5AYWD

Structure of a membrane complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
212
Chain Sequence
GSKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane protein assembly factor BamA
publication title Structure of the BAM complex and its implications for biogenesis of outer-membrane proteins
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 73
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5aywD00
3IEGA 2YQ8A 2Y4UA 2BUGA 3LYAA 4WUYA 4IN3B 3MEKA 2GW1A 2L6JA 1A17A 1QZ2A 1WAO1 2LSVA 3CVQA 3QWWA 4U0UA 4UQXA 4WNEA 4HOUA 3VTYA 2HR2A 3ZFWA 4N3CA 4LEUA 4GZ3A 3CK7A 5G04J 1WM5A 3GZ1A 3TG5A 4GA2A 4UQYA 2QFCA 3FP3A 2R5SA 3CVLA 2XPIA 4U0SA 3ASDA 3U3WA 2Q7FA 3O48A 4J0UA 4N5CA 5FZSA 4N2SA 2J9QA 3RO3A 4GZ6A 3KS2A 4GYOA 5JJTA 1KT0A 4W9RA 3CK9A 4HOQA 2C0MA 5CCLA 3ULQA 2PL2A 3LY9A 3MA5A 5G04C 3RJVA 1NA3A 4U07A 5FZRA 3R9AB 4UQZA 3E4BA 4NQ0A 3MV2B 2PQRA 3Q47B 2KCKA 1OUVA 3SZ7A 4HORA 1FCHA 5FZQA 3PE4A 4Y6WA 2PQNA 2FO7A 2XGSA 4GZ5A 4I2WA 4A1SA 4YVOA 4APOA 4UI9K 3Q5MA 4RG6A 3FWVA 5EX0A 2VGYA 4BT9A 2IF4A 3K9IA 2FEZA 3ZGQA 3QWVA 3OXLA 4GYWA 2KCLA 5DBKA 3CEQA 4KXKB 2OOEA 5D0QD 3AS5A 3CKCA 2VSNA 4G23A 4JA7A 1B89A 4GYYA 3ESKA 5CCMA 3AS8A 2KCVA 2UY1B 4J8DA 3ZHEB 2FI7A 5C1DA 4G1TA 5FJYA 3QOUA 3KAEA 4G25A 4H7YA 3CVNA 3NF1A 2UY1A 3RKVA 4EQFA 3GZ2A 2VGXB 2FF4A 5FT9A 5G05J 3U4TA 3URZA 5BW8C 4J8EA 5HI7A 1TJCA 3RO2A 3LY8A 5KJNA 4F3VA 4I2ZA 3N71A 2AVPA 2VGXA 1IYGA 3OXFA 3MKRA 2HO1A 2XCCA 2P58C 2YHCA 3UPVA 3BEEA 3Q15A 3TAXA 4CGWA 5EX3A 1E96B 3JYSA 5EKQD 1ELRA 4GA0A 2VYIA 5LCWJ 3AS4A 5G05C 2MHKA 4I9CA 5CHEE 5KJMA 4H7XA 3S7JA 4AIFA 2E2EA 4UI9J 5BNWA 4I1AA 2HYZA 3Q4AB 5A6CA 2NC9A 4XI9A 2XCBA 2V5FA 4N3BA 4G26A 3CVPA 3GW4A 3ZN3A 4BTBA 2JLBA 5ARGA 3ASGA 5A7DB 4WNGA 2KATA 5KJLA 3PE3A 4ME2A 5LCWC 3LPZA 4I9EA 1Y8MA 4UI9C 4Y6CA 3ASFA 4HOSA 2KC7A 4JL0A 2PZIA 2WQHA 4AY5A 1HH8A 2XGOA 3LKUA 2WPVA 3ZPJA 3PDNA 4CGVA 4WNFA 4GCNA 1XNFA 1P5QA 4N39A 2C0LA 4O6FA 2DBAA 3ZHEA 4KYOB 1HZ4A 4AY6A 4ABNA 2LSUA 2Y4TA 1KT1A 2UWJG 2IFUA 1PC2A 3OXGA 3KD7A 3CK8A 3VTXA 5M72A 2VQ2A 2FBNA 3TGOA 5DIZA 3QWPA 1NA0A 4GPKA 4BT8A 1KLXA 2XGMA 5JJ7A 4I17A 3UUXA 3S7BA 3RIBA 2C2LA 4JHRA 3SF4A 2XEVA 4AM9A 1IHGA 4YVQC 3CKBA 4N2QA 4J8FA 3FFLA 3WXXA 4JA9A 4CDRA 1HXIA 1ZU2A 1ELWA 4XIFA 4B94A 3QKYA 4HOTA 4XI0A 2VSYA 3GYZA 3RU0A 3Q49B 4G2VA 3UQ3A 4U0ZA 5FTPA 1NZNA 1QQEA 3S7DA 3HYMB 4BTAA 4G24A 5ARFA 3EDTB 3S7FA 3MV3B 4KBQA 3LY7A 4RG9A 4YNDA 4GA1A 3QDNA 4BWRA 2I6HA 5D0OD 3CV0A 4WNDA 2LNIA 4GCOA 5JJ6A 1ZBPA 4NRHB 4N3AA 2ONDA 3ASHA 5HQ8A 3LCAA 5BT1A 1YA0A 3TG4A 5KJKA 5AYWD 4U04A 1W3BA
chains in the Genus database with same CATH superfamily
2WXRA 4HFGA 2Y4UA 4HB5A 4WUYA 4BSZB 3JXIA 4GTSA 2P9IG 4BX9A 3ZYLA 2P2CP 2L6JA 1A17A 3V2XA 1WAO1 2PM7A 4U0UA 1N4RA 4DRXE 4HOUA 4N3CA 5G04J 3CK7A 3WG7E 3GZ1A 5EYPF 2L0TB 4ANUA 1O1RA 2HE0A 4HS2A 2NYJA 4N5CA 1XGWA 4JHJA 2WXLA 3NOGD 3PZ4A 3RO3A 2DZOA 2GROB 3E32A 2XENA 1O5MA 5ENPD 2J49A 5G04C 3LY9A 1MX6A 3RJVA 2XZTG 3NZSA 4U07A 4L9PA 1DC2A 3Q7AA 1YCSB 5KNGA 5ITZF 1X81A 3ZYMA 2FO7A 2XGSA 4GZ5A 4HBDA 2V5QC 5EX0A 3FWVA 5LFAA 1JCQA 2A5EA 2XS8A 4GTMA 5D66A 3QWVA 5JHBA 2ZISA 4GYWA 2AXZA 3I3NA 4DUIA 4Q69A 5KBAA 2IJGX 2KCLA 5DBKA 3ABME 1FVHA 2XRYA 4KXKB 2XEHA 3OTNA 4UWGA 4B8CB 3AS5A 3EHMA 3LVQE 4JW1A 1PAQA 2EQXA 1MJ0A 4GTVA 2IO3C 2ZU6B 4HVBA 1AP7A 3ESKA 5HS0A 2WXNA 4BETA 4TXPA 5C1DA 2Y0BG 3F6QA 4OVUA 1OCCE 4TRQA 1TNZA 1O1TA 3I5PA 4H7YA 4U8YD 3HDXA 3NF1A 1Y6IA 2UY1A 2EIKE 1RZ4A 3D9MA 5JHAA 4A1GA 2FULA 2FF4A 3U4TA 3APFA 4J8EA 1BI8B 2WMOA 1EPUA 4Q94A 1SA4A 5KJNA 4I2ZA 4LRZA 2AVPA 3QNKA 3HXFA 2P58C 4ZFHA 3T5XA 3UPVA 3L6AA 3JQ0A 3FUHA 3TL5A 1IXVA 3FTSA 2GRLA 3AG4E 1ELRA 3L13A 2VSXE 3PZ2A 3ZNGA 3C3OA 2MHKA 3ZW3A 3QJZA 4I9CA 4H7XA 2LAHA 1DCEA 2WXFA 1NL4A 3ABLE 2E2EA 5EIDA 3ZRHA 3PEVB 4AP2A 5A6CA 2WXJA 1UOHA 4XI9A 2XCBA 5ANRA 4N3BA 4G26A 2F8XK 5AQ7A 3GW4A 4U96D 2CHZA 1HE8A 2X6FA 4BTBA 2JLBA 2PNNA 5FQ4A 3SY2A 2KATA 3MKQA 3ZU7B 4GTPA 4EBAG 2KZTA 1S63A 1AWCB 3TWXA 4G8LA 2I9CA 5LP0A 4LERA 1FVFA 4Y6CA 4C9BB 4EECA 4U95D 3L54A 4O60A 5EILA 2VTBA 2WQHA 4AY5A 2CG3A 1HH8A 3FH5A 1EYHA 3ZPJA 4CGVA 2OEVA 2R05A 1OWPA 3HVEA 4N39A 2C0LA 1H2UA 2DBAA 3PZDA 2VGEA 2A4ZA 3TWQA 1N4PA 5ANLA 1DVPA 3B13A 3CLJA 4BESA 2UWJG 3D9PA 2WXMA 5G55A 2VQ2A 2AXUA 2FBNA 3HRAA 3UXGA 5DIZA 3SNXA 4QFVA 3QWPA 3AG3E 3FUJA 3UKRG 3Q7FA 4GPKA 4BT8A 3RRMB 4TXQA 4I17A 4OVVA 4GZCA 3RIBA 2EIME 3SF4A 2LO6A 2XEVA 1MX2A 2L6BA 4YVQC 4BFRA 3CKBA 1H6OA 4N2QA 2GRRB 3R7QA 1H2VC 3SBTB 3ONLA 4I1OB 3L17A 3D3MA 1BPOA 2ZGDA 3B7RL 4B94A 3B95A 4L2LA 4XI0A 3Q49B 1WDYA 3CSTA 2BKKB 3Q9UC 1FT2A 3S7DA 4BTAA 3W9GA 4G24A 3EDTB 3MV3B 1H2TC 5FQ7A 3EJNA 4GA1A 1NP7A 1OXJA 1U3DA 2I6HA 1OWOA 2A5UA 4WNDA 4RVBA 4DI4A 2R2LA 1S64A 5JJ6A 4CRWA 1UW4B 3D9IA 5ENNA 1OT8A 2KBXA 3ASHA 3LCAA 1YA0A 3TG4A 2DZNA 4EZJA 4F53A 4UWKA 3IEGA 2YQ8A 3Q78A 3CVVA 4IN3B 2F37A 3FUIA 4DPRA 4WAFA 3ML8A 3BG0B 1QZ2A 3FDHA 3CVQA 3QWWA 3JQ1A 4K5BA 4L2YA 2E0IA 3BU8A 5BXUA 3TXMA 4GZ3A 4J8SA 5E76A 1WM5A 5AENA 4UQYA 3L22A 2R5SA 2NSZA 5B1AE 2XPIA 3IBEA 2Q7FA 5AQBA 3ZKJA 4N2SA 3E30A 4FULA 4BEPA 1SZAA 3FTUA 3PNTB 4PH4B 2GRQB 1S70B 3QARA 1NFIE 3JUIA 1KT0A 4W9RA 4FADA 2BTDA 5EN5D 4LNUD 1OWMA 1OWNA 4HOQA 2X38A 3MA5A 4CDMA 3HXCA 3UKUG 4EZKA 5FZRA 3D9KA 2RG8A 1Z3YA 4NQ0A 3SO8A 1TN6A 2WXOA 2QYUA 4K5AB 4P29A 3UMVA 1FT1A 4AXHA 3G2TA 2LXMA 4I2WA 4IYPA 4A1SA 3Q79A 4UI9K 4F6RD 3CVUA 4ACKA 1HS6A 4I6GA 4O1PA 4BT9A 3K9IA 4ANXA 2FEZA 2V4LA 3KSLA 3ZGQA 4UUCA 2OCCE 4ILHB 3CEQA 3IHYA 2OOEA 2XS1A 3CKCA 2XQ0A 3IHVA 2P9LG 2VSNA 4G23A 4JPSA 4JA7A 4B93B 3D9LA 4ZHBA 3E34A 4GYYA 4GMRA 2F0YA 3B7TA 1H0AA 2UY1B 1N0QA 4U7EB 3PREA 4EHMA 3DXMG 3DEPA 3AG2E 4CDNA 5IY5E 3QK0A 3NBNB 5FJYA 4M3OA 5T4YA 3PZ1A 4TUUA 3FTXA 1D9SA 3GZ2A 3NB2A 2I1KA 5G05J 4HRMB 3U64A 4URKA 5BW8C 1JCRA 2WXGA 3CR3A 2OEWA 4PS7A 2J8SD 2ETCA 3FU5A 3MKRA 2H6FA 1K3ZD 3BUAA 1TR4A 3UINC 2L0IA 3BEEA 3TAXA 3E33A 4XEIG 2EIJE 5HRYA 3FULA 1E96B 5EKQD 2AW6A 3MJWA 3D9NA 4B8AA 3AS4A 5G05C 5KJMA 1E90A 2XZDG 4AEZC 2XHEA 3MKQB 4Z68A 5T8IA 4DX1A 5AN8A 5CEAA 2KZTB 4Q96A 1MX4A 3QB2A 1E8WA 3ONKA 3ASGA 4PS8A 4GU5A 5CBOA 3LPZA 4CEMA 5CBNA 4I9EA 2VTBB 3C72A 1E8YA 4FU3A 1X5BA 3ASNE 2P9SG 1KZOA 3EHNA 4HOSA 2OV8A 4JL0A 3KEAA 4OAUC 3HVEB 2PZIA 3DSSA 1D8EA 3NAWA 2WPVA 4EZLA 3NZUA 4WNFA 3PS6A 4O1OA 1H6KA 3AU5A 2J4DA 5EYLA 1P5QA 5AJDA 1K8KG 2RFMA 4KYOB 4AY6A 4ABNA 2LSUA 3DEOA 2BKGA 2Y4TA 3B7SA 3I4GA 1OCRE 1PC2A 1UJKA 1IHBA 3TWUA 1JCSA 3EU9A 1FPPA 2ZXWE 5BV1A 5ENTD 3JCKC 4MS6A 4WWNA 1OCZE 3FH8A 1KLXA 3SGHA 4M7CA 4A3VA 2XGMA 5AQ9A 3R7RA 1JUQA 3FH7A 4GTTA 3JXJA 4AV7A 1H19A 4AM9A 4GB9A 1IHGA 4WWPA 3CHSA 5EDSA 3UM2A 4J8FA 2DCPA 4JB8P 5D2MC 2GRMA 4K5CA 3WXXA 3ENEA 2MYOA 1HXIA 1ZU2A 3FEYA 5LX8A 1ELWA 2VSOE 4RLYA 4CCAA 3D9HA 4GTRA 3FTYA 3QKYA 4GMLA 4HOTA 3T9KA 3DRAA 3UQ3A 3MCXA 4EBAA 2J07A 5FTPA 1QQEA 1E7VA 3FUFA 4KBQA 4I6EA 4YNDA 3T8MA 2R17C 1UN9A 2P9NG 3FUMA 4U8HA 3CV0A 4TXRA 1KZPA 2YNQA 3HHMA 5FQ8A 4FLHA 4TUMA 1ZBPA 1YMPA 2X6IA 4NRHB 1HG2A 3TWRA 1D8DA 2R59A 1H6PA 4KVOA 2GRNB 3DSXA 4HRLA 4HLLA 2BUGA 3SI5A 1WG0A 4F7AA 4N5QA 3PUJA 2ETBA 2GW1A 4L23A 2WQ7A 1INZA 4C48B 2LSVA 3DPDA 3FU6A 3SD5A 5JMND 3C5RA 4LEUA 4AJWA 4PUCA 3B7BA 4J8YA 5H7PA 4NURA 4ILIA 1HFAA 3UIPC 2YINA 4GA2A 2QFCA 2JABA 3ZEFA 3TJPA 2DIWA 4OAVB 3EHQA 4I43A 3CVLA 4U0SA 3ASDA 3FUEA 1SA5A 4J0UA 3FEXA 4OYSA 5FZSA 4XKCA 3FUKA 2L9BA 4GZ6A 3ZYQA 4LNGA 5BV0A 1S0PA 4KVMA 4GYOA 5JJTA 2WXHA 5FWQA 3ML9A 2WXPA 5BPPA 3HXDA 1TNYA 3IXEA 5CCLA 4RQIA 2XPYA 4DJAA 3AJIA 2FO1E 3E4BA 1TYQG 4UWLA 3MV2B 3PRZA 4FJZA 2PQRA 2KCKA 1SQMA 3AG1E 1OUVA 3SZ7A 4DX5D 3CHRA 1FCHA 3G2VA 1SVXA 3CVYA 2ILRA 1RW2A 4Y6WA 4U8VD 3ABKE 3UM1A 3DWLG 3I4RB 4APOA 1V54E 5BUZA 4A63B 2X6JA 3T8KA 1QYMA 3LJ3A 2V8SE 1U3CA 4HI8A 1N94A 3TWVA 2QYJA 2V0PA 4MRUA 5ENSD 5D0QD 2MRIA 3ASOE 3L16A 4GTOA 4IULA 5AIJA 4JEHA 1B89A 2WVIA 3KSQA 3PZ3A 2I1JA 4XKBA 4F1PA 3AS8A 3DBSA 3UIOC 2KCVA 3ZHEB 2WQ6A 1N52A 4I1MA 4HNAD 3UT4A 5BXOA 3KAEA 4G8KA 5EIBE 1N4SA 2AWIA 3CVNA 4LSZE 2M63A 3HXEA 3RKVA 4EQFA 1K1BA 3DSTA 2XPZA 4DLQA 5T3RA 4FHJA 3O4ZA 5FT9A 3FTWA 5HI7A 2LAIA 3Q9NC 3DPYA 3RO2A 1UN8A 3LY8A 1N11A 2Y1LE 3N71A 2VGXA 1IYGA 3GZSA 5JA4D 2X6KA 2XCCA 2YHCA 2VJ8A 4CGWA 2KM4A 2DVWA 4DX2A 3MGBA 3PNLB 4G11A 5AAOA 4LUNU 3QAQA 3PEUB 2JEKA 1EF1C 2GGFA 5CHEE 4AIFA 4NIKA 4UI9J 5BNWA 4I1AA 1U2VG 3Q4AB 1OCOE 2X6HA 1QNFA 2V5FA 3AAAC 4GMJA 3RRNB 4B89A 3ZN3A 5FQ6A 1OWLA 1BLXB 3PE3A 5J90A 4ME2A 3RSEG 1LD7A 1HO8A 4L1BA 2IOSA 1Y8MA 3FHEA 4UI9C 1BD8A 4YDYA 3J5PA 2I2OA 3CHMA 1E8XA 4JVSA 3L08A 2KC7A 2OVBA 5B3SE 3LKUA 3P2BA 3MYVA 5B1BE 2J09A 4F1SA 5CERB 3ZIMA 2R03A 1XNFA 2Y69E 2CG2A 1TNUA 4O6FA 3EIQC 3ZHEA 2DWZA 3EU5A 3SHFA 3G2UA 5ENQD 2WB2A 1KT1A 1N54A 3OXGA 5M72A 2CFUA 4L7TA 3TGOA 2BEDA 1IKND 5HKPA 2QC9A 4FJYA 4HI9A 1TNOA 3UUXA 3SFXA 2C2LA 4JHRA 2J08A 3SBSA 2V4HC 1IQUA 1IQRA 3VLFA 3CQGB 3S2AA 3TWSA 3U66A 2R02A 4C0EA 3IV0A 3PH0C 3C3RA 4LCTA 3ZVVA 1QBQA 2VSYA 4AVXA 3RU0A 5ENOD 3V31A 4U0ZA 3U9WA 3DSWA 4JC8A 5AARA 5AJLA 1NZNA 3FU3A 3TXNA 5ARFA 3HIZA 3P1UA 2EINE 4FP7A 4K0RA 4J6IA 4R7LA 4DK5A 4BWRA 5D0OD 4LG6A 2LNIA 4GCOA 4BERA 3ULYA 3MX3A 1N95A 2H6IA 2ONDA 1Q2ZA 3T5VA 5HQ8A 4EPZA 4CT4A 5AYWD 4DI3A 3IKOB 4U04A 1Z6TA 3APCA 3LVRE 3ZYKA 4WWOA 1K1AA 3LYAA 3CSFA 1N0RA 3MEKA 1GW6A 3C3QA 2OVFA 5KCMA 2RKKA 4UQXA 4WNEA 4FHKA 3VTYA 4ATZD 2HR2A 3ZFWA 3LDZA 3EUVA 3EIJA 3TG5A 3FP3A 3BQOA 4J7WA 3U3WA 3LEWA 3O48A 3CVWA 4JEUA 3FTZA 4GTQA 4LNBA 2J9QA 1MHQA 4CT0A 2EILE 4YDOA 1MZCA 4K03A 3KS2A 2WXIA 3UTMA 3CK9A 5CEDB 4ILGA 1BU9A 3ULEG 3ZXSA 4CZ2D 2C0MA 2LXLA 3ULQA 2PL2A 3TWTA 1KPSB 4UWHA 1Z5SC 1NA3A 4ACLA 2XRZA 2QY7A 3R9AB 4UQZA 2MOWA 3LS8A 1Z3XA 4AOFA 4TV3A 2CHWA 3Q47B 1A5EA 4PS3A 4HLEA 4HORA 4X8QA 3SFYA 4HQDA 5FZQA 3CGHA 3PE4A 2RD0A 5J08A 2PQNA 2IOLA 2J4BA 3BG1B 4YVOA 3ZUVB 4A3TA 2Y3AA 4I6JA 3Q5MA 4ANVA 4RG6A 2ZIRA 2VGYA 4IRUA 2IF4A 2WXKA 1UJJA 3Q73A 5FIOA 3W9FA 2IQCA 1TN7A 4HRNA 3UI2A 2QZAA 3OXLA 2GRPB 1JWFA 1UG3A 3TWWA 3ESLA 4FA6A 4BSXA 5C2YA 4A55A 1MQSA 2H6GA 5CCMA 5AQAA 4J8DA 3RK6A 4GZDA 2FI7A 2IO2C 1JPLA 2IEJA 5G2NA 3JUEA 2P9PG 3FU0A 4G1TA 2BF0X 3QOUA 4G25A 1O1SA 5LOZA 1LD8A 4HXIA 1WY6A 2HM8A 4E85A 3PVLA 3CIAA 2VGXB 4YDEA 1E8ZA 2AXVA 2YHEA 3URZA 4JD2G 1YYHA 1TJCA 1HU3A 1MYOA 4F3VA 4FLBA 3QC1A 1DCQA 4ATGA 4APFA 4JHKA 3OXFA 2HO1A 3CHPA 3Q75A 3Q15A 4KZ0A 3DXKG 5EX3A 3EHRA 3JYSA 4KZCA 3X2QE 1TN8A 4GPMA 3J5QB 2CHXA 3D9JA 3MZLB 3NQPA 4GA0A 2VYIA 1EDUA 5LCWJ 3E37A 4C0MA 2KXPC 4KT6B 1PY1A 3S7JA 4MKTA 1TNBA 2X3MA 2DYSE 2NXPA 2HYZA 2NC9A 3G2WA 5A23A 3HXBA 4U63A 1V55E 1HG5A 4DLOA 2IY0C 3CVPA 5FINA 2IU1A 3FTVA 5ARGA 4UWFA 5A7DB 3L82A 4WNGA 2AJAA 5KJLA 5LCWC 3G2SA 3C98A 3UX4A 3V2OA 4V3IA 1E7UA 1LF8A 1ELKA 2F8YA 3VLEA 3ASFA 4XX5A 3CQCB 3DSUA 2WMNA 2B0OE 1G3NB 2XGOA 3FUNA 3PDNA 3HG0D 3KEZA 4GCNA 3B7UX 3DSVA 4E6HA 3SQVA 5KWDA 3LXUX 1HX8A 2B6CA 4PDXA 3LJNA 1JWGA 3NOCD 1HZ4A 2DYRE 3RRUA 2H6HA 5CMYA 2WM9A 2IFUA 3VTXA 3KD7A 3CK8A 4B0ZA 4NACA 3ZXPA 1NA0A 3OAWA 3SFZA 5JJ7A 4CYMD 2XEEA 3S7BA 2ETAA 2LUHA 3FY4A 1LTXA 1N4QA 1SZ9A 4FC8A 5ENRD 3R9MA 3ISMC 3PUKA 2P9KG 4BX8A 5CMWA 3FFLA 4JA9A 3UM3A 3AU4A 2ZGGA 4CDRA 3V30A 1NI1A 2RFAA 5KNHD 3L9TA 4RSYA 5CRVA 4BY6A 4GAAA 1OY3D 4XIFA 1TEZA 4XE0A 2CFZA 1TJFA 3GYZA 4XZ4A 4G2VA 2IONA 2PM6A 1N9AA 3HYMB 3FUDA 5CECB 3S7FA 2P9UG 3CHOA 3LY7A 5E75A 4ANWA 4RG9A 4DX7D 4DX6D 4MLPA 3QDNA 3UT8A 3RAUA 1VDYA 5CRUA 3CVXA 3CHQA 2WXQA 1BI7B 3UT7A 3APDA 3VLDA 4JZYA 4JXTA 4MBGA 1HF8A 3V79K 3D9OA 4YDWA 3UM0A 1ZB1A 4N3AA 5BT1A 4KMOA 4QQIA 1L5JA 5KJKA 4D10C 1DNPA 1SW6A 1W3BA
chains in the Genus database with same CATH topology
1Z6TA 3IEGA 2YQ8A 3APCA 3LVRE 3CVVA 2WXRA 3ZYKA 4HFGA 2Y4UA 4WWOA 2BUGA 3LYAA 3SI5A 4WUYA 4IN3B 3CSFA 4F7AA 3FUIA 4BX9A 3ZYLA 3PUJA 4DPRA 3MEKA 1GW6A 2GW1A 4WAFA 2L6JA 1A17A 3BG0B 3ML8A 4L23A 2WQ7A 2OVFA 1QZ2A 1INZA 3FDHA 1WAO1 5KCMA 2LSVA 2PM7A 3CVQA 3DPDA 3QWWA 4U0UA 3JQ1A 4UQXA 4HOUA 4WNEA 4L2YA 3FU6A 3SD5A 4FHKA 3VTYA 2E0IA 2HR2A 3ZFWA 4N3CA 3LDZA 4LEUA 4AJWA 3TXMA 4GZ3A 3CK7A 4J8SA 5G04J 4PUCA 3EIJA 5E76A 1WM5A 3GZ1A 4NURA 3TG5A 4ILIA 5AENA 1HFAA 2YINA 4GA2A 2QFCA 3FP3A 4UQYA 3TJPA 2DIWA 3ZEFA 2L0TB 4ANUA 3L22A 2R5SA 2NSZA 4I43A 3CVLA 2XPIA 4U0SA 3ASDA 3U3WA 4HS2A 3IBEA 2Q7FA 3FUEA 3LEWA 3O48A 4J0UA 3CVWA 3FEXA 4N5CA 4OYSA 1XGWA 4JEUA 5FZSA 4JHJA 4N2SA 2WXLA 3FTZA 4FULA 4XKCA 2J9QA 3FUKA 2L9BA 3RO3A 1MHQA 4GZ6A 4CT0A 3ZYQA 1SZAA 3FTUA 3PNTB 4PH4B 4K03A 3KS2A 5BV0A 1S0PA 4KVMA 2WXIA 4GYOA 5JJTA 2WXHA 3QARA 3JUIA 5FWQA 1KT0A 4W9RA 3ML9A 3CK9A 4FADA 2J49A 4ILGA 2BTDA 2WXPA 5BPPA 1OWMA 1OWNA 4HOQA 3ZXSA 2X38A 2C0MA 5CCLA 5G04C 2PL2A 3LY9A 3MA5A 3ULQA 3RJVA 4UWHA 2XPYA 4CDMA 3NZSA 1NA3A 4ACLA 2XRZA 2QY7A 4DJAA 4EZKA 4U07A 5FZRA 3R9AB 3D9KA 4UQZA 2RG8A 2MOWA 1Z3YA 3E4BA 4NQ0A 4UWLA 3LS8A 1Z3XA 3MV2B 3PRZA 4AOFA 4FJZA 4TV3A 2CHWA 2PQRA 3Q47B 2KCKA 4PS3A 2WXOA 1SQMA 1OUVA 3SZ7A 4HLEA 4HORA 3CHRA 1FCHA 3G2VA 4P29A 5FZQA 3UMVA 3ZYMA 3CVYA 2ILRA 3CGHA 3PE4A 3G2TA 2RD0A 4Y6WA 4AXHA 5J08A 2PQNA 2FO7A 2IOLA 2XGSA 2J4BA 3BG1B 4GZ5A 4I2WA 4IYPA 3I4RB 4A1SA 4YVOA 4APOA 4UI9K 4A3TA 2Y3AA 4I6JA 5BUZA 3Q5MA 3CVUA 2X6JA 4ACKA 4ANVA 1HS6A 4I6GA 4RG6A 3FWVA 5EX0A 5LFAA 3LJ3A 2VGYA 4IRUA 2IF4A 4BT9A 2WXKA 1UJJA 3K9IA 2V8SE 4ANXA 2IQCA 2FEZA 2V4LA 1U3CA 3ZGQA 3QWVA 5JHBA 3OXLA 4GYWA 2AXZA 3I3NA 1JWFA 2V0PA 4Q69A 1UG3A 4ILHB 2IJGX 2KCLA 4MRUA 5DBKA 3CEQA 1FVHA 2XRYA 3IHYA 4KXKB 2OOEA 5D0QD 2MRIA 3ESLA 3OTNA 3AS5A 3CKCA 4UWGA 3EHMA 4B8CB 2XQ0A 4FA6A 3LVQE 3L16A 3IHVA 4BSXA 4JW1A 1PAQA 2EQXA 2VSNA 4IULA 5AIJA 4G23A 4JPSA 4JA7A 5C2YA 3D9LA 4JEHA 1B89A 4GYYA 2ZU6B 4A55A 2WVIA 4HVBA 2I1JA 1MQSA 3ESKA 4XKBA 5CCMA 2WXNA 3AS8A 3DBSA 3B7TA 1H0AA 2KCVA 2UY1B 4J8DA 3RK6A 3ZHEB 2WQ6A 1N52A 4GZDA 2FI7A 4I1MA 5C1DA 1JPLA 3PREA 3UT4A 5G2NA 4OVUA 4CDNA 3QK0A 4TRQA 3FU0A 4G1TA 2BF0X 3I5PA 5FJYA 3QOUA 3KAEA 4G25A 5LOZA 4H7YA 4M3OA 2AWIA 5T4YA 3HDXA 4HXIA 3CVNA 1WY6A 2HM8A 3NF1A 2M63A 1Y6IA 4E85A 2UY1A 3PVLA 4TUUA 3RKVA 3D9MA 5JHAA 4A1GA 2FULA 4EQFA 3FTXA 3CIAA 2XPZA 4DLQA 3GZ2A 2VGXB 5T3RA 2FF4A 1E8ZA 4FHJA 2I1KA 3O4ZA 3FTWA 2AXVA 5FT9A 3APFA 2YHEA 5G05J 3U4TA 3U64A 3URZA 5BW8C 4J8EA 5HI7A 4URKA 2WMOA 2LAIA 1EPUA 1TJCA 3RO2A 1HU3A 1UN8A 2WXGA 3CR3A 3LY8A 4Q94A 5KJNA 4F3VA 4FLBA 4I2ZA 3N71A 3QC1A 4LRZA 2AVPA 4ATGA 2VGXA 4PS7A 1IYGA 3FU5A 4APFA 4JHKA 3GZSA 3QNKA 3OXFA 3MKRA 4U04A 2HO1A 2X6KA 2XCCA 3CHPA 2P58C 2YHCA 3T5XA 3UPVA 3L6AA 2L0IA 2VJ8A 3BEEA 3Q15A 3TAXA 3JQ0A 3FUHA 4KZ0A 4CGWA 3TL5A 3FULA 1E96B 5EX3A 2KM4A 3JYSA 4KZCA 3FTSA 2GRLA 5EKQD 2CHXA 2AW6A 3D9JA 3MZLB 3MJWA 1ELRA 3MGBA 3NQPA 3D9NA 3PNLB 4GA0A 2VYIA 4G11A 1EDUA 4B8AA 5LCWJ 3AS4A 3L13A 2VSXE 4LUNU 5G05C 3QAQA 2MHKA 3PEUB 2JEKA 3ZW3A 1EF1C 2GGFA 3QJZA 4I9CA 5CHEE 4C0MA 4KT6B 5KJMA 4H7XA 1PY1A 2LAHA 2WXFA 3S7JA 4MKTA 4AIFA 1E90A 2E2EA 2X3MA 4UI9J 5BNWA 4I1AA 2NXPA 2HYZA 4AEZC 2XHEA 3ZRHA 3PEVB 3Q4AB 4AP2A 5A6CA 2X6HA 2NC9A 1QNFA 2WXJA 4XI9A 3G2WA 3MKQB 5A23A 2XCBA 5ANRA 2V5FA 4U63A 4N3BA 5T8IA 4G26A 1HG5A 4GMJA 2KZTB 4DLOA 3CVPA 3GW4A 2CHZA 4Q96A 2IU1A 3RRNB 1HE8A 3FTVA 4B89A 2X6FA 3ZN3A 3QB2A 2JLBA 1E8WA 5FQ6A 5ARGA 4BTBA 3ONKA 3ASGA 4UWFA 4PS8A 5FQ4A 4GU5A 5A7DB 1OWLA 4WNGA 2KATA 5KJLA 3MKQA 3PE3A 5J90A 4ME2A 5LCWC 3LPZA 4CEMA 4EBAG 4I9EA 2VTBB 1E8YA 3G2SA 3C98A 4FU3A 3UX4A 2KZTA 1HO8A 1X5BA 4L1BA 4V3IA 1E7UA 1LF8A 2IOSA 1Y8MA 2I9CA 3FHEA 1ELKA 4UI9C 5LP0A 4LERA 3VLEA 1FVFA 4Y6CA 2I2OA 3ASFA 3CHMA 4C9BB 4EECA 4XX5A 1E8XA 3L54A 4JVSA 3CQCB 3EHNA 4HOSA 2VTBA 3L08A 2KC7A 2OV8A 4JL0A 2OVBA 2WMNA 3HVEB 2PZIA 2WQHA 4AY5A 2CG3A 1HH8A 2XGOA 3FH5A 3LKUA 3P2BA 1EYHA 3MYVA 2WPVA 3FUNA 3ZPJA 3PDNA 4CGVA 4EZLA 3NZUA 3KEZA 4WNFA 2J09A 4GCNA 4F1SA 3PS6A 3ZIMA 3B7UX 1XNFA 1H6KA 3AU5A 2J4DA 1OWPA 4E6HA 3HVEA 1P5QA 3LXUX 4N39A 2C0LA 2CG2A 4O6FA 1HX8A 5AJDA 1H2UA 3EIQC 2DBAA 3PZDA 4PDXA 3ZHEA 1JWGA 4KYOB 1HZ4A 2A4ZA 4AY6A 5ANLA 3RRUA 4ABNA 2LSUA 3SHFA 3G2UA 2Y4TA 1DVPA 3B7SA 3B13A 3CLJA 5CMYA 2WB2A 1KT1A 1N54A 3I4GA 2UWJG 2WM9A 2IFUA 3D9PA 1PC2A 3OXGA 1UJKA 2WXMA 3CK8A 3KD7A 3VTXA 4B0ZA 5M72A 2CFUA 5G55A 2VQ2A 4L7TA 2AXUA 2FBNA 4NACA 3TGOA 5DIZA 3SNXA 4QFVA 3QWPA 3FUJA 5BV1A 3JCKC 4MS6A 1NA0A 4WWNA 4GPKA 3FH8A 4BT8A 3RRMB 3OAWA 1KLXA 4FJYA 3SGHA 4A3VA 3SFZA 2XGMA 3R7RA 5JJ7A 4I17A 1JUQA 4OVVA 3FH7A 3UUXA 4GZCA 3S7BA 3RIBA 2C2LA 4JHRA 3SF4A 4AV7A 1H19A 2LO6A 2XEVA 3FY4A 2J08A 4AM9A 1SZ9A 4FC8A 4GB9A 1IHGA 4YVQC 3SBSA 4BFRA 4WWPA 3CKBA 3CHSA 5EDSA 4N2QA 4J8FA 2DCPA 3R7QA 2GRMA 1H2VC 3PUKA 4BX8A 3SBTB 1IQUA 5CMWA 3FFLA 3WXXA 3ENEA 1IQRA 4JA9A 3ONLA 3VLFA 4I1OB 3AU4A 3CQGB 3L17A 4CDRA 1HXIA 1ZU2A 3D3MA 1BPOA 3FEYA 3S2AA 3U66A 5LX8A 1ELWA 2VSOE 4CCAA 4RSYA 4C0EA 4BY6A 4GAAA 3IV0A 3PH0C 4XIFA 3B7RL 4B94A 3FTYA 1TEZA 4LCTA 4XE0A 4L2LA 3ZVVA 3QKYA 4GMLA 4HOTA 2CFZA 1TJFA 4XI0A 2VSYA 3GYZA 4XZ4A 3Q49B 3RU0A 4AVXA 4G2VA 2IONA 3UQ3A 3CSTA 3MCXA 4U0ZA 4EBAA 3U9WA 2J07A 2PM6A 5FTPA 4JC8A 5AJLA 1NZNA 1QQEA 3FU3A 3S7DA 3TXNA 3HYMB 4BTAA 1E7VA 4G24A 5ARFA 3FUDA 3HIZA 3EDTB 3S7FA 3FUFA 3MV3B 3CHOA 4KBQA 3LY7A 1H2TC 3P1UA 5E75A 5FQ7A 4I6EA 4RG9A 4YNDA 4FP7A 4K0RA 3EJNA 4GA1A 4MLPA 3T8MA 1NP7A 3QDNA 2R17C 1UN9A 3UT8A 1U3DA 4J6IA 4R7LA 1VDYA 3FUMA 4DK5A 4U8HA 4BWRA 2I6HA 5D0OD 3CV0A 3CVXA 3CHQA 2WXQA 1OWOA 2A5UA 4WNDA 2YNQA 4RVBA 3UT7A 3APDA 2LNIA 4ANWA 4DI4A 3HHMA 4JZYA 4GCOA 3VLDA 4JXTA 5FQ8A 5JJ6A 1HF8A 4CRWA 4FLHA 1UW4B 1ZBPA 2X6IA 3D9OA 3D9IA 3MX3A 5ENNA 4NRHB 1HG2A 4N3AA 2ONDA 3T5VA 3ASHA 5HQ8A 4EPZA 3LCAA 5BT1A 1YA0A 3TG4A 4CT4A 4KMOA 4EZJA 2R59A 4F53A 1L5JA 4KVOA 5AYWD 1DNPA 4D10C 5KJKA 4DI3A 4UWKA 3IKOB 1W3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEG A;  2YQ8 A;  2Y4U A;  2BUG A;  3LYA A;  4WUY A;  4IN3 B;  3MEK A;  2GW1 A;  2L6J A;  1A17 A;  1QZ2 A;  1WAO 1;  2LSV A;  3CVQ A;  3QWW A;  4U0U A;  4UQX A;  4WNE A;  4HOU A;  3VTY A;  2HR2 A;  3ZFW A;  4N3C A;  4LEU A;  4GZ3 A;  3CK7 A;  5G04 J;  1WM5 A;  3GZ1 A;  3TG5 A;  4GA2 A;  4UQY A;  2QFC A;  3FP3 A;  2R5S A;  3CVL A;  2XPI A;  4U0S A;  3ASD A;  3U3W A;  2Q7F A;  3O48 A;  4J0U A;  4N5C A;  5FZS A;  4N2S A;  2J9Q A;  3RO3 A;  4GZ6 A;  3KS2 A;  4GYO A;  5JJT A;  1KT0 A;  4W9R A;  3CK9 A;  4HOQ A;  2C0M A;  5CCL A;  3ULQ A;  2PL2 A;  3LY9 A;  3MA5 A;  5G04 C;  3RJV A;  1NA3 A;  4U07 A;  5FZR A;  3R9A B;  4UQZ A;  3E4B A;  4NQ0 A;  3MV2 B;  2PQR A;  3Q47 B;  2KCK A;  1OUV A;  3SZ7 A;  4HOR A;  1FCH A;  5FZQ A;  3PE4 A;  4Y6W A;  2PQN A;  2FO7 A;  2XGS A;  4GZ5 A;  4I2W A;  4A1S A;  4YVO A;  4APO A;  4UI9 K;  3Q5M A;  4RG6 A;  3FWV A;  5EX0 A;  2VGY A;  4BT9 A;  2IF4 A;  3K9I A;  2FEZ A;  3ZGQ A;  3QWV A;  3OXL A;  4GYW A;  2KCL A;  5DBK A;  3CEQ A;  4KXK B;  2OOE A;  5D0Q D;  3AS5 A;  3CKC A;  2VSN A;  4G23 A;  4JA7 A;  1B89 A;  4GYY A;  3ESK A;  5CCM A;  3AS8 A;  2KCV A;  2UY1 B;  4J8D A;  3ZHE B;  2FI7 A;  5C1D A;  4G1T A;  5FJY A;  3QOU A;  3KAE A;  4G25 A;  4H7Y A;  3CVN A;  3NF1 A;  2UY1 A;  3RKV A;  4EQF A;  3GZ2 A;  2VGX B;  2FF4 A;  5FT9 A;  5G05 J;  3U4T A;  3URZ A;  5BW8 C;  4J8E A;  5HI7 A;  1TJC A;  3RO2 A;  3LY8 A;  5KJN A;  4F3V A;  4I2Z A;  3N71 A;  2AVP A;  2VGX A;  1IYG A;  3OXF A;  3MKR A;  2HO1 A;  2XCC A;  2P58 C;  2YHC A;  3UPV A;  3BEE A;  3Q15 A;  3TAX A;  4CGW A;  5EX3 A;  1E96 B;  3JYS A;  5EKQ D;  1ELR A;  4GA0 A;  2VYI A;  5LCW J;  3AS4 A;  5G05 C;  2MHK A;  4I9C A;  5CHE E;  5KJM A;  4H7X A;  3S7J A;  4AIF A;  2E2E A;  4UI9 J;  5BNW A;  4I1A A;  2HYZ A;  3Q4A B;  5A6C A;  2NC9 A;  4XI9 A;  2XCB A;  2V5F A;  4N3B A;  4G26 A;  3CVP A;  3GW4 A;  3ZN3 A;  4BTB A;  2JLB A;  5ARG A;  3ASG A;  5A7D B;  4WNG A;  2KAT A;  5KJL A;  3PE3 A;  4ME2 A;  5LCW C;  3LPZ A;  4I9E A;  1Y8M A;  4UI9 C;  4Y6C A;  3ASF A;  4HOS A;  2KC7 A;  4JL0 A;  2PZI A;  2WQH A;  4AY5 A;  1HH8 A;  2XGO A;  3LKU A;  2WPV A;  3ZPJ A;  3PDN A;  4CGV A;  4WNF A;  4GCN A;  1XNF A;  1P5Q A;  4N39 A;  2C0L A;  4O6F A;  2DBA A;  3ZHE A;  4KYO B;  1HZ4 A;  4AY6 A;  4ABN A;  2LSU A;  2Y4T A;  1KT1 A;  2UWJ G;  2IFU A;  1PC2 A;  3OXG A;  3KD7 A;  3CK8 A;  3VTX A;  5M72 A;  2VQ2 A;  2FBN A;  3TGO A;  5DIZ A;  3QWP A;  1NA0 A;  4GPK A;  4BT8 A;  1KLX A;  2XGM A;  5JJ7 A;  4I17 A;  3UUX A;  3S7B A;  3RIB A;  2C2L A;  4JHR A;  3SF4 A;  2XEV A;  4AM9 A;  1IHG A;  4YVQ C;  3CKB A;  4N2Q A;  4J8F A;  3FFL A;  3WXX A;  4JA9 A;  4CDR A;  1HXI A;  1ZU2 A;  1ELW A;  4XIF A;  4B94 A;  3QKY A;  4HOT A;  4XI0 A;  2VSY A;  3GYZ A;  3RU0 A;  3Q49 B;  4G2V A;  3UQ3 A;  4U0Z A;  5FTP A;  1NZN A;  1QQE A;  3S7D A;  3HYM B;  4BTA A;  4G24 A;  5ARF A;  3EDT B;  3S7F A;  3MV3 B;  4KBQ A;  3LY7 A;  4RG9 A;  4YND A;  4GA1 A;  3QDN A;  4BWR A;  2I6H A;  5D0O D;  3CV0 A;  4WND A;  2LNI A;  4GCO A;  5JJ6 A;  1ZBP A;  4NRH B;  4N3A A;  2OND A;  3ASH A;  5HQ8 A;  3LCA A;  5BT1 A;  1YA0 A;  3TG4 A;  5KJK A;  5AYW D;  4U04 A;  1W3B A; 
#chains in the Genus database with same CATH topology
 2WXR A;  4HFG A;  2Y4U A;  4HB5 A;  4WUY A;  4BSZ B;  3JXI A;  4GTS A;  2P9I G;  4BX9 A;  3ZYL A;  2P2C P;  2L6J A;  1A17 A;  3V2X A;  1WAO 1;  2PM7 A;  4U0U A;  1N4R A;  4DRX E;  4HOU A;  4N3C A;  5G04 J;  3CK7 A;  3WG7 E;  3GZ1 A;  5EYP F;  2L0T B;  4ANU A;  1O1R A;  2HE0 A;  4HS2 A;  2NYJ A;  4N5C A;  1XGW A;  4JHJ A;  2WXL A;  3NOG D;  3PZ4 A;  3RO3 A;  2DZO A;  2GRO B;  3E32 A;  2XEN A;  1O5M A;  5ENP D;  2J49 A;  5G04 C;  3LY9 A;  1MX6 A;  3RJV A;  2XZT G;  3NZS A;  4U07 A;  4L9P A;  1DC2 A;  3Q7A A;  1YCS B;  5KNG A;  5ITZ F;  1X81 A;  3ZYM A;  2FO7 A;  2XGS A;  4GZ5 A;  4HBD A;  2V5Q C;  5EX0 A;  3FWV A;  5LFA A;  1JCQ A;  2A5E A;  2XS8 A;  4GTM A;  5D66 A;  3QWV A;  5JHB A;  2ZIS A;  4GYW A;  2AXZ A;  3I3N A;  4DUI A;  4Q69 A;  5KBA A;  2IJG X;  2KCL A;  5DBK A;  3ABM E;  1FVH A;  2XRY A;  4KXK B;  2XEH A;  3OTN A;  4UWG A;  4B8C B;  3AS5 A;  3EHM A;  3LVQ E;  4JW1 A;  1PAQ A;  2EQX A;  1MJ0 A;  4GTV A;  2IO3 C;  2ZU6 B;  4HVB A;  1AP7 A;  3ESK A;  5HS0 A;  2WXN A;  4BET A;  4TXP A;  5C1D A;  2Y0B G;  3F6Q A;  4OVU A;  1OCC E;  4TRQ A;  1TNZ A;  1O1T A;  3I5P A;  4H7Y A;  4U8Y D;  3HDX A;  3NF1 A;  1Y6I A;  2UY1 A;  2EIK E;  1RZ4 A;  3D9M A;  5JHA A;  4A1G A;  2FUL A;  2FF4 A;  3U4T A;  3APF A;  4J8E A;  1BI8 B;  2WMO A;  1EPU A;  4Q94 A;  1SA4 A;  5KJN A;  4I2Z A;  4LRZ A;  2AVP A;  3QNK A;  3HXF A;  2P58 C;  4ZFH A;  3T5X A;  3UPV A;  3L6A A;  3JQ0 A;  3FUH A;  3TL5 A;  1IXV A;  3FTS A;  2GRL A;  3AG4 E;  1ELR A;  3L13 A;  2VSX E;  3PZ2 A;  3ZNG A;  3C3O A;  2MHK A;  3ZW3 A;  3QJZ A;  4I9C A;  4H7X A;  2LAH A;  1DCE A;  2WXF A;  1NL4 A;  3ABL E;  2E2E A;  5EID A;  3ZRH A;  3PEV B;  4AP2 A;  5A6C A;  2WXJ A;  1UOH A;  4XI9 A;  2XCB A;  5ANR A;  4N3B A;  4G26 A;  2F8X K;  5AQ7 A;  3GW4 A;  4U96 D;  2CHZ A;  1HE8 A;  2X6F A;  4BTB A;  2JLB A;  2PNN A;  5FQ4 A;  3SY2 A;  2KAT A;  3MKQ A;  3ZU7 B;  4GTP A;  4EBA G;  2KZT A;  1S63 A;  1AWC B;  3TWX A;  4G8L A;  2I9C A;  5LP0 A;  4LER A;  1FVF A;  4Y6C A;  4C9B B;  4EEC A;  4U95 D;  3L54 A;  4O60 A;  5EIL A;  2VTB A;  2WQH A;  4AY5 A;  2CG3 A;  1HH8 A;  3FH5 A;  1EYH A;  3ZPJ A;  4CGV A;  2OEV A;  2R05 A;  1OWP A;  3HVE A;  4N39 A;  2C0L A;  1H2U A;  2DBA A;  3PZD A;  2VGE A;  2A4Z A;  3TWQ A;  1N4P A;  5ANL A;  1DVP A;  3B13 A;  3CLJ A;  4BES A;  2UWJ G;  3D9P A;  2WXM A;  5G55 A;  2VQ2 A;  2AXU A;  2FBN A;  3HRA A;  3UXG A;  5DIZ A;  3SNX A;  4QFV A;  3QWP A;  3AG3 E;  3FUJ A;  3UKR G;  3Q7F A;  4GPK A;  4BT8 A;  3RRM B;  4TXQ A;  4I17 A;  4OVV A;  4GZC A;  3RIB A;  2EIM E;  3SF4 A;  2LO6 A;  2XEV A;  1MX2 A;  2L6B A;  4YVQ C;  4BFR A;  3CKB A;  1H6O A;  4N2Q A;  2GRR B;  3R7Q A;  1H2V C;  3SBT B;  3ONL A;  4I1O B;  3L17 A;  3D3M A;  1BPO A;  2ZGD A;  3B7R L;  4B94 A;  3B95 A;  4L2L A;  4XI0 A;  3Q49 B;  1WDY A;  3CST A;  2BKK B;  3Q9U C;  1FT2 A;  3S7D A;  4BTA A;  3W9G A;  4G24 A;  3EDT B;  3MV3 B;  1H2T C;  5FQ7 A;  3EJN A;  4GA1 A;  1NP7 A;  1OXJ A;  1U3D A;  2I6H A;  1OWO A;  2A5U A;  4WND A;  4RVB A;  4DI4 A;  2R2L A;  1S64 A;  5JJ6 A;  4CRW A;  1UW4 B;  3D9I A;  5ENN A;  1OT8 A;  2KBX A;  3ASH A;  3LCA A;  1YA0 A;  3TG4 A;  2DZN A;  4EZJ A;  4F53 A;  4UWK A;  3IEG A;  2YQ8 A;  3Q78 A;  3CVV A;  4IN3 B;  2F37 A;  3FUI A;  4DPR A;  4WAF A;  3ML8 A;  3BG0 B;  1QZ2 A;  3FDH A;  3CVQ A;  3QWW A;  3JQ1 A;  4K5B A;  4L2Y A;  2E0I A;  3BU8 A;  5BXU A;  3TXM A;  4GZ3 A;  4J8S A;  5E76 A;  1WM5 A;  5AEN A;  4UQY A;  3L22 A;  2R5S A;  2NSZ A;  5B1A E;  2XPI A;  3IBE A;  2Q7F A;  5AQB A;  3ZKJ A;  4N2S A;  3E30 A;  4FUL A;  4BEP A;  1SZA A;  3FTU A;  3PNT B;  4PH4 B;  2GRQ B;  1S70 B;  3QAR A;  1NFI E;  3JUI A;  1KT0 A;  4W9R A;  4FAD A;  2BTD A;  5EN5 D;  4LNU D;  1OWM A;  1OWN A;  4HOQ A;  2X38 A;  3MA5 A;  4CDM A;  3HXC A;  3UKU G;  4EZK A;  5FZR A;  3D9K A;  2RG8 A;  1Z3Y A;  4NQ0 A;  3SO8 A;  1TN6 A;  2WXO A;  2QYU A;  4K5A B;  4P29 A;  3UMV A;  1FT1 A;  4AXH A;  3G2T A;  2LXM A;  4I2W A;  4IYP A;  4A1S A;  3Q79 A;  4UI9 K;  4F6R D;  3CVU A;  4ACK A;  1HS6 A;  4I6G A;  4O1P A;  4BT9 A;  3K9I A;  4ANX A;  2FEZ A;  2V4L A;  3KSL A;  3ZGQ A;  4UUC A;  2OCC E;  4ILH B;  3CEQ A;  3IHY A;  2OOE A;  2XS1 A;  3CKC A;  2XQ0 A;  3IHV A;  2P9L G;  2VSN A;  4G23 A;  4JPS A;  4JA7 A;  4B93 B;  3D9L A;  4ZHB A;  3E34 A;  4GYY A;  4GMR A;  2F0Y A;  3B7T A;  1H0A A;  2UY1 B;  1N0Q A;  4U7E B;  3PRE A;  4EHM A;  3DXM G;  3DEP A;  3AG2 E;  4CDN A;  5IY5 E;  3QK0 A;  3NBN B;  5FJY A;  4M3O A;  5T4Y A;  3PZ1 A;  4TUU A;  3FTX A;  1D9S A;  3GZ2 A;  3NB2 A;  2I1K A;  5G05 J;  4HRM B;  3U64 A;  4URK A;  5BW8 C;  1JCR A;  2WXG A;  3CR3 A;  2OEW A;  4PS7 A;  2J8S D;  2ETC A;  3FU5 A;  3MKR A;  2H6F A;  1K3Z D;  3BUA A;  1TR4 A;  3UIN C;  2L0I A;  3BEE A;  3TAX A;  3E33 A;  4XEI G;  2EIJ E;  5HRY A;  3FUL A;  1E96 B;  5EKQ D;  2AW6 A;  3MJW A;  3D9N A;  4B8A A;  3AS4 A;  5G05 C;  5KJM A;  1E90 A;  2XZD G;  4AEZ C;  2XHE A;  3MKQ B;  4Z68 A;  5T8I A;  4DX1 A;  5AN8 A;  5CEA A;  2KZT B;  4Q96 A;  1MX4 A;  3QB2 A;  1E8W A;  3ONK A;  3ASG A;  4PS8 A;  4GU5 A;  5CBO A;  3LPZ A;  4CEM A;  5CBN A;  4I9E A;  2VTB B;  3C72 A;  1E8Y A;  4FU3 A;  1X5B A;  3ASN E;  2P9S G;  1KZO A;  3EHN A;  4HOS A;  2OV8 A;  4JL0 A;  3KEA A;  4OAU C;  3HVE B;  2PZI A;  3DSS A;  1D8E A;  3NAW A;  2WPV A;  4EZL A;  3NZU A;  4WNF A;  3PS6 A;  4O1O A;  1H6K A;  3AU5 A;  2J4D A;  5EYL A;  1P5Q A;  5AJD A;  1K8K G;  2RFM A;  4KYO B;  4AY6 A;  4ABN A;  2LSU A;  3DEO A;  2BKG A;  2Y4T A;  3B7S A;  3I4G A;  1OCR E;  1PC2 A;  1UJK A;  1IHB A;  3TWU A;  1JCS A;  3EU9 A;  1FPP A;  2ZXW E;  5BV1 A;  5ENT D;  3JCK C;  4MS6 A;  4WWN A;  1OCZ E;  3FH8 A;  1KLX A;  3SGH A;  4M7C A;  4A3V A;  2XGM A;  5AQ9 A;  3R7R A;  1JUQ A;  3FH7 A;  4GTT A;  3JXJ A;  4AV7 A;  1H19 A;  4AM9 A;  4GB9 A;  1IHG A;  4WWP A;  3CHS A;  5EDS A;  3UM2 A;  4J8F A;  2DCP A;  4JB8 P;  5D2M C;  2GRM A;  4K5C A;  3WXX A;  3ENE A;  2MYO A;  1HXI A;  1ZU2 A;  3FEY A;  5LX8 A;  1ELW A;  2VSO E;  4RLY A;  4CCA A;  3D9H A;  4GTR A;  3FTY A;  3QKY A;  4GML A;  4HOT A;  3T9K A;  3DRA A;  3UQ3 A;  3MCX A;  4EBA A;  2J07 A;  5FTP A;  1QQE A;  1E7V A;  3FUF A;  4KBQ A;  4I6E A;  4YND A;  3T8M A;  2R17 C;  1UN9 A;  2P9N G;  3FUM A;  4U8H A;  3CV0 A;  4TXR A;  1KZP A;  2YNQ A;  3HHM A;  5FQ8 A;  4FLH A;  4TUM A;  1ZBP A;  1YMP A;  2X6I A;  4NRH B;  1HG2 A;  3TWR A;  1D8D A;  2R59 A;  1H6P A;  4KVO A;  2GRN B;  3DSX A;  4HRL A;  4HLL A;  2BUG A;  3SI5 A;  1WG0 A;  4F7A A;  4N5Q A;  3PUJ A;  2ETB A;  2GW1 A;  4L23 A;  2WQ7 A;  1INZ A;  4C48 B;  2LSV A;  3DPD A;  3FU6 A;  3SD5 A;  5JMN D;  3C5R A;  4LEU A;  4AJW A;  4PUC A;  3B7B A;  4J8Y A;  5H7P A;  4NUR A;  4ILI A;  1HFA A;  3UIP C;  2YIN A;  4GA2 A;  2QFC A;  2JAB A;  3ZEF A;  3TJP A;  2DIW A;  4OAV B;  3EHQ A;  4I43 A;  3CVL A;  4U0S A;  3ASD A;  3FUE A;  1SA5 A;  4J0U A;  3FEX A;  4OYS A;  5FZS A;  4XKC A;  3FUK A;  2L9B A;  4GZ6 A;  3ZYQ A;  4LNG A;  5BV0 A;  1S0P A;  4KVM A;  4GYO A;  5JJT A;  2WXH A;  5FWQ A;  3ML9 A;  2WXP A;  5BPP A;  3HXD A;  1TNY A;  3IXE A;  5CCL A;  4RQI A;  2XPY A;  4DJA A;  3AJI A;  2FO1 E;  3E4B A;  1TYQ G;  4UWL A;  3MV2 B;  3PRZ A;  4FJZ A;  2PQR A;  2KCK A;  1SQM A;  3AG1 E;  1OUV A;  3SZ7 A;  4DX5 D;  3CHR A;  1FCH A;  3G2V A;  1SVX A;  3CVY A;  2ILR A;  1RW2 A;  4Y6W A;  4U8V D;  3ABK E;  3UM1 A;  3DWL G;  3I4R B;  4APO A;  1V54 E;  5BUZ A;  4A63 B;  2X6J A;  3T8K A;  1QYM A;  3LJ3 A;  2V8S E;  1U3C A;  4HI8 A;  1N94 A;  3TWV A;  2QYJ A;  2V0P A;  4MRU A;  5ENS D;  5D0Q D;  2MRI A;  3ASO E;  3L16 A;  4GTO A;  4IUL A;  5AIJ A;  4JEH A;  1B89 A;  2WVI A;  3KSQ A;  3PZ3 A;  2I1J A;  4XKB A;  4F1P A;  3AS8 A;  3DBS A;  3UIO C;  2KCV A;  3ZHE B;  2WQ6 A;  1N52 A;  4I1M A;  4HNA D;  3UT4 A;  5BXO A;  3KAE A;  4G8K A;  5EIB E;  1N4S A;  2AWI A;  3CVN A;  4LSZ E;  2M63 A;  3HXE A;  3RKV A;  4EQF A;  1K1B A;  3DST A;  2XPZ A;  4DLQ A;  5T3R A;  4FHJ A;  3O4Z A;  5FT9 A;  3FTW A;  5HI7 A;  2LAI A;  3Q9N C;  3DPY A;  3RO2 A;  1UN8 A;  3LY8 A;  1N11 A;  2Y1L E;  3N71 A;  2VGX A;  1IYG A;  3GZS A;  5JA4 D;  2X6K A;  2XCC A;  2YHC A;  2VJ8 A;  4CGW A;  2KM4 A;  2DVW A;  4DX2 A;  3MGB A;  3PNL B;  4G11 A;  5AAO A;  4LUN U;  3QAQ A;  3PEU B;  2JEK A;  1EF1 C;  2GGF A;  5CHE E;  4AIF A;  4NIK A;  4UI9 J;  5BNW A;  4I1A A;  1U2V G;  3Q4A B;  1OCO E;  2X6H A;  1QNF A;  2V5F A;  3AAA C;  4GMJ A;  3RRN B;  4B89 A;  3ZN3 A;  5FQ6 A;  1OWL A;  1BLX B;  3PE3 A;  5J90 A;  4ME2 A;  3RSE G;  1LD7 A;  1HO8 A;  4L1B A;  2IOS A;  1Y8M A;  3FHE A;  4UI9 C;  1BD8 A;  4YDY A;  3J5P A;  2I2O A;  3CHM A;  1E8X A;  4JVS A;  3L08 A;  2KC7 A;  2OVB A;  5B3S E;  3LKU A;  3P2B A;  3MYV A;  5B1B E;  2J09 A;  4F1S A;  5CER B;  3ZIM A;  2R03 A;  1XNF A;  2Y69 E;  2CG2 A;  1TNU A;  4O6F A;  3EIQ C;  3ZHE A;  2DWZ A;  3EU5 A;  3SHF A;  3G2U A;  5ENQ D;  2WB2 A;  1KT1 A;  1N54 A;  3OXG A;  5M72 A;  2CFU A;  4L7T A;  3TGO A;  2BED A;  1IKN D;  5HKP A;  2QC9 A;  4FJY A;  4HI9 A;  1TNO A;  3UUX A;  3SFX A;  2C2L A;  4JHR A;  2J08 A;  3SBS A;  2V4H C;  1IQU A;  1IQR A;  3VLF A;  3CQG B;  3S2A A;  3TWS A;  3U66 A;  2R02 A;  4C0E A;  3IV0 A;  3PH0 C;  3C3R A;  4LCT A;  3ZVV A;  1QBQ A;  2VSY A;  4AVX A;  3RU0 A;  5ENO D;  3V31 A;  4U0Z A;  3U9W A;  3DSW A;  4JC8 A;  5AAR A;  5AJL A;  1NZN A;  3FU3 A;  3TXN A;  5ARF A;  3HIZ A;  3P1U A;  2EIN E;  4FP7 A;  4K0R A;  4J6I A;  4R7L A;  4DK5 A;  4BWR A;  5D0O D;  4LG6 A;  2LNI A;  4GCO A;  4BER A;  3ULY A;  3MX3 A;  1N95 A;  2H6I A;  2OND A;  1Q2Z A;  3T5V A;  5HQ8 A;  4EPZ A;  4CT4 A;  5AYW D;  4DI3 A;  3IKO B;  4U04 A;  1Z6T A;  3APC A;  3LVR E;  3ZYK A;  4WWO A;  1K1A A;  3LYA A;  3CSF A;  1N0R A;  3MEK A;  1GW6 A;  3C3Q A;  2OVF A;  5KCM A;  2RKK A;  4UQX A;  4WNE A;  4FHK A;  3VTY A;  4ATZ D;  2HR2 A;  3ZFW A;  3LDZ A;  3EUV A;  3EIJ A;  3TG5 A;  3FP3 A;  3BQO A;  4J7W A;  3U3W A;  3LEW A;  3O48 A;  3CVW A;  4JEU A;  3FTZ A;  4GTQ A;  4LNB A;  2J9Q A;  1MHQ A;  4CT0 A;  2EIL E;  4YDO A;  1MZC A;  4K03 A;  3KS2 A;  2WXI A;  3UTM A;  3CK9 A;  5CED B;  4ILG A;  1BU9 A;  3ULE G;  3ZXS A;  4CZ2 D;  2C0M A;  2LXL A;  3ULQ A;  2PL2 A;  3TWT A;  1KPS B;  4UWH A;  1Z5S C;  1NA3 A;  4ACL A;  2XRZ A;  2QY7 A;  3R9A B;  4UQZ A;  2MOW A;  3LS8 A;  1Z3X A;  4AOF A;  4TV3 A;  2CHW A;  3Q47 B;  1A5E A;  4PS3 A;  4HLE A;  4HOR A;  4X8Q A;  3SFY A;  4HQD A;  5FZQ A;  3CGH A;  3PE4 A;  2RD0 A;  5J08 A;  2PQN A;  2IOL A;  2J4B A;  3BG1 B;  4YVO A;  3ZUV B;  4A3T A;  2Y3A A;  4I6J A;  3Q5M A;  4ANV A;  4RG6 A;  2ZIR A;  2VGY A;  4IRU A;  2IF4 A;  2WXK A;  1UJJ A;  3Q73 A;  5FIO A;  3W9F A;  2IQC A;  1TN7 A;  4HRN A;  3UI2 A;  2QZA A;  3OXL A;  2GRP B;  1JWF A;  1UG3 A;  3TWW A;  3ESL A;  4FA6 A;  4BSX A;  5C2Y A;  4A55 A;  1MQS A;  2H6G A;  5CCM A;  5AQA A;  4J8D A;  3RK6 A;  4GZD A;  2FI7 A;  2IO2 C;  1JPL A;  2IEJ A;  5G2N A;  3JUE A;  2P9P G;  3FU0 A;  4G1T A;  2BF0 X;  3QOU A;  4G25 A;  1O1S A;  5LOZ A;  1LD8 A;  4HXI A;  1WY6 A;  2HM8 A;  4E85 A;  3PVL A;  3CIA A;  2VGX B;  4YDE A;  1E8Z A;  2AXV A;  2YHE A;  3URZ A;  4JD2 G;  1YYH A;  1TJC A;  1HU3 A;  1MYO A;  4F3V A;  4FLB A;  3QC1 A;  1DCQ A;  4ATG A;  4APF A;  4JHK A;  3OXF A;  2HO1 A;  3CHP A;  3Q75 A;  3Q15 A;  4KZ0 A;  3DXK G;  5EX3 A;  3EHR A;  3JYS A;  4KZC A;  3X2Q E;  1TN8 A;  4GPM A;  3J5Q B;  2CHX A;  3D9J A;  3MZL B;  3NQP A;  4GA0 A;  2VYI A;  1EDU A;  5LCW J;  3E37 A;  4C0M A;  2KXP C;  4KT6 B;  1PY1 A;  3S7J A;  4MKT A;  1TNB A;  2X3M A;  2DYS E;  2NXP A;  2HYZ A;  2NC9 A;  3G2W A;  5A23 A;  3HXB A;  4U63 A;  1V55 E;  1HG5 A;  4DLO A;  2IY0 C;  3CVP A;  5FIN A;  2IU1 A;  3FTV A;  5ARG A;  4UWF A;  5A7D B;  3L82 A;  4WNG A;  2AJA A;  5KJL A;  5LCW C;  3G2S A;  3C98 A;  3UX4 A;  3V2O A;  4V3I A;  1E7U A;  1LF8 A;  1ELK A;  2F8Y A;  3VLE A;  3ASF A;  4XX5 A;  3CQC B;  3DSU A;  2WMN A;  2B0O E;  1G3N B;  2XGO A;  3FUN A;  3PDN A;  3HG0 D;  3KEZ A;  4GCN A;  3B7U X;  3DSV A;  4E6H A;  3SQV A;  5KWD A;  3LXU X;  1HX8 A;  2B6C A;  4PDX A;  3LJN A;  1JWG A;  3NOC D;  1HZ4 A;  2DYR E;  3RRU A;  2H6H A;  5CMY A;  2WM9 A;  2IFU A;  3VTX A;  3KD7 A;  3CK8 A;  4B0Z A;  4NAC A;  3ZXP A;  1NA0 A;  3OAW A;  3SFZ A;  5JJ7 A;  4CYM D;  2XEE A;  3S7B A;  2ETA A;  2LUH A;  3FY4 A;  1LTX A;  1N4Q A;  1SZ9 A;  4FC8 A;  5ENR D;  3R9M A;  3ISM C;  3PUK A;  2P9K G;  4BX8 A;  5CMW A;  3FFL A;  4JA9 A;  3UM3 A;  3AU4 A;  2ZGG A;  4CDR A;  3V30 A;  1NI1 A;  2RFA A;  5KNH D;  3L9T A;  4RSY A;  5CRV A;  4BY6 A;  4GAA A;  1OY3 D;  4XIF A;  1TEZ A;  4XE0 A;  2CFZ A;  1TJF A;  3GYZ A;  4XZ4 A;  4G2V A;  2ION A;  2PM6 A;  1N9A A;  3HYM B;  3FUD A;  5CEC B;  3S7F A;  2P9U G;  3CHO A;  3LY7 A;  5E75 A;  4ANW A;  4RG9 A;  4DX7 D;  4DX6 D;  4MLP A;  3QDN A;  3UT8 A;  3RAU A;  1VDY A;  5CRU A;  3CVX A;  3CHQ A;  2WXQ A;  1BI7 B;  3UT7 A;  3APD A;  3VLD A;  4JZY A;  4JXT A;  4MBG A;  1HF8 A;  3V79 K;  3D9O A;  4YDW A;  3UM0 A;  1ZB1 A;  4N3A A;  5BT1 A;  4KMO A;  4QQI A;  1L5J A;  5KJK A;  4D10 C;  1DNP A;  1SW6 A;  1W3B A; 
#chains in the Genus database with same CATH homology
 1Z6T A;  3IEG A;  2YQ8 A;  3APC A;  3LVR E;  3CVV A;  2WXR A;  3ZYK A;  4HFG A;  2Y4U A;  4WWO A;  2BUG A;  3LYA A;  3SI5 A;  4WUY A;  4IN3 B;  3CSF A;  4F7A A;  3FUI A;  4BX9 A;  3ZYL A;  3PUJ A;  4DPR A;  3MEK A;  1GW6 A;  2GW1 A;  4WAF A;  2L6J A;  1A17 A;  3BG0 B;  3ML8 A;  4L23 A;  2WQ7 A;  2OVF A;  1QZ2 A;  1INZ A;  3FDH A;  1WAO 1;  5KCM A;  2LSV A;  2PM7 A;  3CVQ A;  3DPD A;  3QWW A;  4U0U A;  3JQ1 A;  4UQX A;  4HOU A;  4WNE A;  4L2Y A;  3FU6 A;  3SD5 A;  4FHK A;  3VTY A;  2E0I A;  2HR2 A;  3ZFW A;  4N3C A;  3LDZ A;  4LEU A;  4AJW A;  3TXM A;  4GZ3 A;  3CK7 A;  4J8S A;  5G04 J;  4PUC A;  3EIJ A;  5E76 A;  1WM5 A;  3GZ1 A;  4NUR A;  3TG5 A;  4ILI A;  5AEN A;  1HFA A;  2YIN A;  4GA2 A;  2QFC A;  3FP3 A;  4UQY A;  3TJP A;  2DIW A;  3ZEF A;  2L0T B;  4ANU A;  3L22 A;  2R5S A;  2NSZ A;  4I43 A;  3CVL A;  2XPI A;  4U0S A;  3ASD A;  3U3W A;  4HS2 A;  3IBE A;  2Q7F A;  3FUE A;  3LEW A;  3O48 A;  4J0U A;  3CVW A;  3FEX A;  4N5C A;  4OYS A;  1XGW A;  4JEU A;  5FZS A;  4JHJ A;  4N2S A;  2WXL A;  3FTZ A;  4FUL A;  4XKC A;  2J9Q A;  3FUK A;  2L9B A;  3RO3 A;  1MHQ A;  4GZ6 A;  4CT0 A;  3ZYQ A;  1SZA A;  3FTU A;  3PNT B;  4PH4 B;  4K03 A;  3KS2 A;  5BV0 A;  1S0P A;  4KVM A;  2WXI A;  4GYO A;  5JJT A;  2WXH A;  3QAR A;  3JUI A;  5FWQ A;  1KT0 A;  4W9R A;  3ML9 A;  3CK9 A;  4FAD A;  2J49 A;  4ILG A;  2BTD A;  2WXP A;  5BPP A;  1OWM A;  1OWN A;  4HOQ A;  3ZXS A;  2X38 A;  2C0M A;  5CCL A;  5G04 C;  2PL2 A;  3LY9 A;  3MA5 A;  3ULQ A;  3RJV A;  4UWH A;  2XPY A;  4CDM A;  3NZS A;  1NA3 A;  4ACL A;  2XRZ A;  2QY7 A;  4DJA A;  4EZK A;  4U07 A;  5FZR A;  3R9A B;  3D9K A;  4UQZ A;  2RG8 A;  2MOW A;  1Z3Y A;  3E4B A;  4NQ0 A;  4UWL A;  3LS8 A;  1Z3X A;  3MV2 B;  3PRZ A;  4AOF A;  4FJZ A;  4TV3 A;  2CHW A;  2PQR A;  3Q47 B;  2KCK A;  4PS3 A;  2WXO A;  1SQM A;  1OUV A;  3SZ7 A;  4HLE A;  4HOR A;  3CHR A;  1FCH A;  3G2V A;  4P29 A;  5FZQ A;  3UMV A;  3ZYM A;  3CVY A;  2ILR A;  3CGH A;  3PE4 A;  3G2T A;  2RD0 A;  4Y6W A;  4AXH A;  5J08 A;  2PQN A;  2FO7 A;  2IOL A;  2XGS A;  2J4B A;  3BG1 B;  4GZ5 A;  4I2W A;  4IYP A;  3I4R B;  4A1S A;  4YVO A;  4APO A;  4UI9 K;  4A3T A;  2Y3A A;  4I6J A;  5BUZ A;  3Q5M A;  3CVU A;  2X6J A;  4ACK A;  4ANV A;  1HS6 A;  4I6G A;  4RG6 A;  3FWV A;  5EX0 A;  5LFA A;  3LJ3 A;  2VGY A;  4IRU A;  2IF4 A;  4BT9 A;  2WXK A;  1UJJ A;  3K9I A;  2V8S E;  4ANX A;  2IQC A;  2FEZ A;  2V4L A;  1U3C A;  3ZGQ A;  3QWV A;  5JHB A;  3OXL A;  4GYW A;  2AXZ A;  3I3N A;  1JWF A;  2V0P A;  4Q69 A;  1UG3 A;  4ILH B;  2IJG X;  2KCL A;  4MRU A;  5DBK A;  3CEQ A;  1FVH A;  2XRY A;  3IHY A;  4KXK B;  2OOE A;  5D0Q D;  2MRI A;  3ESL A;  3OTN A;  3AS5 A;  3CKC A;  4UWG A;  3EHM A;  4B8C B;  2XQ0 A;  4FA6 A;  3LVQ E;  3L16 A;  3IHV A;  4BSX A;  4JW1 A;  1PAQ A;  2EQX A;  2VSN A;  4IUL A;  5AIJ A;  4G23 A;  4JPS A;  4JA7 A;  5C2Y A;  3D9L A;  4JEH A;  1B89 A;  4GYY A;  2ZU6 B;  4A55 A;  2WVI A;  4HVB A;  2I1J A;  1MQS A;  3ESK A;  4XKB A;  5CCM A;  2WXN A;  3AS8 A;  3DBS A;  3B7T A;  1H0A A;  2KCV A;  2UY1 B;  4J8D A;  3RK6 A;  3ZHE B;  2WQ6 A;  1N52 A;  4GZD A;  2FI7 A;  4I1M A;  5C1D A;  1JPL A;  3PRE A;  3UT4 A;  5G2N A;  4OVU A;  4CDN A;  3QK0 A;  4TRQ A;  3FU0 A;  4G1T A;  2BF0 X;  3I5P A;  5FJY A;  3QOU A;  3KAE A;  4G25 A;  5LOZ A;  4H7Y A;  4M3O A;  2AWI A;  5T4Y A;  3HDX A;  4HXI A;  3CVN A;  1WY6 A;  2HM8 A;  3NF1 A;  2M63 A;  1Y6I A;  4E85 A;  2UY1 A;  3PVL A;  4TUU A;  3RKV A;  3D9M A;  5JHA A;  4A1G A;  2FUL A;  4EQF A;  3FTX A;  3CIA A;  2XPZ A;  4DLQ A;  3GZ2 A;  2VGX B;  5T3R A;  2FF4 A;  1E8Z A;  4FHJ A;  2I1K A;  3O4Z A;  3FTW A;  2AXV A;  5FT9 A;  3APF A;  2YHE A;  5G05 J;  3U4T A;  3U64 A;  3URZ A;  5BW8 C;  4J8E A;  5HI7 A;  4URK A;  2WMO A;  2LAI A;  1EPU A;  1TJC A;  3RO2 A;  1HU3 A;  1UN8 A;  2WXG A;  3CR3 A;  3LY8 A;  4Q94 A;  5KJN A;  4F3V A;  4FLB A;  4I2Z A;  3N71 A;  3QC1 A;  4LRZ A;  2AVP A;  4ATG A;  2VGX A;  4PS7 A;  1IYG A;  3FU5 A;  4APF A;  4JHK A;  3GZS A;  3QNK A;  3OXF A;  3MKR A;  4U04 A;  2HO1 A;  2X6K A;  2XCC A;  3CHP A;  2P58 C;  2YHC A;  3T5X A;  3UPV A;  3L6A A;  2L0I A;  2VJ8 A;  3BEE A;  3Q15 A;  3TAX A;  3JQ0 A;  3FUH A;  4KZ0 A;  4CGW A;  3TL5 A;  3FUL A;  1E96 B;  5EX3 A;  2KM4 A;  3JYS A;  4KZC A;  3FTS A;  2GRL A;  5EKQ D;  2CHX A;  2AW6 A;  3D9J A;  3MZL B;  3MJW A;  1ELR A;  3MGB A;  3NQP A;  3D9N A;  3PNL B;  4GA0 A;  2VYI A;  4G11 A;  1EDU A;  4B8A A;  5LCW J;  3AS4 A;  3L13 A;  2VSX E;  4LUN U;  5G05 C;  3QAQ A;  2MHK A;  3PEU B;  2JEK A;  3ZW3 A;  1EF1 C;  2GGF A;  3QJZ A;  4I9C A;  5CHE E;  4C0M A;  4KT6 B;  5KJM A;  4H7X A;  1PY1 A;  2LAH A;  2WXF A;  3S7J A;  4MKT A;  4AIF A;  1E90 A;  2E2E A;  2X3M A;  4UI9 J;  5BNW A;  4I1A A;  2NXP A;  2HYZ A;  4AEZ C;  2XHE A;  3ZRH A;  3PEV B;  3Q4A B;  4AP2 A;  5A6C A;  2X6H A;  2NC9 A;  1QNF A;  2WXJ A;  4XI9 A;  3G2W A;  3MKQ B;  5A23 A;  2XCB A;  5ANR A;  2V5F A;  4U63 A;  4N3B A;  5T8I A;  4G26 A;  1HG5 A;  4GMJ A;  2KZT B;  4DLO A;  3CVP A;  3GW4 A;  2CHZ A;  4Q96 A;  2IU1 A;  3RRN B;  1HE8 A;  3FTV A;  4B89 A;  2X6F A;  3ZN3 A;  3QB2 A;  2JLB A;  1E8W A;  5FQ6 A;  5ARG A;  4BTB A;  3ONK A;  3ASG A;  4UWF A;  4PS8 A;  5FQ4 A;  4GU5 A;  5A7D B;  1OWL A;  4WNG A;  2KAT A;  5KJL A;  3MKQ A;  3PE3 A;  5J90 A;  4ME2 A;  5LCW C;  3LPZ A;  4CEM A;  4EBA G;  4I9E A;  2VTB B;  1E8Y A;  3G2S A;  3C98 A;  4FU3 A;  3UX4 A;  2KZT A;  1HO8 A;  1X5B A;  4L1B A;  4V3I A;  1E7U A;  1LF8 A;  2IOS A;  1Y8M A;  2I9C A;  3FHE A;  1ELK A;  4UI9 C;  5LP0 A;  4LER A;  3VLE A;  1FVF A;  4Y6C A;  2I2O A;  3ASF A;  3CHM A;  4C9B B;  4EEC A;  4XX5 A;  1E8X A;  3L54 A;  4JVS A;  3CQC B;  3EHN A;  4HOS A;  2VTB A;  3L08 A;  2KC7 A;  2OV8 A;  4JL0 A;  2OVB A;  2WMN A;  3HVE B;  2PZI A;  2WQH A;  4AY5 A;  2CG3 A;  1HH8 A;  2XGO A;  3FH5 A;  3LKU A;  3P2B A;  1EYH A;  3MYV A;  2WPV A;  3FUN A;  3ZPJ A;  3PDN A;  4CGV A;  4EZL A;  3NZU A;  3KEZ A;  4WNF A;  2J09 A;  4GCN A;  4F1S A;  3PS6 A;  3ZIM A;  3B7U X;  1XNF A;  1H6K A;  3AU5 A;  2J4D A;  1OWP A;  4E6H A;  3HVE A;  1P5Q A;  3LXU X;  4N39 A;  2C0L A;  2CG2 A;  4O6F A;  1HX8 A;  5AJD A;  1H2U A;  3EIQ C;  2DBA A;  3PZD A;  4PDX A;  3ZHE A;  1JWG A;  4KYO B;  1HZ4 A;  2A4Z A;  4AY6 A;  5ANL A;  3RRU A;  4ABN A;  2LSU A;  3SHF A;  3G2U A;  2Y4T A;  1DVP A;  3B7S A;  3B13 A;  3CLJ A;  5CMY A;  2WB2 A;  1KT1 A;  1N54 A;  3I4G A;  2UWJ G;  2WM9 A;  2IFU A;  3D9P A;  1PC2 A;  3OXG A;  1UJK A;  2WXM A;  3CK8 A;  3KD7 A;  3VTX A;  4B0Z A;  5M72 A;  2CFU A;  5G55 A;  2VQ2 A;  4L7T A;  2AXU A;  2FBN A;  4NAC A;  3TGO A;  5DIZ A;  3SNX A;  4QFV A;  3QWP A;  3FUJ A;  5BV1 A;  3JCK C;  4MS6 A;  1NA0 A;  4WWN A;  4GPK A;  3FH8 A;  4BT8 A;  3RRM B;  3OAW A;  1KLX A;  4FJY A;  3SGH A;  4A3V A;  3SFZ A;  2XGM A;  3R7R A;  5JJ7 A;  4I17 A;  1JUQ A;  4OVV A;  3FH7 A;  3UUX A;  4GZC A;  3S7B A;  3RIB A;  2C2L A;  4JHR A;  3SF4 A;  4AV7 A;  1H19 A;  2LO6 A;  2XEV A;  3FY4 A;  2J08 A;  4AM9 A;  1SZ9 A;  4FC8 A;  4GB9 A;  1IHG A;  4YVQ C;  3SBS A;  4BFR A;  4WWP A;  3CKB A;  3CHS A;  5EDS A;  4N2Q A;  4J8F A;  2DCP A;  3R7Q A;  2GRM A;  1H2V C;  3PUK A;  4BX8 A;  3SBT B;  1IQU A;  5CMW A;  3FFL A;  3WXX A;  3ENE A;  1IQR A;  4JA9 A;  3ONL A;  3VLF A;  4I1O B;  3AU4 A;  3CQG B;  3L17 A;  4CDR A;  1HXI A;  1ZU2 A;  3D3M A;  1BPO A;  3FEY A;  3S2A A;  3U66 A;  5LX8 A;  1ELW A;  2VSO E;  4CCA A;  4RSY A;  4C0E A;  4BY6 A;  4GAA A;  3IV0 A;  3PH0 C;  4XIF A;  3B7R L;  4B94 A;  3FTY A;  1TEZ A;  4LCT A;  4XE0 A;  4L2L A;  3ZVV A;  3QKY A;  4GML A;  4HOT A;  2CFZ A;  1TJF A;  4XI0 A;  2VSY A;  3GYZ A;  4XZ4 A;  3Q49 B;  3RU0 A;  4AVX A;  4G2V A;  2ION A;  3UQ3 A;  3CST A;  3MCX A;  4U0Z A;  4EBA A;  3U9W A;  2J07 A;  2PM6 A;  5FTP A;  4JC8 A;  5AJL A;  1NZN A;  1QQE A;  3FU3 A;  3S7D A;  3TXN A;  3HYM B;  4BTA A;  1E7V A;  4G24 A;  5ARF A;  3FUD A;  3HIZ A;  3EDT B;  3S7F A;  3FUF A;  3MV3 B;  3CHO A;  4KBQ A;  3LY7 A;  1H2T C;  3P1U A;  5E75 A;  5FQ7 A;  4I6E A;  4RG9 A;  4YND A;  4FP7 A;  4K0R A;  3EJN A;  4GA1 A;  4MLP A;  3T8M A;  1NP7 A;  3QDN A;  2R17 C;  1UN9 A;  3UT8 A;  1U3D A;  4J6I A;  4R7L A;  1VDY A;  3FUM A;  4DK5 A;  4U8H A;  4BWR A;  2I6H A;  5D0O D;  3CV0 A;  3CVX A;  3CHQ A;  2WXQ A;  1OWO A;  2A5U A;  4WND A;  2YNQ A;  4RVB A;  3UT7 A;  3APD A;  2LNI A;  4ANW A;  4DI4 A;  3HHM A;  4JZY A;  4GCO A;  3VLD A;  4JXT A;  5FQ8 A;  5JJ6 A;  1HF8 A;  4CRW A;  4FLH A;  1UW4 B;  1ZBP A;  2X6I A;  3D9O A;  3D9I A;  3MX3 A;  5ENN A;  4NRH B;  1HG2 A;  4N3A A;  2OND A;  3T5V A;  3ASH A;  5HQ8 A;  4EPZ A;  3LCA A;  5BT1 A;  1YA0 A;  3TG4 A;  4CT4 A;  4KMO A;  4EZJ A;  2R59 A;  4F53 A;  1L5J A;  4KVO A;  5AYW D;  1DNP A;  4D10 C;  5KJK A;  4DI3 A;  4UWK A;  3IKO B;  1W3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...