5AYWD

Structure of a membrane complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
212
Chain Sequence
GSKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the BAM complex and its implications for biogenesis of outer-membrane proteins
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Membrane protein
molecule keywords Outer membrane protein assembly factor BamA
total genus 73
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5aywD00
2MHKA 2FO7A 3ZHEA 5JJTA 4N2QA 2VGYA 4H7YA 3MEKA 2VGXA 5DIZA 3VTYA 3LCAA 3CK7A 2LSVA 2XCBA 2C0LA 4KBQA 5EX3A 4BTAA 5FZQA 4G2VA 2Q7FA 4AM9A 4BWRA 3PDNA 4G25A 3LYAA 1HH8A 1ELWA 4N3AA 3OXLA 4XI0A 2XCCA 3ZGQA 3CVQA 3URZA 1B89A 3ZFWA 2FF4A 3AS4A 5G05J 1IYGA 1WAO1 3E4BA 4GA2A 3FWVA 4XIFA 1QQEA 3CKCA 3AS5A 2LNIA 2V5FA 2XPIA 1KT0A 2C0MA 2IFUA 3CV0A 3CVNA 4GCNA 4NRHB 4Y6CA 4YVQC 3WXXA 5A6CA 2VGXB 4N2SA 3FFLA 4I1AA 3TAXA 4GZ3A 4RG6A 3U4TA 5FZRA 4BT9A 2XEVA 4J8FA 4AY5A 3GW4A 3U3WA 3KD7A 1HZ4A 3Q4AB 2KC7A 3N71A 4WNGA 1FCHA 1E96B 1ZBPA 5DBKA 2NC9A 4UQZA 4RG9A 3RO3A 1ELRA 4HOSA 5BT1A 3BEEA 2KCVA 3GYZA 3SZ7A 3UUXA 1XNFA 4G1TA 2IF4A 5BNWA 4F3VA 1QZ2A 3CVPA 3IEGA 3KAEA 3S7FA 4GPKA 3QWPA 1TJCA 5AYWD 3ZN3A 5JJ7A 1YA0A 4ME2A 5G05C 2HR2A 3ULQA 4UI9K 3ASDA 3OXGA 3QOUA 4HOTA 5HQ8A 4WUYA 2FI7A 3Q5MA 4U0UA 1NA0A 2HO1A 5HI7A 3QDNA 3Q49B 4A1SA 5C1DA 3PE3A 2P58C 4GYWA 4I9CA 2UWJG 3GZ1A 4UI9J 4GA0A 4W9RA 1WM5A 2PL2A 4BT8A 3VTXA 4UQXA 4J0UA 3NF1A 4HOUA 4CGVA 2PQRA 4XI9A 1Y8MA 4GA1A 1HXIA 4GYOA 4NQ0A 5KJLA 5D0QD 3MV3B 4G23A 1PC2A 2WPVA 3OXFA 1KLXA 3RO2A 3O48A 3CVLA 5CCMA 3CEQA 4HOQA 2XGOA 5FZSA 5A7DB 1P5QA 5EKQD 3ASHA 4LEUA 4YNDA 4GYYA 2Y4TA 5FT9A 2VQ2A 2UY1A 3S7JA 3LY8A 3Q47B 2KCLA 2Y4UA 5LCWJ 1KT1A 2E2EA 2QFCA 2ONDA 2VYIA 4N3BA 2UY1B 3MV2B 4O6FA 4Y6WA 5CCLA 4HORA 1IHGA 1NA3A 2BUGA 2R5SA 3CK8A 1W3BA 4U07A 4WNDA 4APOA 2FEZA 5JJ6A 3ZHEB 4U0ZA 1OUVA 2PQNA 3EDTB 3LY7A 3K9IA 4I2ZA 3JYSA 4N3CA 3TG5A 4GZ6A 4CGWA 4KXKB 3GZ2A 3S7DA 1A17A 2JLBA 4WNEA 4G26A 4ABNA 3LKUA 4J8DA 4J8EA 2FBNA 2XGMA 4GCOA 2VSYA 4I9EA 2DBAA 3QWVA 3CK9A 5EX0A 3LY9A 2YQ8A 3FP3A 4U04A 4JA9A 5KJNA 4IN3B 2KCKA 2HYZA 3ASGA 2C2LA 1ZU2A 3S7BA 4GZ5A 5G04C 3TGOA 3UPVA 3R9AB 1NZNA 4EQFA 4UQYA 5KJMA 2AVPA 2WQHA 4N5CA 3LPZA 3RIBA 3AS8A 5FJYA 2YHCA 5CHEE 4B94A 5KJKA 3MA5A 5BW8C 3QKYA 2J9QA 3PE4A 3RU0A 3HYMB 4G24A 3KS2A 3ZPJA 4AY6A 3Q15A 5M72A 5LCWC 2L6JA 2I6HA 2KATA 4WNFA 5FTPA 3RKVA 2LSUA 3UQ3A 4UI9C 5ARFA 4BTBA 2GW1A 4U0SA 3RJVA 4JA7A 5ARGA 4AIFA 5G04J 4JHRA 3TG4A 4YVOA 2OOEA 3MKRA 4I17A 4JL0A 3SF4A 4CDRA 3QWWA 4I2WA 2PZIA 2XGSA 4N39A 3ASFA 4H7XA 4KYOB 3CKBA 5D0OD 2VSNA 3ESKA
chains in the Genus database with same CATH superfamily
4LNBA 5EYLA 1FT2A 3U9WA 2IOLA 1N4QA 3LCAA 5EX3A 1QNFA 5LFAA 1E8XA 4B0ZA 3JXIA 2X6JA 4Q96A 3U64A 1BD8A 3HIZA 3HG0D 3TWSA 3D9MA 3EIJA 4KZCA 4RLYA 3GYZA 4HS2A 5KBAA 4G8LA 3ZN3A 2QC9A 3QK0A 3R7QA 1UJKA 1IXVA 2DZOA 2P58C 4GMJA 1FVFA 1HO8A 1WDYA 2RFAA 5EIDA 5CBNA 3L22A 4HFGA 3V79K 1MYOA 5A7DB 1H19A 2HM8A 2L6BA 2WM9A 3Q47B 3B7TA 2ONDA 3FU6A 3MV2B 4HQDA 3D9OA 3EDTB 4BESA 1HG5A 2I1JA 4WNEA 2FBNA 2NYJA 4EPZA 4YDOA 3ASGA 4LG6A 2KZTA 5G04C 4GTPA 2AWIA 1TNBA 3BUAA 1OT8A 3MJWA 3C3OA 1N95A 2QYJA 5BXOA 4BT9A 1O1RA 5JJTA 4I6JA 2VGXA 3LVQE 3P2BA 2X3MA 3SQVA 2XRZA 3FULA 4Z68A 2R17C 1FT1A 3FWVA 3PUKA 4CCAA 3PS6A 2LNIA 2WXJA 3U4TA 4XKCA 4UWLA 4C0EA 4NURA 1WY6A 5CBOA 1QZ2A 3CVPA 4FULA 2WXRA 1TJCA 3D9IA 3D3MA 3G2WA 4KVMA 2HO1A 5C1DA 3PE3A 4AJWA 2XHEA 4L2YA 4L23A 3CSTA 3PNLB 2RG8A 3HRAA 3CVLA 2B0OE 4LEUA 3ASOE 2KCLA 4HLLA 4F53A 5CCLA 1KZPA 3C3RA 3AAAC 1Y6IA 1H6PA 4GZ6A 3KSLA 2VJ8A 4FHKA 3MKQB 3PZ3A 5CEDB 1UG3A 5G55A 2KCKA 1ZU2A 4F1SA 5LX8A 3SBTB 1K1AA 5BXUA 3FUFA 4U7EB 3RSEG 2P9IG 2YHCA 5KJKA 4A55A 3JXJA 1IHBA 3QKYA 3HYMB 4G8KA 1N4RA 2I6HA 1O1TA 1BU9A 4DK5A 4YVOA 3AG1E 4I17A 1S70B 4N39A 2PZIA 4FADA 4F7AA 4B89A 4F6RD 1E8WA 3OTNA 2XCBA 4GU5A 4FHJA 4HRNA 1JUQA 2F8XK 1WAO1 3E4BA 3EJNA 1H0AA 3HXEA 3PVLA 4GTRA 4UWFA 1S64A 4JHKA 4J8FA 3KD7A 3N71A 1H2UA 4UWKA 4KVOA 2ETCA 3MYVA 3ZUVB 4XEIG 2ZGDA 2IJGX 3FTXA 3Q5MA 4UQXA 3NF1A 4OVVA 4MBGA 2LUHA 3VLEA 1FPPA 4FA6A 4HOQA 3FH7A 4GYYA 3S7JA 2Y4UA 1H2VC 2H6FA 1W3BA 5AQ7A 4GTSA 4ILGA 2XS1A 3CIAA 4EHMA 3PREA 3UIPC 5HKPA 2PM6A 2DBAA 3QWVA 3FP3A 3IHYA 5CEAA 4GZ5A 4GTMA 3FUEA 4I1OB 5ENNA 1RZ4A 1JPLA 5FIOA 5BW8C 2YINA 3FUNA 3SD5A 4BFRA 4BTBA 2BEDA 4LNGA 2FO7A 5BUZA 3DSVA 4CEMA 2GROB 4H7YA 5KCMA 4GTOA 2LSVA 3LEWA 1MHQA 5HS0A 2RFMA 1TNUA 4XI0A 1SW6A 2EIME 3L13A 3URZA 4YDEA 3AS5A 2XPIA 4NRHB 3TAXA 3QJZA 4AY5A 1HZ4A 5FTPA 1FCHA 3HXCA 5BNWA 1TN6A 1NP7A 1ELKA 3QARA 3KEAA 1OWNA 2GRLA 1G3NB 3UXGA 3QDNA 2BKGA 4PS8A 1IKND 4HOUA 4KZ0A 3B95A 1OCCE 1HXIA 3R7RA 1O5MA 3Q9NC 2AJAA 1JWFA 4HVBA 4PS7A 1BLXB 3Q7FA 4O6FA 3CHSA 1NA3A 2F0YA 2BUGA 3K9IA 1SVXA 3G2UA 3PZ2A 3LY9A 2XQ0A 1DVPA 3L82A 4OVUA 3EIQC 3HXDA 1AP7A 2NSZA 2DIWA 2CHXA 5FQ6A 4AOFA 1OXJA 3I3NA 3NZUA 2DZNA 1FVHA 4FU3A 3FUMA 4UI9C 2J8SD 4P29A 2VSNA 2WXGA 3ONKA 4BSZB 3D9HA 3TWUA 2KBXA 3SY2A 1INZA 4DI4A 4N3AA 2DYRE 3TWTA 4ILHB 3APFA 5LP0A 1NFIE 1SA4A 1UW4B 2WXKA 2XZTG 5FZRA 4WNGA 2GRQB 1E96B 5DBKA 3BEEA 3SZ7A 1JCSA 4LNUD 2LXLA 1EDUA 3JQ0A 4C9BB 4J6IA 3EHMA 1K3ZD 2J49A 3E34A 4A3TA 4BT8A 3UX4A 3PRZA 2VTBB 2XPYA 1N4PA 2QYUA 3ISMC 3RO2A 4JZYA 3L9TA 2CFZA 4JPSA 3L54A 3UKRG 2EINE 4WWNA 2X6HA 5EX0A 2WXPA 3EU5A 3FUKA 4U04A 2HYZA 4FJZA 3JCKC 3NBNB 1JWGA 2WQHA 4N5CA 2I1KA 3C72A 2LAIA 3PE4A 5IY5E 1MX6A 3ULYA 1H6OA 3EHRA 4ANWA 5M72A 4WNFA 4GMRA 2KZTB 1E7UA 2ZISA 3UT8A 4APFA 1IQUA 2MHKA 3T8KA 2RD0A 4GTQA 3ZHEA 2WVIA 2R03A 2C0LA 4BTAA 3TWVA 1HH8A 3E30A 3ZFWA 2J4BA 4HI8A 4BX8A 1KT0A 4YVQC 4G11A 5KWDA 5ENRD 2VSOE 5AJLA 3FH8A 2XEVA 3GW4A 2IEJA 1ELRA 5BT1A 2GRNB 2J09A 2OVBA 1JCRA 5AYWD 3IXEA 4HOTA 2DYSE 3B7BA 2FI7A 4JB8P 1KPSB 3CVUA 4CDMA 2ZU6B 1D9SA 4E85A 5J90A 3SHFA 2EIKE 1JCQA 3HHMA 5D0QD 1YMPA 3OXFA 3APDA 3O48A 3EHQA 3G2TA 3ZEFA 4Q69A 5FT9A 2QFCA 1L5JA 1E7VA 4EECA 3CVWA 2ETAA 1OUVA 3JYSA 4GAAA 3KSQA 3UMVA 3EHNA 1ZB1A 3ULEG 1WG0A 3FDHA 2IOSA 2WXIA 5KJMA 1HFAA 5CERB 5FJYA 3ABLE 3ZYKA 1A5EA 3RU0A 4U63A 4XZ4A 3ZPJA 2H6IA 2DCPA 4ATZD 2QZAA 3MKQA 1N0RA 2L0TB 3BU8A 3C98A 4L1BA 2GW1A 4U0SA 5JMND 4EZLA 4I2WA 4H7XA 3CKBA 3ML9A 3DXKG 5ITZF 2PM7A 3AJIA 2FO1E 4BETA 4R7LA 3AU5A 3AU4A 2FF4A 2HE0A 4Q94A 2IQCA 2H6GA 4Y6CA 3ABME 3WXXA 2VGXB 5JA4D 3R9MA 2PNNA 5FQ8A 2GRRB 2NC9A 5AAOA 4HRMB 4JVSA 4JW1A 4ME2A 3ESLA 3ASDA 4WUYA 2XEHA 1K8KG 1HG2A 4W9RA 4I1MA 2PQRA 3Q73A 4LCTA 3ONLA 5KJLA 4UWHA 1PC2A 4KT6B 2IO3C 2Y4TA 3UM3A 2UY1A 3LY8A 2M63A 4Y6WA 2OCCE 2BF0X 4DX1A 1QBQA 2WQ6A 4RVBA 4O1PA 4G26A 5BV0A 1LTXA 1OY3D 3DEOA 3L16A 2C2LA 2F8YA 4ANUA 5EYPF 3UINC 3CHRA 3P1UA 1TR4A 1BI8B 1MX4A 3DEPA 4AIFA 1OWLA 2OOEA 4CDRA 3UIOC 3D9LA 1DC2A 2VGEA 2KM4A 3VTYA 1OCRE 5DIZA 5FWQA 4KBQA 5B1AE 3QB2A 3L08A 3G2VA 3UM0A 4EBAA 3FUIA 1H2TC 1IYGA 4K5CA 4CRWA 2I2OA 2V5FA 4IRUA 3FTZA 1HE8A 4HRLA 3IHVA 3V2OA 3NAWA 2P9UG 2V8SE 2HR2A 2ETBA 3TXMA 4U8YD 3CLJA 3IBEA 2XRYA 4N5QA 3GZ1A 5KNGA 3C3QA 3Q9UC 1K1BA 4AEZC 4L7TA 4RQIA 3ZYQA 4FLBA 2L9BA 4G23A 2WXHA 3RAUA 4JXTA 5FZSA 4FP7A 4XX5A 2UY1B 1BI7B 3V2XA 3CK8A 2EILE 2FEZA 3TG5A 1TN8A 1X81A 2XGMA 2WB2A 2CHWA 3Q78A 1Z6TA 2AVPA 3RIBA 4CZ2D 4WAFA 3NOGD 3MA5A 3L17A 2CG3A 4O1OA 3AG3E 5KNHD 1TEZA 1UN8A 1MJ0A 2KATA 3B7RL 4ACKA 4AVXA 3DSWA 2J07A 4JA7A 5A23A 4CGVA 3FH5A 3CQGB 2E0IA 2XGSA 4JEHA 1EYHA 5CRUA 2AXUA 3ESKA 4GB9A 3GZSA 4J8SA 3MEKA 3SFYA 3LYAA 3W9FA 2X6IA 2V4HC 1N9AA 3UTMA 2DVWA 3CVNA 3AG2E 4N2SA 4KMOA 1RW2A 2WXFA 2L0IA 4DPRA 4K03A 4HOSA 3UKUG 3FHEA 3EUVA 4G1TA 2IF4A 2B6CA 4EZJA 3IEGA 1E90A 1YA0A 4K5AB 3OXGA 4O60A 2GGFA 3HXBA 2R02A 4QQIA 5ENOD 1Y8MA 1TN7A 4GYOA 4DX6D 1KLXA 2I9CA 3TWQA 3T5XA 1MX2A 3PZ4A 3D9NA 5LCWJ 4HORA 3ZVVA 2WMNA 4FJYA 3DXMG 4IYPA 2R59A 2V0PA 2LXMA 3LPZA 3FTYA 5C2YA 2JEKA 2WMOA 4B8CB 4YDWA 3HXFA 3CVXA 2OEWA 3DWLG 1NL4A 4LRZA 3RJVA 4MLPA 3HDXA 4IN3B 4N2QA 3PZDA 2GRPB 4G2VA 4DI3A 5ANLA 4G25A 5ENQD 3CVQA 3LJNA 3TWXA 1DCEA 3CKCA 3C5RA 5BV1A 3Q4AB 4DJAA 1SA5A 2P9PG 3I5PA 5JHAA 4C48B 1N0QA 4F3VA 3T8MA 3FTVA 1YCSB 4UI9K 5HQ8A 4BSXA 3FU0A 2GRMA 1OCOE 3O4ZA 3E32A 3FUJA 5CECB 4IULA 5BPPA 4NQ0A 3TJPA 2WPVA 5T3RA 1SZ9A 1HS6A 4L2LA 1KT1A 3LDZA 4U07A 3ZHEB 3SO8A 3FUHA 5CRVA 1KZOA 1N54A 2F37A 2XS8A 3NZSA 1UOHA 3KS2A 3VLFA 2L6JA 2H6HA 1DNPA 4EBAG 2NXPA 1Z3YA 4JHRA 3MKRA 4OYSA 5FQ4A 1H6KA 3UPVA 4RSYA 3FUDA 3JUIA 3Q79A 3NB2A 3PEVB 4ACLA 4BX9A 3FTSA 1UJJA 1Q2ZA 1D8EA 5AARA 3G2SA 2C0MA 1BPOA 3Q75A 1V54E 3TL5A 1AWCB 2P9KG 3RO3A 4URKA 2A5EA 3B13A 3UM2A 4DRXE 1TNOA 3AG4E 5EILA 3S7FA 1EPUA 2Y0BG 4CYMD 5FINA 2XZDG 4U0UA 1GW6A 4TXQA 4GA0A 2V4LA 3DSTA 4FC8A 3SGHA 2AXVA 3MV3B 2JABA 3ZKJA 4YNDA 4MRUA 3E37A 2V5QC 2AXZA 1LF8A 5E76A 4B93B 3NQPA 4PUCA 4E6HA 4U0ZA 2WQ7A 4N3CA 1LD8A 3LJ3A 4U96D 4GCOA 3ZXSA 4JEUA 2VSYA 4MKTA 5JHBA 3LXUX 2VTBA 2YQ8A 3CHMA 5KJNA 4J8YA 4ANXA 4K5BA 4UQYA 4B94A 4MS6A 2J9QA 4M3OA 3MGBA 5LCWC 2OVFA 2FULA 1MZCA 2AW6A 1DCQA 4ILIA 4ATGA 3LVRE 4FLHA 4TRQA 4GMLA 3MZLB 4YDYA 4DLOA 3HVEA 2XCCA 2A5UA 3AS4A 3D9PA 3ZYLA 3ZRHA 4F1PA 1PAQA 4RG6A 4UQZA 3SBSA 3T9KA 4A63B 2KCVA 4ZHBA 3DSSA 5G05C 1U2VG 1HF8A 1NA0A 2MRIA 3DSXA 3Q49B 5HI7A 4DUIA 3L6AA 3MX3A 2UWJG 4UI9J 5AN8A 4J0UA 3FEYA 3I4GA 5B1BE 4TXRA 3ENEA 5D2MC 5EKQD 4TUMA 4U8HA 1HX8A 5EN5D 5ENSD 2EQXA 2VYIA 2YNQA 4N3BA 4WNDA 1S63A 2ZIRA 3DBSA 3U3WA 4ABNA 3LKUA 5H7PA 3BQOA 3J5QB 1TNYA 2OV8A 5G2NA 3R9AB 4HI9A 3IKOB 1YYHA 5E75A 3B7SA 4DX7D 3UI2A 2X6KA 2R05A 4CT0A 2XENA 3CGHA 4JL0A 2IO2C 1EF1C 1Z5SC 1N11A 3ASFA 2P9SG 4HNAD 3T5VA 2WXMA 4GZDA 4UWGA 2CG2A 5ENPD 3ZYMA 2ILRA 3J5PA 1Z3XA 3TXNA 3ZIMA 3OXLA 3ZGQA 3HVEB 3CQCB 1B89A 5G05J 1N94A 4XIFA 1XGWA 3FFLA 3BG0B 3CHPA 5CMYA 3FU3A 1V55E 1IQRA 3ASNE 4HXIA 3ML8A 1X5BA 3SFZA 3QAQA 3QOUA 4PS3A 4A1GA 2XEEA 2MOWA 3PUJA 3QC1A 3JQ1A 4I9CA 5AJDA 5FQ7A 4GTTA 3IV0A 2VQ2A 4HLEA 2IY0C 1IHGA 2R5SA 4I2ZA 3DPDA 3CSFA 1A17A 1N52A 4J8EA 4GPMA 4J8DA 4I9EA 3LS8A 4I6EA 2WXOA 4XE0A 4DLQA 4XKBA 4B8AA 4DX5D 5ARFA 2LAHA 1QYMA 2A4ZA 3CHOA 3SF4A 1TNZA 3QNKA 4EQFA 1OWPA 2EIJE 3CK7A 3APCA 3KEZA 3PDNA 4NACA 2YHEA 3FU5A 4LERA 2KXPC 4AP2A 3DPYA 2ZGGA 2P9NG 4D10C 4GCNA 3UUXA 5AIJA 2RKKA 4HB5A 4TUUA 3PH0C 1O1SA 4U95D 4BY6A 2BTDA 3NOCD 1U3DA 5JJ7A 3FY4A 4A1SA 3JUEA 3I4RB 2LO6A 1WM5A 3RRUA 3VTXA 4BERA 5D66A 1MQSA 3RK6A 4GA1A 2ZXWE 2Y69E 5AQAA 2R2LA 1TJFA 3CHQA 4LSZE 3OAWA 3ZU7B 3CEQA 4UUCA 3ZNGA 4TXPA 2Y3AA 1PY1A 4A3VA 4APOA 3TWWA 4OAUC 2MYOA 2PQNA 5B3SE 3LY7A 4CGWA 4WWPA 3CK9A 4JA9A 5AQ9A 4U8VD 4V3IA 2VSXE 3Q7AA 3Q15A 1N4SA 2DWZA 4NIKA 5G04J 2WXQA 1LD7A 3BG1B 1D8DA 5J08A 3EU9A 2VGYA 3TWRA 3F6QA 3UT4A 4AM9A 3ABKE 2IONA 1E8YA 4WWOA 2J4DA 3FTWA 4GA2A 4GPKA 3FEXA 5A6CA 4OAVB 4HBDA 4I1AA 4TV3A 3S2AA 4L9PA 2KC7A 4RG9A 3DSUA 4I43A 5T8IA 3KAEA 3QWPA 4PH4B 5ENTD 4ANVA 2BKKB 2CFUA 4GYWA 2PL2A 5AQBA 4XI9A 4BEPA 5CCMA 3WG7E 3SNXA 2XGOA 1P5QA 2Y1LE 5EDSA 4DX2A 2E2EA 3SFXA 1SZAA 3U66A 3CVYA 1NI1A 5T4YA 4KXKB 3D9KA 3VLDA 4JHJA 3S7BA 3PEUB 4M7CA 3AS8A 4K0RA 2OEVA 3PNTB 3E33A 2XPZA 4LUNU 2LSUA 2P9LG 3TG4A 3V30A 4I6GA 2P2CP 3QWWA 5D0OD 3W9GA 4CT4A 2X38A 3DRAA 4PDXA 3RRMB 4AXHA 4BWRA 5LOZA 5FZQA 2Q7FA 1OWMA 4C0MA 1ELWA 1VDYA 3PZ1A 4X8QA 3V31A 1QQEA 3CV0A 2IFUA 1SQMA 3FTUA 4EZKA 4GZ3A 5EIBE 1E8ZA 4JD2G 3UM1A 3MCXA 1ZBPA 1XNFA 4AV7A 1U3CA 4J7WA 4CDNA 4GZCA 3ULQA 1OCZE 2J08A 1S0PA 3ZW3A 3UT7A 2WXLA 4ZFHA 3CVVA 1OWOA 4QFVA 3SI5A 5AENA 3ASHA 2X6FA 1HU3A 5CMWA 3X2QE 5HRYA 1TYQG 3RRNB 3B7UX 4GTVA 5JJ6A 3GZ2A 2IU1A 3S7DA 2JLBA 3CR3A 3TGOA 2QY7A 1NZNA 5ANRA 5CHEE 2WXNA 4G24A 3D9JA 4AY6A 1UN9A 3ZXPA 2CHZA 3RKVA 3UQ3A 5ARGA 4JC8A 4KYOB
chains in the Genus database with same CATH topology
3T5VA 2WXGA 3ONKA 2WXMA 4GB9A 4GZDA 3GZSA 4J8SA 4UWGA 3U9WA 3MEKA 2IOLA 3LCAA 2CG2A 4P29A 5EX3A 3ZYMA 2ILRA 1INZA 1Z3XA 3TXNA 1QNFA 3LYAA 5LFAA 3ZIMA 4DI4A 4N3AA 3OXLA 3ZGQA 1E8XA 3HVEB 3CQCB 1B89A 2X6IA 4ILHB 4B0ZA 5G05J 3APFA 4XIFA 5LP0A 2X6JA 3CVNA 4N2SA 4KMOA 2WXFA 4Q96A 3U64A 1XGWA 1UW4B 2L0IA 2WXKA 3FFLA 3HIZA 4DPRA 5FZRA 4K03A 3BG0B 3CHPA 5CMYA 3FU3A 4WNGA 3D9MA 1E96B 4HOSA 5DBKA 1IQRA 3FHEA 3EIJA 4KZCA 3BEEA 3GYZA 4HS2A 3SZ7A 4G1TA 2IF4A 4HXIA 3ML8A 1X5BA 4EZJA 1EDUA 3IEGA 3ZN3A 1E90A 1YA0A 3QK0A 3SFZA 3JQ0A 3QAQA 3OXGA 3QOUA 4C9BB 4J6IA 4PS3A 3R7QA 4A1GA 3EHMA 1UJKA 2GGFA 2J49A 2MOWA 3PUJA 3QC1A 3JQ1A 2P58C 4GMJA 4I9CA 1FVFA 1HO8A 5AJDA 4A3TA 4BT8A 3UX4A 3PRZA 1Y8MA 2VTBB 2XPYA 4GYOA 3L22A 5FQ7A 4HFGA 3RO2A 1KLXA 2I9CA 4JZYA 5A7DB 3T5XA 2CFZA 1H19A 2HM8A 3IV0A 2VQ2A 2WM9A 3D9NA 3B7TA 3Q47B 4JPSA 4HLEA 5LCWJ 4HORA 2ONDA 3FU6A 3ZVVA 3MV2B 3L54A 1IHGA 2WMNA 2R5SA 4FJYA 3D9OA 3EDTB 4I2ZA 3DPDA 3CSFA 1HG5A 1A17A 1N52A 2I1JA 4WNEA 4IYPA 2R59A 4J8DA 2FBNA 4I9EA 3LS8A 4I6EA 4J8EA 4WWNA 2X6HA 2WXOA 5EX0A 2WXPA 4EPZA 2V0PA 4XE0A 3FUKA 4U04A 3ASGA 2HYZA 4FJZA 3JCKC 2KZTA 5G04C 2AWIA 1JWGA 2WQHA 4N5CA 3LPZA 2I1KA 3FTYA 2LAIA 3PE4A 5C2YA 4ANWA 4XKBA 4DLQA 4B8AA 2JEKA 2WMOA 5M72A 4B8CB 4WNFA 3CVXA 5ARFA 2LAHA 3RJVA 4LRZA 3MJWA 2A4ZA 3CHOA 2KZTB 3SF4A 1E7UA 3UT8A 3QNKA 4MLPA 4EQFA 4BT9A 1OWPA 4APFA 1IQUA 3HDXA 4IN3B 2MHKA 2RD0A 3ZHEA 5JJTA 4I6JA 2WVIA 4N2QA 3PZDA 2VGXA 3CK7A 3LVQE 3P2BA 2C0LA 2X3MA 4BTAA 4G2VA 3APCA 4DI3A 5ANLA 2XRZA 3FULA 3KEZA 3PDNA 4G25A 4NACA 1HH8A 2YHEA 3FU5A 4LERA 3CVQA 3ZFWA 2J4BA 4AP2A 2R17C 3FWVA 3PUKA 4BX8A 3CKCA 3PS6A 4CCAA 2LNIA 4D10C 4GCNA 1KT0A 3UUXA 5AIJA 2WXJA 4YVQC 4G11A 4TUUA 3PH0C 5BV1A 3U4TA 2VSOE 5AJLA 3FH8A 2XEVA 4BY6A 3GW4A 4XKCA 3Q4AB 4DJAA 2BTDA 4UWLA 1ELRA 4C0EA 5BT1A 3I5PA 4NURA 2J09A 5JHAA 1WY6A 4F3VA 3T8MA 2OVBA 1QZ2A 1U3DA 3FTVA 3CVPA 4FULA 2WXRA 1TJCA 5AYWD 5JJ7A 3D9IA 4UI9K 3D3MA 4HOTA 5HQ8A 3G2WA 4KVMA 3FY4A 2FI7A 2HO1A 5C1DA 4A1SA 4BSXA 3FU0A 2GRMA 2XHEA 3I4RB 2LO6A 3PE3A 4AJWA 3CVUA 4L2YA 1WM5A 3RRUA 4CDMA 3VTXA 4L23A 3CSTA 3O4ZA 2ZU6B 1MQSA 3PNLB 3RK6A 2RG8A 3FUJA 4E85A 4GA1A 3SHFA 5J90A 4IULA 1TJFA 5BPPA 3HHMA 4NQ0A 5D0QD 3CHQA 3TJPA 2WPVA 3OXFA 3APDA 3OAWA 5T3RA 3O48A 3CVLA 3CEQA 1SZ9A 1HS6A 3G2TA 4LEUA 3ZEFA 4Q69A 5FT9A 4L2LA 2KCLA 1KT1A 2QFCA 1L5JA 4F53A 5CCLA 1E7VA 4EECA 3LDZA 4U07A 2Y3AA 1PY1A 3CVWA 1Y6IA 4A3VA 3ZHEB 4APOA 1OUVA 2PQNA 3LY7A 4CGWA 3JYSA 4GAAA 4GZ6A 2VJ8A 4WWPA 4FHKA 3UMVA 3EHNA 3FUHA 3CK9A 3MKQB 1N54A 1UG3A 4JA9A 5G55A 2KCKA 3FDHA 1ZU2A 4F1SA 5LX8A 3NZSA 3SBTB 2IOSA 2WXIA 5KJMA 3FUFA 1HFAA 5FJYA 2YHCA 5KJKA 3ZYKA 4A55A 4V3IA 3QKYA 2VSXE 3HYMB 3RU0A 3KS2A 4U63A 4XZ4A 3VLFA 3ZPJA 3Q15A 2L6JA 2DCPA 2I6HA 3MKQA 2L0TB 3C98A 1DNPA 4L1BA 2NXPA 4EBAG 2GW1A 4U0SA 4DK5A 5G04J 1Z3YA 2WXQA 4JHRA 3BG1B 3MKRA 4I17A 4YVOA 4OYSA 4EZLA 4N39A 4I2WA 2PZIA 5FQ4A 4FADA 4H7XA 5J08A 3CKBA 4F7AA 1H6KA 4B89A 3ML9A 3UPVA 4RSYA 3FUDA 2PM7A 3JUIA 2VGYA 1E8WA 3OTNA 2XCBA 4GU5A 4AM9A 3UT4A 4FHJA 3PEVB 4ACLA 2IONA 1E8YA 4BX9A 3FTSA 4R7LA 3AU5A 1UJJA 1JUQA 3AU4A 2FF4A 4WWOA 2J4DA 1WAO1 3E4BA 3EJNA 3FTWA 4GA2A 4Q94A 1H0AA 3G2SA 4GPKA 3PVLA 2C0MA 1BPOA 2IQCA 4UWFA 3FEXA 4Y6CA 3WXXA 5A6CA 2VGXB 4I1AA 1EYHA 4TV3A 3TL5A 4JHKA 4J8FA 3S2AA 3KD7A 5FQ8A 2KC7A 3N71A 1H2UA 3RO3A 2NC9A 4URKA 4RG9A 3B13A 4UWKA 4I43A 5T8IA 4KVOA 4JVSA 3KAEA 4JW1A 3S7FA 3QWPA 1EPUA 4ME2A 3MYVA 3ESLA 4PH4B 3ASDA 4ANVA 4WUYA 2CFUA 2IJGX 3FTXA 3Q5MA 4U0UA 1GW6A 4GYWA 1HG2A 4GA0A 4W9RA 2PL2A 4UQXA 2V4LA 3NF1A 4OVVA 4I1MA 2PQRA 4XI9A 4FC8A 3SGHA 2AXVA 4LCTA 3ONLA 5KJLA 3MV3B 4UWHA 1PC2A 3VLEA 5CCMA 4KT6B 4HOQA 4FA6A 3SNXA 2XGOA 1P5QA 4YNDA 3FH7A 4GYYA 2Y4TA 4MRUA 5EDSA 2UY1A 3S7JA 3LY8A 2AXZA 2Y4UA 1LF8A 2M63A 2E2EA 1H2VC 5E76A 4Y6WA 3NQPA 2BF0X 4PUCA 2WQ6A 1W3BA 1SZAA 4ILGA 4JEHA 4E6HA 3U66A 3CVYA 4U0ZA 2WQ7A 4RVBA 3CIAA 4N3CA 3PREA 5T4YA 3LJ3A 4KXKB 3D9KA 2PM6A 4G26A 3VLDA 5BV0A 4GCOA 3ZXSA 4JEUA 2VSYA 4MKTA 2DBAA 3LXUX 3QWVA 4JHJA 5JHBA 2VTBA 2YQ8A 3CHMA 3FP3A 5KJNA 3IHYA 3L16A 4ANXA 2C2LA 3S7BA 4GZ5A 3PEUB 3FUEA 4UQYA 4I1OB 4ANUA 5ENNA 3AS8A 4B94A 1JPLA 5BW8C 4K0RA 4MS6A 2YINA 2J9QA 3CHRA 3PNTB 4M3OA 3FUNA 3P1UA 3SD5A 3MGBA 5LCWC 2XPZA 4LUNU 2LSUA 2OVFA 2FULA 4BFRA 4BTBA 4AIFA 2AW6A 3TG4A 1OWLA 2OOEA 4CDRA 4I6GA 3D9LA 3QWWA 5D0OD 4CT4A 4ILIA 2X38A 2FO7A 4PDXA 5BUZA 3RRMB 4ATGA 2KM4A 3LVRE 4CEMA 4FLHA 4TRQA 4GMLA 4H7YA 3VTYA 5DIZA 4AXHA 5KCMA 2LSVA 3MZLB 5FWQA 3LEWA 4KBQA 5LOZA 5FZQA 1MHQA 2Q7FA 4BWRA 4DLOA 1OWMA 3QB2A 3L08A 4C0MA 3G2VA 3HVEA 1ELWA 1VDYA 3FUIA 4XI0A 2XCCA 4EBAA 1H2TC 3L13A 3URZA 2A5UA 3AS4A 1IYGA 3D9PA 3ZYLA 3ZRHA 1QQEA 4CRWA 2I2OA 3AS5A 2V5FA 2XPIA 3CV0A 2IFUA 1SQMA 4NRHB 3FTUA 1PAQA 4EZKA 4IRUA 3TAXA 3FTZA 4GZ3A 4RG6A 3QJZA 1E8ZA 1HE8A 3IHVA 4AY5A 1HZ4A 3MCXA 5FTPA 1FCHA 1ZBPA 4UQZA 3SBSA 2KCVA 1XNFA 5BNWA 1NP7A 1ELKA 4AV7A 3QARA 1U3CA 5G05C 4CDNA 2V8SE 2HR2A 4GZCA 1OWNA 3ULQA 2GRLA 3TXMA 3CLJA 3IBEA 2J08A 1HF8A 1NA0A 2MRIA 3QDNA 3Q49B 5HI7A 3L6AA 2XRYA 1S0PA 2UWJG 3GZ1A 3MX3A 4UI9J 3ZW3A 4PS8A 4J0UA 4HOUA 3UT7A 4KZ0A 2WXLA 3FEYA 4AEZC 4L7TA 1HXIA 3I4GA 3R7RA 3ZYQA 4FLBA 2L9BA 4G23A 3CVVA 1OWOA 3ENEA 4QFVA 3SI5A 1JWFA 4HVBA 2WXHA 4JXTA 5FZSA 5AENA 4PS7A 3ASHA 5EKQD 4U8HA 2X6FA 1HU3A 1HX8A 4FP7A 5CMWA 4XX5A 2VYIA 2EQXA 2YNQA 4N3BA 2UY1B 3CHSA 4O6FA 3RRNB 3B7UX 1NA3A 3CK8A 2BUGA 4WNDA 2FEZA 5JJ6A 3DBSA 3U3WA 3K9IA 3TG5A 3G2UA 3GZ2A 2IU1A 3S7DA 2JLBA 4ABNA 3LKUA 2XGMA 2WB2A 2CHWA 3LY9A 1Z6TA 2OV8A 2XQ0A 1DVPA 3CR3A 3TGOA 5G2NA 4OVUA 2QY7A 3EIQC 3R9AB 1NZNA 5ANRA 3IKOB 2AVPA 2NSZA 3RIBA 4WAFA 2DIWA 5CHEE 5E75A 2CHXA 5FQ6A 3MA5A 4AOFA 3L17A 2CG3A 2WXNA 3I3NA 3NZUA 4G24A 1TEZA 3B7SA 3D9JA 4AY6A 1UN8A 1UN9A 2KATA 3B7RL 4ACKA 1FVHA 2CHZA 4FU3A 3RKVA 3UQ3A 3FUMA 4UI9C 2X6KA 4AVXA 4JA7A 2J07A 5ARGA 5A23A 4CGVA 3FH5A 4JC8A 3CGHA 4JL0A 3CQGB 4CT0A 1EF1C 2E0IA 2XGSA 3ASFA 4KYOB 2AXUA 2VSNA 3ESKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHK A;  2FO7 A;  3ZHE A;  5JJT A;  4N2Q A;  2VGY A;  4H7Y A;  3MEK A;  2VGX A;  5DIZ A;  3VTY A;  3LCA A;  3CK7 A;  2LSV A;  2XCB A;  2C0L A;  4KBQ A;  5EX3 A;  4BTA A;  5FZQ A;  4G2V A;  2Q7F A;  4AM9 A;  4BWR A;  3PDN A;  4G25 A;  3LYA A;  1HH8 A;  1ELW A;  4N3A A;  3OXL A;  4XI0 A;  2XCC A;  3ZGQ A;  3CVQ A;  3URZ A;  1B89 A;  3ZFW A;  2FF4 A;  3AS4 A;  5G05 J;  1IYG A;  1WAO 1;  3E4B A;  4GA2 A;  3FWV A;  4XIF A;  1QQE A;  3CKC A;  3AS5 A;  2LNI A;  2V5F A;  2XPI A;  1KT0 A;  2C0M A;  2IFU A;  3CV0 A;  3CVN A;  4GCN A;  4NRH B;  4Y6C A;  4YVQ C;  3WXX A;  5A6C A;  2VGX B;  4N2S A;  3FFL A;  4I1A A;  3TAX A;  4GZ3 A;  4RG6 A;  3U4T A;  5FZR A;  4BT9 A;  2XEV A;  4J8F A;  4AY5 A;  3GW4 A;  3U3W A;  3KD7 A;  1HZ4 A;  3Q4A B;  2KC7 A;  3N71 A;  4WNG A;  1FCH A;  1E96 B;  1ZBP A;  5DBK A;  2NC9 A;  4UQZ A;  4RG9 A;  3RO3 A;  1ELR A;  4HOS A;  5BT1 A;  3BEE A;  2KCV A;  3GYZ A;  3SZ7 A;  3UUX A;  1XNF A;  4G1T A;  2IF4 A;  5BNW A;  4F3V A;  1QZ2 A;  3CVP A;  3IEG A;  3KAE A;  3S7F A;  4GPK A;  3QWP A;  1TJC A;  5AYW D;  3ZN3 A;  5JJ7 A;  1YA0 A;  4ME2 A;  5G05 C;  2HR2 A;  3ULQ A;  4UI9 K;  3ASD A;  3OXG A;  3QOU A;  4HOT A;  5HQ8 A;  4WUY A;  2FI7 A;  3Q5M A;  4U0U A;  1NA0 A;  2HO1 A;  5HI7 A;  3QDN A;  3Q49 B;  4A1S A;  5C1D A;  3PE3 A;  2P58 C;  4GYW A;  4I9C A;  2UWJ G;  3GZ1 A;  4UI9 J;  4GA0 A;  4W9R A;  1WM5 A;  2PL2 A;  4BT8 A;  3VTX A;  4UQX A;  4J0U A;  3NF1 A;  4HOU A;  4CGV A;  2PQR A;  4XI9 A;  1Y8M A;  4GA1 A;  1HXI A;  4GYO A;  4NQ0 A;  5KJL A;  5D0Q D;  3MV3 B;  4G23 A;  1PC2 A;  2WPV A;  3OXF A;  1KLX A;  3RO2 A;  3O48 A;  3CVL A;  5CCM A;  3CEQ A;  4HOQ A;  2XGO A;  5FZS A;  5A7D B;  1P5Q A;  5EKQ D;  3ASH A;  4LEU A;  4YND A;  4GYY A;  2Y4T A;  5FT9 A;  2VQ2 A;  2UY1 A;  3S7J A;  3LY8 A;  3Q47 B;  2KCL A;  2Y4U A;  5LCW J;  1KT1 A;  2E2E A;  2QFC A;  2OND A;  2VYI A;  4N3B A;  2UY1 B;  3MV2 B;  4O6F A;  4Y6W A;  5CCL A;  4HOR A;  1IHG A;  1NA3 A;  2BUG A;  2R5S A;  3CK8 A;  1W3B A;  4U07 A;  4WND A;  4APO A;  2FEZ A;  5JJ6 A;  3ZHE B;  4U0Z A;  1OUV A;  2PQN A;  3EDT B;  3LY7 A;  3K9I A;  4I2Z A;  3JYS A;  4N3C A;  3TG5 A;  4GZ6 A;  4CGW A;  4KXK B;  3GZ2 A;  3S7D A;  1A17 A;  2JLB A;  4WNE A;  4G26 A;  4ABN A;  3LKU A;  4J8D A;  4J8E A;  2FBN A;  2XGM A;  4GCO A;  2VSY A;  4I9E A;  2DBA A;  3QWV A;  3CK9 A;  5EX0 A;  3LY9 A;  2YQ8 A;  3FP3 A;  4U04 A;  4JA9 A;  5KJN A;  4IN3 B;  2KCK A;  2HYZ A;  3ASG A;  2C2L A;  1ZU2 A;  3S7B A;  4GZ5 A;  5G04 C;  3TGO A;  3UPV A;  3R9A B;  1NZN A;  4EQF A;  4UQY A;  5KJM A;  2AVP A;  2WQH A;  4N5C A;  3LPZ A;  3RIB A;  3AS8 A;  5FJY A;  2YHC A;  5CHE E;  4B94 A;  5KJK A;  3MA5 A;  5BW8 C;  3QKY A;  2J9Q A;  3PE4 A;  3RU0 A;  3HYM B;  4G24 A;  3KS2 A;  3ZPJ A;  4AY6 A;  3Q15 A;  5M72 A;  5LCW C;  2L6J A;  2I6H A;  2KAT A;  4WNF A;  5FTP A;  3RKV A;  2LSU A;  3UQ3 A;  4UI9 C;  5ARF A;  4BTB A;  2GW1 A;  4U0S A;  3RJV A;  4JA7 A;  5ARG A;  4AIF A;  5G04 J;  4JHR A;  3TG4 A;  4YVO A;  2OOE A;  3MKR A;  4I17 A;  4JL0 A;  3SF4 A;  4CDR A;  3QWW A;  4I2W A;  2PZI A;  2XGS A;  4N39 A;  3ASF A;  4H7X A;  4KYO B;  3CKB A;  5D0O D;  2VSN A;  3ESK A; 
#chains in the Genus database with same CATH topology
 4LNB A;  5EYL A;  1FT2 A;  3U9W A;  2IOL A;  1N4Q A;  3LCA A;  5EX3 A;  1QNF A;  5LFA A;  1E8X A;  4B0Z A;  3JXI A;  2X6J A;  4Q96 A;  3U64 A;  1BD8 A;  3HIZ A;  3HG0 D;  3TWS A;  3D9M A;  3EIJ A;  4KZC A;  4RLY A;  3GYZ A;  4HS2 A;  5KBA A;  4G8L A;  3ZN3 A;  2QC9 A;  3QK0 A;  3R7Q A;  1UJK A;  1IXV A;  2DZO A;  2P58 C;  4GMJ A;  1FVF A;  1HO8 A;  1WDY A;  2RFA A;  5EID A;  5CBN A;  3L22 A;  4HFG A;  3V79 K;  1MYO A;  5A7D B;  1H19 A;  2HM8 A;  2L6B A;  2WM9 A;  3Q47 B;  3B7T A;  2OND A;  3FU6 A;  3MV2 B;  4HQD A;  3D9O A;  3EDT B;  4BES A;  1HG5 A;  2I1J A;  4WNE A;  2FBN A;  2NYJ A;  4EPZ A;  4YDO A;  3ASG A;  4LG6 A;  2KZT A;  5G04 C;  4GTP A;  2AWI A;  1TNB A;  3BUA A;  1OT8 A;  3MJW A;  3C3O A;  1N95 A;  2QYJ A;  5BXO A;  4BT9 A;  1O1R A;  5JJT A;  4I6J A;  2VGX A;  3LVQ E;  3P2B A;  2X3M A;  3SQV A;  2XRZ A;  3FUL A;  4Z68 A;  2R17 C;  1FT1 A;  3FWV A;  3PUK A;  4CCA A;  3PS6 A;  2LNI A;  2WXJ A;  3U4T A;  4XKC A;  4UWL A;  4C0E A;  4NUR A;  1WY6 A;  5CBO A;  1QZ2 A;  3CVP A;  4FUL A;  2WXR A;  1TJC A;  3D9I A;  3D3M A;  3G2W A;  4KVM A;  2HO1 A;  5C1D A;  3PE3 A;  4AJW A;  2XHE A;  4L2Y A;  4L23 A;  3CST A;  3PNL B;  2RG8 A;  3HRA A;  3CVL A;  2B0O E;  4LEU A;  3ASO E;  2KCL A;  4HLL A;  4F53 A;  5CCL A;  1KZP A;  3C3R A;  3AAA C;  1Y6I A;  1H6P A;  4GZ6 A;  3KSL A;  2VJ8 A;  4FHK A;  3MKQ B;  3PZ3 A;  5CED B;  1UG3 A;  5G55 A;  2KCK A;  1ZU2 A;  4F1S A;  5LX8 A;  3SBT B;  1K1A A;  5BXU A;  3FUF A;  4U7E B;  3RSE G;  2P9I G;  2YHC A;  5KJK A;  4A55 A;  3JXJ A;  1IHB A;  3QKY A;  3HYM B;  4G8K A;  1N4R A;  2I6H A;  1O1T A;  1BU9 A;  4DK5 A;  4YVO A;  3AG1 E;  4I17 A;  1S70 B;  4N39 A;  2PZI A;  4FAD A;  4F7A A;  4B89 A;  4F6R D;  1E8W A;  3OTN A;  2XCB A;  4GU5 A;  4FHJ A;  4HRN A;  1JUQ A;  2F8X K;  1WAO 1;  3E4B A;  3EJN A;  1H0A A;  3HXE A;  3PVL A;  4GTR A;  4UWF A;  1S64 A;  4JHK A;  4J8F A;  3KD7 A;  3N71 A;  1H2U A;  4UWK A;  4KVO A;  2ETC A;  3MYV A;  3ZUV B;  4XEI G;  2ZGD A;  2IJG X;  3FTX A;  3Q5M A;  4UQX A;  3NF1 A;  4OVV A;  4MBG A;  2LUH A;  3VLE A;  1FPP A;  4FA6 A;  4HOQ A;  3FH7 A;  4GYY A;  3S7J A;  2Y4U A;  1H2V C;  2H6F A;  1W3B A;  5AQ7 A;  4GTS A;  4ILG A;  2XS1 A;  3CIA A;  4EHM A;  3PRE A;  3UIP C;  5HKP A;  2PM6 A;  2DBA A;  3QWV A;  3FP3 A;  3IHY A;  5CEA A;  4GZ5 A;  4GTM A;  3FUE A;  4I1O B;  5ENN A;  1RZ4 A;  1JPL A;  5FIO A;  5BW8 C;  2YIN A;  3FUN A;  3SD5 A;  4BFR A;  4BTB A;  2BED A;  4LNG A;  2FO7 A;  5BUZ A;  3DSV A;  4CEM A;  2GRO B;  4H7Y A;  5KCM A;  4GTO A;  2LSV A;  3LEW A;  1MHQ A;  5HS0 A;  2RFM A;  1TNU A;  4XI0 A;  1SW6 A;  2EIM E;  3L13 A;  3URZ A;  4YDE A;  3AS5 A;  2XPI A;  4NRH B;  3TAX A;  3QJZ A;  4AY5 A;  1HZ4 A;  5FTP A;  1FCH A;  3HXC A;  5BNW A;  1TN6 A;  1NP7 A;  1ELK A;  3QAR A;  3KEA A;  1OWN A;  2GRL A;  1G3N B;  3UXG A;  3QDN A;  2BKG A;  4PS8 A;  1IKN D;  4HOU A;  4KZ0 A;  3B95 A;  1OCC E;  1HXI A;  3R7R A;  1O5M A;  3Q9N C;  2AJA A;  1JWF A;  4HVB A;  4PS7 A;  1BLX B;  3Q7F A;  4O6F A;  3CHS A;  1NA3 A;  2F0Y A;  2BUG A;  3K9I A;  1SVX A;  3G2U A;  3PZ2 A;  3LY9 A;  2XQ0 A;  1DVP A;  3L82 A;  4OVU A;  3EIQ C;  3HXD A;  1AP7 A;  2NSZ A;  2DIW A;  2CHX A;  5FQ6 A;  4AOF A;  1OXJ A;  3I3N A;  3NZU A;  2DZN A;  1FVH A;  4FU3 A;  3FUM A;  4UI9 C;  2J8S D;  4P29 A;  2VSN A;  2WXG A;  3ONK A;  4BSZ B;  3D9H A;  3TWU A;  2KBX A;  3SY2 A;  1INZ A;  4DI4 A;  4N3A A;  2DYR E;  3TWT A;  4ILH B;  3APF A;  5LP0 A;  1NFI E;  1SA4 A;  1UW4 B;  2WXK A;  2XZT G;  5FZR A;  4WNG A;  2GRQ B;  1E96 B;  5DBK A;  3BEE A;  3SZ7 A;  1JCS A;  4LNU D;  2LXL A;  1EDU A;  3JQ0 A;  4C9B B;  4J6I A;  3EHM A;  1K3Z D;  2J49 A;  3E34 A;  4A3T A;  4BT8 A;  3UX4 A;  3PRZ A;  2VTB B;  2XPY A;  1N4P A;  2QYU A;  3ISM C;  3RO2 A;  4JZY A;  3L9T A;  2CFZ A;  4JPS A;  3L54 A;  3UKR G;  2EIN E;  4WWN A;  2X6H A;  5EX0 A;  2WXP A;  3EU5 A;  3FUK A;  4U04 A;  2HYZ A;  4FJZ A;  3JCK C;  3NBN B;  1JWG A;  2WQH A;  4N5C A;  2I1K A;  3C72 A;  2LAI A;  3PE4 A;  5IY5 E;  1MX6 A;  3ULY A;  1H6O A;  3EHR A;  4ANW A;  5M72 A;  4WNF A;  4GMR A;  2KZT B;  1E7U A;  2ZIS A;  3UT8 A;  4APF A;  1IQU A;  2MHK A;  3T8K A;  2RD0 A;  4GTQ A;  3ZHE A;  2WVI A;  2R03 A;  2C0L A;  4BTA A;  3TWV A;  1HH8 A;  3E30 A;  3ZFW A;  2J4B A;  4HI8 A;  4BX8 A;  1KT0 A;  4YVQ C;  4G11 A;  5KWD A;  5ENR D;  2VSO E;  5AJL A;  3FH8 A;  2XEV A;  3GW4 A;  2IEJ A;  1ELR A;  5BT1 A;  2GRN B;  2J09 A;  2OVB A;  1JCR A;  5AYW D;  3IXE A;  4HOT A;  2DYS E;  3B7B A;  2FI7 A;  4JB8 P;  1KPS B;  3CVU A;  4CDM A;  2ZU6 B;  1D9S A;  4E85 A;  5J90 A;  3SHF A;  2EIK E;  1JCQ A;  3HHM A;  5D0Q D;  1YMP A;  3OXF A;  3APD A;  3O48 A;  3EHQ A;  3G2T A;  3ZEF A;  4Q69 A;  5FT9 A;  2QFC A;  1L5J A;  1E7V A;  4EEC A;  3CVW A;  2ETA A;  1OUV A;  3JYS A;  4GAA A;  3KSQ A;  3UMV A;  3EHN A;  1ZB1 A;  3ULE G;  1WG0 A;  3FDH A;  2IOS A;  2WXI A;  5KJM A;  1HFA A;  5CER B;  5FJY A;  3ABL E;  3ZYK A;  1A5E A;  3RU0 A;  4U63 A;  4XZ4 A;  3ZPJ A;  2H6I A;  2DCP A;  4ATZ D;  2QZA A;  3MKQ A;  1N0R A;  2L0T B;  3BU8 A;  3C98 A;  4L1B A;  2GW1 A;  4U0S A;  5JMN D;  4EZL A;  4I2W A;  4H7X A;  3CKB A;  3ML9 A;  3DXK G;  5ITZ F;  2PM7 A;  3AJI A;  2FO1 E;  4BET A;  4R7L A;  3AU5 A;  3AU4 A;  2FF4 A;  2HE0 A;  4Q94 A;  2IQC A;  2H6G A;  4Y6C A;  3ABM E;  3WXX A;  2VGX B;  5JA4 D;  3R9M A;  2PNN A;  5FQ8 A;  2GRR B;  2NC9 A;  5AAO A;  4HRM B;  4JVS A;  4JW1 A;  4ME2 A;  3ESL A;  3ASD A;  4WUY A;  2XEH A;  1K8K G;  1HG2 A;  4W9R A;  4I1M A;  2PQR A;  3Q73 A;  4LCT A;  3ONL A;  5KJL A;  4UWH A;  1PC2 A;  4KT6 B;  2IO3 C;  2Y4T A;  3UM3 A;  2UY1 A;  3LY8 A;  2M63 A;  4Y6W A;  2OCC E;  2BF0 X;  4DX1 A;  1QBQ A;  2WQ6 A;  4RVB A;  4O1P A;  4G26 A;  5BV0 A;  1LTX A;  1OY3 D;  3DEO A;  3L16 A;  2C2L A;  2F8Y A;  4ANU A;  5EYP F;  3UIN C;  3CHR A;  3P1U A;  1TR4 A;  1BI8 B;  1MX4 A;  3DEP A;  4AIF A;  1OWL A;  2OOE A;  4CDR A;  3UIO C;  3D9L A;  1DC2 A;  2VGE A;  2KM4 A;  3VTY A;  1OCR E;  5DIZ A;  5FWQ A;  4KBQ A;  5B1A E;  3QB2 A;  3L08 A;  3G2V A;  3UM0 A;  4EBA A;  3FUI A;  1H2T C;  1IYG A;  4K5C A;  4CRW A;  2I2O A;  2V5F A;  4IRU A;  3FTZ A;  1HE8 A;  4HRL A;  3IHV A;  3V2O A;  3NAW A;  2P9U G;  2V8S E;  2HR2 A;  2ETB A;  3TXM A;  4U8Y D;  3CLJ A;  3IBE A;  2XRY A;  4N5Q A;  3GZ1 A;  5KNG A;  3C3Q A;  3Q9U C;  1K1B A;  4AEZ C;  4L7T A;  4RQI A;  3ZYQ A;  4FLB A;  2L9B A;  4G23 A;  2WXH A;  3RAU A;  4JXT A;  5FZS A;  4FP7 A;  4XX5 A;  2UY1 B;  1BI7 B;  3V2X A;  3CK8 A;  2EIL E;  2FEZ A;  3TG5 A;  1TN8 A;  1X81 A;  2XGM A;  2WB2 A;  2CHW A;  3Q78 A;  1Z6T A;  2AVP A;  3RIB A;  4CZ2 D;  4WAF A;  3NOG D;  3MA5 A;  3L17 A;  2CG3 A;  4O1O A;  3AG3 E;  5KNH D;  1TEZ A;  1UN8 A;  1MJ0 A;  2KAT A;  3B7R L;  4ACK A;  4AVX A;  3DSW A;  2J07 A;  4JA7 A;  5A23 A;  4CGV A;  3FH5 A;  3CQG B;  2E0I A;  2XGS A;  4JEH A;  1EYH A;  5CRU A;  2AXU A;  3ESK A;  4GB9 A;  3GZS A;  4J8S A;  3MEK A;  3SFY A;  3LYA A;  3W9F A;  2X6I A;  2V4H C;  1N9A A;  3UTM A;  2DVW A;  3CVN A;  3AG2 E;  4N2S A;  4KMO A;  1RW2 A;  2WXF A;  2L0I A;  4DPR A;  4K03 A;  4HOS A;  3UKU G;  3FHE A;  3EUV A;  4G1T A;  2IF4 A;  2B6C A;  4EZJ A;  3IEG A;  1E90 A;  1YA0 A;  4K5A B;  3OXG A;  4O60 A;  2GGF A;  3HXB A;  2R02 A;  4QQI A;  5ENO D;  1Y8M A;  1TN7 A;  4GYO A;  4DX6 D;  1KLX A;  2I9C A;  3TWQ A;  3T5X A;  1MX2 A;  3PZ4 A;  3D9N A;  5LCW J;  4HOR A;  3ZVV A;  2WMN A;  4FJY A;  3DXM G;  4IYP A;  2R59 A;  2V0P A;  2LXM A;  3LPZ A;  3FTY A;  5C2Y A;  2JEK A;  2WMO A;  4B8C B;  4YDW A;  3HXF A;  3CVX A;  2OEW A;  3DWL G;  1NL4 A;  4LRZ A;  3RJV A;  4MLP A;  3HDX A;  4IN3 B;  4N2Q A;  3PZD A;  2GRP B;  4G2V A;  4DI3 A;  5ANL A;  4G25 A;  5ENQ D;  3CVQ A;  3LJN A;  3TWX A;  1DCE A;  3CKC A;  3C5R A;  5BV1 A;  3Q4A B;  4DJA A;  1SA5 A;  2P9P G;  3I5P A;  5JHA A;  4C48 B;  1N0Q A;  4F3V A;  3T8M A;  3FTV A;  1YCS B;  4UI9 K;  5HQ8 A;  4BSX A;  3FU0 A;  2GRM A;  1OCO E;  3O4Z A;  3E32 A;  3FUJ A;  5CEC B;  4IUL A;  5BPP A;  4NQ0 A;  3TJP A;  2WPV A;  5T3R A;  1SZ9 A;  1HS6 A;  4L2L A;  1KT1 A;  3LDZ A;  4U07 A;  3ZHE B;  3SO8 A;  3FUH A;  5CRV A;  1KZO A;  1N54 A;  2F37 A;  2XS8 A;  3NZS A;  1UOH A;  3KS2 A;  3VLF A;  2L6J A;  2H6H A;  1DNP A;  4EBA G;  2NXP A;  1Z3Y A;  4JHR A;  3MKR A;  4OYS A;  5FQ4 A;  1H6K A;  3UPV A;  4RSY A;  3FUD A;  3JUI A;  3Q79 A;  3NB2 A;  3PEV B;  4ACL A;  4BX9 A;  3FTS A;  1UJJ A;  1Q2Z A;  1D8E A;  5AAR A;  3G2S A;  2C0M A;  1BPO A;  3Q75 A;  1V54 E;  3TL5 A;  1AWC B;  2P9K G;  3RO3 A;  4URK A;  2A5E A;  3B13 A;  3UM2 A;  4DRX E;  1TNO A;  3AG4 E;  5EIL A;  3S7F A;  1EPU A;  2Y0B G;  4CYM D;  5FIN A;  2XZD G;  4U0U A;  1GW6 A;  4TXQ A;  4GA0 A;  2V4L A;  3DST A;  4FC8 A;  3SGH A;  2AXV A;  3MV3 B;  2JAB A;  3ZKJ A;  4YND A;  4MRU A;  3E37 A;  2V5Q C;  2AXZ A;  1LF8 A;  5E76 A;  4B93 B;  3NQP A;  4PUC A;  4E6H A;  4U0Z A;  2WQ7 A;  4N3C A;  1LD8 A;  3LJ3 A;  4U96 D;  4GCO A;  3ZXS A;  4JEU A;  2VSY A;  4MKT A;  5JHB A;  3LXU X;  2VTB A;  2YQ8 A;  3CHM A;  5KJN A;  4J8Y A;  4ANX A;  4K5B A;  4UQY A;  4B94 A;  4MS6 A;  2J9Q A;  4M3O A;  3MGB A;  5LCW C;  2OVF A;  2FUL A;  1MZC A;  2AW6 A;  1DCQ A;  4ILI A;  4ATG A;  3LVR E;  4FLH A;  4TRQ A;  4GML A;  3MZL B;  4YDY A;  4DLO A;  3HVE A;  2XCC A;  2A5U A;  3AS4 A;  3D9P A;  3ZYL A;  3ZRH A;  4F1P A;  1PAQ A;  4RG6 A;  4UQZ A;  3SBS A;  3T9K A;  4A63 B;  2KCV A;  4ZHB A;  3DSS A;  5G05 C;  1U2V G;  1HF8 A;  1NA0 A;  2MRI A;  3DSX A;  3Q49 B;  5HI7 A;  4DUI A;  3L6A A;  3MX3 A;  2UWJ G;  4UI9 J;  5AN8 A;  4J0U A;  3FEY A;  3I4G A;  5B1B E;  4TXR A;  3ENE A;  5D2M C;  5EKQ D;  4TUM A;  4U8H A;  1HX8 A;  5EN5 D;  5ENS D;  2EQX A;  2VYI A;  2YNQ A;  4N3B A;  4WND A;  1S63 A;  2ZIR A;  3DBS A;  3U3W A;  4ABN A;  3LKU A;  5H7P A;  3BQO A;  3J5Q B;  1TNY A;  2OV8 A;  5G2N A;  3R9A B;  4HI9 A;  3IKO B;  1YYH A;  5E75 A;  3B7S A;  4DX7 D;  3UI2 A;  2X6K A;  2R05 A;  4CT0 A;  2XEN A;  3CGH A;  4JL0 A;  2IO2 C;  1EF1 C;  1Z5S C;  1N11 A;  3ASF A;  2P9S G;  4HNA D;  3T5V A;  2WXM A;  4GZD A;  4UWG A;  2CG2 A;  5ENP D;  3ZYM A;  2ILR A;  3J5P A;  1Z3X A;  3TXN A;  3ZIM A;  3OXL A;  3ZGQ A;  3HVE B;  3CQC B;  1B89 A;  5G05 J;  1N94 A;  4XIF A;  1XGW A;  3FFL A;  3BG0 B;  3CHP A;  5CMY A;  3FU3 A;  1V55 E;  1IQR A;  3ASN E;  4HXI A;  3ML8 A;  1X5B A;  3SFZ A;  3QAQ A;  3QOU A;  4PS3 A;  4A1G A;  2XEE A;  2MOW A;  3PUJ A;  3QC1 A;  3JQ1 A;  4I9C A;  5AJD A;  5FQ7 A;  4GTT A;  3IV0 A;  2VQ2 A;  4HLE A;  2IY0 C;  1IHG A;  2R5S A;  4I2Z A;  3DPD A;  3CSF A;  1A17 A;  1N52 A;  4J8E A;  4GPM A;  4J8D A;  4I9E A;  3LS8 A;  4I6E A;  2WXO A;  4XE0 A;  4DLQ A;  4XKB A;  4B8A A;  4DX5 D;  5ARF A;  2LAH A;  1QYM A;  2A4Z A;  3CHO A;  3SF4 A;  1TNZ A;  3QNK A;  4EQF A;  1OWP A;  2EIJ E;  3CK7 A;  3APC A;  3KEZ A;  3PDN A;  4NAC A;  2YHE A;  3FU5 A;  4LER A;  2KXP C;  4AP2 A;  3DPY A;  2ZGG A;  2P9N G;  4D10 C;  4GCN A;  3UUX A;  5AIJ A;  2RKK A;  4HB5 A;  4TUU A;  3PH0 C;  1O1S A;  4U95 D;  4BY6 A;  2BTD A;  3NOC D;  1U3D A;  5JJ7 A;  3FY4 A;  4A1S A;  3JUE A;  3I4R B;  2LO6 A;  1WM5 A;  3RRU A;  3VTX A;  4BER A;  5D66 A;  1MQS A;  3RK6 A;  4GA1 A;  2ZXW E;  2Y69 E;  5AQA A;  2R2L A;  1TJF A;  3CHQ A;  4LSZ E;  3OAW A;  3ZU7 B;  3CEQ A;  4UUC A;  3ZNG A;  4TXP A;  2Y3A A;  1PY1 A;  4A3V A;  4APO A;  3TWW A;  4OAU C;  2MYO A;  2PQN A;  5B3S E;  3LY7 A;  4CGW A;  4WWP A;  3CK9 A;  4JA9 A;  5AQ9 A;  4U8V D;  4V3I A;  2VSX E;  3Q7A A;  3Q15 A;  1N4S A;  2DWZ A;  4NIK A;  5G04 J;  2WXQ A;  1LD7 A;  3BG1 B;  1D8D A;  5J08 A;  3EU9 A;  2VGY A;  3TWR A;  3F6Q A;  3UT4 A;  4AM9 A;  3ABK E;  2ION A;  1E8Y A;  4WWO A;  2J4D A;  3FTW A;  4GA2 A;  4GPK A;  3FEX A;  5A6C A;  4OAV B;  4HBD A;  4I1A A;  4TV3 A;  3S2A A;  4L9P A;  2KC7 A;  4RG9 A;  3DSU A;  4I43 A;  5T8I A;  3KAE A;  3QWP A;  4PH4 B;  5ENT D;  4ANV A;  2BKK B;  2CFU A;  4GYW A;  2PL2 A;  5AQB A;  4XI9 A;  4BEP A;  5CCM A;  3WG7 E;  3SNX A;  2XGO A;  1P5Q A;  2Y1L E;  5EDS A;  4DX2 A;  2E2E A;  3SFX A;  1SZA A;  3U66 A;  3CVY A;  1NI1 A;  5T4Y A;  4KXK B;  3D9K A;  3VLD A;  4JHJ A;  3S7B A;  3PEU B;  4M7C A;  3AS8 A;  4K0R A;  2OEV A;  3PNT B;  3E33 A;  2XPZ A;  4LUN U;  2LSU A;  2P9L G;  3TG4 A;  3V30 A;  4I6G A;  2P2C P;  3QWW A;  5D0O D;  3W9G A;  4CT4 A;  2X38 A;  3DRA A;  4PDX A;  3RRM B;  4AXH A;  4BWR A;  5LOZ A;  5FZQ A;  2Q7F A;  1OWM A;  4C0M A;  1ELW A;  1VDY A;  3PZ1 A;  4X8Q A;  3V31 A;  1QQE A;  3CV0 A;  2IFU A;  1SQM A;  3FTU A;  4EZK A;  4GZ3 A;  5EIB E;  1E8Z A;  4JD2 G;  3UM1 A;  3MCX A;  1ZBP A;  1XNF A;  4AV7 A;  1U3C A;  4J7W A;  4CDN A;  4GZC A;  3ULQ A;  1OCZ E;  2J08 A;  1S0P A;  3ZW3 A;  3UT7 A;  2WXL A;  4ZFH A;  3CVV A;  1OWO A;  4QFV A;  3SI5 A;  5AEN A;  3ASH A;  2X6F A;  1HU3 A;  5CMW A;  3X2Q E;  5HRY A;  1TYQ G;  3RRN B;  3B7U X;  4GTV A;  5JJ6 A;  3GZ2 A;  2IU1 A;  3S7D A;  2JLB A;  3CR3 A;  3TGO A;  2QY7 A;  1NZN A;  5ANR A;  5CHE E;  2WXN A;  4G24 A;  3D9J A;  4AY6 A;  1UN9 A;  3ZXP A;  2CHZ A;  3RKV A;  3UQ3 A;  5ARG A;  4JC8 A;  4KYO B; 
#chains in the Genus database with same CATH homology
 3T5V A;  2WXG A;  3ONK A;  2WXM A;  4GB9 A;  4GZD A;  3GZS A;  4J8S A;  4UWG A;  3U9W A;  3MEK A;  2IOL A;  3LCA A;  2CG2 A;  4P29 A;  5EX3 A;  3ZYM A;  2ILR A;  1INZ A;  1Z3X A;  3TXN A;  1QNF A;  3LYA A;  5LFA A;  3ZIM A;  4DI4 A;  4N3A A;  3OXL A;  3ZGQ A;  1E8X A;  3HVE B;  3CQC B;  1B89 A;  2X6I A;  4ILH B;  4B0Z A;  5G05 J;  3APF A;  4XIF A;  5LP0 A;  2X6J A;  3CVN A;  4N2S A;  4KMO A;  2WXF A;  4Q96 A;  3U64 A;  1XGW A;  1UW4 B;  2L0I A;  2WXK A;  3FFL A;  3HIZ A;  4DPR A;  5FZR A;  4K03 A;  3BG0 B;  3CHP A;  5CMY A;  3FU3 A;  4WNG A;  3D9M A;  1E96 B;  4HOS A;  5DBK A;  1IQR A;  3FHE A;  3EIJ A;  4KZC A;  3BEE A;  3GYZ A;  4HS2 A;  3SZ7 A;  4G1T A;  2IF4 A;  4HXI A;  3ML8 A;  1X5B A;  4EZJ A;  1EDU A;  3IEG A;  3ZN3 A;  1E90 A;  1YA0 A;  3QK0 A;  3SFZ A;  3JQ0 A;  3QAQ A;  3OXG A;  3QOU A;  4C9B B;  4J6I A;  4PS3 A;  3R7Q A;  4A1G A;  3EHM A;  1UJK A;  2GGF A;  2J49 A;  2MOW A;  3PUJ A;  3QC1 A;  3JQ1 A;  2P58 C;  4GMJ A;  4I9C A;  1FVF A;  1HO8 A;  5AJD A;  4A3T A;  4BT8 A;  3UX4 A;  3PRZ A;  1Y8M A;  2VTB B;  2XPY A;  4GYO A;  3L22 A;  5FQ7 A;  4HFG A;  3RO2 A;  1KLX A;  2I9C A;  4JZY A;  5A7D B;  3T5X A;  2CFZ A;  1H19 A;  2HM8 A;  3IV0 A;  2VQ2 A;  2WM9 A;  3D9N A;  3B7T A;  3Q47 B;  4JPS A;  4HLE A;  5LCW J;  4HOR A;  2OND A;  3FU6 A;  3ZVV A;  3MV2 B;  3L54 A;  1IHG A;  2WMN A;  2R5S A;  4FJY A;  3D9O A;  3EDT B;  4I2Z A;  3DPD A;  3CSF A;  1HG5 A;  1A17 A;  1N52 A;  2I1J A;  4WNE A;  4IYP A;  2R59 A;  4J8D A;  2FBN A;  4I9E A;  3LS8 A;  4I6E A;  4J8E A;  4WWN A;  2X6H A;  2WXO A;  5EX0 A;  2WXP A;  4EPZ A;  2V0P A;  4XE0 A;  3FUK A;  4U04 A;  3ASG A;  2HYZ A;  4FJZ A;  3JCK C;  2KZT A;  5G04 C;  2AWI A;  1JWG A;  2WQH A;  4N5C A;  3LPZ A;  2I1K A;  3FTY A;  2LAI A;  3PE4 A;  5C2Y A;  4ANW A;  4XKB A;  4DLQ A;  4B8A A;  2JEK A;  2WMO A;  5M72 A;  4B8C B;  4WNF A;  3CVX A;  5ARF A;  2LAH A;  3RJV A;  4LRZ A;  3MJW A;  2A4Z A;  3CHO A;  2KZT B;  3SF4 A;  1E7U A;  3UT8 A;  3QNK A;  4MLP A;  4EQF A;  4BT9 A;  1OWP A;  4APF A;  1IQU A;  3HDX A;  4IN3 B;  2MHK A;  2RD0 A;  3ZHE A;  5JJT A;  4I6J A;  2WVI A;  4N2Q A;  3PZD A;  2VGX A;  3CK7 A;  3LVQ E;  3P2B A;  2C0L A;  2X3M A;  4BTA A;  4G2V A;  3APC A;  4DI3 A;  5ANL A;  2XRZ A;  3FUL A;  3KEZ A;  3PDN A;  4G25 A;  4NAC A;  1HH8 A;  2YHE A;  3FU5 A;  4LER A;  3CVQ A;  3ZFW A;  2J4B A;  4AP2 A;  2R17 C;  3FWV A;  3PUK A;  4BX8 A;  3CKC A;  3PS6 A;  4CCA A;  2LNI A;  4D10 C;  4GCN A;  1KT0 A;  3UUX A;  5AIJ A;  2WXJ A;  4YVQ C;  4G11 A;  4TUU A;  3PH0 C;  5BV1 A;  3U4T A;  2VSO E;  5AJL A;  3FH8 A;  2XEV A;  4BY6 A;  3GW4 A;  4XKC A;  3Q4A B;  4DJA A;  2BTD A;  4UWL A;  1ELR A;  4C0E A;  5BT1 A;  3I5P A;  4NUR A;  2J09 A;  5JHA A;  1WY6 A;  4F3V A;  3T8M A;  2OVB A;  1QZ2 A;  1U3D A;  3FTV A;  3CVP A;  4FUL A;  2WXR A;  1TJC A;  5AYW D;  5JJ7 A;  3D9I A;  4UI9 K;  3D3M A;  4HOT A;  5HQ8 A;  3G2W A;  4KVM A;  3FY4 A;  2FI7 A;  2HO1 A;  5C1D A;  4A1S A;  4BSX A;  3FU0 A;  2GRM A;  2XHE A;  3I4R B;  2LO6 A;  3PE3 A;  4AJW A;  3CVU A;  4L2Y A;  1WM5 A;  3RRU A;  4CDM A;  3VTX A;  4L23 A;  3CST A;  3O4Z A;  2ZU6 B;  1MQS A;  3PNL B;  3RK6 A;  2RG8 A;  3FUJ A;  4E85 A;  4GA1 A;  3SHF A;  5J90 A;  4IUL A;  1TJF A;  5BPP A;  3HHM A;  4NQ0 A;  5D0Q D;  3CHQ A;  3TJP A;  2WPV A;  3OXF A;  3APD A;  3OAW A;  5T3R A;  3O48 A;  3CVL A;  3CEQ A;  1SZ9 A;  1HS6 A;  3G2T A;  4LEU A;  3ZEF A;  4Q69 A;  5FT9 A;  4L2L A;  2KCL A;  1KT1 A;  2QFC A;  1L5J A;  4F53 A;  5CCL A;  1E7V A;  4EEC A;  3LDZ A;  4U07 A;  2Y3A A;  1PY1 A;  3CVW A;  1Y6I A;  4A3V A;  3ZHE B;  4APO A;  1OUV A;  2PQN A;  3LY7 A;  4CGW A;  3JYS A;  4GAA A;  4GZ6 A;  2VJ8 A;  4WWP A;  4FHK A;  3UMV A;  3EHN A;  3FUH A;  3CK9 A;  3MKQ B;  1N54 A;  1UG3 A;  4JA9 A;  5G55 A;  2KCK A;  3FDH A;  1ZU2 A;  4F1S A;  5LX8 A;  3NZS A;  3SBT B;  2IOS A;  2WXI A;  5KJM A;  3FUF A;  1HFA A;  5FJY A;  2YHC A;  5KJK A;  3ZYK A;  4A55 A;  4V3I A;  3QKY A;  2VSX E;  3HYM B;  3RU0 A;  3KS2 A;  4U63 A;  4XZ4 A;  3VLF A;  3ZPJ A;  3Q15 A;  2L6J A;  2DCP A;  2I6H A;  3MKQ A;  2L0T B;  3C98 A;  1DNP A;  4L1B A;  2NXP A;  4EBA G;  2GW1 A;  4U0S A;  4DK5 A;  5G04 J;  1Z3Y A;  2WXQ A;  4JHR A;  3BG1 B;  3MKR A;  4I17 A;  4YVO A;  4OYS A;  4EZL A;  4N39 A;  4I2W A;  2PZI A;  5FQ4 A;  4FAD A;  4H7X A;  5J08 A;  3CKB A;  4F7A A;  1H6K A;  4B89 A;  3ML9 A;  3UPV A;  4RSY A;  3FUD A;  2PM7 A;  3JUI A;  2VGY A;  1E8W A;  3OTN A;  2XCB A;  4GU5 A;  4AM9 A;  3UT4 A;  4FHJ A;  3PEV B;  4ACL A;  2ION A;  1E8Y A;  4BX9 A;  3FTS A;  4R7L A;  3AU5 A;  1UJJ A;  1JUQ A;  3AU4 A;  2FF4 A;  4WWO A;  2J4D A;  1WAO 1;  3E4B A;  3EJN A;  3FTW A;  4GA2 A;  4Q94 A;  1H0A A;  3G2S A;  4GPK A;  3PVL A;  2C0M A;  1BPO A;  2IQC A;  4UWF A;  3FEX A;  4Y6C A;  3WXX A;  5A6C A;  2VGX B;  4I1A A;  1EYH A;  4TV3 A;  3TL5 A;  4JHK A;  4J8F A;  3S2A A;  3KD7 A;  5FQ8 A;  2KC7 A;  3N71 A;  1H2U A;  3RO3 A;  2NC9 A;  4URK A;  4RG9 A;  3B13 A;  4UWK A;  4I43 A;  5T8I A;  4KVO A;  4JVS A;  3KAE A;  4JW1 A;  3S7F A;  3QWP A;  1EPU A;  4ME2 A;  3MYV A;  3ESL A;  4PH4 B;  3ASD A;  4ANV A;  4WUY A;  2CFU A;  2IJG X;  3FTX A;  3Q5M A;  4U0U A;  1GW6 A;  4GYW A;  1HG2 A;  4GA0 A;  4W9R A;  2PL2 A;  4UQX A;  2V4L A;  3NF1 A;  4OVV A;  4I1M A;  2PQR A;  4XI9 A;  4FC8 A;  3SGH A;  2AXV A;  4LCT A;  3ONL A;  5KJL A;  3MV3 B;  4UWH A;  1PC2 A;  3VLE A;  5CCM A;  4KT6 B;  4HOQ A;  4FA6 A;  3SNX A;  2XGO A;  1P5Q A;  4YND A;  3FH7 A;  4GYY A;  2Y4T A;  4MRU A;  5EDS A;  2UY1 A;  3S7J A;  3LY8 A;  2AXZ A;  2Y4U A;  1LF8 A;  2M63 A;  2E2E A;  1H2V C;  5E76 A;  4Y6W A;  3NQP A;  2BF0 X;  4PUC A;  2WQ6 A;  1W3B A;  1SZA A;  4ILG A;  4JEH A;  4E6H A;  3U66 A;  3CVY A;  4U0Z A;  2WQ7 A;  4RVB A;  3CIA A;  4N3C A;  3PRE A;  5T4Y A;  3LJ3 A;  4KXK B;  3D9K A;  2PM6 A;  4G26 A;  3VLD A;  5BV0 A;  4GCO A;  3ZXS A;  4JEU A;  2VSY A;  4MKT A;  2DBA A;  3LXU X;  3QWV A;  4JHJ A;  5JHB A;  2VTB A;  2YQ8 A;  3CHM A;  3FP3 A;  5KJN A;  3IHY A;  3L16 A;  4ANX A;  2C2L A;  3S7B A;  4GZ5 A;  3PEU B;  3FUE A;  4UQY A;  4I1O B;  4ANU A;  5ENN A;  3AS8 A;  4B94 A;  1JPL A;  5BW8 C;  4K0R A;  4MS6 A;  2YIN A;  2J9Q A;  3CHR A;  3PNT B;  4M3O A;  3FUN A;  3P1U A;  3SD5 A;  3MGB A;  5LCW C;  2XPZ A;  4LUN U;  2LSU A;  2OVF A;  2FUL A;  4BFR A;  4BTB A;  4AIF A;  2AW6 A;  3TG4 A;  1OWL A;  2OOE A;  4CDR A;  4I6G A;  3D9L A;  3QWW A;  5D0O D;  4CT4 A;  4ILI A;  2X38 A;  2FO7 A;  4PDX A;  5BUZ A;  3RRM B;  4ATG A;  2KM4 A;  3LVR E;  4CEM A;  4FLH A;  4TRQ A;  4GML A;  4H7Y A;  3VTY A;  5DIZ A;  4AXH A;  5KCM A;  2LSV A;  3MZL B;  5FWQ A;  3LEW A;  4KBQ A;  5LOZ A;  5FZQ A;  1MHQ A;  2Q7F A;  4BWR A;  4DLO A;  1OWM A;  3QB2 A;  3L08 A;  4C0M A;  3G2V A;  3HVE A;  1ELW A;  1VDY A;  3FUI A;  4XI0 A;  2XCC A;  4EBA A;  1H2T C;  3L13 A;  3URZ A;  2A5U A;  3AS4 A;  1IYG A;  3D9P A;  3ZYL A;  3ZRH A;  1QQE A;  4CRW A;  2I2O A;  3AS5 A;  2V5F A;  2XPI A;  3CV0 A;  2IFU A;  1SQM A;  4NRH B;  3FTU A;  1PAQ A;  4EZK A;  4IRU A;  3TAX A;  3FTZ A;  4GZ3 A;  4RG6 A;  3QJZ A;  1E8Z A;  1HE8 A;  3IHV A;  4AY5 A;  1HZ4 A;  3MCX A;  5FTP A;  1FCH A;  1ZBP A;  4UQZ A;  3SBS A;  2KCV A;  1XNF A;  5BNW A;  1NP7 A;  1ELK A;  4AV7 A;  3QAR A;  1U3C A;  5G05 C;  4CDN A;  2V8S E;  2HR2 A;  4GZC A;  1OWN A;  3ULQ A;  2GRL A;  3TXM A;  3CLJ A;  3IBE A;  2J08 A;  1HF8 A;  1NA0 A;  2MRI A;  3QDN A;  3Q49 B;  5HI7 A;  3L6A A;  2XRY A;  1S0P A;  2UWJ G;  3GZ1 A;  3MX3 A;  4UI9 J;  3ZW3 A;  4PS8 A;  4J0U A;  4HOU A;  3UT7 A;  4KZ0 A;  2WXL A;  3FEY A;  4AEZ C;  4L7T A;  1HXI A;  3I4G A;  3R7R A;  3ZYQ A;  4FLB A;  2L9B A;  4G23 A;  3CVV A;  1OWO A;  3ENE A;  4QFV A;  3SI5 A;  1JWF A;  4HVB A;  2WXH A;  4JXT A;  5FZS A;  5AEN A;  4PS7 A;  3ASH A;  5EKQ D;  4U8H A;  2X6F A;  1HU3 A;  1HX8 A;  4FP7 A;  5CMW A;  4XX5 A;  2VYI A;  2EQX A;  2YNQ A;  4N3B A;  2UY1 B;  3CHS A;  4O6F A;  3RRN B;  3B7U X;  1NA3 A;  3CK8 A;  2BUG A;  4WND A;  2FEZ A;  5JJ6 A;  3DBS A;  3U3W A;  3K9I A;  3TG5 A;  3G2U A;  3GZ2 A;  2IU1 A;  3S7D A;  2JLB A;  4ABN A;  3LKU A;  2XGM A;  2WB2 A;  2CHW A;  3LY9 A;  1Z6T A;  2OV8 A;  2XQ0 A;  1DVP A;  3CR3 A;  3TGO A;  5G2N A;  4OVU A;  2QY7 A;  3EIQ C;  3R9A B;  1NZN A;  5ANR A;  3IKO B;  2AVP A;  2NSZ A;  3RIB A;  4WAF A;  2DIW A;  5CHE E;  5E75 A;  2CHX A;  5FQ6 A;  3MA5 A;  4AOF A;  3L17 A;  2CG3 A;  2WXN A;  3I3N A;  3NZU A;  4G24 A;  1TEZ A;  3B7S A;  3D9J A;  4AY6 A;  1UN8 A;  1UN9 A;  2KAT A;  3B7R L;  4ACK A;  1FVH A;  2CHZ A;  4FU3 A;  3RKV A;  3UQ3 A;  3FUM A;  4UI9 C;  2X6K A;  4AVX A;  4JA7 A;  2J07 A;  5ARG A;  5A23 A;  4CGV A;  3FH5 A;  4JC8 A;  3CGH A;  4JL0 A;  3CQG B;  4CT0 A;  1EF1 C;  2E0I A;  2XGS A;  3ASF A;  4KYO B;  2AXU A;  2VSN A;  3ESK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...