5AYWD

Structure of a membrane complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
212
Chain Sequence
GSKEEVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the BAM complex and its implications for biogenesis of outer-membrane proteins
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Membrane protein
molecule keywords Outer membrane protein assembly factor BamA
total genus 73
structure length 212
sequence length 222
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5aywD00
3N71A 2YQ8A 5CCMA 3GYZA 4AIFA 1QZ2A 2FEZA 4EQFA 1Y8MA 3RJVA 3MV2B 5CHEE 5G04J 5G05J 4I9EA 2GW1A 3RU0A 3S7JA 5M72A 1OUVA 2DBAA 2LNIA 3CV0A 2XCCA 5EKQD 2HO1A 3TG5A 4B94A 2YHCA 5LCWC 1XNFA 4GA0A 2XGOA 4GA1A 3U3WA 3QWWA 5A6CA 3OXFA 4UI9C 4ABNA 4CDRA 4G1TA 3UQ3A 5CCLA 3UUXA 3BEEA 3CKCA 1NA3A 3GZ1A 3O48A 4GPKA 3E4BA 3URZA 3FFLA 4WNDA 1HZ4A 2Y4UA 3QOUA 4N39A 4Y6CA 3ZFWA 3ZPJA 3CK7A 3PE4A 3Q47B 2QFCA 4J8DA 3S7BA 4J0UA 3LY9A 4GCNA 4UQZA 4WNGA 2BUGA 2KC7A 1WAO1 1HXIA 3FWVA 3CKBA 4G23A 4HOUA 5DBKA 3QDNA 3S7FA 3TAXA 3S7DA 1HH8A 3ASGA 4KBQA 3Q15A 3GZ2A 4G24A 4J8FA 4KYOB 2XGSA 2LSVA 1KT0A 4O6FA 4WNEA 4XI0A 4HORA 4I9CA 5FZRA 4CGWA 5G05C 2J9QA 2KCLA 3SZ7A 4YVOA 2C0LA 2VQ2A 3WXXA 2FI7A 2VGXA 4AM9A 1PC2A 2UY1A 2UWJG 2PZIA 4GZ3A 2WPVA 5ARGA 3AS8A 5A7DB 5JJ6A 2Y4TA 3R9AB 4BWRA 2FBNA 4N5CA 4U07A 3UPVA 2VGXB 4CGVA 2UY1B 3ASFA 4U0UA 2AVPA 2L6JA 3AS4A 4GA2A 4ME2A 5JJ7A 2C2LA 4AY6A 1IYGA 4N3CA 3AS5A 5KJLA 4YVQC 1B89A 2C0MA 1YA0A 4KXKB 4XIFA 4N3AA 5D0QD 5EX3A 5KJNA 4G26A 3CVLA 3K9IA 4I2ZA 2KCVA 1FCHA 4JA7A 4U04A 2HR2A 5G04C 2E2EA 2MHKA 4JL0A 3MV3B 3MEKA 2VGYA 4RG6A 2VSNA 1ELWA 4GCOA 3KAEA 4N3BA 2ONDA 1QQEA 3CVNA 5DIZA 4BT8A 4BT9A 4YNDA 5C1DA 2WQHA 4N2SA 3KS2A 3PDNA 4UQXA 4UQYA 4W9RA 3ASHA 3IEGA 1ELRA 3CVPA 4GYOA 4I1AA 4JHRA 4LEUA 3LKUA 4H7YA 5ARFA 4GZ6A 5BW8C 3TG4A 3RO3A 3Q49B 3MA5A 1IHGA 3Q5MA 3OXLA 4G25A 3VTXA 4WUYA 1P5QA 1W3BA 3LYAA 4AY5A 2PQRA 2HYZA 3MKRA 3LCAA 5D0OD 5EX0A 4N2QA 2PL2A 3LPZA 4NRHB 1KLXA 3ULQA 1KT1A 2IF4A 2Q7FA 4Y6WA 2KCKA 4RG9A 3SF4A 3ZHEB 1ZU2A 4NQ0A 4HOSA 4HOTA 2NC9A 3GW4A 4BTBA 4BTAA 3NF1A 4H7XA 3CK8A 3OXGA 2FO7A 1E96B 2XCBA 3QWVA 4I2WA 3ASDA 5AYWD 4APOA 3LY8A 3ZN3A 3U4TA 5HQ8A 4J8EA 2JLBA 3PE3A 4UI9K 3RIBA 4WNFA 5LCWJ 1NA0A 5FZQA 3ESKA 5BNWA 2FF4A 4XI9A 3CEQA 3RKVA 5HI7A 5KJMA 2XPIA 3HYMB 3FP3A 4UI9J 5FT9A 3Q4AB 3KD7A 4GYYA 1A17A 3QKYA 4HOQA 4F3VA 4GYWA 2VSYA 1TJCA 2PQNA 4GZ5A 4JA9A 4U0SA 3RO2A 5BT1A 3TGOA 3ZHEA 5KJKA 1WM5A 2KATA 2I6HA 4G2VA 2VYIA 3CK9A 3QWPA 4U0ZA 5FTPA 5FZSA 3VTYA 5JJTA 2OOEA 1ZBPA 3CVQA 3ZGQA 1NZNA 4A1SA 3LY7A 2R5SA 4I17A 2P58C 3JYSA 2IFUA 2XGMA 2LSUA 3EDTB 2XEVA 2V5FA 5FJYA 4IN3B
chains in the Genus database with same CATH superfamily
4DI3A 3PS6A 2OEWA 4I6EA 2LO6A 2PM7A 1OUVA 2DBAA 4XX5A 3Q78A 2XCCA 4EZKA 2CHZA 3ZKJA 3DEPA 3ZYQA 2H6FA 2EINE 2RG8A 3CKCA 2PM6A 2BKKB 2AW6A 3PZ4A 3UM3A 1TYQG 4N39A 4CT4A 2FULA 4UQZA 2KC7A 1AP7A 5DBKA 4C48B 5KJMA 1KT0A 3FUFA 4CGWA 1TJFA 5JHBA 2XEHA 2WXMA 3GZSA 5CEDB 3DPYA 4U0UA 4MRUA 1HO8A 5HRYA 3DWLG 4KXKB 3CVWA 1E8YA 4N3AA 3PNTB 4HLEA 2BEDA 2WXPA 3AU4A 4U04A 1H6PA 3UXGA 1BI8B 5CRUA 3V2XA 4IRUA 4ZHBA 3ZRHA 3TG4A 5ARFA 1KZPA 3BG1B 4KMOA 4G25A 4J8YA 1D8EA 3R7RA 2I9CA 3FUIA 1KLXA 3FUJA 4AEZC 2XZDG 4JEHA 1G3NB 4CYMD 4E85A 2WXKA 4HRNA 4ZFHA 3RIBA 1TNBA 3FTUA 1TNOA 1OT8A 3ESKA 2KZTA 5HS0A 2P9UG 4CZ2D 4UI9J 1BI7B 3Q4AB 4GTMA 2WXLA 1TN6A 4GAAA 3APFA 2EQXA 2QYUA 1SW6A 1ZBPA 3CHRA 2CG2A 3LY7A 1QNFA 5LOZA 4AOFA 5FJYA 2J49A 1E8XA 4I6GA 1UJJA 2LNIA 3SFYA 5EKQD 3EHRA 4B94A 3CLJA 3NZUA 3J5PA 3MZLB 3HVEB 4WWPA 3SO8A 4N5QA 3LY9A 4Q69A 4BEPA 4GMJA 4WNEA 4E6HA 5EIDA 1H2TC 3SZ7A 2VGXA 1V55E 4MBGA 3SNXA 2Y4TA 4HRLA 2VGXB 3AU5A 3V79K 4G26A 4MKTA 3HVEA 3SQVA 5AENA 2WXHA 4GCOA 3CHQA 3SFZA 2X6HA 4BT8A 3EIQC 4L9PA 1ELRA 3TWUA 4H7YA 1FVHA 3QB2A 5KWDA 3VTXA 4FLBA 3OAWA 4JB8P 3PZ3A 4L1BA 3EUVA 3ISMC 3CIAA 2Q7FA 4RG9A 3HHMA 2XS8A 1TNYA 4G11A 4BTBA 1Z5SC 3RRMB 3U4TA 3LS8A 4GZDA 2BTDA 4JPSA 4F1SA 2Y3AA 2R2LA 1K1AA 3TXMA 3VLDA 3MGBA 3WG7E 2JEKA 2XEVA 5AQAA 1JCQA 3RJVA 4X8QA 5G05J 3BG0B 3FHEA 4YDWA 2CHWA 3NOGD 4JEUA 1NFIE 4DI4A 3IKOB 4TUMA 3SHFA 4RVBA 3P1UA 4OYSA 1SZAA 4BT9A 3DPDA 1HU3A 1Z3XA 4HOUA 5G55A 4TV3A 4I9CA 5ARGA 3CVYA 4LSZE 1AWCB 3QJZA 2GRPB 4F6RD 1ELKA 1N11A 3IHYA 1O1RA 4B8AA 1H2UA 1OWMA 3CVNA 3ESLA 3VLEA 2NSZA 3IEGA 3LJ3A 4UWKA 1S63A 3PREA 2KXPC 3TWWA 1N54A 3DRAA 3KSLA 2DWZA 1ZU2A 2DZOA 4AP2A 4URKA 3ZN3A 2V4LA 3CEQA 3NAWA 3FH8A 4EZJA 3QNKA 4GTQA 3NB2A 5FQ7A 2EIJE 2P9NG 3FU0A 2VYIA 3CVQA 3NQPA 2Y1LE 2XPYA 2LUHA 3R9MA 2DCPA 4AIFA 4I9EA 1NP7A 5M72A 3ULYA 3EU9A 3IXEA 5LFAA 2YHCA 3JXIA 2WXJA 2RKKA 3CVXA 3X2QE 3BEEA 3L6AA 3JQ0A 2Y4UA 3V2OA 4GCNA 4O6FA 3PNLB 4XEIG 2IONA 4A63B 3RRUA 4GB9A 2UY1A 2GRMA 3FTZA 4LNBA 1MX4A 1UW4B 2F8YA 1FT1A 4ANVA 4A1GA 3SI5A 2KCVA 1FCHA 3D9JA 4KVMA 3KAEA 3ZYLA 2V5QC 3UT4A 3G2VA 3LKUA 3HG0D 3FUDA 2P2CP 5D0OD 3DSSA 4YDEA 2PL2A 3Q75A 5E75A 4YDYA 3B7RL 4I2WA 1HG5A 2R05A 2NXPA 5AYWD 2JLBA 4UI9K 1Z6TA 2XRYA 5BNWA 2WM9A 5HI7A 1BD8A 5FT9A 3D9NA 3D9PA 5BT1A 4FC8A 4G2VA 4U0ZA 5T4YA 5FTPA 4A1SA 2R5SA 5HKPA 3UM1A 3RU0A 4FA6A 3PEVB 3CSTA 4K0RA 1JCRA 1LD8A 5J08A 3C3OA 2XPZA 2J08A 3Q79A 4I1MA 3PZDA 4PS8A 2VTBB 4JD2G 4Q96A 3UQ3A 3GZ1A 4XE0A 4FP7A 3QOUA 3E34A 2X6IA 3Q47B 2QFCA 4OAUC 5LX8A 4DRXE 3GZ2A 5CBNA 3ZEFA 4AM9A 4GZ3A 3L9TA 5JJ6A 4L23A 3MKQB 4GTOA 3AS5A 2XZTG 3CVLA 3K9IA 2J8SD 2X3MA 2V4HC 4EPZA 1YYHA 2ONDA 1QQEA 4FHKA 4IULA 3ASHA 2L0IA 3EU5A 2EILE 4JW1A 3RO3A 4NURA 1RW2A 4C9BB 2MYOA 2A4ZA 3U66A 1LF8A 1Q2ZA 3L08A 4K03A 3TJPA 4Q94A 1DC2A 5BXUA 4RQIA 5ENTD 4J8EA 4WNFA 4DPRA 2R03A 3AG3E 4HRMB 1IQUA 4JA9A 3ABKE 3ENEA 3T5VA 4BY6A 4K5AB 3CVPA 4P29A 2VGEA 2QYJA 2HM8A 3E30A 4BERA 4GA1A 1N52A 5A6CA 4PDXA 3B7TA 5CCLA 1NA3A 4HXIA 4GPKA 1WAO1 3CHOA 4XKCA 1SZ9A 3MYVA 4J8FA 2KCLA 1OCCE 3R9AB 4N5CA 3UPVA 4ILHB 3FTWA 4AY6A 5KJLA 2XS1A 5AQ7A 3FUKA 5KJNA 3TXNA 1JCSA 1N4QA 3J5QB 4MLPA 2KZTB 2CG3A 1MHQA 3RRNB 4XKBA 5AQ9A 3LJNA 3ONLA 4UUCA 2IOSA 3SBSA 3Q49B 1DCEA 3UIOC 3MKRA 3CGHA 2ETBA 4UWHA 4DX6D 2XQ0A 2I1JA 3D3MA 1SA5A 3DBSA 5LCWJ 2L6BA 4L2YA 4C0EA 2P9PG 3RO2A 3AAAC 3HXDA 1O5MA 3UTMA 2VTBA 4GMRA 2XGMA 3FH7A 4EQFA 3G2WA 1UG3A 1K1BA 3LXUX 2WXIA 3UUXA 4BX8A 1HS6A 2F37A 4WNDA 1HZ4A 2MOWA 5G2NA 4ACLA 4A55A 4DX5D 2YINA 5ITZF 2ETCA 3B95A 2DIWA 4J7WA 2J9QA 3MKQA 1OCRE 2PZIA 1L5JA 1TN8A 2UY1B 4ILGA 3ABLE 3E33A 1N4PA 4A3VA 3I4GA 4GTRA 3PZ2A 4N3BA 3UM0A 4EBAG 4W9RA 4UQYA 2ZU6B 2IY0C 3FTVA 3R7QA 5ENNA 4AJWA 2FO1E 1OCOE 4GMLA 3FUEA 5EYLA 4GTTA 5EX0A 3APDA 4N2QA 2IF4A 2CFZA 1HF8A 4LERA 2LAHA 3ASDA 3LY8A 3RAUA 5J90A 3HIZA 4XI9A 2XPIA 3FP3A 4QQIA 2DYSE 1UJKA 3QKYA 2VSYA 2PQNA 5B1BE 4NIKA 3CHMA 4DLQA 3DXKG 4UWLA 1HFAA 4AV7A 2V5FA 2ZGDA 2ZIRA 3AG1E 1Y8MA 5KCMA 2GRNB 2P9LG 4L7TA 4ANWA 5JA4D 2OEVA 3CQCB 3JUIA 1KZOA 3FFLA 4HOSA 3ZFWA 2JABA 3UT7A 3S7FA 3Q73A 4QFVA 3T8MA 3EJNA 2PNNA 2WPVA 3E32A 2GGFA 2FBNA 5IY5E 3UM2A 3B7UX 4ME2A 1YA0A 2XEEA 3EHQA 4I1OB 3IHVA 2F8XK 2IO3C 4AXHA 5G04C 2MHKA 1E7UA 5FQ4A 4KT6B 4PH4B 3CQGB 5AN8A 4UQXA 1S0PA 3UKUG 5BW8C 2YNQA 4MS6A 1MJ0A 3ZNGA 3LCAA 3T5XA 2RD0A 4WWNA 1H2VC 3CK8A 2DYRE 4CRWA 1PY1A 1TEZA 3F6QA 1WM5A 4A3TA 2QY7A 2P58C 1JUQA 3N71A 2F0YA 2FEZA 3C3RA 3RK6A 5CHEE 5G04J 1U2VG 4OVVA 2HE0A 4GPMA 4HI9A 3C3QA 4BESA 3UT8A 3ASOE 3NOCD 3QDNA 1HH8A 1U3CA 3ML8A 3ZW3A 3MJWA 3G2UA 1V54E 4PUCA 4F1PA 4WWOA 3TWRA 1K3ZD 1OY3D 1IYGA 4NACA 3W9GA 2R59A 2VGYA 4RG6A 5D66A 4JHRA 2X6JA 3UX4A 3P2BA 2V8SE 1WG0A 4AY5A 3MCXA 4NQ0A 2CFUA 5AJLA 4HOTA 1D8DA 2RFMA 4JXTA 3QWVA 4APOA 1NA0A 3HXEA 3VLFA 4BETA 2LXMA 1ZB1A 1Z3YA 1A5EA 3KD7A 2P9SG 4TXQA 4F3VA 2KATA 2VSXE 3FU3A 3PUKA 4M3OA 5EIBE 2B6CA 1NZNA 3CR3A 5FQ8A 1DCQA 2IFUA 2VSOE 1QZ2A 4CT0A 4JC8A 5FQ6A 4LNGA 3L54A 1MYOA 3ZYMA 3TG5A 2GROB 4ACKA 2XGOA 5BV1A 3CHPA 4ABNA 4CDRA 4ANXA 1XGWA 5AQBA 1SA4A 1OWPA 3ZXPA 5ANRA 2XGSA 3PUJA 3CVVA 1UN9A 3UIPC 1SQMA 2VQ2A 2FI7A 1WY6A 4U63A 3AS8A 3B13A 3DSVA 2I1KA 4CGVA 2ILRA 3LDZA 2AVPA 4ILIA 1Y6IA 2E2EA 3O4ZA 3C5RA 5EILA 4N2SA 2X6FA 3MA5A 2NYJA 1IHGA 3OXLA 1EYHA 3CHSA 3FU6A 1P5QA 1W3BA 1U3DA 4NRHB 3ULQA 1GW6A 3B7BA 4JHJA 2BF0X 2OVBA 3NF1A 2XCBA 5BV0A 3PE3A 1E90A 3HXBA 2QC9A 4Z68A 1A17A 2V0PA 2WXOA 3I5PA 3SFXA 3CK9A 3QWPA 2WQ7A 3PRZA 5B1AE 1FT2A 2LSUA 2YQ8A 2GW1A 3JXJA 3C72A 3CV0A 2HO1A 3ULEG 1IQRA 4UI9C 2H6HA 1H0AA 1X81A 3CK7A 3JUEA 5CMYA 5EYPF 4B93B 3HDXA 2BUGA 3PH0C 1MQSA 3L13A 4KZ0A 4IYPA 4KBQA 4G24A 1UN8A 3BUAA 1S70B 3FH5A 4TRQA 3JQ1A 1PC2A 1H6OA 3QC1A 4U07A 1TN7A 4FLHA 4DUIA 5CECB 4CEMA 2C2LA 5CRVA 1N95A 4JA7A 4GTPA 5H7PA 4GZCA 1PAQA 4JL0A 3MEKA 2H6IA 4FJYA 1O1SA 4HNAD 4UWGA 2LXLA 1MX6A 2ETAA 3UI2A 4YNDA 3TWVA 4APFA 3S7BA 4FULA 3T9KA 3U9WA 2IU1A 1DVPA 3LPZA 4KZCA 2EIKE 4O1PA 4DX1A 4DJAA 2ZXWE 2FO7A 3BQOA 4GU5A 4G8KA 4ATGA 4CDMA 3RKVA 4GYYA 3FTXA 4JHKA 4GZ5A 3ZHEA 4DK5A 3AG2E 4YDOA 1QYMA 5LP0A 4K5BA 3EIJA 4PS7A 1YMPA 2WXNA 3ZVVA 3ZYKA 2R17C 4U8YD 2YHEA 1FPPA 3G2TA 3ML9A 5DIZA 2WMOA 1OWOA 4U96D 3MX3A 3ASGA 2KBXA 5KBAA 5FZRA 2XENA 3PZ1A 2OV8A 5G05C 5B3SE 3EHNA 4BSZB 3WXXA 2GRLA 2UWJG 5A7DB 5FIOA 4EBAA 2E0IA 2L6JA 5JJ7A 2IOLA 4YVQC 4ANUA 5EX3A 5BUZA 3DSXA 1BPOA 5CERB 2VJ8A 3MV3B 4EZLA 3UMVA 4B8CB 3V31A 2WQHA 4BTAA 4GYOA 1LTXA 3TWXA 3V30A 2WMNA 4HBDA 2PQRA 2HYZA 3HXFA 5CMWA 3BU8A 4Y6WA 3PEUB 4B89A 1N9AA 2WXQA 3G2SA 4CDNA 3QAQA 4H7XA 3D9HA 5HQ8A 2IJGX 4O60A 4JZYA 1JWGA 3FU5A 4CCAA 3I4RB 4DLOA 2J07A 3KEAA 2MRIA 1D9SA 4BX9A 1WDYA 5AIJA 4RSYA 3E37A 1OWLA 3MV2B 2IEJA 3KEZA 4FJZA 3D9OA 4GTVA 1XNFA 1JPLA 4KVOA 1TR4A 4V3IA 3TWQA 1HE8A 4BWRA 4Y6CA 1E8WA 2P9KG 4J0UA 2X38A 4U8VD 1N0QA 3EHMA 3OTNA 5AARA 4HB5A 2AXUA 1EDUA 3SBTB 4EHMA 4OAVB 4U7EB 3LVRE 3Q9NC 2AXVA 1TNZA 1SVXA 5ENRD 3NZSA 4TXPA 5AJDA 4N3CA 5D0QD 4XIFA 3UINC 4AVXA 4I2ZA 2AXZA 4HS2A 2GRRB 3FY4A 1ELWA 3FUMA 3DSTA 1OCZE 5C1DA 4HFGA 3SD5A 5CBOA 4BFRA 1RZ4A 2XRZA 5BPPA 2IQCA 4HVBA 1E8ZA 3ZHEB 2NC9A 4PS3A 2I2OA 5BXOA 1E96B 4LG6A 1INZA 2B0OE 2RFAA 5FZQA 1O1TA 4HOQA 1MZCA 4GYWA 1TJCA 3FTSA 2WXRA 1BLXB 2OOEA 4K5CA 3B7SA 4DX2A 5JMND 3ONKA 2WQ6A 5CCMA 3GYZA 4O1OA 2H6GA 4FADA 4HQDA 1N4SA 5C2YA 3L82A 3SGHA 1DNPA 2KM4A 3PE4A 5JHAA 3FULA 1S64A 2WXFA 2P9IG 3NBNB 3D9IA 2AJAA 2LSVA 4XI0A 1N4RA 3Q7FA 3HXCA 4TXRA 2CHXA 2ZISA 3QARA 3ASFA 4I43A 4C0MA 4U95D 5AAOA 2C0MA 1YCSB 3IBEA 3CSFA 4B0ZA 4D10C 4HI8A 4FU3A 3ZUVB 5CEAA 1EPUA 4XZ4A 3D9KA 3T8KA 4WUYA 4DX7D 1X5BA 5EDSA 3SF4A 3ZXSA 3GW4A 3FDHA 3I3NA 3ABME 4WAFA 3DXMG 3AG4E 1BU9A 3HYMB 2ZGGA 2I6HA 3VTYA 2EIME 3TWSA 3ZGQA 3JYSA 5FINA 3S7JA 2L9BA 3FUNA 3RSEG 2Y69E 4OVUA 2BKGA 3QK0A 3TL5A 3O48A 3E4BA 4ATZD 2LAIA 1N94A 2OVFA 4WNGA 3FWVA 1HXIA 1UOHA 2J09A 3TAXA 2WB2A 4F7AA 3S7DA 3JCKC 3Q15A 3CVUA 3UKRG 4KYOB 3ASNE 3LEWA 2C0LA 4YVOA 5ENSD 2J4BA 4F53A 2A5EA 2XHEA 1TNUA 2L0TB 4JVSA 1NL4A 4J6IA 5ENQD 2J4DA 2A5UA 3AS4A 4GA2A 4LRZA 5EN5D 1B89A 4M7CA 4G8LA 4RLYA 1MX2A 4TUUA 3HRAA 4LEUA 4I1AA 4GTSA 4GZ6A 3SY2A 5A23A 3Q5MA 4UWFA 1EF1C 5ANLA 2WVIA 2KCKA 1LD7A 4BSXA 1OXJA 1VDYA 3U64A 4HLLA 1E7VA 3OXGA 3FTYA 3TGOA 1HG2A 4J8SA 3L22A 1N0RA 5ENOD 1QBQA 2FF4A 3AJIA 3D9MA 3D9LA 3ZU7B 3LVQE 2M63A 4U0SA 5ENPD 3Q9UC 1IKND 3DSUA 4U8HA 2IO2C 1FVFA 1H6KA 5T8IA 3EDTB 4IN3B 3W9FA 3DEOA 4LUNU 5LCWC 4GA0A 3U3WA 3L16A 3C98A 3QWWA 3OXFA 4G1TA 1K8KG 3Q7AA 3URZA 2OCCE 4L2LA 3ZPJA 3ZIMA 2DZNA 4J8DA 5E76A 3FEXA 4G23A 3CKBA 3S2AA 4HORA 3L17A 1JWFA 4I6JA 3PVLA 5FWQA 4LCTA 3TWTA 3FUHA 1NI1A 3APCA 1IXVA 2R02A 2HR2A 2GRQB 2VSNA 3DSWA 4FHJA 2AWIA 3KS2A 3PDNA 4LNUD 4R7LA 1KPSB 5KNHD 2QZAA 1IHBA 3LYAA 5KNGA 2X6KA 1KT1A 1HX8A 2DVWA 3FEYA 5D2MC 5T3RA 3KSQA 1H19A 4EECA 3IV0A 5KJKA 5FZSA 2Y0BG 1OWNA 5JJTA 4I17A 2WXGA
chains in the Genus database with same CATH topology
3N71A 4DI3A 2FEZA 3PS6A 3RK6A 3MV2B 5CHEE 3PEVB 5G04J 3RU0A 4FA6A 4I6EA 2LO6A 2PM7A 1OUVA 2DBAA 3KEZA 4XX5A 3CSTA 4FJZA 4K0RA 2XCCA 3D9OA 5J08A 4EZKA 1XNFA 2CHZA 4OVVA 2XPZA 2J08A 4I1MA 3ZYQA 3PZDA 1JPLA 4PS8A 2VTBB 4KVOA 2RG8A 4Q96A 4V3IA 3UQ3A 3CKCA 3GZ1A 2PM6A 2AW6A 1HE8A 4XE0A 4FP7A 3UT8A 4BWRA 3QOUA 4N39A 4Y6CA 4CT4A 1E8WA 2X6IA 3Q47B 2FULA 2QFCA 4J0UA 2X38A 4UQZA 2KC7A 5DBKA 3EHMA 3OTNA 3QDNA 5LX8A 1HH8A 1U3CA 3ML8A 3ZW3A 2AXUA 1EDUA 3GZ2A 3MJWA 3SBTB 5KJMA 1KT0A 3G2UA 3FUFA 3LVRE 4PUCA 4CGWA 1TJFA 2AXVA 3ZEFA 4AM9A 5JHBA 4GZ3A 5JJ6A 4WWOA 4L23A 2WXMA 3GZSA 3MKQB 3NZSA 4U0UA 4MRUA 5AJDA 1HO8A 1IYGA 4N3CA 3AS5A 4KXKB 5D0QD 1E8YA 4NACA 4N3AA 3PNTB 4XIFA 4AVXA 4HLEA 3CVWA 3CVLA 3K9IA 4I2ZA 2AXZA 2WXPA 3AU4A 4U04A 2R59A 4HS2A 2X3MA 2VGYA 4RG6A 3FY4A 4EPZA 1ELWA 3FUMA 2ONDA 1QQEA 4FHKA 4IRUA 5C1DA 4IULA 3ZRHA 3ASHA 2L0IA 4HFGA 4JHRA 3TG4A 5ARFA 3SD5A 2X6JA 4JW1A 3RO3A 3BG1B 4KMOA 4BFRA 4G25A 3UX4A 3P2BA 2V8SE 4NURA 2XRZA 5BPPA 2IQCA 4AY5A 4HVBA 3R7RA 3MCXA 2I9CA 4C9BB 3FUIA 1E8ZA 1KLXA 1LF8A 2A4ZA 3U66A 3FUJA 4AEZC 3L08A 4K03A 3TJPA 3ZHEB 4NQ0A 4Q94A 2CFUA 5AJLA 4HOTA 2NC9A 4JEHA 4PS3A 2I2OA 4JXTA 4E85A 1E96B 3QWVA 2WXKA 4APOA 4J8EA 3RIBA 1INZA 4WNFA 4DPRA 3FTUA 1NA0A 5FZQA 3ESKA 2KZTA 3VLFA 1Z3YA 4UI9J 3Q4AB 3KD7A 4HOQA 1IQUA 2WXLA 4GYWA 4F3VA 1TJCA 3FTSA 4JA9A 2WXRA 3ENEA 2KATA 2VSXE 3FU3A 3PUKA 4GAAA 4M3OA 3APFA 2EQXA 3T5VA 2OOEA 1ZBPA 3CHRA 1NZNA 3CR3A 2CG2A 3B7SA 1QNFA 3LY7A 5FQ8A 4BY6A 5LOZA 2IFUA 3CVPA 2VSOE 4P29A 4AOFA 3ONKA 2J49A 5FJYA 2WQ6A 5CCMA 1E8XA 3GYZA 1QZ2A 4I6GA 4CT0A 4JC8A 5FQ6A 2HM8A 1UJJA 2LNIA 3L54A 5EKQD 4FADA 3ZYMA 3TG5A 4B94A 3CLJA 4ACKA 3NZUA 2XGOA 1N52A 4GA1A 5C2YA 5BV1A 3MZLB 5A6CA 3CHPA 4PDXA 4ABNA 4CDRA 3B7TA 4ANXA 1XGWA 3HVEB 4WWPA 5CCLA 3SGHA 1NA3A 4HXIA 4GPKA 1OWPA 1DNPA 2KM4A 3PE4A 5JHAA 3FULA 3LY9A 4Q69A 2WXFA 1WAO1 3CHOA 5ANRA 3D9IA 4XKCA 1SZ9A 4GMJA 3MYVA 4J8FA 4WNEA 2XGSA 2LSVA 4XI0A 3PUJA 4E6HA 3CVVA 1H2TC 1UN9A 2CHXA 2KCLA 3SZ7A 1SQMA 2VQ2A 2FI7A 2VGXA 1WY6A 4U63A 3AS8A 3SNXA 3B13A 2Y4TA 3R9AB 3QARA 4N5CA 3UPVA 4ILHB 2I1KA 2VGXB 3AU5A 2ILRA 3ASFA 3FTWA 4I43A 4CGVA 3LDZA 4C0MA 2AVPA 4AY6A 5KJLA 2C0MA 3FUKA 4ILIA 5KJNA 4G26A 1Y6IA 4MKTA 3HVEA 3TXNA 3IBEA 3CSFA 4B0ZA 4D10C 4MLPA 2KZTB 2E2EA 5AENA 2CG3A 2WXHA 1MHQA 4FU3A 4GCOA 3RRNB 3CHQA 3SFZA 3O4ZA 2X6HA 4BT8A 3EIQC 4XKBA 4N2SA 1ELRA 2X6FA 3ONLA 4H7YA 2IOSA 1FVHA 3SBSA 1EPUA 4XZ4A 3Q49B 3MA5A 3QB2A 3D9KA 1IHGA 3OXLA 1EYHA 3VTXA 4FLBA 3CHSA 4WUYA 3FU6A 1P5QA 1W3BA 1U3DA 3OAWA 4L1BA 3MKRA 4NRHB 3CGHA 3ULQA 3CIAA 2Q7FA 1X5BA 1GW6A 4RG9A 5EDSA 3HHMA 3SF4A 3ZXSA 4G11A 4UWHA 4JHJA 2BF0X 3GW4A 3FDHA 3I3NA 2XQ0A 4BTBA 2OVBA 3NF1A 2XCBA 2I1JA 4WAFA 3RRMB 5BV0A 3U4TA 3D3MA 3PE3A 1E90A 3LS8A 3DBSA 4GZDA 5LCWJ 2BTDA 4JPSA 3HYMB 4L2YA 4C0EA 4F1SA 2Y3AA 1A17A 2V0PA 3RO2A 2WXOA 3I5PA 2I6HA 3TXMA 3VLDA 3CK9A 3QWPA 3VTYA 3MGBA 2WQ7A 3PRZA 3ZGQA 2VTBA 2JEKA 3JYSA 2XGMA 2LSUA 2XEVA 2YQ8A 3FH7A 4EQFA 3RJVA 5G05J 3BG0B 3S7JA 2GW1A 2L9BA 3FHEA 3FUNA 2CHWA 3G2WA 3CV0A 4JEUA 2HO1A 1UG3A 3LXUX 4DI4A 3IKOB 4OVUA 1IQRA 3SHFA 4RVBA 2WXIA 4UI9C 3QK0A 3TL5A 1H0AA 3UUXA 4BX8A 1HS6A 3O48A 3P1UA 3E4BA 4OYSA 4WNDA 1SZAA 1HZ4A 3DPDA 4BT9A 2LAIA 1HU3A 3CK7A 2MOWA 5G2NA 5CMYA 2OVFA 3HDXA 4WNGA 2BUGA 3PH0C 3FWVA 1HXIA 2J09A 1Z3XA 4HOUA 3TAXA 1MQSA 3L13A 4ACLA 4A55A 3S7DA 3JCKC 4KZ0A 2YINA 3Q15A 4G24A 4IYPA 1UN8A 4KBQA 4KYOB 5G55A 3CVUA 4TV3A 2DIWA 4I9CA 3FH5A 4TRQA 2J9QA 3JQ1A 3LEWA 2C0LA 3MKQA 4YVOA 2J4BA 1PC2A 4F53A 2PZIA 2XHEA 5ARGA 2L0TB 3CVYA 4JVSA 1L5JA 3QC1A 4J6IA 4U07A 2J4DA 4FLHA 2UY1B 4ILGA 4CEMA 2A5UA 3AS4A 4GA2A 2C2LA 3QJZA 4LRZA 1B89A 4A3VA 3I4GA 1ELKA 4JA7A 4GZCA 1PAQA 3IHYA 4JL0A 3MEKA 4FJYA 4B8AA 1H2UA 1OWMA 4N3BA 4TUUA 4UWGA 3CVNA 3ESLA 4YNDA 3VLEA 2NSZA 4EBAG 4W9RA 4APFA 4LEUA 3IEGA 4I1AA 4UQYA 3S7BA 2ZU6B 3LJ3A 4GZ6A 4FULA 4UWKA 3FTVA 5A23A 3R7QA 5ENNA 3Q5MA 3PREA 4UWFA 4AJWA 1N54A 1EF1C 4GMLA 3FUEA 2IU1A 3U9WA 5EX0A 4N2QA 3APDA 1DVPA 3LPZA 5ANLA 4KZCA 2IF4A 2CFZA 2WVIA 2KCKA 1HF8A 1ZU2A 4BSXA 4LERA 4DJAA 1VDYA 2LAHA 4AP2A 3U64A 1E7VA 4URKA 3OXGA 2FO7A 3ASDA 3FTYA 3TGOA 3LY8A 3ZN3A 1HG2A 4J8SA 3L22A 4GU5A 2V4LA 5J90A 4ATGA 3HIZA 2FF4A 4XI9A 3CEQA 3RKVA 4CDMA 3FH8A 4EZJA 2XPIA 3QNKA 3FP3A 3D9MA 3FTXA 4GYYA 1UJKA 3D9LA 3QKYA 4JHKA 2VSYA 3LVQE 2PQNA 4GZ5A 5FQ7A 2M63A 4U0SA 3ZHEA 4DK5A 3FU0A 2VYIA 3CHMA 4U8HA 3CVQA 3NQPA 4DLQA 2XPYA 5LP0A 4UWLA 1FVFA 1HFAA 4AV7A 1H6KA 5T8IA 3EDTB 3EIJA 2V5FA 4IN3B 2DCPA 4AIFA 4LUNU 1Y8MA 4PS7A 4I9EA 5KCMA 1NP7A 5M72A 5LFAA 2WXNA 3ZVVA 2YHCA 4L7TA 5LCWC 3ZYKA 4GA0A 2R17C 3U3WA 2WXJA 3L16A 3CVXA 3C98A 3QWWA 4ANWA 3OXFA 4G1TA 3CQCB 3BEEA 3JUIA 3L6AA 2YHEA 3URZA 3FFLA 3JQ0A 4HOSA 2Y4UA 4L2LA 3ZFWA 3ZPJA 3ZIMA 4J8DA 3G2TA 5E76A 3FEXA 4GCNA 3UT7A 3ML9A 4G23A 5DIZA 3CKBA 2WMOA 1OWOA 3S7FA 3MX3A 3ASGA 3S2AA 4QFVA 4HORA 4O6FA 3L17A 5FZRA 2OV8A 3PNLB 1JWFA 2IONA 3EJNA 3EHNA 5G05C 3T8MA 4I6JA 3RRUA 3WXXA 2GRLA 4GB9A 2UY1A 3PVLA 2UWJG 5FWQA 5A7DB 2GRMA 2WPVA 4LCTA 3FTZA 4EBAA 2GGFA 2FBNA 3FUHA 1UW4B 2E0IA 3B7UX 2L6JA 4ME2A 5JJ7A 3APCA 2IOLA 4YVQC 4ANVA 4ANUA 1YA0A 4A1GA 5EX3A 4I1OB 3IHVA 5BUZA 3SI5A 2KCVA 1FCHA 4AXHA 1BPOA 2HR2A 5G04C 3D9JA 2MHKA 4KVMA 2VJ8A 3MV3B 1E7UA 5FQ4A 4KT6B 2VSNA 4EZLA 3KAEA 4PH4B 3UMVA 4B8CB 4FHJA 3CQGB 3ZYLA 2WQHA 2AWIA 3KS2A 3G2VA 3PDNA 4R7LA 4UQXA 1S0PA 3UT4A 5BW8C 4GYOA 4BTAA 3LKUA 2YNQA 4MS6A 3FUDA 2WMNA 3LYAA 2PQRA 2HYZA 3LCAA 5D0OD 2WB2A 5CMWA 2PL2A 2X6KA 1HX8A 1KT1A 4Y6WA 3T5XA 2RD0A 3FEYA 3PEUB 4WWNA 5E75A 4B89A 2WXQA 3G2SA 4CDNA 5T3RA 3B7RL 4F7AA 3QAQA 1H2VC 4H7XA 3CK8A 4I2WA 1HG5A 4CRWA 2NXPA 5AYWD 5HQ8A 1PY1A 2IJGX 1TEZA 2JLBA 4UI9K 4JZYA 1JWGA 3FU5A 4CCAA 1Z6TA 2XRYA 1H19A 2WM9A 3I4RB 4EECA 5BNWA 3IV0A 5HI7A 5FT9A 4DLOA 2J07A 3D9NA 3D9PA 5BT1A 5KJKA 4FC8A 1WM5A 2MRIA 4G2VA 4U0ZA 5T4YA 5FTPA 4A3TA 4BX9A 5FZSA 5JJTA 1OWNA 5AIJA 4A1SA 2R5SA 2QY7A 4I17A 2P58C 1JUQA 2WXGA 4RSYA 1OWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N71 A;  2YQ8 A;  5CCM A;  3GYZ A;  4AIF A;  1QZ2 A;  2FEZ A;  4EQF A;  1Y8M A;  3RJV A;  3MV2 B;  5CHE E;  5G04 J;  5G05 J;  4I9E A;  2GW1 A;  3RU0 A;  3S7J A;  5M72 A;  1OUV A;  2DBA A;  2LNI A;  3CV0 A;  2XCC A;  5EKQ D;  2HO1 A;  3TG5 A;  4B94 A;  2YHC A;  5LCW C;  1XNF A;  4GA0 A;  2XGO A;  4GA1 A;  3U3W A;  3QWW A;  5A6C A;  3OXF A;  4UI9 C;  4ABN A;  4CDR A;  4G1T A;  3UQ3 A;  5CCL A;  3UUX A;  3BEE A;  3CKC A;  1NA3 A;  3GZ1 A;  3O48 A;  4GPK A;  3E4B A;  3URZ A;  3FFL A;  4WND A;  1HZ4 A;  2Y4U A;  3QOU A;  4N39 A;  4Y6C A;  3ZFW A;  3ZPJ A;  3CK7 A;  3PE4 A;  3Q47 B;  2QFC A;  4J8D A;  3S7B A;  4J0U A;  3LY9 A;  4GCN A;  4UQZ A;  4WNG A;  2BUG A;  2KC7 A;  1WAO 1;  1HXI A;  3FWV A;  3CKB A;  4G23 A;  4HOU A;  5DBK A;  3QDN A;  3S7F A;  3TAX A;  3S7D A;  1HH8 A;  3ASG A;  4KBQ A;  3Q15 A;  3GZ2 A;  4G24 A;  4J8F A;  4KYO B;  2XGS A;  2LSV A;  1KT0 A;  4O6F A;  4WNE A;  4XI0 A;  4HOR A;  4I9C A;  5FZR A;  4CGW A;  5G05 C;  2J9Q A;  2KCL A;  3SZ7 A;  4YVO A;  2C0L A;  2VQ2 A;  3WXX A;  2FI7 A;  2VGX A;  4AM9 A;  1PC2 A;  2UY1 A;  2UWJ G;  2PZI A;  4GZ3 A;  2WPV A;  5ARG A;  3AS8 A;  5A7D B;  5JJ6 A;  2Y4T A;  3R9A B;  4BWR A;  2FBN A;  4N5C A;  4U07 A;  3UPV A;  2VGX B;  4CGV A;  2UY1 B;  3ASF A;  4U0U A;  2AVP A;  2L6J A;  3AS4 A;  4GA2 A;  4ME2 A;  5JJ7 A;  2C2L A;  4AY6 A;  1IYG A;  4N3C A;  3AS5 A;  5KJL A;  4YVQ C;  1B89 A;  2C0M A;  1YA0 A;  4KXK B;  4XIF A;  4N3A A;  5D0Q D;  5EX3 A;  5KJN A;  4G26 A;  3CVL A;  3K9I A;  4I2Z A;  2KCV A;  1FCH A;  4JA7 A;  4U04 A;  2HR2 A;  5G04 C;  2E2E A;  2MHK A;  4JL0 A;  3MV3 B;  3MEK A;  2VGY A;  4RG6 A;  2VSN A;  1ELW A;  4GCO A;  3KAE A;  4N3B A;  2OND A;  1QQE A;  3CVN A;  5DIZ A;  4BT8 A;  4BT9 A;  4YND A;  5C1D A;  2WQH A;  4N2S A;  3KS2 A;  3PDN A;  4UQX A;  4UQY A;  4W9R A;  3ASH A;  3IEG A;  1ELR A;  3CVP A;  4GYO A;  4I1A A;  4JHR A;  4LEU A;  3LKU A;  4H7Y A;  5ARF A;  4GZ6 A;  5BW8 C;  3TG4 A;  3RO3 A;  3Q49 B;  3MA5 A;  1IHG A;  3Q5M A;  3OXL A;  4G25 A;  3VTX A;  4WUY A;  1P5Q A;  1W3B A;  3LYA A;  4AY5 A;  2PQR A;  2HYZ A;  3MKR A;  3LCA A;  5D0O D;  5EX0 A;  4N2Q A;  2PL2 A;  3LPZ A;  4NRH B;  1KLX A;  3ULQ A;  1KT1 A;  2IF4 A;  2Q7F A;  4Y6W A;  2KCK A;  4RG9 A;  3SF4 A;  3ZHE B;  1ZU2 A;  4NQ0 A;  4HOS A;  4HOT A;  2NC9 A;  3GW4 A;  4BTB A;  4BTA A;  3NF1 A;  4H7X A;  3CK8 A;  3OXG A;  2FO7 A;  1E96 B;  2XCB A;  3QWV A;  4I2W A;  3ASD A;  5AYW D;  4APO A;  3LY8 A;  3ZN3 A;  3U4T A;  5HQ8 A;  4J8E A;  2JLB A;  3PE3 A;  4UI9 K;  3RIB A;  4WNF A;  5LCW J;  1NA0 A;  5FZQ A;  3ESK A;  5BNW A;  2FF4 A;  4XI9 A;  3CEQ A;  3RKV A;  5HI7 A;  5KJM A;  2XPI A;  3HYM B;  3FP3 A;  4UI9 J;  5FT9 A;  3Q4A B;  3KD7 A;  4GYY A;  1A17 A;  3QKY A;  4HOQ A;  4F3V A;  4GYW A;  2VSY A;  1TJC A;  2PQN A;  4GZ5 A;  4JA9 A;  4U0S A;  3RO2 A;  5BT1 A;  3TGO A;  3ZHE A;  5KJK A;  1WM5 A;  2KAT A;  2I6H A;  4G2V A;  2VYI A;  3CK9 A;  3QWP A;  4U0Z A;  5FTP A;  5FZS A;  3VTY A;  5JJT A;  2OOE A;  1ZBP A;  3CVQ A;  3ZGQ A;  1NZN A;  4A1S A;  3LY7 A;  2R5S A;  4I17 A;  2P58 C;  3JYS A;  2IFU A;  2XGM A;  2LSU A;  3EDT B;  2XEV A;  2V5F A;  5FJY A;  4IN3 B; 
#chains in the Genus database with same CATH topology
 4DI3 A;  3PS6 A;  2OEW A;  4I6E A;  2LO6 A;  2PM7 A;  1OUV A;  2DBA A;  4XX5 A;  3Q78 A;  2XCC A;  4EZK A;  2CHZ A;  3ZKJ A;  3DEP A;  3ZYQ A;  2H6F A;  2EIN E;  2RG8 A;  3CKC A;  2PM6 A;  2BKK B;  2AW6 A;  3PZ4 A;  3UM3 A;  1TYQ G;  4N39 A;  4CT4 A;  2FUL A;  4UQZ A;  2KC7 A;  1AP7 A;  5DBK A;  4C48 B;  5KJM A;  1KT0 A;  3FUF A;  4CGW A;  1TJF A;  5JHB A;  2XEH A;  2WXM A;  3GZS A;  5CED B;  3DPY A;  4U0U A;  4MRU A;  1HO8 A;  5HRY A;  3DWL G;  4KXK B;  3CVW A;  1E8Y A;  4N3A A;  3PNT B;  4HLE A;  2BED A;  2WXP A;  3AU4 A;  4U04 A;  1H6P A;  3UXG A;  1BI8 B;  5CRU A;  3V2X A;  4IRU A;  4ZHB A;  3ZRH A;  3TG4 A;  5ARF A;  1KZP A;  3BG1 B;  4KMO A;  4G25 A;  4J8Y A;  1D8E A;  3R7R A;  2I9C A;  3FUI A;  1KLX A;  3FUJ A;  4AEZ C;  2XZD G;  4JEH A;  1G3N B;  4CYM D;  4E85 A;  2WXK A;  4HRN A;  4ZFH A;  3RIB A;  1TNB A;  3FTU A;  1TNO A;  1OT8 A;  3ESK A;  2KZT A;  5HS0 A;  2P9U G;  4CZ2 D;  4UI9 J;  1BI7 B;  3Q4A B;  4GTM A;  2WXL A;  1TN6 A;  4GAA A;  3APF A;  2EQX A;  2QYU A;  1SW6 A;  1ZBP A;  3CHR A;  2CG2 A;  3LY7 A;  1QNF A;  5LOZ A;  4AOF A;  5FJY A;  2J49 A;  1E8X A;  4I6G A;  1UJJ A;  2LNI A;  3SFY A;  5EKQ D;  3EHR A;  4B94 A;  3CLJ A;  3NZU A;  3J5P A;  3MZL B;  3HVE B;  4WWP A;  3SO8 A;  4N5Q A;  3LY9 A;  4Q69 A;  4BEP A;  4GMJ A;  4WNE A;  4E6H A;  5EID A;  1H2T C;  3SZ7 A;  2VGX A;  1V55 E;  4MBG A;  3SNX A;  2Y4T A;  4HRL A;  2VGX B;  3AU5 A;  3V79 K;  4G26 A;  4MKT A;  3HVE A;  3SQV A;  5AEN A;  2WXH A;  4GCO A;  3CHQ A;  3SFZ A;  2X6H A;  4BT8 A;  3EIQ C;  4L9P A;  1ELR A;  3TWU A;  4H7Y A;  1FVH A;  3QB2 A;  5KWD A;  3VTX A;  4FLB A;  3OAW A;  4JB8 P;  3PZ3 A;  4L1B A;  3EUV A;  3ISM C;  3CIA A;  2Q7F A;  4RG9 A;  3HHM A;  2XS8 A;  1TNY A;  4G11 A;  4BTB A;  1Z5S C;  3RRM B;  3U4T A;  3LS8 A;  4GZD A;  2BTD A;  4JPS A;  4F1S A;  2Y3A A;  2R2L A;  1K1A A;  3TXM A;  3VLD A;  3MGB A;  3WG7 E;  2JEK A;  2XEV A;  5AQA A;  1JCQ A;  3RJV A;  4X8Q A;  5G05 J;  3BG0 B;  3FHE A;  4YDW A;  2CHW A;  3NOG D;  4JEU A;  1NFI E;  4DI4 A;  3IKO B;  4TUM A;  3SHF A;  4RVB A;  3P1U A;  4OYS A;  1SZA A;  4BT9 A;  3DPD A;  1HU3 A;  1Z3X A;  4HOU A;  5G55 A;  4TV3 A;  4I9C A;  5ARG A;  3CVY A;  4LSZ E;  1AWC B;  3QJZ A;  2GRP B;  4F6R D;  1ELK A;  1N11 A;  3IHY A;  1O1R A;  4B8A A;  1H2U A;  1OWM A;  3CVN A;  3ESL A;  3VLE A;  2NSZ A;  3IEG A;  3LJ3 A;  4UWK A;  1S63 A;  3PRE A;  2KXP C;  3TWW A;  1N54 A;  3DRA A;  3KSL A;  2DWZ A;  1ZU2 A;  2DZO A;  4AP2 A;  4URK A;  3ZN3 A;  2V4L A;  3CEQ A;  3NAW A;  3FH8 A;  4EZJ A;  3QNK A;  4GTQ A;  3NB2 A;  5FQ7 A;  2EIJ E;  2P9N G;  3FU0 A;  2VYI A;  3CVQ A;  3NQP A;  2Y1L E;  2XPY A;  2LUH A;  3R9M A;  2DCP A;  4AIF A;  4I9E A;  1NP7 A;  5M72 A;  3ULY A;  3EU9 A;  3IXE A;  5LFA A;  2YHC A;  3JXI A;  2WXJ A;  2RKK A;  3CVX A;  3X2Q E;  3BEE A;  3L6A A;  3JQ0 A;  2Y4U A;  3V2O A;  4GCN A;  4O6F A;  3PNL B;  4XEI G;  2ION A;  4A63 B;  3RRU A;  4GB9 A;  2UY1 A;  2GRM A;  3FTZ A;  4LNB A;  1MX4 A;  1UW4 B;  2F8Y A;  1FT1 A;  4ANV A;  4A1G A;  3SI5 A;  2KCV A;  1FCH A;  3D9J A;  4KVM A;  3KAE A;  3ZYL A;  2V5Q C;  3UT4 A;  3G2V A;  3LKU A;  3HG0 D;  3FUD A;  2P2C P;  5D0O D;  3DSS A;  4YDE A;  2PL2 A;  3Q75 A;  5E75 A;  4YDY A;  3B7R L;  4I2W A;  1HG5 A;  2R05 A;  2NXP A;  5AYW D;  2JLB A;  4UI9 K;  1Z6T A;  2XRY A;  5BNW A;  2WM9 A;  5HI7 A;  1BD8 A;  5FT9 A;  3D9N A;  3D9P A;  5BT1 A;  4FC8 A;  4G2V A;  4U0Z A;  5T4Y A;  5FTP A;  4A1S A;  2R5S A;  5HKP A;  3UM1 A;  3RU0 A;  4FA6 A;  3PEV B;  3CST A;  4K0R A;  1JCR A;  1LD8 A;  5J08 A;  3C3O A;  2XPZ A;  2J08 A;  3Q79 A;  4I1M A;  3PZD A;  4PS8 A;  2VTB B;  4JD2 G;  4Q96 A;  3UQ3 A;  3GZ1 A;  4XE0 A;  4FP7 A;  3QOU A;  3E34 A;  2X6I A;  3Q47 B;  2QFC A;  4OAU C;  5LX8 A;  4DRX E;  3GZ2 A;  5CBN A;  3ZEF A;  4AM9 A;  4GZ3 A;  3L9T A;  5JJ6 A;  4L23 A;  3MKQ B;  4GTO A;  3AS5 A;  2XZT G;  3CVL A;  3K9I A;  2J8S D;  2X3M A;  2V4H C;  4EPZ A;  1YYH A;  2OND A;  1QQE A;  4FHK A;  4IUL A;  3ASH A;  2L0I A;  3EU5 A;  2EIL E;  4JW1 A;  3RO3 A;  4NUR A;  1RW2 A;  4C9B B;  2MYO A;  2A4Z A;  3U66 A;  1LF8 A;  1Q2Z A;  3L08 A;  4K03 A;  3TJP A;  4Q94 A;  1DC2 A;  5BXU A;  4RQI A;  5ENT D;  4J8E A;  4WNF A;  4DPR A;  2R03 A;  3AG3 E;  4HRM B;  1IQU A;  4JA9 A;  3ABK E;  3ENE A;  3T5V A;  4BY6 A;  4K5A B;  3CVP A;  4P29 A;  2VGE A;  2QYJ A;  2HM8 A;  3E30 A;  4BER A;  4GA1 A;  1N52 A;  5A6C A;  4PDX A;  3B7T A;  5CCL A;  1NA3 A;  4HXI A;  4GPK A;  1WAO 1;  3CHO A;  4XKC A;  1SZ9 A;  3MYV A;  4J8F A;  2KCL A;  1OCC E;  3R9A B;  4N5C A;  3UPV A;  4ILH B;  3FTW A;  4AY6 A;  5KJL A;  2XS1 A;  5AQ7 A;  3FUK A;  5KJN A;  3TXN A;  1JCS A;  1N4Q A;  3J5Q B;  4MLP A;  2KZT B;  2CG3 A;  1MHQ A;  3RRN B;  4XKB A;  5AQ9 A;  3LJN A;  3ONL A;  4UUC A;  2IOS A;  3SBS A;  3Q49 B;  1DCE A;  3UIO C;  3MKR A;  3CGH A;  2ETB A;  4UWH A;  4DX6 D;  2XQ0 A;  2I1J A;  3D3M A;  1SA5 A;  3DBS A;  5LCW J;  2L6B A;  4L2Y A;  4C0E A;  2P9P G;  3RO2 A;  3AAA C;  3HXD A;  1O5M A;  3UTM A;  2VTB A;  4GMR A;  2XGM A;  3FH7 A;  4EQF A;  3G2W A;  1UG3 A;  1K1B A;  3LXU X;  2WXI A;  3UUX A;  4BX8 A;  1HS6 A;  2F37 A;  4WND A;  1HZ4 A;  2MOW A;  5G2N A;  4ACL A;  4A55 A;  4DX5 D;  2YIN A;  5ITZ F;  2ETC A;  3B95 A;  2DIW A;  4J7W A;  2J9Q A;  3MKQ A;  1OCR E;  2PZI A;  1L5J A;  1TN8 A;  2UY1 B;  4ILG A;  3ABL E;  3E33 A;  1N4P A;  4A3V A;  3I4G A;  4GTR A;  3PZ2 A;  4N3B A;  3UM0 A;  4EBA G;  4W9R A;  4UQY A;  2ZU6 B;  2IY0 C;  3FTV A;  3R7Q A;  5ENN A;  4AJW A;  2FO1 E;  1OCO E;  4GML A;  3FUE A;  5EYL A;  4GTT A;  5EX0 A;  3APD A;  4N2Q A;  2IF4 A;  2CFZ A;  1HF8 A;  4LER A;  2LAH A;  3ASD A;  3LY8 A;  3RAU A;  5J90 A;  3HIZ A;  4XI9 A;  2XPI A;  3FP3 A;  4QQI A;  2DYS E;  1UJK A;  3QKY A;  2VSY A;  2PQN A;  5B1B E;  4NIK A;  3CHM A;  4DLQ A;  3DXK G;  4UWL A;  1HFA A;  4AV7 A;  2V5F A;  2ZGD A;  2ZIR A;  3AG1 E;  1Y8M A;  5KCM A;  2GRN B;  2P9L G;  4L7T A;  4ANW A;  5JA4 D;  2OEV A;  3CQC B;  3JUI A;  1KZO A;  3FFL A;  4HOS A;  3ZFW A;  2JAB A;  3UT7 A;  3S7F A;  3Q73 A;  4QFV A;  3T8M A;  3EJN A;  2PNN A;  2WPV A;  3E32 A;  2GGF A;  2FBN A;  5IY5 E;  3UM2 A;  3B7U X;  4ME2 A;  1YA0 A;  2XEE A;  3EHQ A;  4I1O B;  3IHV A;  2F8X K;  2IO3 C;  4AXH A;  5G04 C;  2MHK A;  1E7U A;  5FQ4 A;  4KT6 B;  4PH4 B;  3CQG B;  5AN8 A;  4UQX A;  1S0P A;  3UKU G;  5BW8 C;  2YNQ A;  4MS6 A;  1MJ0 A;  3ZNG A;  3LCA A;  3T5X A;  2RD0 A;  4WWN A;  1H2V C;  3CK8 A;  2DYR E;  4CRW A;  1PY1 A;  1TEZ A;  3F6Q A;  1WM5 A;  4A3T A;  2QY7 A;  2P58 C;  1JUQ A;  3N71 A;  2F0Y A;  2FEZ A;  3C3R A;  3RK6 A;  5CHE E;  5G04 J;  1U2V G;  4OVV A;  2HE0 A;  4GPM A;  4HI9 A;  3C3Q A;  4BES A;  3UT8 A;  3ASO E;  3NOC D;  3QDN A;  1HH8 A;  1U3C A;  3ML8 A;  3ZW3 A;  3MJW A;  3G2U A;  1V54 E;  4PUC A;  4F1P A;  4WWO A;  3TWR A;  1K3Z D;  1OY3 D;  1IYG A;  4NAC A;  3W9G A;  2R59 A;  2VGY A;  4RG6 A;  5D66 A;  4JHR A;  2X6J A;  3UX4 A;  3P2B A;  2V8S E;  1WG0 A;  4AY5 A;  3MCX A;  4NQ0 A;  2CFU A;  5AJL A;  4HOT A;  1D8D A;  2RFM A;  4JXT A;  3QWV A;  4APO A;  1NA0 A;  3HXE A;  3VLF A;  4BET A;  2LXM A;  1ZB1 A;  1Z3Y A;  1A5E A;  3KD7 A;  2P9S G;  4TXQ A;  4F3V A;  2KAT A;  2VSX E;  3FU3 A;  3PUK A;  4M3O A;  5EIB E;  2B6C A;  1NZN A;  3CR3 A;  5FQ8 A;  1DCQ A;  2IFU A;  2VSO E;  1QZ2 A;  4CT0 A;  4JC8 A;  5FQ6 A;  4LNG A;  3L54 A;  1MYO A;  3ZYM A;  3TG5 A;  2GRO B;  4ACK A;  2XGO A;  5BV1 A;  3CHP A;  4ABN A;  4CDR A;  4ANX A;  1XGW A;  5AQB A;  1SA4 A;  1OWP A;  3ZXP A;  5ANR A;  2XGS A;  3PUJ A;  3CVV A;  1UN9 A;  3UIP C;  1SQM A;  2VQ2 A;  2FI7 A;  1WY6 A;  4U63 A;  3AS8 A;  3B13 A;  3DSV A;  2I1K A;  4CGV A;  2ILR A;  3LDZ A;  2AVP A;  4ILI A;  1Y6I A;  2E2E A;  3O4Z A;  3C5R A;  5EIL A;  4N2S A;  2X6F A;  3MA5 A;  2NYJ A;  1IHG A;  3OXL A;  1EYH A;  3CHS A;  3FU6 A;  1P5Q A;  1W3B A;  1U3D A;  4NRH B;  3ULQ A;  1GW6 A;  3B7B A;  4JHJ A;  2BF0 X;  2OVB A;  3NF1 A;  2XCB A;  5BV0 A;  3PE3 A;  1E90 A;  3HXB A;  2QC9 A;  4Z68 A;  1A17 A;  2V0P A;  2WXO A;  3I5P A;  3SFX A;  3CK9 A;  3QWP A;  2WQ7 A;  3PRZ A;  5B1A E;  1FT2 A;  2LSU A;  2YQ8 A;  2GW1 A;  3JXJ A;  3C72 A;  3CV0 A;  2HO1 A;  3ULE G;  1IQR A;  4UI9 C;  2H6H A;  1H0A A;  1X81 A;  3CK7 A;  3JUE A;  5CMY A;  5EYP F;  4B93 B;  3HDX A;  2BUG A;  3PH0 C;  1MQS A;  3L13 A;  4KZ0 A;  4IYP A;  4KBQ A;  4G24 A;  1UN8 A;  3BUA A;  1S70 B;  3FH5 A;  4TRQ A;  3JQ1 A;  1PC2 A;  1H6O A;  3QC1 A;  4U07 A;  1TN7 A;  4FLH A;  4DUI A;  5CEC B;  4CEM A;  2C2L A;  5CRV A;  1N95 A;  4JA7 A;  4GTP A;  5H7P A;  4GZC A;  1PAQ A;  4JL0 A;  3MEK A;  2H6I A;  4FJY A;  1O1S A;  4HNA D;  4UWG A;  2LXL A;  1MX6 A;  2ETA A;  3UI2 A;  4YND A;  3TWV A;  4APF A;  3S7B A;  4FUL A;  3T9K A;  3U9W A;  2IU1 A;  1DVP A;  3LPZ A;  4KZC A;  2EIK E;  4O1P A;  4DX1 A;  4DJA A;  2ZXW E;  2FO7 A;  3BQO A;  4GU5 A;  4G8K A;  4ATG A;  4CDM A;  3RKV A;  4GYY A;  3FTX A;  4JHK A;  4GZ5 A;  3ZHE A;  4DK5 A;  3AG2 E;  4YDO A;  1QYM A;  5LP0 A;  4K5B A;  3EIJ A;  4PS7 A;  1YMP A;  2WXN A;  3ZVV A;  3ZYK A;  2R17 C;  4U8Y D;  2YHE A;  1FPP A;  3G2T A;  3ML9 A;  5DIZ A;  2WMO A;  1OWO A;  4U96 D;  3MX3 A;  3ASG A;  2KBX A;  5KBA A;  5FZR A;  2XEN A;  3PZ1 A;  2OV8 A;  5G05 C;  5B3S E;  3EHN A;  4BSZ B;  3WXX A;  2GRL A;  2UWJ G;  5A7D B;  5FIO A;  4EBA A;  2E0I A;  2L6J A;  5JJ7 A;  2IOL A;  4YVQ C;  4ANU A;  5EX3 A;  5BUZ A;  3DSX A;  1BPO A;  5CER B;  2VJ8 A;  3MV3 B;  4EZL A;  3UMV A;  4B8C B;  3V31 A;  2WQH A;  4BTA A;  4GYO A;  1LTX A;  3TWX A;  3V30 A;  2WMN A;  4HBD A;  2PQR A;  2HYZ A;  3HXF A;  5CMW A;  3BU8 A;  4Y6W A;  3PEU B;  4B89 A;  1N9A A;  2WXQ A;  3G2S A;  4CDN A;  3QAQ A;  4H7X A;  3D9H A;  5HQ8 A;  2IJG X;  4O60 A;  4JZY A;  1JWG A;  3FU5 A;  4CCA A;  3I4R B;  4DLO A;  2J07 A;  3KEA A;  2MRI A;  1D9S A;  4BX9 A;  1WDY A;  5AIJ A;  4RSY A;  3E37 A;  1OWL A;  3MV2 B;  2IEJ A;  3KEZ A;  4FJZ A;  3D9O A;  4GTV A;  1XNF A;  1JPL A;  4KVO A;  1TR4 A;  4V3I A;  3TWQ A;  1HE8 A;  4BWR A;  4Y6C A;  1E8W A;  2P9K G;  4J0U A;  2X38 A;  4U8V D;  1N0Q A;  3EHM A;  3OTN A;  5AAR A;  4HB5 A;  2AXU A;  1EDU A;  3SBT B;  4EHM A;  4OAV B;  4U7E B;  3LVR E;  3Q9N C;  2AXV A;  1TNZ A;  1SVX A;  5ENR D;  3NZS A;  4TXP A;  5AJD A;  4N3C A;  5D0Q D;  4XIF A;  3UIN C;  4AVX A;  4I2Z A;  2AXZ A;  4HS2 A;  2GRR B;  3FY4 A;  1ELW A;  3FUM A;  3DST A;  1OCZ E;  5C1D A;  4HFG A;  3SD5 A;  5CBO A;  4BFR A;  1RZ4 A;  2XRZ A;  5BPP A;  2IQC A;  4HVB A;  1E8Z A;  3ZHE B;  2NC9 A;  4PS3 A;  2I2O A;  5BXO A;  1E96 B;  4LG6 A;  1INZ A;  2B0O E;  2RFA A;  5FZQ A;  1O1T A;  4HOQ A;  1MZC A;  4GYW A;  1TJC A;  3FTS A;  2WXR A;  1BLX B;  2OOE A;  4K5C A;  3B7S A;  4DX2 A;  5JMN D;  3ONK A;  2WQ6 A;  5CCM A;  3GYZ A;  4O1O A;  2H6G A;  4FAD A;  4HQD A;  1N4S A;  5C2Y A;  3L82 A;  3SGH A;  1DNP A;  2KM4 A;  3PE4 A;  5JHA A;  3FUL A;  1S64 A;  2WXF A;  2P9I G;  3NBN B;  3D9I A;  2AJA A;  2LSV A;  4XI0 A;  1N4R A;  3Q7F A;  3HXC A;  4TXR A;  2CHX A;  2ZIS A;  3QAR A;  3ASF A;  4I43 A;  4C0M A;  4U95 D;  5AAO A;  2C0M A;  1YCS B;  3IBE A;  3CSF A;  4B0Z A;  4D10 C;  4HI8 A;  4FU3 A;  3ZUV B;  5CEA A;  1EPU A;  4XZ4 A;  3D9K A;  3T8K A;  4WUY A;  4DX7 D;  1X5B A;  5EDS A;  3SF4 A;  3ZXS A;  3GW4 A;  3FDH A;  3I3N A;  3ABM E;  4WAF A;  3DXM G;  3AG4 E;  1BU9 A;  3HYM B;  2ZGG A;  2I6H A;  3VTY A;  2EIM E;  3TWS A;  3ZGQ A;  3JYS A;  5FIN A;  3S7J A;  2L9B A;  3FUN A;  3RSE G;  2Y69 E;  4OVU A;  2BKG A;  3QK0 A;  3TL5 A;  3O48 A;  3E4B A;  4ATZ D;  2LAI A;  1N94 A;  2OVF A;  4WNG A;  3FWV A;  1HXI A;  1UOH A;  2J09 A;  3TAX A;  2WB2 A;  4F7A A;  3S7D A;  3JCK C;  3Q15 A;  3CVU A;  3UKR G;  4KYO B;  3ASN E;  3LEW A;  2C0L A;  4YVO A;  5ENS D;  2J4B A;  4F53 A;  2A5E A;  2XHE A;  1TNU A;  2L0T B;  4JVS A;  1NL4 A;  4J6I A;  5ENQ D;  2J4D A;  2A5U A;  3AS4 A;  4GA2 A;  4LRZ A;  5EN5 D;  1B89 A;  4M7C A;  4G8L A;  4RLY A;  1MX2 A;  4TUU A;  3HRA A;  4LEU A;  4I1A A;  4GTS A;  4GZ6 A;  3SY2 A;  5A23 A;  3Q5M A;  4UWF A;  1EF1 C;  5ANL A;  2WVI A;  2KCK A;  1LD7 A;  4BSX A;  1OXJ A;  1VDY A;  3U64 A;  4HLL A;  1E7V A;  3OXG A;  3FTY A;  3TGO A;  1HG2 A;  4J8S A;  3L22 A;  1N0R A;  5ENO D;  1QBQ A;  2FF4 A;  3AJI A;  3D9M A;  3D9L A;  3ZU7 B;  3LVQ E;  2M63 A;  4U0S A;  5ENP D;  3Q9U C;  1IKN D;  3DSU A;  4U8H A;  2IO2 C;  1FVF A;  1H6K A;  5T8I A;  3EDT B;  4IN3 B;  3W9F A;  3DEO A;  4LUN U;  5LCW C;  4GA0 A;  3U3W A;  3L16 A;  3C98 A;  3QWW A;  3OXF A;  4G1T A;  1K8K G;  3Q7A A;  3URZ A;  2OCC E;  4L2L A;  3ZPJ A;  3ZIM A;  2DZN A;  4J8D A;  5E76 A;  3FEX A;  4G23 A;  3CKB A;  3S2A A;  4HOR A;  3L17 A;  1JWF A;  4I6J A;  3PVL A;  5FWQ A;  4LCT A;  3TWT A;  3FUH A;  1NI1 A;  3APC A;  1IXV A;  2R02 A;  2HR2 A;  2GRQ B;  2VSN A;  3DSW A;  4FHJ A;  2AWI A;  3KS2 A;  3PDN A;  4LNU D;  4R7L A;  1KPS B;  5KNH D;  2QZA A;  1IHB A;  3LYA A;  5KNG A;  2X6K A;  1KT1 A;  1HX8 A;  2DVW A;  3FEY A;  5D2M C;  5T3R A;  3KSQ A;  1H19 A;  4EEC A;  3IV0 A;  5KJK A;  5FZS A;  2Y0B G;  1OWN A;  5JJT A;  4I17 A;  2WXG A; 
#chains in the Genus database with same CATH homology
 3N71 A;  4DI3 A;  2FEZ A;  3PS6 A;  3RK6 A;  3MV2 B;  5CHE E;  3PEV B;  5G04 J;  3RU0 A;  4FA6 A;  4I6E A;  2LO6 A;  2PM7 A;  1OUV A;  2DBA A;  3KEZ A;  4XX5 A;  3CST A;  4FJZ A;  4K0R A;  2XCC A;  3D9O A;  5J08 A;  4EZK A;  1XNF A;  2CHZ A;  4OVV A;  2XPZ A;  2J08 A;  4I1M A;  3ZYQ A;  3PZD A;  1JPL A;  4PS8 A;  2VTB B;  4KVO A;  2RG8 A;  4Q96 A;  4V3I A;  3UQ3 A;  3CKC A;  3GZ1 A;  2PM6 A;  2AW6 A;  1HE8 A;  4XE0 A;  4FP7 A;  3UT8 A;  4BWR A;  3QOU A;  4N39 A;  4Y6C A;  4CT4 A;  1E8W A;  2X6I A;  3Q47 B;  2FUL A;  2QFC A;  4J0U A;  2X38 A;  4UQZ A;  2KC7 A;  5DBK A;  3EHM A;  3OTN A;  3QDN A;  5LX8 A;  1HH8 A;  1U3C A;  3ML8 A;  3ZW3 A;  2AXU A;  1EDU A;  3GZ2 A;  3MJW A;  3SBT B;  5KJM A;  1KT0 A;  3G2U A;  3FUF A;  3LVR E;  4PUC A;  4CGW A;  1TJF A;  2AXV A;  3ZEF A;  4AM9 A;  5JHB A;  4GZ3 A;  5JJ6 A;  4WWO A;  4L23 A;  2WXM A;  3GZS A;  3MKQ B;  3NZS A;  4U0U A;  4MRU A;  5AJD A;  1HO8 A;  1IYG A;  4N3C A;  3AS5 A;  4KXK B;  5D0Q D;  1E8Y A;  4NAC A;  4N3A A;  3PNT B;  4XIF A;  4AVX A;  4HLE A;  3CVW A;  3CVL A;  3K9I A;  4I2Z A;  2AXZ A;  2WXP A;  3AU4 A;  4U04 A;  2R59 A;  4HS2 A;  2X3M A;  2VGY A;  4RG6 A;  3FY4 A;  4EPZ A;  1ELW A;  3FUM A;  2OND A;  1QQE A;  4FHK A;  4IRU A;  5C1D A;  4IUL A;  3ZRH A;  3ASH A;  2L0I A;  4HFG A;  4JHR A;  3TG4 A;  5ARF A;  3SD5 A;  2X6J A;  4JW1 A;  3RO3 A;  3BG1 B;  4KMO A;  4BFR A;  4G25 A;  3UX4 A;  3P2B A;  2V8S E;  4NUR A;  2XRZ A;  5BPP A;  2IQC A;  4AY5 A;  4HVB A;  3R7R A;  3MCX A;  2I9C A;  4C9B B;  3FUI A;  1E8Z A;  1KLX A;  1LF8 A;  2A4Z A;  3U66 A;  3FUJ A;  4AEZ C;  3L08 A;  4K03 A;  3TJP A;  3ZHE B;  4NQ0 A;  4Q94 A;  2CFU A;  5AJL A;  4HOT A;  2NC9 A;  4JEH A;  4PS3 A;  2I2O A;  4JXT A;  4E85 A;  1E96 B;  3QWV A;  2WXK A;  4APO A;  4J8E A;  3RIB A;  1INZ A;  4WNF A;  4DPR A;  3FTU A;  1NA0 A;  5FZQ A;  3ESK A;  2KZT A;  3VLF A;  1Z3Y A;  4UI9 J;  3Q4A B;  3KD7 A;  4HOQ A;  1IQU A;  2WXL A;  4GYW A;  4F3V A;  1TJC A;  3FTS A;  4JA9 A;  2WXR A;  3ENE A;  2KAT A;  2VSX E;  3FU3 A;  3PUK A;  4GAA A;  4M3O A;  3APF A;  2EQX A;  3T5V A;  2OOE A;  1ZBP A;  3CHR A;  1NZN A;  3CR3 A;  2CG2 A;  3B7S A;  1QNF A;  3LY7 A;  5FQ8 A;  4BY6 A;  5LOZ A;  2IFU A;  3CVP A;  2VSO E;  4P29 A;  4AOF A;  3ONK A;  2J49 A;  5FJY A;  2WQ6 A;  5CCM A;  1E8X A;  3GYZ A;  1QZ2 A;  4I6G A;  4CT0 A;  4JC8 A;  5FQ6 A;  2HM8 A;  1UJJ A;  2LNI A;  3L54 A;  5EKQ D;  4FAD A;  3ZYM A;  3TG5 A;  4B94 A;  3CLJ A;  4ACK A;  3NZU A;  2XGO A;  1N52 A;  4GA1 A;  5C2Y A;  5BV1 A;  3MZL B;  5A6C A;  3CHP A;  4PDX A;  4ABN A;  4CDR A;  3B7T A;  4ANX A;  1XGW A;  3HVE B;  4WWP A;  5CCL A;  3SGH A;  1NA3 A;  4HXI A;  4GPK A;  1OWP A;  1DNP A;  2KM4 A;  3PE4 A;  5JHA A;  3FUL A;  3LY9 A;  4Q69 A;  2WXF A;  1WAO 1;  3CHO A;  5ANR A;  3D9I A;  4XKC A;  1SZ9 A;  4GMJ A;  3MYV A;  4J8F A;  4WNE A;  2XGS A;  2LSV A;  4XI0 A;  3PUJ A;  4E6H A;  3CVV A;  1H2T C;  1UN9 A;  2CHX A;  2KCL A;  3SZ7 A;  1SQM A;  2VQ2 A;  2FI7 A;  2VGX A;  1WY6 A;  4U63 A;  3AS8 A;  3SNX A;  3B13 A;  2Y4T A;  3R9A B;  3QAR A;  4N5C A;  3UPV A;  4ILH B;  2I1K A;  2VGX B;  3AU5 A;  2ILR A;  3ASF A;  3FTW A;  4I43 A;  4CGV A;  3LDZ A;  4C0M A;  2AVP A;  4AY6 A;  5KJL A;  2C0M A;  3FUK A;  4ILI A;  5KJN A;  4G26 A;  1Y6I A;  4MKT A;  3HVE A;  3TXN A;  3IBE A;  3CSF A;  4B0Z A;  4D10 C;  4MLP A;  2KZT B;  2E2E A;  5AEN A;  2CG3 A;  2WXH A;  1MHQ A;  4FU3 A;  4GCO A;  3RRN B;  3CHQ A;  3SFZ A;  3O4Z A;  2X6H A;  4BT8 A;  3EIQ C;  4XKB A;  4N2S A;  1ELR A;  2X6F A;  3ONL A;  4H7Y A;  2IOS A;  1FVH A;  3SBS A;  1EPU A;  4XZ4 A;  3Q49 B;  3MA5 A;  3QB2 A;  3D9K A;  1IHG A;  3OXL A;  1EYH A;  3VTX A;  4FLB A;  3CHS A;  4WUY A;  3FU6 A;  1P5Q A;  1W3B A;  1U3D A;  3OAW A;  4L1B A;  3MKR A;  4NRH B;  3CGH A;  3ULQ A;  3CIA A;  2Q7F A;  1X5B A;  1GW6 A;  4RG9 A;  5EDS A;  3HHM A;  3SF4 A;  3ZXS A;  4G11 A;  4UWH A;  4JHJ A;  2BF0 X;  3GW4 A;  3FDH A;  3I3N A;  2XQ0 A;  4BTB A;  2OVB A;  3NF1 A;  2XCB A;  2I1J A;  4WAF A;  3RRM B;  5BV0 A;  3U4T A;  3D3M A;  3PE3 A;  1E90 A;  3LS8 A;  3DBS A;  4GZD A;  5LCW J;  2BTD A;  4JPS A;  3HYM B;  4L2Y A;  4C0E A;  4F1S A;  2Y3A A;  1A17 A;  2V0P A;  3RO2 A;  2WXO A;  3I5P A;  2I6H A;  3TXM A;  3VLD A;  3CK9 A;  3QWP A;  3VTY A;  3MGB A;  2WQ7 A;  3PRZ A;  3ZGQ A;  2VTB A;  2JEK A;  3JYS A;  2XGM A;  2LSU A;  2XEV A;  2YQ8 A;  3FH7 A;  4EQF A;  3RJV A;  5G05 J;  3BG0 B;  3S7J A;  2GW1 A;  2L9B A;  3FHE A;  3FUN A;  2CHW A;  3G2W A;  3CV0 A;  4JEU A;  2HO1 A;  1UG3 A;  3LXU X;  4DI4 A;  3IKO B;  4OVU A;  1IQR A;  3SHF A;  4RVB A;  2WXI A;  4UI9 C;  3QK0 A;  3TL5 A;  1H0A A;  3UUX A;  4BX8 A;  1HS6 A;  3O48 A;  3P1U A;  3E4B A;  4OYS A;  4WND A;  1SZA A;  1HZ4 A;  3DPD A;  4BT9 A;  2LAI A;  1HU3 A;  3CK7 A;  2MOW A;  5G2N A;  5CMY A;  2OVF A;  3HDX A;  4WNG A;  2BUG A;  3PH0 C;  3FWV A;  1HXI A;  2J09 A;  1Z3X A;  4HOU A;  3TAX A;  1MQS A;  3L13 A;  4ACL A;  4A55 A;  3S7D A;  3JCK C;  4KZ0 A;  2YIN A;  3Q15 A;  4G24 A;  4IYP A;  1UN8 A;  4KBQ A;  4KYO B;  5G55 A;  3CVU A;  4TV3 A;  2DIW A;  4I9C A;  3FH5 A;  4TRQ A;  2J9Q A;  3JQ1 A;  3LEW A;  2C0L A;  3MKQ A;  4YVO A;  2J4B A;  1PC2 A;  4F53 A;  2PZI A;  2XHE A;  5ARG A;  2L0T B;  3CVY A;  4JVS A;  1L5J A;  3QC1 A;  4J6I A;  4U07 A;  2J4D A;  4FLH A;  2UY1 B;  4ILG A;  4CEM A;  2A5U A;  3AS4 A;  4GA2 A;  2C2L A;  3QJZ A;  4LRZ A;  1B89 A;  4A3V A;  3I4G A;  1ELK A;  4JA7 A;  4GZC A;  1PAQ A;  3IHY A;  4JL0 A;  3MEK A;  4FJY A;  4B8A A;  1H2U A;  1OWM A;  4N3B A;  4TUU A;  4UWG A;  3CVN A;  3ESL A;  4YND A;  3VLE A;  2NSZ A;  4EBA G;  4W9R A;  4APF A;  4LEU A;  3IEG A;  4I1A A;  4UQY A;  3S7B A;  2ZU6 B;  3LJ3 A;  4GZ6 A;  4FUL A;  4UWK A;  3FTV A;  5A23 A;  3R7Q A;  5ENN A;  3Q5M A;  3PRE A;  4UWF A;  4AJW A;  1N54 A;  1EF1 C;  4GML A;  3FUE A;  2IU1 A;  3U9W A;  5EX0 A;  4N2Q A;  3APD A;  1DVP A;  3LPZ A;  5ANL A;  4KZC A;  2IF4 A;  2CFZ A;  2WVI A;  2KCK A;  1HF8 A;  1ZU2 A;  4BSX A;  4LER A;  4DJA A;  1VDY A;  2LAH A;  4AP2 A;  3U64 A;  1E7V A;  4URK A;  3OXG A;  2FO7 A;  3ASD A;  3FTY A;  3TGO A;  3LY8 A;  3ZN3 A;  1HG2 A;  4J8S A;  3L22 A;  4GU5 A;  2V4L A;  5J90 A;  4ATG A;  3HIZ A;  2FF4 A;  4XI9 A;  3CEQ A;  3RKV A;  4CDM A;  3FH8 A;  4EZJ A;  2XPI A;  3QNK A;  3FP3 A;  3D9M A;  3FTX A;  4GYY A;  1UJK A;  3D9L A;  3QKY A;  4JHK A;  2VSY A;  3LVQ E;  2PQN A;  4GZ5 A;  5FQ7 A;  2M63 A;  4U0S A;  3ZHE A;  4DK5 A;  3FU0 A;  2VYI A;  3CHM A;  4U8H A;  3CVQ A;  3NQP A;  4DLQ A;  2XPY A;  5LP0 A;  4UWL A;  1FVF A;  1HFA A;  4AV7 A;  1H6K A;  5T8I A;  3EDT B;  3EIJ A;  2V5F A;  4IN3 B;  2DCP A;  4AIF A;  4LUN U;  1Y8M A;  4PS7 A;  4I9E A;  5KCM A;  1NP7 A;  5M72 A;  5LFA A;  2WXN A;  3ZVV A;  2YHC A;  4L7T A;  5LCW C;  3ZYK A;  4GA0 A;  2R17 C;  3U3W A;  2WXJ A;  3L16 A;  3CVX A;  3C98 A;  3QWW A;  4ANW A;  3OXF A;  4G1T A;  3CQC B;  3BEE A;  3JUI A;  3L6A A;  2YHE A;  3URZ A;  3FFL A;  3JQ0 A;  4HOS A;  2Y4U A;  4L2L A;  3ZFW A;  3ZPJ A;  3ZIM A;  4J8D A;  3G2T A;  5E76 A;  3FEX A;  4GCN A;  3UT7 A;  3ML9 A;  4G23 A;  5DIZ A;  3CKB A;  2WMO A;  1OWO A;  3S7F A;  3MX3 A;  3ASG A;  3S2A A;  4QFV A;  4HOR A;  4O6F A;  3L17 A;  5FZR A;  2OV8 A;  3PNL B;  1JWF A;  2ION A;  3EJN A;  3EHN A;  5G05 C;  3T8M A;  4I6J A;  3RRU A;  3WXX A;  2GRL A;  4GB9 A;  2UY1 A;  3PVL A;  2UWJ G;  5FWQ A;  5A7D B;  2GRM A;  2WPV A;  4LCT A;  3FTZ A;  4EBA A;  2GGF A;  2FBN A;  3FUH A;  1UW4 B;  2E0I A;  3B7U X;  2L6J A;  4ME2 A;  5JJ7 A;  3APC A;  2IOL A;  4YVQ C;  4ANV A;  4ANU A;  1YA0 A;  4A1G A;  5EX3 A;  4I1O B;  3IHV A;  5BUZ A;  3SI5 A;  2KCV A;  1FCH A;  4AXH A;  1BPO A;  2HR2 A;  5G04 C;  3D9J A;  2MHK A;  4KVM A;  2VJ8 A;  3MV3 B;  1E7U A;  5FQ4 A;  4KT6 B;  2VSN A;  4EZL A;  3KAE A;  4PH4 B;  3UMV A;  4B8C B;  4FHJ A;  3CQG B;  3ZYL A;  2WQH A;  2AWI A;  3KS2 A;  3G2V A;  3PDN A;  4R7L A;  4UQX A;  1S0P A;  3UT4 A;  5BW8 C;  4GYO A;  4BTA A;  3LKU A;  2YNQ A;  4MS6 A;  3FUD A;  2WMN A;  3LYA A;  2PQR A;  2HYZ A;  3LCA A;  5D0O D;  2WB2 A;  5CMW A;  2PL2 A;  2X6K A;  1HX8 A;  1KT1 A;  4Y6W A;  3T5X A;  2RD0 A;  3FEY A;  3PEU B;  4WWN A;  5E75 A;  4B89 A;  2WXQ A;  3G2S A;  4CDN A;  5T3R A;  3B7R L;  4F7A A;  3QAQ A;  1H2V C;  4H7X A;  3CK8 A;  4I2W A;  1HG5 A;  4CRW A;  2NXP A;  5AYW D;  5HQ8 A;  1PY1 A;  2IJG X;  1TEZ A;  2JLB A;  4UI9 K;  4JZY A;  1JWG A;  3FU5 A;  4CCA A;  1Z6T A;  2XRY A;  1H19 A;  2WM9 A;  3I4R B;  4EEC A;  5BNW A;  3IV0 A;  5HI7 A;  5FT9 A;  4DLO A;  2J07 A;  3D9N A;  3D9P A;  5BT1 A;  5KJK A;  4FC8 A;  1WM5 A;  2MRI A;  4G2V A;  4U0Z A;  5T4Y A;  5FTP A;  4A3T A;  4BX9 A;  5FZS A;  5JJT A;  1OWN A;  5AIJ A;  4A1S A;  2R5S A;  2QY7 A;  4I17 A;  2P58 C;  1JUQ A;  2WXG A;  4RSY A;  1OWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...