4GTPA

Ftase in complex with bms analogue 16
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 4gtpA00
3Q7FA 1FPPA 1FT2A 1QBQA 1N95A 3DSUA 1TNOA 3Q79A 4GTRA 3HXDA 1KZPA 2ZISA 3KSQA 1FT1A 4L9PA 4GTVA 1TNUA 3E32A 1X81A 3PZ4A 3DSSA 3C72A 4GTTA 1N4RA 1N4QA 1SA4A 1TN7A 4GTSA 1S64A 3HXBA 1DCEA 1TNYA 1NL4A 1JCQA 4YDOA 1LD7A 3EUVA 1N4SA 4MBGA 1N94A 1D8EA 4GTQA 4EHMA 1SA5A 4GTPA 2H6FA 1TNZA 1O1RA 2H6IA 3E30A 1O1TA 3HXEA 3Q75A 1O5MA 1S63A 3HXFA 1LD8A 3E33A 3E34A 4YDEA 3DSVA 1N4PA 3EU5A 3E37A 1N9AA 1O1SA 3PZ3A 3PZ2A 3DSXA 2ZIRA 1JCRA 2IEJA 1LTXA 1TNBA 4LNGA 1NI1A 3DRAA 1JCSA 4GTMA 1MZCA 2BEDA 2R2LA 3HXCA 3Q78A 3SFXA 1D8DA 3PZ1A 2F0YA 3DPYA 3KSLA 2H6GA 1TN6A 3Q7AA 4LNBA 4GTOA 3Q73A 3SFYA 3DSTA 2H6HA 1TN8A 1KZOA 3DSWA
chains in the Genus database with same CATH superfamily
2PQRA 3F6QA 4F6RD 3Q49B 4CYMD 2XZTG 3JCKC 2AW6A 4GTRA 4OAUC 3KSQA 2AXUA 3UKUG 4L9PA 4FU3A 1TNUA 3PE3A 1PY1A 3OXGA 4JD2G 5FT9A 1Q2ZA 5DBKA 4FLBA 4JA9A 4CGVA 1U3CA 4NRHB 2EIJE 2KBXA 1TN7A 3QDNA 3G2TA 3MYVA 5G55A 2GRLA 3QB2A 3D9KA 4C0EA 4GPKA 2Q7FA 2LSVA 3EU9A 5FQ8A 3S2AA 4B0ZA 4NURA 4YVQC 3TJPA 2XENA 2XPYA 3GZ2A 4N2QA 4O6FA 3QWPA 4A3TA 5BV0A 2H6FA 3IBEA 2H6IA 5EYPF 2KCKA 1TJFA 1WG0A 3UT7A 2LAIA 2JABA 1N4PA 1GW6A 2VSXE 3AJIA 3RO3A 4AY5A 2DZOA 4B94A 3J5PA 3DRAA 4DX5D 3CKCA 4KYOB 4DRXE 3TG4A 4K5BA 3ZNGA 1OCRE 1TN6A 3ASHA 4GTOA 2IONA 4DX6D 1HZ4A 4DK5A 3QC1A 3UQ3A 4O1PA 4U95D 4A55A 3AG3E 2X6IA 1EYHA 1FPPA 5AN8A 4ZFHA 1MJ0A 4GZCA 4KT6B 5AJDA 2RKKA 4BT9A 1KZPA 3DBSA 4CDMA 4IULA 1UJJA 2HR2A 4TUMA 1Z6TA 4U07A 1HG2A 5FINA 4GB9A 1E8WA 2X6JA 3CSFA 3FTYA 1S64A 4GZ5A 4YDYA 5D0OD 4ZHBA 1MYOA 3L17A 3FUMA 3V2XA 4FJZA 3SF4A 2WXHA 5EIBE 2JLBA 2J09A 5E75A 3APCA 5JA4D 3D9OA 1N0QA 3CQGB 4AY6A 2WQ6A 2LSUA 2DYSE 2EIME 2R59A 3FHEA 3HXEA 4BEPA 5BT1A 3SFZA 3IHYA 4GA2A 1KT1A 3OXFA 1AWCB 3HVEA 3PZ2A 2QYJA 2WXFA 3B95A 3FUJA 2IQCA 4PUCA 5CEDB 2A5UA 3AAAC 4G8KA 3PZ1A 4GA1A 4EZLA 3UM0A 3NOCD 2PNNA 3V31A 2R5SA 3FFLA 1H6PA 3UIOC 4UWHA 3JYSA 4JZYA 4DPRA 4Q69A 4ACLA 5CCLA 5AARA 1E96B 3QAQA 4UQZA 3SBSA 5AENA 3LCAA 2WXPA 1H2VC 3L22A 4ANUA 2XQ0A 4DX2A 4GCOA 2CFZA 2NXPA 3ASOE 1V55E 4GTSA 3T8KA 2GRMA 5D2MC 2P9NG 2L9BA 2FI7A 3FTXA 3JXIA 4CRWA 4DUIA 4NACA 3L08A 4L23A 1HH8A 3D9PA 4JA7A 2A5EA 3D9IA 4IN3B 4GZDA 2DBAA 2XCBA 3E4BA 1MQSA 1K1BA 2VYIA 3QNKA 3Q75A 3CV0A 1BPOA 3U4TA 2JEKA 4JEHA 1OWOA 3T9KA 4MKTA 4RG6A 3JQ1A 1BU9A 5T4YA 1JCRA 3V2OA 4LNGA 5AIJA 2LNIA 4CEMA 2P9LG 1OWLA 4BETA 4BT8A 2EINE 2R2LA 4ANWA 4BX9A 2J4BA 2QY7A 5A23A 3DXKG 2X6KA 4HORA 5KJLA 5CHEE 3JUIA 3UT4A 4N3BA 4G24A 2GRRB 2E2EA 3CHQA 4IRUA 1WM5A 1N95A 4RVBA 4B89A 4L2YA 4QFVA 2L6JA 1YYHA 2FF4A 3CK9A 2VGEA 4CT4A 2VSNA 2WXGA 5FZQA 4F53A 1HS6A 1ZB1A 4KVMA 1DCEA 1AP7A 3UM3A 4I1AA 5FQ4A 3LVQE 4NIKA 4ATZD 3X2QE 1A5EA 2WXMA 2F8YA 4GMLA 4FLHA 3WG7E 4GTQA 3ONKA 5HS0A 2P9KG 2IF4A 5KJKA 3FH8A 2NYJA 2KZTB 3I4GA 4HI8A 2ETAA 3HRAA 3LPZA 3OAWA 1N52A 1Z5SC 5EX3A 2DCPA 3UKRG 1O1SA 4TV3A 4BESA 3FDHA 3L82A 3FEYA 2ZGGA 5AQAA 5JHAA 2DWZA 4GMRA 3FUDA 4V3IA 2Y69E 2ILRA 5E76A 4CCAA 1DC2A 2XRYA 3ZPJA 3CSTA 3NF1A 4HB5A 1N11A 1SZAA 4KMOA 3CVWA 3Q79A 5ENRD 1ELRA 5ENPD 1PC2A 1RZ4A 2PQNA 3E32A 2AXVA 3ASNE 3QWWA 3EHMA 3KEAA 3ULEG 3AS5A 5M72A 3PVLA 4JPSA 1A17A 3FUNA 3B7BA 4GYOA 5CRUA 4OVUA 2MRIA 2EQXA 2FBNA 3FTZA 3EUVA 3GZ1A 2BUGA 4EZKA 3ENEA 3QARA 1TNZA 2OV8A 1B89A 4FC8A 3OTNA 5KNGA 4A63B 2LUHA 2WM9A 2ZXWE 4LG6A 1LD8A 3ZU7B 3U64A 1U2VG 2KC7A 3PDNA 4G23A 5KJNA 3LXUX 3JUEA 2UWJG 3CR3A 3UM2A 2IY0C 5FQ6A 4N5CA 4JHKA 2WXQA 4GTMA 1MZCA 3PUKA 5BV1A 1E7VA 3SD5A 2RG8A 3BEEA 3PE4A 5CMYA 4FP7A 4GMJA 4JEUA 2VSOE 3ZYQA 3NB2A 3BU8A 4E6HA 3PRZA 4HXIA 4AXHA 1X5BA 3MKQA 4O60A 3LY8A 3AG1E 3T8MA 2P2CP 2P58C 2VGXB 4F1SA 4HVBA 3S7BA 3ZUVB 4HLLA 2KM4A 2V5FA 3RJVA 3ZKJA 3CKBA 4U0SA 2DZNA 4DLQA 1SA5A 3FY4A 2R17C 3LY9A 4K5CA 1IHGA 4DI4A 1ELKA 3CQCB 5EIDA 2OCCE 1IKND 3GZSA 1BLXB 3E33A 1H0AA 3EU5A 3E37A 3FTUA 3UI2A 3UPVA 2AWIA 5ENNA 4FHJA 3CVVA 5AJLA 3HXCA 4ANXA 4EBAA 1OT8A 3KSLA 2C2LA 3ASGA 2KCVA 3SFYA 3DSTA 4A1GA 2WXJA 4Q96A 2GW1A 3FU5A 5T3RA 5ARFA 1OWMA 1QBQA 2WXKA 1IQRA 2CHZA 3ZEFA 3PZ4A 1UW4B 4BERA 4CDRA 2WVIA 4GAAA 4I17A 1KT0A 3ZFWA 1SA4A 4BTBA 5BUZA 1TR4A 4CDNA 4F3VA 2XPZA 4AVXA 4MRUA 4BSXA 4FJYA 3RK6A 4PH4B 4HBDA 3MV3B 3W9FA 5CMWA 4JHJA 3DXMG 4XE0A 1N94A 2AJAA 3ULQA 1EPUA 4APFA 2QC9A 3EJNA 4I9CA 4L7TA 4HI9A 5FZRA 1O5MA 2OEWA 3B7TA 4I43A 1UG3A 1SVXA 3SI5A 2GRPB 4UUCA 1UOHA 4LSZE 1EF1C 4JW1A 4KXKB 5J08A 3SO8A 4U8HA 3CGHA 1H6OA 4LNBA 5ITZF 3Q5MA 4N39A 3PNLB 3O48A 3S7DA 1PAQA 2AXZA 3ABKE 2KXPC 3ESLA 4BFRA 1MX6A 2A4ZA 3TWRA 1EDUA 5EX0A 4C9BB 4EECA 4ATGA 4L2LA 1IQUA 5EKQD 5KJMA 3RSEG 4JHRA 4KBQA 3CVQA 5ARGA 3FUFA 4K5AB 1HO8A 3RRNB 2LO6A 4B93B 3K9IA 5H7PA 1NP7A 3L9TA 1YA0A 2P9PG 3UINC 5JJ6A 1NL4A 4D10C 3PREA 1QZ2A 5AQ7A 4MBGA 4N3CA 3R7QA 5KCMA 4J6IA 4HOTA 2KATA 1OCCE 4EHMA 2OVFA 1G3NB 3I3NA 4UWLA 3FWVA 3FTSA 5T8IA 3ISMC 4TXPA 3VLEA 5BXUA 3HXFA 4HRLA 2Y3AA 2QFCA 5LCWC 1OWPA 5ANRA 3L54A 2I9CA 4M3OA 1NI1A 4PDXA 1OCOE 2I6HA 3EDTB 3TXMA 3U66A 1DNPA 3WXXA 3FUIA 5AQBA 4JL0A 3TWVA 1IHBA 3ZGQA 3D9LA 3APFA 5KNHD 3D9HA 2VJ8A 3MA5A 4KVOA 5ENQD 4N2SA 2CHWA 4LUNU 5C2YA 2FEZA 3IHVA 4WUYA 3UM1A 2HE0A 1N54A 2OOEA 3DSUA 4WNEA 5LCWJ 4DJAA 2ZISA 1HXIA 2I1KA 2X6HA 3FUEA 4HLEA 4R7LA 5B1AE 3B13A 3FU0A 4ILGA 4IYPA 3IEGA 2WXOA 5FWQA 3I4RB 4RSYA 1NA3A 4UWGA 3UIPC 2YINA 4HRNA 1U3DA 1WY6A 4FULA 3MEKA 4UWFA 2XZDG 4EBAG 1FCHA 1Z3YA 1H6KA 4EZJA 2ONDA 4HNAD 1D8EA 3CHRA 1UN8A 2VTBB 2HO1A 3FP3A 3JXJA 2GRNB 2BF0X 3Q9UC 4I9EA 3ABLE 1H19A 3TWTA 3O4ZA 4TXQA 3QK0A 3IKOB 1N9AA 2BKGA 3UMVA 2Y4UA 4DI3A 2Y0BG 2B0OE 2IFUA 3QJZA 2CHXA 3HYMB 2J9QA 3LDZA 3J5QB 3TWWA 3Q78A 4U8YD 1D9SA 2HYZA 1JWFA 3ZRHA 2EIKE 1KZOA 4RG9A 3ULYA 2P9IG 3LJ3A 3BG0B 2I2OA 3LVRE 2F8XK 4U8VD 1QNFA 2WXRA 4GTVA 3ML8A 1NFIE 3TL5A 4N3AA 1TYQG 3C72A 4FHKA 5C1DA 4XZ4A 3I5PA 2KZTA 5HRYA 4Z68A 3PUJA 2BKKB 4DLOA 3Q47B 3ONLA 2B6CA 2VSYA 5BW8C 4AP2A 3TWUA 3DWLG 5CBNA 3ML9A 1LD7A 1N4SA 2WB2A 1V54E 2WXNA 2J49A 3MZLB 1BI7B 4JXTA 4ME2A 3B7UX 2XGOA 1O1RA 4A1SA 4YVOA 4OVVA 1RW2A 3QOUA 2V5QC 3TGOA 3Q4AB 5LX8A 2FO1E 5D0QD 3E34A 4ILHB 3CHSA 2QYUA 3U9WA 1IYGA 5FQ7A 1MHQA 2XEHA 5CCMA 3TWXA 4H7YA 5EILA 2H6GA 5HI7A 1JPLA 4XX5A 4Q94A 3Q73A 1UN9A 4QQIA 5HKPA 3ESKA 3R7RA 2ETBA 3CEQA 3SNXA 3EHRA 2NC9A 4EPZA 3ZXSA 2WMNA 2ZU6B 4UI9C 1YMPA 3CVPA 1Y6IA 3TWSA 2WXIA 3PS6A 3DSSA 3C5RA 1N4RA 3SBTB 4YNDA 3HDXA 3ZW3A 1MX4A 4WNGA 4TUUA 3SHFA 1H2TC 4JC8A 3C3OA 2YHEA 3L16A 4U0ZA 3RIBA 1OUVA 4LERA 4MS6A 2J07A 3CHPA 5BPPA 2V8SE 1K3ZD 4G1TA 2WQ7A 3KD7A 1HU3A 3HG0D 4GTPA 4UI9J 1E8ZA 3LJNA 3CVLA 1S70B 4I2ZA 1HX8A 4LCTA 2IOSA 3T5VA 1O1TA 3RKVA 1S63A 5AQ9A 3RAUA 2MHKA 3AU5A 2YQ8A 3HHMA 2R02A 2ETCA 2OEVA 2XGMA 2IEJA 1LTXA 1TNBA 1HF8A 1QQEA 3B7RL 5IY5E 5EYLA 3SGHA 3EHNA 4LRZA 3NBNB 3MJWA 2BEDA 3B7SA 4LNUD 2F0YA 3DPYA 1E90A 4XI0A 3U3WA 4K03A 3Q7FA 2J08A 4G25A 5D66A 3URZA 5ENOD 2CFUA 4BWRA 2VGXA 5KBAA 5EN5D 1INZA 4A3VA 5EDSA 3AS4A 3FTWA 1YCSB 3ZYKA 4J8SA 3CK8A 2MYOA 1LF8A 3QKYA 4KZ0A 4HRMB 3AG2E 2RFMA 1UJKA 4URKA 3FU6A 3R9MA 4GZ6A 5LOZA 2V4HC 4HOQA 3LYAA 2X38A 3CVXA 1OY3D 2WMOA 3CIAA 2VGYA 4TXRA 2IOLA 3NZSA 4HOUA 1WDYA 4AM9A 4CZ2D 3C98A 1SQMA 2YNQA 5B3SE 2V4LA 2IU1A 2ZIRA 4UWKA 4OAVB 4HS2A 3ZN3A 5JJ7A 5JJTA 3G2VA 1IXVA 5JMND 3VTYA 2YHCA 5FIOA 2LXMA 4AJWA 3MCXA 4FA6A 5JHBA 2H6HA 3UX4A 4WNFA 1Z3XA 5CEAA 3HVEB 3KS2A 4XIFA 3KAEA 3CHOA 1S0PA 5B1BE 4M7CA 4RLYA 5ANLA 3ZYMA 4PS7A 4APOA 3VLDA 4WAFA 3GYZA 3SQVA 2RFAA 3UTMA 2L0IA 2GGFA 2E0IA 2OVBA 3CK7A 1ELWA 4ILIA 1HE8A 1XGWA 4GPMA 5BNWA 1N4QA 3MGBA 4UQXA 1TEZA 3EHQA 4BY6A 4I6EA 3TG5A 4YDWA 4J0UA 2IO2C 2XEEA 4G8LA 3JQ0A 4WNDA 4EQFA 3KEZA 5FTPA 2L0TB 2XS8A 2EILE 1W3BA 1ZU2A 4U96D 4XI9A 2J4DA 1OWNA 2NSZA 3R9AB 1WAO1 2QZAA 3AG4E 3Q15A 3ZVVA 3RRMB 5G2NA 4AOFA 3PNTB 4I1OB 4P29A 3P1UA 3IV0A 4WWPA 4ACKA 3L13A 5J90A 3NAWA 4Y6WA 1NA0A 3ASDA 3BG1B 3UT8A 2FULA 1VDYA 3OXLA 4I6JA 5AYWD 2FO7A 3VLFA 3Q7AA 1Y8MA 4C0MA 5G04C 2ZGDA 4FADA 4W9RA 3QWVA 1TN8A 3CVYA 3DSWA 1K8KG 4CT0A 4BTAA 1FT2A 1N0RA 5ENSD 4AEZC 3EIJA 1TNOA 4C48B 4NQ0A 5HQ8A 2C0LA 1TJCA 4GZ3A 3DEPA 3L6AA 4ANVA 1X81A 3PEUB 2XCCA 4Y6CA 2P9UG 4KZCA 2WXLA 5KWDA 2LAHA 4DX1A 4DX7D 4BSZB 1SZ9A 4UI9K 4B8AA 4PS3A 1H2UA 4J7WA 5G04J 3RRUA 2GROB 1DVPA 1JCQA 5G05C 3V79K 3FUHA 4G2VA 3D9MA 4JVSA 3G2SA 2RD0A 3UXGA 5DIZA 1P5QA 3ZHEB 4G11A 3D3MA 4E85A 2IJGX 2Y1LE 2XEVA 1SW6A 5ENTD 4B8CB 3APDA 3FULA 4ABNA 4J8YA 1OCZE 3HIZA 4WWNA 1MX2A 2CG3A 2GRQB 3C3QA 5G05J 1JWGA 3AU4A 4G26A 4O1OA 3FUKA 3NOGD 1D8DA 3LS8A 3MV2B 3ZIMA 3FU3A 2C0MA 1QYMA 4AIFA 4HFGA 4RQIA 5AAOA 3ZHEA 3W9GA 4N5QA 3BQOA 1K1AA 3DPDA 2R03A 1OXJA 4HOSA 5LFAA 2DIWA 5A7DB 3HXDA 1KLXA 2XPIA 1FT1A 5BXOA 4LEUA 4GCNA 5A6CA 4X8QA 2VTBA 4J8EA 2XRZA 3G2UA 3HXBA 1FVHA 3MX3A 3G2WA 2XGSA 1TNYA 3D9NA 3V30A 2F37A 3P2BA 4J8DA 5CBOA 1ZBPA 4WWOA 4U7EB 2PL2A 2X3MA 3LY7A 3BUAA 3AS8A 3E30A 2LXLA 4K0RA 3FTVA 1KPSB 3RO2A 1DCQA 4I1MA 4F7AA 3ABME 4UQYA 2XS1A 4H7XA 3SY2A 4U0UA 3VTXA 3PZ3A 1BI8B 4F1PA 2AVPA 3TAXA 3T5XA 2PM6A 4XKCA 3NZUA 2X6FA 4AV7A 4JB8P 3MKRA 2L6BA 3S7FA 2Y4TA 3SZ7A 1HFAA 3CVUA 4GYWA 3CLJA 3DEOA 4TRQA 4OYSA 3ZYLA 2V0PA 3D9JA 2CG2A 1HG5A 2IO3C 3FEXA 4HQDA 4I6GA 3C3RA 4GU5A 3EIQC 4GA0A 2KCLA 3LEWA 1BD8A 2VQ2A 2DYRE 2HM8A 2WPVA 4GTTA 2WQHA 2J8SD 2UY1B 3ASFA 4J8FA 5CERB 3FH5A 1E8YA 3RU0A 2PZIA 4MLPA 1E8XA 5CECB 1XNFA 4YDOA 4U04A 3PEVB 2BTDA 3CVNA 3TWQA 3ZXPA 5CRVA 2DVWA 4I2WA 3MKQB 3PH0C 3TXNA 3IXEA 1L5JA 2R05A 3NQPA 3N71A 4XKBA 1FVFA 4XEIG 3UUXA 1E7UA 2M63A 2P9SG 4YDEA 3DSVA 3GW4A 2MOWA 2UY1A 3FH7A 4PS8A 3DSXA 5FZSA 3CHMA 3S7JA 3PZDA 1JCSA 2PM7A 4BX8A 1JUQA 2I1JA 3LKUA 4CGWA 3SFXA 4GYYA 5FJYA 5LP0A 1NZNA 4U63A 2XHEA 4L1BA 3Q9NC
chains in the Genus database with same CATH topology
3Q7FA 1FPPA 1FT2A 1QBQA 1N95A 3DSUA 1TNOA 3Q79A 4GTRA 3HXDA 1KZPA 2ZISA 3KSQA 1FT1A 4L9PA 4GTVA 1TNUA 3E32A 1X81A 3PZ4A 3DSSA 3C72A 4GTTA 1N4RA 1N4QA 1SA4A 1TN7A 4GTSA 1S64A 3HXBA 1DCEA 1TNYA 1NL4A 1JCQA 4YDOA 1LD7A 3EUVA 1N4SA 4MBGA 1N94A 1D8EA 4GTQA 4EHMA 1SA5A 4GTPA 2H6FA 1TNZA 1O1RA 2H6IA 3E30A 1O1TA 3HXEA 3Q75A 1O5MA 1S63A 3HXFA 1LD8A 3E33A 3E34A 4YDEA 3DSVA 1N4PA 3EU5A 3E37A 1N9AA 1O1SA 3PZ3A 3PZ2A 3DSXA 2ZIRA 1JCRA 2IEJA 1LTXA 1TNBA 4LNGA 1NI1A 3DRAA 1JCSA 4GTMA 1MZCA 2BEDA 2R2LA 3HXCA 3Q78A 3SFXA 1D8DA 3PZ1A 2F0YA 3DPYA 3KSLA 2H6GA 1TN6A 3Q7AA 4LNBA 4GTOA 3Q73A 3SFYA 3DSTA 2H6HA 1TN8A 1KZOA 3DSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7F A;  1FPP A;  1FT2 A;  1QBQ A;  1N95 A;  3DSU A;  1TNO A;  3Q79 A;  4GTR A;  3HXD A;  1KZP A;  2ZIS A;  3KSQ A;  1FT1 A;  4L9P A;  4GTV A;  1TNU A;  3E32 A;  1X81 A;  3PZ4 A;  3DSS A;  3C72 A;  4GTT A;  1N4R A;  1N4Q A;  1SA4 A;  1TN7 A;  4GTS A;  1S64 A;  3HXB A;  1DCE A;  1TNY A;  1NL4 A;  1JCQ A;  4YDO A;  1LD7 A;  3EUV A;  1N4S A;  4MBG A;  1N94 A;  1D8E A;  4GTQ A;  4EHM A;  1SA5 A;  4GTP A;  2H6F A;  1TNZ A;  1O1R A;  2H6I A;  3E30 A;  1O1T A;  3HXE A;  3Q75 A;  1O5M A;  1S63 A;  3HXF A;  1LD8 A;  3E33 A;  3E34 A;  4YDE A;  3DSV A;  1N4P A;  3EU5 A;  3E37 A;  1N9A A;  1O1S A;  3PZ3 A;  3PZ2 A;  3DSX A;  2ZIR A;  1JCR A;  2IEJ A;  1LTX A;  1TNB A;  4LNG A;  1NI1 A;  3DRA A;  1JCS A;  4GTM A;  1MZC A;  2BED A;  2R2L A;  3HXC A;  3Q78 A;  3SFX A;  1D8D A;  3PZ1 A;  2F0Y A;  3DPY A;  3KSL A;  2H6G A;  1TN6 A;  3Q7A A;  4LNB A;  4GTO A;  3Q73 A;  3SFY A;  3DST A;  2H6H A;  1TN8 A;  1KZO A;  3DSW A; 
#chains in the Genus database with same CATH topology
 2PQR A;  3F6Q A;  4F6R D;  3Q49 B;  4CYM D;  2XZT G;  3JCK C;  2AW6 A;  4GTR A;  4OAU C;  3KSQ A;  2AXU A;  3UKU G;  4L9P A;  4FU3 A;  1TNU A;  3PE3 A;  1PY1 A;  3OXG A;  4JD2 G;  5FT9 A;  1Q2Z A;  5DBK A;  4FLB A;  4JA9 A;  4CGV A;  1U3C A;  4NRH B;  2EIJ E;  2KBX A;  1TN7 A;  3QDN A;  3G2T A;  3MYV A;  5G55 A;  2GRL A;  3QB2 A;  3D9K A;  4C0E A;  4GPK A;  2Q7F A;  2LSV A;  3EU9 A;  5FQ8 A;  3S2A A;  4B0Z A;  4NUR A;  4YVQ C;  3TJP A;  2XEN A;  2XPY A;  3GZ2 A;  4N2Q A;  4O6F A;  3QWP A;  4A3T A;  5BV0 A;  2H6F A;  3IBE A;  2H6I A;  5EYP F;  2KCK A;  1TJF A;  1WG0 A;  3UT7 A;  2LAI A;  2JAB A;  1N4P A;  1GW6 A;  2VSX E;  3AJI A;  3RO3 A;  4AY5 A;  2DZO A;  4B94 A;  3J5P A;  3DRA A;  4DX5 D;  3CKC A;  4KYO B;  4DRX E;  3TG4 A;  4K5B A;  3ZNG A;  1OCR E;  1TN6 A;  3ASH A;  4GTO A;  2ION A;  4DX6 D;  1HZ4 A;  4DK5 A;  3QC1 A;  3UQ3 A;  4O1P A;  4U95 D;  4A55 A;  3AG3 E;  2X6I A;  1EYH A;  1FPP A;  5AN8 A;  4ZFH A;  1MJ0 A;  4GZC A;  4KT6 B;  5AJD A;  2RKK A;  4BT9 A;  1KZP A;  3DBS A;  4CDM A;  4IUL A;  1UJJ A;  2HR2 A;  4TUM A;  1Z6T A;  4U07 A;  1HG2 A;  5FIN A;  4GB9 A;  1E8W A;  2X6J A;  3CSF A;  3FTY A;  1S64 A;  4GZ5 A;  4YDY A;  5D0O D;  4ZHB A;  1MYO A;  3L17 A;  3FUM A;  3V2X A;  4FJZ A;  3SF4 A;  2WXH A;  5EIB E;  2JLB A;  2J09 A;  5E75 A;  3APC A;  5JA4 D;  3D9O A;  1N0Q A;  3CQG B;  4AY6 A;  2WQ6 A;  2LSU A;  2DYS E;  2EIM E;  2R59 A;  3FHE A;  3HXE A;  4BEP A;  5BT1 A;  3SFZ A;  3IHY A;  4GA2 A;  1KT1 A;  3OXF A;  1AWC B;  3HVE A;  3PZ2 A;  2QYJ A;  2WXF A;  3B95 A;  3FUJ A;  2IQC A;  4PUC A;  5CED B;  2A5U A;  3AAA C;  4G8K A;  3PZ1 A;  4GA1 A;  4EZL A;  3UM0 A;  3NOC D;  2PNN A;  3V31 A;  2R5S A;  3FFL A;  1H6P A;  3UIO C;  4UWH A;  3JYS A;  4JZY A;  4DPR A;  4Q69 A;  4ACL A;  5CCL A;  5AAR A;  1E96 B;  3QAQ A;  4UQZ A;  3SBS A;  5AEN A;  3LCA A;  2WXP A;  1H2V C;  3L22 A;  4ANU A;  2XQ0 A;  4DX2 A;  4GCO A;  2CFZ A;  2NXP A;  3ASO E;  1V55 E;  4GTS A;  3T8K A;  2GRM A;  5D2M C;  2P9N G;  2L9B A;  2FI7 A;  3FTX A;  3JXI A;  4CRW A;  4DUI A;  4NAC A;  3L08 A;  4L23 A;  1HH8 A;  3D9P A;  4JA7 A;  2A5E A;  3D9I A;  4IN3 B;  4GZD A;  2DBA A;  2XCB A;  3E4B A;  1MQS A;  1K1B A;  2VYI A;  3QNK A;  3Q75 A;  3CV0 A;  1BPO A;  3U4T A;  2JEK A;  4JEH A;  1OWO A;  3T9K A;  4MKT A;  4RG6 A;  3JQ1 A;  1BU9 A;  5T4Y A;  1JCR A;  3V2O A;  4LNG A;  5AIJ A;  2LNI A;  4CEM A;  2P9L G;  1OWL A;  4BET A;  4BT8 A;  2EIN E;  2R2L A;  4ANW A;  4BX9 A;  2J4B A;  2QY7 A;  5A23 A;  3DXK G;  2X6K A;  4HOR A;  5KJL A;  5CHE E;  3JUI A;  3UT4 A;  4N3B A;  4G24 A;  2GRR B;  2E2E A;  3CHQ A;  4IRU A;  1WM5 A;  1N95 A;  4RVB A;  4B89 A;  4L2Y A;  4QFV A;  2L6J A;  1YYH A;  2FF4 A;  3CK9 A;  2VGE A;  4CT4 A;  2VSN A;  2WXG A;  5FZQ A;  4F53 A;  1HS6 A;  1ZB1 A;  4KVM A;  1DCE A;  1AP7 A;  3UM3 A;  4I1A A;  5FQ4 A;  3LVQ E;  4NIK A;  4ATZ D;  3X2Q E;  1A5E A;  2WXM A;  2F8Y A;  4GML A;  4FLH A;  3WG7 E;  4GTQ A;  3ONK A;  5HS0 A;  2P9K G;  2IF4 A;  5KJK A;  3FH8 A;  2NYJ A;  2KZT B;  3I4G A;  4HI8 A;  2ETA A;  3HRA A;  3LPZ A;  3OAW A;  1N52 A;  1Z5S C;  5EX3 A;  2DCP A;  3UKR G;  1O1S A;  4TV3 A;  4BES A;  3FDH A;  3L82 A;  3FEY A;  2ZGG A;  5AQA A;  5JHA A;  2DWZ A;  4GMR A;  3FUD A;  4V3I A;  2Y69 E;  2ILR A;  5E76 A;  4CCA A;  1DC2 A;  2XRY A;  3ZPJ A;  3CST A;  3NF1 A;  4HB5 A;  1N11 A;  1SZA A;  4KMO A;  3CVW A;  3Q79 A;  5ENR D;  1ELR A;  5ENP D;  1PC2 A;  1RZ4 A;  2PQN A;  3E32 A;  2AXV A;  3ASN E;  3QWW A;  3EHM A;  3KEA A;  3ULE G;  3AS5 A;  5M72 A;  3PVL A;  4JPS A;  1A17 A;  3FUN A;  3B7B A;  4GYO A;  5CRU A;  4OVU A;  2MRI A;  2EQX A;  2FBN A;  3FTZ A;  3EUV A;  3GZ1 A;  2BUG A;  4EZK A;  3ENE A;  3QAR A;  1TNZ A;  2OV8 A;  1B89 A;  4FC8 A;  3OTN A;  5KNG A;  4A63 B;  2LUH A;  2WM9 A;  2ZXW E;  4LG6 A;  1LD8 A;  3ZU7 B;  3U64 A;  1U2V G;  2KC7 A;  3PDN A;  4G23 A;  5KJN A;  3LXU X;  3JUE A;  2UWJ G;  3CR3 A;  3UM2 A;  2IY0 C;  5FQ6 A;  4N5C A;  4JHK A;  2WXQ A;  4GTM A;  1MZC A;  3PUK A;  5BV1 A;  1E7V A;  3SD5 A;  2RG8 A;  3BEE A;  3PE4 A;  5CMY A;  4FP7 A;  4GMJ A;  4JEU A;  2VSO E;  3ZYQ A;  3NB2 A;  3BU8 A;  4E6H A;  3PRZ A;  4HXI A;  4AXH A;  1X5B A;  3MKQ A;  4O60 A;  3LY8 A;  3AG1 E;  3T8M A;  2P2C P;  2P58 C;  2VGX B;  4F1S A;  4HVB A;  3S7B A;  3ZUV B;  4HLL A;  2KM4 A;  2V5F A;  3RJV A;  3ZKJ A;  3CKB A;  4U0S A;  2DZN A;  4DLQ A;  1SA5 A;  3FY4 A;  2R17 C;  3LY9 A;  4K5C A;  1IHG A;  4DI4 A;  1ELK A;  3CQC B;  5EID A;  2OCC E;  1IKN D;  3GZS A;  1BLX B;  3E33 A;  1H0A A;  3EU5 A;  3E37 A;  3FTU A;  3UI2 A;  3UPV A;  2AWI A;  5ENN A;  4FHJ A;  3CVV A;  5AJL A;  3HXC A;  4ANX A;  4EBA A;  1OT8 A;  3KSL A;  2C2L A;  3ASG A;  2KCV A;  3SFY A;  3DST A;  4A1G A;  2WXJ A;  4Q96 A;  2GW1 A;  3FU5 A;  5T3R A;  5ARF A;  1OWM A;  1QBQ A;  2WXK A;  1IQR A;  2CHZ A;  3ZEF A;  3PZ4 A;  1UW4 B;  4BER A;  4CDR A;  2WVI A;  4GAA A;  4I17 A;  1KT0 A;  3ZFW A;  1SA4 A;  4BTB A;  5BUZ A;  1TR4 A;  4CDN A;  4F3V A;  2XPZ A;  4AVX A;  4MRU A;  4BSX A;  4FJY A;  3RK6 A;  4PH4 B;  4HBD A;  3MV3 B;  3W9F A;  5CMW A;  4JHJ A;  3DXM G;  4XE0 A;  1N94 A;  2AJA A;  3ULQ A;  1EPU A;  4APF A;  2QC9 A;  3EJN A;  4I9C A;  4L7T A;  4HI9 A;  5FZR A;  1O5M A;  2OEW A;  3B7T A;  4I43 A;  1UG3 A;  1SVX A;  3SI5 A;  2GRP B;  4UUC A;  1UOH A;  4LSZ E;  1EF1 C;  4JW1 A;  4KXK B;  5J08 A;  3SO8 A;  4U8H A;  3CGH A;  1H6O A;  4LNB A;  5ITZ F;  3Q5M A;  4N39 A;  3PNL B;  3O48 A;  3S7D A;  1PAQ A;  2AXZ A;  3ABK E;  2KXP C;  3ESL A;  4BFR A;  1MX6 A;  2A4Z A;  3TWR A;  1EDU A;  5EX0 A;  4C9B B;  4EEC A;  4ATG A;  4L2L A;  1IQU A;  5EKQ D;  5KJM A;  3RSE G;  4JHR A;  4KBQ A;  3CVQ A;  5ARG A;  3FUF A;  4K5A B;  1HO8 A;  3RRN B;  2LO6 A;  4B93 B;  3K9I A;  5H7P A;  1NP7 A;  3L9T A;  1YA0 A;  2P9P G;  3UIN C;  5JJ6 A;  1NL4 A;  4D10 C;  3PRE A;  1QZ2 A;  5AQ7 A;  4MBG A;  4N3C A;  3R7Q A;  5KCM A;  4J6I A;  4HOT A;  2KAT A;  1OCC E;  4EHM A;  2OVF A;  1G3N B;  3I3N A;  4UWL A;  3FWV A;  3FTS A;  5T8I A;  3ISM C;  4TXP A;  3VLE A;  5BXU A;  3HXF A;  4HRL A;  2Y3A A;  2QFC A;  5LCW C;  1OWP A;  5ANR A;  3L54 A;  2I9C A;  4M3O A;  1NI1 A;  4PDX A;  1OCO E;  2I6H A;  3EDT B;  3TXM A;  3U66 A;  1DNP A;  3WXX A;  3FUI A;  5AQB A;  4JL0 A;  3TWV A;  1IHB A;  3ZGQ A;  3D9L A;  3APF A;  5KNH D;  3D9H A;  2VJ8 A;  3MA5 A;  4KVO A;  5ENQ D;  4N2S A;  2CHW A;  4LUN U;  5C2Y A;  2FEZ A;  3IHV A;  4WUY A;  3UM1 A;  2HE0 A;  1N54 A;  2OOE A;  3DSU A;  4WNE A;  5LCW J;  4DJA A;  2ZIS A;  1HXI A;  2I1K A;  2X6H A;  3FUE A;  4HLE A;  4R7L A;  5B1A E;  3B13 A;  3FU0 A;  4ILG A;  4IYP A;  3IEG A;  2WXO A;  5FWQ A;  3I4R B;  4RSY A;  1NA3 A;  4UWG A;  3UIP C;  2YIN A;  4HRN A;  1U3D A;  1WY6 A;  4FUL A;  3MEK A;  4UWF A;  2XZD G;  4EBA G;  1FCH A;  1Z3Y A;  1H6K A;  4EZJ A;  2OND A;  4HNA D;  1D8E A;  3CHR A;  1UN8 A;  2VTB B;  2HO1 A;  3FP3 A;  3JXJ A;  2GRN B;  2BF0 X;  3Q9U C;  4I9E A;  3ABL E;  1H19 A;  3TWT A;  3O4Z A;  4TXQ A;  3QK0 A;  3IKO B;  1N9A A;  2BKG A;  3UMV A;  2Y4U A;  4DI3 A;  2Y0B G;  2B0O E;  2IFU A;  3QJZ A;  2CHX A;  3HYM B;  2J9Q A;  3LDZ A;  3J5Q B;  3TWW A;  3Q78 A;  4U8Y D;  1D9S A;  2HYZ A;  1JWF A;  3ZRH A;  2EIK E;  1KZO A;  4RG9 A;  3ULY A;  2P9I G;  3LJ3 A;  3BG0 B;  2I2O A;  3LVR E;  2F8X K;  4U8V D;  1QNF A;  2WXR A;  4GTV A;  3ML8 A;  1NFI E;  3TL5 A;  4N3A A;  1TYQ G;  3C72 A;  4FHK A;  5C1D A;  4XZ4 A;  3I5P A;  2KZT A;  5HRY A;  4Z68 A;  3PUJ A;  2BKK B;  4DLO A;  3Q47 B;  3ONL A;  2B6C A;  2VSY A;  5BW8 C;  4AP2 A;  3TWU A;  3DWL G;  5CBN A;  3ML9 A;  1LD7 A;  1N4S A;  2WB2 A;  1V54 E;  2WXN A;  2J49 A;  3MZL B;  1BI7 B;  4JXT A;  4ME2 A;  3B7U X;  2XGO A;  1O1R A;  4A1S A;  4YVO A;  4OVV A;  1RW2 A;  3QOU A;  2V5Q C;  3TGO A;  3Q4A B;  5LX8 A;  2FO1 E;  5D0Q D;  3E34 A;  4ILH B;  3CHS A;  2QYU A;  3U9W A;  1IYG A;  5FQ7 A;  1MHQ A;  2XEH A;  5CCM A;  3TWX A;  4H7Y A;  5EIL A;  2H6G A;  5HI7 A;  1JPL A;  4XX5 A;  4Q94 A;  3Q73 A;  1UN9 A;  4QQI A;  5HKP A;  3ESK A;  3R7R A;  2ETB A;  3CEQ A;  3SNX A;  3EHR A;  2NC9 A;  4EPZ A;  3ZXS A;  2WMN A;  2ZU6 B;  4UI9 C;  1YMP A;  3CVP A;  1Y6I A;  3TWS A;  2WXI A;  3PS6 A;  3DSS A;  3C5R A;  1N4R A;  3SBT B;  4YND A;  3HDX A;  3ZW3 A;  1MX4 A;  4WNG A;  4TUU A;  3SHF A;  1H2T C;  4JC8 A;  3C3O A;  2YHE A;  3L16 A;  4U0Z A;  3RIB A;  1OUV A;  4LER A;  4MS6 A;  2J07 A;  3CHP A;  5BPP A;  2V8S E;  1K3Z D;  4G1T A;  2WQ7 A;  3KD7 A;  1HU3 A;  3HG0 D;  4GTP A;  4UI9 J;  1E8Z A;  3LJN A;  3CVL A;  1S70 B;  4I2Z A;  1HX8 A;  4LCT A;  2IOS A;  3T5V A;  1O1T A;  3RKV A;  1S63 A;  5AQ9 A;  3RAU A;  2MHK A;  3AU5 A;  2YQ8 A;  3HHM A;  2R02 A;  2ETC A;  2OEV A;  2XGM A;  2IEJ A;  1LTX A;  1TNB A;  1HF8 A;  1QQE A;  3B7R L;  5IY5 E;  5EYL A;  3SGH A;  3EHN A;  4LRZ A;  3NBN B;  3MJW A;  2BED A;  3B7S A;  4LNU D;  2F0Y A;  3DPY A;  1E90 A;  4XI0 A;  3U3W A;  4K03 A;  3Q7F A;  2J08 A;  4G25 A;  5D66 A;  3URZ A;  5ENO D;  2CFU A;  4BWR A;  2VGX A;  5KBA A;  5EN5 D;  1INZ A;  4A3V A;  5EDS A;  3AS4 A;  3FTW A;  1YCS B;  3ZYK A;  4J8S A;  3CK8 A;  2MYO A;  1LF8 A;  3QKY A;  4KZ0 A;  4HRM B;  3AG2 E;  2RFM A;  1UJK A;  4URK A;  3FU6 A;  3R9M A;  4GZ6 A;  5LOZ A;  2V4H C;  4HOQ A;  3LYA A;  2X38 A;  3CVX A;  1OY3 D;  2WMO A;  3CIA A;  2VGY A;  4TXR A;  2IOL A;  3NZS A;  4HOU A;  1WDY A;  4AM9 A;  4CZ2 D;  3C98 A;  1SQM A;  2YNQ A;  5B3S E;  2V4L A;  2IU1 A;  2ZIR A;  4UWK A;  4OAV B;  4HS2 A;  3ZN3 A;  5JJ7 A;  5JJT A;  3G2V A;  1IXV A;  5JMN D;  3VTY A;  2YHC A;  5FIO A;  2LXM A;  4AJW A;  3MCX A;  4FA6 A;  5JHB A;  2H6H A;  3UX4 A;  4WNF A;  1Z3X A;  5CEA A;  3HVE B;  3KS2 A;  4XIF A;  3KAE A;  3CHO A;  1S0P A;  5B1B E;  4M7C A;  4RLY A;  5ANL A;  3ZYM A;  4PS7 A;  4APO A;  3VLD A;  4WAF A;  3GYZ A;  3SQV A;  2RFA A;  3UTM A;  2L0I A;  2GGF A;  2E0I A;  2OVB A;  3CK7 A;  1ELW A;  4ILI A;  1HE8 A;  1XGW A;  4GPM A;  5BNW A;  1N4Q A;  3MGB A;  4UQX A;  1TEZ A;  3EHQ A;  4BY6 A;  4I6E A;  3TG5 A;  4YDW A;  4J0U A;  2IO2 C;  2XEE A;  4G8L A;  3JQ0 A;  4WND A;  4EQF A;  3KEZ A;  5FTP A;  2L0T B;  2XS8 A;  2EIL E;  1W3B A;  1ZU2 A;  4U96 D;  4XI9 A;  2J4D A;  1OWN A;  2NSZ A;  3R9A B;  1WAO 1;  2QZA A;  3AG4 E;  3Q15 A;  3ZVV A;  3RRM B;  5G2N A;  4AOF A;  3PNT B;  4I1O B;  4P29 A;  3P1U A;  3IV0 A;  4WWP A;  4ACK A;  3L13 A;  5J90 A;  3NAW A;  4Y6W A;  1NA0 A;  3ASD A;  3BG1 B;  3UT8 A;  2FUL A;  1VDY A;  3OXL A;  4I6J A;  5AYW D;  2FO7 A;  3VLF A;  3Q7A A;  1Y8M A;  4C0M A;  5G04 C;  2ZGD A;  4FAD A;  4W9R A;  3QWV A;  1TN8 A;  3CVY A;  3DSW A;  1K8K G;  4CT0 A;  4BTA A;  1FT2 A;  1N0R A;  5ENS D;  4AEZ C;  3EIJ A;  1TNO A;  4C48 B;  4NQ0 A;  5HQ8 A;  2C0L A;  1TJC A;  4GZ3 A;  3DEP A;  3L6A A;  4ANV A;  1X81 A;  3PEU B;  2XCC A;  4Y6C A;  2P9U G;  4KZC A;  2WXL A;  5KWD A;  2LAH A;  4DX1 A;  4DX7 D;  4BSZ B;  1SZ9 A;  4UI9 K;  4B8A A;  4PS3 A;  1H2U A;  4J7W A;  5G04 J;  3RRU A;  2GRO B;  1DVP A;  1JCQ A;  5G05 C;  3V79 K;  3FUH A;  4G2V A;  3D9M A;  4JVS A;  3G2S A;  2RD0 A;  3UXG A;  5DIZ A;  1P5Q A;  3ZHE B;  4G11 A;  3D3M A;  4E85 A;  2IJG X;  2Y1L E;  2XEV A;  1SW6 A;  5ENT D;  4B8C B;  3APD A;  3FUL A;  4ABN A;  4J8Y A;  1OCZ E;  3HIZ A;  4WWN A;  1MX2 A;  2CG3 A;  2GRQ B;  3C3Q A;  5G05 J;  1JWG A;  3AU4 A;  4G26 A;  4O1O A;  3FUK A;  3NOG D;  1D8D A;  3LS8 A;  3MV2 B;  3ZIM A;  3FU3 A;  2C0M A;  1QYM A;  4AIF A;  4HFG A;  4RQI A;  5AAO A;  3ZHE A;  3W9G A;  4N5Q A;  3BQO A;  1K1A A;  3DPD A;  2R03 A;  1OXJ A;  4HOS A;  5LFA A;  2DIW A;  5A7D B;  3HXD A;  1KLX A;  2XPI A;  1FT1 A;  5BXO A;  4LEU A;  4GCN A;  5A6C A;  4X8Q A;  2VTB A;  4J8E A;  2XRZ A;  3G2U A;  3HXB A;  1FVH A;  3MX3 A;  3G2W A;  2XGS A;  1TNY A;  3D9N A;  3V30 A;  2F37 A;  3P2B A;  4J8D A;  5CBO A;  1ZBP A;  4WWO A;  4U7E B;  2PL2 A;  2X3M A;  3LY7 A;  3BUA A;  3AS8 A;  3E30 A;  2LXL A;  4K0R A;  3FTV A;  1KPS B;  3RO2 A;  1DCQ A;  4I1M A;  4F7A A;  3ABM E;  4UQY A;  2XS1 A;  4H7X A;  3SY2 A;  4U0U A;  3VTX A;  3PZ3 A;  1BI8 B;  4F1P A;  2AVP A;  3TAX A;  3T5X A;  2PM6 A;  4XKC A;  3NZU A;  2X6F A;  4AV7 A;  4JB8 P;  3MKR A;  2L6B A;  3S7F A;  2Y4T A;  3SZ7 A;  1HFA A;  3CVU A;  4GYW A;  3CLJ A;  3DEO A;  4TRQ A;  4OYS A;  3ZYL A;  2V0P A;  3D9J A;  2CG2 A;  1HG5 A;  2IO3 C;  3FEX A;  4HQD A;  4I6G A;  3C3R A;  4GU5 A;  3EIQ C;  4GA0 A;  2KCL A;  3LEW A;  1BD8 A;  2VQ2 A;  2DYR E;  2HM8 A;  2WPV A;  4GTT A;  2WQH A;  2J8S D;  2UY1 B;  3ASF A;  4J8F A;  5CER B;  3FH5 A;  1E8Y A;  3RU0 A;  2PZI A;  4MLP A;  1E8X A;  5CEC B;  1XNF A;  4YDO A;  4U04 A;  3PEV B;  2BTD A;  3CVN A;  3TWQ A;  3ZXP A;  5CRV A;  2DVW A;  4I2W A;  3MKQ B;  3PH0 C;  3TXN A;  3IXE A;  1L5J A;  2R05 A;  3NQP A;  3N71 A;  4XKB A;  1FVF A;  4XEI G;  3UUX A;  1E7U A;  2M63 A;  2P9S G;  4YDE A;  3DSV A;  3GW4 A;  2MOW A;  2UY1 A;  3FH7 A;  4PS8 A;  3DSX A;  5FZS A;  3CHM A;  3S7J A;  3PZD A;  1JCS A;  2PM7 A;  4BX8 A;  1JUQ A;  2I1J A;  3LKU A;  4CGW A;  3SFX A;  4GYY A;  5FJY A;  5LP0 A;  1NZN A;  4U63 A;  2XHE A;  4L1B A;  3Q9N C; 
#chains in the Genus database with same CATH homology
 3Q7F A;  1FPP A;  1FT2 A;  1QBQ A;  1N95 A;  3DSU A;  1TNO A;  3Q79 A;  4GTR A;  3HXD A;  1KZP A;  2ZIS A;  3KSQ A;  1FT1 A;  4L9P A;  4GTV A;  1TNU A;  3E32 A;  1X81 A;  3PZ4 A;  3DSS A;  3C72 A;  4GTT A;  1N4R A;  1N4Q A;  1SA4 A;  1TN7 A;  4GTS A;  1S64 A;  3HXB A;  1DCE A;  1TNY A;  1NL4 A;  1JCQ A;  4YDO A;  1LD7 A;  3EUV A;  1N4S A;  4MBG A;  1N94 A;  1D8E A;  4GTQ A;  4EHM A;  1SA5 A;  4GTP A;  2H6F A;  1TNZ A;  1O1R A;  2H6I A;  3E30 A;  1O1T A;  3HXE A;  3Q75 A;  1O5M A;  1S63 A;  3HXF A;  1LD8 A;  3E33 A;  3E34 A;  4YDE A;  3DSV A;  1N4P A;  3EU5 A;  3E37 A;  1N9A A;  1O1S A;  3PZ3 A;  3PZ2 A;  3DSX A;  2ZIR A;  1JCR A;  2IEJ A;  1LTX A;  1TNB A;  4LNG A;  1NI1 A;  3DRA A;  1JCS A;  4GTM A;  1MZC A;  2BED A;  2R2L A;  3HXC A;  3Q78 A;  3SFX A;  1D8D A;  3PZ1 A;  2F0Y A;  3DPY A;  3KSL A;  2H6G A;  1TN6 A;  3Q7A A;  4LNB A;  4GTO A;  3Q73 A;  3SFY A;  3DST A;  2H6H A;  1TN8 A;  1KZO A;  3DSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...