4EQFA

Trip8b-1a#206-567 interacting with the carboxy-terminal seven residues of hcn2
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
312
structure length
281
Chain Sequence
GYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEX5-related protein
publication title Structure and stoichiometry of an accessory subunit TRIP8b interaction with hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding/transport protein
total genus 107
structure length 281
sequence length 312
ec nomenclature
pdb deposition date 2012-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4eqfA00
4A1SA 4XIFA 2GW1A 4CGVA 4U0ZA 1HH8A 3GYZA 3E4BA 2XGOA 4N2SA 4UQXA 1HZ4A 4WNGA 2QFCA 2V5FA 3GZ2A 4W9RA 3IEGA 5A7DB 5D0OD 1YA0A 4EQFA 2XCBA 5EX0A 4YNDA 3PDNA 3UQ3A 4J8FA 2JLBA 2MHKA 5HQ8A 2HR2A 2Y4UA 2PQRA 3KD7A 3CVPA 3CEQA 4BTBA 4CDRA 2Q7FA 3WXXA 3TGOA 3ESKA 3FP3A 3CKCA 3MV2B 5G05C 1P5QA 2VYIA 3QWWA 4BWRA 3RO2A 2R5SA 5FZSA 4I2WA 2FF4A 3OXGA 3PE3A 3OXLA 3AS8A 3N71A 3ZHEB 4U07A 5G04C 3ZFWA 3PE4A 1E96B 2AVPA 3LPZA 4KYOB 3QOUA 4JL0A 3ZPJA 3ASDA 4UQZA 3VTXA 3SF4A 4JA9A 5FZRA 3MV3B 3S7BA 4Y6WA 4U0UA 4GA0A 4RG6A 5CHEE 5CCLA 3LY7A 5KJNA 4G23A 2C2LA 1HXIA 4H7YA 3UUXA 3MEKA 2PQNA 4AY5A 1W3BA 4ME2A 3S7DA 4LEUA 5D0QD 3GZ1A 2KCLA 5DIZA 4XI9A 3CV0A 3LKUA 2XEVA 4APOA 1Y8MA 5LCWJ 3RU0A 1ELWA 4G25A 4N3CA 4G1TA 4JA7A 3LY8A 2FO7A 4I9EA 4J0UA 1ZBPA 5G05J 2FEZA 4U04A 1ZU2A 3RO3A 3QWPA 3Q49B 3CK9A 3URZA 3QKYA 1IYGA 2J9QA 4GZ3A 2HO1A 2LSUA 4N2QA 3OXFA 4HOTA 4I2ZA 2YHCA 2UY1B 4HORA 4J8EA 4J8DA 3CK7A 1NA0A 3ZN3A 4GA1A 5G04J 4O6FA 2VGXA 4Y6CA 4G24A 2KCKA 4CGWA 4N3BA 4HOUA 4B94A 3UPVA 3JYSA 3ULQA 3CK8A 5FTPA 3ASHA 4AY6A 3Q47B 2YQ8A 3LCAA 5ARFA 5KJMA 4GYOA 3U3WA 4H7XA 3QDNA 1WAO1 4XI0A 2UWJG 1FCHA 1OUVA 1NA3A 3NF1A 4GCNA 5ARGA 5C1DA 1KT1A 2KC7A 4UI9C 5A6CA 4WNEA 4JHRA 4WUYA 1KT0A 2OOEA 4N39A 2VGXB 4F3VA 3O48A 5KJLA 4BT9A 4HOQA 4YVQC 4HOSA 3ASGA 5BW8C 5FT9A 4WNFA 2IF4A 3FWVA 4G2VA 4GZ6A 1KLXA 4WNDA 5FJYA 2XGSA 3RKVA 3AS4A 5JJ6A 3RJVA 2XPIA 5JJTA 4GPKA 2Y4TA 4G26A 3LYAA 3SZ7A 4N5CA 2FI7A 2ONDA 2E2EA 4I17A 5BNWA 3KAEA 3ZHEA 1TJCA 2WQHA 3EDTB 2WPVA 4GYWA 3AS5A 2IFUA 5KJKA 1QZ2A 4GZ5A 3RIBA 4RG9A 5CCMA 2VGYA 2VSNA 2VSYA 3HYMB 2NC9A 5JJ7A 2FBNA 2I6HA 5LCWC 3S7FA 3CVQA 5DBKA 2VQ2A 2KATA 1IHGA 2L6JA 3TAXA 3QWVA 3Q5MA 3S7JA 4IN3B 3GW4A 1B89A 2XGMA 4UI9K 4BTAA 4I9CA 4AM9A 2PZIA 4BT8A 4UQYA 3ZGQA 2P58C 4KBQA 5BT1A 3KS2A 3TG4A 3R9AB 3MKRA 2DBAA 1WM5A 1NZNA 3BEEA 3K9IA 3MA5A 4UI9J 4ABNA 5AYWD 3CVLA 5FZQA 4YVOA 2BUGA 1XNFA 5M72A 1QQEA 3CVNA 2LNIA 4AIFA 4GYYA 5HI7A 2C0LA 3VTYA 4U0SA 3Q15A 5EX3A 3CKBA 3TG5A 3LY9A 2XCCA 4KXKB 1ELRA 4I1AA 1A17A 2C0MA 1PC2A 4N3AA 3Q4AB 4NQ0A 4NRHB 2UY1A 2LSVA 3ASFA 2KCVA 2HYZA 4GCOA 3U4TA 3FFLA 4GA2A 5EKQD 2PL2A
chains in the Genus database with same CATH superfamily
3UM1A 3PZDA 4CGVA 2XGOA 4UQXA 4UWGA 3FUKA 1SZ9A 4W9RA 3NBNB 3JQ0A 2DCPA 4EQFA 2AW6A 2XCBA 4YNDA 1SW6A 3J5PA 3Q78A 5HQ8A 3CHRA 4LRZA 1E8WA 4N5QA 4PS8A 3AU5A 3RK6A 2LAHA 3CEQA 3G2TA 3HXDA 1FVFA 1TN7A 4DX7D 3ESKA 3FP3A 5ENSD 1MX4A 3CKCA 1E7UA 3MV2B 3E37A 3HDXA 4HLEA 3EU9A 3ZU7B 3ML8A 3ULEG 3LS8A 5FZSA 3CHPA 5ENRD 2FF4A 3OXLA 3EHMA 4AP2A 4U07A 1YMPA 5G04C 2WQ6A 5CBOA 3TJPA 1TEZA 2HE0A 3QOUA 4JL0A 2MYOA 3JUIA 3VTXA 4IULA 4JA9A 5FZRA 3MV3B 4L23A 2IOLA 5CHEE 1TNBA 4KZCA 3Q9NC 3FH7A 1X81A 3G2UA 2GGFA 3PZ3A 4AV7A 3V2XA 4K5AB 1H2UA 4H7YA 4I6JA 3UUXA 2XENA 3SY2A 3RRNB 4ME2A 2RG8A 3ZYQA 4BX9A 4U63A 5ENQD 5J08A 2QY7A 2XHEA 5LP0A 3GZ1A 2PM7A 3ONKA 3LKUA 3RRMB 4APOA 3DWLG 5LCWJ 3RU0A 2ETBA 4G25A 3Q79A 4GTSA 3JXJA 1RW2A 4JA7A 4BX8A 3PEUB 4I9EA 3UM3A 2FEZA 5G05J 4U04A 4A3TA 4LG6A 3RO3A 1X5BA 3RSEG 2WXMA 1V54E 2J9QA 2YINA 4BFRA 4GZ3A 3B7TA 4ANXA 4N2QA 4KVMA 3QNKA 4M3OA 3ZIMA 3MCXA 1UOHA 4GA1A 4CDNA 3CHMA 4A1GA 1OWLA 3TWSA 4G24A 1Z3YA 2NSZA 3B7RL 4OYSA 4FJYA 4EZJA 4B94A 4HS2A 4L1BA 3AG3E 3LJNA 3UT8A 3SFYA 4AY6A 4HRNA 5EIDA 2DZNA 4DJAA 3LCAA 1H6OA 3ZEFA 3HG0D 3U3WA 3ZKJA 1FCHA 3PZ2A 3TWQA 4U8VD 4DRXE 4XE0A 2BF0X 4UWHA 4DI3A 3VLDA 4CYMD 4TUMA 3D9PA 2WXHA 4JZYA 1NA3A 3LEWA 2LAIA 2EIKE 3L17A 1KT1A 1H2TC 3D9IA 3FHEA 5HKPA 3C3QA 1DCQA 2LXLA 5CRVA 4GMRA 1NL4A 4O60A 4HOQA 1V55E 4YVQC 3FTWA 5BW8C 4HBDA 1G3NB 4WNFA 2GRRB 3R9MA 4G8LA 2AXZA 2AXUA 2VSXE 1TNOA 1Z5SC 4OVVA 3EHQA 3RJVA 2XPIA 3FTXA 5JJTA 4GTRA 4AVXA 2HM8A 3DPDA 3FUIA 1JWGA 3JUEA 4RSYA 2V0PA 4G11A 4RG9A 5CCMA 2V5QC 3PH0C 1MZCA 1SQMA 1IQUA 2VGYA 3FTUA 5JJ7A 2WXQA 1QYMA 2NYJA 3IKOB 2FBNA 5LCWC 3EIQC 2R17C 3FH8A 3Q75A 5G2NA 5JMND 3FH5A 4U8HA 1INZA 3KSLA 2ZXWE 5B1AE 4BERA 5E76A 1IHGA 3ZNGA 1A5EA 4XZ4A 4FLBA 3QWVA 4XKCA 1K1BA 2XRZA 4I9CA 4AM9A 3AJIA 2PZIA 4BT8A 4GZDA 4UQYA 3NZUA 4UWFA 2P58C 3ZGQA 4C0EA 4KBQA 1WDYA 3U9WA 3MKRA 2DBAA 3NZSA 5EILA 2RKKA 5AYWD 1L5JA 3MKQA 4CRWA 3CVLA 2KBXA 3R7RA 4YVOA 2BUGA 5M72A 2X6IA 1QQEA 3CVNA 4O1OA 4U8YD 2GRPB 3P1UA 1K3ZD 4KZ0A 4ILIA 4U0SA 4I1MA 5EX3A 5ANLA 3U66A 3LY9A 4LCTA 5JA4D 1A17A 1PC2A 3EU5A 3MX3A 2HYZA 5CBNA 2IY0C 2VGEA 2ZGGA 4JC8A 4C48B 3S2AA 4OVUA 5CMWA 4K0RA 3FULA 3CHQA 4JD2G 3GYZA 4N2SA 2X6KA 1N4RA 3HXCA 5B3SE 3ASNE 5AQ9A 4LUNU 4TV3A 3D9HA 3MKQB 3DSTA 5FINA 5D0OD 3ZYKA 5AIJA 1YA0A 2WXLA 3DSXA 3F6QA 3SBSA 4WWOA 2F8XK 5AJDA 3UQ3A 3CLJA 4L7TA 5LOZA 5EDSA 4A55A 2LUHA 4DX2A 1DC2A 2YNQA 1GW6A 2PQRA 2I9CA 4PUCA 4CDRA 5CECB 3QARA 3WG7E 3WXXA 3D9NA 3CQGB 4J7WA 4D10C 1P5QA 2JEKA 3D9MA 4BWRA 4DPRA 4F1SA 5AQAA 4KMOA 4ILGA 3TXMA 5IY5E 4I2WA 3OXGA 3PE3A 1WG0A 3AS8A 4FA6A 3ZHEB 3HXBA 1KPSB 1MHQA 2L0IA 3QB2A 2AVPA 2ZGDA 5C2YA 3CVVA 1SA4A 1QNFA 2B0OE 2A5EA 4MRUA 4UQZA 3SF4A 4UUCA 3PNTB 4GA0A 1N0QA 3L16A 1IQRA 4HXIA 1K8KG 5CCLA 4B89A 5KJNA 3APFA 2V4HC 2XS1A 3UM0A 3ABKE 1BI7B 5FQ4A 3PUKA 3UXGA 4AY5A 4V3IA 4JB8P 2ZIRA 2MOWA 3ASOE 4B93B 2V8SE 2XRYA 2KCLA 3UI2A 5CEAA 3KEAA 3LDZA 2KZTA 1Q2ZA 4URKA 4YDWA 2Y69E 4G1TA 2J4BA 1HF8A 3B13A 1BI8B 4J0UA 4P29A 1N94A 3PRZA 3FUNA 2VTBA 2FO1E 3FUJA 4DX1A 1LF8A 4HOTA 4I2ZA 4Q94A 3Q9UC 3DSUA 1BLXB 1NA0A 3TWRA 2P9NG 3ZN3A 4ATZD 4OAUC 2WMOA 1FPPA 2GRLA 4Y6CA 4FC8A 2P9UG 3ZYMA 2QYJA 2NXPA 1D8EA 4ACLA 4GTVA 3JYSA 2V4LA 1OXJA 5CRUA 1N52A 3ASHA 2KM4A 3FUDA 2KZTB 4GAAA 4RQIA 5KJMA 4GB9A 3ZYLA 4AEZC 4GYOA 4CCAA 2IOSA 4H7XA 1WAO1 4XI0A 2UWJG 2EIJE 3IHVA 4AJWA 5BV1A 3L82A 3KEZA 3DSSA 1JCQA 2R02A 5ARGA 4A3VA 4UI9C 4JHRA 2OOEA 1IXVA 4J8SA 2EINE 2DZOA 5KJLA 4BT9A 3B7SA 4HOSA 4XKBA 2CHWA 2IF4A 2J07A 4R7LA 2ZISA 3LVRE 4GPKA 5KNGA 5KBAA 3W9FA 1E7VA 2BKKB 4G26A 2XZDG 2OVBA 2DIWA 4HI9A 1AWCB 4N5CA 1TJFA 2FI7A 2PM6A 2E2EA 1K1AA 3TL5A 1WY6A 3KAEA 4LSZE 5JHAA 1HU3A 1Z3XA 3E34A 1MQSA 5EIBE 3EDTB 5AN8A 3AU4A 3VLEA 4NURA 3OTNA 4GYWA 3AS5A 1E8ZA 3B7UX 1TNUA 3UTMA 3L9TA 1OWOA 3RIBA 4GZCA 2AJAA 1PY1A 3PS6A 5CMYA 3HYMB 3FTVA 1EF1C 5JHBA 2I6HA 2WB2A 3JCKC 1MYOA 1UJKA 5B1BE 2L6JA 2WXIA 3EJNA 4PS7A 2J08A 2H6IA 3Q5MA 1MX2A 4IN3B 5EYPF 3GW4A 1B89A 2XGMA 4UI9K 1QBQA 2ZU6B 4FHKA 4B8AA 3HIZA 1N4SA 4PS3A 4YDEA 3C72A 4UWKA 3R9AB 1D9SA 3NB2A 4MLPA 1BU9A 3AG2E 4HNAD 1TNZA 3EHNA 3K9IA 1N0RA 2Y3AA 3G2VA 3ZRHA 2L0TB 3SGHA 2LNIA 4OAVB 2GROB 5HI7A 2C0LA 1OCOE 1O1RA 1H0AA 5LFAA 3RAUA 1LD7A 3X2QE 1U3CA 4N3AA 3TWTA 4NQ0A 2UY1A 4TXPA 4GCOA 2PNNA 2R05A 3FFLA 2PL2A 3T8KA 2ETCA 2X6FA 4XIFA 3ENEA 3UT7A 2GW1A 1HH8A 3PREA 3LJ3A 1HZ4A 3EHRA 4I43A 4WNGA 2H6FA 4ANWA 4DK5A 3D9JA 1AP7A 3Q73A 3GZ2A 3FUEA 4EECA 3U64A 4JVSA 1UN9A 1HG2A 1TN6A 5EX0A 3PDNA 2F37A 2JLBA 3T5XA 2MHKA 3O4ZA 2EILE 4GTPA 3DPYA 2HR2A 2Y4UA 3SHFA 1JUQA 3KD7A 2QC9A 2EIME 1TR4A 3CVPA 2XZTG 3HXFA 3JQ1A 4MBGA 3I5PA 2Q7FA 3TGOA 3BG1B 1HE8A 5G05C 2VYIA 3QWWA 2I1KA 3L6AA 3FUHA 1UJJA 2CG2A 4JPSA 2R5SA 5ITZF 4TRQA 2R2LA 3IXEA 1E8YA 1E8XA 2P9PG 1H6PA 1BPOA 4FP7A 4AOFA 3FY4A 5ENPD 3ZFWA 4ANVA 3PE4A 1E96B 1UN8A 3C3RA 3LPZA 4KYOB 1N4PA 3ONLA 2BTDA 3ZPJA 4WWNA 5AAOA 1N95A 1OWPA 3S7BA 4Y6WA 4U0UA 4C9BB 4Q96A 5G55A 4LNGA 5BXUA 5FWQA 5T4YA 2GRMA 3FDHA 1LTXA 3L08A 3FU5A 2C2LA 1VDYA 2P2CP 1KZOA 4LERA 2Y0BG 4F53A 5ENNA 1W3BA 3FTYA 1EYHA 3S7DA 1BD8A 4LEUA 4HFGA 3PUJA 5D0QD 2J09A 1TNYA 5H7PA 4ATGA 2MRIA 4XI9A 4DLOA 1O1SA 3KSQA 2KXPC 4IRUA 3QK0A 3FEXA 2OCCE 4K5BA 3FUMA 3CVYA 2J49A 3FEYA 4FU3A 5EYLA 3R7QA 2XPYA 3LY8A 2RFAA 2FO7A 5KWDA 2E0IA 2WMNA 4DLQA 1ZU2A 3QWPA 3ULYA 3Q49B 3CK9A 4RVBA 4YDOA 3G2WA 3QKYA 3G2SA 4NIKA 3T5VA 1IYGA 4AXHA 2XQ0A 3CR3A 3HHMA 2HO1A 5BUZA 1DCEA 1ZB1A 2YHCA 4HORA 3E32A 2IO3C 3CK7A 3T8MA 1LD8A 3UKRG 2X38A 5G04J 2VGXA 2IJGX 4WAFA 3DSVA 4CGWA 4HRMB 3QAQA 4HOUA 1S64A 3UMVA 2M63A 3P2BA 3CK8A 5FTPA 3ZW3A 3Q47B 5AENA 1OWMA 2BKGA 3SBTB 5KCMA 4B0ZA 4JHKA 4B8CB 4JW1A 2DYRE 4EBAG 5E75A 2R03A 1OUVA 3LVQE 2IO2C 2OV8A 1NI1A 2X6JA 3DXMG 5ANRA 3SO8A 1TN8A 4DUIA 5T3RA 1TYQG 2FULA 3NF1A 3SQVA 4EHMA 5C1DA 2GRQB 3ESLA 4WNEA 3V31A 2WXOA 4GMJA 3QC1A 4N39A 2VGXB 4UWLA 2P9IG 3MGBA 3ASGA 3BG0B 4ACKA 3L13A 1FT1A 4GZ6A 1NFIE 3FTSA 1O1TA 1KLXA 3I3NA 5FJYA 2XGSA 4A63B 3UIPC 2Y4TA 3LYAA 4M7CA 2J8SD 1YYHA 4I17A 5BNWA 3AG1E 1OY3D 3DBSA 3ABLE 3CVWA 4YDYA 2OEVA 5KJKA 1QZ2A 2DVWA 4O1PA 1U3DA 2H6GA 2F8YA 3Q7FA 4GZ5A 3APCA 4JHJA 2Y1LE 5FQ8A 2NC9A 2P9SG 1H6KA 3NQPA 1O5MA 3CVQA 3ML9A 5T8IA 3CIAA 4MKTA 2A5UA 3AAAC 2VJ8A 3TWUA 1DVPA 3ISMC 2XEEA 1YCSB 3S7JA 4RLYA 3IBEA 4GPMA 3FTZA 1MJ0A 4JEHA 3V2OA 5BT1A 2CHXA 4DX5D 3DEPA 5BPPA 1WM5A 2WVIA 3RRUA 3AG4E 2VTBB 3MA5A 4ABNA 2I2OA 3BUAA 4BSXA 5FZQA 2QZAA 1XNFA 4L9PA 5A23A 4F6RD 2A4ZA 4QFVA 3VTYA 4KVOA 5AQBA 2XCCA 4KXKB 4I6GA 2C0MA 3Q4AB 4BESA 4NRHB 2LSVA 2WXNA 3ASFA 2KCVA 3CVXA 2LXMA 1OCCE 3C3OA 4GA2A 4NACA 5EKQD 3NOGD 2J4DA 1HFAA 2QYUA 4A1SA 4U0ZA 3V79K 3E4BA 2OEWA 2P9KG 3QJZA 2QFCA 2V5FA 4G8KA 2P9LG 4TXRA 3TWWA 5CERB 3IEGA 4FHJA 5A7DB 4CT0A 4BY6A 4I6EA 4FADA 3SNXA 1OWNA 4J8FA 4L2LA 2OVFA 5AARA 1OCRE 1N54A 3ZUVB 2B6CA 5LX8A 2WXFA 2AXVA 3CQCB 4PH4B 4BTBA 4XX5A 2ILRA 4IYPA 4HRLA 4EZKA 2ETAA 3DSWA 3IV0A 4APFA 3L54A 4CT4A 3RO2A 1ELKA 4EZLA 3I4RB 3N71A 1UG3A 2R59A 3BQOA 1NP7A 3BU8A 3V30A 4PDXA 4F1PA 3SFZA 3EUVA 1U2VG 3DEOA 1JCSA 3ASDA 3OAWA 4U95D 5D66A 4KT6B 4CEMA 2CG3A 5KNHD 3EIJA 4RG6A 4Q69A 3D3MA 3LY7A 4J8YA 1Z6TA 2L6BA 4BSZB 2GRNB 4G23A 1D8DA 3UT4A 3PEVB 3CGHA 1HXIA 4BEPA 3MEKA 2PQNA 3CSFA 1PAQA 4GTMA 3FU3A 4CZ2D 1HO8A 5DIZA 5J90A 3CV0A 3D9KA 2XEVA 1Y8MA 3DRAA 3B95A 4QQIA 1ELWA 2EQXA 5FQ6A 5FIOA 1UW4B 5ENTD 4N3CA 3ZXSA 4GTTA 3HXEA 1ZBPA 4HVBA 4TXQA 3URZA 3SI5A 3W9GA 3CSTA 3TWVA 2LSUA 5BXOA 1S70B 3OXFA 4E85A 4BETA 2AWIA 2UY1B 4K03A 4J8EA 4J8DA 3C5RA 3ZVVA 4DX6D 3MZLB 2BEDA 4ZFHA 3LXUX 1JCRA 4O6FA 3PZ4A 2KCKA 4N3BA 1S0PA 3UPVA 3ULQA 5BV0A 3J5QB 2LO6A 4GU5A 1IKND 2YQ8A 5ARFA 2XPZA 3SFXA 3NOCD 5AJLA 3D9OA 3QDNA 2I1JA 1JPLA 2IONA 3MJWA 5ENOD 2X3MA 3SD5A 3PZ1A 1HG5A 3TXNA 2WM9A 4L2YA 4DI4A 4GCNA 2KC7A 5A6CA 2WXJA 2IQCA 4WWPA 2WXRA 1HX8A 4WUYA 1KT0A 2X6HA 3FUFA 4ILHB 4F3VA 2VSOE 3O48A 5HRYA 3D9LA 1SA5A 4HB5A 1SVXA 3VLFA 5FT9A 5D2MC 2IU1A 4ANUA 3FWVA 3APDA 4G2VA 1IHBA 3L22A 1OCZE 4WNDA 1H2VC 3RKVA 3AS4A 5JJ6A 3E30A 1KZPA 2CFUA 3MYVA 3CVUA 5EN5D 3SZ7A 4JXTA 4I1OB 4CDMA 3HVEA 3HRAA 2WQ7A 2WXPA 2ONDA 1N9AA 1H19A 2JABA 1DNPA 3ZHEA 1TJCA 2WQHA 3E33A 4FJZA 5FQ7A 1E90A 2WPVA 4X8QA 2WXKA 3Q7AA 1JWFA 2IFUA 1EPUA 4EPZA 1Y6IA 2VSNA 2VSYA 4GMLA 2F0YA 3GZSA 4Z68A 1N4QA 4K5CA 1MX6A 3S7FA 2XEHA 4XEIG 5DBKA 3UKUG 2VQ2A 3PVLA 3B7BA 2KATA 2YHEA 4GTQA 4MS6A 2IEJA 3T9KA 2DWZA 4U7EB 4ZHBA 4EBAA 1EDUA 1RZ4A 1FT2A 1FVHA 3FU6A 3NAWA 3UX4A 3TAXA 4HI8A 4JEUA 1SZAA 4LNBA 3ABME 3CHOA 4BTAA 1OT8A 4HQDA 3HVEB 4C0MA 1N11A 2CHZA 3DXKG 3KS2A 5CEDB 3FU0A 1HS6A 3TG4A 2H6HA 4F7AA 1NZNA 3BEEA 4LNUD 2XS8A 2L9BA 4UI9J 3UIOC 4E6HA 1S63A 2RD0A 3ZXPA 4J6IA 2DYSE 5HS0A 4AIFA 5AQ7A 3CHSA 3JXIA 3PNLB 3C98A 4GYYA 3UINC 4GTOA 4HLLA 3Q15A 4FULA 3CKBA 3TWXA 3IHYA 3TG5A 1XGWA 1ELRA 4I1AA 4TUUA 3UM2A 4U96D 2WXGA 2CFZA 3I4GA 3U4TA 2RFMA 4FLHA
chains in the Genus database with same CATH topology
4A1SA 4K0RA 2X6FA 4XIFA 3PZDA 3ENEA 3FULA 2GW1A 3UT7A 4CGVA 4U0ZA 1HH8A 3CHQA 3GYZA 3E4BA 2XGOA 4N2SA 2X6KA 3LJ3A 3PREA 4UQXA 1HZ4A 4UWGA 3QJZA 4I43A 4WNGA 2QFCA 2V5FA 4ANWA 4DK5A 3D9JA 3FUKA 3GZ2A 4LUNU 4TV3A 1SZ9A 4W9RA 3FUEA 3MKQB 3JQ0A 3IEGA 4FHJA 5A7DB 5D0OD 3ZYKA 4EECA 5AIJA 1YA0A 2WXLA 4CT0A 4BY6A 3SBSA 2DCPA 4WWOA 3U64A 4EQFA 2AW6A 4JVSA 1UN9A 1HG2A 2XCBA 5AJDA 5EX0A 4I6EA 4FADA 4YNDA 3SNXA 3PDNA 1OWNA 3UQ3A 3CLJA 4J8FA 2JLBA 4L2LA 3T5XA 2OVFA 2MHKA 3O4ZA 4L7TA 5LOZA 5EDSA 4A55A 5HQ8A 2HR2A 2Y4UA 2YNQA 1GW6A 3CHRA 1N54A 2PQRA 3SHFA 1JUQA 3KD7A 4LRZA 1E8WA 2AXVA 2WXFA 4PS8A 5LX8A 3AU5A 3RK6A 3CQCB 4PH4B 3CVPA 2LAHA 3CEQA 3G2TA 2I9CA 4BTBA 4PUCA 3JQ1A 1FVFA 4XX5A 2ILRA 4CDRA 3QARA 4IYPA 3I5PA 2Q7FA 3WXXA 3TGOA 3D9NA 3BG1B 3ESKA 3CQGB 3FP3A 4EZKA 3CKCA 4D10C 1E7UA 1HE8A 1P5QA 3IV0A 3MV2B 5G05C 2JEKA 4APFA 3L54A 2VYIA 3QWWA 3D9MA 2I1KA 3HDXA 3FUHA 3L6AA 4BWRA 1UJJA 4CT4A 4HLEA 3RO2A 4DPRA 4F1SA 2CG2A 1ELKA 4JPSA 2R5SA 3ML8A 3LS8A 4KMOA 4ILGA 3CHPA 4TRQA 5FZSA 3TXMA 4I2WA 2FF4A 1E8YA 1E8XA 3OXGA 3PE3A 3OXLA 4EZLA 3EHMA 1BPOA 3AS8A 4FP7A 3I4RB 4AOFA 3FY4A 4FA6A 3N71A 3ZHEB 1UG3A 2R59A 4AP2A 1NP7A 4U07A 1MHQA 2L0IA 5G04C 3QB2A 3ZFWA 4PDXA 4ANVA 2WQ6A 3TJPA 3SFZA 3PE4A 1E96B 1UN8A 1TEZA 2AVPA 3LPZA 4KYOB 3ONLA 5C2YA 3CVVA 3QOUA 4JL0A 2BTDA 1QNFA 3ZPJA 3JUIA 4WWNA 1OWPA 4MRUA 3ASDA 4UQZA 3VTXA 3SF4A 4IULA 3OAWA 4JA9A 4KT6B 4CEMA 2CG3A 5FZRA 3MV3B 3S7BA 3EIJA 3PNTB 4U0UA 4GA0A 4Y6WA 4C9BB 3L16A 1IQRA 4RG6A 4Q96A 4HXIA 4Q69A 3D3MA 4L23A 5G55A 2IOLA 5CHEE 5CCLA 3LY7A 4KZCA 1Z6TA 4B89A 5FWQA 5T4YA 3FH7A 2GRMA 5KJNA 3FDHA 3L08A 3FU5A 4G23A 3APFA 2C2LA 3G2UA 2GGFA 1VDYA 3UT4A 4AV7A 3PEVB 3CGHA 5FQ4A 3PUKA 1HXIA 1H2UA 4H7YA 4I6JA 3UUXA 3MEKA 4LERA 2PQNA 4AY5A 4F53A 5ENNA 1W3BA 3CSFA 3FTYA 4ME2A 1PAQA 4V3IA 3RRNB 1EYHA 2RG8A 3S7DA 3ZYQA 4BX9A 4U63A 4LEUA 5J08A 2QY7A 3FU3A 4HFGA 3PUJA 2XHEA 5D0QD 2MOWA 2J09A 5LP0A 2V8SE 2XRYA 3GZ1A 2KCLA 4ATGA 2MRIA 1HO8A 5DIZA 4XI9A 5J90A 3CV0A 2PM7A 3ONKA 3D9KA 3LKUA 4DLOA 2XEVA 3RRMB 4APOA 4EPZA 1Y8MA 3LDZA 5LCWJ 4IRUA 3QK0A 3RU0A 3FEXA 1ELWA 2EQXA 2KZTA 3FUMA 4G25A 5FQ6A 3CVYA 2J49A 1UW4B 3FEYA 4URKA 4N3CA 4G1TA 2J4BA 4FU3A 4JA7A 3ZXSA 1HF8A 3R7QA 4BX8A 2XPYA 3LY8A 2FO7A 3B13A 3PEUB 2E0IA 4I9EA 4J0UA 2WMNA 1ZBPA 4DLQA 2FEZA 4P29A 4U04A 1ZU2A 3PRZA 5G05J 4A3TA 3RO3A 3QWPA 4HVBA 3Q49B 3CK9A 4RVBA 1X5BA 3G2WA 3URZA 3QKYA 3FUNA 3SI5A 2WXMA 3CSTA 3G2SA 2VTBA 3T5VA 2J9QA 2YINA 2XQ0A 3CR3A 4AXHA 3HHMA 4BFRA 1IYGA 4GZ3A 2HO1A 2LSUA 3FUJA 3B7TA 4ANXA 1LF8A 5BUZA 3OXFA 4N2QA 4E85A 4KVMA 3QNKA 4HOTA 4I2ZA 4Q94A 2YHCA 2AWIA 2UY1B 4M3OA 4K03A 4HORA 4J8EA 4J8DA 3CK7A 3ZVVA 3ZIMA 1NA0A 3T8MA 3MCXA 3ZN3A 2WMOA 3MZLB 4GA1A 4CDNA 3LXUX 3CHMA 4A1GA 2X38A 1OWLA 2GRLA 5G04J 4O6FA 2VGXA 4FC8A 4Y6CA 2IJGX 4G24A 3ZYMA 4WAFA 1Z3YA 2NSZA 2KCKA 3B7RL 2NXPA 4N3BA 4OYSA 4FJYA 4CGWA 4EZJA 3QAQA 4HOUA 4ACLA 1S0PA 4B94A 3UPVA 3JYSA 3UMVA 2M63A 4HS2A 2V4LA 4L1BA 3P2BA 3UT8A 3ULQA 5BV0A 1N52A 3CK8A 5FTPA 2LO6A 3ASHA 3ZW3A 4AY6A 4GU5A 2KM4A 3Q47B 5AENA 2YQ8A 3FUDA 2KZTB 4GAAA 4DJAA 3LCAA 1OWMA 5ARFA 3SBTB 3ZEFA 5KJMA 2XPZA 5KCMA 4GB9A 5AJLA 3ZYLA 4B0ZA 4JHKA 4AEZC 4B8CB 4JW1A 4GYOA 3D9OA 3U3WA 4CCAA 2IOSA 4EBAG 4H7XA 5E75A 3QDNA 2I1JA 1JPLA 1WAO1 2UWJG 4XI0A 1OUVA 1FCHA 3IHVA 3LVQE 2IONA 4AJWA 5BV1A 4XE0A 2BF0X 3MJWA 2X3MA 4UWHA 4DI3A 3KEZA 3VLDA 3SD5A 2OV8A 2X6JA 5ANRA 1HG5A 3D9PA 2WXHA 5T3RA 3TXNA 2WM9A 4L2YA 4JZYA 1NA3A 3LEWA 4DI4A 2LAIA 2FULA 3NF1A 4GCNA 5ARGA 4A3VA 5C1DA 3L17A 1KT1A 3ESLA 1H2TC 2KC7A 3D9IA 3FHEA 4UI9C 2WXJA 4WNEA 5A6CA 4JHRA 2IQCA 2WXOA 4WWPA 2WXRA 1HX8A 4WUYA 1KT0A 3QC1A 4GMJA 2OOEA 4N39A 2X6HA 3FUFA 2VGXB 4J8SA 4UWLA 4ILHB 4F3VA 2VSOE 3O48A 5KJLA 4BT9A 4HOQA 3D9LA 4YVQC 3B7SA 4HOSA 3FTWA 3ASGA 3MGBA 3VLFA 5BW8C 4XKBA 2CHWA 5FT9A 3BG0B 4ACKA 4WNFA 3L13A 2IU1A 2IF4A 4ANUA 2J07A 3FWVA 3APDA 4G2VA 4GZ6A 2AXZA 2AXUA 2VSXE 3FTSA 3L22A 1KLXA 3I3NA 4R7LA 4WNDA 4OVVA 5FJYA 2XGSA 1H2VC 3RKVA 3AS4A 3RIBA 5JJ6A 3RJVA 2XPIA 3FTXA 5JJTA 3LVRE 4GPKA 2CFUA 2Y4TA 1E7VA 3MYVA 4G26A 3LYAA 3CVUA 3SZ7A 4JXTA 4I1OB 4AVXA 2OVBA 4CDMA 2DIWA 3HVEA 4N5CA 1TJFA 2WQ7A 2FI7A 2WXPA 2ONDA 2PM6A 2E2EA 2HM8A 1H19A 3DPDA 4I17A 3FUIA 3TL5A 5BNWA 1DNPA 1WY6A 3KAEA 3ZHEA 1JWGA 1TJCA 5JHAA 1HU3A 1Z3XA 2WQHA 1MQSA 3DBSA 3EDTB 4RSYA 4FJZA 5FQ7A 3AU4A 1E90A 2WPVA 3VLEA 3CVWA 4NURA 2WXKA 3OTNA 4GYWA 3AS5A 1JWFA 2IFUA 1E8ZA 5KJKA 1QZ2A 3B7UX 1U3DA 2V0PA 4G11A 1OWOA 1EPUA 3APCA 4GZ5A 1PY1A 4GZCA 1Y6IA 4JHJA 3PH0C 3PS6A 1SQMA 1IQUA 4RG9A 5CMYA 2VGYA 5CCMA 2VSNA 2VSYA 3FTUA 2NC9A 3FTVA 3HYMB 4GMLA 2WXQA 5FQ8A 5JJ7A 3GZSA 1EF1C 3IKOB 2FBNA 1H6KA 5JHBA 2I6HA 5LCWC 3EIQC 2R17C 3FH8A 3NQPA 5G2NA 3S7FA 3FH5A 3CVQA 3JCKC 4U8HA 5DBKA 5CMWA 2WB2A 1INZA 2VQ2A 3PVLA 3ML9A 5T8IA 3CIAA 4MKTA 2KATA 2YHEA 4MS6A 5E76A 1IHGA 1UJKA 2A5UA 2VJ8A 2L6JA 2WXIA 3EJNA 4EBAA 4XZ4A 1DVPA 1EDUA 4PS7A 4FLBA 3FU6A 1FVHA 2J08A 3UX4A 3TAXA 3QWVA 4XKCA 4JEUA 3Q5MA 3S7JA 4IN3B 3IBEA 3GW4A 1SZAA 3FTZA 2XRZA 1B89A 2XGMA 3CHOA 4UI9K 4JEHA 4BTAA 4I9CA 4AM9A 2PZIA 2ZU6B 4BT8A 4FHKA 4B8AA 3HVEB 3HIZA 4GZDA 4UQYA 4C0MA 3NZUA 4UWFA 2P58C 3ZGQA 2CHZA 4C0EA 4KBQA 5BT1A 2CHXA 4PS3A 3U9WA 3KS2A 3FU0A 1HS6A 4UWKA 3TG4A 3R9AB 3MKRA 2DBAA 4MLPA 5BPPA 4F7AA 1WM5A 1NZNA 2WVIA 3RRUA 3BEEA 3NZSA 2VTBB 2L9BA 3EHNA 3K9IA 3MA5A 4UI9J 4ABNA 4E6HA 2I2OA 5AYWD 1L5JA 3MKQA 4BSXA 3CVLA 4CRWA 2Y3AA 5FZQA 3G2VA 2RD0A 3R7RA 4YVOA 3ZRHA 2BUGA 1XNFA 2L0TB 2X6IA 1QQEA 4J6IA 5M72A 3SGHA 3CVNA 2LNIA 5A23A 4AIFA 3CHSA 3PNLB 3C98A 4GYYA 2A4ZA 5HI7A 3P1UA 4QFVA 4KZ0A 4ILIA 2C0LA 3VTYA 4KVOA 4U0SA 3Q15A 4I1MA 5EX3A 4FULA 1H0AA 3CKBA 3IHYA 5LFAA 3TG5A 5ANLA 3U66A 3LY9A 2XCCA 4LCTA 1XGWA 4KXKB 1ELRA 1U3CA 1A17A 2C0MA 4I1AA 4I6GA 1PC2A 4TUUA 4N3AA 3Q4AB 4NQ0A 4NRHB 2UY1A 2LSVA 2WXNA 3ASFA 3MX3A 2KCVA 2HYZA 2WXGA 2CFZA 4GCOA 3CVXA 3I4GA 3U4TA 4JC8A 3FFLA 4GA2A 4NACA 5EKQD 3S2AA 2J4DA 2PL2A 4FLHA 1HFAA 4OVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1S A;  4XIF A;  2GW1 A;  4CGV A;  4U0Z A;  1HH8 A;  3GYZ A;  3E4B A;  2XGO A;  4N2S A;  4UQX A;  1HZ4 A;  4WNG A;  2QFC A;  2V5F A;  3GZ2 A;  4W9R A;  3IEG A;  5A7D B;  5D0O D;  1YA0 A;  4EQF A;  2XCB A;  5EX0 A;  4YND A;  3PDN A;  3UQ3 A;  4J8F A;  2JLB A;  2MHK A;  5HQ8 A;  2HR2 A;  2Y4U A;  2PQR A;  3KD7 A;  3CVP A;  3CEQ A;  4BTB A;  4CDR A;  2Q7F A;  3WXX A;  3TGO A;  3ESK A;  3FP3 A;  3CKC A;  3MV2 B;  5G05 C;  1P5Q A;  2VYI A;  3QWW A;  4BWR A;  3RO2 A;  2R5S A;  5FZS A;  4I2W A;  2FF4 A;  3OXG A;  3PE3 A;  3OXL A;  3AS8 A;  3N71 A;  3ZHE B;  4U07 A;  5G04 C;  3ZFW A;  3PE4 A;  1E96 B;  2AVP A;  3LPZ A;  4KYO B;  3QOU A;  4JL0 A;  3ZPJ A;  3ASD A;  4UQZ A;  3VTX A;  3SF4 A;  4JA9 A;  5FZR A;  3MV3 B;  3S7B A;  4Y6W A;  4U0U A;  4GA0 A;  4RG6 A;  5CHE E;  5CCL A;  3LY7 A;  5KJN A;  4G23 A;  2C2L A;  1HXI A;  4H7Y A;  3UUX A;  3MEK A;  2PQN A;  4AY5 A;  1W3B A;  4ME2 A;  3S7D A;  4LEU A;  5D0Q D;  3GZ1 A;  2KCL A;  5DIZ A;  4XI9 A;  3CV0 A;  3LKU A;  2XEV A;  4APO A;  1Y8M A;  5LCW J;  3RU0 A;  1ELW A;  4G25 A;  4N3C A;  4G1T A;  4JA7 A;  3LY8 A;  2FO7 A;  4I9E A;  4J0U A;  1ZBP A;  5G05 J;  2FEZ A;  4U04 A;  1ZU2 A;  3RO3 A;  3QWP A;  3Q49 B;  3CK9 A;  3URZ A;  3QKY A;  1IYG A;  2J9Q A;  4GZ3 A;  2HO1 A;  2LSU A;  4N2Q A;  3OXF A;  4HOT A;  4I2Z A;  2YHC A;  2UY1 B;  4HOR A;  4J8E A;  4J8D A;  3CK7 A;  1NA0 A;  3ZN3 A;  4GA1 A;  5G04 J;  4O6F A;  2VGX A;  4Y6C A;  4G24 A;  2KCK A;  4CGW A;  4N3B A;  4HOU A;  4B94 A;  3UPV A;  3JYS A;  3ULQ A;  3CK8 A;  5FTP A;  3ASH A;  4AY6 A;  3Q47 B;  2YQ8 A;  3LCA A;  5ARF A;  5KJM A;  4GYO A;  3U3W A;  4H7X A;  3QDN A;  1WAO 1;  4XI0 A;  2UWJ G;  1FCH A;  1OUV A;  1NA3 A;  3NF1 A;  4GCN A;  5ARG A;  5C1D A;  1KT1 A;  2KC7 A;  4UI9 C;  5A6C A;  4WNE A;  4JHR A;  4WUY A;  1KT0 A;  2OOE A;  4N39 A;  2VGX B;  4F3V A;  3O48 A;  5KJL A;  4BT9 A;  4HOQ A;  4YVQ C;  4HOS A;  3ASG A;  5BW8 C;  5FT9 A;  4WNF A;  2IF4 A;  3FWV A;  4G2V A;  4GZ6 A;  1KLX A;  4WND A;  5FJY A;  2XGS A;  3RKV A;  3AS4 A;  5JJ6 A;  3RJV A;  2XPI A;  5JJT A;  4GPK A;  2Y4T A;  4G26 A;  3LYA A;  3SZ7 A;  4N5C A;  2FI7 A;  2OND A;  2E2E A;  4I17 A;  5BNW A;  3KAE A;  3ZHE A;  1TJC A;  2WQH A;  3EDT B;  2WPV A;  4GYW A;  3AS5 A;  2IFU A;  5KJK A;  1QZ2 A;  4GZ5 A;  3RIB A;  4RG9 A;  5CCM A;  2VGY A;  2VSN A;  2VSY A;  3HYM B;  2NC9 A;  5JJ7 A;  2FBN A;  2I6H A;  5LCW C;  3S7F A;  3CVQ A;  5DBK A;  2VQ2 A;  2KAT A;  1IHG A;  2L6J A;  3TAX A;  3QWV A;  3Q5M A;  3S7J A;  4IN3 B;  3GW4 A;  1B89 A;  2XGM A;  4UI9 K;  4BTA A;  4I9C A;  4AM9 A;  2PZI A;  4BT8 A;  4UQY A;  3ZGQ A;  2P58 C;  4KBQ A;  5BT1 A;  3KS2 A;  3TG4 A;  3R9A B;  3MKR A;  2DBA A;  1WM5 A;  1NZN A;  3BEE A;  3K9I A;  3MA5 A;  4UI9 J;  4ABN A;  5AYW D;  3CVL A;  5FZQ A;  4YVO A;  2BUG A;  1XNF A;  5M72 A;  1QQE A;  3CVN A;  2LNI A;  4AIF A;  4GYY A;  5HI7 A;  2C0L A;  3VTY A;  4U0S A;  3Q15 A;  5EX3 A;  3CKB A;  3TG5 A;  3LY9 A;  2XCC A;  4KXK B;  1ELR A;  4I1A A;  1A17 A;  2C0M A;  1PC2 A;  4N3A A;  3Q4A B;  4NQ0 A;  4NRH B;  2UY1 A;  2LSV A;  3ASF A;  2KCV A;  2HYZ A;  4GCO A;  3U4T A;  3FFL A;  4GA2 A;  5EKQ D;  2PL2 A; 
#chains in the Genus database with same CATH topology
 3UM1 A;  3PZD A;  4CGV A;  2XGO A;  4UQX A;  4UWG A;  3FUK A;  1SZ9 A;  4W9R A;  3NBN B;  3JQ0 A;  2DCP A;  4EQF A;  2AW6 A;  2XCB A;  4YND A;  1SW6 A;  3J5P A;  3Q78 A;  5HQ8 A;  3CHR A;  4LRZ A;  1E8W A;  4N5Q A;  4PS8 A;  3AU5 A;  3RK6 A;  2LAH A;  3CEQ A;  3G2T A;  3HXD A;  1FVF A;  1TN7 A;  4DX7 D;  3ESK A;  3FP3 A;  5ENS D;  1MX4 A;  3CKC A;  1E7U A;  3MV2 B;  3E37 A;  3HDX A;  4HLE A;  3EU9 A;  3ZU7 B;  3ML8 A;  3ULE G;  3LS8 A;  5FZS A;  3CHP A;  5ENR D;  2FF4 A;  3OXL A;  3EHM A;  4AP2 A;  4U07 A;  1YMP A;  5G04 C;  2WQ6 A;  5CBO A;  3TJP A;  1TEZ A;  2HE0 A;  3QOU A;  4JL0 A;  2MYO A;  3JUI A;  3VTX A;  4IUL A;  4JA9 A;  5FZR A;  3MV3 B;  4L23 A;  2IOL A;  5CHE E;  1TNB A;  4KZC A;  3Q9N C;  3FH7 A;  1X81 A;  3G2U A;  2GGF A;  3PZ3 A;  4AV7 A;  3V2X A;  4K5A B;  1H2U A;  4H7Y A;  4I6J A;  3UUX A;  2XEN A;  3SY2 A;  3RRN B;  4ME2 A;  2RG8 A;  3ZYQ A;  4BX9 A;  4U63 A;  5ENQ D;  5J08 A;  2QY7 A;  2XHE A;  5LP0 A;  3GZ1 A;  2PM7 A;  3ONK A;  3LKU A;  3RRM B;  4APO A;  3DWL G;  5LCW J;  3RU0 A;  2ETB A;  4G25 A;  3Q79 A;  4GTS A;  3JXJ A;  1RW2 A;  4JA7 A;  4BX8 A;  3PEU B;  4I9E A;  3UM3 A;  2FEZ A;  5G05 J;  4U04 A;  4A3T A;  4LG6 A;  3RO3 A;  1X5B A;  3RSE G;  2WXM A;  1V54 E;  2J9Q A;  2YIN A;  4BFR A;  4GZ3 A;  3B7T A;  4ANX A;  4N2Q A;  4KVM A;  3QNK A;  4M3O A;  3ZIM A;  3MCX A;  1UOH A;  4GA1 A;  4CDN A;  3CHM A;  4A1G A;  1OWL A;  3TWS A;  4G24 A;  1Z3Y A;  2NSZ A;  3B7R L;  4OYS A;  4FJY A;  4EZJ A;  4B94 A;  4HS2 A;  4L1B A;  3AG3 E;  3LJN A;  3UT8 A;  3SFY A;  4AY6 A;  4HRN A;  5EID A;  2DZN A;  4DJA A;  3LCA A;  1H6O A;  3ZEF A;  3HG0 D;  3U3W A;  3ZKJ A;  1FCH A;  3PZ2 A;  3TWQ A;  4U8V D;  4DRX E;  4XE0 A;  2BF0 X;  4UWH A;  4DI3 A;  3VLD A;  4CYM D;  4TUM A;  3D9P A;  2WXH A;  4JZY A;  1NA3 A;  3LEW A;  2LAI A;  2EIK E;  3L17 A;  1KT1 A;  1H2T C;  3D9I A;  3FHE A;  5HKP A;  3C3Q A;  1DCQ A;  2LXL A;  5CRV A;  4GMR A;  1NL4 A;  4O60 A;  4HOQ A;  1V55 E;  4YVQ C;  3FTW A;  5BW8 C;  4HBD A;  1G3N B;  4WNF A;  2GRR B;  3R9M A;  4G8L A;  2AXZ A;  2AXU A;  2VSX E;  1TNO A;  1Z5S C;  4OVV A;  3EHQ A;  3RJV A;  2XPI A;  3FTX A;  5JJT A;  4GTR A;  4AVX A;  2HM8 A;  3DPD A;  3FUI A;  1JWG A;  3JUE A;  4RSY A;  2V0P A;  4G11 A;  4RG9 A;  5CCM A;  2V5Q C;  3PH0 C;  1MZC A;  1SQM A;  1IQU A;  2VGY A;  3FTU A;  5JJ7 A;  2WXQ A;  1QYM A;  2NYJ A;  3IKO B;  2FBN A;  5LCW C;  3EIQ C;  2R17 C;  3FH8 A;  3Q75 A;  5G2N A;  5JMN D;  3FH5 A;  4U8H A;  1INZ A;  3KSL A;  2ZXW E;  5B1A E;  4BER A;  5E76 A;  1IHG A;  3ZNG A;  1A5E A;  4XZ4 A;  4FLB A;  3QWV A;  4XKC A;  1K1B A;  2XRZ A;  4I9C A;  4AM9 A;  3AJI A;  2PZI A;  4BT8 A;  4GZD A;  4UQY A;  3NZU A;  4UWF A;  2P58 C;  3ZGQ A;  4C0E A;  4KBQ A;  1WDY A;  3U9W A;  3MKR A;  2DBA A;  3NZS A;  5EIL A;  2RKK A;  5AYW D;  1L5J A;  3MKQ A;  4CRW A;  3CVL A;  2KBX A;  3R7R A;  4YVO A;  2BUG A;  5M72 A;  2X6I A;  1QQE A;  3CVN A;  4O1O A;  4U8Y D;  2GRP B;  3P1U A;  1K3Z D;  4KZ0 A;  4ILI A;  4U0S A;  4I1M A;  5EX3 A;  5ANL A;  3U66 A;  3LY9 A;  4LCT A;  5JA4 D;  1A17 A;  1PC2 A;  3EU5 A;  3MX3 A;  2HYZ A;  5CBN A;  2IY0 C;  2VGE A;  2ZGG A;  4JC8 A;  4C48 B;  3S2A A;  4OVU A;  5CMW A;  4K0R A;  3FUL A;  3CHQ A;  4JD2 G;  3GYZ A;  4N2S A;  2X6K A;  1N4R A;  3HXC A;  5B3S E;  3ASN E;  5AQ9 A;  4LUN U;  4TV3 A;  3D9H A;  3MKQ B;  3DST A;  5FIN A;  5D0O D;  3ZYK A;  5AIJ A;  1YA0 A;  2WXL A;  3DSX A;  3F6Q A;  3SBS A;  4WWO A;  2F8X K;  5AJD A;  3UQ3 A;  3CLJ A;  4L7T A;  5LOZ A;  5EDS A;  4A55 A;  2LUH A;  4DX2 A;  1DC2 A;  2YNQ A;  1GW6 A;  2PQR A;  2I9C A;  4PUC A;  4CDR A;  5CEC B;  3QAR A;  3WG7 E;  3WXX A;  3D9N A;  3CQG B;  4J7W A;  4D10 C;  1P5Q A;  2JEK A;  3D9M A;  4BWR A;  4DPR A;  4F1S A;  5AQA A;  4KMO A;  4ILG A;  3TXM A;  5IY5 E;  4I2W A;  3OXG A;  3PE3 A;  1WG0 A;  3AS8 A;  4FA6 A;  3ZHE B;  3HXB A;  1KPS B;  1MHQ A;  2L0I A;  3QB2 A;  2AVP A;  2ZGD A;  5C2Y A;  3CVV A;  1SA4 A;  1QNF A;  2B0O E;  2A5E A;  4MRU A;  4UQZ A;  3SF4 A;  4UUC A;  3PNT B;  4GA0 A;  1N0Q A;  3L16 A;  1IQR A;  4HXI A;  1K8K G;  5CCL A;  4B89 A;  5KJN A;  3APF A;  2V4H C;  2XS1 A;  3UM0 A;  3ABK E;  1BI7 B;  5FQ4 A;  3PUK A;  3UXG A;  4AY5 A;  4V3I A;  4JB8 P;  2ZIR A;  2MOW A;  3ASO E;  4B93 B;  2V8S E;  2XRY A;  2KCL A;  3UI2 A;  5CEA A;  3KEA A;  3LDZ A;  2KZT A;  1Q2Z A;  4URK A;  4YDW A;  2Y69 E;  4G1T A;  2J4B A;  1HF8 A;  3B13 A;  1BI8 B;  4J0U A;  4P29 A;  1N94 A;  3PRZ A;  3FUN A;  2VTB A;  2FO1 E;  3FUJ A;  4DX1 A;  1LF8 A;  4HOT A;  4I2Z A;  4Q94 A;  3Q9U C;  3DSU A;  1BLX B;  1NA0 A;  3TWR A;  2P9N G;  3ZN3 A;  4ATZ D;  4OAU C;  2WMO A;  1FPP A;  2GRL A;  4Y6C A;  4FC8 A;  2P9U G;  3ZYM A;  2QYJ A;  2NXP A;  1D8E A;  4ACL A;  4GTV A;  3JYS A;  2V4L A;  1OXJ A;  5CRU A;  1N52 A;  3ASH A;  2KM4 A;  3FUD A;  2KZT B;  4GAA A;  4RQI A;  5KJM A;  4GB9 A;  3ZYL A;  4AEZ C;  4GYO A;  4CCA A;  2IOS A;  4H7X A;  1WAO 1;  4XI0 A;  2UWJ G;  2EIJ E;  3IHV A;  4AJW A;  5BV1 A;  3L82 A;  3KEZ A;  3DSS A;  1JCQ A;  2R02 A;  5ARG A;  4A3V A;  4UI9 C;  4JHR A;  2OOE A;  1IXV A;  4J8S A;  2EIN E;  2DZO A;  5KJL A;  4BT9 A;  3B7S A;  4HOS A;  4XKB A;  2CHW A;  2IF4 A;  2J07 A;  4R7L A;  2ZIS A;  3LVR E;  4GPK A;  5KNG A;  5KBA A;  3W9F A;  1E7V A;  2BKK B;  4G26 A;  2XZD G;  2OVB A;  2DIW A;  4HI9 A;  1AWC B;  4N5C A;  1TJF A;  2FI7 A;  2PM6 A;  2E2E A;  1K1A A;  3TL5 A;  1WY6 A;  3KAE A;  4LSZ E;  5JHA A;  1HU3 A;  1Z3X A;  3E34 A;  1MQS A;  5EIB E;  3EDT B;  5AN8 A;  3AU4 A;  3VLE A;  4NUR A;  3OTN A;  4GYW A;  3AS5 A;  1E8Z A;  3B7U X;  1TNU A;  3UTM A;  3L9T A;  1OWO A;  3RIB A;  4GZC A;  2AJA A;  1PY1 A;  3PS6 A;  5CMY A;  3HYM B;  3FTV A;  1EF1 C;  5JHB A;  2I6H A;  2WB2 A;  3JCK C;  1MYO A;  1UJK A;  5B1B E;  2L6J A;  2WXI A;  3EJN A;  4PS7 A;  2J08 A;  2H6I A;  3Q5M A;  1MX2 A;  4IN3 B;  5EYP F;  3GW4 A;  1B89 A;  2XGM A;  4UI9 K;  1QBQ A;  2ZU6 B;  4FHK A;  4B8A A;  3HIZ A;  1N4S A;  4PS3 A;  4YDE A;  3C72 A;  4UWK A;  3R9A B;  1D9S A;  3NB2 A;  4MLP A;  1BU9 A;  3AG2 E;  4HNA D;  1TNZ A;  3EHN A;  3K9I A;  1N0R A;  2Y3A A;  3G2V A;  3ZRH A;  2L0T B;  3SGH A;  2LNI A;  4OAV B;  2GRO B;  5HI7 A;  2C0L A;  1OCO E;  1O1R A;  1H0A A;  5LFA A;  3RAU A;  1LD7 A;  3X2Q E;  1U3C A;  4N3A A;  3TWT A;  4NQ0 A;  2UY1 A;  4TXP A;  4GCO A;  2PNN A;  2R05 A;  3FFL A;  2PL2 A;  3T8K A;  2ETC A;  2X6F A;  4XIF A;  3ENE A;  3UT7 A;  2GW1 A;  1HH8 A;  3PRE A;  3LJ3 A;  1HZ4 A;  3EHR A;  4I43 A;  4WNG A;  2H6F A;  4ANW A;  4DK5 A;  3D9J A;  1AP7 A;  3Q73 A;  3GZ2 A;  3FUE A;  4EEC A;  3U64 A;  4JVS A;  1UN9 A;  1HG2 A;  1TN6 A;  5EX0 A;  3PDN A;  2F37 A;  2JLB A;  3T5X A;  2MHK A;  3O4Z A;  2EIL E;  4GTP A;  3DPY A;  2HR2 A;  2Y4U A;  3SHF A;  1JUQ A;  3KD7 A;  2QC9 A;  2EIM E;  1TR4 A;  3CVP A;  2XZT G;  3HXF A;  3JQ1 A;  4MBG A;  3I5P A;  2Q7F A;  3TGO A;  3BG1 B;  1HE8 A;  5G05 C;  2VYI A;  3QWW A;  2I1K A;  3L6A A;  3FUH A;  1UJJ A;  2CG2 A;  4JPS A;  2R5S A;  5ITZ F;  4TRQ A;  2R2L A;  3IXE A;  1E8Y A;  1E8X A;  2P9P G;  1H6P A;  1BPO A;  4FP7 A;  4AOF A;  3FY4 A;  5ENP D;  3ZFW A;  4ANV A;  3PE4 A;  1E96 B;  1UN8 A;  3C3R A;  3LPZ A;  4KYO B;  1N4P A;  3ONL A;  2BTD A;  3ZPJ A;  4WWN A;  5AAO A;  1N95 A;  1OWP A;  3S7B A;  4Y6W A;  4U0U A;  4C9B B;  4Q96 A;  5G55 A;  4LNG A;  5BXU A;  5FWQ A;  5T4Y A;  2GRM A;  3FDH A;  1LTX A;  3L08 A;  3FU5 A;  2C2L A;  1VDY A;  2P2C P;  1KZO A;  4LER A;  2Y0B G;  4F53 A;  5ENN A;  1W3B A;  3FTY A;  1EYH A;  3S7D A;  1BD8 A;  4LEU A;  4HFG A;  3PUJ A;  5D0Q D;  2J09 A;  1TNY A;  5H7P A;  4ATG A;  2MRI A;  4XI9 A;  4DLO A;  1O1S A;  3KSQ A;  2KXP C;  4IRU A;  3QK0 A;  3FEX A;  2OCC E;  4K5B A;  3FUM A;  3CVY A;  2J49 A;  3FEY A;  4FU3 A;  5EYL A;  3R7Q A;  2XPY A;  3LY8 A;  2RFA A;  2FO7 A;  5KWD A;  2E0I A;  2WMN A;  4DLQ A;  1ZU2 A;  3QWP A;  3ULY A;  3Q49 B;  3CK9 A;  4RVB A;  4YDO A;  3G2W A;  3QKY A;  3G2S A;  4NIK A;  3T5V A;  1IYG A;  4AXH A;  2XQ0 A;  3CR3 A;  3HHM A;  2HO1 A;  5BUZ A;  1DCE A;  1ZB1 A;  2YHC A;  4HOR A;  3E32 A;  2IO3 C;  3CK7 A;  3T8M A;  1LD8 A;  3UKR G;  2X38 A;  5G04 J;  2VGX A;  2IJG X;  4WAF A;  3DSV A;  4CGW A;  4HRM B;  3QAQ A;  4HOU A;  1S64 A;  3UMV A;  2M63 A;  3P2B A;  3CK8 A;  5FTP A;  3ZW3 A;  3Q47 B;  5AEN A;  1OWM A;  2BKG A;  3SBT B;  5KCM A;  4B0Z A;  4JHK A;  4B8C B;  4JW1 A;  2DYR E;  4EBA G;  5E75 A;  2R03 A;  1OUV A;  3LVQ E;  2IO2 C;  2OV8 A;  1NI1 A;  2X6J A;  3DXM G;  5ANR A;  3SO8 A;  1TN8 A;  4DUI A;  5T3R A;  1TYQ G;  2FUL A;  3NF1 A;  3SQV A;  4EHM A;  5C1D A;  2GRQ B;  3ESL A;  4WNE A;  3V31 A;  2WXO A;  4GMJ A;  3QC1 A;  4N39 A;  2VGX B;  4UWL A;  2P9I G;  3MGB A;  3ASG A;  3BG0 B;  4ACK A;  3L13 A;  1FT1 A;  4GZ6 A;  1NFI E;  3FTS A;  1O1T A;  1KLX A;  3I3N A;  5FJY A;  2XGS A;  4A63 B;  3UIP C;  2Y4T A;  3LYA A;  4M7C A;  2J8S D;  1YYH A;  4I17 A;  5BNW A;  3AG1 E;  1OY3 D;  3DBS A;  3ABL E;  3CVW A;  4YDY A;  2OEV A;  5KJK A;  1QZ2 A;  2DVW A;  4O1P A;  1U3D A;  2H6G A;  2F8Y A;  3Q7F A;  4GZ5 A;  3APC A;  4JHJ A;  2Y1L E;  5FQ8 A;  2NC9 A;  2P9S G;  1H6K A;  3NQP A;  1O5M A;  3CVQ A;  3ML9 A;  5T8I A;  3CIA A;  4MKT A;  2A5U A;  3AAA C;  2VJ8 A;  3TWU A;  1DVP A;  3ISM C;  2XEE A;  1YCS B;  3S7J A;  4RLY A;  3IBE A;  4GPM A;  3FTZ A;  1MJ0 A;  4JEH A;  3V2O A;  5BT1 A;  2CHX A;  4DX5 D;  3DEP A;  5BPP A;  1WM5 A;  2WVI A;  3RRU A;  3AG4 E;  2VTB B;  3MA5 A;  4ABN A;  2I2O A;  3BUA A;  4BSX A;  5FZQ A;  2QZA A;  1XNF A;  4L9P A;  5A23 A;  4F6R D;  2A4Z A;  4QFV A;  3VTY A;  4KVO A;  5AQB A;  2XCC A;  4KXK B;  4I6G A;  2C0M A;  3Q4A B;  4BES A;  4NRH B;  2LSV A;  2WXN A;  3ASF A;  2KCV A;  3CVX A;  2LXM A;  1OCC E;  3C3O A;  4GA2 A;  4NAC A;  5EKQ D;  3NOG D;  2J4D A;  1HFA A;  2QYU A;  4A1S A;  4U0Z A;  3V79 K;  3E4B A;  2OEW A;  2P9K G;  3QJZ A;  2QFC A;  2V5F A;  4G8K A;  2P9L G;  4TXR A;  3TWW A;  5CER B;  3IEG A;  4FHJ A;  5A7D B;  4CT0 A;  4BY6 A;  4I6E A;  4FAD A;  3SNX A;  1OWN A;  4J8F A;  4L2L A;  2OVF A;  5AAR A;  1OCR E;  1N54 A;  3ZUV B;  2B6C A;  5LX8 A;  2WXF A;  2AXV A;  3CQC B;  4PH4 B;  4BTB A;  4XX5 A;  2ILR A;  4IYP A;  4HRL A;  4EZK A;  2ETA A;  3DSW A;  3IV0 A;  4APF A;  3L54 A;  4CT4 A;  3RO2 A;  1ELK A;  4EZL A;  3I4R B;  3N71 A;  1UG3 A;  2R59 A;  3BQO A;  1NP7 A;  3BU8 A;  3V30 A;  4PDX A;  4F1P A;  3SFZ A;  3EUV A;  1U2V G;  3DEO A;  1JCS A;  3ASD A;  3OAW A;  4U95 D;  5D66 A;  4KT6 B;  4CEM A;  2CG3 A;  5KNH D;  3EIJ A;  4RG6 A;  4Q69 A;  3D3M A;  3LY7 A;  4J8Y A;  1Z6T A;  2L6B A;  4BSZ B;  2GRN B;  4G23 A;  1D8D A;  3UT4 A;  3PEV B;  3CGH A;  1HXI A;  4BEP A;  3MEK A;  2PQN A;  3CSF A;  1PAQ A;  4GTM A;  3FU3 A;  4CZ2 D;  1HO8 A;  5DIZ A;  5J90 A;  3CV0 A;  3D9K A;  2XEV A;  1Y8M A;  3DRA A;  3B95 A;  4QQI A;  1ELW A;  2EQX A;  5FQ6 A;  5FIO A;  1UW4 B;  5ENT D;  4N3C A;  3ZXS A;  4GTT A;  3HXE A;  1ZBP A;  4HVB A;  4TXQ A;  3URZ A;  3SI5 A;  3W9G A;  3CST A;  3TWV A;  2LSU A;  5BXO A;  1S70 B;  3OXF A;  4E85 A;  4BET A;  2AWI A;  2UY1 B;  4K03 A;  4J8E A;  4J8D A;  3C5R A;  3ZVV A;  4DX6 D;  3MZL B;  2BED A;  4ZFH A;  3LXU X;  1JCR A;  4O6F A;  3PZ4 A;  2KCK A;  4N3B A;  1S0P A;  3UPV A;  3ULQ A;  5BV0 A;  3J5Q B;  2LO6 A;  4GU5 A;  1IKN D;  2YQ8 A;  5ARF A;  2XPZ A;  3SFX A;  3NOC D;  5AJL A;  3D9O A;  3QDN A;  2I1J A;  1JPL A;  2ION A;  3MJW A;  5ENO D;  2X3M A;  3SD5 A;  3PZ1 A;  1HG5 A;  3TXN A;  2WM9 A;  4L2Y A;  4DI4 A;  4GCN A;  2KC7 A;  5A6C A;  2WXJ A;  2IQC A;  4WWP A;  2WXR A;  1HX8 A;  4WUY A;  1KT0 A;  2X6H A;  3FUF A;  4ILH B;  4F3V A;  2VSO E;  3O48 A;  5HRY A;  3D9L A;  1SA5 A;  4HB5 A;  1SVX A;  3VLF A;  5FT9 A;  5D2M C;  2IU1 A;  4ANU A;  3FWV A;  3APD A;  4G2V A;  1IHB A;  3L22 A;  1OCZ E;  4WND A;  1H2V C;  3RKV A;  3AS4 A;  5JJ6 A;  3E30 A;  1KZP A;  2CFU A;  3MYV A;  3CVU A;  5EN5 D;  3SZ7 A;  4JXT A;  4I1O B;  4CDM A;  3HVE A;  3HRA A;  2WQ7 A;  2WXP A;  2OND A;  1N9A A;  1H19 A;  2JAB A;  1DNP A;  3ZHE A;  1TJC A;  2WQH A;  3E33 A;  4FJZ A;  5FQ7 A;  1E90 A;  2WPV A;  4X8Q A;  2WXK A;  3Q7A A;  1JWF A;  2IFU A;  1EPU A;  4EPZ A;  1Y6I A;  2VSN A;  2VSY A;  4GML A;  2F0Y A;  3GZS A;  4Z68 A;  1N4Q A;  4K5C A;  1MX6 A;  3S7F A;  2XEH A;  4XEI G;  5DBK A;  3UKU G;  2VQ2 A;  3PVL A;  3B7B A;  2KAT A;  2YHE A;  4GTQ A;  4MS6 A;  2IEJ A;  3T9K A;  2DWZ A;  4U7E B;  4ZHB A;  4EBA A;  1EDU A;  1RZ4 A;  1FT2 A;  1FVH A;  3FU6 A;  3NAW A;  3UX4 A;  3TAX A;  4HI8 A;  4JEU A;  1SZA A;  4LNB A;  3ABM E;  3CHO A;  4BTA A;  1OT8 A;  4HQD A;  3HVE B;  4C0M A;  1N11 A;  2CHZ A;  3DXK G;  3KS2 A;  5CED B;  3FU0 A;  1HS6 A;  3TG4 A;  2H6H A;  4F7A A;  1NZN A;  3BEE A;  4LNU D;  2XS8 A;  2L9B A;  4UI9 J;  3UIO C;  4E6H A;  1S63 A;  2RD0 A;  3ZXP A;  4J6I A;  2DYS E;  5HS0 A;  4AIF A;  5AQ7 A;  3CHS A;  3JXI A;  3PNL B;  3C98 A;  4GYY A;  3UIN C;  4GTO A;  4HLL A;  3Q15 A;  4FUL A;  3CKB A;  3TWX A;  3IHY A;  3TG5 A;  1XGW A;  1ELR A;  4I1A A;  4TUU A;  3UM2 A;  4U96 D;  2WXG A;  2CFZ A;  3I4G A;  3U4T A;  2RFM A;  4FLH A; 
#chains in the Genus database with same CATH homology
 4A1S A;  4K0R A;  2X6F A;  4XIF A;  3PZD A;  3ENE A;  3FUL A;  2GW1 A;  3UT7 A;  4CGV A;  4U0Z A;  1HH8 A;  3CHQ A;  3GYZ A;  3E4B A;  2XGO A;  4N2S A;  2X6K A;  3LJ3 A;  3PRE A;  4UQX A;  1HZ4 A;  4UWG A;  3QJZ A;  4I43 A;  4WNG A;  2QFC A;  2V5F A;  4ANW A;  4DK5 A;  3D9J A;  3FUK A;  3GZ2 A;  4LUN U;  4TV3 A;  1SZ9 A;  4W9R A;  3FUE A;  3MKQ B;  3JQ0 A;  3IEG A;  4FHJ A;  5A7D B;  5D0O D;  3ZYK A;  4EEC A;  5AIJ A;  1YA0 A;  2WXL A;  4CT0 A;  4BY6 A;  3SBS A;  2DCP A;  4WWO A;  3U64 A;  4EQF A;  2AW6 A;  4JVS A;  1UN9 A;  1HG2 A;  2XCB A;  5AJD A;  5EX0 A;  4I6E A;  4FAD A;  4YND A;  3SNX A;  3PDN A;  1OWN A;  3UQ3 A;  3CLJ A;  4J8F A;  2JLB A;  4L2L A;  3T5X A;  2OVF A;  2MHK A;  3O4Z A;  4L7T A;  5LOZ A;  5EDS A;  4A55 A;  5HQ8 A;  2HR2 A;  2Y4U A;  2YNQ A;  1GW6 A;  3CHR A;  1N54 A;  2PQR A;  3SHF A;  1JUQ A;  3KD7 A;  4LRZ A;  1E8W A;  2AXV A;  2WXF A;  4PS8 A;  5LX8 A;  3AU5 A;  3RK6 A;  3CQC B;  4PH4 B;  3CVP A;  2LAH A;  3CEQ A;  3G2T A;  2I9C A;  4BTB A;  4PUC A;  3JQ1 A;  1FVF A;  4XX5 A;  2ILR A;  4CDR A;  3QAR A;  4IYP A;  3I5P A;  2Q7F A;  3WXX A;  3TGO A;  3D9N A;  3BG1 B;  3ESK A;  3CQG B;  3FP3 A;  4EZK A;  3CKC A;  4D10 C;  1E7U A;  1HE8 A;  1P5Q A;  3IV0 A;  3MV2 B;  5G05 C;  2JEK A;  4APF A;  3L54 A;  2VYI A;  3QWW A;  3D9M A;  2I1K A;  3HDX A;  3FUH A;  3L6A A;  4BWR A;  1UJJ A;  4CT4 A;  4HLE A;  3RO2 A;  4DPR A;  4F1S A;  2CG2 A;  1ELK A;  4JPS A;  2R5S A;  3ML8 A;  3LS8 A;  4KMO A;  4ILG A;  3CHP A;  4TRQ A;  5FZS A;  3TXM A;  4I2W A;  2FF4 A;  1E8Y A;  1E8X A;  3OXG A;  3PE3 A;  3OXL A;  4EZL A;  3EHM A;  1BPO A;  3AS8 A;  4FP7 A;  3I4R B;  4AOF A;  3FY4 A;  4FA6 A;  3N71 A;  3ZHE B;  1UG3 A;  2R59 A;  4AP2 A;  1NP7 A;  4U07 A;  1MHQ A;  2L0I A;  5G04 C;  3QB2 A;  3ZFW A;  4PDX A;  4ANV A;  2WQ6 A;  3TJP A;  3SFZ A;  3PE4 A;  1E96 B;  1UN8 A;  1TEZ A;  2AVP A;  3LPZ A;  4KYO B;  3ONL A;  5C2Y A;  3CVV A;  3QOU A;  4JL0 A;  2BTD A;  1QNF A;  3ZPJ A;  3JUI A;  4WWN A;  1OWP A;  4MRU A;  3ASD A;  4UQZ A;  3VTX A;  3SF4 A;  4IUL A;  3OAW A;  4JA9 A;  4KT6 B;  4CEM A;  2CG3 A;  5FZR A;  3MV3 B;  3S7B A;  3EIJ A;  3PNT B;  4U0U A;  4GA0 A;  4Y6W A;  4C9B B;  3L16 A;  1IQR A;  4RG6 A;  4Q96 A;  4HXI A;  4Q69 A;  3D3M A;  4L23 A;  5G55 A;  2IOL A;  5CHE E;  5CCL A;  3LY7 A;  4KZC A;  1Z6T A;  4B89 A;  5FWQ A;  5T4Y A;  3FH7 A;  2GRM A;  5KJN A;  3FDH A;  3L08 A;  3FU5 A;  4G23 A;  3APF A;  2C2L A;  3G2U A;  2GGF A;  1VDY A;  3UT4 A;  4AV7 A;  3PEV B;  3CGH A;  5FQ4 A;  3PUK A;  1HXI A;  1H2U A;  4H7Y A;  4I6J A;  3UUX A;  3MEK A;  4LER A;  2PQN A;  4AY5 A;  4F53 A;  5ENN A;  1W3B A;  3CSF A;  3FTY A;  4ME2 A;  1PAQ A;  4V3I A;  3RRN B;  1EYH A;  2RG8 A;  3S7D A;  3ZYQ A;  4BX9 A;  4U63 A;  4LEU A;  5J08 A;  2QY7 A;  3FU3 A;  4HFG A;  3PUJ A;  2XHE A;  5D0Q D;  2MOW A;  2J09 A;  5LP0 A;  2V8S E;  2XRY A;  3GZ1 A;  2KCL A;  4ATG A;  2MRI A;  1HO8 A;  5DIZ A;  4XI9 A;  5J90 A;  3CV0 A;  2PM7 A;  3ONK A;  3D9K A;  3LKU A;  4DLO A;  2XEV A;  3RRM B;  4APO A;  4EPZ A;  1Y8M A;  3LDZ A;  5LCW J;  4IRU A;  3QK0 A;  3RU0 A;  3FEX A;  1ELW A;  2EQX A;  2KZT A;  3FUM A;  4G25 A;  5FQ6 A;  3CVY A;  2J49 A;  1UW4 B;  3FEY A;  4URK A;  4N3C A;  4G1T A;  2J4B A;  4FU3 A;  4JA7 A;  3ZXS A;  1HF8 A;  3R7Q A;  4BX8 A;  2XPY A;  3LY8 A;  2FO7 A;  3B13 A;  3PEU B;  2E0I A;  4I9E A;  4J0U A;  2WMN A;  1ZBP A;  4DLQ A;  2FEZ A;  4P29 A;  4U04 A;  1ZU2 A;  3PRZ A;  5G05 J;  4A3T A;  3RO3 A;  3QWP A;  4HVB A;  3Q49 B;  3CK9 A;  4RVB A;  1X5B A;  3G2W A;  3URZ A;  3QKY A;  3FUN A;  3SI5 A;  2WXM A;  3CST A;  3G2S A;  2VTB A;  3T5V A;  2J9Q A;  2YIN A;  2XQ0 A;  3CR3 A;  4AXH A;  3HHM A;  4BFR A;  1IYG A;  4GZ3 A;  2HO1 A;  2LSU A;  3FUJ A;  3B7T A;  4ANX A;  1LF8 A;  5BUZ A;  3OXF A;  4N2Q A;  4E85 A;  4KVM A;  3QNK A;  4HOT A;  4I2Z A;  4Q94 A;  2YHC A;  2AWI A;  2UY1 B;  4M3O A;  4K03 A;  4HOR A;  4J8E A;  4J8D A;  3CK7 A;  3ZVV A;  3ZIM A;  1NA0 A;  3T8M A;  3MCX A;  3ZN3 A;  2WMO A;  3MZL B;  4GA1 A;  4CDN A;  3LXU X;  3CHM A;  4A1G A;  2X38 A;  1OWL A;  2GRL A;  5G04 J;  4O6F A;  2VGX A;  4FC8 A;  4Y6C A;  2IJG X;  4G24 A;  3ZYM A;  4WAF A;  1Z3Y A;  2NSZ A;  2KCK A;  3B7R L;  2NXP A;  4N3B A;  4OYS A;  4FJY A;  4CGW A;  4EZJ A;  3QAQ A;  4HOU A;  4ACL A;  1S0P A;  4B94 A;  3UPV A;  3JYS A;  3UMV A;  2M63 A;  4HS2 A;  2V4L A;  4L1B A;  3P2B A;  3UT8 A;  3ULQ A;  5BV0 A;  1N52 A;  3CK8 A;  5FTP A;  2LO6 A;  3ASH A;  3ZW3 A;  4AY6 A;  4GU5 A;  2KM4 A;  3Q47 B;  5AEN A;  2YQ8 A;  3FUD A;  2KZT B;  4GAA A;  4DJA A;  3LCA A;  1OWM A;  5ARF A;  3SBT B;  3ZEF A;  5KJM A;  2XPZ A;  5KCM A;  4GB9 A;  5AJL A;  3ZYL A;  4B0Z A;  4JHK A;  4AEZ C;  4B8C B;  4JW1 A;  4GYO A;  3D9O A;  3U3W A;  4CCA A;  2IOS A;  4EBA G;  4H7X A;  5E75 A;  3QDN A;  2I1J A;  1JPL A;  1WAO 1;  2UWJ G;  4XI0 A;  1OUV A;  1FCH A;  3IHV A;  3LVQ E;  2ION A;  4AJW A;  5BV1 A;  4XE0 A;  2BF0 X;  3MJW A;  2X3M A;  4UWH A;  4DI3 A;  3KEZ A;  3VLD A;  3SD5 A;  2OV8 A;  2X6J A;  5ANR A;  1HG5 A;  3D9P A;  2WXH A;  5T3R A;  3TXN A;  2WM9 A;  4L2Y A;  4JZY A;  1NA3 A;  3LEW A;  4DI4 A;  2LAI A;  2FUL A;  3NF1 A;  4GCN A;  5ARG A;  4A3V A;  5C1D A;  3L17 A;  1KT1 A;  3ESL A;  1H2T C;  2KC7 A;  3D9I A;  3FHE A;  4UI9 C;  2WXJ A;  4WNE A;  5A6C A;  4JHR A;  2IQC A;  2WXO A;  4WWP A;  2WXR A;  1HX8 A;  4WUY A;  1KT0 A;  3QC1 A;  4GMJ A;  2OOE A;  4N39 A;  2X6H A;  3FUF A;  2VGX B;  4J8S A;  4UWL A;  4ILH B;  4F3V A;  2VSO E;  3O48 A;  5KJL A;  4BT9 A;  4HOQ A;  3D9L A;  4YVQ C;  3B7S A;  4HOS A;  3FTW A;  3ASG A;  3MGB A;  3VLF A;  5BW8 C;  4XKB A;  2CHW A;  5FT9 A;  3BG0 B;  4ACK A;  4WNF A;  3L13 A;  2IU1 A;  2IF4 A;  4ANU A;  2J07 A;  3FWV A;  3APD A;  4G2V A;  4GZ6 A;  2AXZ A;  2AXU A;  2VSX E;  3FTS A;  3L22 A;  1KLX A;  3I3N A;  4R7L A;  4WND A;  4OVV A;  5FJY A;  2XGS A;  1H2V C;  3RKV A;  3AS4 A;  3RIB A;  5JJ6 A;  3RJV A;  2XPI A;  3FTX A;  5JJT A;  3LVR E;  4GPK A;  2CFU A;  2Y4T A;  1E7V A;  3MYV A;  4G26 A;  3LYA A;  3CVU A;  3SZ7 A;  4JXT A;  4I1O B;  4AVX A;  2OVB A;  4CDM A;  2DIW A;  3HVE A;  4N5C A;  1TJF A;  2WQ7 A;  2FI7 A;  2WXP A;  2OND A;  2PM6 A;  2E2E A;  2HM8 A;  1H19 A;  3DPD A;  4I17 A;  3FUI A;  3TL5 A;  5BNW A;  1DNP A;  1WY6 A;  3KAE A;  3ZHE A;  1JWG A;  1TJC A;  5JHA A;  1HU3 A;  1Z3X A;  2WQH A;  1MQS A;  3DBS A;  3EDT B;  4RSY A;  4FJZ A;  5FQ7 A;  3AU4 A;  1E90 A;  2WPV A;  3VLE A;  3CVW A;  4NUR A;  2WXK A;  3OTN A;  4GYW A;  3AS5 A;  1JWF A;  2IFU A;  1E8Z A;  5KJK A;  1QZ2 A;  3B7U X;  1U3D A;  2V0P A;  4G11 A;  1OWO A;  1EPU A;  3APC A;  4GZ5 A;  1PY1 A;  4GZC A;  1Y6I A;  4JHJ A;  3PH0 C;  3PS6 A;  1SQM A;  1IQU A;  4RG9 A;  5CMY A;  2VGY A;  5CCM A;  2VSN A;  2VSY A;  3FTU A;  2NC9 A;  3FTV A;  3HYM B;  4GML A;  2WXQ A;  5FQ8 A;  5JJ7 A;  3GZS A;  1EF1 C;  3IKO B;  2FBN A;  1H6K A;  5JHB A;  2I6H A;  5LCW C;  3EIQ C;  2R17 C;  3FH8 A;  3NQP A;  5G2N A;  3S7F A;  3FH5 A;  3CVQ A;  3JCK C;  4U8H A;  5DBK A;  5CMW A;  2WB2 A;  1INZ A;  2VQ2 A;  3PVL A;  3ML9 A;  5T8I A;  3CIA A;  4MKT A;  2KAT A;  2YHE A;  4MS6 A;  5E76 A;  1IHG A;  1UJK A;  2A5U A;  2VJ8 A;  2L6J A;  2WXI A;  3EJN A;  4EBA A;  4XZ4 A;  1DVP A;  1EDU A;  4PS7 A;  4FLB A;  3FU6 A;  1FVH A;  2J08 A;  3UX4 A;  3TAX A;  3QWV A;  4XKC A;  4JEU A;  3Q5M A;  3S7J A;  4IN3 B;  3IBE A;  3GW4 A;  1SZA A;  3FTZ A;  2XRZ A;  1B89 A;  2XGM A;  3CHO A;  4UI9 K;  4JEH A;  4BTA A;  4I9C A;  4AM9 A;  2PZI A;  2ZU6 B;  4BT8 A;  4FHK A;  4B8A A;  3HVE B;  3HIZ A;  4GZD A;  4UQY A;  4C0M A;  3NZU A;  4UWF A;  2P58 C;  3ZGQ A;  2CHZ A;  4C0E A;  4KBQ A;  5BT1 A;  2CHX A;  4PS3 A;  3U9W A;  3KS2 A;  3FU0 A;  1HS6 A;  4UWK A;  3TG4 A;  3R9A B;  3MKR A;  2DBA A;  4MLP A;  5BPP A;  4F7A A;  1WM5 A;  1NZN A;  2WVI A;  3RRU A;  3BEE A;  3NZS A;  2VTB B;  2L9B A;  3EHN A;  3K9I A;  3MA5 A;  4UI9 J;  4ABN A;  4E6H A;  2I2O A;  5AYW D;  1L5J A;  3MKQ A;  4BSX A;  3CVL A;  4CRW A;  2Y3A A;  5FZQ A;  3G2V A;  2RD0 A;  3R7R A;  4YVO A;  3ZRH A;  2BUG A;  1XNF A;  2L0T B;  2X6I A;  1QQE A;  4J6I A;  5M72 A;  3SGH A;  3CVN A;  2LNI A;  5A23 A;  4AIF A;  3CHS A;  3PNL B;  3C98 A;  4GYY A;  2A4Z A;  5HI7 A;  3P1U A;  4QFV A;  4KZ0 A;  4ILI A;  2C0L A;  3VTY A;  4KVO A;  4U0S A;  3Q15 A;  4I1M A;  5EX3 A;  4FUL A;  1H0A A;  3CKB A;  3IHY A;  5LFA A;  3TG5 A;  5ANL A;  3U66 A;  3LY9 A;  2XCC A;  4LCT A;  1XGW A;  4KXK B;  1ELR A;  1U3C A;  1A17 A;  2C0M A;  4I1A A;  4I6G A;  1PC2 A;  4TUU A;  4N3A A;  3Q4A B;  4NQ0 A;  4NRH B;  2UY1 A;  2LSV A;  2WXN A;  3ASF A;  3MX3 A;  2KCV A;  2HYZ A;  2WXG A;  2CFZ A;  4GCO A;  3CVX A;  3I4G A;  3U4T A;  4JC8 A;  3FFL A;  4GA2 A;  4NAC A;  5EKQ D;  3S2A A;  2J4D A;  2PL2 A;  4FLH A;  1HFA A;  4OVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...