4EQFA

Trip8b-1a#206-567 interacting with the carboxy-terminal seven residues of hcn2
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
281
Chain Sequence
GYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/transport protein
molecule keywords PEX5-related protein
publication title Structure and stoichiometry of an accessory subunit TRIP8b interaction with hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
total genus 107
structure length 281
sequence length 312
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4eqfA00
4NRHB 4UQZA 4U0SA 2UWJG 1TJCA 3MV2B 4JHRA 4H7XA 5HI7A 3QWPA 5CCLA 4CDRA 3QWVA 1W3BA 4GCOA 3BEEA 1XNFA 4U07A 3Q47B 2R5SA 4WUYA 4WNGA 4KBQA 4A1SA 2KCKA 5EKQD 3JYSA 3CVPA 3CEQA 3AS5A 2XGSA 3ULQA 4YVOA 1QQEA 4CGWA 4UQYA 2C2LA 2NC9A 3OXFA 3Q49B 3U3WA 2P58C 1A17A 5C1DA 5G05J 2IF4A 2I6HA 4GYOA 5M72A 2LNIA 3KS2A 3MEKA 3TAXA 3UQ3A 4HOUA 3RO2A 3NF1A 4GZ3A 3RJVA 5KJMA 4N3AA 3AS8A 3FWVA 3ESKA 2E2EA 3R9AB 4HOSA 2FEZA 2PQRA 4UI9C 1ELRA 5FTPA 2Y4TA 3AS4A 4AM9A 1ZU2A 3PE4A 1NA3A 1ZBPA 3CKCA 3PDNA 2UY1B 5DBKA 2QFCA 3U4TA 2YHCA 4N2SA 4XIFA 3ZPJA 2WQHA 3SZ7A 4EQFA 3UPVA 2V5FA 2XEVA 2VYIA 4N3CA 5G04C 4N2QA 3VTYA 2C0MA 5FJYA 2VSNA 5LCWC 2HO1A 1WAO1 2AVPA 2PZIA 5KJKA 4G26A 3S7DA 3WXXA 1P5QA 5KJLA 4N39A 4KYOB 3TG4A 4LEUA 5AYWD 3ASGA 5BNWA 3KD7A 1KLXA 3UUXA 2VQ2A 3CKBA 3ASDA 4J8FA 2XGOA 4F3VA 1PC2A 5A6CA 4GZ5A 4XI0A 4GA2A 3IEGA 1B89A 3LY8A 1Y8MA 3Q15A 3RIBA 3RKVA 2XCCA 2KCVA 5CHEE 4G2VA 2XCBA 5A7DB 4WNEA 3FFLA 2UY1A 4ME2A 2XPIA 2LSVA 4ABNA 4WNFA 4XI9A 2XGMA 4UI9J 5D0QD 3ZN3A 3GYZA 2FBNA 1HZ4A 2FF4A 1NA0A 3OXLA 4JA7A 1FCHA 5ARGA 2MHKA 5FT9A 2LSUA 3Q4AB 4BT8A 3SF4A 2Y4UA 4BT9A 1YA0A 4Y6WA 3GW4A 4U0UA 3RO3A 4CGVA 3ZHEB 3QKYA 4UI9K 5G04J 4I9CA 3EDTB 5JJTA 4J8EA 1HH8A 3TG5A 4I17A 3CV0A 2FI7A 2FO7A 4HOTA 4GCNA 1KT1A 5FZQA 4G24A 4KXKB 3CVNA 4HORA 2IFUA 4U0ZA 1IYGA 3RU0A 4U04A 3CK7A 1KT0A 4G25A 3KAEA 4W9RA 4J8DA 5BT1A 4UQXA 5JJ6A 4GYYA 5D0OD 4AY6A 4YVQC 2ONDA 5FZSA 4GPKA 3VTXA 1HXIA 3QWWA 5JJ7A 4BWRA 4GYWA 2HR2A 4B94A 3LY9A 5EX0A 2JLBA 4GZ6A 2YQ8A 2C0LA 4APOA 5HQ8A 5KJNA 5BW8C 2VGXA 4JA9A 3N71A 5DIZA 1IHGA 3O48A 4BTAA 4I1AA 3ASFA 2VSYA 1NZNA 2WPVA 4GA1A 3LCAA 3FP3A 4NQ0A 3Q5MA 2DBAA 3QOUA 4J0UA 5EX3A 5FZRA 2KATA 3CVLA 1ELWA 3ZGQA 4G23A 3ZFWA 2PQNA 3ZHEA 4Y6CA 3QDNA 3S7BA 3LPZA 2VGXB 4I2ZA 3OXGA 4G1TA 4N3BA 5G05C 3HYMB 2VGYA 3ASHA 3TGOA 3URZA 2GW1A 3MV3B 4RG9A 2Q7FA 3LYAA 3GZ1A 2J9QA 3CK8A 1WM5A 5CCMA 5ARFA 4N5CA 4YNDA 1E96B 4WNDA 4AY5A 5LCWJ 2L6JA 1QZ2A 3E4BA 4JL0A 3LY7A 3GZ2A 2HYZA 2OOEA 3MA5A 3CK9A 3LKUA 3S7FA 4BTBA 3CVQA 4I2WA 1OUVA 2KC7A 3PE3A 3MKRA 4GA0A 4I9EA 4O6FA 2BUGA 4H7YA 4HOQA 2KCLA 4IN3B 3S7JA 4AIFA 2PL2A 4RG6A 3K9IA
chains in the Genus database with same CATH superfamily
2X38A 2AXUA 4H7XA 5HI7A 3ZYQA 4CEMA 4CT4A 2WMNA 2WXJA 3BEEA 3FTZA 3HRAA 3HXFA 1A5EA 4WNGA 3D9NA 4KBQA 4LRZA 3SFYA 3ABLE 4A1SA 1H0AA 2I2OA 4EECA 2XGSA 4JXTA 4K0RA 3ULQA 3SHFA 1QQEA 3AAAC 2P58C 1MJ0A 2IF4A 2I6HA 3CGHA 5M72A 3PVLA 3T5VA 2LNIA 2HE0A 3E34A 3B13A 4BETA 3PUJA 3UQ3A 3D9KA 2F8XK 4GZ3A 2WVIA 4N3AA 3AS8A 4BERA 3PH0C 4YDEA 1TNYA 4F1SA 4GTOA 2XPYA 3U64A 2Y4TA 3QK0A 1SZ9A 4I6EA 4TUUA 1UW4B 5CBOA 4PS8A 1IKND 2ETCA 1Z3YA 5DBKA 4L2LA 4WWOA 3U4TA 2QYUA 1EPUA 3P2BA 2WXLA 4LUNU 3FU3A 4J7WA 3S2AA 3NOCD 2NSZA 3AG3E 3FTYA 2KZTA 2V5FA 3R7RA 2BEDA 3VTYA 4N2QA 5EYLA 2CG2A 5CRVA 2C0MA 5LCWC 3BG0B 4HB5A 1WAO1 2XQ0A 5AAOA 3FUMA 5ENNA 3S7DA 3AU4A 2WXKA 2F0YA 4WWNA 5AQAA 5ENQD 2ZU6B 1E8XA 2DVWA 3MKQB 2FULA 3ZXPA 1K8KG 2YHEA 3ASDA 2KZTB 1OCRE 4FJYA 5EIDA 3PREA 4F3VA 4GZCA 5A6CA 4GZ5A 3CHOA 4FULA 4GA2A 1EDUA 5JMND 4CYMD 3TWXA 1LD8A 3RIBA 1TN8A 2KM4A 2L0TB 5ANRA 3U66A 1JCQA 5JHBA 1Z6TA 3UM0A 4G2VA 4FP7A 4XKBA 2IEJA 4WNEA 2BKKB 4U96D 3LEWA 2B6CA 2LSVA 1E8WA 3V2XA 3ENEA 3RK6A 5D0QD 4R7LA 2P9PG 1HZ4A 4URKA 4A1GA 2DYRE 4JA7A 1MQSA 3DBSA 2GRPB 5CRUA 1H2VC 5ARGA 1FVFA 1N0QA 4HQDA 2AW6A 4PUCA 2Y3AA 4UWGA 4CGVA 3U9WA 3W9GA 4JW1A 4HRNA 5JJTA 2OV8A 1UG3A 4I17A 2FI7A 3CVYA 1Q2ZA 4HOTA 2R03A 5FZQA 1MX2A 3C98A 5BV1A 5LFAA 3BQOA 1IYGA 3RU0A 2XZTG 3I5PA 1FPPA 4L23A 1KT0A 4FHKA 5FQ7A 1U3CA 3KAEA 3CSFA 3NBNB 1H6PA 3ZUVB 4WWPA 3APCA 3DSUA 4UQXA 3DEPA 2ONDA 4GPKA 3T9KA 1HXIA 2R59A 4MS6A 1N11A 5KBAA 3LY9A 1DCQA 5EX0A 4EZLA 1N4QA 5BPPA 1Z3XA 4GMLA 3LS8A 2CHXA 2OVFA 3UIPC 3RRMB 1V55E 4I1AA 1L5JA 3SY2A 5H7PA 2WPVA 1N52A 4GA1A 3SQVA 4NQ0A 2OVBA 2I9CA 2ZGDA 4TXPA 5FZRA 2KATA 3CVLA 3I4RB 3ZGQA 3D9HA 2CHWA 3B7SA 4NURA 2QZAA 4B8CB 2I1JA 2P9SG 1JUQA 3FUKA 4ACKA 3APDA 4GTPA 3P1UA 1BU9A 2EILE 2WXRA 2P9NG 4DI3A 5G05C 4JB8P 2WQ6A 1OT8A 2F8YA 5T8IA 2VGYA 1E7UA 4C9BB 1OY3D 2GW1A 4YDOA 4JHKA 1S0PA 2PM7A 3C3OA 3G2WA 5B1BE 4EZJA 2WB2A 3CK8A 4OAUC 3MGBA 5A23A 3TXMA 3ZRHA 2Y69E 4AY5A 1D8EA 2X6HA 1QZ2A 2GGFA 3ISMC 2R05A 3FTXA 2OOEA 3MA5A 3S7FA 3DSSA 1OWMA 3JCKC 2DZOA 4I2WA 3ABKE 2WXNA 3PE3A 3MKRA 4O6FA 3SFXA 3HXDA 1TR4A 2DCPA 1N95A 4IN3B 2X6JA 4J6IA 3E30A 4NIKA 2MYOA 2A4ZA 4NRHB 4UQZA 1DVPA 5BXUA 4YDYA 1SW6A 2IU1A 5FIOA 4JHRA 5KWDA 5FQ6A 1BPOA 1KPSB 5CCLA 1N0RA 4ACLA 4GTTA 3IHYA 3NZSA 4GTRA 3FUEA 1UOHA 1XNFA 4CDNA 4OAVB 1HF8A 3DSTA 2R5SA 4XEIG 3QB2A 5ENRD 2GRNB 3JQ1A 2QC9A 4CCAA 4ANWA 2GRRB 2X6FA 4AOFA 4HLLA 3JYSA 3FUNA 4OVVA 4KZ0A 3NQPA 3L82A 4YDWA 4CGWA 3ULEG 3RRNB 2J07A 2NC9A 4GTQA 1A17A 5ITZF 3KS2A 1YYHA 3ASOE 2P9LG 4QQIA 1BI7B 4HOUA 3NF1A 3RJVA 3ZEFA 3CQCB 3ESKA 3R9AB 2FEZA 2IO2C 5CBNA 4JZYA 2PQRA 4UWHA 4RVBA 4EHMA 5IY5E 4HBDA 5CMYA 4GAAA 3PE4A 4G8KA 2DIWA 3PDNA 2UY1B 1OCOE 1HO8A 3FUJA 5CMWA 2XS8A 1OWOA 4M3OA 4DJAA 4XIFA 2V4HC 3ZPJA 2WQHA 1DNPA 3J5QB 4ANVA 1ELKA 3OAWA 5CEDB 2XEVA 3OTNA 4AP2A 2DYSE 1X5BA 2IONA 1MHQA 5FJYA 4K5BA 5D2MC 2J09A 5LOZA 3FDHA 3APFA 3ZYMA 1G3NB 4K5CA 1P5QA 5KJLA 4N39A 3D9JA 1SZAA 4KYOB 5BXOA 4LEUA 5B3SE 2PNNA 4HLEA 4BY6A 5BNWA 1KLXA 3TWQA 3VLDA 2QY7A 2MRIA 3CKBA 4J8FA 2P9UG 3PUKA 4XI0A 1UN9A 1O5MA 3HDXA 3CQGB 3CSTA 5EILA 3DEOA 1Y8MA 3Q15A 3EUVA 4DUIA 3FH8A 2LO6A 4I43A 5AARA 2YNQA 4ANXA 3FFLA 3ASNE 2NXPA 4ABNA 1WY6A 2EIME 1O1TA 5AJLA 2PM6A 5E75A 3CHSA 4XI9A 4G11A 5HS0A 3GYZA 2JEKA 2FBNA 3ULYA 4K5AB 3LVRE 5D66A 2X6IA 1NA0A 5AJDA 2LAIA 2MHKA 5FT9A 3R9MA 2LSUA 3EHMA 1E8YA 3TJPA 4BT8A 4ATZD 4RQIA 5LX8A 1NL4A 4LNUD 4BT9A 1EF1C 3LJ3A 3GW4A 3FTWA 3JQ0A 1U2VG 3ZHEB 1HU3A 2IY0C 3FULA 4KVMA 3V31A 3MKQA 3V2OA 2J08A 1FT2A 3CV0A 5CERB 2LXMA 3RSEG 4GCNA 4UUCA 5EYPF 2IOSA 3DWLG 2J8SD 4TUMA 4GMJA 4U0ZA 4IRUA 2V0PA 2CG3A 3G2SA 2WXPA 2LXLA 4I1MA 2V4LA 3FUFA 3HVEB 4G25A 4W9RA 3ESLA 4AVXA 5JJ6A 3DPDA 4AY6A 2GRMA 3FTSA 3UKRG 3FTVA 3SBTB 1OWLA 3VTXA 4JC8A 2J49A 1KZPA 4LERA 2HR2A 5AENA 2JLBA 3EU9A 2YQ8A 5BV0A 5BW8C 4JA9A 1TYQG 3IKOB 1XGWA 3L9TA 1AP7A 3O48A 4Q96A 3DXMG 2A5UA 4ILHB 3Q5MA 3EHNA 4B8AA 5EX3A 1OWNA 3AG2E 1NI1A 2RD0A 2ZXWE 3C5RA 5HKPA 3D9IA 1ELWA 3PNTB 2BTDA 3ML8A 4G23A 4JEHA 2I1KA 3S7BA 3KEAA 1MZCA 3ZKJA 2IO3C 3LPZA 3FU6A 3SNXA 1K1BA 4G1TA 3TWSA 4N3BA 1H6OA 1H6KA 3ABME 3FEYA 4B89A 4ATGA 2EIJE 3WG7E 4TXRA 3TGOA 3URZA 3L08A 1S63A 1OCCE 5LP0A 3D9OA 3FUIA 1WDYA 3FU5A 3TXNA 2KBXA 2R02A 3G2UA 2J9QA 4FC8A 3UMVA 1WM5A 5CCMA 4G8LA 4YNDA 2LAHA 3EJNA 1E96B 2EINE 4JEUA 2L6JA 3TWUA 3E4BA 3IHVA 3LY7A 3QAQA 2HYZA 3HIZA 3SO8A 5AQ9A 3ZYLA 4EPZA 3B7BA 2OCCE 5G2NA 4CDMA 4HOQA 2KCLA 1OXJA 1TNUA 2PL2A 3DSVA 4C48B 4X8QA 3Q75A 3JUIA 4U0SA 3UINC 4GMRA 3ZVVA 2GROB 2UWJG 2L0IA 3MV2B 3PZ3A 3T8MA 3CIAA 4J8SA 4CDRA 3QWVA 1W3BA 4GCOA 3JXIA 4WUYA 3C3QA 1UJJA 4XZ4A 4DX1A 4MRUA 4F7AA 4HRLA 2XRZA 4BX8A 3PS6A 5EKQD 3KSQA 3MYVA 3G2VA 1NP7A 2KXPC 5KCMA 1LF8A 3ZW3A 1LD7A 4YVOA 4LNBA 4KMOA 4UQYA 3V79K 3OXFA 3Q49B 5C1DA 5G05J 4HRMB 3HXEA 4GYOA 3DRAA 3UT4A 3TAXA 4OYSA 1E8ZA 4XX5A 5CECB 5KJMA 4ILIA 3FWVA 2E2EA 2L9BA 3EHRA 1JCRA 1JPLA 4O1PA 4HOSA 4L7TA 4UI9C 5FTPA 1RW2A 4M7CA 3UM2A 4PS3A 3UT8A 1SVXA 1NA3A 4LCTA 4A3VA 1H2TC 4GTMA 3SI5A 4DLOA 3MCXA 3JXJA 2YHCA 2WXGA 4BESA 4ANUA 4B93B 1V54E 4WAFA 3ZXSA 4N5QA 2MOWA 4EQFA 5ENTD 4CT0A 3L22A 3TWWA 3DXKG 3D9PA 3AU5A 4N3CA 5G04C 3B7RL 2VTBA 3UXGA 5JA4D 4K03A 2AVPA 2PZIA 5HRYA 5KJKA 4G26A 3WXXA 5BUZA 2XEHA 4LSZE 3CVXA 3MX3A 4V3IA 3DPYA 4I6GA 1K3ZD 4JHJA 3I3NA 3HG0D 5FQ4A 4FADA 3ASGA 4A63B 1BD8A 3D9LA 3X2QE 2WXMA 3EU5A 2XGOA 1PC2A 4HNAD 3BU8A 4HI8A 3IEGA 2VTBB 1B89A 3LY8A 5C2YA 2R17C 3ZIMA 3E32A 2VGEA 3GZSA 1PAQA 2IOLA 4U63A 3RKVA 4FA6A 2XCCA 2KCVA 5CHEE 3J5PA 3Q79A 1RZ4A 2XCBA 5A7DB 4CZ2D 4TRQA 2UY1A 3SFZA 1IQUA 2R2LA 1N54A 4I6JA 3BG1B 4U95D 4Q69A 4WNFA 2B0OE 4PS7A 3Q73A 1MYOA 2OEVA 4D10C 1TN6A 2JABA 2FF4A 4MLPA 1BI8B 1IXVA 3MJWA 3DSWA 2WXOA 3SF4A 1SA4A 2Y4UA 3FH7A 1YA0A 3AG4E 2P2CP 3RO3A 4HI9A 4UI9K 4DI4A 1S64A 4I9CA 2VSOE 1YCSB 1IHBA 4UWKA 4GZDA 2RFAA 4KXKB 3CVNA 4HORA 1PY1A 1Z5SC 2IFUA 3ZU7B 4E6HA 4U04A 3ONLA 3T5XA 2RG8A 4UWLA 4AXHA 4J8DA 2H6IA 4EBAG 1Y6IA 1E7VA 1OWPA 5EDSA 3NOGD 2BF0X 4GYYA 5D0OD 1N4SA 3EIJA 4YVQC 1IQRA 4F53A 2V5QC 3C72A 4RSYA 5JJ7A 4BWRA 4GYWA 1N9AA 3SBSA 4B94A 4PH4B 3Q7FA 2ZISA 4APOA 3G2TA 5HQ8A 5KJNA 2VGXA 2AJAA 1JWFA 1X81A 3IV0A 3FHEA 2F37A 3ASFA 4TV3A 5J90A 2VSYA 4JVSA 1NZNA 5J08A 3LCAA 3FP3A 3CLJA 3CHPA 2DBAA 4NACA 1N4RA 1UJKA 2PQNA 3ZHEA 3Q7AA 4U8YD 3QDNA 1HS6A 2GRQB 3PNLB 4I2ZA 2VGXB 3OXGA 3PZ1A 2DWZA 1E90A 4UWFA 4JD2G 4LNGA 3ASHA 4RG9A 2RKKA 3E33A 1NFIE 2A5EA 3HVEA 3GZ1A 2L6BA 5FWQA 3JUEA 2XRYA 2GRLA 4GB9A 1VDYA 4N5CA 3SD5A 4A55A 2WM9A 2WQ7A 5E76A 3ZYKA 1N94A 4A3TA 3B7UX 5LCWJ 3LXUX 1AWCB 1HFAA 3ZNGA 3GZ2A 2BKGA 3TWVA 3CK9A 4BTBA 3CVQA 2AXZA 4BSXA 1OUVA 2KC7A 4I9EA 1TEZA 3RRUA 4HFGA 2M63A 3EHQA 3CVVA 4U7EB 4H7YA 2H6HA 3C3RA 2Y1LE 5ENPD 2NYJA 5AQ7A 4ZHBA 4DX6D 1TJCA 4O60A 3QWPA 1QNFA 2YINA 3PZ2A 4APFA 3CHQA 3IXEA 4U07A 2XHEA 3Q47B 3CR3A 3UTMA 1HG5A 3UT7A 2KCKA 3CVPA 3CHMA 3CEQA 3AS5A 3UIOC 5EIBE 2J4BA 2C2LA 3UI2A 1QYMA 3O4ZA 4QFVA 3U3WA 1GW6A 5AIJA 3PEVB 3D3MA 3QJZA 5T4YA 2XEEA 4OVUA 4DK5A 1MX6A 3MEKA 1D9SA 3TL5A 3RO2A 2XZDG 2ETBA 3F6QA 5AN8A 2WXIA 4U8HA 4MKTA 1ELRA 4AJWA 4DLQA 3AS4A 4F1PA 4HXIA 4AM9A 1ZU2A 4FHJA 1FVHA 1ZBPA 2CFZA 3CKCA 1JWGA 3LDZA 3W9FA 4BSZB 2QFCA 1U3DA 4N2SA 4HS2A 1HX8A 5KNHD 4AEZC 3SZ7A 3PEUB 4XKCA 4MBGA 4EBAA 3KEZA 1HG2A 3LJNA 3UPVA 2XS1A 4E85A 1O1SA 3HXBA 2WMOA 1ZB1A 2VYIA 1EYHA 2V8SE 4CRWA 2H6FA 1UN8A 3BUAA 2VSNA 2HO1A 2CHZA 2X6KA 1JCSA 4DX7D 5FQ8A 3TG4A 2Y0BG 2XPZA 3Q78A 1TNBA 2AXVA 4XE0A 5AYWD 2ZGGA 3KD7A 3UUXA 4AV7A 2VQ2A 4B0ZA 4GTVA 4U8VD 2H6GA 3L6AA 3UM1A 4DX5D 2FO1E 2IJGX 4KT6B 5B1AE 3IBEA 4HVBA 4IYPA 4KVOA 5JHAA 3FEXA 4F6RD 4DX2A 3L16A 4FLHA 4BX9A 4FJZA 4ME2A 3FTUA 2XPIA 4L1BA 3B95A 5FINA 5KNGA 2ILRA 4GU5A 3NZUA 4EZKA 3UKUG 2XGMA 4UI9J 3UX4A 1FT1A 5CEAA 3ZN3A 3FUHA 3AJIA 1O1RA 2OEWA 3FU0A 3OXLA 2DZNA 4BFRA 1DCEA 1FCHA 2WXHA 4IULA 1H2UA 1WG0A 4PDXA 3Q4AB 1YMPA 5G55A 3QARA 1S70B 3D9MA 4FLBA 3T8KA 4Y6WA 4U0UA 4O1OA 4C0EA 4FU3A 4ILGA 3QKYA 5G04J 3EDTB 3I4GA 4DRXE 4J8EA 1HH8A 3TG5A 2CFUA 2FO7A 3ML9A 1KZOA 4L9PA 4KZCA 1KT1A 4G24A 4P29A 1QBQA 5ENOD 3VLEA 3KSLA 3Q9UC 3ONKA 1TNZA 2P9IG 3SGHA 2RFMA 5ENSD 5EN5D 1TN7A 3B7TA 3L17A 3CK7A 3PZDA 1TNOA 3FUDA 4ZFHA 3MZLB 5BT1A 4BEPA 1INZA 3TWTA 2WXFA 1D8DA 1N4PA 4TXQA 2J4DA 3DSXA 3PRZA 5FZSA 3QWWA 3AG1E 3TWRA 2P9KG 4GZ6A 2C0LA 2LUHA 4Z68A 2E0IA 3UM3A 2VSXE 4GTSA 5ANLA 3N71A 1SA5A 4J8YA 5DIZA 1IHGA 4BTAA 3CVWA 3L13A 2EQXA 2HM8A 1TJFA 1LTXA 2VJ8A 3CVUA 5AQBA 3QOUA 1HE8A 3FY4A 4J0UA 3VLFA 3ZFWA 4RLYA 1MX4A 2ZIRA 4L2YA 4Y6CA 3Q9NC 3NAWA 3HHMA 3HYMB 4JPSA 2QYJA 3MV3B 3L54A 3E37A 3LVQE 2Q7FA 3LYAA 3FH5A 1OCZE 1DC2A 5ARFA 2X3MA 2AWIA 3QNKA 3CHRA 2WXQA 4WNDA 3RAUA 2EIKE 4Q94A 4JL0A 4DPRA 1BLXB 3HXCA 2ETAA 3LKUA 2IQCA 1H19A 3R7QA 4I1OB 3QC1A 3PZ4A 4GA0A 4LG6A 2BUGA 4C0MA 5T3RA 1SQMA 3S7JA 1K1AA 3NB2A 3EIQC 4GPMA 4AIFA 4RG6A 2XENA 3K9IA 3V30A
chains in the Genus database with same CATH topology
2A4ZA 4NRHB 3JUIA 4UQZA 4U0SA 1DVPA 2X38A 3ZVVA 2AXUA 2UWJG 2L0IA 1TJCA 2IU1A 3MV2B 4JHRA 4H7XA 5HI7A 3QWPA 5FQ6A 1BPOA 3T8MA 1QNFA 3CIAA 5CCLA 4ACLA 3ZYQA 4CEMA 2YINA 4J8SA 4APFA 4CDRA 4CT4A 2WMNA 2WXJA 3IHYA 3NZSA 3QWVA 1W3BA 3CHQA 3FUEA 4GCOA 3BEEA 3FTZA 1XNFA 4U07A 2XHEA 3Q47B 4CDNA 3CR3A 1HF8A 2R5SA 4WUYA 4WNGA 1UJJA 3D9NA 4XZ4A 1HG5A 3UT7A 4MRUA 4F7AA 4KBQA 4LRZA 2XRZA 4A1SA 2KCKA 3QB2A 3JQ1A 4BX8A 1H0AA 4CCAA 2I2OA 4ANWA 3PS6A 5EKQD 2X6FA 4AOFA 3MYVA 3JYSA 3FUNA 3G2VA 1NP7A 3CVPA 3CHMA 5KCMA 4EECA 4OVVA 1LF8A 3CEQA 4KZ0A 3NQPA 3AS5A 3ZW3A 2XGSA 4JXTA 4K0RA 3ULQA 4YVOA 3SHFA 1QQEA 4KMOA 4CGWA 4UQYA 2J4BA 3RRNB 2C2LA 2J07A 2NC9A 3OXFA 3O4ZA 4QFVA 3Q49B 3U3WA 2P58C 1A17A 1GW6A 5C1DA 5G05J 5AIJA 3PEVB 3D3MA 2IF4A 2I6HA 3QJZA 4GYOA 5T4YA 3CGHA 5M72A 4OVUA 3PVLA 4DK5A 3UT4A 3T5VA 2LNIA 3KS2A 3B13A 3MEKA 3PUJA 3TAXA 3UQ3A 4OYSA 3TL5A 1E8ZA 4XX5A 4HOUA 3RO2A 3D9KA 3NF1A 4GZ3A 3RJVA 2WVIA 3CQCB 4ILIA 4N3AA 3ZEFA 5KJMA 3AS8A 3FWVA 3ESKA 2E2EA 2L9BA 3R9AB 3PH0C 1JPLA 4HOSA 2FEZA 2WXIA 4JZYA 2PQRA 4UWHA 4L7TA 4RVBA 4U8HA 4F1SA 4UI9C 4MKTA 1ELRA 4AJWA 2XPYA 4DLQA 5FTPA 3U64A 2Y4TA 3AS4A 3QK0A 1SZ9A 5CMYA 4I6EA 4HXIA 4TUUA 4AM9A 1UW4B 1ZU2A 4GAAA 4PS3A 3UT8A 4FHJA 3PE4A 1FVHA 1NA3A 1ZBPA 2CFZA 2DIWA 3CKCA 3PDNA 1JWGA 2UY1B 4LCTA 4A3VA 1H2TC 4PS8A 3LDZA 3SI5A 1Z3YA 4DLOA 5DBKA 2QFCA 1HO8A 3MCXA 4L2LA 4WWOA 3U4TA 1U3DA 2YHCA 2WXGA 3FUJA 5CMWA 4N2SA 1EPUA 3P2BA 2WXLA 4LUNU 4ANUA 3FU3A 1OWOA 4M3OA 4DJAA 4HS2A 4XIFA 4WAFA 2WQHA 1HX8A 3ZPJA 1DNPA 4AEZC 3SZ7A 3ZXSA 3PEUB 4XKCA 4EBAA 3KEZA 1HG2A 3S2AA 2NSZA 2MOWA 4EQFA 4ANVA 3UPVA 3FTYA 2KZTA 4CT0A 1ELKA 2V5FA 3OAWA 4E85A 2XEVA 3OTNA 3L22A 4AP2A 1X5BA 2WMOA 2IONA 1MHQA 3D9PA 2VYIA 3AU5A 1EYHA 4N3CA 5G04C 3R7RA 4N2QA 3VTYA 2V8SE 2CG2A 3B7RL 4CRWA 2VTBA 1UN8A 2C0MA 5FJYA 4K03A 2VSNA 3BG0B 5LCWC 2HO1A 1WAO1 2AVPA 2CHZA 2J09A 2PZIA 2XQ0A 3FUMA 3FDHA 5ENNA 3APFA 4G26A 5LOZA 3AU4A 3S7DA 3WXXA 2WXKA 2X6KA 3ZYMA 5BUZA 1P5QA 5KJLA 4N39A 4WWNA 3D9JA 5FQ8A 1SZAA 4KYOB 3TG4A 3CVXA 3MX3A 4LEUA 2XPZA 4V3IA 4I6GA 2AXVA 4JHJA 4XE0A 5AYWD 3I3NA 4HLEA 5FQ4A 4BY6A 4FADA 3ASGA 5BNWA 3KD7A 1KLXA 2ZU6B 3UUXA 1E8XA 3VLDA 3D9LA 3MKQB 2FULA 2QY7A 4AV7A 2MRIA 2VQ2A 4B0ZA 2YHEA 3ASDA 3CKBA 2KZTB 2WXMA 4FJYA 3PREA 4J8FA 2XGOA 4F3VA 3PUKA 4GZCA 1PC2A 5A6CA 4GZ5A 3L6AA 4XI0A 3CHOA 4FULA 1UN9A 4GA2A 3IEGA 3HDXA 1EDUA 2IJGX 3CQGB 3CSTA 4KT6B 2VTBB 1B89A 3LY8A 5C2YA 2R17C 1Y8MA 3IBEA 3Q15A 3ZIMA 4HVBA 3RIBA 4IYPA 3GZSA 1PAQA 2KM4A 2IOLA 2L0TB 4U63A 3RKVA 4KVOA 4FA6A 5JHAA 2XCCA 5ANRA 2KCVA 3U66A 3FH8A 3FEXA 5CHEE 5JHBA 1Z6TA 4G2VA 2LO6A 4I43A 4FP7A 4ANXA 2YNQA 3L16A 2XCBA 4XKBA 5A7DB 4WNEA 4FLHA 4BX9A 3FFLA 4FJZA 3LEWA 4TRQA 2UY1A 4ME2A 3FTUA 2XPIA 2NXPA 2LSVA 1WY6A 4L1BA 3SFZA 4ABNA 5AJLA 1IQUA 1E8WA 1N54A 4I6JA 2PM6A 3BG1B 2ILRA 4Q69A 3ENEA 5E75A 4GU5A 3CHSA 3RK6A 3NZUA 4WNFA 4XI9A 4EZKA 2XGMA 4G11A 4PS7A 4UI9J 3UX4A 5D0QD 3ZN3A 3GYZA 2JEKA 4R7LA 4D10C 3FUHA 2FBNA 1HZ4A 4URKA 2FF4A 4MLPA 3LVRE 4A1GA 3FU0A 2X6IA 1NA0A 3OXLA 4JA7A 1MQSA 3DBSA 4BFRA 3MJWA 5AJDA 2LAIA 1FCHA 1H2VC 2WXHA 5ARGA 1FVFA 2MHKA 4IULA 1H2UA 5FT9A 4PDXA 2AW6A 2LSUA 3EHMA 3Q4AB 4PUCA 2WXOA 1E8YA 3TJPA 4BT8A 3SF4A 2Y3AA 5G55A 2Y4UA 3QARA 3D9MA 5LX8A 3FH7A 4BT9A 1EF1C 3LJ3A 4FLBA 1YA0A 4Y6WA 3GW4A 4UWGA 3FTWA 4U0UA 3JQ0A 3RO3A 4C0EA 4CGVA 4FU3A 1HU3A 3QKYA 4ILGA 3FULA 4UI9K 3U9WA 3ZHEB 5G04J 4KVMA 4DI4A 4I9CA 4JW1A 3EDTB 3MKQA 2VSOE 2J08A 5JJTA 3I4GA 4J8EA 1HH8A 3TG5A 2OV8A 1UG3A 2CFUA 3CV0A 4I17A 2FI7A 4UWKA 4GZDA 2FO7A 3ML9A 3CVYA 4KZCA 4HOTA 4GCNA 1KT1A 5FZQA 4G24A 3C98A 4KXKB 5BV1A 4P29A 3CVNA 4HORA 2IOSA 5LFAA 3VLEA 1PY1A 4GMJA 2IFUA 3ONKA 4U0ZA 4IRUA 2V0PA 3SGHA 2CG3A 1IYGA 3RU0A 3G2SA 4E6HA 3B7TA 4U04A 3ONLA 3I5PA 2WXPA 3L17A 3CK7A 3T5XA 3PZDA 4I1MA 2V4LA 4L23A 1KT0A 2RG8A 3FUFA 4FHKA 5FQ7A 1U3CA 3HVEB 3KAEA 3CSFA 4G25A 3FUDA 4UWLA 4W9RA 4AXHA 3ESLA 3MZLB 4J8DA 5BT1A 4WWPA 3APCA 4AVXA 1INZA 4EBAG 2WXFA 1Y6IA 1E7VA 1OWPA 4UQXA 5JJ6A 3DPDA 5EDSA 4GYYA 2BF0X 5D0OD 4AY6A 3EIJA 2GRMA 2J4DA 1IQRA 3FTSA 4YVQC 3FTVA 3SBTB 4F53A 3PRZA 2ONDA 1OWLA 5FZSA 4GPKA 3VTXA 1HXIA 3QWWA 2R59A 4RSYA 5JJ7A 4BWRA 4JC8A 2J49A 4MS6A 4GYWA 4LERA 3SBSA 2HR2A 4B94A 4PH4B 5KJKA 5AENA 3LY9A 5EX0A 2JLBA 4GZ6A 2YQ8A 2C0LA 4EZLA 4APOA 3G2TA 5HQ8A 5KJNA 2E0IA 5BV0A 5BW8C 5BPPA 2VGXA 4JA9A 1Z3XA 4GMLA 2VSXE 3LS8A 1JWFA 2CHXA 2OVFA 5ANLA 3N71A 3RRMB 3IKOB 5DIZA 1IHGA 1XGWA 3IV0A 3FHEA 3O48A 4Q96A 4BTAA 3L13A 4I1AA 3CVWA 1L5JA 2EQXA 3ASFA 4TV3A 2HM8A 1TJFA 2A5UA 5J90A 2VSYA 4JVSA 1NZNA 2WPVA 1N52A 4GA1A 3LCAA 5J08A 4ILHB 3FP3A 4NQ0A 3CLJA 3CHPA 2OVBA 2I9CA 3Q5MA 2DBAA 3EHNA 2VJ8A 3CVUA 3QOUA 4NACA 1HE8A 3FY4A 4B8AA 4J0UA 5EX3A 1OWNA 5FZRA 2KATA 2RD0A 3CVLA 3D9IA 1ELWA 3PNTB 3VLFA 3I4RB 3ZGQA 2BTDA 3ML8A 4G23A 2CHWA 4JEHA 1UJKA 3B7SA 2PQNA 4NURA 3ZFWA 3ZHEA 4B8CB 4L2YA 2I1KA 2I1JA 4Y6CA 3QDNA 3S7BA 1HS6A 1JUQA 3FUKA 4ACKA 3APDA 3PNLB 3LPZA 2VGXB 3FU6A 4I2ZA 3OXGA 4G1TA 3SNXA 4N3BA 1H6KA 3P1UA 3FEYA 2WXRA 4DI3A 4B89A 5G05C 3HHMA 1E90A 2WQ6A 4UWFA 4ATGA 5T8IA 3HYMB 2VGYA 1E7UA 4JPSA 3ASHA 4C9BB 3TGOA 3URZA 3L08A 2GW1A 3MV3B 4RG9A 3L54A 5LP0A 3D9OA 3LVQE 2Q7FA 4JHKA 3FUIA 1S0PA 3LYAA 2PM7A 3FU5A 3TXNA 3FH5A 3HVEA 3G2WA 3GZ1A 3G2UA 5FWQA 2XRYA 4EZJA 2J9QA 4FC8A 3UMVA 2GRLA 3CK8A 2WB2A 4GB9A 1WM5A 5CCMA 1VDYA 3MGBA 5ARFA 4N5CA 2X3MA 2AWIA 3QNKA 4YNDA 3CHRA 3SD5A 5A23A 2LAHA 4A55A 2WXQA 3EJNA 2WM9A 3TXMA 3ZRHA 2WQ7A 5E76A 1E96B 3ZYKA 4WNDA 4JEUA 4Q94A 4A3TA 4AY5A 3B7UX 5LCWJ 2L6JA 2X6HA 1QZ2A 3E4BA 3LXUX 3IHVA 4JL0A 1HFAA 2GGFA 3LY7A 3QAQA 4DPRA 3GZ2A 2HYZA 3HIZA 3FTXA 2OOEA 3MA5A 3CK9A 3LKUA 3S7FA 2IQCA 3ZYLA 1OWMA 1H19A 4BTBA 3JCKC 3CVQA 2AXZA 4I2WA 3R7QA 1OUVA 2WXNA 3QC1A 4I1OB 4BSXA 4EPZA 2KC7A 3PE3A 3MKRA 4GA0A 4I9EA 1TEZA 4O6FA 3RRUA 4HFGA 2M63A 2BUGA 4C0MA 2DCPA 5T3RA 3CVVA 4H7YA 5G2NA 1SQMA 4CDMA 4HOQA 2KCLA 4IN3B 2X6JA 4J6IA 3S7JA 3EIQC 2PL2A 4AIFA 4RG6A 3K9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRH B;  4UQZ A;  4U0S A;  2UWJ G;  1TJC A;  3MV2 B;  4JHR A;  4H7X A;  5HI7 A;  3QWP A;  5CCL A;  4CDR A;  3QWV A;  1W3B A;  4GCO A;  3BEE A;  1XNF A;  4U07 A;  3Q47 B;  2R5S A;  4WUY A;  4WNG A;  4KBQ A;  4A1S A;  2KCK A;  5EKQ D;  3JYS A;  3CVP A;  3CEQ A;  3AS5 A;  2XGS A;  3ULQ A;  4YVO A;  1QQE A;  4CGW A;  4UQY A;  2C2L A;  2NC9 A;  3OXF A;  3Q49 B;  3U3W A;  2P58 C;  1A17 A;  5C1D A;  5G05 J;  2IF4 A;  2I6H A;  4GYO A;  5M72 A;  2LNI A;  3KS2 A;  3MEK A;  3TAX A;  3UQ3 A;  4HOU A;  3RO2 A;  3NF1 A;  4GZ3 A;  3RJV A;  5KJM A;  4N3A A;  3AS8 A;  3FWV A;  3ESK A;  2E2E A;  3R9A B;  4HOS A;  2FEZ A;  2PQR A;  4UI9 C;  1ELR A;  5FTP A;  2Y4T A;  3AS4 A;  4AM9 A;  1ZU2 A;  3PE4 A;  1NA3 A;  1ZBP A;  3CKC A;  3PDN A;  2UY1 B;  5DBK A;  2QFC A;  3U4T A;  2YHC A;  4N2S A;  4XIF A;  3ZPJ A;  2WQH A;  3SZ7 A;  4EQF A;  3UPV A;  2V5F A;  2XEV A;  2VYI A;  4N3C A;  5G04 C;  4N2Q A;  3VTY A;  2C0M A;  5FJY A;  2VSN A;  5LCW C;  2HO1 A;  1WAO 1;  2AVP A;  2PZI A;  5KJK A;  4G26 A;  3S7D A;  3WXX A;  1P5Q A;  5KJL A;  4N39 A;  4KYO B;  3TG4 A;  4LEU A;  5AYW D;  3ASG A;  5BNW A;  3KD7 A;  1KLX A;  3UUX A;  2VQ2 A;  3CKB A;  3ASD A;  4J8F A;  2XGO A;  4F3V A;  1PC2 A;  5A6C A;  4GZ5 A;  4XI0 A;  4GA2 A;  3IEG A;  1B89 A;  3LY8 A;  1Y8M A;  3Q15 A;  3RIB A;  3RKV A;  2XCC A;  2KCV A;  5CHE E;  4G2V A;  2XCB A;  5A7D B;  4WNE A;  3FFL A;  2UY1 A;  4ME2 A;  2XPI A;  2LSV A;  4ABN A;  4WNF A;  4XI9 A;  2XGM A;  4UI9 J;  5D0Q D;  3ZN3 A;  3GYZ A;  2FBN A;  1HZ4 A;  2FF4 A;  1NA0 A;  3OXL A;  4JA7 A;  1FCH A;  5ARG A;  2MHK A;  5FT9 A;  2LSU A;  3Q4A B;  4BT8 A;  3SF4 A;  2Y4U A;  4BT9 A;  1YA0 A;  4Y6W A;  3GW4 A;  4U0U A;  3RO3 A;  4CGV A;  3ZHE B;  3QKY A;  4UI9 K;  5G04 J;  4I9C A;  3EDT B;  5JJT A;  4J8E A;  1HH8 A;  3TG5 A;  4I17 A;  3CV0 A;  2FI7 A;  2FO7 A;  4HOT A;  4GCN A;  1KT1 A;  5FZQ A;  4G24 A;  4KXK B;  3CVN A;  4HOR A;  2IFU A;  4U0Z A;  1IYG A;  3RU0 A;  4U04 A;  3CK7 A;  1KT0 A;  4G25 A;  3KAE A;  4W9R A;  4J8D A;  5BT1 A;  4UQX A;  5JJ6 A;  4GYY A;  5D0O D;  4AY6 A;  4YVQ C;  2OND A;  5FZS A;  4GPK A;  3VTX A;  1HXI A;  3QWW A;  5JJ7 A;  4BWR A;  4GYW A;  2HR2 A;  4B94 A;  3LY9 A;  5EX0 A;  2JLB A;  4GZ6 A;  2YQ8 A;  2C0L A;  4APO A;  5HQ8 A;  5KJN A;  5BW8 C;  2VGX A;  4JA9 A;  3N71 A;  5DIZ A;  1IHG A;  3O48 A;  4BTA A;  4I1A A;  3ASF A;  2VSY A;  1NZN A;  2WPV A;  4GA1 A;  3LCA A;  3FP3 A;  4NQ0 A;  3Q5M A;  2DBA A;  3QOU A;  4J0U A;  5EX3 A;  5FZR A;  2KAT A;  3CVL A;  1ELW A;  3ZGQ A;  4G23 A;  3ZFW A;  2PQN A;  3ZHE A;  4Y6C A;  3QDN A;  3S7B A;  3LPZ A;  2VGX B;  4I2Z A;  3OXG A;  4G1T A;  4N3B A;  5G05 C;  3HYM B;  2VGY A;  3ASH A;  3TGO A;  3URZ A;  2GW1 A;  3MV3 B;  4RG9 A;  2Q7F A;  3LYA A;  3GZ1 A;  2J9Q A;  3CK8 A;  1WM5 A;  5CCM A;  5ARF A;  4N5C A;  4YND A;  1E96 B;  4WND A;  4AY5 A;  5LCW J;  2L6J A;  1QZ2 A;  3E4B A;  4JL0 A;  3LY7 A;  3GZ2 A;  2HYZ A;  2OOE A;  3MA5 A;  3CK9 A;  3LKU A;  3S7F A;  4BTB A;  3CVQ A;  4I2W A;  1OUV A;  2KC7 A;  3PE3 A;  3MKR A;  4GA0 A;  4I9E A;  4O6F A;  2BUG A;  4H7Y A;  4HOQ A;  2KCL A;  4IN3 B;  3S7J A;  4AIF A;  2PL2 A;  4RG6 A;  3K9I A; 
#chains in the Genus database with same CATH topology
 2X38 A;  2AXU A;  4H7X A;  5HI7 A;  3ZYQ A;  4CEM A;  4CT4 A;  2WMN A;  2WXJ A;  3BEE A;  3FTZ A;  3HRA A;  3HXF A;  1A5E A;  4WNG A;  3D9N A;  4KBQ A;  4LRZ A;  3SFY A;  3ABL E;  4A1S A;  1H0A A;  2I2O A;  4EEC A;  2XGS A;  4JXT A;  4K0R A;  3ULQ A;  3SHF A;  1QQE A;  3AAA C;  2P58 C;  1MJ0 A;  2IF4 A;  2I6H A;  3CGH A;  5M72 A;  3PVL A;  3T5V A;  2LNI A;  2HE0 A;  3E34 A;  3B13 A;  4BET A;  3PUJ A;  3UQ3 A;  3D9K A;  2F8X K;  4GZ3 A;  2WVI A;  4N3A A;  3AS8 A;  4BER A;  3PH0 C;  4YDE A;  1TNY A;  4F1S A;  4GTO A;  2XPY A;  3U64 A;  2Y4T A;  3QK0 A;  1SZ9 A;  4I6E A;  4TUU A;  1UW4 B;  5CBO A;  4PS8 A;  1IKN D;  2ETC A;  1Z3Y A;  5DBK A;  4L2L A;  4WWO A;  3U4T A;  2QYU A;  1EPU A;  3P2B A;  2WXL A;  4LUN U;  3FU3 A;  4J7W A;  3S2A A;  3NOC D;  2NSZ A;  3AG3 E;  3FTY A;  2KZT A;  2V5F A;  3R7R A;  2BED A;  3VTY A;  4N2Q A;  5EYL A;  2CG2 A;  5CRV A;  2C0M A;  5LCW C;  3BG0 B;  4HB5 A;  1WAO 1;  2XQ0 A;  5AAO A;  3FUM A;  5ENN A;  3S7D A;  3AU4 A;  2WXK A;  2F0Y A;  4WWN A;  5AQA A;  5ENQ D;  2ZU6 B;  1E8X A;  2DVW A;  3MKQ B;  2FUL A;  3ZXP A;  1K8K G;  2YHE A;  3ASD A;  2KZT B;  1OCR E;  4FJY A;  5EID A;  3PRE A;  4F3V A;  4GZC A;  5A6C A;  4GZ5 A;  3CHO A;  4FUL A;  4GA2 A;  1EDU A;  5JMN D;  4CYM D;  3TWX A;  1LD8 A;  3RIB A;  1TN8 A;  2KM4 A;  2L0T B;  5ANR A;  3U66 A;  1JCQ A;  5JHB A;  1Z6T A;  3UM0 A;  4G2V A;  4FP7 A;  4XKB A;  2IEJ A;  4WNE A;  2BKK B;  4U96 D;  3LEW A;  2B6C A;  2LSV A;  1E8W A;  3V2X A;  3ENE A;  3RK6 A;  5D0Q D;  4R7L A;  2P9P G;  1HZ4 A;  4URK A;  4A1G A;  2DYR E;  4JA7 A;  1MQS A;  3DBS A;  2GRP B;  5CRU A;  1H2V C;  5ARG A;  1FVF A;  1N0Q A;  4HQD A;  2AW6 A;  4PUC A;  2Y3A A;  4UWG A;  4CGV A;  3U9W A;  3W9G A;  4JW1 A;  4HRN A;  5JJT A;  2OV8 A;  1UG3 A;  4I17 A;  2FI7 A;  3CVY A;  1Q2Z A;  4HOT A;  2R03 A;  5FZQ A;  1MX2 A;  3C98 A;  5BV1 A;  5LFA A;  3BQO A;  1IYG A;  3RU0 A;  2XZT G;  3I5P A;  1FPP A;  4L23 A;  1KT0 A;  4FHK A;  5FQ7 A;  1U3C A;  3KAE A;  3CSF A;  3NBN B;  1H6P A;  3ZUV B;  4WWP A;  3APC A;  3DSU A;  4UQX A;  3DEP A;  2OND A;  4GPK A;  3T9K A;  1HXI A;  2R59 A;  4MS6 A;  1N11 A;  5KBA A;  3LY9 A;  1DCQ A;  5EX0 A;  4EZL A;  1N4Q A;  5BPP A;  1Z3X A;  4GML A;  3LS8 A;  2CHX A;  2OVF A;  3UIP C;  3RRM B;  1V55 E;  4I1A A;  1L5J A;  3SY2 A;  5H7P A;  2WPV A;  1N52 A;  4GA1 A;  3SQV A;  4NQ0 A;  2OVB A;  2I9C A;  2ZGD A;  4TXP A;  5FZR A;  2KAT A;  3CVL A;  3I4R B;  3ZGQ A;  3D9H A;  2CHW A;  3B7S A;  4NUR A;  2QZA A;  4B8C B;  2I1J A;  2P9S G;  1JUQ A;  3FUK A;  4ACK A;  3APD A;  4GTP A;  3P1U A;  1BU9 A;  2EIL E;  2WXR A;  2P9N G;  4DI3 A;  5G05 C;  4JB8 P;  2WQ6 A;  1OT8 A;  2F8Y A;  5T8I A;  2VGY A;  1E7U A;  4C9B B;  1OY3 D;  2GW1 A;  4YDO A;  4JHK A;  1S0P A;  2PM7 A;  3C3O A;  3G2W A;  5B1B E;  4EZJ A;  2WB2 A;  3CK8 A;  4OAU C;  3MGB A;  5A23 A;  3TXM A;  3ZRH A;  2Y69 E;  4AY5 A;  1D8E A;  2X6H A;  1QZ2 A;  2GGF A;  3ISM C;  2R05 A;  3FTX A;  2OOE A;  3MA5 A;  3S7F A;  3DSS A;  1OWM A;  3JCK C;  2DZO A;  4I2W A;  3ABK E;  2WXN A;  3PE3 A;  3MKR A;  4O6F A;  3SFX A;  3HXD A;  1TR4 A;  2DCP A;  1N95 A;  4IN3 B;  2X6J A;  4J6I A;  3E30 A;  4NIK A;  2MYO A;  2A4Z A;  4NRH B;  4UQZ A;  1DVP A;  5BXU A;  4YDY A;  1SW6 A;  2IU1 A;  5FIO A;  4JHR A;  5KWD A;  5FQ6 A;  1BPO A;  1KPS B;  5CCL A;  1N0R A;  4ACL A;  4GTT A;  3IHY A;  3NZS A;  4GTR A;  3FUE A;  1UOH A;  1XNF A;  4CDN A;  4OAV B;  1HF8 A;  3DST A;  2R5S A;  4XEI G;  3QB2 A;  5ENR D;  2GRN B;  3JQ1 A;  2QC9 A;  4CCA A;  4ANW A;  2GRR B;  2X6F A;  4AOF A;  4HLL A;  3JYS A;  3FUN A;  4OVV A;  4KZ0 A;  3NQP A;  3L82 A;  4YDW A;  4CGW A;  3ULE G;  3RRN B;  2J07 A;  2NC9 A;  4GTQ A;  1A17 A;  5ITZ F;  3KS2 A;  1YYH A;  3ASO E;  2P9L G;  4QQI A;  1BI7 B;  4HOU A;  3NF1 A;  3RJV A;  3ZEF A;  3CQC B;  3ESK A;  3R9A B;  2FEZ A;  2IO2 C;  5CBN A;  4JZY A;  2PQR A;  4UWH A;  4RVB A;  4EHM A;  5IY5 E;  4HBD A;  5CMY A;  4GAA A;  3PE4 A;  4G8K A;  2DIW A;  3PDN A;  2UY1 B;  1OCO E;  1HO8 A;  3FUJ A;  5CMW A;  2XS8 A;  1OWO A;  4M3O A;  4DJA A;  4XIF A;  2V4H C;  3ZPJ A;  2WQH A;  1DNP A;  3J5Q B;  4ANV A;  1ELK A;  3OAW A;  5CED B;  2XEV A;  3OTN A;  4AP2 A;  2DYS E;  1X5B A;  2ION A;  1MHQ A;  5FJY A;  4K5B A;  5D2M C;  2J09 A;  5LOZ A;  3FDH A;  3APF A;  3ZYM A;  1G3N B;  4K5C A;  1P5Q A;  5KJL A;  4N39 A;  3D9J A;  1SZA A;  4KYO B;  5BXO A;  4LEU A;  5B3S E;  2PNN A;  4HLE A;  4BY6 A;  5BNW A;  1KLX A;  3TWQ A;  3VLD A;  2QY7 A;  2MRI A;  3CKB A;  4J8F A;  2P9U G;  3PUK A;  4XI0 A;  1UN9 A;  1O5M A;  3HDX A;  3CQG B;  3CST A;  5EIL A;  3DEO A;  1Y8M A;  3Q15 A;  3EUV A;  4DUI A;  3FH8 A;  2LO6 A;  4I43 A;  5AAR A;  2YNQ A;  4ANX A;  3FFL A;  3ASN E;  2NXP A;  4ABN A;  1WY6 A;  2EIM E;  1O1T A;  5AJL A;  2PM6 A;  5E75 A;  3CHS A;  4XI9 A;  4G11 A;  5HS0 A;  3GYZ A;  2JEK A;  2FBN A;  3ULY A;  4K5A B;  3LVR E;  5D66 A;  2X6I A;  1NA0 A;  5AJD A;  2LAI A;  2MHK A;  5FT9 A;  3R9M A;  2LSU A;  3EHM A;  1E8Y A;  3TJP A;  4BT8 A;  4ATZ D;  4RQI A;  5LX8 A;  1NL4 A;  4LNU D;  4BT9 A;  1EF1 C;  3LJ3 A;  3GW4 A;  3FTW A;  3JQ0 A;  1U2V G;  3ZHE B;  1HU3 A;  2IY0 C;  3FUL A;  4KVM A;  3V31 A;  3MKQ A;  3V2O A;  2J08 A;  1FT2 A;  3CV0 A;  5CER B;  2LXM A;  3RSE G;  4GCN A;  4UUC A;  5EYP F;  2IOS A;  3DWL G;  2J8S D;  4TUM A;  4GMJ A;  4U0Z A;  4IRU A;  2V0P A;  2CG3 A;  3G2S A;  2WXP A;  2LXL A;  4I1M A;  2V4L A;  3FUF A;  3HVE B;  4G25 A;  4W9R A;  3ESL A;  4AVX A;  5JJ6 A;  3DPD A;  4AY6 A;  2GRM A;  3FTS A;  3UKR G;  3FTV A;  3SBT B;  1OWL A;  3VTX A;  4JC8 A;  2J49 A;  1KZP A;  4LER A;  2HR2 A;  5AEN A;  2JLB A;  3EU9 A;  2YQ8 A;  5BV0 A;  5BW8 C;  4JA9 A;  1TYQ G;  3IKO B;  1XGW A;  3L9T A;  1AP7 A;  3O48 A;  4Q96 A;  3DXM G;  2A5U A;  4ILH B;  3Q5M A;  3EHN A;  4B8A A;  5EX3 A;  1OWN A;  3AG2 E;  1NI1 A;  2RD0 A;  2ZXW E;  3C5R A;  5HKP A;  3D9I A;  1ELW A;  3PNT B;  2BTD A;  3ML8 A;  4G23 A;  4JEH A;  2I1K A;  3S7B A;  3KEA A;  1MZC A;  3ZKJ A;  2IO3 C;  3LPZ A;  3FU6 A;  3SNX A;  1K1B A;  4G1T A;  3TWS A;  4N3B A;  1H6O A;  1H6K A;  3ABM E;  3FEY A;  4B89 A;  4ATG A;  2EIJ E;  3WG7 E;  4TXR A;  3TGO A;  3URZ A;  3L08 A;  1S63 A;  1OCC E;  5LP0 A;  3D9O A;  3FUI A;  1WDY A;  3FU5 A;  3TXN A;  2KBX A;  2R02 A;  3G2U A;  2J9Q A;  4FC8 A;  3UMV A;  1WM5 A;  5CCM A;  4G8L A;  4YND A;  2LAH A;  3EJN A;  1E96 B;  2EIN E;  4JEU A;  2L6J A;  3TWU A;  3E4B A;  3IHV A;  3LY7 A;  3QAQ A;  2HYZ A;  3HIZ A;  3SO8 A;  5AQ9 A;  3ZYL A;  4EPZ A;  3B7B A;  2OCC E;  5G2N A;  4CDM A;  4HOQ A;  2KCL A;  1OXJ A;  1TNU A;  2PL2 A;  3DSV A;  4C48 B;  4X8Q A;  3Q75 A;  3JUI A;  4U0S A;  3UIN C;  4GMR A;  3ZVV A;  2GRO B;  2UWJ G;  2L0I A;  3MV2 B;  3PZ3 A;  3T8M A;  3CIA A;  4J8S A;  4CDR A;  3QWV A;  1W3B A;  4GCO A;  3JXI A;  4WUY A;  3C3Q A;  1UJJ A;  4XZ4 A;  4DX1 A;  4MRU A;  4F7A A;  4HRL A;  2XRZ A;  4BX8 A;  3PS6 A;  5EKQ D;  3KSQ A;  3MYV A;  3G2V A;  1NP7 A;  2KXP C;  5KCM A;  1LF8 A;  3ZW3 A;  1LD7 A;  4YVO A;  4LNB A;  4KMO A;  4UQY A;  3V79 K;  3OXF A;  3Q49 B;  5C1D A;  5G05 J;  4HRM B;  3HXE A;  4GYO A;  3DRA A;  3UT4 A;  3TAX A;  4OYS A;  1E8Z A;  4XX5 A;  5CEC B;  5KJM A;  4ILI A;  3FWV A;  2E2E A;  2L9B A;  3EHR A;  1JCR A;  1JPL A;  4O1P A;  4HOS A;  4L7T A;  4UI9 C;  5FTP A;  1RW2 A;  4M7C A;  3UM2 A;  4PS3 A;  3UT8 A;  1SVX A;  1NA3 A;  4LCT A;  4A3V A;  1H2T C;  4GTM A;  3SI5 A;  4DLO A;  3MCX A;  3JXJ A;  2YHC A;  2WXG A;  4BES A;  4ANU A;  4B93 B;  1V54 E;  4WAF A;  3ZXS A;  4N5Q A;  2MOW A;  4EQF A;  5ENT D;  4CT0 A;  3L22 A;  3TWW A;  3DXK G;  3D9P A;  3AU5 A;  4N3C A;  5G04 C;  3B7R L;  2VTB A;  3UXG A;  5JA4 D;  4K03 A;  2AVP A;  2PZI A;  5HRY A;  5KJK A;  4G26 A;  3WXX A;  5BUZ A;  2XEH A;  4LSZ E;  3CVX A;  3MX3 A;  4V3I A;  3DPY A;  4I6G A;  1K3Z D;  4JHJ A;  3I3N A;  3HG0 D;  5FQ4 A;  4FAD A;  3ASG A;  4A63 B;  1BD8 A;  3D9L A;  3X2Q E;  2WXM A;  3EU5 A;  2XGO A;  1PC2 A;  4HNA D;  3BU8 A;  4HI8 A;  3IEG A;  2VTB B;  1B89 A;  3LY8 A;  5C2Y A;  2R17 C;  3ZIM A;  3E32 A;  2VGE A;  3GZS A;  1PAQ A;  2IOL A;  4U63 A;  3RKV A;  4FA6 A;  2XCC A;  2KCV A;  5CHE E;  3J5P A;  3Q79 A;  1RZ4 A;  2XCB A;  5A7D B;  4CZ2 D;  4TRQ A;  2UY1 A;  3SFZ A;  1IQU A;  2R2L A;  1N54 A;  4I6J A;  3BG1 B;  4U95 D;  4Q69 A;  4WNF A;  2B0O E;  4PS7 A;  3Q73 A;  1MYO A;  2OEV A;  4D10 C;  1TN6 A;  2JAB A;  2FF4 A;  4MLP A;  1BI8 B;  1IXV A;  3MJW A;  3DSW A;  2WXO A;  3SF4 A;  1SA4 A;  2Y4U A;  3FH7 A;  1YA0 A;  3AG4 E;  2P2C P;  3RO3 A;  4HI9 A;  4UI9 K;  4DI4 A;  1S64 A;  4I9C A;  2VSO E;  1YCS B;  1IHB A;  4UWK A;  4GZD A;  2RFA A;  4KXK B;  3CVN A;  4HOR A;  1PY1 A;  1Z5S C;  2IFU A;  3ZU7 B;  4E6H A;  4U04 A;  3ONL A;  3T5X A;  2RG8 A;  4UWL A;  4AXH A;  4J8D A;  2H6I A;  4EBA G;  1Y6I A;  1E7V A;  1OWP A;  5EDS A;  3NOG D;  2BF0 X;  4GYY A;  5D0O D;  1N4S A;  3EIJ A;  4YVQ C;  1IQR A;  4F53 A;  2V5Q C;  3C72 A;  4RSY A;  5JJ7 A;  4BWR A;  4GYW A;  1N9A A;  3SBS A;  4B94 A;  4PH4 B;  3Q7F A;  2ZIS A;  4APO A;  3G2T A;  5HQ8 A;  5KJN A;  2VGX A;  2AJA A;  1JWF A;  1X81 A;  3IV0 A;  3FHE A;  2F37 A;  3ASF A;  4TV3 A;  5J90 A;  2VSY A;  4JVS A;  1NZN A;  5J08 A;  3LCA A;  3FP3 A;  3CLJ A;  3CHP A;  2DBA A;  4NAC A;  1N4R A;  1UJK A;  2PQN A;  3ZHE A;  3Q7A A;  4U8Y D;  3QDN A;  1HS6 A;  2GRQ B;  3PNL B;  4I2Z A;  2VGX B;  3OXG A;  3PZ1 A;  2DWZ A;  1E90 A;  4UWF A;  4JD2 G;  4LNG A;  3ASH A;  4RG9 A;  2RKK A;  3E33 A;  1NFI E;  2A5E A;  3HVE A;  3GZ1 A;  2L6B A;  5FWQ A;  3JUE A;  2XRY A;  2GRL A;  4GB9 A;  1VDY A;  4N5C A;  3SD5 A;  4A55 A;  2WM9 A;  2WQ7 A;  5E76 A;  3ZYK A;  1N94 A;  4A3T A;  3B7U X;  5LCW J;  3LXU X;  1AWC B;  1HFA A;  3ZNG A;  3GZ2 A;  2BKG A;  3TWV A;  3CK9 A;  4BTB A;  3CVQ A;  2AXZ A;  4BSX A;  1OUV A;  2KC7 A;  4I9E A;  1TEZ A;  3RRU A;  4HFG A;  2M63 A;  3EHQ A;  3CVV A;  4U7E B;  4H7Y A;  2H6H A;  3C3R A;  2Y1L E;  5ENP D;  2NYJ A;  5AQ7 A;  4ZHB A;  4DX6 D;  1TJC A;  4O60 A;  3QWP A;  1QNF A;  2YIN A;  3PZ2 A;  4APF A;  3CHQ A;  3IXE A;  4U07 A;  2XHE A;  3Q47 B;  3CR3 A;  3UTM A;  1HG5 A;  3UT7 A;  2KCK A;  3CVP A;  3CHM A;  3CEQ A;  3AS5 A;  3UIO C;  5EIB E;  2J4B A;  2C2L A;  3UI2 A;  1QYM A;  3O4Z A;  4QFV A;  3U3W A;  1GW6 A;  5AIJ A;  3PEV B;  3D3M A;  3QJZ A;  5T4Y A;  2XEE A;  4OVU A;  4DK5 A;  1MX6 A;  3MEK A;  1D9S A;  3TL5 A;  3RO2 A;  2XZD G;  2ETB A;  3F6Q A;  5AN8 A;  2WXI A;  4U8H A;  4MKT A;  1ELR A;  4AJW A;  4DLQ A;  3AS4 A;  4F1P A;  4HXI A;  4AM9 A;  1ZU2 A;  4FHJ A;  1FVH A;  1ZBP A;  2CFZ A;  3CKC A;  1JWG A;  3LDZ A;  3W9F A;  4BSZ B;  2QFC A;  1U3D A;  4N2S A;  4HS2 A;  1HX8 A;  5KNH D;  4AEZ C;  3SZ7 A;  3PEU B;  4XKC A;  4MBG A;  4EBA A;  3KEZ A;  1HG2 A;  3LJN A;  3UPV A;  2XS1 A;  4E85 A;  1O1S A;  3HXB A;  2WMO A;  1ZB1 A;  2VYI A;  1EYH A;  2V8S E;  4CRW A;  2H6F A;  1UN8 A;  3BUA A;  2VSN A;  2HO1 A;  2CHZ A;  2X6K A;  1JCS A;  4DX7 D;  5FQ8 A;  3TG4 A;  2Y0B G;  2XPZ A;  3Q78 A;  1TNB A;  2AXV A;  4XE0 A;  5AYW D;  2ZGG A;  3KD7 A;  3UUX A;  4AV7 A;  2VQ2 A;  4B0Z A;  4GTV A;  4U8V D;  2H6G A;  3L6A A;  3UM1 A;  4DX5 D;  2FO1 E;  2IJG X;  4KT6 B;  5B1A E;  3IBE A;  4HVB A;  4IYP A;  4KVO A;  5JHA A;  3FEX A;  4F6R D;  4DX2 A;  3L16 A;  4FLH A;  4BX9 A;  4FJZ A;  4ME2 A;  3FTU A;  2XPI A;  4L1B A;  3B95 A;  5FIN A;  5KNG A;  2ILR A;  4GU5 A;  3NZU A;  4EZK A;  3UKU G;  2XGM A;  4UI9 J;  3UX4 A;  1FT1 A;  5CEA A;  3ZN3 A;  3FUH A;  3AJI A;  1O1R A;  2OEW A;  3FU0 A;  3OXL A;  2DZN A;  4BFR A;  1DCE A;  1FCH A;  2WXH A;  4IUL A;  1H2U A;  1WG0 A;  4PDX A;  3Q4A B;  1YMP A;  5G55 A;  3QAR A;  1S70 B;  3D9M A;  4FLB A;  3T8K A;  4Y6W A;  4U0U A;  4O1O A;  4C0E A;  4FU3 A;  4ILG A;  3QKY A;  5G04 J;  3EDT B;  3I4G A;  4DRX E;  4J8E A;  1HH8 A;  3TG5 A;  2CFU A;  2FO7 A;  3ML9 A;  1KZO A;  4L9P A;  4KZC A;  1KT1 A;  4G24 A;  4P29 A;  1QBQ A;  5ENO D;  3VLE A;  3KSL A;  3Q9U C;  3ONK A;  1TNZ A;  2P9I G;  3SGH A;  2RFM A;  5ENS D;  5EN5 D;  1TN7 A;  3B7T A;  3L17 A;  3CK7 A;  3PZD A;  1TNO A;  3FUD A;  4ZFH A;  3MZL B;  5BT1 A;  4BEP A;  1INZ A;  3TWT A;  2WXF A;  1D8D A;  1N4P A;  4TXQ A;  2J4D A;  3DSX A;  3PRZ A;  5FZS A;  3QWW A;  3AG1 E;  3TWR A;  2P9K G;  4GZ6 A;  2C0L A;  2LUH A;  4Z68 A;  2E0I A;  3UM3 A;  2VSX E;  4GTS A;  5ANL A;  3N71 A;  1SA5 A;  4J8Y A;  5DIZ A;  1IHG A;  4BTA A;  3CVW A;  3L13 A;  2EQX A;  2HM8 A;  1TJF A;  1LTX A;  2VJ8 A;  3CVU A;  5AQB A;  3QOU A;  1HE8 A;  3FY4 A;  4J0U A;  3VLF A;  3ZFW A;  4RLY A;  1MX4 A;  2ZIR A;  4L2Y A;  4Y6C A;  3Q9N C;  3NAW A;  3HHM A;  3HYM B;  4JPS A;  2QYJ A;  3MV3 B;  3L54 A;  3E37 A;  3LVQ E;  2Q7F A;  3LYA A;  3FH5 A;  1OCZ E;  1DC2 A;  5ARF A;  2X3M A;  2AWI A;  3QNK A;  3CHR A;  2WXQ A;  4WND A;  3RAU A;  2EIK E;  4Q94 A;  4JL0 A;  4DPR A;  1BLX B;  3HXC A;  2ETA A;  3LKU A;  2IQC A;  1H19 A;  3R7Q A;  4I1O B;  3QC1 A;  3PZ4 A;  4GA0 A;  4LG6 A;  2BUG A;  4C0M A;  5T3R A;  1SQM A;  3S7J A;  1K1A A;  3NB2 A;  3EIQ C;  4GPM A;  4AIF A;  4RG6 A;  2XEN A;  3K9I A;  3V30 A; 
#chains in the Genus database with same CATH homology
 2A4Z A;  4NRH B;  3JUI A;  4UQZ A;  4U0S A;  1DVP A;  2X38 A;  3ZVV A;  2AXU A;  2UWJ G;  2L0I A;  1TJC A;  2IU1 A;  3MV2 B;  4JHR A;  4H7X A;  5HI7 A;  3QWP A;  5FQ6 A;  1BPO A;  3T8M A;  1QNF A;  3CIA A;  5CCL A;  4ACL A;  3ZYQ A;  4CEM A;  2YIN A;  4J8S A;  4APF A;  4CDR A;  4CT4 A;  2WMN A;  2WXJ A;  3IHY A;  3NZS A;  3QWV A;  1W3B A;  3CHQ A;  3FUE A;  4GCO A;  3BEE A;  3FTZ A;  1XNF A;  4U07 A;  2XHE A;  3Q47 B;  4CDN A;  3CR3 A;  1HF8 A;  2R5S A;  4WUY A;  4WNG A;  1UJJ A;  3D9N A;  4XZ4 A;  1HG5 A;  3UT7 A;  4MRU A;  4F7A A;  4KBQ A;  4LRZ A;  2XRZ A;  4A1S A;  2KCK A;  3QB2 A;  3JQ1 A;  4BX8 A;  1H0A A;  4CCA A;  2I2O A;  4ANW A;  3PS6 A;  5EKQ D;  2X6F A;  4AOF A;  3MYV A;  3JYS A;  3FUN A;  3G2V A;  1NP7 A;  3CVP A;  3CHM A;  5KCM A;  4EEC A;  4OVV A;  1LF8 A;  3CEQ A;  4KZ0 A;  3NQP A;  3AS5 A;  3ZW3 A;  2XGS A;  4JXT A;  4K0R A;  3ULQ A;  4YVO A;  3SHF A;  1QQE A;  4KMO A;  4CGW A;  4UQY A;  2J4B A;  3RRN B;  2C2L A;  2J07 A;  2NC9 A;  3OXF A;  3O4Z A;  4QFV A;  3Q49 B;  3U3W A;  2P58 C;  1A17 A;  1GW6 A;  5C1D A;  5G05 J;  5AIJ A;  3PEV B;  3D3M A;  2IF4 A;  2I6H A;  3QJZ A;  4GYO A;  5T4Y A;  3CGH A;  5M72 A;  4OVU A;  3PVL A;  4DK5 A;  3UT4 A;  3T5V A;  2LNI A;  3KS2 A;  3B13 A;  3MEK A;  3PUJ A;  3TAX A;  3UQ3 A;  4OYS A;  3TL5 A;  1E8Z A;  4XX5 A;  4HOU A;  3RO2 A;  3D9K A;  3NF1 A;  4GZ3 A;  3RJV A;  2WVI A;  3CQC B;  4ILI A;  4N3A A;  3ZEF A;  5KJM A;  3AS8 A;  3FWV A;  3ESK A;  2E2E A;  2L9B A;  3R9A B;  3PH0 C;  1JPL A;  4HOS A;  2FEZ A;  2WXI A;  4JZY A;  2PQR A;  4UWH A;  4L7T A;  4RVB A;  4U8H A;  4F1S A;  4UI9 C;  4MKT A;  1ELR A;  4AJW A;  2XPY A;  4DLQ A;  5FTP A;  3U64 A;  2Y4T A;  3AS4 A;  3QK0 A;  1SZ9 A;  5CMY A;  4I6E A;  4HXI A;  4TUU A;  4AM9 A;  1UW4 B;  1ZU2 A;  4GAA A;  4PS3 A;  3UT8 A;  4FHJ A;  3PE4 A;  1FVH A;  1NA3 A;  1ZBP A;  2CFZ A;  2DIW A;  3CKC A;  3PDN A;  1JWG A;  2UY1 B;  4LCT A;  4A3V A;  1H2T C;  4PS8 A;  3LDZ A;  3SI5 A;  1Z3Y A;  4DLO A;  5DBK A;  2QFC A;  1HO8 A;  3MCX A;  4L2L A;  4WWO A;  3U4T A;  1U3D A;  2YHC A;  2WXG A;  3FUJ A;  5CMW A;  4N2S A;  1EPU A;  3P2B A;  2WXL A;  4LUN U;  4ANU A;  3FU3 A;  1OWO A;  4M3O A;  4DJA A;  4HS2 A;  4XIF A;  4WAF A;  2WQH A;  1HX8 A;  3ZPJ A;  1DNP A;  4AEZ C;  3SZ7 A;  3ZXS A;  3PEU B;  4XKC A;  4EBA A;  3KEZ A;  1HG2 A;  3S2A A;  2NSZ A;  2MOW A;  4EQF A;  4ANV A;  3UPV A;  3FTY A;  2KZT A;  4CT0 A;  1ELK A;  2V5F A;  3OAW A;  4E85 A;  2XEV A;  3OTN A;  3L22 A;  4AP2 A;  1X5B A;  2WMO A;  2ION A;  1MHQ A;  3D9P A;  2VYI A;  3AU5 A;  1EYH A;  4N3C A;  5G04 C;  3R7R A;  4N2Q A;  3VTY A;  2V8S E;  2CG2 A;  3B7R L;  4CRW A;  2VTB A;  1UN8 A;  2C0M A;  5FJY A;  4K03 A;  2VSN A;  3BG0 B;  5LCW C;  2HO1 A;  1WAO 1;  2AVP A;  2CHZ A;  2J09 A;  2PZI A;  2XQ0 A;  3FUM A;  3FDH A;  5ENN A;  3APF A;  4G26 A;  5LOZ A;  3AU4 A;  3S7D A;  3WXX A;  2WXK A;  2X6K A;  3ZYM A;  5BUZ A;  1P5Q A;  5KJL A;  4N39 A;  4WWN A;  3D9J A;  5FQ8 A;  1SZA A;  4KYO B;  3TG4 A;  3CVX A;  3MX3 A;  4LEU A;  2XPZ A;  4V3I A;  4I6G A;  2AXV A;  4JHJ A;  4XE0 A;  5AYW D;  3I3N A;  4HLE A;  5FQ4 A;  4BY6 A;  4FAD A;  3ASG A;  5BNW A;  3KD7 A;  1KLX A;  2ZU6 B;  3UUX A;  1E8X A;  3VLD A;  3D9L A;  3MKQ B;  2FUL A;  2QY7 A;  4AV7 A;  2MRI A;  2VQ2 A;  4B0Z A;  2YHE A;  3ASD A;  3CKB A;  2KZT B;  2WXM A;  4FJY A;  3PRE A;  4J8F A;  2XGO A;  4F3V A;  3PUK A;  4GZC A;  1PC2 A;  5A6C A;  4GZ5 A;  3L6A A;  4XI0 A;  3CHO A;  4FUL A;  1UN9 A;  4GA2 A;  3IEG A;  3HDX A;  1EDU A;  2IJG X;  3CQG B;  3CST A;  4KT6 B;  2VTB B;  1B89 A;  3LY8 A;  5C2Y A;  2R17 C;  1Y8M A;  3IBE A;  3Q15 A;  3ZIM A;  4HVB A;  3RIB A;  4IYP A;  3GZS A;  1PAQ A;  2KM4 A;  2IOL A;  2L0T B;  4U63 A;  3RKV A;  4KVO A;  4FA6 A;  5JHA A;  2XCC A;  5ANR A;  2KCV A;  3U66 A;  3FH8 A;  3FEX A;  5CHE E;  5JHB A;  1Z6T A;  4G2V A;  2LO6 A;  4I43 A;  4FP7 A;  4ANX A;  2YNQ A;  3L16 A;  2XCB A;  4XKB A;  5A7D B;  4WNE A;  4FLH A;  4BX9 A;  3FFL A;  4FJZ A;  3LEW A;  4TRQ A;  2UY1 A;  4ME2 A;  3FTU A;  2XPI A;  2NXP A;  2LSV A;  1WY6 A;  4L1B A;  3SFZ A;  4ABN A;  5AJL A;  1IQU A;  1E8W A;  1N54 A;  4I6J A;  2PM6 A;  3BG1 B;  2ILR A;  4Q69 A;  3ENE A;  5E75 A;  4GU5 A;  3CHS A;  3RK6 A;  3NZU A;  4WNF A;  4XI9 A;  4EZK A;  2XGM A;  4G11 A;  4PS7 A;  4UI9 J;  3UX4 A;  5D0Q D;  3ZN3 A;  3GYZ A;  2JEK A;  4R7L A;  4D10 C;  3FUH A;  2FBN A;  1HZ4 A;  4URK A;  2FF4 A;  4MLP A;  3LVR E;  4A1G A;  3FU0 A;  2X6I A;  1NA0 A;  3OXL A;  4JA7 A;  1MQS A;  3DBS A;  4BFR A;  3MJW A;  5AJD A;  2LAI A;  1FCH A;  1H2V C;  2WXH A;  5ARG A;  1FVF A;  2MHK A;  4IUL A;  1H2U A;  5FT9 A;  4PDX A;  2AW6 A;  2LSU A;  3EHM A;  3Q4A B;  4PUC A;  2WXO A;  1E8Y A;  3TJP A;  4BT8 A;  3SF4 A;  2Y3A A;  5G55 A;  2Y4U A;  3QAR A;  3D9M A;  5LX8 A;  3FH7 A;  4BT9 A;  1EF1 C;  3LJ3 A;  4FLB A;  1YA0 A;  4Y6W A;  3GW4 A;  4UWG A;  3FTW A;  4U0U A;  3JQ0 A;  3RO3 A;  4C0E A;  4CGV A;  4FU3 A;  1HU3 A;  3QKY A;  4ILG A;  3FUL A;  4UI9 K;  3U9W A;  3ZHE B;  5G04 J;  4KVM A;  4DI4 A;  4I9C A;  4JW1 A;  3EDT B;  3MKQ A;  2VSO E;  2J08 A;  5JJT A;  3I4G A;  4J8E A;  1HH8 A;  3TG5 A;  2OV8 A;  1UG3 A;  2CFU A;  3CV0 A;  4I17 A;  2FI7 A;  4UWK A;  4GZD A;  2FO7 A;  3ML9 A;  3CVY A;  4KZC A;  4HOT A;  4GCN A;  1KT1 A;  5FZQ A;  4G24 A;  3C98 A;  4KXK B;  5BV1 A;  4P29 A;  3CVN A;  4HOR A;  2IOS A;  5LFA A;  3VLE A;  1PY1 A;  4GMJ A;  2IFU A;  3ONK A;  4U0Z A;  4IRU A;  2V0P A;  3SGH A;  2CG3 A;  1IYG A;  3RU0 A;  3G2S A;  4E6H A;  3B7T A;  4U04 A;  3ONL A;  3I5P A;  2WXP A;  3L17 A;  3CK7 A;  3T5X A;  3PZD A;  4I1M A;  2V4L A;  4L23 A;  1KT0 A;  2RG8 A;  3FUF A;  4FHK A;  5FQ7 A;  1U3C A;  3HVE B;  3KAE A;  3CSF A;  4G25 A;  3FUD A;  4UWL A;  4W9R A;  4AXH A;  3ESL A;  3MZL B;  4J8D A;  5BT1 A;  4WWP A;  3APC A;  4AVX A;  1INZ A;  4EBA G;  2WXF A;  1Y6I A;  1E7V A;  1OWP A;  4UQX A;  5JJ6 A;  3DPD A;  5EDS A;  4GYY A;  2BF0 X;  5D0O D;  4AY6 A;  3EIJ A;  2GRM A;  2J4D A;  1IQR A;  3FTS A;  4YVQ C;  3FTV A;  3SBT B;  4F53 A;  3PRZ A;  2OND A;  1OWL A;  5FZS A;  4GPK A;  3VTX A;  1HXI A;  3QWW A;  2R59 A;  4RSY A;  5JJ7 A;  4BWR A;  4JC8 A;  2J49 A;  4MS6 A;  4GYW A;  4LER A;  3SBS A;  2HR2 A;  4B94 A;  4PH4 B;  5KJK A;  5AEN A;  3LY9 A;  5EX0 A;  2JLB A;  4GZ6 A;  2YQ8 A;  2C0L A;  4EZL A;  4APO A;  3G2T A;  5HQ8 A;  5KJN A;  2E0I A;  5BV0 A;  5BW8 C;  5BPP A;  2VGX A;  4JA9 A;  1Z3X A;  4GML A;  2VSX E;  3LS8 A;  1JWF A;  2CHX A;  2OVF A;  5ANL A;  3N71 A;  3RRM B;  3IKO B;  5DIZ A;  1IHG A;  1XGW A;  3IV0 A;  3FHE A;  3O48 A;  4Q96 A;  4BTA A;  3L13 A;  4I1A A;  3CVW A;  1L5J A;  2EQX A;  3ASF A;  4TV3 A;  2HM8 A;  1TJF A;  2A5U A;  5J90 A;  2VSY A;  4JVS A;  1NZN A;  2WPV A;  1N52 A;  4GA1 A;  3LCA A;  5J08 A;  4ILH B;  3FP3 A;  4NQ0 A;  3CLJ A;  3CHP A;  2OVB A;  2I9C A;  3Q5M A;  2DBA A;  3EHN A;  2VJ8 A;  3CVU A;  3QOU A;  4NAC A;  1HE8 A;  3FY4 A;  4B8A A;  4J0U A;  5EX3 A;  1OWN A;  5FZR A;  2KAT A;  2RD0 A;  3CVL A;  3D9I A;  1ELW A;  3PNT B;  3VLF A;  3I4R B;  3ZGQ A;  2BTD A;  3ML8 A;  4G23 A;  2CHW A;  4JEH A;  1UJK A;  3B7S A;  2PQN A;  4NUR A;  3ZFW A;  3ZHE A;  4B8C B;  4L2Y A;  2I1K A;  2I1J A;  4Y6C A;  3QDN A;  3S7B A;  1HS6 A;  1JUQ A;  3FUK A;  4ACK A;  3APD A;  3PNL B;  3LPZ A;  2VGX B;  3FU6 A;  4I2Z A;  3OXG A;  4G1T A;  3SNX A;  4N3B A;  1H6K A;  3P1U A;  3FEY A;  2WXR A;  4DI3 A;  4B89 A;  5G05 C;  3HHM A;  1E90 A;  2WQ6 A;  4UWF A;  4ATG A;  5T8I A;  3HYM B;  2VGY A;  1E7U A;  4JPS A;  3ASH A;  4C9B B;  3TGO A;  3URZ A;  3L08 A;  2GW1 A;  3MV3 B;  4RG9 A;  3L54 A;  5LP0 A;  3D9O A;  3LVQ E;  2Q7F A;  4JHK A;  3FUI A;  1S0P A;  3LYA A;  2PM7 A;  3FU5 A;  3TXN A;  3FH5 A;  3HVE A;  3G2W A;  3GZ1 A;  3G2U A;  5FWQ A;  2XRY A;  4EZJ A;  2J9Q A;  4FC8 A;  3UMV A;  2GRL A;  3CK8 A;  2WB2 A;  4GB9 A;  1WM5 A;  5CCM A;  1VDY A;  3MGB A;  5ARF A;  4N5C A;  2X3M A;  2AWI A;  3QNK A;  4YND A;  3CHR A;  3SD5 A;  5A23 A;  2LAH A;  4A55 A;  2WXQ A;  3EJN A;  2WM9 A;  3TXM A;  3ZRH A;  2WQ7 A;  5E76 A;  1E96 B;  3ZYK A;  4WND A;  4JEU A;  4Q94 A;  4A3T A;  4AY5 A;  3B7U X;  5LCW J;  2L6J A;  2X6H A;  1QZ2 A;  3E4B A;  3LXU X;  3IHV A;  4JL0 A;  1HFA A;  2GGF A;  3LY7 A;  3QAQ A;  4DPR A;  3GZ2 A;  2HYZ A;  3HIZ A;  3FTX A;  2OOE A;  3MA5 A;  3CK9 A;  3LKU A;  3S7F A;  2IQC A;  3ZYL A;  1OWM A;  1H19 A;  4BTB A;  3JCK C;  3CVQ A;  2AXZ A;  4I2W A;  3R7Q A;  1OUV A;  2WXN A;  3QC1 A;  4I1O B;  4BSX A;  4EPZ A;  2KC7 A;  3PE3 A;  3MKR A;  4GA0 A;  4I9E A;  1TEZ A;  4O6F A;  3RRU A;  4HFG A;  2M63 A;  2BUG A;  4C0M A;  2DCP A;  5T3R A;  3CVV A;  4H7Y A;  5G2N A;  1SQM A;  4CDM A;  4HOQ A;  2KCL A;  4IN3 B;  2X6J A;  4J6I A;  3S7J A;  3EIQ C;  2PL2 A;  4AIF A;  4RG6 A;  3K9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...