4EQFA

Trip8b-1a#206-567 interacting with the carboxy-terminal seven residues of hcn2
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
281
Chain Sequence
b'GYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEX5-related protein
molecule tags Protein binding/transport protein
source organism Mus musculus
publication title Structure and stoichiometry of an accessory subunit TRIP8b interaction with hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
total genus 107
structure length 281
sequence length 312
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4eqfA00
2FI7A 2QFCA 3QKYA 3CK8A 4EQFA 4G2VA 3GZ2A 3ULQA 4BTBA 4CGVA 2HYZA 4XIFA 5G05C 1QQEA 3EDTB 2BUGA 3UPVA 4GPKA 5BW8C 3SF4A 1HH8A 2KATA 4UI9C 3O48A 3CK9A 2VGYA 5G04C 4A1SA 1WM5A 3KD7A 4GA1A 4U04A 4GYWA 4APOA 2Y4UA 4GZ5A 5AYWD 2KCVA 3QWPA 5G04J 1NA0A 4UI9J 4CGWA 2P58C 3ZPJA 2XCBA 2C0LA 3ASFA 3OXFA 5G05J 3U4TA 3UQ3A 1KT1A 3URZA 3UUXA 5BT1A 1IYGA 4KYOB 2YQ8A 1TJCA 4N3BA 4Y6WA 3FP3A 4F3VA 4GZ6A 2Y4TA 2KCLA 3CVQA 3HYMB 4J8EA 4WUYA 4G23A 3LYAA 3U3WA 3S7DA 3MV2B 1A17A 4G25A 4I9CA 4YVQC 3S7BA 2MHKA 4H7XA 4YVOA 2E2EA 2XPIA 2PL2A 3LY9A 3NF1A 3CKBA 3PE3A 3K9IA 1ZU2A 2C2LA 3JYSA 1WAO1 4O6FA 2VGXA 3MKRA 4G26A 2KCKA 5DBKA 3MEKA 3VTXA 4XI9A 4B94A 3CK7A 4G24A 5D0OD 4BT9A 4N2QA 4N2SA 5HQ8A 3QWVA 2XCCA 2VSYA 3PE4A 4RG6A 4AY5A 4WNGA 3FFLA 2XGMA 5CCMA 4HOSA 3AS4A 2FO7A 2L6JA 3VTYA 4J8FA 2R5SA 5C1DA 4U0ZA 4AM9A 2HR2A 2DBAA 4J8DA 5FT9A 1ELWA 1IHGA 2WQHA 4IN3B 2HO1A 2OOEA 1P5QA 5FZSA 4CDRA 3E4BA 4HOQA 4HOUA 1ELRA 5EX0A 1HZ4A 3RJVA 3BEEA 4N5CA 3CVNA 1PC2A 4AIFA 3CV0A 5JJ7A 5KJLA 3MV3B 3TAXA 5DIZA 4J0UA 4BT8A 5ARFA 4GYYA 4N39A 3ZHEB 3N71A 3LY8A 5CCLA 3ZFWA 5FZRA 5LCWC 3TG4A 2XGSA 3Q49B 5JJTA 2V5FA 3GW4A 2VGXB 4W9RA 3ASGA 2LNIA 3QWWA 4I2WA 4Y6CA 5A7DB 3GZ1A 2XGOA 4JA7A 1YA0A 2GW1A 4GA0A 4XI0A 3AS5A 5JJ6A 2C0MA 4WNDA 4WNEA 5FJYA 4HOTA 2UY1A 4GCOA 4RG9A 3ZN3A 3TGOA 1E96B 3FWVA 4N3CA 4ABNA 2FF4A 1NZNA 4AY6A 4GZ3A 3MA5A 3RKVA 1ZBPA 4U0SA 2ONDA 2AVPA 4UQYA 3AS8A 5KJKA 2PQRA 3S7JA 3OXGA 2IF4A 4LEUA 3Q47B 4NRHB 4UI9K 5FZQA 2VYIA 3SZ7A 1NA3A 3Q5MA 5LCWJ 5KJMA 4JA9A 4JHRA 3CVPA 4BTAA 1Y8MA 3ESKA 3QDNA 3ZHEA 2UWJG 3LY7A 1HXIA 4UQXA 4I9EA 3KS2A 4ME2A 4NQ0A 5EX3A 4I2ZA 1OUVA 2WPVA 1B89A 2J9QA 3OXLA 2PZIA 3GYZA 2PQNA 4WNFA 2FEZA 1FCHA 3PDNA 4G1TA 2JLBA 3Q15A 3TG5A 3LKUA 4BWRA 4H7YA 2KC7A 3ZGQA 3QOUA 2VQ2A 4GA2A 2LSVA 3RIBA 3RO2A 1KLXA 4UQZA 3IEGA 4GYOA 5FTPA 1KT0A 2I6HA 5A6CA 3CVLA 2VSNA 5BNWA 5M72A 1XNFA 1W3BA 3RO3A 2LSUA 5KJNA 4HORA 5D0QD 3S7FA 5EKQD 3KAEA 3CKCA 3WXXA 2FBNA 3ASDA 4KXKB 4JL0A 4N3AA 3LCAA 4KBQA 2IFUA 3CEQA 3LPZA 4GCNA 5HI7A 2NC9A 4U07A 1QZ2A 2YHCA 3ASHA 3Q4AB 5CHEE 3R9AB 3RU0A 2Q7FA 2UY1B 4U0UA 4YNDA 2XEVA 5ARGA 4I17A 4I1AA
chains in the Genus database with same CATH superfamily
4FLHA 3HXCA 3E30A 1ZB1A 3EDTB 2J8SD 3CK9A 4BY6A 1MYOA 3EUVA 3ULEG 3UM0A 3EIJA 2C0LA 4RLYA 2AXVA 4JHKA 2BTDA 3ZKJA 1SZ9A 1S0PA 3ZXPA 1RW2A 2L0TB 3CKBA 3PE3A 4G11A 4O60A 4D10C 3CK7A 4OVUA 4YDWA 4GMLA 4HRNA 3D9NA 5JHBA 4ANWA 2WQHA 4DI4A 2NXPA 3UMVA 3E33A 3TXNA 5DIZA 1WG0A 1LTXA 5A7DB 4UUCA 4EPZA 3G2VA 5BPPA 5AIJA 4CDNA 4AY6A 4B93B 5B1BE 3FUIA 5KJMA 4HRMB 3TL5A 1SQMA 4HQDA 4UQXA 3ONLA 3PEVB 3Q9UC 1B89A 3APCA 1H6OA 5J08A 4G1TA 3TG5A 4BWRA 4F7AA 3PZ1A 3W9GA 3C98A 1XNFA 4HORA 5J90A 4L2YA 3B13A 3U3WA 3CEQA 2UY1B 4U0UA 4G2VA 3PH0C 4HXIA 3AG1E 4A1GA 5G05C 2P9KG 3DXMG 3TWXA 2JEKA 3UT7A 5KBAA 1TNBA 1LD8A 1OWOA 3C3QA 1WY6A 1MX6A 3ZW3A 1K8KG 4O1PA 2DZOA 3DEOA 1O5MA 1BPOA 4IRUA 5CECB 2C2LA 3JYSA 4N2QA 4HOSA 5CBOA 4U95D 2DBAA 3BG1B 1D8EA 1H19A 4KT6B 4XKCA 4UWGA 2P2CP 3ONKA 1PC2A 2XZDG 3MV3B 3FTVA 4J0UA 3TWVA 3LY8A 3L16A 5EDSA 3SI5A 5JJTA 1N4QA 4BSXA 3UX4A 3TWQA 2XGOA 5H7PA 1Z3YA 2WMOA 3BQOA 4TUUA 2L9BA 4U96D 3FEYA 1E7VA 3OXGA 3SZ7A 4M3OA 3FTWA 4C0MA 3D9MA 3Q9NC 4I2ZA 3J5PA 5D2MC 3V31A 3DSVA 2J4DA 1W3BA 4LNUD 3CKCA 3DXKG 1HG2A 2GRLA 4FHJA 3SBSA 4AV7A 1D9SA 2Y69E 5AN8A 1QZ2A 3RU0A 2X6JA 3E37A 3AG4E 5EIBE 1N4PA 5AQBA 4BTBA 1V54E 5EYLA 3O48A 2X6FA 5CMYA 3D3MA 3LJNA 4KMOA 1IYGA 2NSZA 1VDYA 2VJ8A 3CHRA 3MJWA 4PH4B 2ZISA 4H7XA 3KSQA 1QNFA 1S70B 1E8WA 3EIQC 2Y0BG 3MKRA 2IJGX 3VTXA 4BT9A 2V5QC 3QWVA 4WNGA 2YINA 2R5SA 2X3MA 4AVXA 4IN3B 5HS0A 1EDUA 4EBAG 3T8KA 2FULA 4TRQA 2RG8A 4BT8A 3ZEFA 3CVVA 1LD7A 3QWWA 2DCPA 4U8YD 1MX2A 4BSZB 1IHBA 4B8AA 3FTZA 5BXUA 2ZIRA 3FUMA 3JQ0A 3WG7E 3EHNA 4YDEA 2XZTG 4LCTA 3LVQE 5LP0A 4ACLA 3CVPA 3QDNA 3ZHEA 3LY7A 1HXIA 4GPMA 2P9UG 4BEPA 2XRZA 4ACKA 3IHYA 3L08A 3MYVA 2L6BA 2H6GA 4KZ0A 3I3NA 4HLEA 4KXKB 2NC9A 3FU3A 3DSTA 3T9KA 3OTNA 1SA4A 4DLOA 2P9PG 3BG0B 2KZTB 3CLJA 4J7WA 4TV3A 3V2OA 3B95A 3OXFA 4I1MA 5G05J 3DSUA 4MRUA 3J5QB 1HFAA 1OY3D 3V79K 2WXIA 2XPIA 4U63A 1WAO1 5ENTD 3MEKA 4CCAA 2WXPA 4KVOA 5AAOA 1YYHA 3I5PA 4AM9A 4HBDA 4HOUA 2BEDA 3HRAA 5KJLA 1N52A 5ARFA 3AG3E 3CVWA 2OVBA 4BETA 4L9PA 3NBNB 4QFVA 2KM4A 1H2UA 5FQ4A 4CEMA 3AS8A 2RKKA 4LEUA 3Q47B 5FZQA 3UKRG 4GB9A 1AP7A 3MZLB 4CYMD 1TYQG 3SGHA 3X2QE 2XEEA 1N11A 5BV1A 5AARA 4UQZA 3FH5A 4HNAD 5ANRA 5FTPA 3G2SA 3NAWA 2VSXE 4FC8A 2LSUA 1BI8B 1XGWA 5EKQD 4GCNA 2WXJA 4TXRA 5FQ6A 2QYUA 2QFCA 3CK8A 4GMRA 1QBQA 2QY7A 3IBEA 3PRZA 4EZLA 2RD0A 2XHEA 4U04A 2LUHA 4GYWA 3B7BA 2L0IA 4CGWA 4GMJA 1FT2A 3ZUVB 5CBNA 3QNKA 4G23A 3LYAA 1HU3A 2E2EA 3LY9A 4AEZC 3RAUA 1EPUA 2IY0C 4O6FA 4G26A 4E85A 3U64A 2FO7A 4YDOA 3EU9A 2HO1A 2OOEA 4RSYA 3E4BA 2H6FA 4MS6A 3CVNA 1TJFA 2OVFA 5FZRA 3R9MA 3RRNB 3Q49B 4OVVA 4W9RA 3FUNA 3GZ1A 4JA7A 3FU5A 3SD5A 2V8SE 3TGOA 3ZN3A 1HS6A 4GZ3A 1N0RA 2F8YA 4UWLA 4JPSA 1K1BA 3F6QA 1IQRA 3AU4A 4FHKA 3MCXA 3FUEA 2J9QA 3HDXA 3OXLA 4GTVA 1TN8A 3CHOA 3CIAA 4GYOA 5A6CA 2IO3C 4HI9A 2J4BA 2AW6A 3DPDA 4DRXE 2H6IA 3Q7FA 3UM1A 3I4RB 2KZTA 3ASDA 1SZAA 1TNZA 2WXNA 5FINA 1PY1A 3UKUG 2LXMA 4XKBA 2A5EA 3T8MA 3Q79A 4FJYA 3GZ2A 4DX7D 3EHMA 4DI3A 2R03A 5LFAA 5AYWD 2F37A 3FY4A 3LXUX 4GTOA 3FUFA 5FQ8A 4DPRA 1BD8A 5CEAA 3MKQA 2ZGDA 4X8QA 1JUQA 3K9IA 1ZU2A 2PNNA 5D0OD 2FO1E 2XGMA 4ILIA 3TWUA 5FZSA 3BEEA 1SW6A 4EZJA 3TAXA 3FH8A 3D9LA 4F1PA 4J6IA 5ANLA 1AWCB 4DUIA 5T4YA 3AS5A 4HOTA 3MGBA 4Q69A 1E96B 2BKKB 1NZNA 5E75A 2I2OA 2IF4A 4KVMA 4RVBA 3CGHA 4AXHA 1JCRA 3ASOE 4YDYA 4LERA 3P1UA 3RO2A 2ETCA 2JABA 4BX9A 4L7TA 4N5QA 3DSWA 3FUJA 2F0YA 3LCAA 2R59A 5JHAA 2YNQA 4YNDA 1H2VC 5T8IA 3UXGA 2FI7A 4ANXA 3SF4A 1WM5A 1Y6IA 4GA1A 1UOHA 2H6HA 1UW4B 1WDYA 3TWSA 2OV8A 3UQ3A 2YQ8A 2WM9A 1TJCA 5FWQA 4Y6WA 4Z68A 2MOWA 3RSEG 3S7BA 3SY2A 2EIKE 4XX5A 2LAHA 4B94A 1HG5A 4G24A 4K0RA 4RG6A 3ABME 1TEZA 5C2YA 1IHGA 5G2NA 1P5QA 1K3ZD 3RJVA 4JEHA 3N71A 4OAVB 4JXTA 2OCCE 3LDZA 2X38A 1EYHA 2IU1A 1OCZE 2R05A 3I4GA 1IKND 3V2XA 4FJZA 4CZ2D 1U2VG 4FP7A 2P9LG 3BU8A 3VLFA 2V4HC 4C48B 5KWDA 3HVEB 3RRMB 4JHRA 3BUAA 5EX3A 1KPSB 2CG3A 4IYPA 4LSZE 2KC7A 2V4LA 4K5CA 3NZSA 2XRYA 4UWHA 3R7RA 2VSNA 1D8DA 3PS6A 3TXMA 1TNUA 5JMND 1NP7A 4FADA 3D9OA 1UG3A 3ZU7B 4KBQA 2IFUA 3LPZA 1NL4A 2GGFA 2RFMA 3ENEA 2IOLA 2WXHA 2IO2C 4GPKA 4GZDA 5JA4D 2DWZA 2KATA 3ABLE 4UI9C 3FU6A 1MHQA 2Y4UA 2ZGGA 3URZA 3UUXA 1V55E 4I6JA 5AJDA 2WXMA 5IY5E 4F3VA 3HYMB 1HE8A 4QQIA 4WUYA 3TWRA 2IEJA 3L6AA 2MHKA 1N4RA 4ATZD 3SFZA 2WQ7A 5ENOD 1OWPA 4DX1A 5CCMA 5KNGA 1H6PA 4J8DA 1OWMA 3SBTB 2IONA 4CDRA 2M63A 5JJ7A 4B8CB 3DSSA 4PDXA 5T3RA 3Q75A 4XI0A 3TWTA 4UWKA 1GW6A 2DYRE 1PAQA 4EHMA 4L2LA 2WXFA 4JC8A 5KJKA 1A5EA 2WXGA 4DX6D 5LCWJ 3ZYLA 2ILRA 4BTAA 3QARA 3DWLG 3GYZA 4WNFA 2EILE 3LKUA 4A55A 1TN6A 3ZGQA 4GA2A 2LSVA 1KT0A 3OAWA 4M7CA 3KAEA 4JL0A 4XE0A 3Q4AB 4N3BA 1OCCE 1SA5A 1S63A 4IULA 1H0AA 4I6EA 2HYZA 1DVPA 4LNGA 2LO6A 3CHQA 3RRUA 3QWPA 4TXPA 2B6CA 5G04J 4P29A 2ETAA 1HO8A 3NOGD 4HVBA 3FTXA 2BKGA 5CEDB 3FP3A 4GZ6A 3L22A 3MV2B 3L9TA 3B7RL 1JCSA 4MLPA 5FIOA 2I1KA 3FFLA 2AWIA 2L6JA 4NACA 1DCEA 4L23A 3JQ1A 4BFRA 4FLBA 4EBAA 1N94A 1YCSB 5EX0A 4N5CA 2LXLA 4K5BA 5AQ7A 1HF8A 3TG4A 2CHZA 2V5FA 3UTMA 3JUIA 3SO8A 5B1AE 2C0MA 2FF4A 3RKVA 4GTQA 3Q5MA 2MYOA 3HXBA 5EILA 3NOCD 3PDNA 4KZCA 3Q15A 2RFAA 2I6HA 4F6RD 2XS8A 3FTUA 2XQ0A 4JHJA 5KCMA 3S7FA 1NFIE 5ENSD 4C9BB 5HI7A 3R9AB 5ARGA 4EQFA 1MQSA 3PEUB 3D9PA 1TNYA 4CGVA 1OXJA 3KD7A 3ZYMA 4GZ5A 1NA0A 3ZPJA 4I1OB 1MZCA 1IXVA 2Y4TA 4B89A 3ML8A 4I9CA 1G3NB 2PL2A 3NF1A 3C5RA 3IXEA 4U8VD 4TUMA 2VTBB 5DBKA 2XCCA 4AY5A 3V30A 1BU9A 2KXPC 4HLLA 1HZ4A 3JXIA 3ZHEB 4N39A 2GRQB 3ZFWA 4F1SA 3PZ2A 2XS1A 1FT1A 3L54A 3O4ZA 4A3VA 3MA5A 4WWPA 1HX8A 4NURA 3TWWA 3S2AA 2VYIA 5E76A 2MRIA 3AJIA 1Y8MA 3ESKA 4J8SA 4HRLA 2WPVA 4O1OA 4ANUA 4A3TA 1OWLA 2P9NG 1Z6TA 3RIBA 3UT4A 3L13A 4DJAA 3RO3A 5KJNA 2VSOE 4I6GA 2LAIA 5LX8A 3ZRHA 2A5UA 4CT0A 3UM3A 2AXUA 1UN8A 4XIFA 3UPVA 2EIME 4ZHBA 1L5JA 4APOA 1U3DA 2BF0X 2EIJE 4WAFA 3CVUA 4CDMA 4UI9J 4OAUC 2XCBA 3CVYA 1ELKA 3CHMA 4G25A 2IQCA 5LOZA 4ZFHA 2Y1LE 1OT8A 4U8HA 3KSLA 3SNXA 5HQ8A 2R17C 3PE4A 3NB2A 3AS4A 1JCQA 3B7UX 5C1DA 4V3IA 2HR2A 1ELWA 1IQUA 1N9AA 1ELRA 3IKOB 3D9KA 3CHSA 1BI7B 2GW1A 4B0ZA 1JWGA 4NIKA 3CSTA 4ABNA 3AG2E 3DRAA 4FULA 4UQYA 5A23A 4JVSA 3DEPA 3FTSA 1BLXB 3AAAC 5CRUA 3PZDA 3JXJA 1UN9A 3QB2A 4G8LA 1LF8A 5G55A 1JWFA 3G2WA 3CSFA 2FBNA 4N3AA 3CR3A 4I1AA 3E34A 2CFZA 3PVLA 3ULQA 1YMPA 1QQEA 4A1SA 4ILGA 3HVEA 1FVFA 3EJNA 2QYJA 2XEHA 3ASFA 5BT1A 2GROB 3CVQA 3S7DA 2P9IG 2VGXA 1NI1A 5CMWA 4DX5D 4Q94A 3Q78A 1DNPA 3PZ4A 3G2UA 3FUDA 1N0QA 4FU3A 3PREA 2CG2A 1OCOE 4AIFA 4GTTA 3T5VA 2DZNA 3HHMA 3ABKE 5HKPA 3KEZA 1UJJA 3SQVA 1E90A 3ASGA 5B3SE 5FQ7A 2UY1A 4RG9A 4N3CA 3ESLA 3CQGB 5AQ9A 1ZBPA 4R7LA 3T5XA 3S7JA 2DYSE 1Z3XA 4TXQA 2QZAA 1OUVA 2PZIA 2PQNA 2V0PA 2FEZA 3R7QA 4BX8A 4OYSA 1TN7A 1FVHA 5D0QD 5CHEE 3B7TA 4LG6A 3HXFA 4I17A 3L17A 3APDA 3QK0A 4A63B 5G04C 3HXDA 4HFGA 2PM7A 3IHVA 3UIOC 2VTBA 3FU0A 4RQIA 5CERB 3LEWA 3HG0D 4CT4A 4YVQC 3P2BA 3NZUA 4YVOA 5BXOA 3ZYKA 4HS2A 4XI9A 1K1AA 2VSYA 3D9HA 3ASNE 1DCQA 1INZA 3CHPA 2WXRA 2WXKA 4JD2G 5CCLA 5LCWC 4PS8A 2J49A 4F53A 4JB8P 4WNDA 5FJYA 5ENPD 4GCOA 2VGEA 2AJAA 2HM8A 2ONDA 5ENRD 5EN5D 2B0OE 4UI9K 1NA3A 2QC9A 2HE0A 2ETBA 2UWJG 4I9EA 3KS2A 4NQ0A 3SHFA 3ULYA 2GRPB 2JLBA 2VQ2A 4GU5A 1KLXA 2R2LA 3FHEA 4GTMA 3CVLA 2CHXA 3FUKA 2F8XK 1S64A 4U07A 2YHCA 4HB5A 4UWFA 3APFA 3QKYA 5ENNA 3FTYA 3LS8A 1N4SA 2VGYA 4DLQA 3PNTB 2P58C 4JZYA 1RZ4A 3U4TA 4GTRA 5EIDA 3HIZA 5AJLA 4URKA 3Q7AA 4BESA 2KCLA 4GTPA 3PUJA 4J8EA 3DPYA 4LNBA 3SFYA 3MX3A 2E0IA 4DX2A 4ANVA 1E7UA 3UIPC 4J8FA 5FT9A 1KZOA 4EZKA 3LVRE 1H6KA 2YHEA 4WWOA 1TR4A 3GW4A 2VGXB 3JCKC 4BERA 1YA0A 3PUKA 5JJ6A 4ILHB 5BV0A 1OCRE 2J07A 5AQAA 1DC2A 2X6IA 4MKTA 4FA6A 4JA9A 4HI8A 4L1BA 4EECA 3IEGA 3TJPA 3ML9A 3VLDA 2ZU6B 1H2TC 2AXZA 1JPLA 3WXXA 4AJWA 3GZSA 3RK6A 3EU5A 3QAQA 4GTSA 1Z5SC 2WXQA 2Q7FA 2WQ6A 2XEVA 3FH7A 3UT8A 2BUGA 4XEIG 3ISMC 1HH8A 2GRNB 4JEUA 3MKQB 4LUNU 2KCVA 2KBXA 3VLEA 4J8YA 1KT1A 3CQCB 3IV0A 5ITZF 4PS7A 2WXLA 4MBGA 3C3RA 1X81A 4GZCA 4N2SA 4ATGA 2WVIA 2OEWA 4E6HA 3QC1A 3ZXSA 3VTYA 4U0ZA 1TNOA 3DSXA 1O1SA 4HOQA 4GAAA 4G8KA 3CV0A 5KNHD 1MX4A 1OWNA 2NYJA 4AOFA 2XPZA 2R02A 4U7EB 3D9IA 3FWVA 3L82A 5BUZA 2WXOA 3U66A 5HRYA 2AVPA 2PQRA 3Q73A 2A4ZA 1E8YA 4CRWA 3EHQA 3U9WA 5EYPF 1QYMA 3B7SA 3SFXA 2OEVA 2Y3AA 5CRVA 3PNLB 3FEXA 3PZ3A 1FCHA 1SVXA 3UI2A 5BNWA 3E32A 5ENQD 2XPYA 4K5AB 1EF1C 3ASHA 4PUCA 5BW8C 1O1RA 2WMNA 2PM6A 1E8ZA 2P9SG 3AU5A 3JUEA 4KYOB 3DBSA 5AENA 3G2TA 4PS3A 2GRMA 3LJ3A 3D9JA 1A17A 1N95A 1KZPA 1E8XA 2KCKA 3C3OA 3ZIMA 1N54A 3KEAA 3FDHA 4K03A 3QJZA 3NQPA 3ZVVA 4C0EA 4AP2A 1U3CA 1X5BA 4GYYA 2DIWA 2XGSA 2XENA 4Q96A 4XZ4A 5D66A 3UM2A 2LNIA 4I2WA 4Y6CA 4LRZA 4APFA 2DVWA 4GA0A 4DK5A 2I9CA 4WNEA 4JW1A 3C72A 2X6KA 2EINE 4U0SA 3ZNGA 1Q2ZA 4NRHB 2WB2A 4I43A 2GRRB 3CVXA 3W9FA 2X6HA 4ME2A 3UINC 1FPPA 1O1TA 2EQXA 1UJKA 1MJ0A 2CHWA 2J09A 4H7YA 3QOUA 2I1JA 5M72A 3ZYQA 2IOSA 4WWNA 3EHRA 2ZXWE 2CFUA 2J08A 3HXEA 3FUHA 3FULA
chains in the Genus database with same CATH topology
3QK0A 4FLHA 2QFCA 4IULA 3CK8A 1H0AA 4I6EA 2HYZA 3EDTB 2QY7A 1DVPA 3IBEA 2LO6A 3PRZA 3CK9A 5G04C 4BY6A 4EZLA 2RD0A 2XHEA 4U04A 4GYWA 4HFGA 3CHQA 3RRUA 2L0IA 2PM7A 3QWPA 5G04J 4CGWA 3IHVA 3EIJA 4P29A 2C0LA 2VTBA 1HO8A 2AXVA 3FU0A 4GMJA 4JHKA 4HVBA 3FTXA 2BTDA 3LEWA 3FP3A 4GZ6A 1SZ9A 3QNKA 4G23A 3LYAA 3L22A 4CT4A 3MV2B 4YVQC 3P2BA 1S0PA 3NZUA 1HU3A 2L0TB 2E2EA 4YVOA 3B7RL 3LY9A 3CKBA 4AEZC 3PE3A 3ZYKA 1EPUA 4G11A 4O6FA 4G26A 4HS2A 4MLPA 4XI9A 4D10C 3CK7A 4OVUA 4GMLA 2I1KA 2VSYA 3D9NA 4E85A 3FFLA 3U64A 2AWIA 2FO7A 2L6JA 5JHBA 1INZA 4NACA 4L23A 3JQ1A 2WQHA 4ANWA 4BFRA 2HO1A 3CHPA 2OOEA 4RSYA 4FLBA 4DI4A 4EBAA 3E4BA 2NXPA 3UMVA 5EX0A 3TXNA 4MS6A 4N5CA 2WXRA 3CVNA 1TJFA 2WXKA 5DIZA 5CCLA 2OVFA 1HF8A 5FZRA 5LCWC 3TG4A 3RRNB 2CHZA 3Q49B 4OVVA 4PS8A 2V5FA 4W9RA 3FUNA 5A7DB 2J49A 3JUIA 3GZ1A 4JA7A 4EPZA 4F53A 3FU5A 3SD5A 3G2VA 2C0MA 4WNDA 5FJYA 5BPPA 2V8SE 4GCOA 3TGOA 3ZN3A 5AIJA 1HS6A 2FF4A 4CDNA 2HM8A 4AY6A 4GZ3A 3RKVA 2ONDA 3FUIA 4UI9K 4UWLA 1NA3A 3Q5MA 4JPSA 5KJMA 3TL5A 1SQMA 2UWJG 1IQRA 3AU4A 4FHKA 4UQXA 4I9EA 3MCXA 3KS2A 3ONLA 3PEVB 4NQ0A 3SHFA 1B89A 3APCA 2J9QA 3FUEA 3HDXA 3OXLA 5J08A 3PDNA 4G1TA 2JLBA 3Q15A 4KZCA 3TG5A 4BWRA 2VQ2A 3CHOA 4F7AA 4GU5A 1KLXA 3FHEA 3CIAA 4GYOA 5A6CA 2I6HA 3CVLA 2CHXA 3C98A 1XNFA 4HORA 2J4BA 2AW6A 3DPDA 3FTUA 3FUKA 5J90A 2XQ0A 4JHJA 3I4RB 2KZTA 5KCMA 3S7FA 3ASDA 1SZAA 2WXNA 4L2YA 3B13A 1PY1A 3U3WA 4C9BB 3CEQA 5HI7A 4XKBA 4U07A 3R9AB 2YHCA 3T8MA 2UY1B 4U0UA 4UWFA 5ARGA 3APFA 3QKYA 4EQFA 1MQSA 3PEUB 4FJYA 3D9PA 3GZ2A 3PH0C 4G2VA 3FTYA 4HXIA 5ENNA 4A1GA 4CGVA 5G05C 3LS8A 3EHMA 4DI3A 2VGYA 4DLQA 2JEKA 3UT7A 3KD7A 3ZYMA 5LFAA 3PNTB 4GZ5A 5AYWD 1NA0A 2P58C 3ZPJA 4JZYA 3U4TA 1OWOA 3FY4A 4I1OB 3LXUX 3FUFA 3HIZA 5AJLA 4URKA 1WY6A 5FQ8A 3ZW3A 2Y4TA 2KCLA 4DPRA 4J8EA 3PUJA 4B89A 3ML8A 3MKQA 4I9CA 2PL2A 3NF1A 1BPOA 1JUQA 3K9IA 1ZU2A 4IRUA 2C2LA 3JYSA 2VTBB 5DBKA 3MX3A 2E0IA 5D0OD 4N2QA 2XCCA 4AY5A 4ANVA 1E7UA 2XGMA 4HOSA 4J8FA 2DBAA 5FT9A 3BG1B 4ILIA 1H19A 3LVRE 4EZKA 4KT6B 4XKCA 4UWGA 5FZSA 1H6KA 3ONKA 1HZ4A 3BEEA 1PC2A 3MV3B 3FTVA 4EZJA 3TAXA 4J0UA 3ZHEB 4N39A 3FH8A 3D9LA 2YHEA 3LY8A 3ZFWA 3L16A 4WWOA 5EDSA 3SI5A 5JJTA 3GW4A 2VGXB 4J6IA 5ANLA 3UX4A 3JCKC 4BSXA 4F1SA 2XGOA 1YA0A 3PUKA 5T4YA 3AS5A 5JJ6A 1Z3YA 2WMOA 4TUUA 4HOTA 3MGBA 4ILHB 4Q69A 5BV0A 1E96B 2J07A 2L9BA 1NZNA 3L54A 3O4ZA 4A3VA 5E75A 3MA5A 2X6IA 3FEYA 4WWPA 1HX8A 4NURA 2I2OA 4MKTA 1E7VA 3OXGA 2IF4A 3S2AA 4KVMA 3SZ7A 4FA6A 2VYIA 4RVBA 4M3OA 5E76A 3FTWA 4JA9A 2MRIA 3CGHA 4C0MA 1Y8MA 3ESKA 4AXHA 4J8SA 3D9MA 4I2ZA 2WPVA 4L1BA 4LERA 4ANUA 3P1UA 4A3TA 1OWLA 1Z6TA 3RIBA 3RO2A 3UT4A 4EECA 3IEGA 2J4DA 3TJPA 3L13A 3ML9A 3VLDA 4DJAA 2ZU6B 1W3BA 3RO3A 5KJNA 1H2TC 2VSOE 4BX9A 2AXZA 4L7TA 3CKCA 1JPLA 3WXXA 4AJWA 1HG2A 3FUJA 2GRLA 3GZSA 4FHJA 3SBSA 4AV7A 3RK6A 4I6GA 3LCAA 2LAIA 3QAQA 2R59A 5JHAA 1QZ2A 2WXQA 3RU0A 2Q7FA 5LX8A 2X6JA 2WQ6A 2YNQA 2A5UA 4YNDA 3ZRHA 2XEVA 1H2VC 3FH7A 2AXUA 5T8IA 3UT8A 4CT0A 2FI7A 1UN8A 4BTBA 4XIFA 3UPVA 2BUGA 4ANXA 3SF4A 1HH8A 3O48A 4JEUA 2X6FA 1WM5A 1Y6IA 4GA1A 1L5JA 3MKQB 5CMYA 1U3DA 2BF0X 4WAFA 4APOA 1UW4B 3CVUA 4LUNU 2KCVA 3D3MA 4CDMA 2OV8A 4UI9J 3VLEA 4KMOA 2XCBA 1IYGA 3UQ3A 1KT1A 2NSZA 3CQCB 1VDYA 2YQ8A 2VJ8A 1TJCA 2WM9A 3IV0A 5FWQA 3CVYA 1ELKA 4PS7A 3CHRA 4Y6WA 2WXLA 3MJWA 2MOWA 4PH4B 3CHMA 4G25A 3S7BA 4H7XA 4XX5A 2LAHA 1QNFA 2IQCA 1E8WA 3EIQC 5LOZA 3MKRA 4U8HA 2IJGX 4GZCA 3VTXA 1HG5A 4B94A 4G24A 3SNXA 4K0RA 4BT9A 4N2SA 2WVIA 3QWVA 2R17C 3PE4A 4RG6A 4ATGA 4E6HA 4WNGA 5HQ8A 3QC1A 3AS4A 3ZXSA 1TEZA 3VTYA 2YINA 3B7UX 2R5SA 5C1DA 4U0ZA 4V3IA 2HR2A 2X3MA 5C2YA 1ELWA 1IHGA 4AVXA 4IN3B 1IQUA 5G2NA 1EDUA 1P5QA 4HOQA 1ELRA 4GAAA 3RJVA 4EBAG 3IKOB 2FULA 3CV0A 4JEHA 4TRQA 2RG8A 3D9KA 4BT8A 3ZEFA 3N71A 3CVVA 3CHSA 4JXTA 3LDZA 3QWWA 2DCPA 2X38A 1OWNA 1EYHA 2GW1A 2IU1A 2XPZA 4AOFA 3I4GA 4B0ZA 1JWGA 3D9IA 3CSTA 3FWVA 3FTZA 4FJZA 4ABNA 4B8AA 3FUMA 5BUZA 2WXOA 3U66A 3JQ0A 4FP7A 2AVPA 4FULA 4UQYA 2PQRA 3EHNA 3VLFA 2A4ZA 5A23A 4LCTA 3LVQE 4JVSA 3FTSA 3HVEB 3RRMB 5LP0A 4ACLA 4JHRA 3CVPA 1E8YA 4CRWA 3QDNA 3ZHEA 3LY7A 3U9WA 1HXIA 3B7SA 5EX3A 2Y3AA 2XRZA 4ACKA 3PNLB 3PZDA 2CG3A 3FEXA 4IYPA 1FCHA 1UN9A 3IHYA 3QB2A 2KC7A 2V4LA 3L08A 3NZSA 3MYVA 1LF8A 2XRYA 4UWHA 3R7RA 2VSNA 3PS6A 5G55A 3TXMA 5BNWA 1JWFA 4KZ0A 3G2WA 3I3NA 1NP7A 4FADA 3D9OA 4HLEA 1UG3A 2XPYA 3CSFA 2FBNA 1EF1C 4KXKB 4N3AA 4KBQA 2IFUA 3LPZA 3CR3A 2NC9A 3FU3A 3ASHA 2GGFA 3OTNA 4I1AA 4DLOA 3ENEA 2CFZA 3PVLA 3ULQA 4PUCA 2IOLA 3BG0B 1QQEA 2WXHA 2KZTB 4GPKA 4GZDA 5BW8C 4A1SA 2KATA 3CLJA 4UI9C 3FU6A 4ILGA 3HVEA 1MHQA 2WMNA 2PM6A 2Y4UA 4TV3A 1E8ZA 1FVFA 3EJNA 3AU5A 3ASFA 3OXFA 4I1MA 5G05J 3URZA 3UUXA 5BT1A 4KYOB 4MRUA 4I6JA 5AJDA 2WXMA 3DBSA 5AENA 3G2TA 4PS3A 1HFAA 4F3VA 2GRMA 3HYMB 3CVQA 1HE8A 3LJ3A 3D9JA 4WUYA 3L6AA 3S7DA 1A17A 2MHKA 2WXIA 2XPIA 4U63A 1WAO1 1E8XA 2VGXA 3SFZA 2KCKA 3ZIMA 3MEKA 4CCAA 5CMWA 2WXPA 4Q94A 1N54A 2WQ7A 1OWPA 5CCMA 4KVOA 1DNPA 3FDHA 3I5PA 4AM9A 4J8DA 3QJZA 4K03A 3G2UA 3FUDA 1OWMA 3NQPA 3SBTB 2IONA 4FU3A 3ZVVA 4C0EA 4CDRA 3PREA 4HOUA 2CG2A 2M63A 4AP2A 1U3CA 4AIFA 5JJ7A 5KJLA 1N52A 4B8CB 3T5VA 1X5BA 3HHMA 5ARFA 4GYYA 2DIWA 2XGSA 3KEZA 1UJJA 4Q96A 4XZ4A 3CVWA 2OVBA 1E90A 3ASGA 2LNIA 4I2WA 4Y6CA 4LRZA 4APFA 4PDXA 5T3RA 4GA0A 4DK5A 4XI0A 2I9CA 4WNEA 5FQ7A 4UWKA 2UY1A 1GW6A 4JW1A 4RG9A 1PAQA 4N3CA 3ESLA 4QFVA 2KM4A 3CQGB 4L2LA 1H2UA 2X6KA 1ZBPA 2WXFA 4U0SA 5FQ4A 4CEMA 3AS8A 4JC8A 5KJKA 4R7LA 3T5XA 3S7JA 4LEUA 3Q47B 2WXGA 4NRHB 5FZQA 4GB9A 2WB2A 5LCWJ 3ZYLA 4I43A 2ILRA 3MZLB 4BTAA 1Z3XA 3QARA 3CVXA 2X6HA 4ME2A 3SGHA 1OUVA 2PZIA 3GYZA 2PQNA 2V0PA 2EQXA 2FEZA 4WNFA 3R7QA 1UJKA 3LKUA 2CHWA 2J09A 4H7YA 3ZGQA 3QOUA 4A55A 4GA2A 2LSVA 5BV1A 2I1JA 3FH5A 4UQZA 5ANRA 5FTPA 1KT0A 3G2SA 5M72A 3OAWA 3ZYQA 2IOSA 2VSXE 4FC8A 4OYSA 4BX8A 2LSUA 1FVHA 1XGWA 4WWNA 5D0QD 5EKQD 3KAEA 4JL0A 2CFUA 2J08A 4GCNA 4XE0A 5CHEE 3Q4AB 2WXJA 3B7TA 5FQ6A 3FUHA 4N3BA 3FULA 4I17A 3L17A 3APDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FI7 A;  2QFC A;  3QKY A;  3CK8 A;  4EQF A;  4G2V A;  3GZ2 A;  3ULQ A;  4BTB A;  4CGV A;  2HYZ A;  4XIF A;  5G05 C;  1QQE A;  3EDT B;  2BUG A;  3UPV A;  4GPK A;  5BW8 C;  3SF4 A;  1HH8 A;  2KAT A;  4UI9 C;  3O48 A;  3CK9 A;  2VGY A;  5G04 C;  4A1S A;  1WM5 A;  3KD7 A;  4GA1 A;  4U04 A;  4GYW A;  4APO A;  2Y4U A;  4GZ5 A;  5AYW D;  2KCV A;  3QWP A;  5G04 J;  1NA0 A;  4UI9 J;  4CGW A;  2P58 C;  3ZPJ A;  2XCB A;  2C0L A;  3ASF A;  3OXF A;  5G05 J;  3U4T A;  3UQ3 A;  1KT1 A;  3URZ A;  3UUX A;  5BT1 A;  1IYG A;  4KYO B;  2YQ8 A;  1TJC A;  4N3B A;  4Y6W A;  3FP3 A;  4F3V A;  4GZ6 A;  2Y4T A;  2KCL A;  3CVQ A;  3HYM B;  4J8E A;  4WUY A;  4G23 A;  3LYA A;  3U3W A;  3S7D A;  3MV2 B;  1A17 A;  4G25 A;  4I9C A;  4YVQ C;  3S7B A;  2MHK A;  4H7X A;  4YVO A;  2E2E A;  2XPI A;  2PL2 A;  3LY9 A;  3NF1 A;  3CKB A;  3PE3 A;  3K9I A;  1ZU2 A;  2C2L A;  3JYS A;  1WAO 1;  4O6F A;  2VGX A;  3MKR A;  4G26 A;  2KCK A;  5DBK A;  3MEK A;  3VTX A;  4XI9 A;  4B94 A;  3CK7 A;  4G24 A;  5D0O D;  4BT9 A;  4N2Q A;  4N2S A;  5HQ8 A;  3QWV A;  2XCC A;  2VSY A;  3PE4 A;  4RG6 A;  4AY5 A;  4WNG A;  3FFL A;  2XGM A;  5CCM A;  4HOS A;  3AS4 A;  2FO7 A;  2L6J A;  3VTY A;  4J8F A;  2R5S A;  5C1D A;  4U0Z A;  4AM9 A;  2HR2 A;  2DBA A;  4J8D A;  5FT9 A;  1ELW A;  1IHG A;  2WQH A;  4IN3 B;  2HO1 A;  2OOE A;  1P5Q A;  5FZS A;  4CDR A;  3E4B A;  4HOQ A;  4HOU A;  1ELR A;  5EX0 A;  1HZ4 A;  3RJV A;  3BEE A;  4N5C A;  3CVN A;  1PC2 A;  4AIF A;  3CV0 A;  5JJ7 A;  5KJL A;  3MV3 B;  3TAX A;  5DIZ A;  4J0U A;  4BT8 A;  5ARF A;  4GYY A;  4N39 A;  3ZHE B;  3N71 A;  3LY8 A;  5CCL A;  3ZFW A;  5FZR A;  5LCW C;  3TG4 A;  2XGS A;  3Q49 B;  5JJT A;  2V5F A;  3GW4 A;  2VGX B;  4W9R A;  3ASG A;  2LNI A;  3QWW A;  4I2W A;  4Y6C A;  5A7D B;  3GZ1 A;  2XGO A;  4JA7 A;  1YA0 A;  2GW1 A;  4GA0 A;  4XI0 A;  3AS5 A;  5JJ6 A;  2C0M A;  4WND A;  4WNE A;  5FJY A;  4HOT A;  2UY1 A;  4GCO A;  4RG9 A;  3ZN3 A;  3TGO A;  1E96 B;  3FWV A;  4N3C A;  4ABN A;  2FF4 A;  1NZN A;  4AY6 A;  4GZ3 A;  3MA5 A;  3RKV A;  1ZBP A;  4U0S A;  2OND A;  2AVP A;  4UQY A;  3AS8 A;  5KJK A;  2PQR A;  3S7J A;  3OXG A;  2IF4 A;  4LEU A;  3Q47 B;  4NRH B;  4UI9 K;  5FZQ A;  2VYI A;  3SZ7 A;  1NA3 A;  3Q5M A;  5LCW J;  5KJM A;  4JA9 A;  4JHR A;  3CVP A;  4BTA A;  1Y8M A;  3ESK A;  3QDN A;  3ZHE A;  2UWJ G;  3LY7 A;  1HXI A;  4UQX A;  4I9E A;  3KS2 A;  4ME2 A;  4NQ0 A;  5EX3 A;  4I2Z A;  1OUV A;  2WPV A;  1B89 A;  2J9Q A;  3OXL A;  2PZI A;  3GYZ A;  2PQN A;  4WNF A;  2FEZ A;  1FCH A;  3PDN A;  4G1T A;  2JLB A;  3Q15 A;  3TG5 A;  3LKU A;  4BWR A;  4H7Y A;  2KC7 A;  3ZGQ A;  3QOU A;  2VQ2 A;  4GA2 A;  2LSV A;  3RIB A;  3RO2 A;  1KLX A;  4UQZ A;  3IEG A;  4GYO A;  5FTP A;  1KT0 A;  2I6H A;  5A6C A;  3CVL A;  2VSN A;  5BNW A;  5M72 A;  1XNF A;  1W3B A;  3RO3 A;  2LSU A;  5KJN A;  4HOR A;  5D0Q D;  3S7F A;  5EKQ D;  3KAE A;  3CKC A;  3WXX A;  2FBN A;  3ASD A;  4KXK B;  4JL0 A;  4N3A A;  3LCA A;  4KBQ A;  2IFU A;  3CEQ A;  3LPZ A;  4GCN A;  5HI7 A;  2NC9 A;  4U07 A;  1QZ2 A;  2YHC A;  3ASH A;  3Q4A B;  5CHE E;  3R9A B;  3RU0 A;  2Q7F A;  2UY1 B;  4U0U A;  4YND A;  2XEV A;  5ARG A;  4I17 A;  4I1A A; 
#chains in the Genus database with same CATH topology
 4FLH A;  3HXC A;  3E30 A;  1ZB1 A;  3EDT B;  2J8S D;  3CK9 A;  4BY6 A;  1MYO A;  3EUV A;  3ULE G;  3UM0 A;  3EIJ A;  2C0L A;  4RLY A;  2AXV A;  4JHK A;  2BTD A;  3ZKJ A;  1SZ9 A;  1S0P A;  3ZXP A;  1RW2 A;  2L0T B;  3CKB A;  3PE3 A;  4G11 A;  4O60 A;  4D10 C;  3CK7 A;  4OVU A;  4YDW A;  4GML A;  4HRN A;  3D9N A;  5JHB A;  4ANW A;  2WQH A;  4DI4 A;  2NXP A;  3UMV A;  3E33 A;  3TXN A;  5DIZ A;  1WG0 A;  1LTX A;  5A7D B;  4UUC A;  4EPZ A;  3G2V A;  5BPP A;  5AIJ A;  4CDN A;  4AY6 A;  4B93 B;  5B1B E;  3FUI A;  5KJM A;  4HRM B;  3TL5 A;  1SQM A;  4HQD A;  4UQX A;  3ONL A;  3PEV B;  3Q9U C;  1B89 A;  3APC A;  1H6O A;  5J08 A;  4G1T A;  3TG5 A;  4BWR A;  4F7A A;  3PZ1 A;  3W9G A;  3C98 A;  1XNF A;  4HOR A;  5J90 A;  4L2Y A;  3B13 A;  3U3W A;  3CEQ A;  2UY1 B;  4U0U A;  4G2V A;  3PH0 C;  4HXI A;  3AG1 E;  4A1G A;  5G05 C;  2P9K G;  3DXM G;  3TWX A;  2JEK A;  3UT7 A;  5KBA A;  1TNB A;  1LD8 A;  1OWO A;  3C3Q A;  1WY6 A;  1MX6 A;  3ZW3 A;  1K8K G;  4O1P A;  2DZO A;  3DEO A;  1O5M A;  1BPO A;  4IRU A;  5CEC B;  2C2L A;  3JYS A;  4N2Q A;  4HOS A;  5CBO A;  4U95 D;  2DBA A;  3BG1 B;  1D8E A;  1H19 A;  4KT6 B;  4XKC A;  4UWG A;  2P2C P;  3ONK A;  1PC2 A;  2XZD G;  3MV3 B;  3FTV A;  4J0U A;  3TWV A;  3LY8 A;  3L16 A;  5EDS A;  3SI5 A;  5JJT A;  1N4Q A;  4BSX A;  3UX4 A;  3TWQ A;  2XGO A;  5H7P A;  1Z3Y A;  2WMO A;  3BQO A;  4TUU A;  2L9B A;  4U96 D;  3FEY A;  1E7V A;  3OXG A;  3SZ7 A;  4M3O A;  3FTW A;  4C0M A;  3D9M A;  3Q9N C;  4I2Z A;  3J5P A;  5D2M C;  3V31 A;  3DSV A;  2J4D A;  1W3B A;  4LNU D;  3CKC A;  3DXK G;  1HG2 A;  2GRL A;  4FHJ A;  3SBS A;  4AV7 A;  1D9S A;  2Y69 E;  5AN8 A;  1QZ2 A;  3RU0 A;  2X6J A;  3E37 A;  3AG4 E;  5EIB E;  1N4P A;  5AQB A;  4BTB A;  1V54 E;  5EYL A;  3O48 A;  2X6F A;  5CMY A;  3D3M A;  3LJN A;  4KMO A;  1IYG A;  2NSZ A;  1VDY A;  2VJ8 A;  3CHR A;  3MJW A;  4PH4 B;  2ZIS A;  4H7X A;  3KSQ A;  1QNF A;  1S70 B;  1E8W A;  3EIQ C;  2Y0B G;  3MKR A;  2IJG X;  3VTX A;  4BT9 A;  2V5Q C;  3QWV A;  4WNG A;  2YIN A;  2R5S A;  2X3M A;  4AVX A;  4IN3 B;  5HS0 A;  1EDU A;  4EBA G;  3T8K A;  2FUL A;  4TRQ A;  2RG8 A;  4BT8 A;  3ZEF A;  3CVV A;  1LD7 A;  3QWW A;  2DCP A;  4U8Y D;  1MX2 A;  4BSZ B;  1IHB A;  4B8A A;  3FTZ A;  5BXU A;  2ZIR A;  3FUM A;  3JQ0 A;  3WG7 E;  3EHN A;  4YDE A;  2XZT G;  4LCT A;  3LVQ E;  5LP0 A;  4ACL A;  3CVP A;  3QDN A;  3ZHE A;  3LY7 A;  1HXI A;  4GPM A;  2P9U G;  4BEP A;  2XRZ A;  4ACK A;  3IHY A;  3L08 A;  3MYV A;  2L6B A;  2H6G A;  4KZ0 A;  3I3N A;  4HLE A;  4KXK B;  2NC9 A;  3FU3 A;  3DST A;  3T9K A;  3OTN A;  1SA4 A;  4DLO A;  2P9P G;  3BG0 B;  2KZT B;  3CLJ A;  4J7W A;  4TV3 A;  3V2O A;  3B95 A;  3OXF A;  4I1M A;  5G05 J;  3DSU A;  4MRU A;  3J5Q B;  1HFA A;  1OY3 D;  3V79 K;  2WXI A;  2XPI A;  4U63 A;  1WAO 1;  5ENT D;  3MEK A;  4CCA A;  2WXP A;  4KVO A;  5AAO A;  1YYH A;  3I5P A;  4AM9 A;  4HBD A;  4HOU A;  2BED A;  3HRA A;  5KJL A;  1N52 A;  5ARF A;  3AG3 E;  3CVW A;  2OVB A;  4BET A;  4L9P A;  3NBN B;  4QFV A;  2KM4 A;  1H2U A;  5FQ4 A;  4CEM A;  3AS8 A;  2RKK A;  4LEU A;  3Q47 B;  5FZQ A;  3UKR G;  4GB9 A;  1AP7 A;  3MZL B;  4CYM D;  1TYQ G;  3SGH A;  3X2Q E;  2XEE A;  1N11 A;  5BV1 A;  5AAR A;  4UQZ A;  3FH5 A;  4HNA D;  5ANR A;  5FTP A;  3G2S A;  3NAW A;  2VSX E;  4FC8 A;  2LSU A;  1BI8 B;  1XGW A;  5EKQ D;  4GCN A;  2WXJ A;  4TXR A;  5FQ6 A;  2QYU A;  2QFC A;  3CK8 A;  4GMR A;  1QBQ A;  2QY7 A;  3IBE A;  3PRZ A;  4EZL A;  2RD0 A;  2XHE A;  4U04 A;  2LUH A;  4GYW A;  3B7B A;  2L0I A;  4CGW A;  4GMJ A;  1FT2 A;  3ZUV B;  5CBN A;  3QNK A;  4G23 A;  3LYA A;  1HU3 A;  2E2E A;  3LY9 A;  4AEZ C;  3RAU A;  1EPU A;  2IY0 C;  4O6F A;  4G26 A;  4E85 A;  3U64 A;  2FO7 A;  4YDO A;  3EU9 A;  2HO1 A;  2OOE A;  4RSY A;  3E4B A;  2H6F A;  4MS6 A;  3CVN A;  1TJF A;  2OVF A;  5FZR A;  3R9M A;  3RRN B;  3Q49 B;  4OVV A;  4W9R A;  3FUN A;  3GZ1 A;  4JA7 A;  3FU5 A;  3SD5 A;  2V8S E;  3TGO A;  3ZN3 A;  1HS6 A;  4GZ3 A;  1N0R A;  2F8Y A;  4UWL A;  4JPS A;  1K1B A;  3F6Q A;  1IQR A;  3AU4 A;  4FHK A;  3MCX A;  3FUE A;  2J9Q A;  3HDX A;  3OXL A;  4GTV A;  1TN8 A;  3CHO A;  3CIA A;  4GYO A;  5A6C A;  2IO3 C;  4HI9 A;  2J4B A;  2AW6 A;  3DPD A;  4DRX E;  2H6I A;  3Q7F A;  3UM1 A;  3I4R B;  2KZT A;  3ASD A;  1SZA A;  1TNZ A;  2WXN A;  5FIN A;  1PY1 A;  3UKU G;  2LXM A;  4XKB A;  2A5E A;  3T8M A;  3Q79 A;  4FJY A;  3GZ2 A;  4DX7 D;  3EHM A;  4DI3 A;  2R03 A;  5LFA A;  5AYW D;  2F37 A;  3FY4 A;  3LXU X;  4GTO A;  3FUF A;  5FQ8 A;  4DPR A;  1BD8 A;  5CEA A;  3MKQ A;  2ZGD A;  4X8Q A;  1JUQ A;  3K9I A;  1ZU2 A;  2PNN A;  5D0O D;  2FO1 E;  2XGM A;  4ILI A;  3TWU A;  5FZS A;  3BEE A;  1SW6 A;  4EZJ A;  3TAX A;  3FH8 A;  3D9L A;  4F1P A;  4J6I A;  5ANL A;  1AWC B;  4DUI A;  5T4Y A;  3AS5 A;  4HOT A;  3MGB A;  4Q69 A;  1E96 B;  2BKK B;  1NZN A;  5E75 A;  2I2O A;  2IF4 A;  4KVM A;  4RVB A;  3CGH A;  4AXH A;  1JCR A;  3ASO E;  4YDY A;  4LER A;  3P1U A;  3RO2 A;  2ETC A;  2JAB A;  4BX9 A;  4L7T A;  4N5Q A;  3DSW A;  3FUJ A;  2F0Y A;  3LCA A;  2R59 A;  5JHA A;  2YNQ A;  4YND A;  1H2V C;  5T8I A;  3UXG A;  2FI7 A;  4ANX A;  3SF4 A;  1WM5 A;  1Y6I A;  4GA1 A;  1UOH A;  2H6H A;  1UW4 B;  1WDY A;  3TWS A;  2OV8 A;  3UQ3 A;  2YQ8 A;  2WM9 A;  1TJC A;  5FWQ A;  4Y6W A;  4Z68 A;  2MOW A;  3RSE G;  3S7B A;  3SY2 A;  2EIK E;  4XX5 A;  2LAH A;  4B94 A;  1HG5 A;  4G24 A;  4K0R A;  4RG6 A;  3ABM E;  1TEZ A;  5C2Y A;  1IHG A;  5G2N A;  1P5Q A;  1K3Z D;  3RJV A;  4JEH A;  3N71 A;  4OAV B;  4JXT A;  2OCC E;  3LDZ A;  2X38 A;  1EYH A;  2IU1 A;  1OCZ E;  2R05 A;  3I4G A;  1IKN D;  3V2X A;  4FJZ A;  4CZ2 D;  1U2V G;  4FP7 A;  2P9L G;  3BU8 A;  3VLF A;  2V4H C;  4C48 B;  5KWD A;  3HVE B;  3RRM B;  4JHR A;  3BUA A;  5EX3 A;  1KPS B;  2CG3 A;  4IYP A;  4LSZ E;  2KC7 A;  2V4L A;  4K5C A;  3NZS A;  2XRY A;  4UWH A;  3R7R A;  2VSN A;  1D8D A;  3PS6 A;  3TXM A;  1TNU A;  5JMN D;  1NP7 A;  4FAD A;  3D9O A;  1UG3 A;  3ZU7 B;  4KBQ A;  2IFU A;  3LPZ A;  1NL4 A;  2GGF A;  2RFM A;  3ENE A;  2IOL A;  2WXH A;  2IO2 C;  4GPK A;  4GZD A;  5JA4 D;  2DWZ A;  2KAT A;  3ABL E;  4UI9 C;  3FU6 A;  1MHQ A;  2Y4U A;  2ZGG A;  3URZ A;  3UUX A;  1V55 E;  4I6J A;  5AJD A;  2WXM A;  5IY5 E;  4F3V A;  3HYM B;  1HE8 A;  4QQI A;  4WUY A;  3TWR A;  2IEJ A;  3L6A A;  2MHK A;  1N4R A;  4ATZ D;  3SFZ A;  2WQ7 A;  5ENO D;  1OWP A;  4DX1 A;  5CCM A;  5KNG A;  1H6P A;  4J8D A;  1OWM A;  3SBT B;  2ION A;  4CDR A;  2M63 A;  5JJ7 A;  4B8C B;  3DSS A;  4PDX A;  5T3R A;  3Q75 A;  4XI0 A;  3TWT A;  4UWK A;  1GW6 A;  2DYR E;  1PAQ A;  4EHM A;  4L2L A;  2WXF A;  4JC8 A;  5KJK A;  1A5E A;  2WXG A;  4DX6 D;  5LCW J;  3ZYL A;  2ILR A;  4BTA A;  3QAR A;  3DWL G;  3GYZ A;  4WNF A;  2EIL E;  3LKU A;  4A55 A;  1TN6 A;  3ZGQ A;  4GA2 A;  2LSV A;  1KT0 A;  3OAW A;  4M7C A;  3KAE A;  4JL0 A;  4XE0 A;  3Q4A B;  4N3B A;  1OCC E;  1SA5 A;  1S63 A;  4IUL A;  1H0A A;  4I6E A;  2HYZ A;  1DVP A;  4LNG A;  2LO6 A;  3CHQ A;  3RRU A;  3QWP A;  4TXP A;  2B6C A;  5G04 J;  4P29 A;  2ETA A;  1HO8 A;  3NOG D;  4HVB A;  3FTX A;  2BKG A;  5CED B;  3FP3 A;  4GZ6 A;  3L22 A;  3MV2 B;  3L9T A;  3B7R L;  1JCS A;  4MLP A;  5FIO A;  2I1K A;  3FFL A;  2AWI A;  2L6J A;  4NAC A;  1DCE A;  4L23 A;  3JQ1 A;  4BFR A;  4FLB A;  4EBA A;  1N94 A;  1YCS B;  5EX0 A;  4N5C A;  2LXL A;  4K5B A;  5AQ7 A;  1HF8 A;  3TG4 A;  2CHZ A;  2V5F A;  3UTM A;  3JUI A;  3SO8 A;  5B1A E;  2C0M A;  2FF4 A;  3RKV A;  4GTQ A;  3Q5M A;  2MYO A;  3HXB A;  5EIL A;  3NOC D;  3PDN A;  4KZC A;  3Q15 A;  2RFA A;  2I6H A;  4F6R D;  2XS8 A;  3FTU A;  2XQ0 A;  4JHJ A;  5KCM A;  3S7F A;  1NFI E;  5ENS D;  4C9B B;  5HI7 A;  3R9A B;  5ARG A;  4EQF A;  1MQS A;  3PEU B;  3D9P A;  1TNY A;  4CGV A;  1OXJ A;  3KD7 A;  3ZYM A;  4GZ5 A;  1NA0 A;  3ZPJ A;  4I1O B;  1MZC A;  1IXV A;  2Y4T A;  4B89 A;  3ML8 A;  4I9C A;  1G3N B;  2PL2 A;  3NF1 A;  3C5R A;  3IXE A;  4U8V D;  4TUM A;  2VTB B;  5DBK A;  2XCC A;  4AY5 A;  3V30 A;  1BU9 A;  2KXP C;  4HLL A;  1HZ4 A;  3JXI A;  3ZHE B;  4N39 A;  2GRQ B;  3ZFW A;  4F1S A;  3PZ2 A;  2XS1 A;  1FT1 A;  3L54 A;  3O4Z A;  4A3V A;  3MA5 A;  4WWP A;  1HX8 A;  4NUR A;  3TWW A;  3S2A A;  2VYI A;  5E76 A;  2MRI A;  3AJI A;  1Y8M A;  3ESK A;  4J8S A;  4HRL A;  2WPV A;  4O1O A;  4ANU A;  4A3T A;  1OWL A;  2P9N G;  1Z6T A;  3RIB A;  3UT4 A;  3L13 A;  4DJA A;  3RO3 A;  5KJN A;  2VSO E;  4I6G A;  2LAI A;  5LX8 A;  3ZRH A;  2A5U A;  4CT0 A;  3UM3 A;  2AXU A;  1UN8 A;  4XIF A;  3UPV A;  2EIM E;  4ZHB A;  1L5J A;  4APO A;  1U3D A;  2BF0 X;  2EIJ E;  4WAF A;  3CVU A;  4CDM A;  4UI9 J;  4OAU C;  2XCB A;  3CVY A;  1ELK A;  3CHM A;  4G25 A;  2IQC A;  5LOZ A;  4ZFH A;  2Y1L E;  1OT8 A;  4U8H A;  3KSL A;  3SNX A;  5HQ8 A;  2R17 C;  3PE4 A;  3NB2 A;  3AS4 A;  1JCQ A;  3B7U X;  5C1D A;  4V3I A;  2HR2 A;  1ELW A;  1IQU A;  1N9A A;  1ELR A;  3IKO B;  3D9K A;  3CHS A;  1BI7 B;  2GW1 A;  4B0Z A;  1JWG A;  4NIK A;  3CST A;  4ABN A;  3AG2 E;  3DRA A;  4FUL A;  4UQY A;  5A23 A;  4JVS A;  3DEP A;  3FTS A;  1BLX B;  3AAA C;  5CRU A;  3PZD A;  3JXJ A;  1UN9 A;  3QB2 A;  4G8L A;  1LF8 A;  5G55 A;  1JWF A;  3G2W A;  3CSF A;  2FBN A;  4N3A A;  3CR3 A;  4I1A A;  3E34 A;  2CFZ A;  3PVL A;  3ULQ A;  1YMP A;  1QQE A;  4A1S A;  4ILG A;  3HVE A;  1FVF A;  3EJN A;  2QYJ A;  2XEH A;  3ASF A;  5BT1 A;  2GRO B;  3CVQ A;  3S7D A;  2P9I G;  2VGX A;  1NI1 A;  5CMW A;  4DX5 D;  4Q94 A;  3Q78 A;  1DNP A;  3PZ4 A;  3G2U A;  3FUD A;  1N0Q A;  4FU3 A;  3PRE A;  2CG2 A;  1OCO E;  4AIF A;  4GTT A;  3T5V A;  2DZN A;  3HHM A;  3ABK E;  5HKP A;  3KEZ A;  1UJJ A;  3SQV A;  1E90 A;  3ASG A;  5B3S E;  5FQ7 A;  2UY1 A;  4RG9 A;  4N3C A;  3ESL A;  3CQG B;  5AQ9 A;  1ZBP A;  4R7L A;  3T5X A;  3S7J A;  2DYS E;  1Z3X A;  4TXQ A;  2QZA A;  1OUV A;  2PZI A;  2PQN A;  2V0P A;  2FEZ A;  3R7Q A;  4BX8 A;  4OYS A;  1TN7 A;  1FVH A;  5D0Q D;  5CHE E;  3B7T A;  4LG6 A;  3HXF A;  4I17 A;  3L17 A;  3APD A;  3QK0 A;  4A63 B;  5G04 C;  3HXD A;  4HFG A;  2PM7 A;  3IHV A;  3UIO C;  2VTB A;  3FU0 A;  4RQI A;  5CER B;  3LEW A;  3HG0 D;  4CT4 A;  4YVQ C;  3P2B A;  3NZU A;  4YVO A;  5BXO A;  3ZYK A;  4HS2 A;  4XI9 A;  1K1A A;  2VSY A;  3D9H A;  3ASN E;  1DCQ A;  1INZ A;  3CHP A;  2WXR A;  2WXK A;  4JD2 G;  5CCL A;  5LCW C;  4PS8 A;  2J49 A;  4F53 A;  4JB8 P;  4WND A;  5FJY A;  5ENP D;  4GCO A;  2VGE A;  2AJA A;  2HM8 A;  2OND A;  5ENR D;  5EN5 D;  2B0O E;  4UI9 K;  1NA3 A;  2QC9 A;  2HE0 A;  2ETB A;  2UWJ G;  4I9E A;  3KS2 A;  4NQ0 A;  3SHF A;  3ULY A;  2GRP B;  2JLB A;  2VQ2 A;  4GU5 A;  1KLX A;  2R2L A;  3FHE A;  4GTM A;  3CVL A;  2CHX A;  3FUK A;  2F8X K;  1S64 A;  4U07 A;  2YHC A;  4HB5 A;  4UWF A;  3APF A;  3QKY A;  5ENN A;  3FTY A;  3LS8 A;  1N4S A;  2VGY A;  4DLQ A;  3PNT B;  2P58 C;  4JZY A;  1RZ4 A;  3U4T A;  4GTR A;  5EID A;  3HIZ A;  5AJL A;  4URK A;  3Q7A A;  4BES A;  2KCL A;  4GTP A;  3PUJ A;  4J8E A;  3DPY A;  4LNB A;  3SFY A;  3MX3 A;  2E0I A;  4DX2 A;  4ANV A;  1E7U A;  3UIP C;  4J8F A;  5FT9 A;  1KZO A;  4EZK A;  3LVR E;  1H6K A;  2YHE A;  4WWO A;  1TR4 A;  3GW4 A;  2VGX B;  3JCK C;  4BER A;  1YA0 A;  3PUK A;  5JJ6 A;  4ILH B;  5BV0 A;  1OCR E;  2J07 A;  5AQA A;  1DC2 A;  2X6I A;  4MKT A;  4FA6 A;  4JA9 A;  4HI8 A;  4L1B A;  4EEC A;  3IEG A;  3TJP A;  3ML9 A;  3VLD A;  2ZU6 B;  1H2T C;  2AXZ A;  1JPL A;  3WXX A;  4AJW A;  3GZS A;  3RK6 A;  3EU5 A;  3QAQ A;  4GTS A;  1Z5S C;  2WXQ A;  2Q7F A;  2WQ6 A;  2XEV A;  3FH7 A;  3UT8 A;  2BUG A;  4XEI G;  3ISM C;  1HH8 A;  2GRN B;  4JEU A;  3MKQ B;  4LUN U;  2KCV A;  2KBX A;  3VLE A;  4J8Y A;  1KT1 A;  3CQC B;  3IV0 A;  5ITZ F;  4PS7 A;  2WXL A;  4MBG A;  3C3R A;  1X81 A;  4GZC A;  4N2S A;  4ATG A;  2WVI A;  2OEW A;  4E6H A;  3QC1 A;  3ZXS A;  3VTY A;  4U0Z A;  1TNO A;  3DSX A;  1O1S A;  4HOQ A;  4GAA A;  4G8K A;  3CV0 A;  5KNH D;  1MX4 A;  1OWN A;  2NYJ A;  4AOF A;  2XPZ A;  2R02 A;  4U7E B;  3D9I A;  3FWV A;  3L82 A;  5BUZ A;  2WXO A;  3U66 A;  5HRY A;  2AVP A;  2PQR A;  3Q73 A;  2A4Z A;  1E8Y A;  4CRW A;  3EHQ A;  3U9W A;  5EYP F;  1QYM A;  3B7S A;  3SFX A;  2OEV A;  2Y3A A;  5CRV A;  3PNL B;  3FEX A;  3PZ3 A;  1FCH A;  1SVX A;  3UI2 A;  5BNW A;  3E32 A;  5ENQ D;  2XPY A;  4K5A B;  1EF1 C;  3ASH A;  4PUC A;  5BW8 C;  1O1R A;  2WMN A;  2PM6 A;  1E8Z A;  2P9S G;  3AU5 A;  3JUE A;  4KYO B;  3DBS A;  5AEN A;  3G2T A;  4PS3 A;  2GRM A;  3LJ3 A;  3D9J A;  1A17 A;  1N95 A;  1KZP A;  1E8X A;  2KCK A;  3C3O A;  3ZIM A;  1N54 A;  3KEA A;  3FDH A;  4K03 A;  3QJZ A;  3NQP A;  3ZVV A;  4C0E A;  4AP2 A;  1U3C A;  1X5B A;  4GYY A;  2DIW A;  2XGS A;  2XEN A;  4Q96 A;  4XZ4 A;  5D66 A;  3UM2 A;  2LNI A;  4I2W A;  4Y6C A;  4LRZ A;  4APF A;  2DVW A;  4GA0 A;  4DK5 A;  2I9C A;  4WNE A;  4JW1 A;  3C72 A;  2X6K A;  2EIN E;  4U0S A;  3ZNG A;  1Q2Z A;  4NRH B;  2WB2 A;  4I43 A;  2GRR B;  3CVX A;  3W9F A;  2X6H A;  4ME2 A;  3UIN C;  1FPP A;  1O1T A;  2EQX A;  1UJK A;  1MJ0 A;  2CHW A;  2J09 A;  4H7Y A;  3QOU A;  2I1J A;  5M72 A;  3ZYQ A;  2IOS A;  4WWN A;  3EHR A;  2ZXW E;  2CFU A;  2J08 A;  3HXE A;  3FUH A;  3FUL A; 
#chains in the Genus database with same CATH homology
 3QK0 A;  4FLH A;  2QFC A;  4IUL A;  3CK8 A;  1H0A A;  4I6E A;  2HYZ A;  3EDT B;  2QY7 A;  1DVP A;  3IBE A;  2LO6 A;  3PRZ A;  3CK9 A;  5G04 C;  4BY6 A;  4EZL A;  2RD0 A;  2XHE A;  4U04 A;  4GYW A;  4HFG A;  3CHQ A;  3RRU A;  2L0I A;  2PM7 A;  3QWP A;  5G04 J;  4CGW A;  3IHV A;  3EIJ A;  4P29 A;  2C0L A;  2VTB A;  1HO8 A;  2AXV A;  3FU0 A;  4GMJ A;  4JHK A;  4HVB A;  3FTX A;  2BTD A;  3LEW A;  3FP3 A;  4GZ6 A;  1SZ9 A;  3QNK A;  4G23 A;  3LYA A;  3L22 A;  4CT4 A;  3MV2 B;  4YVQ C;  3P2B A;  1S0P A;  3NZU A;  1HU3 A;  2L0T B;  2E2E A;  4YVO A;  3B7R L;  3LY9 A;  3CKB A;  4AEZ C;  3PE3 A;  3ZYK A;  1EPU A;  4G11 A;  4O6F A;  4G26 A;  4HS2 A;  4MLP A;  4XI9 A;  4D10 C;  3CK7 A;  4OVU A;  4GML A;  2I1K A;  2VSY A;  3D9N A;  4E85 A;  3FFL A;  3U64 A;  2AWI A;  2FO7 A;  2L6J A;  5JHB A;  1INZ A;  4NAC A;  4L23 A;  3JQ1 A;  2WQH A;  4ANW A;  4BFR A;  2HO1 A;  3CHP A;  2OOE A;  4RSY A;  4FLB A;  4DI4 A;  4EBA A;  3E4B A;  2NXP A;  3UMV A;  5EX0 A;  3TXN A;  4MS6 A;  4N5C A;  2WXR A;  3CVN A;  1TJF A;  2WXK A;  5DIZ A;  5CCL A;  2OVF A;  1HF8 A;  5FZR A;  5LCW C;  3TG4 A;  3RRN B;  2CHZ A;  3Q49 B;  4OVV A;  4PS8 A;  2V5F A;  4W9R A;  3FUN A;  5A7D B;  2J49 A;  3JUI A;  3GZ1 A;  4JA7 A;  4EPZ A;  4F53 A;  3FU5 A;  3SD5 A;  3G2V A;  2C0M A;  4WND A;  5FJY A;  5BPP A;  2V8S E;  4GCO A;  3TGO A;  3ZN3 A;  5AIJ A;  1HS6 A;  2FF4 A;  4CDN A;  2HM8 A;  4AY6 A;  4GZ3 A;  3RKV A;  2OND A;  3FUI A;  4UI9 K;  4UWL A;  1NA3 A;  3Q5M A;  4JPS A;  5KJM A;  3TL5 A;  1SQM A;  2UWJ G;  1IQR A;  3AU4 A;  4FHK A;  4UQX A;  4I9E A;  3MCX A;  3KS2 A;  3ONL A;  3PEV B;  4NQ0 A;  3SHF A;  1B89 A;  3APC A;  2J9Q A;  3FUE A;  3HDX A;  3OXL A;  5J08 A;  3PDN A;  4G1T A;  2JLB A;  3Q15 A;  4KZC A;  3TG5 A;  4BWR A;  2VQ2 A;  3CHO A;  4F7A A;  4GU5 A;  1KLX A;  3FHE A;  3CIA A;  4GYO A;  5A6C A;  2I6H A;  3CVL A;  2CHX A;  3C98 A;  1XNF A;  4HOR A;  2J4B A;  2AW6 A;  3DPD A;  3FTU A;  3FUK A;  5J90 A;  2XQ0 A;  4JHJ A;  3I4R B;  2KZT A;  5KCM A;  3S7F A;  3ASD A;  1SZA A;  2WXN A;  4L2Y A;  3B13 A;  1PY1 A;  3U3W A;  4C9B B;  3CEQ A;  5HI7 A;  4XKB A;  4U07 A;  3R9A B;  2YHC A;  3T8M A;  2UY1 B;  4U0U A;  4UWF A;  5ARG A;  3APF A;  3QKY A;  4EQF A;  1MQS A;  3PEU B;  4FJY A;  3D9P A;  3GZ2 A;  3PH0 C;  4G2V A;  3FTY A;  4HXI A;  5ENN A;  4A1G A;  4CGV A;  5G05 C;  3LS8 A;  3EHM A;  4DI3 A;  2VGY A;  4DLQ A;  2JEK A;  3UT7 A;  3KD7 A;  3ZYM A;  5LFA A;  3PNT B;  4GZ5 A;  5AYW D;  1NA0 A;  2P58 C;  3ZPJ A;  4JZY A;  3U4T A;  1OWO A;  3FY4 A;  4I1O B;  3LXU X;  3FUF A;  3HIZ A;  5AJL A;  4URK A;  1WY6 A;  5FQ8 A;  3ZW3 A;  2Y4T A;  2KCL A;  4DPR A;  4J8E A;  3PUJ A;  4B89 A;  3ML8 A;  3MKQ A;  4I9C A;  2PL2 A;  3NF1 A;  1BPO A;  1JUQ A;  3K9I A;  1ZU2 A;  4IRU A;  2C2L A;  3JYS A;  2VTB B;  5DBK A;  3MX3 A;  2E0I A;  5D0O D;  4N2Q A;  2XCC A;  4AY5 A;  4ANV A;  1E7U A;  2XGM A;  4HOS A;  4J8F A;  2DBA A;  5FT9 A;  3BG1 B;  4ILI A;  1H19 A;  3LVR E;  4EZK A;  4KT6 B;  4XKC A;  4UWG A;  5FZS A;  1H6K A;  3ONK A;  1HZ4 A;  3BEE A;  1PC2 A;  3MV3 B;  3FTV A;  4EZJ A;  3TAX A;  4J0U A;  3ZHE B;  4N39 A;  3FH8 A;  3D9L A;  2YHE A;  3LY8 A;  3ZFW A;  3L16 A;  4WWO A;  5EDS A;  3SI5 A;  5JJT A;  3GW4 A;  2VGX B;  4J6I A;  5ANL A;  3UX4 A;  3JCK C;  4BSX A;  4F1S A;  2XGO A;  1YA0 A;  3PUK A;  5T4Y A;  3AS5 A;  5JJ6 A;  1Z3Y A;  2WMO A;  4TUU A;  4HOT A;  3MGB A;  4ILH B;  4Q69 A;  5BV0 A;  1E96 B;  2J07 A;  2L9B A;  1NZN A;  3L54 A;  3O4Z A;  4A3V A;  5E75 A;  3MA5 A;  2X6I A;  3FEY A;  4WWP A;  1HX8 A;  4NUR A;  2I2O A;  4MKT A;  1E7V A;  3OXG A;  2IF4 A;  3S2A A;  4KVM A;  3SZ7 A;  4FA6 A;  2VYI A;  4RVB A;  4M3O A;  5E76 A;  3FTW A;  4JA9 A;  2MRI A;  3CGH A;  4C0M A;  1Y8M A;  3ESK A;  4AXH A;  4J8S A;  3D9M A;  4I2Z A;  2WPV A;  4L1B A;  4LER A;  4ANU A;  3P1U A;  4A3T A;  1OWL A;  1Z6T A;  3RIB A;  3RO2 A;  3UT4 A;  4EEC A;  3IEG A;  2J4D A;  3TJP A;  3L13 A;  3ML9 A;  3VLD A;  4DJA A;  2ZU6 B;  1W3B A;  3RO3 A;  5KJN A;  1H2T C;  2VSO E;  4BX9 A;  2AXZ A;  4L7T A;  3CKC A;  1JPL A;  3WXX A;  4AJW A;  1HG2 A;  3FUJ A;  2GRL A;  3GZS A;  4FHJ A;  3SBS A;  4AV7 A;  3RK6 A;  4I6G A;  3LCA A;  2LAI A;  3QAQ A;  2R59 A;  5JHA A;  1QZ2 A;  2WXQ A;  3RU0 A;  2Q7F A;  5LX8 A;  2X6J A;  2WQ6 A;  2YNQ A;  2A5U A;  4YND A;  3ZRH A;  2XEV A;  1H2V C;  3FH7 A;  2AXU A;  5T8I A;  3UT8 A;  4CT0 A;  2FI7 A;  1UN8 A;  4BTB A;  4XIF A;  3UPV A;  2BUG A;  4ANX A;  3SF4 A;  1HH8 A;  3O48 A;  4JEU A;  2X6F A;  1WM5 A;  1Y6I A;  4GA1 A;  1L5J A;  3MKQ B;  5CMY A;  1U3D A;  2BF0 X;  4WAF A;  4APO A;  1UW4 B;  3CVU A;  4LUN U;  2KCV A;  3D3M A;  4CDM A;  2OV8 A;  4UI9 J;  3VLE A;  4KMO A;  2XCB A;  1IYG A;  3UQ3 A;  1KT1 A;  2NSZ A;  3CQC B;  1VDY A;  2YQ8 A;  2VJ8 A;  1TJC A;  2WM9 A;  3IV0 A;  5FWQ A;  3CVY A;  1ELK A;  4PS7 A;  3CHR A;  4Y6W A;  2WXL A;  3MJW A;  2MOW A;  4PH4 B;  3CHM A;  4G25 A;  3S7B A;  4H7X A;  4XX5 A;  2LAH A;  1QNF A;  2IQC A;  1E8W A;  3EIQ C;  5LOZ A;  3MKR A;  4U8H A;  2IJG X;  4GZC A;  3VTX A;  1HG5 A;  4B94 A;  4G24 A;  3SNX A;  4K0R A;  4BT9 A;  4N2S A;  2WVI A;  3QWV A;  2R17 C;  3PE4 A;  4RG6 A;  4ATG A;  4E6H A;  4WNG A;  5HQ8 A;  3QC1 A;  3AS4 A;  3ZXS A;  1TEZ A;  3VTY A;  2YIN A;  3B7U X;  2R5S A;  5C1D A;  4U0Z A;  4V3I A;  2HR2 A;  2X3M A;  5C2Y A;  1ELW A;  1IHG A;  4AVX A;  4IN3 B;  1IQU A;  5G2N A;  1EDU A;  1P5Q A;  4HOQ A;  1ELR A;  4GAA A;  3RJV A;  4EBA G;  3IKO B;  2FUL A;  3CV0 A;  4JEH A;  4TRQ A;  2RG8 A;  3D9K A;  4BT8 A;  3ZEF A;  3N71 A;  3CVV A;  3CHS A;  4JXT A;  3LDZ A;  3QWW A;  2DCP A;  2X38 A;  1OWN A;  1EYH A;  2GW1 A;  2IU1 A;  2XPZ A;  4AOF A;  3I4G A;  4B0Z A;  1JWG A;  3D9I A;  3CST A;  3FWV A;  3FTZ A;  4FJZ A;  4ABN A;  4B8A A;  3FUM A;  5BUZ A;  2WXO A;  3U66 A;  3JQ0 A;  4FP7 A;  2AVP A;  4FUL A;  4UQY A;  2PQR A;  3EHN A;  3VLF A;  2A4Z A;  5A23 A;  4LCT A;  3LVQ E;  4JVS A;  3FTS A;  3HVE B;  3RRM B;  5LP0 A;  4ACL A;  4JHR A;  3CVP A;  1E8Y A;  4CRW A;  3QDN A;  3ZHE A;  3LY7 A;  3U9W A;  1HXI A;  3B7S A;  5EX3 A;  2Y3A A;  2XRZ A;  4ACK A;  3PNL B;  3PZD A;  2CG3 A;  3FEX A;  4IYP A;  1FCH A;  1UN9 A;  3IHY A;  3QB2 A;  2KC7 A;  2V4L A;  3L08 A;  3NZS A;  3MYV A;  1LF8 A;  2XRY A;  4UWH A;  3R7R A;  2VSN A;  3PS6 A;  5G55 A;  3TXM A;  5BNW A;  1JWF A;  4KZ0 A;  3G2W A;  3I3N A;  1NP7 A;  4FAD A;  3D9O A;  4HLE A;  1UG3 A;  2XPY A;  3CSF A;  2FBN A;  1EF1 C;  4KXK B;  4N3A A;  4KBQ A;  2IFU A;  3LPZ A;  3CR3 A;  2NC9 A;  3FU3 A;  3ASH A;  2GGF A;  3OTN A;  4I1A A;  4DLO A;  3ENE A;  2CFZ A;  3PVL A;  3ULQ A;  4PUC A;  2IOL A;  3BG0 B;  1QQE A;  2WXH A;  2KZT B;  4GPK A;  4GZD A;  5BW8 C;  4A1S A;  2KAT A;  3CLJ A;  4UI9 C;  3FU6 A;  4ILG A;  3HVE A;  1MHQ A;  2WMN A;  2PM6 A;  2Y4U A;  4TV3 A;  1E8Z A;  1FVF A;  3EJN A;  3AU5 A;  3ASF A;  3OXF A;  4I1M A;  5G05 J;  3URZ A;  3UUX A;  5BT1 A;  4KYO B;  4MRU A;  4I6J A;  5AJD A;  2WXM A;  3DBS A;  5AEN A;  3G2T A;  4PS3 A;  1HFA A;  4F3V A;  2GRM A;  3HYM B;  3CVQ A;  1HE8 A;  3LJ3 A;  3D9J A;  4WUY A;  3L6A A;  3S7D A;  1A17 A;  2MHK A;  2WXI A;  2XPI A;  4U63 A;  1WAO 1;  1E8X A;  2VGX A;  3SFZ A;  2KCK A;  3ZIM A;  3MEK A;  4CCA A;  5CMW A;  2WXP A;  4Q94 A;  1N54 A;  2WQ7 A;  1OWP A;  5CCM A;  4KVO A;  1DNP A;  3FDH A;  3I5P A;  4AM9 A;  4J8D A;  3QJZ A;  4K03 A;  3G2U A;  3FUD A;  1OWM A;  3NQP A;  3SBT B;  2ION A;  4FU3 A;  3ZVV A;  4C0E A;  4CDR A;  3PRE A;  4HOU A;  2CG2 A;  2M63 A;  4AP2 A;  1U3C A;  4AIF A;  5JJ7 A;  5KJL A;  1N52 A;  4B8C B;  3T5V A;  1X5B A;  3HHM A;  5ARF A;  4GYY A;  2DIW A;  2XGS A;  3KEZ A;  1UJJ A;  4Q96 A;  4XZ4 A;  3CVW A;  2OVB A;  1E90 A;  3ASG A;  2LNI A;  4I2W A;  4Y6C A;  4LRZ A;  4APF A;  4PDX A;  5T3R A;  4GA0 A;  4DK5 A;  4XI0 A;  2I9C A;  4WNE A;  5FQ7 A;  4UWK A;  2UY1 A;  1GW6 A;  4JW1 A;  4RG9 A;  1PAQ A;  4N3C A;  3ESL A;  4QFV A;  2KM4 A;  3CQG B;  4L2L A;  1H2U A;  2X6K A;  1ZBP A;  2WXF A;  4U0S A;  5FQ4 A;  4CEM A;  3AS8 A;  4JC8 A;  5KJK A;  4R7L A;  3T5X A;  3S7J A;  4LEU A;  3Q47 B;  2WXG A;  4NRH B;  5FZQ A;  4GB9 A;  2WB2 A;  5LCW J;  3ZYL A;  4I43 A;  2ILR A;  3MZL B;  4BTA A;  1Z3X A;  3QAR A;  3CVX A;  2X6H A;  4ME2 A;  3SGH A;  1OUV A;  2PZI A;  3GYZ A;  2PQN A;  2V0P A;  2EQX A;  2FEZ A;  4WNF A;  3R7Q A;  1UJK A;  3LKU A;  2CHW A;  2J09 A;  4H7Y A;  3ZGQ A;  3QOU A;  4A55 A;  4GA2 A;  2LSV A;  5BV1 A;  2I1J A;  3FH5 A;  4UQZ A;  5ANR A;  5FTP A;  1KT0 A;  3G2S A;  5M72 A;  3OAW A;  3ZYQ A;  2IOS A;  2VSX E;  4FC8 A;  4OYS A;  4BX8 A;  2LSU A;  1FVH A;  1XGW A;  4WWN A;  5D0Q D;  5EKQ D;  3KAE A;  4JL0 A;  2CFU A;  2J08 A;  4GCN A;  4XE0 A;  5CHE E;  3Q4A B;  2WXJ A;  3B7T A;  5FQ6 A;  3FUH A;  4N3B A;  3FUL A;  4I17 A;  3L17 A;  3APD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...