4EQFA

Trip8b-1a#206-567 interacting with the carboxy-terminal seven residues of hcn2
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
281
Chain Sequence
GYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEX5-related protein
publication title Structure and stoichiometry of an accessory subunit TRIP8b interaction with hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/transport protein
total genus 107
structure length 281
sequence length 312
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4eqfA00
2L6JA 4HOSA 4Y6CA 4GA0A 2JLBA 4N3CA 3URZA 2YQ8A 4U0UA 4I9EA 3TG4A 2Y4TA 5JJ7A 4GYYA 4U0ZA 3QOUA 3QWVA 5G04J 3GW4A 1A17A 4GYOA 3GZ2A 4LEUA 3OXGA 4EQFA 2UY1A 4NRHB 2DBAA 3SZ7A 3VTXA 1WAO1 3CV0A 1KT0A 1W3BA 3CKCA 4A1SA 5DBKA 4JA9A 4JL0A 1KLXA 2IFUA 1TJCA 2Q7FA 3CK9A 1QQEA 4YVQC 5AYWD 2WQHA 2QFCA 3ASFA 4N5CA 5HQ8A 4N2QA 5CCMA 1NA0A 4AM9A 2C0MA 2IF4A 4O6FA 5ARGA 5C1DA 3UUXA 5BT1A 1E96B 4GA1A 4F3VA 4BWRA 5G05C 4GZ5A 5FZQA 2PZIA 5FZSA 1KT1A 4AY5A 2XPIA 3ZFWA 4WNDA 5A7DB 3K9IA 2XCCA 5JJTA 1ZBPA 4J0UA 4U0SA 3RJVA 3QDNA 3PE4A 2KC7A 1B89A 4JA7A 4J8DA 5FT9A 3RKVA 3ULQA 3RU0A 3QKYA 4HOUA 3KD7A 4WNFA 3PDNA 3WXXA 2FEZA 3FP3A 4WNEA 3ZN3A 3KAEA 3KS2A 4Y6WA 3ZPJA 3R9AB 2VGXB 4XIFA 3Q4AB 4BTBA 3LYAA 4WUYA 4AY6A 2LSUA 1YA0A 3S7JA 4U04A 4GZ6A 4CGWA 4CGVA 5A6CA 2KATA 5ARFA 4WNGA 3ZHEB 2OOEA 1PC2A 2VQ2A 4NQ0A 2LSVA 4B94A 3HYMB 4G24A 4G26A 2PQNA 4BT9A 3CK8A 4GZ3A 4UI9C 2KCLA 2KCVA 2FF4A 3QWWA 3PE3A 2YHCA 1HZ4A 5EX3A 2HYZA 3FWVA 3U4TA 3U3WA 5KJNA 4W9RA 4N39A 3NF1A 4I2WA 3SF4A 3VTYA 3TG5A 2V5FA 4YVOA 3QWPA 2E2EA 4I2ZA 2XGSA 1WM5A 3UQ3A 2UY1B 3UPVA 4G2VA 3LY8A 4XI9A 3ESKA 3MKRA 3CVNA 4KYOB 4GCNA 3MA5A 3IEGA 4RG6A 3CVLA 1IYGA 5CHEE 2BUGA 1NZNA 4UQXA 5KJLA 2PL2A 3MV2B 1Y8MA 4HOQA 3Q15A 3RO3A 2VGYA 3Q47B 3CKBA 3EDTB 2VSYA 4ABNA 2GW1A 4GA2A 2AVPA 3GZ1A 5LCWC 4HORA 3BEEA 2FO7A 2UWJG 3Q5MA 4N3AA 4RG9A 2C0LA 5D0QD 2Y4UA 5M72A 4J8FA 4H7YA 4UI9J 2J9QA 3FFLA 2P58C 3ASDA 5EX0A 3MV3B 3RIBA 3S7BA 4UI9K 2XGMA 2VSNA 3TGOA 4GYWA 5BNWA 1ELWA 2HR2A 1OUVA 3Q49B 1ZU2A 3CVPA 3O48A 5KJKA 5DIZA 3LKUA 4BT8A 4HOTA 4I17A 5G05J 4GCOA 4G1TA 3AS5A 3LPZA 3S7DA 3LY7A 2XEVA 3S7FA 4JHRA 2MHKA 2XGOA 2R5SA 3AS4A 2NC9A 4H7XA 3OXFA 4YNDA 5FTPA 5FJYA 5D0OD 3OXLA 5G04C 1P5QA 4U07A 4KXKB 2LNIA 2PQRA 5KJMA 4I1AA 5EKQD 3LY9A 1HXIA 3JYSA 4N2SA 5FZRA 4UQYA 4UQZA 3LCAA 5LCWJ 1ELRA 5CCLA 2XCBA 3CK7A 3ZGQA 4I9CA 4BTAA 2VGXA 3ASGA 1HH8A 3AS8A 4KBQA 1QZ2A 2HO1A 3RO2A 2WPVA 4GPKA 5JJ6A 4N3BA 1FCHA 3E4BA 3CVQA 2FI7A 4APOA 4J8EA 4G25A 2I6HA 3CEQA 3MEKA 5BW8C 4IN3B 4ME2A 4AIFA 2C2LA 3ZHEA 3TAXA 2KCKA 2VYIA 3GYZA 1IHGA 1NA3A 4G23A 5HI7A 2ONDA 3ASHA 4XI0A 4CDRA 2FBNA 3N71A 1XNFA
chains in the Genus database with same CATH superfamily
3AU5A 2L6JA 2AXUA 2EINE 4U8HA 4V3IA 2JLBA 4N3CA 4UUCA 3ZIMA 5JJ7A 5AENA 3U64A 5AJDA 3QJZA 1HE8A 2RG8A 3QWVA 3QNKA 4BEPA 3NOCD 4GYOA 3GZ2A 3R7RA 5ENPD 4LEUA 3OXGA 4BESA 5ENTD 3DEPA 2BF0X 1AWCB 4IULA 3QK0A 2MYOA 2OCCE 3PNLB 1N4SA 4J8SA 1V54E 3VTXA 2GROB 3FTWA 4A1SA 3Q7FA 5AQ7A 5DBKA 2GRNB 3KEZA 4HLEA 1TJCA 1KPSB 3UMVA 5AYWD 1SZAA 4AVXA 4BY6A 3ASFA 2VSOE 3C72A 3ULYA 3L13A 3QC1A 2X6JA 4AM9A 4ACKA 1QBQA 2WXOA 3LJNA 5ENSD 4FP7A 4I43A 5BXOA 2EIME 4OYSA 3UUXA 5BT1A 1MX4A 4XZ4A 1E96B 2GRRB 4OAUC 3L16A 4F3VA 4BWRA 4DX1A 1EF1C 3TWSA 5CRVA 1SA5A 4HI9A 1OCZE 2XPIA 3ZFWA 4WNDA 1E7UA 5KCMA 1TNBA 1MX6A 1DC2A 3JQ0A 1TYQG 5A7DB 3K9IA 4NIKA 3DSXA 4J8YA 2H6HA 1OWOA 3D9LA 4HFGA 4AJWA 3IBEA 4MBGA 4LSZE 5FT9A 3UKRG 3ULQA 1YCSB 2DVWA 2XEHA 4HQDA 3KD7A 2XZTG 4C0MA 3EHMA 2WQ7A 3G2SA 5JHBA 3ZN3A 3KAEA 4XIFA 3LVQE 2ZXWE 3LYAA 3CIAA 4JZYA 2H6GA 3JXIA 4U7EB 1JUQA 4DUIA 4U04A 2BKGA 2IY0C 2RFAA 4QQIA 4UWLA 4WWPA 5CMYA 4JHKA 3ZVVA 5C2YA 3KSQA 2KATA 3APFA 2OOEA 3AJIA 5ANLA 1PC2A 2VQ2A 1OXJA 4B94A 4G26A 3SFYA 2VSXE 2WXFA 4GTRA 4JVSA 5BPPA 3BG1B 3PE3A 3NB2A 2HYZA 3MKQB 2P9NG 3E33A 5AIJA 5T8IA 5AQAA 1D8DA 3CQCB 2A4ZA 3TWTA 2WMOA 4K5AB 3D9IA 3V2XA 3NF1A 4K5CA 3ABME 2HE0A 3QWPA 4I2ZA 3B7SA 1HF8A 4BETA 3LY8A 2WXNA 3AG3E 3ESKA 3MKRA 1LD8A 3V30A 4KYOB 1YYHA 4M7CA 4N5QA 4I1OB 3LXUX 3DEOA 5CECB 2X6FA 5LOZA 5ITZF 1UJJA 1BLXB 3WG7E 4DX6D 2XS8A 4ATZD 3PUJA 1EPUA 3FTXA 3EDTB 3HXFA 3PS6A 3CVVA 4GA2A 4I6JA 4ABNA 2AVPA 5LCWC 4DI3A 4UWKA 2X3MA 3FH8A 4KZCA 1OY3D 4RG9A 1N95A 2C0LA 5D0QD 1IQRA 3KSLA 3ESLA 1TNZA 4F1PA 2GGFA 2P58C 2BEDA 3TL5A 3MV3B 3S7BA 4UI9K 3TGOA 3MCXA 4I6EA 4I1MA 3Q49B 4ZHBA 4HBDA 2A5EA 3LKUA 4BT8A 2AXZA 2KZTA 4K0RA 4DLOA 2L0TB 2X6KA 3DXMG 4L1BA 2XGOA 2KM4A 5LX8A 1SVXA 2EIKE 5BXUA 1UOHA 3E34A 1U3DA 3OXFA 3ONLA 3SFXA 3SHFA 3OXLA 1P5QA 4KXKB 2PQRA 2F8XK 5KJMA 1JCRA 1U3CA 3CVXA 3JYSA 3I3NA 4U8VD 3Q7AA 5FZRA 1FVFA 5ENRD 3TWWA 2V5QC 2J09A 1IHBA 5LCWJ 4G11A 5CCLA 4U8YD 3L6AA 3ZGQA 2QZAA 4I9CA 1LF8A 4TUUA 2CG2A 4DJAA 3NAWA 1QZ2A 3BG0B 1MZCA 3CR3A 4IYPA 1FT2A 3RRMB 1TNUA 1FCHA 3E4BA 4G25A 2JABA 4EZLA 1O1TA 4GTMA 4ME2A 5BUZA 2C2LA 2IQCA 3Q75A 2KCKA 3CSFA 3UT4A 3GYZA 1IHGA 2NYJA 3SBSA 5FQ6A 1TJFA 1JWGA 2V4HC 2XENA 2WXGA 5D2MC 3DXKG 3LS8A 4F1SA 4LERA 4AXHA 4HOSA 4Y6CA 4AP2A 1HG2A 2XQ0A 2YQ8A 2XPYA 4I9EA 2LO6A 4U0ZA 3QOUA 5LFAA 3ZUVB 4TV3A 5CMWA 3D3MA 4GTOA 4IRUA 2NXPA 2P9IG 3FHEA 2UY1A 3FUNA 4NRHB 3Q9NC 3SZ7A 1WAO1 2ETBA 3PREA 3CV0A 3ONKA 2P2CP 1OCCE 1UN9A 4O60A 2QC9A 5ANRA 3CK9A 2ZGDA 3FTZA 1WG0A 4N5CA 5HQ8A 2VTBA 3LDZA 2DYRE 3I5PA 3D9PA 2FULA 3Q73A 1JCQA 3E37A 4YDWA 4GAAA 4GA1A 4PUCA 3HHMA 5G05C 4GZ5A 4O1OA 3PZ1A 1U2VG 5FZSA 4HXIA 3UM1A 1DCQA 1PAQA 4DLQA 4GU5A 1ZBPA 2Y69E 3RJVA 2F8YA 3QDNA 5EDSA 2RD0A 5EILA 1B89A 5B3SE 2VTBB 4JA7A 3T8MA 2ZGGA 4J8DA 3RU0A 3QKYA 2ZU6B 1KZOA 4ATGA 3C98A 3WXXA 2WQ6A 4ILHB 2FEZA 3UT8A 2MRIA 1AP7A 3I4GA 4EHMA 5D66A 3TXNA 3NQPA 3R9AB 3PVLA 1OT8A 2M63A 2LSUA 5LP0A 3RK6A 3R7QA 3FUJA 1UW4B 5EN5D 3SQVA 5BV1A 4ILGA 3SBTB 2XRZA 2CG3A 4CGVA 3ULEG 2LXLA 2IOSA 4K03A 2R03A 2BTDA 2IEJA 5A6CA 2L0IA 3ZHEB 1IXVA 3OTNA 4C9BB 3D9HA 2LSVA 1TN8A 3QARA 2PQNA 4MLPA 1K8KG 3PZ4A 4BT9A 1KZPA 1SQMA 4GZ3A 2XS1A 1RW2A 1MQSA 3J5PA 3QWWA 4DX7D 1HZ4A 4PS8A 2QY7A 3HDXA 1WDYA 2R2LA 5T3RA 3ABKE 3U3WA 5KJNA 3GZSA 4PDXA 4N39A 2AWIA 3JUIA 2F37A 4GB9A 2H6FA 4LNGA 2CFZA 3TG5A 2V5FA 3MJWA 1WM5A 3O4ZA 4APFA 3UPVA 3TJPA 4G2VA 4NACA 1Z3YA 4BFRA 3FY4A 5FQ8A 1OCRE 4EBAA 2VGEA 5EIDA 5FWQA 4OVVA 2DCPA 3L9TA 3MA5A 4CYMD 4L2LA 4B8AA 3U66A 1VDYA 2R17C 4KT6B 3X2QE 2J4DA 3DBSA 3DSWA 2ETCA 4TXPA 3CVYA 1JWFA 2A5UA 4UQXA 3ZYKA 2V0PA 3Q15A 3D9NA 5T4YA 2OV8A 2V8SE 3Q47B 1SW6A 3ZEFA 3FU6A 4GZDA 1ZB1A 3FUIA 3ASNE 2FO7A 2KBXA 3FTSA 4A3TA 1RZ4A 3RAUA 2XHEA 5E76A 3Q5MA 4N3AA 4Q69A 3CGHA 2X6HA 3I4RB 2J9QA 3FFLA 5CEDB 1TEZA 5EIBE 3PZ3A 2L9BA 4WWNA 4D10C 2VSNA 4FC8A 2LAIA 4GYWA 3PRZA 3C3OA 4WWOA 4CZ2D 3CLJA 3CVPA 5FQ7A 4HS2A 4I6GA 2J07A 3T9KA 1BI7B 2XPZA 1FPPA 2DZOA 2XZDG 2CHZA 3AS5A 2GRMA 3LJ3A 3S7DA 3RRNB 2XEVA 3S7FA 4JHRA 2MHKA 3DRAA 1DNPA 1NI1A 2R5SA 3AS4A 3MGBA 2NC9A 1NL4A 1G3NB 4RVBA 2ILRA 2EILE 3ASOE 4CEMA 2P9SG 5B1BE 5D0OD 3UM2A 5G04C 1LD7A 2IO2C 3EHNA 4GZCA 1H0AA 1OWMA 5CBOA 3LY9A 1N4QA 3FTVA 3ENEA 4XE0A 3IHYA 2E0IA 3CHRA 3NBNB 3LCAA 2EIJE 2VGXA 4BX9A 4PS7A 3UINC 3AS8A 2DZNA 1SA4A 1WY6A 2IOLA 4GPKA 3HXBA 4N3BA 1QYMA 2AW6A 5AQ9A 5JA4D 4J8EA 5B1AE 3CEQA 3MEKA 5BW8C 4IN3B 4GMRA 1N11A 2MOWA 5ENOD 3SY2A 1L5JA 1IQUA 4CCAA 3TAXA 1NA3A 2J49A 4Q94A 4M3OA 5HI7A 2PM7A 4LG6A 3V31A 4HRMB 3ASHA 5EYPF 1EDUA 3IXEA 3E30A 1Z3XA 3ISMC 3FUMA 1XGWA 5AJLA 4FLHA 3QB2A 4LCTA 3URZA 4U0UA 2RKKA 4ANVA 2YHEA 2RFMA 3TG4A 2Y4TA 1OWLA 5G04J 4ANUA 1A17A 3Q78A 3B7RL 4GTVA 4JEUA 4EQFA 3W9FA 1UN8A 3TWVA 3AAAC 2DBAA 3IV0A 1KT0A 1W3BA 4GMLA 4R7LA 2GRQB 5JMND 4HNAD 3APCA 1H2UA 3DPDA 1H6PA 4JA9A 1TNYA 3FH5A 5A23A 2QYJA 4A1GA 1HX8A 3C5RA 3EHRA 2Q7FA 3PNTB 4CT4A 3FULA 1QQEA 3D9OA 5CEAA 1H6KA 4A55A 4P29A 1NA0A 3FTUA 3SGHA 3EU5A 2C0MA 2IF4A 2Y3AA 5ARGA 4CRWA 4WAFA 2WXHA 2B0OE 2IU1A 2WXPA 5FZQA 1MYOA 3HVEA 2PZIA 2KZTB 2WMNA 1PY1A 3Q79A 4MRUA 5JHAA 4AY5A 2LXMA 3JQ1A 4A3VA 2XCCA 3FEYA 2DWZA 1FVHA 5JJTA 3ZYLA 4J0UA 4TRQA 4U0SA 2CHWA 2J08A 3PE4A 2WVIA 4FHJA 5AARA 1HU3A 2CHXA 3T8KA 4HOUA 3F6QA 4F6RD 3PDNA 4RLYA 3DWLG 3FP3A 4WNEA 3KS2A 4Y6WA 4FADA 2Y0BG 3Q4AB 3ZKJA 4BTBA 3S2AA 4EZJA 3B95A 1YA0A 4O1PA 1INZA 4XEIG 4TXRA 4EPZA 4CGWA 4EZKA 4B0ZA 3T5XA 2OEVA 4U95D 1HS6A 4MS6A 3CSTA 2IONA 1A5EA 1MX2A 3ZXPA 3HYMB 4G24A 1H19A 3SO8A 3DSTA 5J90A 1N0RA 2KCLA 5AQBA 2KCVA 2V4LA 4LUNU 4JC8A 5J08A 2FF4A 5CBNA 1Z5SC 2YHCA 3B7UX 3HXCA 3FWVA 1HO8A 3SNXA 2XEEA 4DK5A 4RQIA 2ETAA 3SF4A 3FUHA 1H6OA 4KMOA 3VLFA 3VTYA 2L6BA 3ZXSA 3TWRA 2OVFA 3VLDA 3MX3A 2E2EA 1N4RA 2XGSA 2UY1B 3FUFA 4LNUD 2ZISA 1TN6A 4GCNA 3JCKC 3ZNGA 4EECA 3EUVA 1UG3A 3FUKA 1H2TC 5CHEE 3B7BA 1NZNA 3T5VA 5KJLA 2PL2A 4HOQA 2F0YA 1X5BA 4RSYA 2VGYA 4PS3A 5H7PA 1S64A 3V79K 2VSYA 2GW1A 3FU5A 3GZ1A 3ZYMA 4CDNA 4K5BA 3J5QB 3BEEA 4JXTA 1E90A 1V55E 4FU3A 2UWJG 2FO1E 2Y4UA 1HG5A 1K1AA 4J8FA 3FTYA 5ENQD 4C0EA 3ASDA 3IKOB 5G55A 5EX0A 3RIBA 3FDHA 3D9KA 2XGMA 1D9SA 5AAOA 3EIJA 2Y1LE 3MZLB 1ELWA 4JPSA 3AG4E 3SD5A 1MJ0A 1OUVA 1ZU2A 3O48A 3SI5A 4L2YA 5DIZA 1E8YA 4J6IA 1OWNA 1H2VC 1Y6IA 5G05J 3OAWA 4GCOA 4HVBA 4G1TA 2DYSE 3LY7A 4KVOA 4E6HA 4J7WA 2OVBA 4G8KA 3DSSA 4JHJA 3UIPC 3HXDA 1E7VA 4YNDA 3UXGA 4HRNA 4GTPA 2PNNA 2LNIA 4I1AA 1Z6TA 2I1JA 5EKQD 1HXIA 4N2SA 1S0PA 2WXLA 3IHVA 3ML8A 3KEAA 1NFIE 4L9PA 4UQYA 4FJYA 4OAVB 4UQZA 5FINA 1UJKA 4GMJA 1X81A 3CHPA 1ELRA 2XCBA 5FIOA 3ASGA 1HH8A 4TUMA 3CHMA 4Q96A 3U9WA 3PEVB 3RO2A 1N52A 3P1UA 2WPVA 5JJ6A 3MYVA 2OEWA 1O5MA 2QYUA 1TNOA 3CVQA 4APOA 4DX5D 3ZU7B 2I6HA 3ZRHA 3NZSA 1O1SA 2VYIA 5E75A 4G23A 3DPYA 5BV0A 4XI0A 3B7TA 3P2BA 4YDOA 4EBAG 3C3QA 3EHQA 2FBNA 4BX8A 3N71A 5HS0A 3FH7A 1GW6A 2IJGX 3TWUA 3L82A 2WXKA 3FUEA 3MKQA 3CVWA 4GA0A 3FU3A 4XX5A 1JCSA 4BERA 3ZW3A 1S70B 4LRZA 4GYYA 3GW4A 1HFAA 1BI8B 4L7TA 4B93B 1BU9A 3PEUB 4JW1A 2YINA 4U63A 3TWXA 3CKCA 4GPMA 3TXMA 4JL0A 3PUKA 2WXJA 1KLXA 2IFUA 1MHQA 3AG2E 3NOGD 2HM8A 3CHOA 1IKND 4YVQC 4JEHA 2WQHA 2QFCA 3HXEA 3UI2A 4X8QA 5CCMA 4N2QA 5CRUA 5EYLA 2XRYA 2PM6A 1E8XA 1LTXA 4O6FA 4HI8A 3D9MA 4A63B 5C1DA 4CDMA 1K3ZD 2P9UG 2YNQA 4AOFA 4UWFA 1N94A 4U96D 5ENNA 3DSVA 3NZUA 3TWQA 4JB8P 1KT1A 2WXQA 1E8WA 4HLLA 3BUAA 5KNGA 3UM3A 4DX2A 2R02A 3PZ2A 3HG0D 3VLEA 3ML9A 4F7AA 3HRAA 3PH0C 2KC7A 4XKBA 4UWGA 3RSEG 3RKVA 2B6CA 2LUHA 4L23A 4GTQA 4WNFA 1N54A 2I2OA 3L17A 4NURA 4B89A 3ZPJA 1JPLA 3UM0A 2VGXB 4BSZB 4ANXA 4WUYA 4AY6A 2P9LG 2GRLA 3CHQA 3S7JA 4JD2G 2WB2A 4GZ6A 3CVUA 4PH4B 4FHKA 3C3RA 3QAQA 4B8CB 2I9CA 5ARFA 4WNGA 3PZDA 4NQ0A 5AN8A 1N0QA 2P9KG 3G2UA 3V2OA 1OCOE 3CK8A 4DRXE 4ANWA 4GTSA 4UI9C 2WXIA 2DIWA 3UT7A 3UIOC 2R59A 5EX3A 4FLBA 3DSUA 3E32A 4QFVA 5FQ4A 1D8EA 3U4TA 1EYHA 4W9RA 4AV7A 4I2WA 5KBAA 3FU0A 4HRLA 2IO3C 2R05A 4YDEA 4MKTA 2WM9A 4YVOA 2JEKA 3UQ3A 4F53A 1DCEA 4XI9A 3B13A 3L22A 3Q9UC 1E8ZA 1NP7A 4XKCA 3CVNA 3IEGA 2GRPB 4RG6A 2EQXA 2J8SD 3EIQC 3CVLA 2P9PG 1IYGA 4FJZA 4LNBA 1ELKA 3APDA 2BUGA 5CERB 3MV2B 4AEZC 2AJAA 1Y8MA 2ZIRA 3RO3A 3AU4A 1TN7A 3CKBA 1BPOA 3ABLE 1BD8A 4HORA 4TXQA 3R9MA 4FULA 3CHSA 4G8LA 3BU8A 3HVEB 3G2VA 1FT1A 5KNHD 4DPRA 4UWHA 3LVRE 4KZ0A 5M72A 3HIZA 4H7YA 4UI9J 3FUDA 4DI4A 4CT0A 3EU9A 3G2TA 5BNWA 2HR2A 2VJ8A 3ZYQA 5KJKA 1N4PA 1YMPA 1O1RA 1OWPA 3FEXA 4HOTA 4I17A 4KVMA 2I1KA 3LPZA 4ACLA 3BQOA 1K1BA 2NSZA 2X38A 2LAHA 3L54A 2WXRA 3UTMA 1Q2ZA 4Z68A 1TR4A 3JXJA 4H7XA 3D9JA 3CQGB 2CFUA 3AG1E 5FTPA 5HRYA 4E85A 5FJYA 3RRUA 5G2NA 3W9GA 4U07A 4YDYA 3SFZA 4ILIA 2BKKB 3UKUG 4HB5A 2X6IA 1N9AA 3JUEA 4C48B 5IY5E 1S63A 4BSXA 3CK7A 4BTAA 1DVPA 4KBQA 2J4BA 2HO1A 4FA6A 4ZFHA 4GTTA 2KXPC 2FI7A 4URKA 3EJNA 5KWDA 4AIFA 2AXVA 3ZHEA 3UX4A 3G2WA 5HKPA 1SZ9A 2WXMA 2H6IA 2ONDA 4CDRA 3LEWA 1QNFA 4OVUA 1XNFA 3L08A
chains in the Genus database with same CATH topology
3AU5A 4F1SA 2L6JA 1Z3XA 4LERA 2IJGX 2AXUA 4AXHA 3FUMA 4HOSA 2WXKA 1XGWA 3FUEA 3MKQA 4U8HA 4FLHA 4V3IA 3QB2A 4Y6CA 5AJLA 4GA0A 3CVWA 3FU3A 2JLBA 4LCTA 4N3CA 3URZA 4AP2A 1HG2A 2XQ0A 2YQ8A 4U0UA 4ANVA 4XX5A 2YHEA 2XPYA 4I9EA 3TG4A 3ZIMA 3ZW3A 4LRZA 2Y4TA 5JJ7A 5AENA 3U64A 1OWLA 2LO6A 5AJDA 3QJZA 4GYYA 1HE8A 4U0ZA 2RG8A 3QOUA 5LFAA 3QWVA 5G04J 3GW4A 1A17A 4ANUA 4TV3A 3QNKA 1HFAA 3B7RL 5CMWA 4GYOA 4L7TA 3D3MA 3GZ2A 3R7RA 4JEUA 3OXGA 4IRUA 2NXPA 3FHEA 4LEUA 4EQFA 3PEUB 2BF0X 4JW1A 1UN8A 4IULA 3QK0A 2UY1A 3FUNA 4NRHB 2YINA 3PNLB 4U63A 4J8SA 2DBAA 3IV0A 3SZ7A 1WAO1 3PREA 3VTXA 3CV0A 1KT0A 3ONKA 1W3BA 3CKCA 4GMLA 3FTWA 4R7LA 3TXMA 4A1SA 3APCA 1H2UA 5DBKA 3DPDA 4JA9A 4JL0A 1UN9A 3KEZA 3PUKA 2WXJA 1KLXA 3FH5A 5A23A 4HLEA 2IFUA 1MHQA 4A1GA 1HX8A 1TJCA 2Q7FA 3PNTB 5ANRA 4CT4A 3FULA 2HM8A 3CHOA 3CK9A 1QQEA 4YVQC 3UMVA 5AYWD 4JEHA 3D9OA 2WQHA 1SZAA 3FTZA 1H6KA 2QFCA 3ASFA 4AVXA 2VSOE 4BY6A 4A55A 4N5CA 4P29A 5HQ8A 4N2QA 5CCMA 2VTBA 3L13A 1NA0A 3FTUA 3LDZA 3QC1A 2X6JA 3SGHA 4ACKA 2XRYA 2C0MA 1E8XA 2PM6A 2IF4A 2WXOA 3I5PA 4FP7A 4I43A 3D9PA 4O6FA 2Y3AA 5ARGA 4CRWA 4AM9A 3D9MA 4OYSA 5C1DA 3UUXA 2FULA 5BT1A 4CDMA 4WAFA 4XZ4A 2WXHA 1E96B 3L16A 2IU1A 2YNQA 4GAAA 4GA1A 4PUCA 4AOFA 4UWFA 4F3VA 4BWRA 3HHMA 5G05C 2WXPA 1EF1C 4GZ5A 5FZQA 3ZEFA 5ENNA 3HVEA 2PZIA 5FZSA 2KZTB 2WMNA 4HXIA 1PY1A 3NZUA 4MRUA 1KT1A 2WXQA 4AY5A 5JHAA 1E8WA 2XPIA 3ZFWA 4WNDA 1E7UA 5KCMA 1PAQA 4DLQA 2WQ7A 3JQ0A 3JQ1A 5A7DB 4A3VA 3K9IA 2XCCA 3FEYA 1FVHA 4GU5A 5JJTA 1ZBPA 3ZYLA 4J0UA 4TRQA 3VLEA 4U0SA 3ML9A 2CHWA 1OWOA 3RJVA 3D9LA 2J08A 4F7AA 3QDNA 3PE4A 5EDSA 2WVIA 4FHJA 3PH0C 4HFGA 2RD0A 2KC7A 4AJWA 1B89A 2VTBB 4JA7A 1HU3A 3IBEA 3T8MA 4XKBA 4J8DA 4UWGA 5FT9A 3RKVA 2CHXA 3ULQA 3RU0A 3QKYA 2ZU6B 4HOUA 3KD7A 4L23A 4WNFA 4ATGA 3C98A 1N54A 3PDNA 2I2OA 3WXXA 4C0MA 3EHMA 2WQ6A 4ILHB 2FEZA 3FP3A 3L17A 4NURA 2MRIA 3G2SA 4WNEA 3UT8A 3I4GA 4B89A 5JHBA 3ZN3A 3KAEA 3KS2A 4Y6WA 3NQPA 3TXNA 3ZPJA 4FADA 1JPLA 3R9AB 2VGXB 3PVLA 4XIFA 3Q4AB 3LVQE 4BTBA 3S2AA 3LYAA 3CIAA 2M63A 4JZYA 4EZJA 4ANXA 4WUYA 4AY6A 2LSUA 1YA0A 1INZA 2GRLA 3CHQA 5LP0A 3RK6A 1JUQA 3S7JA 3R7QA 2WB2A 3FUJA 1UW4B 4GZ6A 4U04A 4EPZA 4CGWA 3CVUA 4EZKA 5BV1A 4ILGA 3SBTB 2XRZA 2CG3A 4PH4B 4CGVA 2IOSA 4K03A 4B0ZA 4FHKA 4UWLA 4WWPA 2BTDA 5CMYA 3QAQA 4JHKA 3ZVVA 5C2YA 4B8CB 5A6CA 2I9CA 3T5XA 2KATA 2L0IA 5ARFA 3APFA 4WNGA 3ZHEB 2OOEA 3PZDA 5ANLA 1PC2A 2VQ2A 3OTNA 4C9BB 1HS6A 4NQ0A 2LSVA 4MS6A 3CSTA 2IONA 3G2UA 4B94A 3QARA 3HYMB 4G24A 4G26A 2PQNA 4MLPA 4BT9A 1H19A 1SQMA 2VSXE 2WXFA 3CK8A 4GZ3A 4UI9C 4ANWA 5J90A 2KCLA 4JVSA 2KCVA 2V4LA 4LUNU 1MQSA 4JC8A 5J08A 2FF4A 2WXIA 2DIWA 5BPPA 3BG1B 3QWWA 3PE3A 3UT7A 2R59A 1HZ4A 2YHCA 5EX3A 4PS8A 4FLBA 2QY7A 2HYZA 3B7UX 3HDXA 5T3RA 3MKQB 3FWVA 5AIJA 1HO8A 5T8IA 4QFVA 5FQ4A 3U4TA 3CQCB 3SNXA 1EYHA 2A4ZA 4DK5A 3U3WA 2WMOA 5KJNA 3GZSA 4W9RA 3D9IA 4AV7A 4PDXA 4N39A 3NF1A 2AWIA 3JUIA 4I2WA 4GB9A 3SF4A 3FUHA 3FU0A 2CFZA 4KMOA 3VLFA 3VTYA 3TG5A 3ZXSA 2OVFA 2V5FA 3VLDA 4MKTA 2WM9A 3MX3A 3QWPA 2E2EA 2JEKA 4YVOA 3MJWA 4I2ZA 2XGSA 1WM5A 3UQ3A 2UY1B 3B7SA 3FUFA 3O4ZA 4APFA 4F53A 3UPVA 3TJPA 1HF8A 4G2VA 3LY8A 2WXNA 3B13A 4XI9A 3ESKA 3L22A 3MKRA 4NACA 1Z3YA 4BFRA 3FY4A 1E8ZA 3CVVA 5FQ8A 1NP7A 4XKCA 4EBAA 3CVNA 4KYOB 5FWQA 4OVVA 4GCNA 2DCPA 3MA5A 3IEGA 3JCKC 4L2LA 4RG6A 2EQXA 4B8AA 1VDYA 2R17C 3EIQC 4KT6B 3U66A 4EECA 2J4DA 1UG3A 3CVLA 4I1OB 3FUKA 1H2TC 1IYGA 3DBSA 4FJZA 3LXUX 1ELKA 2X6FA 5LOZA 3APDA 3CVYA 1JWFA 2A5UA 5CHEE 2BUGA 1NZNA 3T5VA 1UJJA 4UQXA 5KJLA 2PL2A 3MV2B 3ZYKA 4AEZC 1Y8MA 3PUJA 4HOQA 2V0PA 3Q15A 3RO3A 3D9NA 1EPUA 3AU4A 1X5BA 5T4YA 2OV8A 3FTXA 2V8SE 2VGYA 4RSYA 3Q47B 3CKBA 1BPOA 4PS3A 3EDTB 2VSYA 3FU6A 2GW1A 3FU5A 3PS6A 4GA2A 4GZDA 2AVPA 3GZ1A 4I6JA 3ZYMA 4ABNA 4CDNA 4DI3A 5LCWC 3FUIA 4UWKA 4HORA 2X3MA 3BEEA 4JXTA 2FO7A 3FH8A 3FTSA 1E90A 4FULA 4A3TA 3CHSA 4FU3A 2XHEA 5E76A 2UWJG 3HVEB 4KZCA 3Q5MA 3G2VA 4N3AA 2C0LA 4RG9A 5D0QD 4DPRA 4Q69A 1IQRA 4UWHA 2Y4UA 1HG5A 3LVRE 4KZ0A 3CGHA 3ESLA 2X6HA 5M72A 3I4RB 3HIZA 4H7YA 4J8FA 4UI9J 2J9QA 2GGFA 3FFLA 2P58C 3FTYA 3FUDA 1TEZA 4C0EA 2L9BA 4DI4A 3ASDA 3IKOB 5G55A 5EX0A 3TL5A 3MV3B 3RIBA 3FDHA 4CT0A 3D9KA 4UI9K 2XGMA 4WWNA 3S7BA 3G2TA 4D10C 2VSNA 4FC8A 2LAIA 3TGOA 4GYWA 3MCXA 3EIJA 3MZLB 5BNWA 4I6EA 1ELWA 2HR2A 4JPSA 2VJ8A 3PRZA 4I1MA 3ZYQA 3SD5A 1OUVA 4WWOA 3Q49B 1ZU2A 3CLJA 3CVPA 3O48A 4L2YA 5FQ7A 5DIZA 3SI5A 5KJKA 1E8YA 4HS2A 4I6GA 1OWPA 4J6IA 1OWNA 2J07A 3FEXA 3LKUA 4BT8A 4HOTA 1H2VC 4I17A 4KVMA 2XPZA 1Y6IA 5G05J 2I1KA 3OAWA 4GCOA 4HVBA 2KZTA 2AXZA 4K0RA 4G1TA 2CHZA 3AS5A 3LPZA 2GRMA 4ACLA 3LJ3A 3S7DA 4DLOA 2NSZA 3LY7A 2L0TB 2X38A 2LAHA 3RRNB 3L54A 2WXRA 4KVOA 4E6HA 2X6KA 2OVBA 2XEVA 3S7FA 4L1BA 4JHRA 2MHKA 2XGOA 2KM4A 1DNPA 4JHJA 5LX8A 2R5SA 1E7VA 3AS4A 2NC9A 3MGBA 3D9JA 4H7XA 4RVBA 2ILRA 4CEMA 3CQGB 1U3DA 3OXFA 4YNDA 2CFUA 5FTPA 4E85A 3ONLA 5FJYA 3RRUA 5D0OD 3SHFA 5G2NA 3OXLA 5G04C 1P5QA 4U07A 4KXKB 2LNIA 2PQRA 3EHNA 5KJMA 4GZCA 1H0AA 1U3CA 1OWMA 4I1AA 1Z6TA 3SFZA 2I1JA 4ILIA 5EKQD 3LY9A 1HXIA 3CVXA 3JYSA 3FTVA 4N2SA 3I3NA 3ENEA 1S0PA 2WXLA 4XE0A 3IHYA 3IHVA 2X6IA 3ML8A 5FZRA 4UQYA 2E0IA 1FVFA 3CHRA 4FJYA 4UQZA 1UJKA 2J09A 4GMJA 3LCAA 5LCWJ 3CHPA 4G11A 1ELRA 4BSXA 5CCLA 2XCBA 3CK7A 3L6AA 3ZGQA 4I9CA 4BTAA 1LF8A 2VGXA 3ASGA 4BX9A 1HH8A 4PS7A 1DVPA 3AS8A 4TUUA 2CG2A 4DJAA 3CHMA 4Q96A 3U9WA 4KBQA 1QZ2A 2J4BA 2HO1A 3PEVB 3RO2A 1WY6A 2IOLA 1N52A 3P1UA 2WPVA 3BG0B 4GPKA 4FA6A 5JJ6A 3MYVA 3CR3A 4IYPA 4N3BA 2AW6A 3RRMB 1FCHA 3E4BA 3CVQA 2FI7A 4APOA 4J8EA 4URKA 4G25A 2I6HA 3EJNA 4EZLA 3CEQA 3MEKA 5BW8C 4IN3B 3ZRHA 4ME2A 2MOWA 4AIFA 5BUZA 2AXVA 1L5JA 2C2LA 2IQCA 3NZSA 1IQUA 3ZHEA 4CCAA 3TAXA 2KCKA 5E75A 2VYIA 3CSFA 3UT4A 3UX4A 3GYZA 1IHGA 1NA3A 2J49A 3G2WA 4G23A 5BV0A 4Q94A 3SBSA 5FQ6A 1SZ9A 2WXMA 4M3OA 5HI7A 1TJFA 2PM7A 1JWGA 2ONDA 3ASHA 4XI0A 4CDRA 3B7TA 3P2BA 3LEWA 1QNFA 4EBAG 2FBNA 4OVUA 3N71A 4BX8A 2WXGA 3FH7A 1EDUA 1XNFA 3L08A 1GW6A 3LS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6J A;  4HOS A;  4Y6C A;  4GA0 A;  2JLB A;  4N3C A;  3URZ A;  2YQ8 A;  4U0U A;  4I9E A;  3TG4 A;  2Y4T A;  5JJ7 A;  4GYY A;  4U0Z A;  3QOU A;  3QWV A;  5G04 J;  3GW4 A;  1A17 A;  4GYO A;  3GZ2 A;  4LEU A;  3OXG A;  4EQF A;  2UY1 A;  4NRH B;  2DBA A;  3SZ7 A;  3VTX A;  1WAO 1;  3CV0 A;  1KT0 A;  1W3B A;  3CKC A;  4A1S A;  5DBK A;  4JA9 A;  4JL0 A;  1KLX A;  2IFU A;  1TJC A;  2Q7F A;  3CK9 A;  1QQE A;  4YVQ C;  5AYW D;  2WQH A;  2QFC A;  3ASF A;  4N5C A;  5HQ8 A;  4N2Q A;  5CCM A;  1NA0 A;  4AM9 A;  2C0M A;  2IF4 A;  4O6F A;  5ARG A;  5C1D A;  3UUX A;  5BT1 A;  1E96 B;  4GA1 A;  4F3V A;  4BWR A;  5G05 C;  4GZ5 A;  5FZQ A;  2PZI A;  5FZS A;  1KT1 A;  4AY5 A;  2XPI A;  3ZFW A;  4WND A;  5A7D B;  3K9I A;  2XCC A;  5JJT A;  1ZBP A;  4J0U A;  4U0S A;  3RJV A;  3QDN A;  3PE4 A;  2KC7 A;  1B89 A;  4JA7 A;  4J8D A;  5FT9 A;  3RKV A;  3ULQ A;  3RU0 A;  3QKY A;  4HOU A;  3KD7 A;  4WNF A;  3PDN A;  3WXX A;  2FEZ A;  3FP3 A;  4WNE A;  3ZN3 A;  3KAE A;  3KS2 A;  4Y6W A;  3ZPJ A;  3R9A B;  2VGX B;  4XIF A;  3Q4A B;  4BTB A;  3LYA A;  4WUY A;  4AY6 A;  2LSU A;  1YA0 A;  3S7J A;  4U04 A;  4GZ6 A;  4CGW A;  4CGV A;  5A6C A;  2KAT A;  5ARF A;  4WNG A;  3ZHE B;  2OOE A;  1PC2 A;  2VQ2 A;  4NQ0 A;  2LSV A;  4B94 A;  3HYM B;  4G24 A;  4G26 A;  2PQN A;  4BT9 A;  3CK8 A;  4GZ3 A;  4UI9 C;  2KCL A;  2KCV A;  2FF4 A;  3QWW A;  3PE3 A;  2YHC A;  1HZ4 A;  5EX3 A;  2HYZ A;  3FWV A;  3U4T A;  3U3W A;  5KJN A;  4W9R A;  4N39 A;  3NF1 A;  4I2W A;  3SF4 A;  3VTY A;  3TG5 A;  2V5F A;  4YVO A;  3QWP A;  2E2E A;  4I2Z A;  2XGS A;  1WM5 A;  3UQ3 A;  2UY1 B;  3UPV A;  4G2V A;  3LY8 A;  4XI9 A;  3ESK A;  3MKR A;  3CVN A;  4KYO B;  4GCN A;  3MA5 A;  3IEG A;  4RG6 A;  3CVL A;  1IYG A;  5CHE E;  2BUG A;  1NZN A;  4UQX A;  5KJL A;  2PL2 A;  3MV2 B;  1Y8M A;  4HOQ A;  3Q15 A;  3RO3 A;  2VGY A;  3Q47 B;  3CKB A;  3EDT B;  2VSY A;  4ABN A;  2GW1 A;  4GA2 A;  2AVP A;  3GZ1 A;  5LCW C;  4HOR A;  3BEE A;  2FO7 A;  2UWJ G;  3Q5M A;  4N3A A;  4RG9 A;  2C0L A;  5D0Q D;  2Y4U A;  5M72 A;  4J8F A;  4H7Y A;  4UI9 J;  2J9Q A;  3FFL A;  2P58 C;  3ASD A;  5EX0 A;  3MV3 B;  3RIB A;  3S7B A;  4UI9 K;  2XGM A;  2VSN A;  3TGO A;  4GYW A;  5BNW A;  1ELW A;  2HR2 A;  1OUV A;  3Q49 B;  1ZU2 A;  3CVP A;  3O48 A;  5KJK A;  5DIZ A;  3LKU A;  4BT8 A;  4HOT A;  4I17 A;  5G05 J;  4GCO A;  4G1T A;  3AS5 A;  3LPZ A;  3S7D A;  3LY7 A;  2XEV A;  3S7F A;  4JHR A;  2MHK A;  2XGO A;  2R5S A;  3AS4 A;  2NC9 A;  4H7X A;  3OXF A;  4YND A;  5FTP A;  5FJY A;  5D0O D;  3OXL A;  5G04 C;  1P5Q A;  4U07 A;  4KXK B;  2LNI A;  2PQR A;  5KJM A;  4I1A A;  5EKQ D;  3LY9 A;  1HXI A;  3JYS A;  4N2S A;  5FZR A;  4UQY A;  4UQZ A;  3LCA A;  5LCW J;  1ELR A;  5CCL A;  2XCB A;  3CK7 A;  3ZGQ A;  4I9C A;  4BTA A;  2VGX A;  3ASG A;  1HH8 A;  3AS8 A;  4KBQ A;  1QZ2 A;  2HO1 A;  3RO2 A;  2WPV A;  4GPK A;  5JJ6 A;  4N3B A;  1FCH A;  3E4B A;  3CVQ A;  2FI7 A;  4APO A;  4J8E A;  4G25 A;  2I6H A;  3CEQ A;  3MEK A;  5BW8 C;  4IN3 B;  4ME2 A;  4AIF A;  2C2L A;  3ZHE A;  3TAX A;  2KCK A;  2VYI A;  3GYZ A;  1IHG A;  1NA3 A;  4G23 A;  5HI7 A;  2OND A;  3ASH A;  4XI0 A;  4CDR A;  2FBN A;  3N71 A;  1XNF A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  2L6J A;  2AXU A;  2EIN E;  4U8H A;  4V3I A;  2JLB A;  4N3C A;  4UUC A;  3ZIM A;  5JJ7 A;  5AEN A;  3U64 A;  5AJD A;  3QJZ A;  1HE8 A;  2RG8 A;  3QWV A;  3QNK A;  4BEP A;  3NOC D;  4GYO A;  3GZ2 A;  3R7R A;  5ENP D;  4LEU A;  3OXG A;  4BES A;  5ENT D;  3DEP A;  2BF0 X;  1AWC B;  4IUL A;  3QK0 A;  2MYO A;  2OCC E;  3PNL B;  1N4S A;  4J8S A;  1V54 E;  3VTX A;  2GRO B;  3FTW A;  4A1S A;  3Q7F A;  5AQ7 A;  5DBK A;  2GRN B;  3KEZ A;  4HLE A;  1TJC A;  1KPS B;  3UMV A;  5AYW D;  1SZA A;  4AVX A;  4BY6 A;  3ASF A;  2VSO E;  3C72 A;  3ULY A;  3L13 A;  3QC1 A;  2X6J A;  4AM9 A;  4ACK A;  1QBQ A;  2WXO A;  3LJN A;  5ENS D;  4FP7 A;  4I43 A;  5BXO A;  2EIM E;  4OYS A;  3UUX A;  5BT1 A;  1MX4 A;  4XZ4 A;  1E96 B;  2GRR B;  4OAU C;  3L16 A;  4F3V A;  4BWR A;  4DX1 A;  1EF1 C;  3TWS A;  5CRV A;  1SA5 A;  4HI9 A;  1OCZ E;  2XPI A;  3ZFW A;  4WND A;  1E7U A;  5KCM A;  1TNB A;  1MX6 A;  1DC2 A;  3JQ0 A;  1TYQ G;  5A7D B;  3K9I A;  4NIK A;  3DSX A;  4J8Y A;  2H6H A;  1OWO A;  3D9L A;  4HFG A;  4AJW A;  3IBE A;  4MBG A;  4LSZ E;  5FT9 A;  3UKR G;  3ULQ A;  1YCS B;  2DVW A;  2XEH A;  4HQD A;  3KD7 A;  2XZT G;  4C0M A;  3EHM A;  2WQ7 A;  3G2S A;  5JHB A;  3ZN3 A;  3KAE A;  4XIF A;  3LVQ E;  2ZXW E;  3LYA A;  3CIA A;  4JZY A;  2H6G A;  3JXI A;  4U7E B;  1JUQ A;  4DUI A;  4U04 A;  2BKG A;  2IY0 C;  2RFA A;  4QQI A;  4UWL A;  4WWP A;  5CMY A;  4JHK A;  3ZVV A;  5C2Y A;  3KSQ A;  2KAT A;  3APF A;  2OOE A;  3AJI A;  5ANL A;  1PC2 A;  2VQ2 A;  1OXJ A;  4B94 A;  4G26 A;  3SFY A;  2VSX E;  2WXF A;  4GTR A;  4JVS A;  5BPP A;  3BG1 B;  3PE3 A;  3NB2 A;  2HYZ A;  3MKQ B;  2P9N G;  3E33 A;  5AIJ A;  5T8I A;  5AQA A;  1D8D A;  3CQC B;  2A4Z A;  3TWT A;  2WMO A;  4K5A B;  3D9I A;  3V2X A;  3NF1 A;  4K5C A;  3ABM E;  2HE0 A;  3QWP A;  4I2Z A;  3B7S A;  1HF8 A;  4BET A;  3LY8 A;  2WXN A;  3AG3 E;  3ESK A;  3MKR A;  1LD8 A;  3V30 A;  4KYO B;  1YYH A;  4M7C A;  4N5Q A;  4I1O B;  3LXU X;  3DEO A;  5CEC B;  2X6F A;  5LOZ A;  5ITZ F;  1UJJ A;  1BLX B;  3WG7 E;  4DX6 D;  2XS8 A;  4ATZ D;  3PUJ A;  1EPU A;  3FTX A;  3EDT B;  3HXF A;  3PS6 A;  3CVV A;  4GA2 A;  4I6J A;  4ABN A;  2AVP A;  5LCW C;  4DI3 A;  4UWK A;  2X3M A;  3FH8 A;  4KZC A;  1OY3 D;  4RG9 A;  1N95 A;  2C0L A;  5D0Q D;  1IQR A;  3KSL A;  3ESL A;  1TNZ A;  4F1P A;  2GGF A;  2P58 C;  2BED A;  3TL5 A;  3MV3 B;  3S7B A;  4UI9 K;  3TGO A;  3MCX A;  4I6E A;  4I1M A;  3Q49 B;  4ZHB A;  4HBD A;  2A5E A;  3LKU A;  4BT8 A;  2AXZ A;  2KZT A;  4K0R A;  4DLO A;  2L0T B;  2X6K A;  3DXM G;  4L1B A;  2XGO A;  2KM4 A;  5LX8 A;  1SVX A;  2EIK E;  5BXU A;  1UOH A;  3E34 A;  1U3D A;  3OXF A;  3ONL A;  3SFX A;  3SHF A;  3OXL A;  1P5Q A;  4KXK B;  2PQR A;  2F8X K;  5KJM A;  1JCR A;  1U3C A;  3CVX A;  3JYS A;  3I3N A;  4U8V D;  3Q7A A;  5FZR A;  1FVF A;  5ENR D;  3TWW A;  2V5Q C;  2J09 A;  1IHB A;  5LCW J;  4G11 A;  5CCL A;  4U8Y D;  3L6A A;  3ZGQ A;  2QZA A;  4I9C A;  1LF8 A;  4TUU A;  2CG2 A;  4DJA A;  3NAW A;  1QZ2 A;  3BG0 B;  1MZC A;  3CR3 A;  4IYP A;  1FT2 A;  3RRM B;  1TNU A;  1FCH A;  3E4B A;  4G25 A;  2JAB A;  4EZL A;  1O1T A;  4GTM A;  4ME2 A;  5BUZ A;  2C2L A;  2IQC A;  3Q75 A;  2KCK A;  3CSF A;  3UT4 A;  3GYZ A;  1IHG A;  2NYJ A;  3SBS A;  5FQ6 A;  1TJF A;  1JWG A;  2V4H C;  2XEN A;  2WXG A;  5D2M C;  3DXK G;  3LS8 A;  4F1S A;  4LER A;  4AXH A;  4HOS A;  4Y6C A;  4AP2 A;  1HG2 A;  2XQ0 A;  2YQ8 A;  2XPY A;  4I9E A;  2LO6 A;  4U0Z A;  3QOU A;  5LFA A;  3ZUV B;  4TV3 A;  5CMW A;  3D3M A;  4GTO A;  4IRU A;  2NXP A;  2P9I G;  3FHE A;  2UY1 A;  3FUN A;  4NRH B;  3Q9N C;  3SZ7 A;  1WAO 1;  2ETB A;  3PRE A;  3CV0 A;  3ONK A;  2P2C P;  1OCC E;  1UN9 A;  4O60 A;  2QC9 A;  5ANR A;  3CK9 A;  2ZGD A;  3FTZ A;  1WG0 A;  4N5C A;  5HQ8 A;  2VTB A;  3LDZ A;  2DYR E;  3I5P A;  3D9P A;  2FUL A;  3Q73 A;  1JCQ A;  3E37 A;  4YDW A;  4GAA A;  4GA1 A;  4PUC A;  3HHM A;  5G05 C;  4GZ5 A;  4O1O A;  3PZ1 A;  1U2V G;  5FZS A;  4HXI A;  3UM1 A;  1DCQ A;  1PAQ A;  4DLQ A;  4GU5 A;  1ZBP A;  2Y69 E;  3RJV A;  2F8Y A;  3QDN A;  5EDS A;  2RD0 A;  5EIL A;  1B89 A;  5B3S E;  2VTB B;  4JA7 A;  3T8M A;  2ZGG A;  4J8D A;  3RU0 A;  3QKY A;  2ZU6 B;  1KZO A;  4ATG A;  3C98 A;  3WXX A;  2WQ6 A;  4ILH B;  2FEZ A;  3UT8 A;  2MRI A;  1AP7 A;  3I4G A;  4EHM A;  5D66 A;  3TXN A;  3NQP A;  3R9A B;  3PVL A;  1OT8 A;  2M63 A;  2LSU A;  5LP0 A;  3RK6 A;  3R7Q A;  3FUJ A;  1UW4 B;  5EN5 D;  3SQV A;  5BV1 A;  4ILG A;  3SBT B;  2XRZ A;  2CG3 A;  4CGV A;  3ULE G;  2LXL A;  2IOS A;  4K03 A;  2R03 A;  2BTD A;  2IEJ A;  5A6C A;  2L0I A;  3ZHE B;  1IXV A;  3OTN A;  4C9B B;  3D9H A;  2LSV A;  1TN8 A;  3QAR A;  2PQN A;  4MLP A;  1K8K G;  3PZ4 A;  4BT9 A;  1KZP A;  1SQM A;  4GZ3 A;  2XS1 A;  1RW2 A;  1MQS A;  3J5P A;  3QWW A;  4DX7 D;  1HZ4 A;  4PS8 A;  2QY7 A;  3HDX A;  1WDY A;  2R2L A;  5T3R A;  3ABK E;  3U3W A;  5KJN A;  3GZS A;  4PDX A;  4N39 A;  2AWI A;  3JUI A;  2F37 A;  4GB9 A;  2H6F A;  4LNG A;  2CFZ A;  3TG5 A;  2V5F A;  3MJW A;  1WM5 A;  3O4Z A;  4APF A;  3UPV A;  3TJP A;  4G2V A;  4NAC A;  1Z3Y A;  4BFR A;  3FY4 A;  5FQ8 A;  1OCR E;  4EBA A;  2VGE A;  5EID A;  5FWQ A;  4OVV A;  2DCP A;  3L9T A;  3MA5 A;  4CYM D;  4L2L A;  4B8A A;  3U66 A;  1VDY A;  2R17 C;  4KT6 B;  3X2Q E;  2J4D A;  3DBS A;  3DSW A;  2ETC A;  4TXP A;  3CVY A;  1JWF A;  2A5U A;  4UQX A;  3ZYK A;  2V0P A;  3Q15 A;  3D9N A;  5T4Y A;  2OV8 A;  2V8S E;  3Q47 B;  1SW6 A;  3ZEF A;  3FU6 A;  4GZD A;  1ZB1 A;  3FUI A;  3ASN E;  2FO7 A;  2KBX A;  3FTS A;  4A3T A;  1RZ4 A;  3RAU A;  2XHE A;  5E76 A;  3Q5M A;  4N3A A;  4Q69 A;  3CGH A;  2X6H A;  3I4R B;  2J9Q A;  3FFL A;  5CED B;  1TEZ A;  5EIB E;  3PZ3 A;  2L9B A;  4WWN A;  4D10 C;  2VSN A;  4FC8 A;  2LAI A;  4GYW A;  3PRZ A;  3C3O A;  4WWO A;  4CZ2 D;  3CLJ A;  3CVP A;  5FQ7 A;  4HS2 A;  4I6G A;  2J07 A;  3T9K A;  1BI7 B;  2XPZ A;  1FPP A;  2DZO A;  2XZD G;  2CHZ A;  3AS5 A;  2GRM A;  3LJ3 A;  3S7D A;  3RRN B;  2XEV A;  3S7F A;  4JHR A;  2MHK A;  3DRA A;  1DNP A;  1NI1 A;  2R5S A;  3AS4 A;  3MGB A;  2NC9 A;  1NL4 A;  1G3N B;  4RVB A;  2ILR A;  2EIL E;  3ASO E;  4CEM A;  2P9S G;  5B1B E;  5D0O D;  3UM2 A;  5G04 C;  1LD7 A;  2IO2 C;  3EHN A;  4GZC A;  1H0A A;  1OWM A;  5CBO A;  3LY9 A;  1N4Q A;  3FTV A;  3ENE A;  4XE0 A;  3IHY A;  2E0I A;  3CHR A;  3NBN B;  3LCA A;  2EIJ E;  2VGX A;  4BX9 A;  4PS7 A;  3UIN C;  3AS8 A;  2DZN A;  1SA4 A;  1WY6 A;  2IOL A;  4GPK A;  3HXB A;  4N3B A;  1QYM A;  2AW6 A;  5AQ9 A;  5JA4 D;  4J8E A;  5B1A E;  3CEQ A;  3MEK A;  5BW8 C;  4IN3 B;  4GMR A;  1N11 A;  2MOW A;  5ENO D;  3SY2 A;  1L5J A;  1IQU A;  4CCA A;  3TAX A;  1NA3 A;  2J49 A;  4Q94 A;  4M3O A;  5HI7 A;  2PM7 A;  4LG6 A;  3V31 A;  4HRM B;  3ASH A;  5EYP F;  1EDU A;  3IXE A;  3E30 A;  1Z3X A;  3ISM C;  3FUM A;  1XGW A;  5AJL A;  4FLH A;  3QB2 A;  4LCT A;  3URZ A;  4U0U A;  2RKK A;  4ANV A;  2YHE A;  2RFM A;  3TG4 A;  2Y4T A;  1OWL A;  5G04 J;  4ANU A;  1A17 A;  3Q78 A;  3B7R L;  4GTV A;  4JEU A;  4EQF A;  3W9F A;  1UN8 A;  3TWV A;  3AAA C;  2DBA A;  3IV0 A;  1KT0 A;  1W3B A;  4GML A;  4R7L A;  2GRQ B;  5JMN D;  4HNA D;  3APC A;  1H2U A;  3DPD A;  1H6P A;  4JA9 A;  1TNY A;  3FH5 A;  5A23 A;  2QYJ A;  4A1G A;  1HX8 A;  3C5R A;  3EHR A;  2Q7F A;  3PNT B;  4CT4 A;  3FUL A;  1QQE A;  3D9O A;  5CEA A;  1H6K A;  4A55 A;  4P29 A;  1NA0 A;  3FTU A;  3SGH A;  3EU5 A;  2C0M A;  2IF4 A;  2Y3A A;  5ARG A;  4CRW A;  4WAF A;  2WXH A;  2B0O E;  2IU1 A;  2WXP A;  5FZQ A;  1MYO A;  3HVE A;  2PZI A;  2KZT B;  2WMN A;  1PY1 A;  3Q79 A;  4MRU A;  5JHA A;  4AY5 A;  2LXM A;  3JQ1 A;  4A3V A;  2XCC A;  3FEY A;  2DWZ A;  1FVH A;  5JJT A;  3ZYL A;  4J0U A;  4TRQ A;  4U0S A;  2CHW A;  2J08 A;  3PE4 A;  2WVI A;  4FHJ A;  5AAR A;  1HU3 A;  2CHX A;  3T8K A;  4HOU A;  3F6Q A;  4F6R D;  3PDN A;  4RLY A;  3DWL G;  3FP3 A;  4WNE A;  3KS2 A;  4Y6W A;  4FAD A;  2Y0B G;  3Q4A B;  3ZKJ A;  4BTB A;  3S2A A;  4EZJ A;  3B95 A;  1YA0 A;  4O1P A;  1INZ A;  4XEI G;  4TXR A;  4EPZ A;  4CGW A;  4EZK A;  4B0Z A;  3T5X A;  2OEV A;  4U95 D;  1HS6 A;  4MS6 A;  3CST A;  2ION A;  1A5E A;  1MX2 A;  3ZXP A;  3HYM B;  4G24 A;  1H19 A;  3SO8 A;  3DST A;  5J90 A;  1N0R A;  2KCL A;  5AQB A;  2KCV A;  2V4L A;  4LUN U;  4JC8 A;  5J08 A;  2FF4 A;  5CBN A;  1Z5S C;  2YHC A;  3B7U X;  3HXC A;  3FWV A;  1HO8 A;  3SNX A;  2XEE A;  4DK5 A;  4RQI A;  2ETA A;  3SF4 A;  3FUH A;  1H6O A;  4KMO A;  3VLF A;  3VTY A;  2L6B A;  3ZXS A;  3TWR A;  2OVF A;  3VLD A;  3MX3 A;  2E2E A;  1N4R A;  2XGS A;  2UY1 B;  3FUF A;  4LNU D;  2ZIS A;  1TN6 A;  4GCN A;  3JCK C;  3ZNG A;  4EEC A;  3EUV A;  1UG3 A;  3FUK A;  1H2T C;  5CHE E;  3B7B A;  1NZN A;  3T5V A;  5KJL A;  2PL2 A;  4HOQ A;  2F0Y A;  1X5B A;  4RSY A;  2VGY A;  4PS3 A;  5H7P A;  1S64 A;  3V79 K;  2VSY A;  2GW1 A;  3FU5 A;  3GZ1 A;  3ZYM A;  4CDN A;  4K5B A;  3J5Q B;  3BEE A;  4JXT A;  1E90 A;  1V55 E;  4FU3 A;  2UWJ G;  2FO1 E;  2Y4U A;  1HG5 A;  1K1A A;  4J8F A;  3FTY A;  5ENQ D;  4C0E A;  3ASD A;  3IKO B;  5G55 A;  5EX0 A;  3RIB A;  3FDH A;  3D9K A;  2XGM A;  1D9S A;  5AAO A;  3EIJ A;  2Y1L E;  3MZL B;  1ELW A;  4JPS A;  3AG4 E;  3SD5 A;  1MJ0 A;  1OUV A;  1ZU2 A;  3O48 A;  3SI5 A;  4L2Y A;  5DIZ A;  1E8Y A;  4J6I A;  1OWN A;  1H2V C;  1Y6I A;  5G05 J;  3OAW A;  4GCO A;  4HVB A;  4G1T A;  2DYS E;  3LY7 A;  4KVO A;  4E6H A;  4J7W A;  2OVB A;  4G8K A;  3DSS A;  4JHJ A;  3UIP C;  3HXD A;  1E7V A;  4YND A;  3UXG A;  4HRN A;  4GTP A;  2PNN A;  2LNI A;  4I1A A;  1Z6T A;  2I1J A;  5EKQ D;  1HXI A;  4N2S A;  1S0P A;  2WXL A;  3IHV A;  3ML8 A;  3KEA A;  1NFI E;  4L9P A;  4UQY A;  4FJY A;  4OAV B;  4UQZ A;  5FIN A;  1UJK A;  4GMJ A;  1X81 A;  3CHP A;  1ELR A;  2XCB A;  5FIO A;  3ASG A;  1HH8 A;  4TUM A;  3CHM A;  4Q96 A;  3U9W A;  3PEV B;  3RO2 A;  1N52 A;  3P1U A;  2WPV A;  5JJ6 A;  3MYV A;  2OEW A;  1O5M A;  2QYU A;  1TNO A;  3CVQ A;  4APO A;  4DX5 D;  3ZU7 B;  2I6H A;  3ZRH A;  3NZS A;  1O1S A;  2VYI A;  5E75 A;  4G23 A;  3DPY A;  5BV0 A;  4XI0 A;  3B7T A;  3P2B A;  4YDO A;  4EBA G;  3C3Q A;  3EHQ A;  2FBN A;  4BX8 A;  3N71 A;  5HS0 A;  3FH7 A;  1GW6 A;  2IJG X;  3TWU A;  3L82 A;  2WXK A;  3FUE A;  3MKQ A;  3CVW A;  4GA0 A;  3FU3 A;  4XX5 A;  1JCS A;  4BER A;  3ZW3 A;  1S70 B;  4LRZ A;  4GYY A;  3GW4 A;  1HFA A;  1BI8 B;  4L7T A;  4B93 B;  1BU9 A;  3PEU B;  4JW1 A;  2YIN A;  4U63 A;  3TWX A;  3CKC A;  4GPM A;  3TXM A;  4JL0 A;  3PUK A;  2WXJ A;  1KLX A;  2IFU A;  1MHQ A;  3AG2 E;  3NOG D;  2HM8 A;  3CHO A;  1IKN D;  4YVQ C;  4JEH A;  2WQH A;  2QFC A;  3HXE A;  3UI2 A;  4X8Q A;  5CCM A;  4N2Q A;  5CRU A;  5EYL A;  2XRY A;  2PM6 A;  1E8X A;  1LTX A;  4O6F A;  4HI8 A;  3D9M A;  4A63 B;  5C1D A;  4CDM A;  1K3Z D;  2P9U G;  2YNQ A;  4AOF A;  4UWF A;  1N94 A;  4U96 D;  5ENN A;  3DSV A;  3NZU A;  3TWQ A;  4JB8 P;  1KT1 A;  2WXQ A;  1E8W A;  4HLL A;  3BUA A;  5KNG A;  3UM3 A;  4DX2 A;  2R02 A;  3PZ2 A;  3HG0 D;  3VLE A;  3ML9 A;  4F7A A;  3HRA A;  3PH0 C;  2KC7 A;  4XKB A;  4UWG A;  3RSE G;  3RKV A;  2B6C A;  2LUH A;  4L23 A;  4GTQ A;  4WNF A;  1N54 A;  2I2O A;  3L17 A;  4NUR A;  4B89 A;  3ZPJ A;  1JPL A;  3UM0 A;  2VGX B;  4BSZ B;  4ANX A;  4WUY A;  4AY6 A;  2P9L G;  2GRL A;  3CHQ A;  3S7J A;  4JD2 G;  2WB2 A;  4GZ6 A;  3CVU A;  4PH4 B;  4FHK A;  3C3R A;  3QAQ A;  4B8C B;  2I9C A;  5ARF A;  4WNG A;  3PZD A;  4NQ0 A;  5AN8 A;  1N0Q A;  2P9K G;  3G2U A;  3V2O A;  1OCO E;  3CK8 A;  4DRX E;  4ANW A;  4GTS A;  4UI9 C;  2WXI A;  2DIW A;  3UT7 A;  3UIO C;  2R59 A;  5EX3 A;  4FLB A;  3DSU A;  3E32 A;  4QFV A;  5FQ4 A;  1D8E A;  3U4T A;  1EYH A;  4W9R A;  4AV7 A;  4I2W A;  5KBA A;  3FU0 A;  4HRL A;  2IO3 C;  2R05 A;  4YDE A;  4MKT A;  2WM9 A;  4YVO A;  2JEK A;  3UQ3 A;  4F53 A;  1DCE A;  4XI9 A;  3B13 A;  3L22 A;  3Q9U C;  1E8Z A;  1NP7 A;  4XKC A;  3CVN A;  3IEG A;  2GRP B;  4RG6 A;  2EQX A;  2J8S D;  3EIQ C;  3CVL A;  2P9P G;  1IYG A;  4FJZ A;  4LNB A;  1ELK A;  3APD A;  2BUG A;  5CER B;  3MV2 B;  4AEZ C;  2AJA A;  1Y8M A;  2ZIR A;  3RO3 A;  3AU4 A;  1TN7 A;  3CKB A;  1BPO A;  3ABL E;  1BD8 A;  4HOR A;  4TXQ A;  3R9M A;  4FUL A;  3CHS A;  4G8L A;  3BU8 A;  3HVE B;  3G2V A;  1FT1 A;  5KNH D;  4DPR A;  4UWH A;  3LVR E;  4KZ0 A;  5M72 A;  3HIZ A;  4H7Y A;  4UI9 J;  3FUD A;  4DI4 A;  4CT0 A;  3EU9 A;  3G2T A;  5BNW A;  2HR2 A;  2VJ8 A;  3ZYQ A;  5KJK A;  1N4P A;  1YMP A;  1O1R A;  1OWP A;  3FEX A;  4HOT A;  4I17 A;  4KVM A;  2I1K A;  3LPZ A;  4ACL A;  3BQO A;  1K1B A;  2NSZ A;  2X38 A;  2LAH A;  3L54 A;  2WXR A;  3UTM A;  1Q2Z A;  4Z68 A;  1TR4 A;  3JXJ A;  4H7X A;  3D9J A;  3CQG B;  2CFU A;  3AG1 E;  5FTP A;  5HRY A;  4E85 A;  5FJY A;  3RRU A;  5G2N A;  3W9G A;  4U07 A;  4YDY A;  3SFZ A;  4ILI A;  2BKK B;  3UKU G;  4HB5 A;  2X6I A;  1N9A A;  3JUE A;  4C48 B;  5IY5 E;  1S63 A;  4BSX A;  3CK7 A;  4BTA A;  1DVP A;  4KBQ A;  2J4B A;  2HO1 A;  4FA6 A;  4ZFH A;  4GTT A;  2KXP C;  2FI7 A;  4URK A;  3EJN A;  5KWD A;  4AIF A;  2AXV A;  3ZHE A;  3UX4 A;  3G2W A;  5HKP A;  1SZ9 A;  2WXM A;  2H6I A;  2OND A;  4CDR A;  3LEW A;  1QNF A;  4OVU A;  1XNF A;  3L08 A; 
#chains in the Genus database with same CATH homology
 3AU5 A;  4F1S A;  2L6J A;  1Z3X A;  4LER A;  2IJG X;  2AXU A;  4AXH A;  3FUM A;  4HOS A;  2WXK A;  1XGW A;  3FUE A;  3MKQ A;  4U8H A;  4FLH A;  4V3I A;  3QB2 A;  4Y6C A;  5AJL A;  4GA0 A;  3CVW A;  3FU3 A;  2JLB A;  4LCT A;  4N3C A;  3URZ A;  4AP2 A;  1HG2 A;  2XQ0 A;  2YQ8 A;  4U0U A;  4ANV A;  4XX5 A;  2YHE A;  2XPY A;  4I9E A;  3TG4 A;  3ZIM A;  3ZW3 A;  4LRZ A;  2Y4T A;  5JJ7 A;  5AEN A;  3U64 A;  1OWL A;  2LO6 A;  5AJD A;  3QJZ A;  4GYY A;  1HE8 A;  4U0Z A;  2RG8 A;  3QOU A;  5LFA A;  3QWV A;  5G04 J;  3GW4 A;  1A17 A;  4ANU A;  4TV3 A;  3QNK A;  1HFA A;  3B7R L;  5CMW A;  4GYO A;  4L7T A;  3D3M A;  3GZ2 A;  3R7R A;  4JEU A;  3OXG A;  4IRU A;  2NXP A;  3FHE A;  4LEU A;  4EQF A;  3PEU B;  2BF0 X;  4JW1 A;  1UN8 A;  4IUL A;  3QK0 A;  2UY1 A;  3FUN A;  4NRH B;  2YIN A;  3PNL B;  4U63 A;  4J8S A;  2DBA A;  3IV0 A;  3SZ7 A;  1WAO 1;  3PRE A;  3VTX A;  3CV0 A;  1KT0 A;  3ONK A;  1W3B A;  3CKC A;  4GML A;  3FTW A;  4R7L A;  3TXM A;  4A1S A;  3APC A;  1H2U A;  5DBK A;  3DPD A;  4JA9 A;  4JL0 A;  1UN9 A;  3KEZ A;  3PUK A;  2WXJ A;  1KLX A;  3FH5 A;  5A23 A;  4HLE A;  2IFU A;  1MHQ A;  4A1G A;  1HX8 A;  1TJC A;  2Q7F A;  3PNT B;  5ANR A;  4CT4 A;  3FUL A;  2HM8 A;  3CHO A;  3CK9 A;  1QQE A;  4YVQ C;  3UMV A;  5AYW D;  4JEH A;  3D9O A;  2WQH A;  1SZA A;  3FTZ A;  1H6K A;  2QFC A;  3ASF A;  4AVX A;  2VSO E;  4BY6 A;  4A55 A;  4N5C A;  4P29 A;  5HQ8 A;  4N2Q A;  5CCM A;  2VTB A;  3L13 A;  1NA0 A;  3FTU A;  3LDZ A;  3QC1 A;  2X6J A;  3SGH A;  4ACK A;  2XRY A;  2C0M A;  1E8X A;  2PM6 A;  2IF4 A;  2WXO A;  3I5P A;  4FP7 A;  4I43 A;  3D9P A;  4O6F A;  2Y3A A;  5ARG A;  4CRW A;  4AM9 A;  3D9M A;  4OYS A;  5C1D A;  3UUX A;  2FUL A;  5BT1 A;  4CDM A;  4WAF A;  4XZ4 A;  2WXH A;  1E96 B;  3L16 A;  2IU1 A;  2YNQ A;  4GAA A;  4GA1 A;  4PUC A;  4AOF A;  4UWF A;  4F3V A;  4BWR A;  3HHM A;  5G05 C;  2WXP A;  1EF1 C;  4GZ5 A;  5FZQ A;  3ZEF A;  5ENN A;  3HVE A;  2PZI A;  5FZS A;  2KZT B;  2WMN A;  4HXI A;  1PY1 A;  3NZU A;  4MRU A;  1KT1 A;  2WXQ A;  4AY5 A;  5JHA A;  1E8W A;  2XPI A;  3ZFW A;  4WND A;  1E7U A;  5KCM A;  1PAQ A;  4DLQ A;  2WQ7 A;  3JQ0 A;  3JQ1 A;  5A7D B;  4A3V A;  3K9I A;  2XCC A;  3FEY A;  1FVH A;  4GU5 A;  5JJT A;  1ZBP A;  3ZYL A;  4J0U A;  4TRQ A;  3VLE A;  4U0S A;  3ML9 A;  2CHW A;  1OWO A;  3RJV A;  3D9L A;  2J08 A;  4F7A A;  3QDN A;  3PE4 A;  5EDS A;  2WVI A;  4FHJ A;  3PH0 C;  4HFG A;  2RD0 A;  2KC7 A;  4AJW A;  1B89 A;  2VTB B;  4JA7 A;  1HU3 A;  3IBE A;  3T8M A;  4XKB A;  4J8D A;  4UWG A;  5FT9 A;  3RKV A;  2CHX A;  3ULQ A;  3RU0 A;  3QKY A;  2ZU6 B;  4HOU A;  3KD7 A;  4L23 A;  4WNF A;  4ATG A;  3C98 A;  1N54 A;  3PDN A;  2I2O A;  3WXX A;  4C0M A;  3EHM A;  2WQ6 A;  4ILH B;  2FEZ A;  3FP3 A;  3L17 A;  4NUR A;  2MRI A;  3G2S A;  4WNE A;  3UT8 A;  3I4G A;  4B89 A;  5JHB A;  3ZN3 A;  3KAE A;  3KS2 A;  4Y6W A;  3NQP A;  3TXN A;  3ZPJ A;  4FAD A;  1JPL A;  3R9A B;  2VGX B;  3PVL A;  4XIF A;  3Q4A B;  3LVQ E;  4BTB A;  3S2A A;  3LYA A;  3CIA A;  2M63 A;  4JZY A;  4EZJ A;  4ANX A;  4WUY A;  4AY6 A;  2LSU A;  1YA0 A;  1INZ A;  2GRL A;  3CHQ A;  5LP0 A;  3RK6 A;  1JUQ A;  3S7J A;  3R7Q A;  2WB2 A;  3FUJ A;  1UW4 B;  4GZ6 A;  4U04 A;  4EPZ A;  4CGW A;  3CVU A;  4EZK A;  5BV1 A;  4ILG A;  3SBT B;  2XRZ A;  2CG3 A;  4PH4 B;  4CGV A;  2IOS A;  4K03 A;  4B0Z A;  4FHK A;  4UWL A;  4WWP A;  2BTD A;  5CMY A;  3QAQ A;  4JHK A;  3ZVV A;  5C2Y A;  4B8C B;  5A6C A;  2I9C A;  3T5X A;  2KAT A;  2L0I A;  5ARF A;  3APF A;  4WNG A;  3ZHE B;  2OOE A;  3PZD A;  5ANL A;  1PC2 A;  2VQ2 A;  3OTN A;  4C9B B;  1HS6 A;  4NQ0 A;  2LSV A;  4MS6 A;  3CST A;  2ION A;  3G2U A;  4B94 A;  3QAR A;  3HYM B;  4G24 A;  4G26 A;  2PQN A;  4MLP A;  4BT9 A;  1H19 A;  1SQM A;  2VSX E;  2WXF A;  3CK8 A;  4GZ3 A;  4UI9 C;  4ANW A;  5J90 A;  2KCL A;  4JVS A;  2KCV A;  2V4L A;  4LUN U;  1MQS A;  4JC8 A;  5J08 A;  2FF4 A;  2WXI A;  2DIW A;  5BPP A;  3BG1 B;  3QWW A;  3PE3 A;  3UT7 A;  2R59 A;  1HZ4 A;  2YHC A;  5EX3 A;  4PS8 A;  4FLB A;  2QY7 A;  2HYZ A;  3B7U X;  3HDX A;  5T3R A;  3MKQ B;  3FWV A;  5AIJ A;  1HO8 A;  5T8I A;  4QFV A;  5FQ4 A;  3U4T A;  3CQC B;  3SNX A;  1EYH A;  2A4Z A;  4DK5 A;  3U3W A;  2WMO A;  5KJN A;  3GZS A;  4W9R A;  3D9I A;  4AV7 A;  4PDX A;  4N39 A;  3NF1 A;  2AWI A;  3JUI A;  4I2W A;  4GB9 A;  3SF4 A;  3FUH A;  3FU0 A;  2CFZ A;  4KMO A;  3VLF A;  3VTY A;  3TG5 A;  3ZXS A;  2OVF A;  2V5F A;  3VLD A;  4MKT A;  2WM9 A;  3MX3 A;  3QWP A;  2E2E A;  2JEK A;  4YVO A;  3MJW A;  4I2Z A;  2XGS A;  1WM5 A;  3UQ3 A;  2UY1 B;  3B7S A;  3FUF A;  3O4Z A;  4APF A;  4F53 A;  3UPV A;  3TJP A;  1HF8 A;  4G2V A;  3LY8 A;  2WXN A;  3B13 A;  4XI9 A;  3ESK A;  3L22 A;  3MKR A;  4NAC A;  1Z3Y A;  4BFR A;  3FY4 A;  1E8Z A;  3CVV A;  5FQ8 A;  1NP7 A;  4XKC A;  4EBA A;  3CVN A;  4KYO B;  5FWQ A;  4OVV A;  4GCN A;  2DCP A;  3MA5 A;  3IEG A;  3JCK C;  4L2L A;  4RG6 A;  2EQX A;  4B8A A;  1VDY A;  2R17 C;  3EIQ C;  4KT6 B;  3U66 A;  4EEC A;  2J4D A;  1UG3 A;  3CVL A;  4I1O B;  3FUK A;  1H2T C;  1IYG A;  3DBS A;  4FJZ A;  3LXU X;  1ELK A;  2X6F A;  5LOZ A;  3APD A;  3CVY A;  1JWF A;  2A5U A;  5CHE E;  2BUG A;  1NZN A;  3T5V A;  1UJJ A;  4UQX A;  5KJL A;  2PL2 A;  3MV2 B;  3ZYK A;  4AEZ C;  1Y8M A;  3PUJ A;  4HOQ A;  2V0P A;  3Q15 A;  3RO3 A;  3D9N A;  1EPU A;  3AU4 A;  1X5B A;  5T4Y A;  2OV8 A;  3FTX A;  2V8S E;  2VGY A;  4RSY A;  3Q47 B;  3CKB A;  1BPO A;  4PS3 A;  3EDT B;  2VSY A;  3FU6 A;  2GW1 A;  3FU5 A;  3PS6 A;  4GA2 A;  4GZD A;  2AVP A;  3GZ1 A;  4I6J A;  3ZYM A;  4ABN A;  4CDN A;  4DI3 A;  5LCW C;  3FUI A;  4UWK A;  4HOR A;  2X3M A;  3BEE A;  4JXT A;  2FO7 A;  3FH8 A;  3FTS A;  1E90 A;  4FUL A;  4A3T A;  3CHS A;  4FU3 A;  2XHE A;  5E76 A;  2UWJ G;  3HVE B;  4KZC A;  3Q5M A;  3G2V A;  4N3A A;  2C0L A;  4RG9 A;  5D0Q D;  4DPR A;  4Q69 A;  1IQR A;  4UWH A;  2Y4U A;  1HG5 A;  3LVR E;  4KZ0 A;  3CGH A;  3ESL A;  2X6H A;  5M72 A;  3I4R B;  3HIZ A;  4H7Y A;  4J8F A;  4UI9 J;  2J9Q A;  2GGF A;  3FFL A;  2P58 C;  3FTY A;  3FUD A;  1TEZ A;  4C0E A;  2L9B A;  4DI4 A;  3ASD A;  3IKO B;  5G55 A;  5EX0 A;  3TL5 A;  3MV3 B;  3RIB A;  3FDH A;  4CT0 A;  3D9K A;  4UI9 K;  2XGM A;  4WWN A;  3S7B A;  3G2T A;  4D10 C;  2VSN A;  4FC8 A;  2LAI A;  3TGO A;  4GYW A;  3MCX A;  3EIJ A;  3MZL B;  5BNW A;  4I6E A;  1ELW A;  2HR2 A;  4JPS A;  2VJ8 A;  3PRZ A;  4I1M A;  3ZYQ A;  3SD5 A;  1OUV A;  4WWO A;  3Q49 B;  1ZU2 A;  3CLJ A;  3CVP A;  3O48 A;  4L2Y A;  5FQ7 A;  5DIZ A;  3SI5 A;  5KJK A;  1E8Y A;  4HS2 A;  4I6G A;  1OWP A;  4J6I A;  1OWN A;  2J07 A;  3FEX A;  3LKU A;  4BT8 A;  4HOT A;  1H2V C;  4I17 A;  4KVM A;  2XPZ A;  1Y6I A;  5G05 J;  2I1K A;  3OAW A;  4GCO A;  4HVB A;  2KZT A;  2AXZ A;  4K0R A;  4G1T A;  2CHZ A;  3AS5 A;  3LPZ A;  2GRM A;  4ACL A;  3LJ3 A;  3S7D A;  4DLO A;  2NSZ A;  3LY7 A;  2L0T B;  2X38 A;  2LAH A;  3RRN B;  3L54 A;  2WXR A;  4KVO A;  4E6H A;  2X6K A;  2OVB A;  2XEV A;  3S7F A;  4L1B A;  4JHR A;  2MHK A;  2XGO A;  2KM4 A;  1DNP A;  4JHJ A;  5LX8 A;  2R5S A;  1E7V A;  3AS4 A;  2NC9 A;  3MGB A;  3D9J A;  4H7X A;  4RVB A;  2ILR A;  4CEM A;  3CQG B;  1U3D A;  3OXF A;  4YND A;  2CFU A;  5FTP A;  4E85 A;  3ONL A;  5FJY A;  3RRU A;  5D0O D;  3SHF A;  5G2N A;  3OXL A;  5G04 C;  1P5Q A;  4U07 A;  4KXK B;  2LNI A;  2PQR A;  3EHN A;  5KJM A;  4GZC A;  1H0A A;  1U3C A;  1OWM A;  4I1A A;  1Z6T A;  3SFZ A;  2I1J A;  4ILI A;  5EKQ D;  3LY9 A;  1HXI A;  3CVX A;  3JYS A;  3FTV A;  4N2S A;  3I3N A;  3ENE A;  1S0P A;  2WXL A;  4XE0 A;  3IHY A;  3IHV A;  2X6I A;  3ML8 A;  5FZR A;  4UQY A;  2E0I A;  1FVF A;  3CHR A;  4FJY A;  4UQZ A;  1UJK A;  2J09 A;  4GMJ A;  3LCA A;  5LCW J;  3CHP A;  4G11 A;  1ELR A;  4BSX A;  5CCL A;  2XCB A;  3CK7 A;  3L6A A;  3ZGQ A;  4I9C A;  4BTA A;  1LF8 A;  2VGX A;  3ASG A;  4BX9 A;  1HH8 A;  4PS7 A;  1DVP A;  3AS8 A;  4TUU A;  2CG2 A;  4DJA A;  3CHM A;  4Q96 A;  3U9W A;  4KBQ A;  1QZ2 A;  2J4B A;  2HO1 A;  3PEV B;  3RO2 A;  1WY6 A;  2IOL A;  1N52 A;  3P1U A;  2WPV A;  3BG0 B;  4GPK A;  4FA6 A;  5JJ6 A;  3MYV A;  3CR3 A;  4IYP A;  4N3B A;  2AW6 A;  3RRM B;  1FCH A;  3E4B A;  3CVQ A;  2FI7 A;  4APO A;  4J8E A;  4URK A;  4G25 A;  2I6H A;  3EJN A;  4EZL A;  3CEQ A;  3MEK A;  5BW8 C;  4IN3 B;  3ZRH A;  4ME2 A;  2MOW A;  4AIF A;  5BUZ A;  2AXV A;  1L5J A;  2C2L A;  2IQC A;  3NZS A;  1IQU A;  3ZHE A;  4CCA A;  3TAX A;  2KCK A;  5E75 A;  2VYI A;  3CSF A;  3UT4 A;  3UX4 A;  3GYZ A;  1IHG A;  1NA3 A;  2J49 A;  3G2W A;  4G23 A;  5BV0 A;  4Q94 A;  3SBS A;  5FQ6 A;  1SZ9 A;  2WXM A;  4M3O A;  5HI7 A;  1TJF A;  2PM7 A;  1JWG A;  2OND A;  3ASH A;  4XI0 A;  4CDR A;  3B7T A;  3P2B A;  3LEW A;  1QNF A;  4EBA G;  2FBN A;  4OVU A;  3N71 A;  4BX8 A;  2WXG A;  3FH7 A;  1EDU A;  1XNF A;  3L08 A;  1GW6 A;  3LS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...