5AYWD

Structure of a membrane complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
212
Chain Sequence
GSKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title Structure of the BAM complex and its implications for biogenesis of outer-membrane proteins
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Membrane protein
total genus 73
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5aywD00
4N3BA 5JJTA 5EX3A 5M72A 3KAEA 3MV2B 2IF4A 3BEEA 5D0OD 3QWWA 3CK7A 2C0LA 1KT1A 4I1AA 2KCKA 4AIFA 3CKCA 5KJMA 3KS2A 4I2ZA 3RKVA 3LKUA 3N71A 4BWRA 5LCWJ 4GYYA 5FZRA 2VGYA 3MEKA 5BW8C 4CGWA 2Y4TA 1ZBPA 2UY1A 3S7BA 3VTYA 2FBNA 5JJ7A 1PC2A 3FWVA 3RO2A 3AS8A 1KT0A 4O6FA 2VGXA 4I9EA 3WXXA 5D0QD 2HYZA 2KCVA 3NF1A 2C2LA 2XEVA 1HXIA 3OXGA 3CVLA 4UQZA 2WQHA 4U0ZA 2FO7A 5KJLA 3S7DA 3TGOA 2DBAA 5ARFA 5KJKA 4G26A 2HO1A 3QOUA 4YNDA 2PQRA 2ONDA 3RU0A 5FTPA 3LY7A 1E96B 3SZ7A 4GZ6A 4N2SA 4WNGA 3E4BA 5A6CA 3MKRA 1ELRA 2PQNA 3CK9A 4XI0A 5ARGA 3MV3B 4N39A 1XNFA 3CK8A 4WNEA 3ULQA 4NRHB 4IN3B 1OUVA 3Q4AB 2XCBA 3U4TA 2YHCA 3EDTB 5EX0A 4UI9K 3ZPJA 4UQYA 3PE3A 1ZU2A 3TG4A 4G1TA 3UUXA 2XCCA 5BNWA 3ZFWA 3QWVA 3Q49B 3ASFA 2I6HA 5CCMA 4A1SA 2P58C 5HQ8A 2LNIA 5DBKA 2Y4UA 4BT9A 3KD7A 3MA5A 2J9QA 4G24A 5CCLA 3QDNA 4LEUA 3FFLA 5LCWC 2UY1B 3OXLA 5G04J 4G23A 4JA9A 2MHKA 5JJ6A 4H7XA 3HYMB 2VGXB 2KC7A 4UQXA 4BTBA 4HORA 3ASGA 3GYZA 4BTAA 3QKYA 3CV0A 3Q5MA 1HH8A 4YVQC 3ASHA 1NA3A 2YQ8A 2IFUA 2UWJG 4CGVA 4ABNA 2VSNA 1YA0A 1TJCA 4WUYA 4GYWA 4GYOA 2L6JA 2GW1A 2E2EA 2VYIA 3FP3A 2XGSA 2OOEA 4RG6A 4G25A 4WNDA 3TAXA 4XI9A 4GCOA 3LY9A 1NA0A 2AVPA 4U0SA 3Q47B 4N3AA 3ZN3A 3PE4A 3ESKA 3CKBA 4JA7A 4KBQA 2BUGA 3ZHEA 2PL2A 3ZHEB 4GA2A 1Y8MA 1HZ4A 2FEZA 4HOTA 4KYOB 4JL0A 2PZIA 4Y6CA 3K9IA 1ELWA 3UQ3A 3JYSA 3URZA 5CHEE 3RIBA 2V5FA 3GZ2A 4EQFA 4W9RA 4AM9A 5FZQA 4HOUA 1IYGA 5G05J 2XPIA 3O48A 5FJYA 4GZ3A 2QFCA 3QWPA 3U3WA 1B89A 4Y6WA 5G05C 4NQ0A 2WPVA 4KXKB 4CDRA 2R5SA 4APOA 3CVPA 3LY8A 3RO3A 4G2VA 4J0UA 2KATA 2NC9A 4JHRA 4U07A 2XGOA 2JLBA 4YVOA 1WM5A 5HI7A 4HOSA 5G04C 2VQ2A 3CEQA 1FCHA 3OXFA 5BT1A 3AS4A 5A7DB 4U04A 4ME2A 3UPVA 4GPKA 5DIZA 1NZNA 3SF4A 4U0UA 4HOQA 5FT9A 3ASDA 4J8EA 5FZSA 2FF4A 4UI9J 4J8FA 4UI9C 4RG9A 1WAO1 3LYAA 4BT8A 3GW4A 1IHGA 4I9CA 3IEGA 4B94A 4H7YA 3LCAA 5KJNA 4GA0A 1KLXA 1QQEA 3CVQA 1A17A 1W3BA 4AY6A 3Q15A 3PDNA 4I2WA 2HR2A 4XIFA 4GZ5A 1P5QA 4AY5A 4N3CA 2C0MA 3TG5A 3LPZA 4WNFA 3RJVA 4GCNA 1QZ2A 3S7FA 5C1DA 2XGMA 2KCLA 5EKQD 2VSYA 2Q7FA 2LSUA 4J8DA 3S7JA 2LSVA 4GA1A 3VTXA 3AS5A 4N5CA 3GZ1A 5AYWD 2FI7A 3ZGQA 4N2QA 4I17A 3R9AB 4F3VA 3CVNA
chains in the Genus database with same CATH superfamily
2J4DA 5EX3A 2QY7A 2H6FA 3MJWA 2J49A 4EPZA 3PRZA 5BPPA 1OCOE 2A5UA 3AU4A 3JUEA 2CHXA 2IF4A 4JEHA 3L08A 5ENRD 1MYOA 4HBDA 3RRMB 3FU5A 3CK7A 2C0LA 2KCKA 5KJMA 3KS2A 4BWRA 4HVBA 3LVRE 3B7RL 2OCCE 5CECB 5FZRA 4TXRA 4BERA 3MEKA 3L16A 4KMOA 2FBNA 3TWVA 3W9GA 4UWKA 3FWVA 2LUHA 5AQ7A 4DPRA 4O6FA 4TXPA 5D0QD 2EQXA 1BU9A 3Q78A 3ZW3A 3NF1A 1HU3A 4O60A 2CHWA 2RKKA 4FC8A 3ZYMA 3SNXA 3OXGA 4O1PA 5ENQD 4FA6A 1L5JA 1YYHA 4ZHBA 1TNYA 3NB2A 4QFVA 4G11A 3LXUX 1H19A 3QOUA 3NAWA 4KVMA 2PQRA 2ONDA 2H6GA 4FULA 1TN6A 3SFYA 4B8CB 4A1GA 4BY6A 5KWDA 3U66A 4RVBA 3CHMA 1UW4B 3FH5A 2KBXA 3PZ4A 4ILHB 3MV3B 4HLLA 4GPMA 3B13A 1XNFA 3ULQA 4O1OA 2XRZA 1OUVA 3Q4AB 3T8MA 3EU5A 1D9SA 2YHCA 1IHBA 1WDYA 3FTZA 3BUAA 3WG7E 2FO1E 4BESA 2QZAA 2XCCA 1UN8A 3ZFWA 2I2OA 2DZNA 3QWVA 2VTBB 2AXZA 3ZXSA 2J8SD 5CBNA 3AU5A 1KPSB 4HLEA 5FIOA 1E90A 5DBKA 3CQCB 3PNLB 3TWXA 3ZEFA 2Y4UA 4M7CA 4OAVB 5FQ7A 4BT9A 3KD7A 3EJNA 1LTXA 2P9LG 5CCLA 3QJZA 3DEPA 3IV0A 5B1AE 3L22A 2UY1B 3V79K 4G23A 4JA9A 2DVWA 3LDZA 5JJ6A 3APCA 2KC7A 4HRNA 4I6EA 1LD7A 3FHEA 2ETAA 1N4SA 2J4BA 3QKYA 4CDNA 3Q5MA 2IJGX 2WXQA 3JQ0A 3ABKE 5J08A 2V4LA 1NA3A 2YQ8A 4CGVA 1TJFA 2VSNA 4CT4A 4LSZE 4K5CA 2XGSA 4JEUA 5EN5D 4DJAA 4OVUA 2OEWA 2B0OE 4WNDA 1INZA 1E7UA 1EYHA 2MYOA 3Q47B 3EHNA 3HXDA 3ZYKA 4ANXA 2YINA 3BG0B 3PZDA 3UKRG 4PS8A 3UM0A 4GTVA 2PL2A 3EU9A 1S63A 3U9WA 4GA2A 3C72A 5CEDB 1SW6A 3PVLA 5ENPD 2WXGA 3QB2A 4KYOB 4JL0A 1Y6IA 4GTTA 4DI4A 2Y69E 2WXIA 2OVFA 3JYSA 1LD8A 3FTUA 2V5FA 1SZAA 4AM9A 3UM2A 5FQ6A 3TWTA 4EHMA 4BETA 4Y6WA 4JZYA 1NP7A 4JD2G 3HDXA 4APOA 3CVPA 3RO3A 1DNPA 4G2VA 4V3IA 2CHZA 1FPPA 4Q69A 3SQVA 3SY2A 2JLBA 1WM5A 1O5MA 4DRXE 4HOSA 2LAIA 4J6IA 3JXIA 2ZU6B 3FEYA 1OT8A 3ONLA 5ENTD 1FCHA 1BI8B 1G3NB 3DSWA 4U04A 4HFGA 4HOQA 4TUUA 4CYMD 3ASDA 4J8EA 4P29A 2X38A 5ANRA 3E30A 2P9SG 3E34A 3D9PA 4CT0A 4Z68A 4J8FA 1U2VG 1E7VA 3IHYA 3VLFA 4BT8A 1IHGA 5FWQA 4F53A 2DYRE 4CEMA 2WQ7A 4G8KA 1TR4A 4H7YA 3KEZA 4UWLA 5IY5E 4X8QA 1IXVA 1OWLA 1OCRE 4OYSA 4TUMA 3Q15A 3PDNA 3LEWA 3SO8A 2KM4A 1U3DA 4AY5A 3SBTB 4MRUA 3RJVA 3SI5A 2WXPA 4GCNA 1OWPA 3ZIMA 4B0ZA 4ACLA 2XGMA 4CZ2D 2P9UG 4XE0A 4EZLA 2KCLA 3IBEA 4EZJA 2EINE 2VSYA 4URKA 3J5QB 3P2BA 3FEXA 3I3NA 4GMJA 5AYWD 4LNGA 3FUNA 3CHPA 4F3VA 1DVPA 4CCAA 3V2XA 2WXOA 2P9PG 3KAEA 3PEVB 4KZCA 3D9HA 2WMOA 1PAQA 1JCRA 3CKCA 4DK5A 3LKUA 5LCWJ 4GYYA 3IHVA 3PH0C 4XKBA 2EILE 2V5QC 3EHQA 3JUIA 3VTYA 3S7BA 1PC2A 1EPUA 3NOGD 1KT0A 2I9CA 1SA4A 2EIME 1N4QA 5D2MC 4ZFHA 4PDXA 4I9EA 5AIJA 4C48B 4YDYA 3V31A 2HYZA 2E0IA 4EBAG 2VSOE 2KZTB 1HXIA 3I4GA 2FO7A 5KJLA 5LOZA 3ULEG 5KJKA 4G26A 2NSZA 4YNDA 3EIQC 1SVXA 3RU0A 5FTPA 2JEKA 3LY7A 3D9KA 2J08A 3C5RA 3ABME 2WM9A 1K1BA 3MKRA 1MJ0A 4AJWA 1V54E 2ZXWE 5T8IA 4HI9A 1O1RA 1RZ4A 4WNEA 1EDUA 4IN3B 3ZUVB 4RLYA 2XCBA 5EX0A 4UI9K 4HRLA 3TWQA 1A5EA 3PE3A 3TG4A 4G1TA 3UUXA 3DXMG 2XPYA 3EHRA 5ENOD 2V0PA 3Q49B 2F37A 1UG3A 2I6HA 2OEVA 4I6GA 3IKOB 2Y3AA 3R9MA 1DCEA 4A1SA 2P58C 2BEDA 2LNIA 2XHEA 1N4RA 4ANWA 4L1BA 2VSXE 2F8YA 1KZOA 5C2YA 4IYPA 2QYJA 5G04J 2F0YA 4F1SA 4AP2A 4H7XA 3HYMB 1VDYA 2NXPA 3ASGA 3GYZA 4LRZA 1OCCE 4BTAA 3UT8A 1OWNA 3V30A 2X6HA 3TWUA 2UWJG 4ABNA 3E32A 4K0RA 1TJCA 4L9PA 4DX5D 3AG2E 3AG4E 1NL4A 2ILRA 2VYIA 2IY0C 4G25A 4D10C 4E85A 1JWGA 4GCOA 4MBGA 4J8SA 3NZSA 3SD5A 3L82A 3DEOA 4YDOA 1EF1C 4I1OB 3ESKA 2CG2A 3CKBA 4ATZD 3D9IA 4LCTA 3ZHEA 4BFRA 3ZHEB 4TXQA 1Y8MA 1HZ4A 1S70B 2IOSA 1OXJA 4HOTA 2OV8A 4WWOA 3L54A 2WXNA 3G2WA 3K9IA 2WXLA 1ELWA 4JHJA 3URZA 3RIBA 4MKTA 3DSXA 4EQFA 4W9RA 4HOUA 1IYGA 2GGFA 3X2QE 3BQOA 3HRAA 4GZ3A 4APFA 3HXEA 4FJZA 3Q7FA 1B89A 5LP0A 2XZTG 4NQ0A 4K03A 1TEZA 2BKGA 2DYSE 2KATA 2P2CP 5BXOA 3FH7A 1HX8A 5CERB 2DIWA 1JCQA 3PZ2A 4UWHA 2L9BA 3G2UA 5KNGA 3CEQA 2J07A 3B95A 3CHQA 2AWIA 3FUKA 5BT1A 3AS4A 5A7DB 4GPKA 2WMNA 3SF4A 1HS6A 2X6FA 4U0UA 1X81A 3ZVVA 2GRMA 3ASOE 2FF4A 4UI9J 2HM8A 4PUCA 4FHJA 1Q2ZA 3V2OA 3G2SA 2R59A 4UI9C 3ZYQA 4JC8A 3LYAA 4HB5A 3HVEA 3GW4A 4ILGA 3HVEB 3KSLA 2XRYA 3IEGA 5KJNA 4U63A 4E6HA 1KLXA 1QQEA 3CHSA 3DSUA 4GTSA 1FVHA 3Q79A 5J90A 3SHFA 2AW6A 4I2WA 3P1UA 5ANLA 1JWFA 2RG8A 4L2YA 4GZ5A 4N3CA 4WNFA 3L6AA 4I1MA 3UT7A 2YNQA 3DXKG 2GRQB 3FTYA 5AJDA 5HRYA 1Z3XA 3PREA 3MGBA 4I43A 5CRUA 3S7JA 4GA1A 3FTWA 5EILA 3VTXA 3AS5A 3GZ1A 4B93B 4DLQA 1HG2A 4DX7D 3HXBA 2I1KA 1ELKA 3QARA 3UKUG 2X6KA 1N0QA 4GMLA 2EIJE 5BUZA 4EBAA 1HE8A 3BEEA 5D0OD 3QWWA 1KT1A 3Q9NC 2IO3C 4RSYA 4AIFA 2P9IG 4HQDA 3RKVA 3SGHA 3TXMA 2P9KG 4EZKA 4Q94A 3EIJA 3ABLE 2LXMA 3ZXPA 3FDHA 4Q96A 1ZBPA 4TV3A 2ZISA 3PZ3A 5JJ7A 3DSSA 1SQMA 2L0IA 5CRVA 3RO2A 3BU8A 3LJNA 2VGXA 4AXHA 1S0PA 3WXXA 4OAUC 3W9FA 2ZIRA 2WXKA 2XEVA 1UOHA 3OTNA 3CVLA 4UQZA 3SFZA 4DLOA 3GZSA 1MHQA 3ML8A 1GW6A 2DBAA 1Z5SC 2HO1A 2YHEA 1KZPA 4A3VA 1E96B 3SZ7A 4HRMB 4GZ6A 4C9BB 3B7UX 4N2SA 3LJ3A 4U8HA 4WNGA 3UI2A 3E4BA 4GTOA 5HS0A 2PQNA 4HNAD 4N39A 2BKKB 3UTMA 3CK8A 3TJPA 3RSEG 4NRHB 4ILIA 3QAQA 3U4TA 4JHKA 3T8KA 4DX1A 3EDTB 2Y1LE 3ZPJA 2A5EA 4UQYA 4BSZB 1ZU2A 2GRRB 5A23A 3RAUA 2IONA 2IOLA 2V4HC 5KCMA 1QNFA 1HF8A 5T4YA 5CCMA 3MYVA 3FUDA 1D8DA 5E75A 1JPLA 1E8ZA 3ZKJA 5LX8A 4K5BA 5G2NA 3F6QA 4L7TA 3UX4A 1TYQG 3HXFA 5JMND 3HIZA 2KXPC 4F6RD 3CR3A 2LAHA 1H2TC 1MX2A 3QDNA 4LEUA 2WXRA 4ACKA 3FFLA 5LCWC 3OXLA 2H6IA 3HG0D 3L9TA 3J5PA 3Q75A 2MHKA 4ATGA 2R05A 4HORA 2ETCA 1UJKA 4GB9A 3CV0A 3CHOA 3PUJA 4YVQC 3ASHA 2IFUA 4LNBA 1YA0A 5AJLA 4WUYA 3UM3A 4B89A 2GW1A 1QYMA 2JABA 3PS6A 5E76A 1TN8A 2V8SE 2MOWA 4XZ4A 3U64A 2WXHA 3TAXA 2LO6A 2XS1A 4XI9A 2IEJA 4U95D 3LY9A 5BV1A 1BI7B 1NA0A 2R2LA 4U0SA 1SA5A 3C98A 3AAAC 4N3AA 4M3OA 1WY6A 2J09A 3PE4A 3PNTB 2BUGA 4KBQA 5AQBA 1N0RA 3D9OA 2X3MA 4IULA 2FEZA 1FVFA 2ZGDA 1MZCA 2WXJA 2ZGGA 2GRLA 4Y6CA 4GTMA 2X6JA 2LXLA 3VLDA 3HHMA 3FUIA 5JA4D 5CHEE 4FP7A 1FT1A 1H0AA 3MX3A 5G05J 4XKCA 3ENEA 2QFCA 3QWPA 4FJYA 5B1BE 1H6OA 1OWMA 2XENA 2XEHA 5G05C 2WPVA 3ZYLA 3RK6A 4FU3A 4CDRA 2IQCA 5AENA 4GTPA 5ENNA 2FULA 2RFMA 3TWRA 2WXMA 4J0UA 2OVBA 1JCSA 3CHRA 4JHRA 4U07A 5HKPA 3RRUA 2R17C 3B7SA 3DSTA 2XGOA 2B6CA 5D66A 5HI7A 1PY1A 3CSTA 3JXJA 4PS3A 1N54A 5BV0A 4FADA 3FTXA 5G04C 2VQ2A 4F7AA 1MX6A 1TNZA 2CFUA 3DRAA 3OXFA 4B8AA 4A3TA 4ME2A 5DIZA 1NZNA 5KNHD 1UN9A 3R7RA 5FT9A 4U7EB 5AQAA 2R03A 3AG3E 3DPDA 4DX6D 3AJIA 4HXIA 4RG9A 4LERA 2WVIA 4C0EA 1HO8A 4JVSA 3BG1B 3TWWA 4GZCA 3MKQA 4ANVA 4I6JA 3CQGB 1O1SA 3MKQB 4B94A 1LF8A 2PM7A 4MS6A 3FUFA 4GA0A 1K8KG 2M63A 5KBAA 1A17A 3UMVA 1W3BA 4JXTA 5AAOA 4UWFA 3R7QA 2HR2A 3PZ1A 1V55E 3I4RB 4XIFA 3D9MA 1P5QA 3ZU7B 5CMWA 2C0MA 3TWSA 5AN8A 1K1AA 3TG5A 3CVWA 1IKND 2P9NG 3CVXA 1QZ2A 3S7FA 4EECA 1N9AA 4FHKA 2AXVA 5JHAA 2LSUA 4J8DA 5ITZF 3CSFA 2LSVA 4N5CA 4JW1A 3I5PA 2FI7A 3ZGQA 4N2QA 1ZB1A 2PNNA 2PM6A 3OAWA 1WG0A 2BF0X 3FULA 2VTBA 4N3BA 5JJTA 3LS8A 4DI3A 5M72A 1HFAA 3UXGA 1E8XA 3G2TA 3FUMA 3MV2B 4L23A 3ASNE 4IRUA 5ENSD 5CEAA 2RD0A 2ETBA 4I1AA 3HXCA 3O4ZA 1H2VC 3FUHA 2GRNB 4I2ZA 3N71A 1Z6TA 2QC9A 3CLJA 4HS2A 2VGYA 4NIKA 5BW8C 4CGWA 2Y4TA 1FT2A 2WXFA 2UY1A 3D9LA 3QK0A 4F1PA 3AS8A 5EYLA 3FH8A 5EIBE 4PH4B 4BEPA 2XEEA 3C3QA 3L17A 2KCVA 2C2LA 4HI8A 2WQ6A 2HE0A 2XQ0A 5FINA 1MX4A 2WQHA 2XS8A 4U0ZA 3DWLG 2F8XK 3S7DA 3RRNB 3TGOA 3JCKC 1OY3D 5ARFA 4N5QA 3FU6A 3Q9UC 3C3OA 3G2VA 4CRWA 4RQIA 4CDMA 1X5BA 3QC1A 4G8LA 2L6BA 4A63B 1YMPA 5A6CA 1ELRA 2AXUA 1AWCB 3CK9A 1OCZE 4XI0A 3CGHA 3Q73A 5ARGA 3ONKA 3S2AA 2R02A 3B7BA 3ZRHA 1TNUA 3MCXA 1H2UA 3NOCD 4GMRA 1OWOA 3CVVA 1AP7A 5CMYA 5BNWA 3ASFA 1BLXB 2BTDA 3FU3A 4J7WA 4BSXA 5EDSA 2VGEA 1IQRA 3APDA 3JQ1A 4FLBA 4GU5A 4ANUA 3PUKA 1BD8A 2Y0BG 5HQ8A 4YDWA 2XZDG 3ZNGA 3MA5A 1MQSA 2J9QA 4G24A 4NURA 5BXUA 5FQ8A 4C0MA 1SZ9A 5CBOA 3UIOC 3LVQE 3UINC 2VGXB 4UQXA 4BTBA 3L13A 2WB2A 1TNBA 3B7TA 4DUIA 4JPSA 2NYJA 3FUJA 4AEZC 2VJ8A 1HH8A 4AV7A 4GZDA 4XEIG 1QBQA 5LFAA 3E33A 4BX9A 4GYWA 4GYOA 2L6JA 3FU0A 3DSVA 5T3RA 3MZLB 3T5XA 2E2EA 3Q7AA 1YCSB 3FP3A 4BX8A 1TN7A 1RW2A 2OOEA 1N11A 4OVVA 4RG6A 1H6PA 2IU1A 2AVPA 4WWNA 3NBNB 1TNOA 3EUVA 2CFZA 4FLHA 1N52A 3ZN3A 1N95A 4JA7A 2QYUA 3FTVA 1HG5A 2XPZA 4LUNU 2X6IA 1N4PA 4KZ0A 4DX2A 4YDEA 3ISMC 4L2LA 2PZIA 4U96D 3UQ3A 3EHMA 3UT4A 3GZ2A 4A55A 5EIDA 5EYPF 5FZQA 5FQ4A 3ULYA 2XPIA 3CIAA 3O48A 1D8EA 5FJYA 2I1JA 3U3WA 2L0TB 1NI1A 5JHBA 2AJAA 4UWGA 4KXKB 3TL5A 1N94A 2GROB 1E8WA 2DZOA 3T5VA 2R5SA 4U8YD 3AG1E 3LY8A 1DC2A 2NC9A 4QQIA 3D3MA 2RFAA 4YVOA 1S64A 3APFA 5H7PA 1U3CA 1BPOA 4GAAA 5B3SE 4LNUD 4LG6A 3T9KA 3KEAA 2DWZA 3ESLA 4AVXA 1JUQA 3DBSA 3ML9A 4U8VD 3FY4A 3UPVA 3UM1A 1UJJA 3D9JA 5FZSA 1NFIE 4UUCA 2KZTA 4JB8P 2IO2C 1WAO1 5AQ9A 2MRIA 2GRPB 4PS7A 4I9CA 4J8YA 3VLEA 3UIPC 3LCAA 4WAFA 3CVUA 4TRQA 3D9NA 3SBSA 3KSQA 3CVQA 4NACA 4AOFA 4KT6B 3C3RA 3QNKA 4WWPA 4XX5A 4AY6A 4K5AB 2DCPA 5G55A 2EIKE 1K3ZD 3LPZA 4MLPA 3CVYA 1H6KA 3FUEA 5C1DA 3PEUB 5AARA 5EKQD 1DCQA 2Q7FA 3FTSA 2CG3A 4KVOA 1XGWA 3NZUA 3IXEA 1Z3YA 1O1TA 3E37A 3TXNA 3NQPA 1E8YA 4R7LA 3SFXA 2H6HA 4I17A 3R9AB 1IQUA 2A4ZA 3DPYA 3CVNA 4GTRA 4GTQA
chains in the Genus database with same CATH topology
2BF0X 3FULA 2VTBA 2WXOA 4N3BA 2I1KA 2J4DA 3LS8A 5EX3A 2QY7A 5JJTA 4DI3A 1ELKA 3QARA 5M72A 1HFAA 2X6KA 3MJWA 4GMLA 2J49A 3KAEA 1E8XA 4EPZA 3PEVB 3PRZA 3G2TA 5BPPA 5BUZA 3FUMA 3MV2B 2A5UA 3AU4A 4EBAA 1HE8A 2CHXA 2IF4A 3BEEA 3L08A 4JEHA 4KZCA 4L23A 5D0OD 4IRUA 3RRMB 2RD0A 2WMOA 3QWWA 3FU5A 3CK7A 2C0LA 1PAQA 1KT1A 4I1AA 3O4ZA 2KCKA 4RSYA 1H2VC 4AIFA 3FUHA 3CKCA 5KJMA 4DK5A 3KS2A 4I2ZA 3RKVA 3SGHA 3TXMA 3LKUA 3N71A 4BWRA 4HVBA 1Z6TA 3LVRE 3B7RL 5LCWJ 4GYYA 3CLJA 4HS2A 5FZRA 2VGYA 4EZKA 4Q94A 3EIJA 3IHVA 3PH0C 4XKBA 3MEKA 5BW8C 4CGWA 3FDHA 2Y4TA 2WXFA 3JUIA 3L16A 1ZBPA 2UY1A 3D9LA 4KMOA 2FBNA 4Q96A 4TV3A 3S7BA 3VTYA 5JJ7A 1PC2A 3QK0A 4UWKA 3FWVA 1SQMA 2L0IA 3AS8A 1EPUA 3RO2A 1KT0A 2I9CA 4DPRA 4O6FA 2VGXA 4PDXA 4AXHA 1S0PA 4I9EA 3FH8A 3WXXA 5AIJA 5D0QD 2EQXA 2HYZA 2E0IA 4PH4B 4EBAG 2WXKA 3L17A 3ZW3A 2KCVA 1HU3A 2VSOE 2C2LA 2KZTB 3NF1A 2CHWA 2XEVA 4FC8A 3ZYMA 2WQ6A 1HXIA 3SNXA 3OXGA 2XQ0A 3OTNA 3CVLA 3I4GA 4UQZA 3SFZA 2WQHA 4DLOA 4FA6A 3GZSA 4U0ZA 1MHQA 1L5JA 2FO7A 3ML8A 1GW6A 5KJLA 5LOZA 4QFVA 3S7DA 4G11A 3RRNB 3TGOA 2DBAA 3JCKC 5ARFA 5KJKA 3LXUX 1H19A 4G26A 2HO1A 2NSZA 3FU6A 3QOUA 4YNDA 3EIQC 4KVMA 2PQRA 2YHEA 2ONDA 3RU0A 4A3VA 4ANXA 5FTPA 2JEKA 3G2VA 1E96B 3LY7A 4FULA 3D9KA 3SZ7A 4CRWA 4CDMA 4GZ6A 4C9BB 2J08A 3B7UX 4A1GA 4B8CB 4BY6A 1X5BA 4N2SA 3U66A 2WM9A 3LJ3A 3QC1A 4RVBA 4U8HA 4WNGA 3CHMA 1UW4B 3E4BA 3FH5A 3MKRA 5A6CA 1ELRA 2AXUA 2PQNA 3CK9A 4AJWA 4XI0A 3CGHA 4ILHB 3MV3B 5ARGA 4N39A 5T8IA 3B13A 1XNFA 3CK8A 3TJPA 4WNEA 3ONKA 3ULQA 4NRHB 3S2AA 1EDUA 4ILIA 4IN3B 2XRZA 3QAQA 1OUVA 3Q4AB 3T8MA 2XCBA 3ZRHA 3U4TA 4JHKA 2YHCA 3EDTB 5EX0A 4UI9K 3MCXA 3ZPJA 3FTZA 1H2UA 4UQYA 3PE3A 1ZU2A 3TG4A 4G1TA 1OWOA 3UUXA 3CVVA 2XPYA 5A23A 2XCCA 5CMYA 1UN8A 5BNWA 2IONA 2V0PA 3ZFWA 2I2OA 2IOLA 3QWVA 3Q49B 3ASFA 5KCMA 2VTBB 1QNFA 2AXZA 3ZXSA 1HF8A 1UG3A 2BTDA 3FU3A 5T4YA 4BSXA 2I6HA 5CCMA 3MYVA 3AU5A 3FUDA 5EDSA 4I6GA 5E75A 1IQRA 1JPLA 3APDA 3JQ1A 3IKOB 1E8ZA 2Y3AA 4A1SA 4FLBA 4GU5A 4ANUA 4HLEA 2P58C 3PUKA 5LX8A 5HQ8A 2LNIA 1E90A 5DBKA 3CQCB 3PNLB 5G2NA 5JHBA 3ZEFA 2Y4UA 2XHEA 4L7TA 3UX4A 4ANWA 5FQ7A 4BT9A 4L1BA 3HIZA 3KD7A 2VSXE 3MA5A 3EJNA 3CR3A 1MQSA 2LAHA 5C2YA 2J9QA 4G24A 4IYPA 4NURA 5CCLA 3QJZA 3IV0A 1H2TC 5FQ8A 3QDNA 3L22A 4LEUA 4C0MA 1SZ9A 2WXRA 4ACKA 3FFLA 5LCWC 2UY1B 3LVQE 3OXLA 5G04J 4F1SA 4AP2A 4G23A 4JA9A 3LDZA 2MHKA 4ATGA 5JJ6A 4H7XA 3HYMB 2VGXB 2KC7A 3APCA 4I6EA 4UQXA 4BTBA 3FHEA 3L13A 2WB2A 1VDYA 4HORA 2J4BA 3B7TA 2NXPA 4JPSA 3ASGA 3GYZA 1UJKA 3FUJA 4LRZA 4AEZC 2VJ8A 4BTAA 3QKYA 4GB9A 4CDNA 3CV0A 3CHOA 3PUJA 3Q5MA 1HH8A 2IJGX 1OWNA 2WXQA 3JQ0A 4YVQC 3UT8A 4AV7A 5J08A 2V4LA 2X6HA 3ASHA 1NA3A 4GZDA 2YQ8A 2IFUA 2UWJG 4CGVA 1TJFA 2VSNA 4ABNA 5LFAA 4BX9A 4CT4A 1YA0A 4K0RA 1TJCA 5AJLA 4WUYA 4GYWA 4GYOA 2L6JA 4B89A 2GW1A 3FU0A 5T3RA 3MZLB 3T5XA 2E2EA 3PS6A 5E76A 2ILRA 2VYIA 3FP3A 2XGSA 4BX8A 2OOEA 2V8SE 4JEUA 4DJAA 3SHFA 4OVUA 4OVVA 2MOWA 4RG6A 4G25A 4WNDA 4XZ4A 3U64A 4D10C 2WXHA 1JWGA 3TAXA 4E85A 2LO6A 4XI9A 4GCOA 1INZA 2IU1A 3LY9A 1E7UA 5BV1A 1NA0A 2AVPA 1EYHA 4WWNA 4J8SA 4U0SA 3NZSA 3SD5A 3C98A 3Q47B 3EHNA 2CFZA 1WY6A 4M3OA 4N3AA 2J09A 1EF1C 1N52A 4FLHA 2YINA 3PE4A 3ESKA 4I1OB 3ZN3A 2CG2A 3CKBA 3ZYKA 4JA7A 3D9IA 2BUGA 3PNTB 3BG0B 4KBQA 3PZDA 4PS8A 4LCTA 3FTVA 3ZHEA 4BFRA 2PL2A 3D9OA 3U9WA 3ZHEB 4GA2A 2X3MA 1HG5A 4IULA 2XPZA 4LUNU 1Y8MA 2X6IA 1HZ4A 4KZ0A 2IOSA 2FEZA 1FVFA 3PVLA 2WXGA 3QB2A 4HOTA 2OV8A 4KYOB 2WXJA 4JL0A 4L2LA 4WWOA 1Y6IA 2PZIA 3L54A 2GRLA 4Y6CA 2WXNA 4DI4A 3G2WA 2X6JA 3VLDA 3K9IA 2WXLA 1ELWA 4JHJA 2WXIA 3UQ3A 2OVFA 3HHMA 3EHMA 3JYSA 3FUIA 3URZA 3UT4A 5CHEE 3RIBA 3FTUA 2V5FA 3GZ2A 4FP7A 4MKTA 4A55A 1SZAA 4EQFA 4W9RA 4AM9A 1H0AA 3MX3A 5FZQA 5FQ4A 4HOUA 1IYGA 5FQ6A 5G05J 2GGFA 2XPIA 3CIAA 3O48A 4XKCA 5FJYA 4GZ3A 3ENEA 2I1JA 4APFA 4FJZA 2QFCA 3QWPA 3U3WA 4FJYA 1B89A 1OWMA 2L0TB 5LP0A 4Y6WA 5G05C 4NQ0A 2WPVA 4JZYA 1NP7A 4UWGA 4KXKB 3TL5A 3RK6A 3ZYLA 4FU3A 1E8WA 4CDRA 4K03A 1TEZA 2IQCA 3HDXA 5AENA 3T5VA 2R5SA 4APOA 5ENNA 2FULA 3CVPA 3LY8A 1DNPA 4G2VA 4V3IA 2CHZA 3RO3A 2WXMA 4J0UA 2OVBA 3CHRA 2KATA 2NC9A 4Q69A 3FH7A 1HX8A 4JHRA 4U07A 2DIWA 3RRUA 2R17C 3D3MA 3B7SA 4UWHA 2L9BA 2XGOA 2JLBA 4YVOA 1WM5A 5HI7A 3G2UA 1PY1A 4HOSA 2LAIA 3APFA 4J6IA 1U3CA 3CSTA 4PS3A 1BPOA 1N54A 4GAAA 5BV0A 4FADA 3FTXA 2ZU6B 3FEYA 5G04C 2VQ2A 3ONLA 4F7AA 3CEQA 2J07A 2CFUA 1FCHA 3CHQA 2AWIA 3ESLA 4AVXA 3FUKA 3OXFA 4B8AA 5BT1A 3AS4A 5A7DB 4A3TA 1JUQA 4U04A 3DBSA 3ML9A 4ME2A 3FY4A 3UPVA 2WMNA 5DIZA 4GPKA 1NZNA 4HFGA 3SF4A 1UN9A 1HS6A 2X6FA 4U0UA 4HOQA 3ZVVA 4TUUA 2GRMA 3R7RA 1UJJA 3D9JA 5FT9A 3ASDA 4J8EA 5FZSA 2FF4A 4P29A 2X38A 4UI9J 5ANRA 2HM8A 4PUCA 4FHJA 3DPDA 3D9PA 4CT0A 3G2SA 2R59A 4J8FA 2KZTA 4UI9C 1E7VA 4HXIA 4RG9A 3IHYA 3VLFA 1WAO1 3ZYQA 4JC8A 3LYAA 4LERA 2MRIA 2WVIA 4C0EA 3HVEA 4BT8A 1HO8A 3GW4A 1IHGA 3BG1B 4ILGA 4JVSA 3HVEB 5FWQA 4GZCA 4PS7A 4F53A 4CEMA 4I9CA 3MKQA 2XRYA 4ANVA 4I6JA 3CQGB 3IEGA 3MKQB 4B94A 2WQ7A 4H7YA 1LF8A 2PM7A 3VLEA 3KEZA 3LCAA 4MS6A 4WAFA 4TRQA 3D9NA 3FUFA 4UWLA 3SBSA 4GA0A 5KJNA 4U63A 4E6HA 2M63A 1KLXA 1QQEA 3CVQA 4NACA 3CHSA 4AOFA 1A17A 4KT6B 1OWLA 1FVHA 4OYSA 4WWPA 3QNKA 1W3BA 4JXTA 4XX5A 3UMVA 4AY6A 5J90A 3Q15A 2AW6A 3PDNA 4I2WA 4UWFA 3R7QA 3P1UA 2DCPA 2HR2A 3LEWA 5ANLA 5G55A 1JWFA 2RG8A 3I4RB 4L2YA 2KM4A 3D9MA 4XIFA 4GZ5A 1P5QA 1U3DA 4AY5A 5CMWA 4N3CA 2C0MA 3SBTB 4MRUA 3TG5A 3LPZA 3CVWA 4WNFA 3CVUA 3L6AA 3RJVA 2WXPA 4GCNA 4MLPA 3SI5A 3CVYA 1OWPA 1H6KA 4I1MA 3UT7A 3FUEA 1QZ2A 2YNQA 3CVXA 3ZIMA 3S7FA 4B0ZA 5C1DA 4ACLA 2XGMA 4EECA 3PEUB 4XE0A 4EZLA 2KCLA 3IBEA 5EKQD 4EZJA 3FTYA 5AJDA 2VSYA 2Q7FA 3FTSA 4FHKA 1Z3XA 2CG3A 3PREA 4KVOA 1XGWA 4URKA 2AXVA 5JHAA 2LSUA 3MGBA 4J8DA 4I43A 3S7JA 3CSFA 3NZUA 2LSVA 3P2BA 3FTWA 4GA1A 1Z3YA 3VTXA 3FEXA 3TXNA 3AS5A 3NQPA 4N5CA 1E8YA 4JW1A 3GZ1A 3I3NA 3I5PA 4GMJA 4R7LA 5AYWD 2FI7A 3ZGQA 4N2QA 4DLQA 1HG2A 4I17A 2PM6A 3FUNA 3R9AB 3OAWA 3CHPA 1IQUA 1DVPA 4F3VA 2A4ZA 3CVNA 4CCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3B A;  5JJT A;  5EX3 A;  5M72 A;  3KAE A;  3MV2 B;  2IF4 A;  3BEE A;  5D0O D;  3QWW A;  3CK7 A;  2C0L A;  1KT1 A;  4I1A A;  2KCK A;  4AIF A;  3CKC A;  5KJM A;  3KS2 A;  4I2Z A;  3RKV A;  3LKU A;  3N71 A;  4BWR A;  5LCW J;  4GYY A;  5FZR A;  2VGY A;  3MEK A;  5BW8 C;  4CGW A;  2Y4T A;  1ZBP A;  2UY1 A;  3S7B A;  3VTY A;  2FBN A;  5JJ7 A;  1PC2 A;  3FWV A;  3RO2 A;  3AS8 A;  1KT0 A;  4O6F A;  2VGX A;  4I9E A;  3WXX A;  5D0Q D;  2HYZ A;  2KCV A;  3NF1 A;  2C2L A;  2XEV A;  1HXI A;  3OXG A;  3CVL A;  4UQZ A;  2WQH A;  4U0Z A;  2FO7 A;  5KJL A;  3S7D A;  3TGO A;  2DBA A;  5ARF A;  5KJK A;  4G26 A;  2HO1 A;  3QOU A;  4YND A;  2PQR A;  2OND A;  3RU0 A;  5FTP A;  3LY7 A;  1E96 B;  3SZ7 A;  4GZ6 A;  4N2S A;  4WNG A;  3E4B A;  5A6C A;  3MKR A;  1ELR A;  2PQN A;  3CK9 A;  4XI0 A;  5ARG A;  3MV3 B;  4N39 A;  1XNF A;  3CK8 A;  4WNE A;  3ULQ A;  4NRH B;  4IN3 B;  1OUV A;  3Q4A B;  2XCB A;  3U4T A;  2YHC A;  3EDT B;  5EX0 A;  4UI9 K;  3ZPJ A;  4UQY A;  3PE3 A;  1ZU2 A;  3TG4 A;  4G1T A;  3UUX A;  2XCC A;  5BNW A;  3ZFW A;  3QWV A;  3Q49 B;  3ASF A;  2I6H A;  5CCM A;  4A1S A;  2P58 C;  5HQ8 A;  2LNI A;  5DBK A;  2Y4U A;  4BT9 A;  3KD7 A;  3MA5 A;  2J9Q A;  4G24 A;  5CCL A;  3QDN A;  4LEU A;  3FFL A;  5LCW C;  2UY1 B;  3OXL A;  5G04 J;  4G23 A;  4JA9 A;  2MHK A;  5JJ6 A;  4H7X A;  3HYM B;  2VGX B;  2KC7 A;  4UQX A;  4BTB A;  4HOR A;  3ASG A;  3GYZ A;  4BTA A;  3QKY A;  3CV0 A;  3Q5M A;  1HH8 A;  4YVQ C;  3ASH A;  1NA3 A;  2YQ8 A;  2IFU A;  2UWJ G;  4CGV A;  4ABN A;  2VSN A;  1YA0 A;  1TJC A;  4WUY A;  4GYW A;  4GYO A;  2L6J A;  2GW1 A;  2E2E A;  2VYI A;  3FP3 A;  2XGS A;  2OOE A;  4RG6 A;  4G25 A;  4WND A;  3TAX A;  4XI9 A;  4GCO A;  3LY9 A;  1NA0 A;  2AVP A;  4U0S A;  3Q47 B;  4N3A A;  3ZN3 A;  3PE4 A;  3ESK A;  3CKB A;  4JA7 A;  4KBQ A;  2BUG A;  3ZHE A;  2PL2 A;  3ZHE B;  4GA2 A;  1Y8M A;  1HZ4 A;  2FEZ A;  4HOT A;  4KYO B;  4JL0 A;  2PZI A;  4Y6C A;  3K9I A;  1ELW A;  3UQ3 A;  3JYS A;  3URZ A;  5CHE E;  3RIB A;  2V5F A;  3GZ2 A;  4EQF A;  4W9R A;  4AM9 A;  5FZQ A;  4HOU A;  1IYG A;  5G05 J;  2XPI A;  3O48 A;  5FJY A;  4GZ3 A;  2QFC A;  3QWP A;  3U3W A;  1B89 A;  4Y6W A;  5G05 C;  4NQ0 A;  2WPV A;  4KXK B;  4CDR A;  2R5S A;  4APO A;  3CVP A;  3LY8 A;  3RO3 A;  4G2V A;  4J0U A;  2KAT A;  2NC9 A;  4JHR A;  4U07 A;  2XGO A;  2JLB A;  4YVO A;  1WM5 A;  5HI7 A;  4HOS A;  5G04 C;  2VQ2 A;  3CEQ A;  1FCH A;  3OXF A;  5BT1 A;  3AS4 A;  5A7D B;  4U04 A;  4ME2 A;  3UPV A;  4GPK A;  5DIZ A;  1NZN A;  3SF4 A;  4U0U A;  4HOQ A;  5FT9 A;  3ASD A;  4J8E A;  5FZS A;  2FF4 A;  4UI9 J;  4J8F A;  4UI9 C;  4RG9 A;  1WAO 1;  3LYA A;  4BT8 A;  3GW4 A;  1IHG A;  4I9C A;  3IEG A;  4B94 A;  4H7Y A;  3LCA A;  5KJN A;  4GA0 A;  1KLX A;  1QQE A;  3CVQ A;  1A17 A;  1W3B A;  4AY6 A;  3Q15 A;  3PDN A;  4I2W A;  2HR2 A;  4XIF A;  4GZ5 A;  1P5Q A;  4AY5 A;  4N3C A;  2C0M A;  3TG5 A;  3LPZ A;  4WNF A;  3RJV A;  4GCN A;  1QZ2 A;  3S7F A;  5C1D A;  2XGM A;  2KCL A;  5EKQ D;  2VSY A;  2Q7F A;  2LSU A;  4J8D A;  3S7J A;  2LSV A;  4GA1 A;  3VTX A;  3AS5 A;  4N5C A;  3GZ1 A;  5AYW D;  2FI7 A;  3ZGQ A;  4N2Q A;  4I17 A;  3R9A B;  4F3V A;  3CVN A; 
#chains in the Genus database with same CATH topology
 2J4D A;  5EX3 A;  2QY7 A;  2H6F A;  3MJW A;  2J49 A;  4EPZ A;  3PRZ A;  5BPP A;  1OCO E;  2A5U A;  3AU4 A;  3JUE A;  2CHX A;  2IF4 A;  4JEH A;  3L08 A;  5ENR D;  1MYO A;  4HBD A;  3RRM B;  3FU5 A;  3CK7 A;  2C0L A;  2KCK A;  5KJM A;  3KS2 A;  4BWR A;  4HVB A;  3LVR E;  3B7R L;  2OCC E;  5CEC B;  5FZR A;  4TXR A;  4BER A;  3MEK A;  3L16 A;  4KMO A;  2FBN A;  3TWV A;  3W9G A;  4UWK A;  3FWV A;  2LUH A;  5AQ7 A;  4DPR A;  4O6F A;  4TXP A;  5D0Q D;  2EQX A;  1BU9 A;  3Q78 A;  3ZW3 A;  3NF1 A;  1HU3 A;  4O60 A;  2CHW A;  2RKK A;  4FC8 A;  3ZYM A;  3SNX A;  3OXG A;  4O1P A;  5ENQ D;  4FA6 A;  1L5J A;  1YYH A;  4ZHB A;  1TNY A;  3NB2 A;  4QFV A;  4G11 A;  3LXU X;  1H19 A;  3QOU A;  3NAW A;  4KVM A;  2PQR A;  2OND A;  2H6G A;  4FUL A;  1TN6 A;  3SFY A;  4B8C B;  4A1G A;  4BY6 A;  5KWD A;  3U66 A;  4RVB A;  3CHM A;  1UW4 B;  3FH5 A;  2KBX A;  3PZ4 A;  4ILH B;  3MV3 B;  4HLL A;  4GPM A;  3B13 A;  1XNF A;  3ULQ A;  4O1O A;  2XRZ A;  1OUV A;  3Q4A B;  3T8M A;  3EU5 A;  1D9S A;  2YHC A;  1IHB A;  1WDY A;  3FTZ A;  3BUA A;  3WG7 E;  2FO1 E;  4BES A;  2QZA A;  2XCC A;  1UN8 A;  3ZFW A;  2I2O A;  2DZN A;  3QWV A;  2VTB B;  2AXZ A;  3ZXS A;  2J8S D;  5CBN A;  3AU5 A;  1KPS B;  4HLE A;  5FIO A;  1E90 A;  5DBK A;  3CQC B;  3PNL B;  3TWX A;  3ZEF A;  2Y4U A;  4M7C A;  4OAV B;  5FQ7 A;  4BT9 A;  3KD7 A;  3EJN A;  1LTX A;  2P9L G;  5CCL A;  3QJZ A;  3DEP A;  3IV0 A;  5B1A E;  3L22 A;  2UY1 B;  3V79 K;  4G23 A;  4JA9 A;  2DVW A;  3LDZ A;  5JJ6 A;  3APC A;  2KC7 A;  4HRN A;  4I6E A;  1LD7 A;  3FHE A;  2ETA A;  1N4S A;  2J4B A;  3QKY A;  4CDN A;  3Q5M A;  2IJG X;  2WXQ A;  3JQ0 A;  3ABK E;  5J08 A;  2V4L A;  1NA3 A;  2YQ8 A;  4CGV A;  1TJF A;  2VSN A;  4CT4 A;  4LSZ E;  4K5C A;  2XGS A;  4JEU A;  5EN5 D;  4DJA A;  4OVU A;  2OEW A;  2B0O E;  4WND A;  1INZ A;  1E7U A;  1EYH A;  2MYO A;  3Q47 B;  3EHN A;  3HXD A;  3ZYK A;  4ANX A;  2YIN A;  3BG0 B;  3PZD A;  3UKR G;  4PS8 A;  3UM0 A;  4GTV A;  2PL2 A;  3EU9 A;  1S63 A;  3U9W A;  4GA2 A;  3C72 A;  5CED B;  1SW6 A;  3PVL A;  5ENP D;  2WXG A;  3QB2 A;  4KYO B;  4JL0 A;  1Y6I A;  4GTT A;  4DI4 A;  2Y69 E;  2WXI A;  2OVF A;  3JYS A;  1LD8 A;  3FTU A;  2V5F A;  1SZA A;  4AM9 A;  3UM2 A;  5FQ6 A;  3TWT A;  4EHM A;  4BET A;  4Y6W A;  4JZY A;  1NP7 A;  4JD2 G;  3HDX A;  4APO A;  3CVP A;  3RO3 A;  1DNP A;  4G2V A;  4V3I A;  2CHZ A;  1FPP A;  4Q69 A;  3SQV A;  3SY2 A;  2JLB A;  1WM5 A;  1O5M A;  4DRX E;  4HOS A;  2LAI A;  4J6I A;  3JXI A;  2ZU6 B;  3FEY A;  1OT8 A;  3ONL A;  5ENT D;  1FCH A;  1BI8 B;  1G3N B;  3DSW A;  4U04 A;  4HFG A;  4HOQ A;  4TUU A;  4CYM D;  3ASD A;  4J8E A;  4P29 A;  2X38 A;  5ANR A;  3E30 A;  2P9S G;  3E34 A;  3D9P A;  4CT0 A;  4Z68 A;  4J8F A;  1U2V G;  1E7V A;  3IHY A;  3VLF A;  4BT8 A;  1IHG A;  5FWQ A;  4F53 A;  2DYR E;  4CEM A;  2WQ7 A;  4G8K A;  1TR4 A;  4H7Y A;  3KEZ A;  4UWL A;  5IY5 E;  4X8Q A;  1IXV A;  1OWL A;  1OCR E;  4OYS A;  4TUM A;  3Q15 A;  3PDN A;  3LEW A;  3SO8 A;  2KM4 A;  1U3D A;  4AY5 A;  3SBT B;  4MRU A;  3RJV A;  3SI5 A;  2WXP A;  4GCN A;  1OWP A;  3ZIM A;  4B0Z A;  4ACL A;  2XGM A;  4CZ2 D;  2P9U G;  4XE0 A;  4EZL A;  2KCL A;  3IBE A;  4EZJ A;  2EIN E;  2VSY A;  4URK A;  3J5Q B;  3P2B A;  3FEX A;  3I3N A;  4GMJ A;  5AYW D;  4LNG A;  3FUN A;  3CHP A;  4F3V A;  1DVP A;  4CCA A;  3V2X A;  2WXO A;  2P9P G;  3KAE A;  3PEV B;  4KZC A;  3D9H A;  2WMO A;  1PAQ A;  1JCR A;  3CKC A;  4DK5 A;  3LKU A;  5LCW J;  4GYY A;  3IHV A;  3PH0 C;  4XKB A;  2EIL E;  2V5Q C;  3EHQ A;  3JUI A;  3VTY A;  3S7B A;  1PC2 A;  1EPU A;  3NOG D;  1KT0 A;  2I9C A;  1SA4 A;  2EIM E;  1N4Q A;  5D2M C;  4ZFH A;  4PDX A;  4I9E A;  5AIJ A;  4C48 B;  4YDY A;  3V31 A;  2HYZ A;  2E0I A;  4EBA G;  2VSO E;  2KZT B;  1HXI A;  3I4G A;  2FO7 A;  5KJL A;  5LOZ A;  3ULE G;  5KJK A;  4G26 A;  2NSZ A;  4YND A;  3EIQ C;  1SVX A;  3RU0 A;  5FTP A;  2JEK A;  3LY7 A;  3D9K A;  2J08 A;  3C5R A;  3ABM E;  2WM9 A;  1K1B A;  3MKR A;  1MJ0 A;  4AJW A;  1V54 E;  2ZXW E;  5T8I A;  4HI9 A;  1O1R A;  1RZ4 A;  4WNE A;  1EDU A;  4IN3 B;  3ZUV B;  4RLY A;  2XCB A;  5EX0 A;  4UI9 K;  4HRL A;  3TWQ A;  1A5E A;  3PE3 A;  3TG4 A;  4G1T A;  3UUX A;  3DXM G;  2XPY A;  3EHR A;  5ENO D;  2V0P A;  3Q49 B;  2F37 A;  1UG3 A;  2I6H A;  2OEV A;  4I6G A;  3IKO B;  2Y3A A;  3R9M A;  1DCE A;  4A1S A;  2P58 C;  2BED A;  2LNI A;  2XHE A;  1N4R A;  4ANW A;  4L1B A;  2VSX E;  2F8Y A;  1KZO A;  5C2Y A;  4IYP A;  2QYJ A;  5G04 J;  2F0Y A;  4F1S A;  4AP2 A;  4H7X A;  3HYM B;  1VDY A;  2NXP A;  3ASG A;  3GYZ A;  4LRZ A;  1OCC E;  4BTA A;  3UT8 A;  1OWN A;  3V30 A;  2X6H A;  3TWU A;  2UWJ G;  4ABN A;  3E32 A;  4K0R A;  1TJC A;  4L9P A;  4DX5 D;  3AG2 E;  3AG4 E;  1NL4 A;  2ILR A;  2VYI A;  2IY0 C;  4G25 A;  4D10 C;  4E85 A;  1JWG A;  4GCO A;  4MBG A;  4J8S A;  3NZS A;  3SD5 A;  3L82 A;  3DEO A;  4YDO A;  1EF1 C;  4I1O B;  3ESK A;  2CG2 A;  3CKB A;  4ATZ D;  3D9I A;  4LCT A;  3ZHE A;  4BFR A;  3ZHE B;  4TXQ A;  1Y8M A;  1HZ4 A;  1S70 B;  2IOS A;  1OXJ A;  4HOT A;  2OV8 A;  4WWO A;  3L54 A;  2WXN A;  3G2W A;  3K9I A;  2WXL A;  1ELW A;  4JHJ A;  3URZ A;  3RIB A;  4MKT A;  3DSX A;  4EQF A;  4W9R A;  4HOU A;  1IYG A;  2GGF A;  3X2Q E;  3BQO A;  3HRA A;  4GZ3 A;  4APF A;  3HXE A;  4FJZ A;  3Q7F A;  1B89 A;  5LP0 A;  2XZT G;  4NQ0 A;  4K03 A;  1TEZ A;  2BKG A;  2DYS E;  2KAT A;  2P2C P;  5BXO A;  3FH7 A;  1HX8 A;  5CER B;  2DIW A;  1JCQ A;  3PZ2 A;  4UWH A;  2L9B A;  3G2U A;  5KNG A;  3CEQ A;  2J07 A;  3B95 A;  3CHQ A;  2AWI A;  3FUK A;  5BT1 A;  3AS4 A;  5A7D B;  4GPK A;  2WMN A;  3SF4 A;  1HS6 A;  2X6F A;  4U0U A;  1X81 A;  3ZVV A;  2GRM A;  3ASO E;  2FF4 A;  4UI9 J;  2HM8 A;  4PUC A;  4FHJ A;  1Q2Z A;  3V2O A;  3G2S A;  2R59 A;  4UI9 C;  3ZYQ A;  4JC8 A;  3LYA A;  4HB5 A;  3HVE A;  3GW4 A;  4ILG A;  3HVE B;  3KSL A;  2XRY A;  3IEG A;  5KJN A;  4U63 A;  4E6H A;  1KLX A;  1QQE A;  3CHS A;  3DSU A;  4GTS A;  1FVH A;  3Q79 A;  5J90 A;  3SHF A;  2AW6 A;  4I2W A;  3P1U A;  5ANL A;  1JWF A;  2RG8 A;  4L2Y A;  4GZ5 A;  4N3C A;  4WNF A;  3L6A A;  4I1M A;  3UT7 A;  2YNQ A;  3DXK G;  2GRQ B;  3FTY A;  5AJD A;  5HRY A;  1Z3X A;  3PRE A;  3MGB A;  4I43 A;  5CRU A;  3S7J A;  4GA1 A;  3FTW A;  5EIL A;  3VTX A;  3AS5 A;  3GZ1 A;  4B93 B;  4DLQ A;  1HG2 A;  4DX7 D;  3HXB A;  2I1K A;  1ELK A;  3QAR A;  3UKU G;  2X6K A;  1N0Q A;  4GML A;  2EIJ E;  5BUZ A;  4EBA A;  1HE8 A;  3BEE A;  5D0O D;  3QWW A;  1KT1 A;  3Q9N C;  2IO3 C;  4RSY A;  4AIF A;  2P9I G;  4HQD A;  3RKV A;  3SGH A;  3TXM A;  2P9K G;  4EZK A;  4Q94 A;  3EIJ A;  3ABL E;  2LXM A;  3ZXP A;  3FDH A;  4Q96 A;  1ZBP A;  4TV3 A;  2ZIS A;  3PZ3 A;  5JJ7 A;  3DSS A;  1SQM A;  2L0I A;  5CRV A;  3RO2 A;  3BU8 A;  3LJN A;  2VGX A;  4AXH A;  1S0P A;  3WXX A;  4OAU C;  3W9F A;  2ZIR A;  2WXK A;  2XEV A;  1UOH A;  3OTN A;  3CVL A;  4UQZ A;  3SFZ A;  4DLO A;  3GZS A;  1MHQ A;  3ML8 A;  1GW6 A;  2DBA A;  1Z5S C;  2HO1 A;  2YHE A;  1KZP A;  4A3V A;  1E96 B;  3SZ7 A;  4HRM B;  4GZ6 A;  4C9B B;  3B7U X;  4N2S A;  3LJ3 A;  4U8H A;  4WNG A;  3UI2 A;  3E4B A;  4GTO A;  5HS0 A;  2PQN A;  4HNA D;  4N39 A;  2BKK B;  3UTM A;  3CK8 A;  3TJP A;  3RSE G;  4NRH B;  4ILI A;  3QAQ A;  3U4T A;  4JHK A;  3T8K A;  4DX1 A;  3EDT B;  2Y1L E;  3ZPJ A;  2A5E A;  4UQY A;  4BSZ B;  1ZU2 A;  2GRR B;  5A23 A;  3RAU A;  2ION A;  2IOL A;  2V4H C;  5KCM A;  1QNF A;  1HF8 A;  5T4Y A;  5CCM A;  3MYV A;  3FUD A;  1D8D A;  5E75 A;  1JPL A;  1E8Z A;  3ZKJ A;  5LX8 A;  4K5B A;  5G2N A;  3F6Q A;  4L7T A;  3UX4 A;  1TYQ G;  3HXF A;  5JMN D;  3HIZ A;  2KXP C;  4F6R D;  3CR3 A;  2LAH A;  1H2T C;  1MX2 A;  3QDN A;  4LEU A;  2WXR A;  4ACK A;  3FFL A;  5LCW C;  3OXL A;  2H6I A;  3HG0 D;  3L9T A;  3J5P A;  3Q75 A;  2MHK A;  4ATG A;  2R05 A;  4HOR A;  2ETC A;  1UJK A;  4GB9 A;  3CV0 A;  3CHO A;  3PUJ A;  4YVQ C;  3ASH A;  2IFU A;  4LNB A;  1YA0 A;  5AJL A;  4WUY A;  3UM3 A;  4B89 A;  2GW1 A;  1QYM A;  2JAB A;  3PS6 A;  5E76 A;  1TN8 A;  2V8S E;  2MOW A;  4XZ4 A;  3U64 A;  2WXH A;  3TAX A;  2LO6 A;  2XS1 A;  4XI9 A;  2IEJ A;  4U95 D;  3LY9 A;  5BV1 A;  1BI7 B;  1NA0 A;  2R2L A;  4U0S A;  1SA5 A;  3C98 A;  3AAA C;  4N3A A;  4M3O A;  1WY6 A;  2J09 A;  3PE4 A;  3PNT B;  2BUG A;  4KBQ A;  5AQB A;  1N0R A;  3D9O A;  2X3M A;  4IUL A;  2FEZ A;  1FVF A;  2ZGD A;  1MZC A;  2WXJ A;  2ZGG A;  2GRL A;  4Y6C A;  4GTM A;  2X6J A;  2LXL A;  3VLD A;  3HHM A;  3FUI A;  5JA4 D;  5CHE E;  4FP7 A;  1FT1 A;  1H0A A;  3MX3 A;  5G05 J;  4XKC A;  3ENE A;  2QFC A;  3QWP A;  4FJY A;  5B1B E;  1H6O A;  1OWM A;  2XEN A;  2XEH A;  5G05 C;  2WPV A;  3ZYL A;  3RK6 A;  4FU3 A;  4CDR A;  2IQC A;  5AEN A;  4GTP A;  5ENN A;  2FUL A;  2RFM A;  3TWR A;  2WXM A;  4J0U A;  2OVB A;  1JCS A;  3CHR A;  4JHR A;  4U07 A;  5HKP A;  3RRU A;  2R17 C;  3B7S A;  3DST A;  2XGO A;  2B6C A;  5D66 A;  5HI7 A;  1PY1 A;  3CST A;  3JXJ A;  4PS3 A;  1N54 A;  5BV0 A;  4FAD A;  3FTX A;  5G04 C;  2VQ2 A;  4F7A A;  1MX6 A;  1TNZ A;  2CFU A;  3DRA A;  3OXF A;  4B8A A;  4A3T A;  4ME2 A;  5DIZ A;  1NZN A;  5KNH D;  1UN9 A;  3R7R A;  5FT9 A;  4U7E B;  5AQA A;  2R03 A;  3AG3 E;  3DPD A;  4DX6 D;  3AJI A;  4HXI A;  4RG9 A;  4LER A;  2WVI A;  4C0E A;  1HO8 A;  4JVS A;  3BG1 B;  3TWW A;  4GZC A;  3MKQ A;  4ANV A;  4I6J A;  3CQG B;  1O1S A;  3MKQ B;  4B94 A;  1LF8 A;  2PM7 A;  4MS6 A;  3FUF A;  4GA0 A;  1K8K G;  2M63 A;  5KBA A;  1A17 A;  3UMV A;  1W3B A;  4JXT A;  5AAO A;  4UWF A;  3R7Q A;  2HR2 A;  3PZ1 A;  1V55 E;  3I4R B;  4XIF A;  3D9M A;  1P5Q A;  3ZU7 B;  5CMW A;  2C0M A;  3TWS A;  5AN8 A;  1K1A A;  3TG5 A;  3CVW A;  1IKN D;  2P9N G;  3CVX A;  1QZ2 A;  3S7F A;  4EEC A;  1N9A A;  4FHK A;  2AXV A;  5JHA A;  2LSU A;  4J8D A;  5ITZ F;  3CSF A;  2LSV A;  4N5C A;  4JW1 A;  3I5P A;  2FI7 A;  3ZGQ A;  4N2Q A;  1ZB1 A;  2PNN A;  2PM6 A;  3OAW A;  1WG0 A;  2BF0 X;  3FUL A;  2VTB A;  4N3B A;  5JJT A;  3LS8 A;  4DI3 A;  5M72 A;  1HFA A;  3UXG A;  1E8X A;  3G2T A;  3FUM A;  3MV2 B;  4L23 A;  3ASN E;  4IRU A;  5ENS D;  5CEA A;  2RD0 A;  2ETB A;  4I1A A;  3HXC A;  3O4Z A;  1H2V C;  3FUH A;  2GRN B;  4I2Z A;  3N71 A;  1Z6T A;  2QC9 A;  3CLJ A;  4HS2 A;  2VGY A;  4NIK A;  5BW8 C;  4CGW A;  2Y4T A;  1FT2 A;  2WXF A;  2UY1 A;  3D9L A;  3QK0 A;  4F1P A;  3AS8 A;  5EYL A;  3FH8 A;  5EIB E;  4PH4 B;  4BEP A;  2XEE A;  3C3Q A;  3L17 A;  2KCV A;  2C2L A;  4HI8 A;  2WQ6 A;  2HE0 A;  2XQ0 A;  5FIN A;  1MX4 A;  2WQH A;  2XS8 A;  4U0Z A;  3DWL G;  2F8X K;  3S7D A;  3RRN B;  3TGO A;  3JCK C;  1OY3 D;  5ARF A;  4N5Q A;  3FU6 A;  3Q9U C;  3C3O A;  3G2V A;  4CRW A;  4RQI A;  4CDM A;  1X5B A;  3QC1 A;  4G8L A;  2L6B A;  4A63 B;  1YMP A;  5A6C A;  1ELR A;  2AXU A;  1AWC B;  3CK9 A;  1OCZ E;  4XI0 A;  3CGH A;  3Q73 A;  5ARG A;  3ONK A;  3S2A A;  2R02 A;  3B7B A;  3ZRH A;  1TNU A;  3MCX A;  1H2U A;  3NOC D;  4GMR A;  1OWO A;  3CVV A;  1AP7 A;  5CMY A;  5BNW A;  3ASF A;  1BLX B;  2BTD A;  3FU3 A;  4J7W A;  4BSX A;  5EDS A;  2VGE A;  1IQR A;  3APD A;  3JQ1 A;  4FLB A;  4GU5 A;  4ANU A;  3PUK A;  1BD8 A;  2Y0B G;  5HQ8 A;  4YDW A;  2XZD G;  3ZNG A;  3MA5 A;  1MQS A;  2J9Q A;  4G24 A;  4NUR A;  5BXU A;  5FQ8 A;  4C0M A;  1SZ9 A;  5CBO A;  3UIO C;  3LVQ E;  3UIN C;  2VGX B;  4UQX A;  4BTB A;  3L13 A;  2WB2 A;  1TNB A;  3B7T A;  4DUI A;  4JPS A;  2NYJ A;  3FUJ A;  4AEZ C;  2VJ8 A;  1HH8 A;  4AV7 A;  4GZD A;  4XEI G;  1QBQ A;  5LFA A;  3E33 A;  4BX9 A;  4GYW A;  4GYO A;  2L6J A;  3FU0 A;  3DSV A;  5T3R A;  3MZL B;  3T5X A;  2E2E A;  3Q7A A;  1YCS B;  3FP3 A;  4BX8 A;  1TN7 A;  1RW2 A;  2OOE A;  1N11 A;  4OVV A;  4RG6 A;  1H6P A;  2IU1 A;  2AVP A;  4WWN A;  3NBN B;  1TNO A;  3EUV A;  2CFZ A;  4FLH A;  1N52 A;  3ZN3 A;  1N95 A;  4JA7 A;  2QYU A;  3FTV A;  1HG5 A;  2XPZ A;  4LUN U;  2X6I A;  1N4P A;  4KZ0 A;  4DX2 A;  4YDE A;  3ISM C;  4L2L A;  2PZI A;  4U96 D;  3UQ3 A;  3EHM A;  3UT4 A;  3GZ2 A;  4A55 A;  5EID A;  5EYP F;  5FZQ A;  5FQ4 A;  3ULY A;  2XPI A;  3CIA A;  3O48 A;  1D8E A;  5FJY A;  2I1J A;  3U3W A;  2L0T B;  1NI1 A;  5JHB A;  2AJA A;  4UWG A;  4KXK B;  3TL5 A;  1N94 A;  2GRO B;  1E8W A;  2DZO A;  3T5V A;  2R5S A;  4U8Y D;  3AG1 E;  3LY8 A;  1DC2 A;  2NC9 A;  4QQI A;  3D3M A;  2RFA A;  4YVO A;  1S64 A;  3APF A;  5H7P A;  1U3C A;  1BPO A;  4GAA A;  5B3S E;  4LNU D;  4LG6 A;  3T9K A;  3KEA A;  2DWZ A;  3ESL A;  4AVX A;  1JUQ A;  3DBS A;  3ML9 A;  4U8V D;  3FY4 A;  3UPV A;  3UM1 A;  1UJJ A;  3D9J A;  5FZS A;  1NFI E;  4UUC A;  2KZT A;  4JB8 P;  2IO2 C;  1WAO 1;  5AQ9 A;  2MRI A;  2GRP B;  4PS7 A;  4I9C A;  4J8Y A;  3VLE A;  3UIP C;  3LCA A;  4WAF A;  3CVU A;  4TRQ A;  3D9N A;  3SBS A;  3KSQ A;  3CVQ A;  4NAC A;  4AOF A;  4KT6 B;  3C3R A;  3QNK A;  4WWP A;  4XX5 A;  4AY6 A;  4K5A B;  2DCP A;  5G55 A;  2EIK E;  1K3Z D;  3LPZ A;  4MLP A;  3CVY A;  1H6K A;  3FUE A;  5C1D A;  3PEU B;  5AAR A;  5EKQ D;  1DCQ A;  2Q7F A;  3FTS A;  2CG3 A;  4KVO A;  1XGW A;  3NZU A;  3IXE A;  1Z3Y A;  1O1T A;  3E37 A;  3TXN A;  3NQP A;  1E8Y A;  4R7L A;  3SFX A;  2H6H A;  4I17 A;  3R9A B;  1IQU A;  2A4Z A;  3DPY A;  3CVN A;  4GTR A;  4GTQ A; 
#chains in the Genus database with same CATH homology
 2BF0 X;  3FUL A;  2VTB A;  2WXO A;  4N3B A;  2I1K A;  2J4D A;  3LS8 A;  5EX3 A;  2QY7 A;  5JJT A;  4DI3 A;  1ELK A;  3QAR A;  5M72 A;  1HFA A;  2X6K A;  3MJW A;  4GML A;  2J49 A;  3KAE A;  1E8X A;  4EPZ A;  3PEV B;  3PRZ A;  3G2T A;  5BPP A;  5BUZ A;  3FUM A;  3MV2 B;  2A5U A;  3AU4 A;  4EBA A;  1HE8 A;  2CHX A;  2IF4 A;  3BEE A;  3L08 A;  4JEH A;  4KZC A;  4L23 A;  5D0O D;  4IRU A;  3RRM B;  2RD0 A;  2WMO A;  3QWW A;  3FU5 A;  3CK7 A;  2C0L A;  1PAQ A;  1KT1 A;  4I1A A;  3O4Z A;  2KCK A;  4RSY A;  1H2V C;  4AIF A;  3FUH A;  3CKC A;  5KJM A;  4DK5 A;  3KS2 A;  4I2Z A;  3RKV A;  3SGH A;  3TXM A;  3LKU A;  3N71 A;  4BWR A;  4HVB A;  1Z6T A;  3LVR E;  3B7R L;  5LCW J;  4GYY A;  3CLJ A;  4HS2 A;  5FZR A;  2VGY A;  4EZK A;  4Q94 A;  3EIJ A;  3IHV A;  3PH0 C;  4XKB A;  3MEK A;  5BW8 C;  4CGW A;  3FDH A;  2Y4T A;  2WXF A;  3JUI A;  3L16 A;  1ZBP A;  2UY1 A;  3D9L A;  4KMO A;  2FBN A;  4Q96 A;  4TV3 A;  3S7B A;  3VTY A;  5JJ7 A;  1PC2 A;  3QK0 A;  4UWK A;  3FWV A;  1SQM A;  2L0I A;  3AS8 A;  1EPU A;  3RO2 A;  1KT0 A;  2I9C A;  4DPR A;  4O6F A;  2VGX A;  4PDX A;  4AXH A;  1S0P A;  4I9E A;  3FH8 A;  3WXX A;  5AIJ A;  5D0Q D;  2EQX A;  2HYZ A;  2E0I A;  4PH4 B;  4EBA G;  2WXK A;  3L17 A;  3ZW3 A;  2KCV A;  1HU3 A;  2VSO E;  2C2L A;  2KZT B;  3NF1 A;  2CHW A;  2XEV A;  4FC8 A;  3ZYM A;  2WQ6 A;  1HXI A;  3SNX A;  3OXG A;  2XQ0 A;  3OTN A;  3CVL A;  3I4G A;  4UQZ A;  3SFZ A;  2WQH A;  4DLO A;  4FA6 A;  3GZS A;  4U0Z A;  1MHQ A;  1L5J A;  2FO7 A;  3ML8 A;  1GW6 A;  5KJL A;  5LOZ A;  4QFV A;  3S7D A;  4G11 A;  3RRN B;  3TGO A;  2DBA A;  3JCK C;  5ARF A;  5KJK A;  3LXU X;  1H19 A;  4G26 A;  2HO1 A;  2NSZ A;  3FU6 A;  3QOU A;  4YND A;  3EIQ C;  4KVM A;  2PQR A;  2YHE A;  2OND A;  3RU0 A;  4A3V A;  4ANX A;  5FTP A;  2JEK A;  3G2V A;  1E96 B;  3LY7 A;  4FUL A;  3D9K A;  3SZ7 A;  4CRW A;  4CDM A;  4GZ6 A;  4C9B B;  2J08 A;  3B7U X;  4A1G A;  4B8C B;  4BY6 A;  1X5B A;  4N2S A;  3U66 A;  2WM9 A;  3LJ3 A;  3QC1 A;  4RVB A;  4U8H A;  4WNG A;  3CHM A;  1UW4 B;  3E4B A;  3FH5 A;  3MKR A;  5A6C A;  1ELR A;  2AXU A;  2PQN A;  3CK9 A;  4AJW A;  4XI0 A;  3CGH A;  4ILH B;  3MV3 B;  5ARG A;  4N39 A;  5T8I A;  3B13 A;  1XNF A;  3CK8 A;  3TJP A;  4WNE A;  3ONK A;  3ULQ A;  4NRH B;  3S2A A;  1EDU A;  4ILI A;  4IN3 B;  2XRZ A;  3QAQ A;  1OUV A;  3Q4A B;  3T8M A;  2XCB A;  3ZRH A;  3U4T A;  4JHK A;  2YHC A;  3EDT B;  5EX0 A;  4UI9 K;  3MCX A;  3ZPJ A;  3FTZ A;  1H2U A;  4UQY A;  3PE3 A;  1ZU2 A;  3TG4 A;  4G1T A;  1OWO A;  3UUX A;  3CVV A;  2XPY A;  5A23 A;  2XCC A;  5CMY A;  1UN8 A;  5BNW A;  2ION A;  2V0P A;  3ZFW A;  2I2O A;  2IOL A;  3QWV A;  3Q49 B;  3ASF A;  5KCM A;  2VTB B;  1QNF A;  2AXZ A;  3ZXS A;  1HF8 A;  1UG3 A;  2BTD A;  3FU3 A;  5T4Y A;  4BSX A;  2I6H A;  5CCM A;  3MYV A;  3AU5 A;  3FUD A;  5EDS A;  4I6G A;  5E75 A;  1IQR A;  1JPL A;  3APD A;  3JQ1 A;  3IKO B;  1E8Z A;  2Y3A A;  4A1S A;  4FLB A;  4GU5 A;  4ANU A;  4HLE A;  2P58 C;  3PUK A;  5LX8 A;  5HQ8 A;  2LNI A;  1E90 A;  5DBK A;  3CQC B;  3PNL B;  5G2N A;  5JHB A;  3ZEF A;  2Y4U A;  2XHE A;  4L7T A;  3UX4 A;  4ANW A;  5FQ7 A;  4BT9 A;  4L1B A;  3HIZ A;  3KD7 A;  2VSX E;  3MA5 A;  3EJN A;  3CR3 A;  1MQS A;  2LAH A;  5C2Y A;  2J9Q A;  4G24 A;  4IYP A;  4NUR A;  5CCL A;  3QJZ A;  3IV0 A;  1H2T C;  5FQ8 A;  3QDN A;  3L22 A;  4LEU A;  4C0M A;  1SZ9 A;  2WXR A;  4ACK A;  3FFL A;  5LCW C;  2UY1 B;  3LVQ E;  3OXL A;  5G04 J;  4F1S A;  4AP2 A;  4G23 A;  4JA9 A;  3LDZ A;  2MHK A;  4ATG A;  5JJ6 A;  4H7X A;  3HYM B;  2VGX B;  2KC7 A;  3APC A;  4I6E A;  4UQX A;  4BTB A;  3FHE A;  3L13 A;  2WB2 A;  1VDY A;  4HOR A;  2J4B A;  3B7T A;  2NXP A;  4JPS A;  3ASG A;  3GYZ A;  1UJK A;  3FUJ A;  4LRZ A;  4AEZ C;  2VJ8 A;  4BTA A;  3QKY A;  4GB9 A;  4CDN A;  3CV0 A;  3CHO A;  3PUJ A;  3Q5M A;  1HH8 A;  2IJG X;  1OWN A;  2WXQ A;  3JQ0 A;  4YVQ C;  3UT8 A;  4AV7 A;  5J08 A;  2V4L A;  2X6H A;  3ASH A;  1NA3 A;  4GZD A;  2YQ8 A;  2IFU A;  2UWJ G;  4CGV A;  1TJF A;  2VSN A;  4ABN A;  5LFA A;  4BX9 A;  4CT4 A;  1YA0 A;  4K0R A;  1TJC A;  5AJL A;  4WUY A;  4GYW A;  4GYO A;  2L6J A;  4B89 A;  2GW1 A;  3FU0 A;  5T3R A;  3MZL B;  3T5X A;  2E2E A;  3PS6 A;  5E76 A;  2ILR A;  2VYI A;  3FP3 A;  2XGS A;  4BX8 A;  2OOE A;  2V8S E;  4JEU A;  4DJA A;  3SHF A;  4OVU A;  4OVV A;  2MOW A;  4RG6 A;  4G25 A;  4WND A;  4XZ4 A;  3U64 A;  4D10 C;  2WXH A;  1JWG A;  3TAX A;  4E85 A;  2LO6 A;  4XI9 A;  4GCO A;  1INZ A;  2IU1 A;  3LY9 A;  1E7U A;  5BV1 A;  1NA0 A;  2AVP A;  1EYH A;  4WWN A;  4J8S A;  4U0S A;  3NZS A;  3SD5 A;  3C98 A;  3Q47 B;  3EHN A;  2CFZ A;  1WY6 A;  4M3O A;  4N3A A;  2J09 A;  1EF1 C;  1N52 A;  4FLH A;  2YIN A;  3PE4 A;  3ESK A;  4I1O B;  3ZN3 A;  2CG2 A;  3CKB A;  3ZYK A;  4JA7 A;  3D9I A;  2BUG A;  3PNT B;  3BG0 B;  4KBQ A;  3PZD A;  4PS8 A;  4LCT A;  3FTV A;  3ZHE A;  4BFR A;  2PL2 A;  3D9O A;  3U9W A;  3ZHE B;  4GA2 A;  2X3M A;  1HG5 A;  4IUL A;  2XPZ A;  4LUN U;  1Y8M A;  2X6I A;  1HZ4 A;  4KZ0 A;  2IOS A;  2FEZ A;  1FVF A;  3PVL A;  2WXG A;  3QB2 A;  4HOT A;  2OV8 A;  4KYO B;  2WXJ A;  4JL0 A;  4L2L A;  4WWO A;  1Y6I A;  2PZI A;  3L54 A;  2GRL A;  4Y6C A;  2WXN A;  4DI4 A;  3G2W A;  2X6J A;  3VLD A;  3K9I A;  2WXL A;  1ELW A;  4JHJ A;  2WXI A;  3UQ3 A;  2OVF A;  3HHM A;  3EHM A;  3JYS A;  3FUI A;  3URZ A;  3UT4 A;  5CHE E;  3RIB A;  3FTU A;  2V5F A;  3GZ2 A;  4FP7 A;  4MKT A;  4A55 A;  1SZA A;  4EQF A;  4W9R A;  4AM9 A;  1H0A A;  3MX3 A;  5FZQ A;  5FQ4 A;  4HOU A;  1IYG A;  5FQ6 A;  5G05 J;  2GGF A;  2XPI A;  3CIA A;  3O48 A;  4XKC A;  5FJY A;  4GZ3 A;  3ENE A;  2I1J A;  4APF A;  4FJZ A;  2QFC A;  3QWP A;  3U3W A;  4FJY A;  1B89 A;  1OWM A;  2L0T B;  5LP0 A;  4Y6W A;  5G05 C;  4NQ0 A;  2WPV A;  4JZY A;  1NP7 A;  4UWG A;  4KXK B;  3TL5 A;  3RK6 A;  3ZYL A;  4FU3 A;  1E8W A;  4CDR A;  4K03 A;  1TEZ A;  2IQC A;  3HDX A;  5AEN A;  3T5V A;  2R5S A;  4APO A;  5ENN A;  2FUL A;  3CVP A;  3LY8 A;  1DNP A;  4G2V A;  4V3I A;  2CHZ A;  3RO3 A;  2WXM A;  4J0U A;  2OVB A;  3CHR A;  2KAT A;  2NC9 A;  4Q69 A;  3FH7 A;  1HX8 A;  4JHR A;  4U07 A;  2DIW A;  3RRU A;  2R17 C;  3D3M A;  3B7S A;  4UWH A;  2L9B A;  2XGO A;  2JLB A;  4YVO A;  1WM5 A;  5HI7 A;  3G2U A;  1PY1 A;  4HOS A;  2LAI A;  3APF A;  4J6I A;  1U3C A;  3CST A;  4PS3 A;  1BPO A;  1N54 A;  4GAA A;  5BV0 A;  4FAD A;  3FTX A;  2ZU6 B;  3FEY A;  5G04 C;  2VQ2 A;  3ONL A;  4F7A A;  3CEQ A;  2J07 A;  2CFU A;  1FCH A;  3CHQ A;  2AWI A;  3ESL A;  4AVX A;  3FUK A;  3OXF A;  4B8A A;  5BT1 A;  3AS4 A;  5A7D B;  4A3T A;  1JUQ A;  4U04 A;  3DBS A;  3ML9 A;  4ME2 A;  3FY4 A;  3UPV A;  2WMN A;  5DIZ A;  4GPK A;  1NZN A;  4HFG A;  3SF4 A;  1UN9 A;  1HS6 A;  2X6F A;  4U0U A;  4HOQ A;  3ZVV A;  4TUU A;  2GRM A;  3R7R A;  1UJJ A;  3D9J A;  5FT9 A;  3ASD A;  4J8E A;  5FZS A;  2FF4 A;  4P29 A;  2X38 A;  4UI9 J;  5ANR A;  2HM8 A;  4PUC A;  4FHJ A;  3DPD A;  3D9P A;  4CT0 A;  3G2S A;  2R59 A;  4J8F A;  2KZT A;  4UI9 C;  1E7V A;  4HXI A;  4RG9 A;  3IHY A;  3VLF A;  1WAO 1;  3ZYQ A;  4JC8 A;  3LYA A;  4LER A;  2MRI A;  2WVI A;  4C0E A;  3HVE A;  4BT8 A;  1HO8 A;  3GW4 A;  1IHG A;  3BG1 B;  4ILG A;  4JVS A;  3HVE B;  5FWQ A;  4GZC A;  4PS7 A;  4F53 A;  4CEM A;  4I9C A;  3MKQ A;  2XRY A;  4ANV A;  4I6J A;  3CQG B;  3IEG A;  3MKQ B;  4B94 A;  2WQ7 A;  4H7Y A;  1LF8 A;  2PM7 A;  3VLE A;  3KEZ A;  3LCA A;  4MS6 A;  4WAF A;  4TRQ A;  3D9N A;  3FUF A;  4UWL A;  3SBS A;  4GA0 A;  5KJN A;  4U63 A;  4E6H A;  2M63 A;  1KLX A;  1QQE A;  3CVQ A;  4NAC A;  3CHS A;  4AOF A;  1A17 A;  4KT6 B;  1OWL A;  1FVH A;  4OYS A;  4WWP A;  3QNK A;  1W3B A;  4JXT A;  4XX5 A;  3UMV A;  4AY6 A;  5J90 A;  3Q15 A;  2AW6 A;  3PDN A;  4I2W A;  4UWF A;  3R7Q A;  3P1U A;  2DCP A;  2HR2 A;  3LEW A;  5ANL A;  5G55 A;  1JWF A;  2RG8 A;  3I4R B;  4L2Y A;  2KM4 A;  3D9M A;  4XIF A;  4GZ5 A;  1P5Q A;  1U3D A;  4AY5 A;  5CMW A;  4N3C A;  2C0M A;  3SBT B;  4MRU A;  3TG5 A;  3LPZ A;  3CVW A;  4WNF A;  3CVU A;  3L6A A;  3RJV A;  2WXP A;  4GCN A;  4MLP A;  3SI5 A;  3CVY A;  1OWP A;  1H6K A;  4I1M A;  3UT7 A;  3FUE A;  1QZ2 A;  2YNQ A;  3CVX A;  3ZIM A;  3S7F A;  4B0Z A;  5C1D A;  4ACL A;  2XGM A;  4EEC A;  3PEU B;  4XE0 A;  4EZL A;  2KCL A;  3IBE A;  5EKQ D;  4EZJ A;  3FTY A;  5AJD A;  2VSY A;  2Q7F A;  3FTS A;  4FHK A;  1Z3X A;  2CG3 A;  3PRE A;  4KVO A;  1XGW A;  4URK A;  2AXV A;  5JHA A;  2LSU A;  3MGB A;  4J8D A;  4I43 A;  3S7J A;  3CSF A;  3NZU A;  2LSV A;  3P2B A;  3FTW A;  4GA1 A;  1Z3Y A;  3VTX A;  3FEX A;  3TXN A;  3AS5 A;  3NQP A;  4N5C A;  1E8Y A;  4JW1 A;  3GZ1 A;  3I3N A;  3I5P A;  4GMJ A;  4R7L A;  5AYW D;  2FI7 A;  3ZGQ A;  4N2Q A;  4DLQ A;  1HG2 A;  4I17 A;  2PM6 A;  3FUN A;  3R9A B;  3OAW A;  3CHP A;  1IQU A;  1DVP A;  4F3V A;  2A4Z A;  3CVN A;  4CCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...