBD A;  3CK8 A;  1N0Q A;  5KJK A;  1N95 A;  4TXQ A;  1Y6I A;  1FPP A;  5BXO A;  5J90 A;  3Q78 A;  3TWW A;  2WM9 A;  4FJY A;  5FQ8 A;  2GRP B;  2IOL A;  3TWT A;  3SBT B;  4DJA A;  2WQH A;  3CQC B;  1SA5 A;  4XEI G;  3ZYL A;  2Y1L E;  2I2O A;  5EKQ D;  5CRU A;  5AEN A;  3LJN A;  2ILR A;  1LF8 A;  4ME2 A;  3FUL A;  4ABN A;  2WXK A;  2LAI A;  5JJ6 A;  2R05 A;  1FVF A;  4YDW A;  3ZYQ A;  3F6Q A;  4QFV A;  3CVW A;  3NOC D;  2Y0B G;  5FIN A;  4QQI A;  1UOH A;  2OND A;  4M7C A;  4BSX A;  3JCK C;  1TNB A;  3UQ3 A;  1H6K A;  5AJD A;  2OEW A;  3FU3 A;  5FQ7 A;  3FEX A;  3SFX A;  4EBA G;  4ZHB A;  3EIQ C;  1G3N B;  3EHM A;  3UXG A;  3DXM G;  3MGB A;  1N94 A;  3FU6 A;  3FTX A;  1E8W A;  1E90 A;  4WNG A;  1QNF A;  1HH8 A;  1BD8 A;  3RO3 A;  3TWX A;  3ASD A;  2DWZ A;  3LS8 A;  3CHM A;  5LOZ A;  3HXF A;  4GYW A;  3ZEF A;  3ULY A;  4L7T A;  2DYS E;  4HOR A;  2F8X K;  1OWO A;  4GMJ A;  3D9P A;  4DLO A;  3LY9 A;  4G8L A;  2KCL A;  3RO2 A;  1E8Z A;  3ONK A;  5CMY A;  3LEW A;  3Q9N C;  4CDR A;  1D8E A;  4RLY A;  2C2L A;  4AJW A;  4MS6 A;  4FU3 A;  3PH0 C;  4CGW A;  4C48 B;  3UI2 A;  2UY1 B;  4IYP A;  1N11 A;  4BX9 A;  1UJJ A;  4LEU A;  3AG2 E;  1D9S A;  4CT4 A;  2DYR E;  5C2Y A;  2MYO A;  2CHW A;  3EHR A;  3G2V A;  3JYS A;  4ACL A;  2LUH A;  1JWF A;  1OWP A;  4E6H A;  2NC9 A;  4IRU A;  5BUZ A;  1S64 A;  2QC9 A;  5EN5 D;  5ARF A;  2VSN A;  4AVX A;  1HS6 A;  3CVN A;  5ENP D;  1QQE A;  5A7D B;  5CER B;  3KAE A;  2GRQ B;  3U66 A;  4UWL A;  4BEP A;  1TR4 A;  3UX4 A;  2WPV A;  4KXK B;  4D10 C;  2PNN A;  3HVE B;  2KXP C;  3KEA A;  3FP3 A;  2FI7 A;  1DC2 A;  4UI9 J;  1HF8 A;  4JPS A;  2XGM A;  4KYO B;  4B0Z A;  4AEZ C;  1TJF A;  4URK A;  2KCV A;  4RQI A;  1AWC B;  4A1G A;  4BES A;  2YQ8 A;  4DPR A;  2Y69 E;  3UMV A;  4AY5 A;  4DX7 D;  4GZ6 A;  3RRM B;  4OVU A;  4BFR A;  3PE3 A;  3OXF A;  4OVV A;  3LPZ A;  3E34 A;  3EU5 A;  3T5V A;  1K1A A;  4JL0 A;  1OCZ E;  4UWF A;  3V2O A;  4UUC A;  1YMP A;  3PZ4 A;  1MX4 A;  3I4R B;  4B93 B;  2BKG A;  3VLE A;  5KWD A;  3UM1 A;  1N4Q A;  4F7A A;  3URZ A;  2XGS A;  1HFA A;  2VTB A;  4BWR A;  2EIJ E;  4HQD A;  3ESK A;  4V3I A;  4Q69 A;  2GRO B;  2OCC E;  3P2B A;  3B95 A;  3C98 A;  2UY1 A;  1JCR A;  4I43 A;  5T4Y A;  4AXH A;  2GRR B;  2R2L A;  2VJ8 A;  3GW4 A;  1Z3X A;  3UKU G;  5G05 J;  3ZNG A;  3FTV A;  5JA4 D;  3DWL G;  3PEV B;  1SQM A;  3ONL A;  2I9C A;  5LFA A;  2QZA A;  2CFZ A;  4G26 A;  2X6H A;  4I9E A;  4JZY A;  3RRN B;  1ZU2 A;  2LNI A;  3D9O A;  4GTM A;  1JWG A;  2BED A;  3TL5 A;  1MX6 A;  3E33 A;  2E0I A;  2XCB A;  4A63 B;  4HRN A;  3PUK A;  2I1J A;  1H6O A;  3K9I A;  5ENO D;  1TYQ G;  4CDN A;  2WXH A;  3CKC A;  5FQ4 A;  4O1P A;  2KC7 A;  3Q7A A;  4YDO A;  2ION A;  2KAT A;  4BER A;  1HG5 A;  4HOT A;  4A3V A;  1A5E A;  4LNG A;  2R03 A;  3APF A;  2XZD G;  1DNP A;  2CG2 A;  5JMN D;  5ENQ D;  4O1O A;  2KCK A;  4ANW A;  4OAV B;  4DK5 A;  3MKQ B;  1YYH A;  1TNO A;  1ELR A;  5G2N A;  3MEK A;  4XZ4 A;  3CV0 A;  4Z68 A;  5JHB A;  1BPO A;  5FTP A;  4UWK A;  5AQ9 A;  1HXI A;  5E76 A;  2L0T B;  3G2S A;  1WAO 1;  3DSW A;  4G1T A;  2R02 A;  1H6P A;  5H7P A;  4GA1 A;  3SD5 A;  3L82 A;  1TNU A;  3AS8 A;  4B89 A;  3FUH A;  3ZGQ A;  3C3Q A;  4PH4 B;  2BF0 X;  3QAR A;  4DX6 D;  5ENR D;  3MJW A;  3AJI A;  2ETA A;  2F0Y A;  3LVR E;  4EHM A;  3APD A;  2V4L A;  3CEQ A;  3R9M A;  4A3T A;  1TNZ A;  2P9S G;  4BSZ B;  3ZKJ A;  4ILH B;  1OWL A;  5FZR A;  3TWU A;  2P9N G;  4CT0 A;  2FF4 A;  5T8I A;  3ASO E;  3L6A A;  1JPL A;  4HI8 A;  2WVI A;  3VTX A;  2F8Y A;  2J07 A;  4Q94 A;  3ASH A;  1UG3 A;  5CCM A;  5ANL A;  4F53 A;  4IN3 B;  1EF1 C;  2IO2 C;  3UT7 A;  3HRA A;  2OV8 A;  3APC A;  1OWN A;  2B0O E;  3FH5 A;  3DEO A;  3FUM A;  1O5M A;  1B89 A;  1HX8 A;  3R7R A;  2A5U A;  4OYS A;  4JVS A;  5AQ7 A;  2OEV A;  2IEJ A;  4GPM A;  3E37 A;  3D9M A;  4L2L A;  5HRY A;  3GZ1 A;  3QC1 A;  3GZS A;  4FUL A;  4N39 A;  1BI8 B;  3JUE A;  3EUV A;  2LXM A;  1TN8 A;  4MLP A;  4O6F A;  4N2S A;  4HRM B;  3Q47 B;  1H2T C;  1MX2 A;  2XEE A;  2KM4 A;  1HO8 A;  3OXG A;  4EZK A;  1EDU A;  1UJK A;  5JJT A;  3U64 A;  3KEZ A;  4AOF A;  4GZ5 A;  2QFC A;  2ZGG A;  3ZXP A;  3SQV A;  4L1B A;  2IOS A;  5A23 A;  1JCQ A;  2ETC A;  1W3B A;  4GZ3 A;  1Y8M A;  4J7W A;  2XPI A;  3ZU7 B;  3T8K A;  3UIN C;  4CRW A;  2XGO A;  4GTQ A;  3AU4 A;  2P2C P;  2WXO A;  4R7L A;  3DXK G;  4I2W A;  1MJ0 A;  1UW4 B;  2M63 A;  1E8Y A;  1LD8 A;  5ITZ F;  3EIJ A;  1LTX A;  1N54 A;  4FA6 A;  3ZUV B;  4WAF A;  1YA0 A;  4EQF A;  4UQX A;  2UWJ G;  2NXP A;  4WND A;  3DBS A;  4C9B B;  4HI9 A;  3ZRH A;  4K0R A;  1E7V A;  2L6B A;  3AAA C;  3FDH A;  3CSF A;  4FLB A;  1DCQ A;  2YIN A;  4W9R A;  3ASN E;  2KZT A;  4G2V A;  2AVP A;  2X6I A;  4HS2 A;  1DCE A;  4M3O A;  2WXR A;  4APF A;  4BY6 A;  3Q75 A;  4GCN A;  4Y6C A;  3LY7 A;  4FHJ A;  4JEU A;  1OT8 A;  2YHE A;  4LNB A;  4LSZ E;  4TV3 A;  3LXU X;  1WDY A;  5DIZ A;  4G25 A;  3TGO A;  1AP7 A;  3IV0 A;  3C3R A;  4NRH B;  4RSY A;  3ZFW A;  1V54 E;  4WNE A;  3SGH A;  4C0M A;  4G23 A;  1ZB1 A;  3SBS A;  4BTB A;  3FHE A;  3WG7 E;  3E30 A;  2WMN A;  2X6F A;  4HFG A;  4F3V A;  1HG2 A;  2WXJ A;  2OOE A;  2BTD A;  1N52 A;  3AG1 E;  4O60 A;  4JEH A;  2JLB A;  2H6F A;  2FEZ A;  3DSU A;  4X8Q A;  5JHA A;  3U3W A;  5BW8 C;  4ATG A;  4U0U A;  3ZN3 A;  4C0E A;  2J09 A;  4XX5 A;  3HHM A;  3TXM A;  1P5Q A;  3OTN A;  2FO7 A;  3QWV A;  4ILG A;  5AIJ A;  5CBN A;  4U8V D;  3L08 A;  5LCW C;  3B7T A;  3D9J A;  5EX0 A;  3CGH A;  4EZL A;  1O1S A;  2DZO A;  5M72 A;  2V4H C;  3ZHE A;  1HE8 A;  4RG6 A;  4LRZ A;  4CDM A;  4DX1 A;  5EDS A;  4HNA D;  4GTV A;  4CZ2 D;  1TN7 A;  1X81 A;  1MZC A;  2V0P A;  3ZYM A;  4AP2 A;  3G2U A;  3IHY A;  2ZXW E;  3Q5M A;  2BKK B;  2KZT B;  4BTA A;  3D9K A;  2ZIR A;  2FBN A;  2NSZ A;  4IUL A;  2WXP A;  5KNG A;  2JEK A;  1S70 B;  2Y4U A;  3DSX A;  3QWP A;  2J08 A;  2RKK A;  4N3B A;  5ENS D;  3C72 A;  5FWQ A;  3HXB A;  1H2V C;  2J4D A;  3UM2 A;  1ELW A;  1KZP A;  4CYM D;  3Q15 A;  4GZC A;  3NZS A;  4WNF A;  2XPY A;  5BV0 A;  3QKY A;  1X5B A;  1N4R A;  3JQ1 A;  2IU1 A;  2IJG X;  4U04 A;  3CVU A;  4GPK A;  1SVX A;  2L9B A;  3MCX A;  2L0I A;  1GW6 A;  4GCO A;  4YVQ C;  4F1S A;  4GYY A;  2VGX A;  2EIM E;  3D9L A;  5T3R A;  1OXJ A;  2AWI A;  3E4B A;  4AIF A;  2P9L G;  3JXJ A;  4U63 A;  3N71 A;  4XKB A;  3U9W A;  5G55 A;  3FUN A;  3SFZ A;  4L9P A;  2A4Z A;  2P9U G;  2J49 A;  1Z6T A;  2WQ7 A;  2XPZ A;  1Z3Y A;  1IKN D;  5HS0 A;  3LCA A;  4JD2 G;  3W9G A;  1O1R A;  2DIW A;  2V8S E;  3FTU A;  2PQN A;  3UPV A;  5B1B E;  1K3Z D;  3CVY A;  3L13 A;  4U07 A;  1FVH A;  3ZPJ A;  3QK0 A;  2WQ6 A;  3FUE A;  3I5P A;  2VTB B;  4TUM A;  4A1S A;  2R17 C;  3ABK E;  4Q96 A;  2PL2 A;  3NF1 A;  1LD7 A;  2IY0 C;  4PDX A;  3R9A B;  4F6R D;  2FUL A;  3ZVV A;  3SHF A;  3GZ2 A;  1NI1 A;  2X38 A;  3TWV A;  3T5X A;  3EDT B;  3HG0 D;  3CQG B;  3ESL A;  3EHQ A;  3QWW A;  2P9K G;  3SO8 A;  2P9P G;  1HZ4 A;  1BU9 A;  2LAH A;  4FLH A;  2FO1 E;  2PZI A;  4AY6 A;  5LCW J;  1NL4 A;  3QDN A;  1KT1 A;  4N5Q A;  1FT2 A;  1IHB A;  3E32 A;  3ASF A;  2XCC A;  1WY6 A;  4EPZ A;  4BT9 A;  3B7S A;  1FCH A;  4GB9 A;  4HLE A;  3EJN A;  1S63 A;  2XQ0 A;  4NIK A;  4N3A A;  2H6I A;  3LDZ A;  2OVB A;  3OAW A;  2V5Q C;  4I1M A;  5CEC B;  1VDY A;  5ENN A;  3PUJ A;  2CHX A;  3CVX A;  3O4Z A;  3PZ2 A; 
#chains in the Genus database with same CATH homology
 1O1R A;  3DST A;  3DRA A;  1D8D A;  3HXE A;  3DSW A;  4LNB A;  1N95 A;  3EUV A;  1TN8 A;  1FPP A;  3KSQ A;  3Q78 A;  2ZIR A;  1TNU A;  3HXF A;  1N4P A;  1TNY A;  3DSX A;  3Q7F A;  4GTM A;  2BED A;  3E30 A;  3E33 A;  1SA5 A;  1LD7 A;  1QBQ A;  3Q79 A;  1O1T A;  3PZ1 A;  4GTR A;  1SA4 A;  3C72 A;  2F0Y A;  4EHM A;  3HXB A;  1JCQ A;  2H6F A;  1NI1 A;  1TNZ A;  1N9A A;  3DSU A;  1D8E A;  4GTQ A;  4GTS A;  1TN6 A;  1KZP A;  3E34 A;  3EU5 A;  3DPY A;  3SFY A;  3Q7A A;  4YDO A;  1KZO A;  1LD8 A;  3PZ4 A;  1LTX A;  1N4R A;  3DSS A;  3HXD A;  4YDE A;  4GTT A;  2H6H A;  1JCS A;  2ZIS A;  4LNG A;  1N4Q A;  1NL4 A;  1N4S A;  3KSL A;  1TNB A;  1FT2 A;  3E32 A;  3Q73 A;  1O1S A;  3PZ3 A;  1S63 A;  4GTP A;  2H6I A;  1JCR A;  3SFX A;  1S64 A;  1DCE A;  1O5M A;  1TNO A;  4MBG A;  3Q75 A;  2R2L A;  4L9P A;  4GTV A;  1FT1 A;  2IEJ A;  3E37 A;  1TN7 A;  1X81 A;  3DSV A;  2H6G A;  1MZC A;  1N94 A;  4GTO A;  3PZ2 A;  3HXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...