4GTPA

Ftase in complex with bms analogue 16
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 4gtpA00
1KZPA 1SA4A 3HXDA 3HXFA 1LD8A 1TNOA 3E33A 1JCQA 3DSWA 1KZOA 2F0YA 4LNBA 1D8DA 4YDEA 1TNYA 1N95A 1LD7A 3PZ2A 3DSVA 1TN8A 1O1TA 3PZ4A 2ZIRA 3HXEA 3KSLA 2ZISA 3SFXA 1X81A 1N4SA 1O5MA 1JCRA 1D8EA 2IEJA 1TN7A 3Q7AA 3DRAA 4MBGA 1NI1A 3Q75A 1JCSA 4L9PA 4YDOA 3HXCA 4GTQA 2BEDA 3HXBA 3KSQA 3DSSA 1N4RA 2H6IA 3Q7FA 4GTPA 1QBQA 3SFYA 1DCEA 4GTSA 4LNGA 4GTTA 3PZ1A 1FT2A 3EU5A 1MZCA 3DSTA 1O1SA 1SA5A 1TNBA 1N94A 1FPPA 1S64A 4GTMA 3Q73A 1O1RA 1LTXA 3DSUA 3E30A 3E32A 4GTOA 4GTRA 2R2LA 3DSXA 3DPYA 1N4QA 3Q79A 1S63A 2H6GA 3E37A 2H6HA 1NL4A 1TNUA 3C72A 4EHMA 1N9AA 1N4PA 3E34A 2H6FA 4GTVA 3PZ3A 1TN6A 3EUVA 3Q78A 1TNZA 1FT1A
chains in the Genus database with same CATH superfamily
3ZW3A 4A1SA 1NZNA 3LDZA 5ENPD 5ENRD 3HHMA 3KD7A 4CEMA 2XQ0A 5CCMA 3NOGD 2YNQA 1KT0A 2AVPA 3QC1A 2VYIA 1TNYA 1N95A 2R02A 4WNFA 3DSVA 2R5SA 4XZ4A 3HXEA 2EILE 2GRPB 5FINA 3FUKA 3D9MA 4K03A 4U07A 5D0QD 4ATZD 3EHNA 3OXFA 5ITZF 5EILA 4WWPA 1SZAA 4CGWA 3KSQA 5LOZA 4UWKA 3HG0D 1JWGA 4BETA 2EIKE 4DRXE 3LYAA 2X6HA 5LCWC 4HI8A 4CYMD 2V4HC 4RQIA 4F1SA 4EQFA 3Q9NC 2XZDG 2R59A 2A5UA 1YYHA 3GZ2A 2ETAA 5JA4D 2V4LA 4HORA 3VLEA 1NL4A 4WAFA 2OOEA 3D9KA 3DEPA 4EHMA 5G04C 2PNNA 1X5BA 4QQIA 4AOFA 3ML8A 3ABKE 1DNPA 3Q47B 5BPPA 1KPSB 5KJKA 1E7UA 4U8VD 3CVUA 3SFZA 3K9IA 3MX3A 5D66A 1Z3XA 2WM9A 3P2BA 3L54A 4JB8P 3CHSA 5FT9A 5FQ8A 1U2VG 5AENA 4KZ0A 2WXOA 3CVPA 1VDYA 3D9IA 1W3BA 4MRUA 2GRLA 5T4YA 1E8ZA 3FUMA 4UUCA 1IQRA 2M63A 4JPSA 3CVQA 3UUXA 2GRRB 2RKKA 3V2XA 4J8SA 4B89A 3HXCA 4FJZA 2HYZA 1E8WA 3UM0A 5ANLA 3ABLE 2IU1A 3W9FA 4HXIA 2OVFA 3RO3A 3EU5A 3MKQA 4XI9A 2FBNA 2UWJG 4BSZB 4IYPA 3PNLB 3FTZA 4DX1A 4GMLA 5KNHD 3D3MA 4I1OB 2Y4TA 2OCCE 3AG3E 3LY8A 3E30A 2XS8A 3AU5A 1N4QA 2P9SG 4GZ6A 2C0MA 4N5CA 3LVRE 4M3OA 2AXUA 4XIFA 3LVQE 4ACLA 2R05A 4I2ZA 1Q2ZA 3BG1B 1NFIE 3PZDA 3OXLA 2GRNB 2J9QA 3QDNA 3RU0A 4U8YD 4XKBA 2AXZA 3G2UA 1EDUA 4K5BA 5BV0A 2IEJA 1H6KA 3O4ZA 1UJKA 2IQCA 3FUJA 1IKND 4AP2A 4MKTA 4RSYA 3HXBA 3QARA 5T3RA 3ONLA 3EU9A 3S2AA 4RG6A 3TWXA 2X38A 4GTPA 5B3SE 1ELWA 3SO8A 3TWUA 3LEWA 2XGMA 3ISMC 3ASFA 4I2WA 2LSUA 4UI9J 1E8XA 3R7RA 1E8YA 5G05J 4U0SA 3ULEG 5DIZA 3PUKA 3DSUA 4GTRA 3Q79A 5BNWA 2DWZA 1K3ZD 3IKOB 5EX3A 3MV3B 4DX7D 3L9TA 3ASHA 3CVNA 2J49A 2KCLA 3CVVA 4KBQA 4NRHB 4BX8A 2FI7A 3FTWA 2R17C 4APFA 4ANUA 3B7BA 4I6GA 1MX6A 4LCTA 3C3RA 2ONDA 2F0YA 3APFA 4AY5A 4JW1A 1XNFA 2LSVA 5FQ7A 4OVVA 1S70B 3EHMA 3U3WA 4Q94A 4A63B 3SFXA 3OXGA 4GPMA 5CBOA 5FZRA 3RRUA 2VTBA 3Q7AA 4B93B 4LG6A 3MA5A 4AY6A 1N0QA 2KCKA 1HE8A 2ILRA 1WY6A 2WXNA 3RAUA 3T8MA 4APOA 5BUZA 2IF4A 3VTYA 4J8FA 2Y4UA 4GTTA 2FEZA 2NC9A 3AU4A 4LRZA 3EHRA 2JLBA 4GYYA 2KC7A 4J6IA 3TWSA 3PE3A 3QOUA 3DSTA 4L2LA 3CVYA 3AS8A 2F37A 2C0LA 4H7YA 2WQ7A 5KJLA 4DI3A 4HNAD 1JUQA 4TRQA 5AQ9A 2R03A 2VSOE 3ZN3A 2B0OE 1K1AA 4I1AA 4G8LA 3PNTB 3NB2A 5KNGA 2QC9A 4JHJA 3ZXSA 5FZQA 4F7AA 2XCBA 4BT9A 4JHKA 3NAWA 4KYOB 2Y69E 3ZYQA 5C2YA 4OVUA 5FQ4A 1TN7A 4WNEA 2VGXA 5B1BE 1D9SA 3FEXA 1JWFA 3B13A 4CGVA 3ASNE 2DIWA 3FUIA 4K5CA 4IN3B 3HRAA 3MGBA 3E4BA 3NOCD 5FWQA 3SQVA 2L6JA 4EBAG 1OXJA 3MKQB 2WQ6A 2HM8A 5AAOA 4TV3A 1TYQG 2WXMA 1Z5SC 3R7QA 4UQYA 4NURA 4EZJA 4DX6D 5EYLA 4HLLA 1N94A 1SZ9A 2BKKB 3RIBA 3S7BA 4BFRA 4ME2A 4XEIG 5CEAA 2PQNA 4FC8A 4AM9A 3D9JA 2RD0A 3TXNA 4BEPA 2LNIA 2DBAA 4JA7A 3UTMA 4FLHA 3JXJA 3IEGA 2CHXA 3Q78A 5J90A 5EX0A 3ULYA 4XI0A 1YA0A 3AG2E 3QWWA 4C48B 1BU9A 3LJ3A 4BT8A 2WXKA 1JPLA 4Y6CA 1BLXB 4EPZA 3ESKA 4N2QA 4LNUD 3APCA 2ZGGA 4BESA 3U66A 4YDEA 3JUIA 3U9WA 2QY7A 2E2EA 3C3OA 3EIQC 3TG5A 3B7TA 1QZ2A 1OWOA 1O1TA 1PAQA 3RSEG 1LF8A 4NIKA 4MLPA 5ENTD 2DYRE 1E96B 3CVWA 2IONA 3AS5A 1MX2A 4HBDA 3ML9A 1HFAA 3DSSA 4ANXA 4PS8A 3FUNA 1NA3A 3SFYA 2ZXWE 3ZRHA 3RRMB 3FU3A 1HF8A 2MYOA 1BI8B 1FT2A 1WDYA 5AJDA 2I6HA 1MZCA 1K1BA 3TJPA 2P2CP 4I9CA 4TXQA 2L0IA 5AQBA 2CHWA 1A5EA 4XE0A 4HS2A 4B94A 3TXMA 4HI9A 2V8SE 4EZLA 2XEVA 3FP3A 3CR3A 4X8QA 4EBAA 3HVEA 2XHEA 4MS6A 1HG2A 2KZTA 1OT8A 4ILIA 3ZHEA 1OWMA 5AJLA 2WXPA 4FU3A 4G24A 2XRYA 3QWPA 4GTVA 1HH8A 2J07A 5G2NA 2QFCA 1TN6A 3FU6A 4G25A 3LY7A 1U3DA 1FT1A 5FTPA 2KXPC 3TL5A 1Y8MA 1PY1A 2UY1A 3JQ1A 1N0RA 4I43A 1PC2A 4J8YA 4L1BA 4UWLA 3IHYA 1FVHA 3PUJA 3VLDA 3PH0C 3J5PA 4JC8A 2VTBB 2FULA 3CHQA 1N11A 1N54A 1K8KG 4MBGA 1GW6A 1DCQA 3EIJA 3QJZA 4YDYA 4GCOA 3Q7FA 3X2QE 3FTXA 4F6RD 5HI7A 2A5EA 1DCEA 3DEOA 3O48A 4DLQA 2WXHA 3V30A 4NQ0A 1FCHA 3UQ3A 4JD2G 4BTBA 1O1SA 4IULA 4AEZC 4FHKA 4JZYA 4WNDA 4O1OA 1O1RA 4GZDA 4CDNA 3L08A 4ZHBA 3CLJA 3E37A 3HDXA 3CHPA 3MJWA 2OEVA 2JABA 4HOSA 4GA0A 4U96D 5LFAA 5EIBE 3CKCA 3IHVA 2WVIA 3QNKA 4HRNA 3TGOA 4N5QA 3B7SA 4U04A 1TNZA 3OTNA 4U8HA 3ZEFA 1KLXA 1QQEA 4A3TA 1MQSA 3AJIA 2B6CA 1AWCB 3L82A 3L16A 1RW2A 2DZOA 4N39A 4GPKA 4HVBA 2HO1A 2IY0C 3GW4A 4YNDA 3ASGA 2EIJE 1U3CA 2VGXB 2I1JA 2VGYA 2WMOA 2XEEA 3FU0A 3QB2A 3SGHA 1IQUA 5A7DB 4CT0A 4KT6B 3CV0A 3FTYA 5EDSA 1NA0A 1DC2A 2RFAA 2IFUA 3V79K 4AV7A 3D9NA 3FTSA 1QNFA 2XPYA 5ENNA 4W9RA 5LX8A 4B0ZA 5CEDB 3PREA 4GTMA 2KATA 2LAHA 4N3AA 4TUUA 3FTUA 5CMWA 2HR2A 2R2LA 3DPYA 2L0TB 3T9KA 4NACA 1N9AA 3I5PA 3CQGB 4CZ2D 2DVWA 4BY6A 1H2VC 3T5XA 3NZUA 3BEEA 4P29A 3S7DA 5CBNA 2LO6A 1TJCA 2WPVA 5E76A 3ULQA 2GGFA 2ZGDA 5M72A 4HQDA 1HG5A 2EINE 3KAEA 3ZUVB 1TJFA 2WQHA 4ILHB 4LNBA 3ZGQA 3U4TA 4PS3A 3ASOE 3D9PA 2QYUA 4ILGA 2XZTG 2J4DA 4UWFA 3GZSA 2OV8A 2BKGA 1MYOA 4GCNA 3Q75A 3MYVA 4TXRA 4BX9A 2XGOA 4JEUA 4FADA 4ANVA 5LP0A 2BEDA 3SY2A 3CK9A 3SD5A 4BWRA 5CMYA 3SI5A 4YVOA 4Y6WA 1MX4A 3JCKC 4U0UA 4LNGA 3CSTA 5AIJA 4F1PA 2AJAA 1BD8A 4UI9C 2JEKA 3FUFA 2XENA 2Y1LE 4WWNA 1SQMA 5G05C 4AVXA 4U7EB 5JJ6A 4J8EA 3CK8A 4GA2A 3MZLB 3GZ1A 3HVEB 3C98A 2KZTB 3ZHEB 5DBKA 1WM5A 4OYSA 1OWPA 4DUIA 2J4BA 3ASDA 2OEWA 3RO2A 2VSYA 3CKBA 2QZAA 3NQPA 1OCOE 2UY1B 4DX5D 1SVXA 4FLBA 3UMVA 2VSNA 4BERA 3CK7A 3D9LA 2AXVA 1OCZE 3ENEA 4HOUA 4EZKA 2XEHA 2PM7A 5JHAA 1AP7A 2ETCA 2DYSE 3T8KA 3DBSA 1N4SA 4ANWA 4DPRA 2ETBA 3QKYA 3BU8A 3ZYKA 5JJ7A 5CRVA 2L6BA 4U63A 4JHRA 4XKCA 1JCSA 3FU5A 2IOLA 2GRQB 2LXLA 2H6IA 1KT1A 1YMPA 4A3VA 4JEHA 3SBSA 4I1MA 2LUHA 2CG2A 1UW4B 2I1KA 1ZU2A 4G2VA 3ZNGA 3EHQA 2GRMA 4DX2A 2F8YA 3AG4E 3ZKJA 1TNBA 2Y0BG 5B1AE 5HRYA 4EECA 1LTXA 5HQ8A 2NSZA 2XPIA 3Q9UC 4GZ5A 1TNUA 4PS7A 2XCCA 3Q49B 5T8IA 2EQXA 3R9AB 3UI2A 1SW6A 4KXKB 3ZYLA 4WNGA 3HXDA 5D0OD 1MJ0A 3FH8A 2LAIA 3E33A 3V31A 1JCQA 4AXHA 3LXUX 4FJYA 2MOWA 2FO1E 5FIOA 5AYWD 4KVOA 3JXIA 2Y3AA 2X3MA 5JMND 3ZU7B 4E85A 5ENSD 1Y6IA 3JYSA 2I2OA 4UWGA 2ZIRA 4JXTA 3CHMA 2ZISA 3P1UA 2J8SD 3FUHA 4TXPA 1RZ4A 3UINC 2DCPA 4CDRA 4HRLA 1NI1A 2ZU6B 4L9PA 2V0PA 4YDOA 2CHZA 1UN9A 3Q4AB 1MHQA 3FUDA 4I9EA 3FDHA 3AS4A 3DXKG 4G11A 2AW6A 3EJNA 2E0IA 5EYPF 5LCWJ 2P9UG 1HZ4A 2J08A 2PZIA 3LPZA 1TR4A 5KBAA 4GA1A 3TWRA 3B7RL 3FFLA 3HIZA 3JQ0A 2P9IG 5A6CA 3QK0A 2H6HA 2MHKA 4AIFA 3URZA 5G04J 1UJJA 3EDTB 4L23A 4JL0A 1IHGA 1ELKA 3UT4A 1IYGA 5EIDA 2RG8A 4J8DA 1FVFA 4I17A 3SNXA 4O60A 3RJVA 4U0ZA 5BW8C 4HFGA 3SBTB 2YHEA 5CECB 3BG0B 5IY5E 5AARA 1HU3A 3I4RB 3UIPC 4ACKA 2LXMA 3FH7A 1EYHA 5EKQD 3L22A 5G55A 5CERB 1TN8A 4GB9A 4C0MA 3UIOC 2WXIA 3VLFA 1HX8A 3L17A 4M7CA 4K0RA 2WXFA 5HKPA 4U95D 4GTQA 2C2LA 5FJYA 3UT7A 1N4RA 2WXQA 2P9NG 2V5FA 3IXEA 4DLOA 1OCRE 5ANRA 2XPZA 2F8XK 5BV1A 3TWWA 1EPUA 3MCXA 3G2TA 2BF0X 2NXPA 3LCAA 2V5QC 2X6FA 1H0AA 1Z3YA 3S7JA 4CCAA 3RK6A 2YINA 3G2WA 5E75A 4KVMA 1ELRA 3Q73A 1A17A 4LUNU 5CRUA 4GTOA 4O1PA 4L7TA 1OWLA 3CGHA 2I9CA 5D2MC 4UQXA 3E34A 3U64A 4WWOA 3UXGA 4CT4A 4D10C 3VTXA 3FEYA 1ZB1A 4AJWA 4YDWA 1OY3D 4ZFHA 2BUGA 1V55E 4O6FA 4URKA 3Q5MA 3PRZA 4V3IA 4ATGA 2P9PG 3ABME 4PH4B 1INZA 3B7UX 3PEVB 3F6QA 4RVBA 4J0UA 4C9BB 2WXLA 3N71A 3QWVA 4PDXA 3G2VA 4R7LA 3ZIMA 4GZCA 5ENQD 4GMRA 1O5MA 2HE0A 3DRAA 4G8KA 3RRNB 3KEZA 1E7VA 5J08A 4HOTA 3WXXA 4FP7A 1QBQA 5KWDA 3C5RA 3FULA 3UM1A 2KM4A 3PVLA 3PZ1A 4IRUA 4UWHA 3ZYMA 4DJAA 4A1GA 4Q69A 2MRIA 3G2SA 1UOHA 1OWNA 4XX5A 2YQ8A 4Q96A 2CFZA 3E32A 2X6KA 2KCVA 1S63A 2XGSA 5BT1A 3ONKA 2P9LG 3J5QB 4JA9A 2WXJA 2VJ8A 3MKRA 2H6FA 5FQ6A 4GAAA 3PZ3A 2X6JA 2X6IA 4FA6A 2IJGX 3KEAA 4ABNA 1KZPA 1SA4A 5AN8A 1UN8A 2IO3C 3SZ7A 3LS8A 3CEQA 3FHEA 2WMNA 3R9MA 1YCSB 3C3QA 3IV0A 3DXMG 4UQZA 3MEKA 2XS1A 1LD7A 2OVBA 3KSLA 1Z6TA 1D8EA 5AQAA 2PL2A 1H2UA 3W9GA 1EF1C 3TAXA 4HRMB 3NBNB 3I4GA 5A23A 1NP7A 3IBEA 2Q7FA 2CFUA 1L5JA 3LY9A 1E90A 1H6OA 3AAAC 3FH5A 3L6AA 3OAWA 4FHJA 3QAQA 1HS6A 1QYMA 3CQCB 1S64A 1WAO1 3UX4A 3TG4A 2A4ZA 2KBXA 3ZFWA 3DSXA 1UG3A 2H6GA 5ARGA 4J7WA 3SHFA 5C1DA 5CHEE 4LEUA 5KJNA 1H6PA 3D9OA 4RG9A 5FZSA 3PE4A 4K5AB 4FULA 3BUAA 3GYZA 5JHBA 3S7FA 1LD8A 2FF4A 1TNOA 2IOSA 4GYWA 1OUVA 3DSWA 2P9KG 4OAUC 3V2OA 3TWQA 2VGEA 3PEUB 3PZ4A 1X81A 4OAVB 1JCRA 3LKUA 3JUEA 2P58C 1OCCE 1HO8A 4LSZE 5HS0A 3Q15A 2YHCA 3UM3A 3TWVA 3CIAA 3KS2A 3RKVA 2RFMA 4DK5A 4GTSA 4GZ3A 2GROB 5AQ7A 3DWLG 3UKRG 4GU5A 3DPDA 4A55A 5KJMA 4HB5A 3PDNA 4I6JA 4WUYA 4YVQC 3FUEA 1XGWA 4F3VA 3PS6A 4DI4A 4F53A 1IHBA 2DZNA 3CVXA 3FTVA 3CVLA 3HYMB 1BPOA 4KMOA 3MV2B 2AWIA 2FO7A 4JVSA 4CDMA 4TUMA 3FWVA 3UM2A 4QFVA 2WB2A 2WXGA 3C72A 5CCLA 1N4PA 3ESLA 4KZCA 2VSXE 4B8CB 3FY4A 1ZBPA 4C0EA 3HXFA 4GMJA 4N3CA 3ZXPA 4HLEA 1DVPA 4LERA 2VQ2A 5ARFA 4BTAA 1KZOA 4B8AA 3T5VA 4Z68A 2J09A 2L9BA 1D8DA 1S0PA 1BI7B 1B89A 3D9HA 2BTDA 1H19A 3PZ2A 3UT8A 3I3NA 4H7XA 2CG3A 3TWTA 4N3BA 4BSXA 1V54E 2IO2C 1G3NB 3AG1E 3NZSA 3SF4A 2EIME 2PM6A 4L2YA 3CSFA 2XRZA 3NF1A 1H2TC 1HXIA 2PQRA 4HOQA 5JJTA 2GW1A 4UI9K 4G26A 4RLYA 3UPVA 2QYJA 3UKUG 4I6EA 3L13A 1P5QA 1SA5A 3APDA 4G23A 1FPPA 4G1TA 4PUCA 4GYOA 5BXUA 3WG7E 3B95A 2WXRA 3ZVVA 3CHRA 3CHOA 5ENOD 3BQOA 5EN5D 1WG0A 1IXVA 1TEZA 2NYJA 4CRWA 3ZPJA 4E6HA 3LJNA 3EUVA 5H7PA 4N2SA 1N52A 5BXOA 5KCMA
chains in the Genus database with same CATH topology
1KZPA 1SA4A 3HXDA 3HXFA 1LD8A 1TNOA 3E33A 1JCQA 3DSWA 1KZOA 2F0YA 4LNBA 1D8DA 4YDEA 1TNYA 1N95A 1LD7A 3PZ2A 3DSVA 1TN8A 1O1TA 3PZ4A 2ZIRA 3HXEA 3KSLA 2ZISA 3SFXA 1X81A 1N4SA 1O5MA 1JCRA 1D8EA 2IEJA 1TN7A 3Q7AA 3DRAA 4MBGA 1NI1A 3Q75A 1JCSA 4L9PA 4YDOA 3HXCA 4GTQA 2BEDA 3HXBA 3KSQA 3DSSA 1N4RA 2H6IA 3Q7FA 4GTPA 1QBQA 3SFYA 1DCEA 4GTSA 4LNGA 4GTTA 3PZ1A 1FT2A 3EU5A 1MZCA 3DSTA 1O1SA 1SA5A 1TNBA 1N94A 1FPPA 1S64A 4GTMA 3Q73A 1O1RA 1LTXA 3DSUA 3E30A 3E32A 4GTOA 4GTRA 2R2LA 3DSXA 3DPYA 1N4QA 3Q79A 1S63A 2H6GA 3E37A 2H6HA 1NL4A 1TNUA 3C72A 4EHMA 1N9AA 1N4PA 3E34A 2H6FA 4GTVA 3PZ3A 1TN6A 3EUVA 3Q78A 1TNZA 1FT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZP A;  1SA4 A;  3HXD A;  3HXF A;  1LD8 A;  1TNO A;  3E33 A;  1JCQ A;  3DSW A;  1KZO A;  2F0Y A;  4LNB A;  1D8D A;  4YDE A;  1TNY A;  1N95 A;  1LD7 A;  3PZ2 A;  3DSV A;  1TN8 A;  1O1T A;  3PZ4 A;  2ZIR A;  3HXE A;  3KSL A;  2ZIS A;  3SFX A;  1X81 A;  1N4S A;  1O5M A;  1JCR A;  1D8E A;  2IEJ A;  1TN7 A;  3Q7A A;  3DRA A;  4MBG A;  1NI1 A;  3Q75 A;  1JCS A;  4L9P A;  4YDO A;  3HXC A;  4GTQ A;  2BED A;  3HXB A;  3KSQ A;  3DSS A;  1N4R A;  2H6I A;  3Q7F A;  4GTP A;  1QBQ A;  3SFY A;  1DCE A;  4GTS A;  4LNG A;  4GTT A;  3PZ1 A;  1FT2 A;  3EU5 A;  1MZC A;  3DST A;  1O1S A;  1SA5 A;  1TNB A;  1N94 A;  1FPP A;  1S64 A;  4GTM A;  3Q73 A;  1O1R A;  1LTX A;  3DSU A;  3E30 A;  3E32 A;  4GTO A;  4GTR A;  2R2L A;  3DSX A;  3DPY A;  1N4Q A;  3Q79 A;  1S63 A;  2H6G A;  3E37 A;  2H6H A;  1NL4 A;  1TNU A;  3C72 A;  4EHM A;  1N9A A;  1N4P A;  3E34 A;  2H6F A;  4GTV A;  3PZ3 A;  1TN6 A;  3EUV A;  3Q78 A;  1TNZ A;  1FT1 A; 
#chains in the Genus database with same CATH topology
 3ZW3 A;  4A1S A;  1NZN A;  3LDZ A;  5ENP D;  5ENR D;  3HHM A;  3KD7 A;  4CEM A;  2XQ0 A;  5CCM A;  3NOG D;  2YNQ A;  1KT0 A;  2AVP A;  3QC1 A;  2VYI A;  1TNY A;  1N95 A;  2R02 A;  4WNF A;  3DSV A;  2R5S A;  4XZ4 A;  3HXE A;  2EIL E;  2GRP B;  5FIN A;  3FUK A;  3D9M A;  4K03 A;  4U07 A;  5D0Q D;  4ATZ D;  3EHN A;  3OXF A;  5ITZ F;  5EIL A;  4WWP A;  1SZA A;  4CGW A;  3KSQ A;  5LOZ A;  4UWK A;  3HG0 D;  1JWG A;  4BET A;  2EIK E;  4DRX E;  3LYA A;  2X6H A;  5LCW C;  4HI8 A;  4CYM D;  2V4H C;  4RQI A;  4F1S A;  4EQF A;  3Q9N C;  2XZD G;  2R59 A;  2A5U A;  1YYH A;  3GZ2 A;  2ETA A;  5JA4 D;  2V4L A;  4HOR A;  3VLE A;  1NL4 A;  4WAF A;  2OOE A;  3D9K A;  3DEP A;  4EHM A;  5G04 C;  2PNN A;  1X5B A;  4QQI A;  4AOF A;  3ML8 A;  3ABK E;  1DNP A;  3Q47 B;  5BPP A;  1KPS B;  5KJK A;  1E7U A;  4U8V D;  3CVU A;  3SFZ A;  3K9I A;  3MX3 A;  5D66 A;  1Z3X A;  2WM9 A;  3P2B A;  3L54 A;  4JB8 P;  3CHS A;  5FT9 A;  5FQ8 A;  1U2V G;  5AEN A;  4KZ0 A;  2WXO A;  3CVP A;  1VDY A;  3D9I A;  1W3B A;  4MRU A;  2GRL A;  5T4Y A;  1E8Z A;  3FUM A;  4UUC A;  1IQR A;  2M63 A;  4JPS A;  3CVQ A;  3UUX A;  2GRR B;  2RKK A;  3V2X A;  4J8S A;  4B89 A;  3HXC A;  4FJZ A;  2HYZ A;  1E8W A;  3UM0 A;  5ANL A;  3ABL E;  2IU1 A;  3W9F A;  4HXI A;  2OVF A;  3RO3 A;  3EU5 A;  3MKQ A;  4XI9 A;  2FBN A;  2UWJ G;  4BSZ B;  4IYP A;  3PNL B;  3FTZ A;  4DX1 A;  4GML A;  5KNH D;  3D3M A;  4I1O B;  2Y4T A;  2OCC E;  3AG3 E;  3LY8 A;  3E30 A;  2XS8 A;  3AU5 A;  1N4Q A;  2P9S G;  4GZ6 A;  2C0M A;  4N5C A;  3LVR E;  4M3O A;  2AXU A;  4XIF A;  3LVQ E;  4ACL A;  2R05 A;  4I2Z A;  1Q2Z A;  3BG1 B;  1NFI E;  3PZD A;  3OXL A;  2GRN B;  2J9Q A;  3QDN A;  3RU0 A;  4U8Y D;  4XKB A;  2AXZ A;  3G2U A;  1EDU A;  4K5B A;  5BV0 A;  2IEJ A;  1H6K A;  3O4Z A;  1UJK A;  2IQC A;  3FUJ A;  1IKN D;  4AP2 A;  4MKT A;  4RSY A;  3HXB A;  3QAR A;  5T3R A;  3ONL A;  3EU9 A;  3S2A A;  4RG6 A;  3TWX A;  2X38 A;  4GTP A;  5B3S E;  1ELW A;  3SO8 A;  3TWU A;  3LEW A;  2XGM A;  3ISM C;  3ASF A;  4I2W A;  2LSU A;  4UI9 J;  1E8X A;  3R7R A;  1E8Y A;  5G05 J;  4U0S A;  3ULE G;  5DIZ A;  3PUK A;  3DSU A;  4GTR A;  3Q79 A;  5BNW A;  2DWZ A;  1K3Z D;  3IKO B;  5EX3 A;  3MV3 B;  4DX7 D;  3L9T A;  3ASH A;  3CVN A;  2J49 A;  2KCL A;  3CVV A;  4KBQ A;  4NRH B;  4BX8 A;  2FI7 A;  3FTW A;  2R17 C;  4APF A;  4ANU A;  3B7B A;  4I6G A;  1MX6 A;  4LCT A;  3C3R A;  2OND A;  2F0Y A;  3APF A;  4AY5 A;  4JW1 A;  1XNF A;  2LSV A;  5FQ7 A;  4OVV A;  1S70 B;  3EHM A;  3U3W A;  4Q94 A;  4A63 B;  3SFX A;  3OXG A;  4GPM A;  5CBO A;  5FZR A;  3RRU A;  2VTB A;  3Q7A A;  4B93 B;  4LG6 A;  3MA5 A;  4AY6 A;  1N0Q A;  2KCK A;  1HE8 A;  2ILR A;  1WY6 A;  2WXN A;  3RAU A;  3T8M A;  4APO A;  5BUZ A;  2IF4 A;  3VTY A;  4J8F A;  2Y4U A;  4GTT A;  2FEZ A;  2NC9 A;  3AU4 A;  4LRZ A;  3EHR A;  2JLB A;  4GYY A;  2KC7 A;  4J6I A;  3TWS A;  3PE3 A;  3QOU A;  3DST A;  4L2L A;  3CVY A;  3AS8 A;  2F37 A;  2C0L A;  4H7Y A;  2WQ7 A;  5KJL A;  4DI3 A;  4HNA D;  1JUQ A;  4TRQ A;  5AQ9 A;  2R03 A;  2VSO E;  3ZN3 A;  2B0O E;  1K1A A;  4I1A A;  4G8L A;  3PNT B;  3NB2 A;  5KNG A;  2QC9 A;  4JHJ A;  3ZXS A;  5FZQ A;  4F7A A;  2XCB A;  4BT9 A;  4JHK A;  3NAW A;  4KYO B;  2Y69 E;  3ZYQ A;  5C2Y A;  4OVU A;  5FQ4 A;  1TN7 A;  4WNE A;  2VGX A;  5B1B E;  1D9S A;  3FEX A;  1JWF A;  3B13 A;  4CGV A;  3ASN E;  2DIW A;  3FUI A;  4K5C A;  4IN3 B;  3HRA A;  3MGB A;  3E4B A;  3NOC D;  5FWQ A;  3SQV A;  2L6J A;  4EBA G;  1OXJ A;  3MKQ B;  2WQ6 A;  2HM8 A;  5AAO A;  4TV3 A;  1TYQ G;  2WXM A;  1Z5S C;  3R7Q A;  4UQY A;  4NUR A;  4EZJ A;  4DX6 D;  5EYL A;  4HLL A;  1N94 A;  1SZ9 A;  2BKK B;  3RIB A;  3S7B A;  4BFR A;  4ME2 A;  4XEI G;  5CEA A;  2PQN A;  4FC8 A;  4AM9 A;  3D9J A;  2RD0 A;  3TXN A;  4BEP A;  2LNI A;  2DBA A;  4JA7 A;  3UTM A;  4FLH A;  3JXJ A;  3IEG A;  2CHX A;  3Q78 A;  5J90 A;  5EX0 A;  3ULY A;  4XI0 A;  1YA0 A;  3AG2 E;  3QWW A;  4C48 B;  1BU9 A;  3LJ3 A;  4BT8 A;  2WXK A;  1JPL A;  4Y6C A;  1BLX B;  4EPZ A;  3ESK A;  4N2Q A;  4LNU D;  3APC A;  2ZGG A;  4BES A;  3U66 A;  4YDE A;  3JUI A;  3U9W A;  2QY7 A;  2E2E A;  3C3O A;  3EIQ C;  3TG5 A;  3B7T A;  1QZ2 A;  1OWO A;  1O1T A;  1PAQ A;  3RSE G;  1LF8 A;  4NIK A;  4MLP A;  5ENT D;  2DYR E;  1E96 B;  3CVW A;  2ION A;  3AS5 A;  1MX2 A;  4HBD A;  3ML9 A;  1HFA A;  3DSS A;  4ANX A;  4PS8 A;  3FUN A;  1NA3 A;  3SFY A;  2ZXW E;  3ZRH A;  3RRM B;  3FU3 A;  1HF8 A;  2MYO A;  1BI8 B;  1FT2 A;  1WDY A;  5AJD A;  2I6H A;  1MZC A;  1K1B A;  3TJP A;  2P2C P;  4I9C A;  4TXQ A;  2L0I A;  5AQB A;  2CHW A;  1A5E A;  4XE0 A;  4HS2 A;  4B94 A;  3TXM A;  4HI9 A;  2V8S E;  4EZL A;  2XEV A;  3FP3 A;  3CR3 A;  4X8Q A;  4EBA A;  3HVE A;  2XHE A;  4MS6 A;  1HG2 A;  2KZT A;  1OT8 A;  4ILI A;  3ZHE A;  1OWM A;  5AJL A;  2WXP A;  4FU3 A;  4G24 A;  2XRY A;  3QWP A;  4GTV A;  1HH8 A;  2J07 A;  5G2N A;  2QFC A;  1TN6 A;  3FU6 A;  4G25 A;  3LY7 A;  1U3D A;  1FT1 A;  5FTP A;  2KXP C;  3TL5 A;  1Y8M A;  1PY1 A;  2UY1 A;  3JQ1 A;  1N0R A;  4I43 A;  1PC2 A;  4J8Y A;  4L1B A;  4UWL A;  3IHY A;  1FVH A;  3PUJ A;  3VLD A;  3PH0 C;  3J5P A;  4JC8 A;  2VTB B;  2FUL A;  3CHQ A;  1N11 A;  1N54 A;  1K8K G;  4MBG A;  1GW6 A;  1DCQ A;  3EIJ A;  3QJZ A;  4YDY A;  4GCO A;  3Q7F A;  3X2Q E;  3FTX A;  4F6R D;  5HI7 A;  2A5E A;  1DCE A;  3DEO A;  3O48 A;  4DLQ A;  2WXH A;  3V30 A;  4NQ0 A;  1FCH A;  3UQ3 A;  4JD2 G;  4BTB A;  1O1S A;  4IUL A;  4AEZ C;  4FHK A;  4JZY A;  4WND A;  4O1O A;  1O1R A;  4GZD A;  4CDN A;  3L08 A;  4ZHB A;  3CLJ A;  3E37 A;  3HDX A;  3CHP A;  3MJW A;  2OEV A;  2JAB A;  4HOS A;  4GA0 A;  4U96 D;  5LFA A;  5EIB E;  3CKC A;  3IHV A;  2WVI A;  3QNK A;  4HRN A;  3TGO A;  4N5Q A;  3B7S A;  4U04 A;  1TNZ A;  3OTN A;  4U8H A;  3ZEF A;  1KLX A;  1QQE A;  4A3T A;  1MQS A;  3AJI A;  2B6C A;  1AWC B;  3L82 A;  3L16 A;  1RW2 A;  2DZO A;  4N39 A;  4GPK A;  4HVB A;  2HO1 A;  2IY0 C;  3GW4 A;  4YND A;  3ASG A;  2EIJ E;  1U3C A;  2VGX B;  2I1J A;  2VGY A;  2WMO A;  2XEE A;  3FU0 A;  3QB2 A;  3SGH A;  1IQU A;  5A7D B;  4CT0 A;  4KT6 B;  3CV0 A;  3FTY A;  5EDS A;  1NA0 A;  1DC2 A;  2RFA A;  2IFU A;  3V79 K;  4AV7 A;  3D9N A;  3FTS A;  1QNF A;  2XPY A;  5ENN A;  4W9R A;  5LX8 A;  4B0Z A;  5CED B;  3PRE A;  4GTM A;  2KAT A;  2LAH A;  4N3A A;  4TUU A;  3FTU A;  5CMW A;  2HR2 A;  2R2L A;  3DPY A;  2L0T B;  3T9K A;  4NAC A;  1N9A A;  3I5P A;  3CQG B;  4CZ2 D;  2DVW A;  4BY6 A;  1H2V C;  3T5X A;  3NZU A;  3BEE A;  4P29 A;  3S7D A;  5CBN A;  2LO6 A;  1TJC A;  2WPV A;  5E76 A;  3ULQ A;  2GGF A;  2ZGD A;  5M72 A;  4HQD A;  1HG5 A;  2EIN E;  3KAE A;  3ZUV B;  1TJF A;  2WQH A;  4ILH B;  4LNB A;  3ZGQ A;  3U4T A;  4PS3 A;  3ASO E;  3D9P A;  2QYU A;  4ILG A;  2XZT G;  2J4D A;  4UWF A;  3GZS A;  2OV8 A;  2BKG A;  1MYO A;  4GCN A;  3Q75 A;  3MYV A;  4TXR A;  4BX9 A;  2XGO A;  4JEU A;  4FAD A;  4ANV A;  5LP0 A;  2BED A;  3SY2 A;  3CK9 A;  3SD5 A;  4BWR A;  5CMY A;  3SI5 A;  4YVO A;  4Y6W A;  1MX4 A;  3JCK C;  4U0U A;  4LNG A;  3CST A;  5AIJ A;  4F1P A;  2AJA A;  1BD8 A;  4UI9 C;  2JEK A;  3FUF A;  2XEN A;  2Y1L E;  4WWN A;  1SQM A;  5G05 C;  4AVX A;  4U7E B;  5JJ6 A;  4J8E A;  3CK8 A;  4GA2 A;  3MZL B;  3GZ1 A;  3HVE B;  3C98 A;  2KZT B;  3ZHE B;  5DBK A;  1WM5 A;  4OYS A;  1OWP A;  4DUI A;  2J4B A;  3ASD A;  2OEW A;  3RO2 A;  2VSY A;  3CKB A;  2QZA A;  3NQP A;  1OCO E;  2UY1 B;  4DX5 D;  1SVX A;  4FLB A;  3UMV A;  2VSN A;  4BER A;  3CK7 A;  3D9L A;  2AXV A;  1OCZ E;  3ENE A;  4HOU A;  4EZK A;  2XEH A;  2PM7 A;  5JHA A;  1AP7 A;  2ETC A;  2DYS E;  3T8K A;  3DBS A;  1N4S A;  4ANW A;  4DPR A;  2ETB A;  3QKY A;  3BU8 A;  3ZYK A;  5JJ7 A;  5CRV A;  2L6B A;  4U63 A;  4JHR A;  4XKC A;  1JCS A;  3FU5 A;  2IOL A;  2GRQ B;  2LXL A;  2H6I A;  1KT1 A;  1YMP A;  4A3V A;  4JEH A;  3SBS A;  4I1M A;  2LUH A;  2CG2 A;  1UW4 B;  2I1K A;  1ZU2 A;  4G2V A;  3ZNG A;  3EHQ A;  2GRM A;  4DX2 A;  2F8Y A;  3AG4 E;  3ZKJ A;  1TNB A;  2Y0B G;  5B1A E;  5HRY A;  4EEC A;  1LTX A;  5HQ8 A;  2NSZ A;  2XPI A;  3Q9U C;  4GZ5 A;  1TNU A;  4PS7 A;  2XCC A;  3Q49 B;  5T8I A;  2EQX A;  3R9A B;  3UI2 A;  1SW6 A;  4KXK B;  3ZYL A;  4WNG A;  3HXD A;  5D0O D;  1MJ0 A;  3FH8 A;  2LAI A;  3E33 A;  3V31 A;  1JCQ A;  4AXH A;  3LXU X;  4FJY A;  2MOW A;  2FO1 E;  5FIO A;  5AYW D;  4KVO A;  3JXI A;  2Y3A A;  2X3M A;  5JMN D;  3ZU7 B;  4E85 A;  5ENS D;  1Y6I A;  3JYS A;  2I2O A;  4UWG A;  2ZIR A;  4JXT A;  3CHM A;  2ZIS A;  3P1U A;  2J8S D;  3FUH A;  4TXP A;  1RZ4 A;  3UIN C;  2DCP A;  4CDR A;  4HRL A;  1NI1 A;  2ZU6 B;  4L9P A;  2V0P A;  4YDO A;  2CHZ A;  1UN9 A;  3Q4A B;  1MHQ A;  3FUD A;  4I9E A;  3FDH A;  3AS4 A;  3DXK G;  4G11 A;  2AW6 A;  3EJN A;  2E0I A;  5EYP F;  5LCW J;  2P9U G;  1HZ4 A;  2J08 A;  2PZI A;  3LPZ A;  1TR4 A;  5KBA A;  4GA1 A;  3TWR A;  3B7R L;  3FFL A;  3HIZ A;  3JQ0 A;  2P9I G;  5A6C A;  3QK0 A;  2H6H A;  2MHK A;  4AIF A;  3URZ A;  5G04 J;  1UJJ A;  3EDT B;  4L23 A;  4JL0 A;  1IHG A;  1ELK A;  3UT4 A;  1IYG A;  5EID A;  2RG8 A;  4J8D A;  1FVF A;  4I17 A;  3SNX A;  4O60 A;  3RJV A;  4U0Z A;  5BW8 C;  4HFG A;  3SBT B;  2YHE A;  5CEC B;  3BG0 B;  5IY5 E;  5AAR A;  1HU3 A;  3I4R B;  3UIP C;  4ACK A;  2LXM A;  3FH7 A;  1EYH A;  5EKQ D;  3L22 A;  5G55 A;  5CER B;  1TN8 A;  4GB9 A;  4C0M A;  3UIO C;  2WXI A;  3VLF A;  1HX8 A;  3L17 A;  4M7C A;  4K0R A;  2WXF A;  5HKP A;  4U95 D;  4GTQ A;  2C2L A;  5FJY A;  3UT7 A;  1N4R A;  2WXQ A;  2P9N G;  2V5F A;  3IXE A;  4DLO A;  1OCR E;  5ANR A;  2XPZ A;  2F8X K;  5BV1 A;  3TWW A;  1EPU A;  3MCX A;  3G2T A;  2BF0 X;  2NXP A;  3LCA A;  2V5Q C;  2X6F A;  1H0A A;  1Z3Y A;  3S7J A;  4CCA A;  3RK6 A;  2YIN A;  3G2W A;  5E75 A;  4KVM A;  1ELR A;  3Q73 A;  1A17 A;  4LUN U;  5CRU A;  4GTO A;  4O1P A;  4L7T A;  1OWL A;  3CGH A;  2I9C A;  5D2M C;  4UQX A;  3E34 A;  3U64 A;  4WWO A;  3UXG A;  4CT4 A;  4D10 C;  3VTX A;  3FEY A;  1ZB1 A;  4AJW A;  4YDW A;  1OY3 D;  4ZFH A;  2BUG A;  1V55 E;  4O6F A;  4URK A;  3Q5M A;  3PRZ A;  4V3I A;  4ATG A;  2P9P G;  3ABM E;  4PH4 B;  1INZ A;  3B7U X;  3PEV B;  3F6Q A;  4RVB A;  4J0U A;  4C9B B;  2WXL A;  3N71 A;  3QWV A;  4PDX A;  3G2V A;  4R7L A;  3ZIM A;  4GZC A;  5ENQ D;  4GMR A;  1O5M A;  2HE0 A;  3DRA A;  4G8K A;  3RRN B;  3KEZ A;  1E7V A;  5J08 A;  4HOT A;  3WXX A;  4FP7 A;  1QBQ A;  5KWD A;  3C5R A;  3FUL A;  3UM1 A;  2KM4 A;  3PVL A;  3PZ1 A;  4IRU A;  4UWH A;  3ZYM A;  4DJA A;  4A1G A;  4Q69 A;  2MRI A;  3G2S A;  1UOH A;  1OWN A;  4XX5 A;  2YQ8 A;  4Q96 A;  2CFZ A;  3E32 A;  2X6K A;  2KCV A;  1S63 A;  2XGS A;  5BT1 A;  3ONK A;  2P9L G;  3J5Q B;  4JA9 A;  2WXJ A;  2VJ8 A;  3MKR A;  2H6F A;  5FQ6 A;  4GAA A;  3PZ3 A;  2X6J A;  2X6I A;  4FA6 A;  2IJG X;  3KEA A;  4ABN A;  1KZP A;  1SA4 A;  5AN8 A;  1UN8 A;  2IO3 C;  3SZ7 A;  3LS8 A;  3CEQ A;  3FHE A;  2WMN A;  3R9M A;  1YCS B;  3C3Q A;  3IV0 A;  3DXM G;  4UQZ A;  3MEK A;  2XS1 A;  1LD7 A;  2OVB A;  3KSL A;  1Z6T A;  1D8E A;  5AQA A;  2PL2 A;  1H2U A;  3W9G A;  1EF1 C;  3TAX A;  4HRM B;  3NBN B;  3I4G A;  5A23 A;  1NP7 A;  3IBE A;  2Q7F A;  2CFU A;  1L5J A;  3LY9 A;  1E90 A;  1H6O A;  3AAA C;  3FH5 A;  3L6A A;  3OAW A;  4FHJ A;  3QAQ A;  1HS6 A;  1QYM A;  3CQC B;  1S64 A;  1WAO 1;  3UX4 A;  3TG4 A;  2A4Z A;  2KBX A;  3ZFW A;  3DSX A;  1UG3 A;  2H6G A;  5ARG A;  4J7W A;  3SHF A;  5C1D A;  5CHE E;  4LEU A;  5KJN A;  1H6P A;  3D9O A;  4RG9 A;  5FZS A;  3PE4 A;  4K5A B;  4FUL A;  3BUA A;  3GYZ A;  5JHB A;  3S7F A;  1LD8 A;  2FF4 A;  1TNO A;  2IOS A;  4GYW A;  1OUV A;  3DSW A;  2P9K G;  4OAU C;  3V2O A;  3TWQ A;  2VGE A;  3PEU B;  3PZ4 A;  1X81 A;  4OAV B;  1JCR A;  3LKU A;  3JUE A;  2P58 C;  1OCC E;  1HO8 A;  4LSZ E;  5HS0 A;  3Q15 A;  2YHC A;  3UM3 A;  3TWV A;  3CIA A;  3KS2 A;  3RKV A;  2RFM A;  4DK5 A;  4GTS A;  4GZ3 A;  2GRO B;  5AQ7 A;  3DWL G;  3UKR G;  4GU5 A;  3DPD A;  4A55 A;  5KJM A;  4HB5 A;  3PDN A;  4I6J A;  4WUY A;  4YVQ C;  3FUE A;  1XGW A;  4F3V A;  3PS6 A;  4DI4 A;  4F53 A;  1IHB A;  2DZN A;  3CVX A;  3FTV A;  3CVL A;  3HYM B;  1BPO A;  4KMO A;  3MV2 B;  2AWI A;  2FO7 A;  4JVS A;  4CDM A;  4TUM A;  3FWV A;  3UM2 A;  4QFV A;  2WB2 A;  2WXG A;  3C72 A;  5CCL A;  1N4P A;  3ESL A;  4KZC A;  2VSX E;  4B8C B;  3FY4 A;  1ZBP A;  4C0E A;  3HXF A;  4GMJ A;  4N3C A;  3ZXP A;  4HLE A;  1DVP A;  4LER A;  2VQ2 A;  5ARF A;  4BTA A;  1KZO A;  4B8A A;  3T5V A;  4Z68 A;  2J09 A;  2L9B A;  1D8D A;  1S0P A;  1BI7 B;  1B89 A;  3D9H A;  2BTD A;  1H19 A;  3PZ2 A;  3UT8 A;  3I3N A;  4H7X A;  2CG3 A;  3TWT A;  4N3B A;  4BSX A;  1V54 E;  2IO2 C;  1G3N B;  3AG1 E;  3NZS A;  3SF4 A;  2EIM E;  2PM6 A;  4L2Y A;  3CSF A;  2XRZ A;  3NF1 A;  1H2T C;  1HXI A;  2PQR A;  4HOQ A;  5JJT A;  2GW1 A;  4UI9 K;  4G26 A;  4RLY A;  3UPV A;  2QYJ A;  3UKU G;  4I6E A;  3L13 A;  1P5Q A;  1SA5 A;  3APD A;  4G23 A;  1FPP A;  4G1T A;  4PUC A;  4GYO A;  5BXU A;  3WG7 E;  3B95 A;  2WXR A;  3ZVV A;  3CHR A;  3CHO A;  5ENO D;  3BQO A;  5EN5 D;  1WG0 A;  1IXV A;  1TEZ A;  2NYJ A;  4CRW A;  3ZPJ A;  4E6H A;  3LJN A;  3EUV A;  5H7P A;  4N2S A;  1N52 A;  5BXO A;  5KCM A; 
#chains in the Genus database with same CATH homology
 1KZP A;  1SA4 A;  3HXD A;  3HXF A;  1LD8 A;  1TNO A;  3E33 A;  1JCQ A;  3DSW A;  1KZO A;  2F0Y A;  4LNB A;  1D8D A;  4YDE A;  1TNY A;  1N95 A;  1LD7 A;  3PZ2 A;  3DSV A;  1TN8 A;  1O1T A;  3PZ4 A;  2ZIR A;  3HXE A;  3KSL A;  2ZIS A;  3SFX A;  1X81 A;  1N4S A;  1O5M A;  1JCR A;  1D8E A;  2IEJ A;  1TN7 A;  3Q7A A;  3DRA A;  4MBG A;  1NI1 A;  3Q75 A;  1JCS A;  4L9P A;  4YDO A;  3HXC A;  4GTQ A;  2BED A;  3HXB A;  3KSQ A;  3DSS A;  1N4R A;  2H6I A;  3Q7F A;  4GTP A;  1QBQ A;  3SFY A;  1DCE A;  4GTS A;  4LNG A;  4GTT A;  3PZ1 A;  1FT2 A;  3EU5 A;  1MZC A;  3DST A;  1O1S A;  1SA5 A;  1TNB A;  1N94 A;  1FPP A;  1S64 A;  4GTM A;  3Q73 A;  1O1R A;  1LTX A;  3DSU A;  3E30 A;  3E32 A;  4GTO A;  4GTR A;  2R2L A;  3DSX A;  3DPY A;  1N4Q A;  3Q79 A;  1S63 A;  2H6G A;  3E37 A;  2H6H A;  1NL4 A;  1TNU A;  3C72 A;  4EHM A;  1N9A A;  1N4P A;  3E34 A;  2H6F A;  4GTV A;  3PZ3 A;  1TN6 A;  3EUV A;  3Q78 A;  1TNZ A;  1FT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...