2ETBA

Crystal structure of the ankyrin repeat domain of trpv2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
252
structure length
252
Chain Sequence
FDRDRLFSVVSRGVPEELTGLLEYLRWNSKYLTDSAYTEGSTGKTCLMKAVLNLQDGVNACIMPLLQIDKDSGNPKPLVNAQCTDEFYQGHSALHIAIEKRSLQCVKLLVENGADVHLRACGRFFQKHQGTCFYFGELPLSLAACTKQWDVVTYLLENPHQPASLEATDSLGNTVLHALVMIADNSPENSALVIHMYDGLLQMGARLCPTVQLEEISNHQGLTPLKLAAKEGKIEIFRHILQREFSGAAAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title Structure of the N-terminal Ankyrin Repeat Domain of the TRPV2 Ion Channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 94
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2etbA00
3NBNB 4HRMB 5BXOA 2FO1E 5ITZF 3NOGD 3AAAC 5HS0A 4BEPA 4DX5D 4K5CA 1MX4A 5ENQD 1N0RA 4G8KA 1G3NB 1OY3D 5AAOA 4HQDA 5AARA 3JXIA 4DX2A 2V4HC 2RFAA 4U95D 3DEOA 5AQBA 5CEAA 1UOHA 2NYJA 3B95A 5CBNA 5ENTD 5CBOA 1AWCB 4O1OA 4O1PA 4HRLA 4U8VD 3F6QA 5EIBE 3EHQA 4OAVB 3C5RA 4HBDA 5ENSD 3V79K 5FINA 4RLYA 3UTMA 2QYJA 2F8XK 3W9FA 4QFVA 5D66A 3TWWA 3V30A 4N5QA 3TWVA 2B0OE 4QQIA 4J7WA 3HRAA 5EYLA 2BKKB 2J8SD 4CYMD 4Z68A 5AQ9A 5KNGA 1BLXB 2KXPC 2PNNA 3J5QB 2KBXA 3B7BA 5EILA 1DCQA 1SVXA 4UUCA 3D9HA 2AJAA 4HB5A 4GPMA 3V31A 4ATZD 4JB8P 4LG6A 2A5EA 3EU9A 5EYPF 3ZUVB 4DX7D 3JUEA 3Q9NC 3TWXA 5ENRD 2Y0BG 4HI8A 3T8KA 3TWSA 2DVWA 5JMND 1MJ0A 4C48B 5AN8A 1IXVA 3ZKJA 5FIOA 3TWUA 4A63B 4YDYA 3ZNGA 1K1AA 2L6BA 1N0QA 2XEHA 4O60A 5AQ7A 4ZFHA 1AP7A 5EN5D 1OT8A 3IXEA 4BESA 5KNHD 1IHBA 4U96D 1QYMA 2P2CP 1BU9A 1K1BA 1MYOA 2DZOA 5HRYA 5CECB 4G8LA 2JABA 3TWRA 4TUMA 3TWQA 3W9GA 4DX1A 2V5QC 3NOCD 4F1PA 3AJIA 4OAUC 2XEEA 2ETCA 3DEPA 4HNAD 3TWTA 1S70B 1YMPA 5CERB 3EHRA 3LJNA 3V2OA 2F8YA 1YYHA 4F6RD 1BD8A 3KEAA 2QC9A 2DWZA 4HI9A 1MX2A 4YDWA 1A5EA 4GMRA 5CEDB 4BETA 4DX6D 1MX6A 2DZNA 2MYOA 3ZU7B 3Q9UC 4LSZE 2ETBA 3J5PA 5ENPD 4HLLA 5AQAA 1BI8B 5HKPA 4B93B 3V2XA 1D9SA 3T9KA 1BI7B 3UXGA 2ETAA 2HE0A 1WDYA 4CZ2D 2F37A 3SO8A 3JXJA 1SW6A 2XENA 5ENOD 4DUIA 5BXUA 4K5AB 4BERA 4NIKA 1K3ZD 2BKGA 3UI2A 2ZGGA 5EIDA 2ZGDA 3HG0D 4ZHBA 5JA4D 5KWDA 1DC2A 4HRNA 2Y1LE 1TR4A 2XZTG 1NFIE 4K5BA 1YCSB 2RFMA 4J8YA 4U8YD 1IKND 4BSZB 4DRXE 1N11A 5KBAA 4LNUD 2VGEA 2XZDG 1WG0A
chains in the Genus database with same CATH superfamily
3CHOA 5ITZF 4JL0A 4BEPA 3JUIA 5IY5E 2RFAA 5CEAA 2E2EA 3CVXA 2RD0A 5D0OD 1FT1A 5H7PA 4QFVA 3UIPC 2KCVA 3VTXA 2CFZA 3Q4AB 4ATGA 4QQIA 3G2VA 4DI3A 4HOTA 5D2MC 1SVXA 3UM1A 2V0PA 2H6IA 1O1TA 3ISMC 4A3VA 3KSLA 3LY7A 3ABME 3C72A 5G05C 4PS3A 4GA1A 3SNXA 3ZXPA 3FUKA 4HLEA 4EBAG 1TN8A 3TWQA 2ETCA 4GZ3A 1ZBPA 4LRZA 2A5UA 4OYSA 3B7RL 2DZNA 3C3OA 4U7EB 3CVPA 1N52A 4NQ0A 4CZ2D 4G26A 3ZYKA 3RSEG 4L23A 4N5CA 1NFIE 2GRLA 1N11A 3L17A 3IHVA 4I9CA 5KCMA 3DSWA 1KLXA 3D9OA 2X6KA 1LD8A 1OY3D 1FCHA 3SBTB 4JHRA 3U4TA 5BPPA 3CVLA 3E4BA 4OAVB 3ONLA 2P9IG 4K0RA 3MGBA 5ANRA 2RKKA 3Q75A 4N5QA 3U3WA 4GYOA 3FP3A 1BLXB 2J9QA 2R5SA 3P1UA 5JJ7A 2H6HA 1DCQA 4HB5A 5ENRD 2X6IA 3ASGA 3SHFA 3L13A 3CVVA 4BTAA 4WWNA 3ZNGA 3PZ2A 3E34A 4L9PA 4U96D 3FTZA 1JUQA 2KC7A 3TG4A 3RRNB 2JLBA 2F0YA 4YDEA 4DX1A 3LY9A 4HNAD 2GRNB 2CHZA 2DWZA 4HI9A 4CT0A 2MYOA 3E30A 5LOZA 2LXMA 3R7RA 2GRRB 1IQRA 1QBQA 1HO8A 3T9KA 4A55A 3UINC 1H2UA 3SO8A 2C0MA 1XNFA 3GYZA 3I3NA 2AVPA 3QC1A 1QNFA 1TJFA 4KYOB 5FZRA 2H6GA 1EPUA 1OXJA 1LD7A 3FUDA 2FO1E 3FH8A 3HVEB 4AEZC 3RJVA 4I9EA 5AQBA 3EIQC 2WMOA 4GA0A 4KMOA 1TNZA 2XCCA 3B7UX 2Y3AA 3FU0A 4WNEA 3CVUA 2J8SD 4FJYA 2IF4A 3CKBA 3FTSA 3Q49B 4U0SA 3V31A 2WXJA 3RU0A 5BNWA 5BV1A 2J09A 3FTXA 4E6HA 3TWSA 4UI9K 5AN8A 2C2LA 1HXIA 1K1AA 1D8EA 4NRHB 4UWHA 5EN5D 1N54A 4C0MA 1QYMA 1ELWA 4KT6B 1HX8A 3ULQA 5AJLA 2V5QC 4DK5A 4I6GA 4LEUA 5DBKA 3ZHEB 3AG2E 1JCQA 3LYAA 4U0UA 2IONA 4JW1A 4DX6D 3CQGB 3X2QE 4P29A 3BG0B 3UMVA 5ENPD 2PZIA 2HE0A 4XIFA 4A1SA 2X38A 4KVOA 4O6FA 5BV0A 1E7UA 2Y1LE 1Z3YA 4J8FA 3DSSA 4JEUA 4GA2A 3FDHA 3JYSA 3CVWA 4A3TA 1H0AA 3I5PA 3DSVA 3ZEFA 2IEJA 5ENTD 2XPIA 5CBOA 4ANUA 3HIZA 1OWLA 4RLYA 3TWWA 4B8AA 2KCKA 2FEZA 2VSNA 3SY2A 2BKKB 4EHMA 2PNNA 4DPRA 3RRMB 3LCAA 1JWGA 2CG2A 3FUEA 4CDRA 2Y69E 4GAAA 2GRQB 4B89A 1KZPA 3CGHA 4BFRA 5JMND 4Q69A 4AVXA 3BUAA 3ZRHA 3MKQA 2YHEA 2IQCA 3IXEA 5FTPA 4JZYA 5FQ7A 4RG6A 2FF4A 4LUNU 3VLDA 3KSQA 4HOUA 2L9BA 1U3DA 5CCMA 3LS8A 3OAWA 5BT1A 3TWTA 2EIJE 1H2TC 2F8YA 3ONKA 2R05A 4F6RD 1N94A 3U66A 2I6HA 3EJNA 5HKPA 1BI7B 3Q47B 5AJDA 1SW6A 5BXUA 4J8SA 5ARGA 2BKGA 3GZ2A 3P2BA 2WXQA 2ZGDA 3MA5A 1S63A 2PL2A 3CK8A 4K5BA 2VGXA 2RFMA 4DRXE 3B7TA 2LSVA 4LNUD 2VGEA 3UT4A 4HRMB 2IO2C 4GTOA 2AXZA 4XKCA 4K03A 4U0ZA 4L2LA 3E33A 3HXDA 4GZ5A 3SGHA 3AS4A 4MS6A 3PEVB 1TN6A 3OTNA 3L54A 3QAQA 2IY0C 1IQUA 2ZISA 4GTQA 4TXPA 3W9FA 4N3CA 4BSXA 2GRMA 2GW1A 4HXIA 4CRWA 1JPLA 2DYSE 4EZLA 3VTYA 3CR3A 5EX3A 3CK7A 1HZ4A 1KT0A 2XGSA 4KZ0A 3T8KA 5FT9A 3PS6A 2WXLA 1FPPA 5FIOA 1FT2A 4WWPA 2GROB 2VYIA 1MQSA 2DZOA 5HRYA 3UM0A 4BWRA 2JABA 4GZCA 3MJWA 2C0LA 1S70B 1YYHA 4HOQA 3ASNE 2QC9A 2BUGA 2J07A 3LPZA 4G23A 4L1BA 4DLQA 1PAQA 1JCRA 3Q73A 5KJMA 3CLJA 2EQXA 4GCNA 2P9SG 2X6FA 4GZDA 2J4DA 4AOFA 4BSZB 4CDNA 3WXXA 3QARA 1OCOE 5T8IA 3E32A 2YHCA 3WG7E 2H6FA 4N2QA 2BEDA 3UIOC 3S7JA 5KJLA 3F6QA 3SI5A 4CCAA 5JHBA 2XGOA 2B0OE 3PEUB 3ABLE 2KXPC 3MYVA 2KBXA 3SFYA 1SA4A 5LCWJ 3D9HA 4JA9A 4DX7D 4AIFA 3Q9NC 4UI9C 2OV8A 4FC8A 5B1BE 3UX4A 2WXGA 3SZ7A 4H7YA 3OXGA 1OWPA 1N4QA 2FO7A 3AG1E 4LNGA 4TV3A 4HS2A 1BU9A 2UY1A 1Z3XA 5CECB 4MBGA 4GTPA 5M72A 1HG2A 1H6OA 2EIME 3BG1B 2L0IA 3ZYQA 1BD8A 3TXMA 1NP7A 4F1SA 3ML9A 1TEZA 3EIJA 2KCLA 3S7BA 3ZW3A 2XEVA 3DPYA 1HG5A 4B93B 2EILE 3DXKG 4DI4A 1IYGA 2YINA 5ENOD 3O48A 2MHKA 3NAWA 4TXQA 2V8SE 5EIDA 1INZA 3D9IA 4ZHBA 3CQCB 1D8DA 5FWQA 5KBAA 1V55E 3Q7AA 3S7DA 1WG0A 4Q94A 4GTVA 3NOGD 2LAIA 3NB2A 2XHEA 3CEQA 1N9AA 3UM2A 3RRUA 2P9PG 4KBQA 3V79K 2IOLA 1GW6A 2WQ6A 2I1JA 4F7AA 5G04J 4A1GA 1XGWA 5B3SE 4Z68A 5BW8C 4EPZA 2VJ8A 3FH5A 5CMYA 4UUCA 4KVMA 4LG6A 3BEEA 4ANVA 3R9MA 3CV0A 2NC9A 3S7FA 5JHAA 1BPOA 5T3RA 3FEXA 4H7XA 1IXVA 3QNKA 3OXFA 4JHKA 3T5VA 3ZYMA 3QDNA 1UN9A 3FUMA 1Y8MA 1MZCA 3LJNA 2DBAA 3LEWA 5EDSA 4ANXA 4FLHA 3G2UA 2A4ZA 2WXFA 5C2YA 4AP2A 2HYZA 1TN7A 2HM8A 3ASDA 4FJZA 1QQEA 4ACKA 2ETAA 3L22A 2XPZA 3QWPA 3N71A 3ML8A 4YVQC 3FTYA 2ZXWE 3JQ0A 3D9LA 1VDYA 3FU6A 5KWDA 3ENEA 4HORA 1RW2A 2VGXB 4AJWA 3T8MA 4BY6A 4UQYA 4AXHA 5ARFA 3AAAC 4YVOA 4FHKA 4DX2A 4U95D 3SFXA 3MV3B 4Q96A 3MEKA 2VSXE 2CHXA 3C5RA 4PUCA 4PS7A 3NQPA 4D10C 3PUKA 2VSYA 2FI7A 3KD7A 2XRYA 2LO6A 2VTBB 4CGWA 3B7BA 5EILA 4KXKB 1SA5A 3FTUA 4LNBA 2KATA 2FULA 2QYUA 1OWOA 3FUFA 5FQ6A 1MJ0A 2FBNA 3APCA 4M7CA 4XI0A 2XEHA 4R7LA 5DIZA 1NA0A 3FTWA 2IU1A 3PE3A 4JC8A 4OAUC 4DJAA 3T5XA 1YMPA 4I6JA 5AIJA 1TYQG 3UQ3A 1KPSB 3KEAA 3HDXA 1TNUA 4TXRA 3R9AB 1D9SA 3L82A 4W9RA 3CIAA 3UT8A 5A7DB 3ZPJA 3JXJA 4JHJA 2HO1A 4PS8A 5J90A 5JA4D 1UJJA 2XZTG 2CFUA 3MX3A 3IBEA 3UKUG 3AU5A 1DCEA 3AU4A 4J6IA 2WMNA 4PDXA 2EIKE 5G05J 4K5CA 2WQ7A 4G8KA 3C3QA 3RO2A 3DEOA 3D9NA 1YA0A 5CHEE 1B89A 3EU5A 1E8XA 2WXOA 3EHQA 4GB9A 1N95A 3TGOA 3G2TA 2QFCA 2L6JA 3L16A 1OWNA 4IN3B 2OVFA 4HI8A 4BX8A 4GTSA 5J08A 3ZKJA 3KAEA 4A63B 4GMLA 1N0QA 4UQXA 2XS1A 1IHBA 3NZSA 4V3IA 3FH7A 4TRQA 2UY1B 5E76A 4U07A 3EHRA 3PH0C 3MKRA 4XI9A 4GMRA 2GGFA 4BETA 3CVYA 5T4YA 2PQRA 4LSZE 3MCXA 4U04A 3Q7FA 3TJPA 1TJCA 2R02A 2OEVA 3FY4A 2I9CA 2V5FA 2BF0X 3L6AA 4AY6A 3UI2A 4WNDA 4FULA 4HRNA 2WXIA 2DYRE 2LXLA 4UWFA 2I2OA 2XZDG 3NZUA 3CK9A 3HXEA 2BTDA 5CRVA 4DX5D 3LKUA 2R03A 5ENQD 4CEMA 4HQDA 3I4RB 5AARA 1SZAA 2CG3A 2NYJA 3I4GA 4HRLA 5EIBE 1ELRA 4JVSA 4JA7A 1KT1A 3AG3E 1DVPA 2AXUA 4N3BA 4JXTA 4JEHA 3CHQA 1H6PA 3SD5A 4CYMD 4UWKA 1U3CA 5FJYA 2CHWA 3PE4A 4GYWA 4GTMA 2AJAA 1E96B 2WXRA 4GTTA 5EYPF 5E75A 3ABKE 3UKRG 3B7SA 1HH8A 3U9WA 5HQ8A 4IRUA 4F53A 5G2NA 1EYHA 2L0TB 3C98A 3URZA 3D9KA 3B13A 4ZFHA 1OT8A 4X8QA 1WM5A 3FUNA 3PZ4A 1S0PA 3FEYA 5HI7A 4C9BB 2P9UG 3DEPA 3JQ1A 3HYMB 4I2WA 3QB2A 2I1KA 4GPKA 1A5EA 5CEDB 2WXMA 3L08A 3PNTB 1LTXA 1H2VC 1U2VG 3ULYA 3D9PA 1TNOA 1BI8B 3HVEA 4HFGA 3UXGA 5AYWD 3CHSA 4EECA 3S2AA 3HXFA 5FZQA 1TR4A 4B94A 4EQFA 3OXLA 2OCCE 2XQ0A 4GMJA 2B6CA 3ZFWA 3QWWA 1NI1A 3FULA 4J8DA 5ANLA 4URKA 1SQMA 3JXIA 2XCBA 3B95A 5CBNA 4M3OA 4O1OA 5LP0A 3EHMA 2F8XK 1Q2ZA 3V30A 3TWVA 2RG8A 2NXPA 5KNGA 4OVVA 4I2ZA 3DWLG 3DPDA 3TL5A 1QZ2A 2WQHA 3FUHA 4RVBA 2GRPB 3ZHEA 2A5EA 1ELKA 4PH4B 4XKBA 1UG3A 1HFAA 4MLPA 2AXVA 2VQ2A 3VLEA 1K8KG 3CKCA 4YDOA 2R59A 1MYOA 3LJ3A 4TUMA 4I1OB 3Q78A 3SBSA 4F3VA 4FP7A 4E85A 4N2SA 1TNYA 4UWGA 3ZIMA 4J0UA 2QZAA 1H19A 2XENA 2XGMA 1UW4B 4K5AB 3FU3A 4NIKA 1HS6A 5FZSA 2E0IA 4I1MA 4B0ZA 3ASHA 5C1DA 4NURA 3PREA 2J4BA 2Y4UA 4WNGA 3SF4A 3J5PA 3IEGA 4FHJA 2WPVA 3BQOA 4FA6A 3ESKA 4JPSA 3QWVA 1MX4A 3KS2A 4BTBA 5FQ4A 4IULA 1UOHA 4MRUA 4BT8A 3UTMA 5D0QD 2QYJA 1MHQA 3PNLB 5D66A 1Z5SC 2XRZA 5FQ8A 3FHEA 4N39A 5CMWA 2AWIA 4JB8P 3CSFA 3EU9A 4WAFA 1HE8A 3TWXA 2Y0BG 3HXCA 4L2YA 1O1SA 4G11A 1AP7A 4O60A 2P2CP 3EUVA 3NOCD 4ILGA 4BT9A 3LVQE 1W3BA 1OCRE 4FU3A 3FWVA 3ASFA 3MKQB 4I1AA 3ZVVA 1ZU2A 4ME2A 5A6CA 2IOSA 2X6JA 2QY7A 3RKVA 2ZGGA 2IFUA 3HG0D 4GZ6A 4WNFA 1DC2A 5EX0A 3Q79A 1KZOA 3CHPA 2MOWA 3G2SA 3JCKC 3NBNB 5CRUA 3G2WA 2HR2A 1OCCE 4ANWA 1IHGA 3O4ZA 1Z6TA 4ILHB 1PY1A 3NF1A 3LY8A 2P9LG 3CHRA 5FINA 3IHYA 2X6HA 4J7WA 4B8CB 1LF8A 4XX5A 4HOSA 3IKOB 3TAXA 3TG5A 3BU8A 1V54E 3DXMG 4C48B 1HU3A 2WXNA 5LX8A 4I17A 3APDA 3AS5A 4BESA 4UWLA 2KZTA 5JJ6A 2NSZA 1JCSA 3GZSA 3R7QA 3MV2B 3GW4A 4RQIA 4EZKA 1ZB1A 3FUIA 3PDNA 3DSUA 3U64A 4XE0A 4FADA 1MX2A 2MRIA 3Q9UC 3DSXA 3HHMA 1NA3A 2ZIRA 4XEIG 2VSOE 4HLLA 3LDZA 4RG9A 3V2XA 2DIWA 2WXKA 3ESLA 3FU5A 4DUIA 1X81A 4EBAA 3Q5MA 1N4PA 2Y4TA 3ZYLA 1YCSB 3QKYA 2WVIA 4UQZA 5ENNA 2WXHA 4U8YD 5JJTA 4CGVA 1NZNA 4NACA 4UI9J 4AV7A 3GZ1A 2V4LA 2DCPA 3FTVA 3K9IA 4TUUA 4CT4A 2OVBA 1G3NB 4L7TA 1E8ZA 5LFAA 4DLOA 4O1PA 1H6KA 2Q7FA 3Q15A 3AG4E 4LCTA 2P9NG 2UWJG 3RO3A 2YQ8A 3SFZA 4AM9A 5EYLA 1RZ4A 1E8WA 3IV0A 4XZ4A 3ASOE 3TXNA 3D9MA 3UPVA 4C0EA 3E37A 1PC2A 5KJKA 3HXBA 2L6BA 3PVLA 5AQ7A 3PZ1A 5KNHD 1OUVA 4MKTA 4U63A 4G8LA 3W9GA 1EDUA 2KM4A 2XEEA 3C3RA 1E90A 5CERB 4APFA 2WM9A 3EDTB 2LUHA 1SZ9A 3LVRE 5EKQD 5LCWC 3ZN3A 4I43A 5AQAA 4RSYA 5B1AE 2ILRA 4LERA 2M63A 1P5QA 1FVHA 4FLBA 1K3ZD 1X5BA 3RAUA 3ULEG 2P58C 2IJGX 2ZU6B 4CDMA 1OCZE 5AAOA 4J8EA 5CCLA 1A17A 2LSUA 1AWCB 1E8YA 3DRAA 3L9TA 3PZDA 4HBDA 5ENSD 1E7VA 1O5MA 4BX9A 1HF8A 4HVBA 2PM6A 3HRAA 2R2LA 5AQ9A 4I6EA 3J5QB 4ATZD 2VGYA 3ZUVB 1S64A 3CVQA 2PQNA 2DVWA 2IO3C 3TWUA 4YDYA 2X3MA 5KJNA 2OOEA 3RK6A 3QOUA 1Y6IA 1NL4A 1TNBA 1K1BA 4AY5A 4G24A 2YNQA 3VLFA 5G04C 5AENA 3DBSA 4ILIA 3RIBA 2OEWA 3V2OA 4GU5A 4YDWA 1MX6A 3ZU7B 4GTRA 2ETBA 4U8HA 1N4SA 4Y6WA 1JWFA 4WUYA 2F37A 3LXUX 1DNPA 2J08A 4EZJA 3CHMA 3PUJA 2LAHA 3UT7A 1IKND 3QK0A 4WWOA 3UM3A 2VTBA 1L5JA 3CSTA 5BXOA 4ACLA 4APOA 1UJKA 5HS0A 1N0RA 2V4HC 4OVUA 3FUJA 1OWMA 2PM7A 1EF1C 4N3AA 4U8VD 4YNDA 4GCOA 3UUXA 4KZCA 4ABNA 4JD2G 4Y6CA 3DSTA 3PZ3A 5BUZA 5A23A 4G2VA 3FFLA 4GPMA 3JUEA 4GYYA 3D9JA 3D3MA 1N4RA 4G25A 2XS8A 3CVNA 3PRZA 4IYPA 3MZLB 2KZTB 2AW6A 3TWRA 3QJZA 4F1PA 1UN8A 3AJIA 2WXPA 2WB2A 2XPYA 3KEZA 2EINE 2JEKA 1WAO1 2ONDA 3AS8A 1WDYA 1O1RA 3SQVA 3ZXSA 1FVFA 4BERA 3EHNA 2J49A 3ZGQA 2R17C 4G1TA 5G55A 4J8YA 1WY6A 2LNIA 2P9KG 3APFA
chains in the Genus database with same CATH topology
3NBNB 4HRMB 5BXOA 2FO1E 5ITZF 3NOGD 3AAAC 5HS0A 4BEPA 4DX5D 4K5CA 1MX4A 5ENQD 1N0RA 4G8KA 1G3NB 1OY3D 5AAOA 4HQDA 5AARA 3JXIA 4DX2A 2V4HC 2RFAA 4U95D 3DEOA 5AQBA 5CEAA 1UOHA 2NYJA 3B95A 5CBNA 5ENTD 5CBOA 1AWCB 4O1OA 4O1PA 4HRLA 4U8VD 3F6QA 5EIBE 3EHQA 4OAVB 3C5RA 4HBDA 5ENSD 3V79K 5FINA 4RLYA 3UTMA 2QYJA 2F8XK 3W9FA 4QFVA 5D66A 3TWWA 3V30A 4N5QA 3TWVA 2B0OE 4QQIA 4J7WA 3HRAA 5EYLA 2BKKB 2J8SD 4CYMD 4Z68A 5AQ9A 5KNGA 1BLXB 2KXPC 2PNNA 3J5QB 2KBXA 3B7BA 5EILA 1DCQA 1SVXA 4UUCA 3D9HA 2AJAA 4HB5A 4GPMA 3V31A 4ATZD 4JB8P 4LG6A 2A5EA 3EU9A 5EYPF 3ZUVB 4DX7D 3JUEA 3Q9NC 3TWXA 5ENRD 2Y0BG 4HI8A 3T8KA 3TWSA 2DVWA 5JMND 1MJ0A 4C48B 5AN8A 1IXVA 3ZKJA 5FIOA 3TWUA 4A63B 4YDYA 3ZNGA 1K1AA 2L6BA 1N0QA 2XEHA 4O60A 5AQ7A 4ZFHA 1AP7A 5EN5D 1OT8A 3IXEA 4BESA 5KNHD 1IHBA 4U96D 1QYMA 2P2CP 1BU9A 1K1BA 1MYOA 2DZOA 5HRYA 5CECB 4G8LA 2JABA 3TWRA 4TUMA 3TWQA 3W9GA 4DX1A 2V5QC 3NOCD 4F1PA 3AJIA 4OAUC 2XEEA 2ETCA 3DEPA 4HNAD 3TWTA 1S70B 1YMPA 5CERB 3EHRA 3LJNA 3V2OA 2F8YA 1YYHA 4F6RD 1BD8A 3KEAA 2QC9A 2DWZA 4HI9A 1MX2A 4YDWA 1A5EA 4GMRA 5CEDB 4BETA 4DX6D 1MX6A 2DZNA 2MYOA 3ZU7B 3Q9UC 4LSZE 2ETBA 3J5PA 5ENPD 4HLLA 5AQAA 1BI8B 5HKPA 4B93B 3V2XA 1D9SA 3T9KA 1BI7B 3UXGA 2ETAA 2HE0A 1WDYA 4CZ2D 2F37A 3SO8A 3JXJA 1SW6A 2XENA 5ENOD 4DUIA 5BXUA 4K5AB 4BERA 4NIKA 1K3ZD 2BKGA 3UI2A 2ZGGA 5EIDA 2ZGDA 3HG0D 4ZHBA 5JA4D 5KWDA 1DC2A 4HRNA 2Y1LE 1TR4A 2XZTG 1NFIE 4K5BA 1YCSB 2RFMA 4J8YA 4U8YD 1IKND 4BSZB 4DRXE 1N11A 5KBAA 4LNUD 2VGEA 2XZDG 1WG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBN B;  4HRM B;  5BXO A;  2FO1 E;  5ITZ F;  3NOG D;  3AAA C;  5HS0 A;  4BEP A;  4DX5 D;  4K5C A;  1MX4 A;  5ENQ D;  1N0R A;  4G8K A;  1G3N B;  1OY3 D;  5AAO A;  4HQD A;  5AAR A;  3JXI A;  4DX2 A;  2V4H C;  2RFA A;  4U95 D;  3DEO A;  5AQB A;  5CEA A;  1UOH A;  2NYJ A;  3B95 A;  5CBN A;  5ENT D;  5CBO A;  1AWC B;  4O1O A;  4O1P A;  4HRL A;  4U8V D;  3F6Q A;  5EIB E;  3EHQ A;  4OAV B;  3C5R A;  4HBD A;  5ENS D;  3V79 K;  5FIN A;  4RLY A;  3UTM A;  2QYJ A;  2F8X K;  3W9F A;  4QFV A;  5D66 A;  3TWW A;  3V30 A;  4N5Q A;  3TWV A;  2B0O E;  4QQI A;  4J7W A;  3HRA A;  5EYL A;  2BKK B;  2J8S D;  4CYM D;  4Z68 A;  5AQ9 A;  5KNG A;  1BLX B;  2KXP C;  2PNN A;  3J5Q B;  2KBX A;  3B7B A;  5EIL A;  1DCQ A;  1SVX A;  4UUC A;  3D9H A;  2AJA A;  4HB5 A;  4GPM A;  3V31 A;  4ATZ D;  4JB8 P;  4LG6 A;  2A5E A;  3EU9 A;  5EYP F;  3ZUV B;  4DX7 D;  3JUE A;  3Q9N C;  3TWX A;  5ENR D;  2Y0B G;  4HI8 A;  3T8K A;  3TWS A;  2DVW A;  5JMN D;  1MJ0 A;  4C48 B;  5AN8 A;  1IXV A;  3ZKJ A;  5FIO A;  3TWU A;  4A63 B;  4YDY A;  3ZNG A;  1K1A A;  2L6B A;  1N0Q A;  2XEH A;  4O60 A;  5AQ7 A;  4ZFH A;  1AP7 A;  5EN5 D;  1OT8 A;  3IXE A;  4BES A;  5KNH D;  1IHB A;  4U96 D;  1QYM A;  2P2C P;  1BU9 A;  1K1B A;  1MYO A;  2DZO A;  5HRY A;  5CEC B;  4G8L A;  2JAB A;  3TWR A;  4TUM A;  3TWQ A;  3W9G A;  4DX1 A;  2V5Q C;  3NOC D;  4F1P A;  3AJI A;  4OAU C;  2XEE A;  2ETC A;  3DEP A;  4HNA D;  3TWT A;  1S70 B;  1YMP A;  5CER B;  3EHR A;  3LJN A;  3V2O A;  2F8Y A;  1YYH A;  4F6R D;  1BD8 A;  3KEA A;  2QC9 A;  2DWZ A;  4HI9 A;  1MX2 A;  4YDW A;  1A5E A;  4GMR A;  5CED B;  4BET A;  4DX6 D;  1MX6 A;  2DZN A;  2MYO A;  3ZU7 B;  3Q9U C;  4LSZ E;  2ETB A;  3J5P A;  5ENP D;  4HLL A;  5AQA A;  1BI8 B;  5HKP A;  4B93 B;  3V2X A;  1D9S A;  3T9K A;  1BI7 B;  3UXG A;  2ETA A;  2HE0 A;  1WDY A;  4CZ2 D;  2F37 A;  3SO8 A;  3JXJ A;  1SW6 A;  2XEN A;  5ENO D;  4DUI A;  5BXU A;  4K5A B;  4BER A;  4NIK A;  1K3Z D;  2BKG A;  3UI2 A;  2ZGG A;  5EID A;  2ZGD A;  3HG0 D;  4ZHB A;  5JA4 D;  5KWD A;  1DC2 A;  4HRN A;  2Y1L E;  1TR4 A;  2XZT G;  1NFI E;  4K5B A;  1YCS B;  2RFM A;  4J8Y A;  4U8Y D;  1IKN D;  4BSZ B;  4DRX E;  1N11 A;  5KBA A;  4LNU D;  2VGE A;  2XZD G;  1WG0 A; 
#chains in the Genus database with same CATH topology
 3CHO A;  5ITZ F;  4JL0 A;  4BEP A;  3JUI A;  5IY5 E;  2RFA A;  5CEA A;  2E2E A;  3CVX A;  2RD0 A;  5D0O D;  1FT1 A;  5H7P A;  4QFV A;  3UIP C;  2KCV A;  3VTX A;  2CFZ A;  3Q4A B;  4ATG A;  4QQI A;  3G2V A;  4DI3 A;  4HOT A;  5D2M C;  1SVX A;  3UM1 A;  2V0P A;  2H6I A;  1O1T A;  3ISM C;  4A3V A;  3KSL A;  3LY7 A;  3ABM E;  3C72 A;  5G05 C;  4PS3 A;  4GA1 A;  3SNX A;  3ZXP A;  3FUK A;  4HLE A;  4EBA G;  1TN8 A;  3TWQ A;  2ETC A;  4GZ3 A;  1ZBP A;  4LRZ A;  2A5U A;  4OYS A;  3B7R L;  2DZN A;  3C3O A;  4U7E B;  3CVP A;  1N52 A;  4NQ0 A;  4CZ2 D;  4G26 A;  3ZYK A;  3RSE G;  4L23 A;  4N5C A;  1NFI E;  2GRL A;  1N11 A;  3L17 A;  3IHV A;  4I9C A;  5KCM A;  3DSW A;  1KLX A;  3D9O A;  2X6K A;  1LD8 A;  1OY3 D;  1FCH A;  3SBT B;  4JHR A;  3U4T A;  5BPP A;  3CVL A;  3E4B A;  4OAV B;  3ONL A;  2P9I G;  4K0R A;  3MGB A;  5ANR A;  2RKK A;  3Q75 A;  4N5Q A;  3U3W A;  4GYO A;  3FP3 A;  1BLX B;  2J9Q A;  2R5S A;  3P1U A;  5JJ7 A;  2H6H A;  1DCQ A;  4HB5 A;  5ENR D;  2X6I A;  3ASG A;  3SHF A;  3L13 A;  3CVV A;  4BTA A;  4WWN A;  3ZNG A;  3PZ2 A;  3E34 A;  4L9P A;  4U96 D;  3FTZ A;  1JUQ A;  2KC7 A;  3TG4 A;  3RRN B;  2JLB A;  2F0Y A;  4YDE A;  4DX1 A;  3LY9 A;  4HNA D;  2GRN B;  2CHZ A;  2DWZ A;  4HI9 A;  4CT0 A;  2MYO A;  3E30 A;  5LOZ A;  2LXM A;  3R7R A;  2GRR B;  1IQR A;  1QBQ A;  1HO8 A;  3T9K A;  4A55 A;  3UIN C;  1H2U A;  3SO8 A;  2C0M A;  1XNF A;  3GYZ A;  3I3N A;  2AVP A;  3QC1 A;  1QNF A;  1TJF A;  4KYO B;  5FZR A;  2H6G A;  1EPU A;  1OXJ A;  1LD7 A;  3FUD A;  2FO1 E;  3FH8 A;  3HVE B;  4AEZ C;  3RJV A;  4I9E A;  5AQB A;  3EIQ C;  2WMO A;  4GA0 A;  4KMO A;  1TNZ A;  2XCC A;  3B7U X;  2Y3A A;  3FU0 A;  4WNE A;  3CVU A;  2J8S D;  4FJY A;  2IF4 A;  3CKB A;  3FTS A;  3Q49 B;  4U0S A;  3V31 A;  2WXJ A;  3RU0 A;  5BNW A;  5BV1 A;  2J09 A;  3FTX A;  4E6H A;  3TWS A;  4UI9 K;  5AN8 A;  2C2L A;  1HXI A;  1K1A A;  1D8E A;  4NRH B;  4UWH A;  5EN5 D;  1N54 A;  4C0M A;  1QYM A;  1ELW A;  4KT6 B;  1HX8 A;  3ULQ A;  5AJL A;  2V5Q C;  4DK5 A;  4I6G A;  4LEU A;  5DBK A;  3ZHE B;  3AG2 E;  1JCQ A;  3LYA A;  4U0U A;  2ION A;  4JW1 A;  4DX6 D;  3CQG B;  3X2Q E;  4P29 A;  3BG0 B;  3UMV A;  5ENP D;  2PZI A;  2HE0 A;  4XIF A;  4A1S A;  2X38 A;  4KVO A;  4O6F A;  5BV0 A;  1E7U A;  2Y1L E;  1Z3Y A;  4J8F A;  3DSS A;  4JEU A;  4GA2 A;  3FDH A;  3JYS A;  3CVW A;  4A3T A;  1H0A A;  3I5P A;  3DSV A;  3ZEF A;  2IEJ A;  5ENT D;  2XPI A;  5CBO A;  4ANU A;  3HIZ A;  1OWL A;  4RLY A;  3TWW A;  4B8A A;  2KCK A;  2FEZ A;  2VSN A;  3SY2 A;  2BKK B;  4EHM A;  2PNN A;  4DPR A;  3RRM B;  3LCA A;  1JWG A;  2CG2 A;  3FUE A;  4CDR A;  2Y69 E;  4GAA A;  2GRQ B;  4B89 A;  1KZP A;  3CGH A;  4BFR A;  5JMN D;  4Q69 A;  4AVX A;  3BUA A;  3ZRH A;  3MKQ A;  2YHE A;  2IQC A;  3IXE A;  5FTP A;  4JZY A;  5FQ7 A;  4RG6 A;  2FF4 A;  4LUN U;  3VLD A;  3KSQ A;  4HOU A;  2L9B A;  1U3D A;  5CCM A;  3LS8 A;  3OAW A;  5BT1 A;  3TWT A;  2EIJ E;  1H2T C;  2F8Y A;  3ONK A;  2R05 A;  4F6R D;  1N94 A;  3U66 A;  2I6H A;  3EJN A;  5HKP A;  1BI7 B;  3Q47 B;  5AJD A;  1SW6 A;  5BXU A;  4J8S A;  5ARG A;  2BKG A;  3GZ2 A;  3P2B A;  2WXQ A;  2ZGD A;  3MA5 A;  1S63 A;  2PL2 A;  3CK8 A;  4K5B A;  2VGX A;  2RFM A;  4DRX E;  3B7T A;  2LSV A;  4LNU D;  2VGE A;  3UT4 A;  4HRM B;  2IO2 C;  4GTO A;  2AXZ A;  4XKC A;  4K03 A;  4U0Z A;  4L2L A;  3E33 A;  3HXD A;  4GZ5 A;  3SGH A;  3AS4 A;  4MS6 A;  3PEV B;  1TN6 A;  3OTN A;  3L54 A;  3QAQ A;  2IY0 C;  1IQU A;  2ZIS A;  4GTQ A;  4TXP A;  3W9F A;  4N3C A;  4BSX A;  2GRM A;  2GW1 A;  4HXI A;  4CRW A;  1JPL A;  2DYS E;  4EZL A;  3VTY A;  3CR3 A;  5EX3 A;  3CK7 A;  1HZ4 A;  1KT0 A;  2XGS A;  4KZ0 A;  3T8K A;  5FT9 A;  3PS6 A;  2WXL A;  1FPP A;  5FIO A;  1FT2 A;  4WWP A;  2GRO B;  2VYI A;  1MQS A;  2DZO A;  5HRY A;  3UM0 A;  4BWR A;  2JAB A;  4GZC A;  3MJW A;  2C0L A;  1S70 B;  1YYH A;  4HOQ A;  3ASN E;  2QC9 A;  2BUG A;  2J07 A;  3LPZ A;  4G23 A;  4L1B A;  4DLQ A;  1PAQ A;  1JCR A;  3Q73 A;  5KJM A;  3CLJ A;  2EQX A;  4GCN A;  2P9S G;  2X6F A;  4GZD A;  2J4D A;  4AOF A;  4BSZ B;  4CDN A;  3WXX A;  3QAR A;  1OCO E;  5T8I A;  3E32 A;  2YHC A;  3WG7 E;  2H6F A;  4N2Q A;  2BED A;  3UIO C;  3S7J A;  5KJL A;  3F6Q A;  3SI5 A;  4CCA A;  5JHB A;  2XGO A;  2B0O E;  3PEU B;  3ABL E;  2KXP C;  3MYV A;  2KBX A;  3SFY A;  1SA4 A;  5LCW J;  3D9H A;  4JA9 A;  4DX7 D;  4AIF A;  3Q9N C;  4UI9 C;  2OV8 A;  4FC8 A;  5B1B E;  3UX4 A;  2WXG A;  3SZ7 A;  4H7Y A;  3OXG A;  1OWP A;  1N4Q A;  2FO7 A;  3AG1 E;  4LNG A;  4TV3 A;  4HS2 A;  1BU9 A;  2UY1 A;  1Z3X A;  5CEC B;  4MBG A;  4GTP A;  5M72 A;  1HG2 A;  1H6O A;  2EIM E;  3BG1 B;  2L0I A;  3ZYQ A;  1BD8 A;  3TXM A;  1NP7 A;  4F1S A;  3ML9 A;  1TEZ A;  3EIJ A;  2KCL A;  3S7B A;  3ZW3 A;  2XEV A;  3DPY A;  1HG5 A;  4B93 B;  2EIL E;  3DXK G;  4DI4 A;  1IYG A;  2YIN A;  5ENO D;  3O48 A;  2MHK A;  3NAW A;  4TXQ A;  2V8S E;  5EID A;  1INZ A;  3D9I A;  4ZHB A;  3CQC B;  1D8D A;  5FWQ A;  5KBA A;  1V55 E;  3Q7A A;  3S7D A;  1WG0 A;  4Q94 A;  4GTV A;  3NOG D;  2LAI A;  3NB2 A;  2XHE A;  3CEQ A;  1N9A A;  3UM2 A;  3RRU A;  2P9P G;  4KBQ A;  3V79 K;  2IOL A;  1GW6 A;  2WQ6 A;  2I1J A;  4F7A A;  5G04 J;  4A1G A;  1XGW A;  5B3S E;  4Z68 A;  5BW8 C;  4EPZ A;  2VJ8 A;  3FH5 A;  5CMY A;  4UUC A;  4KVM A;  4LG6 A;  3BEE A;  4ANV A;  3R9M A;  3CV0 A;  2NC9 A;  3S7F A;  5JHA A;  1BPO A;  5T3R A;  3FEX A;  4H7X A;  1IXV A;  3QNK A;  3OXF A;  4JHK A;  3T5V A;  3ZYM A;  3QDN A;  1UN9 A;  3FUM A;  1Y8M A;  1MZC A;  3LJN A;  2DBA A;  3LEW A;  5EDS A;  4ANX A;  4FLH A;  3G2U A;  2A4Z A;  2WXF A;  5C2Y A;  4AP2 A;  2HYZ A;  1TN7 A;  2HM8 A;  3ASD A;  4FJZ A;  1QQE A;  4ACK A;  2ETA A;  3L22 A;  2XPZ A;  3QWP A;  3N71 A;  3ML8 A;  4YVQ C;  3FTY A;  2ZXW E;  3JQ0 A;  3D9L A;  1VDY A;  3FU6 A;  5KWD A;  3ENE A;  4HOR A;  1RW2 A;  2VGX B;  4AJW A;  3T8M A;  4BY6 A;  4UQY A;  4AXH A;  5ARF A;  3AAA C;  4YVO A;  4FHK A;  4DX2 A;  4U95 D;  3SFX A;  3MV3 B;  4Q96 A;  3MEK A;  2VSX E;  2CHX A;  3C5R A;  4PUC A;  4PS7 A;  3NQP A;  4D10 C;  3PUK A;  2VSY A;  2FI7 A;  3KD7 A;  2XRY A;  2LO6 A;  2VTB B;  4CGW A;  3B7B A;  5EIL A;  4KXK B;  1SA5 A;  3FTU A;  4LNB A;  2KAT A;  2FUL A;  2QYU A;  1OWO A;  3FUF A;  5FQ6 A;  1MJ0 A;  2FBN A;  3APC A;  4M7C A;  4XI0 A;  2XEH A;  4R7L A;  5DIZ A;  1NA0 A;  3FTW A;  2IU1 A;  3PE3 A;  4JC8 A;  4OAU C;  4DJA A;  3T5X A;  1YMP A;  4I6J A;  5AIJ A;  1TYQ G;  3UQ3 A;  1KPS B;  3KEA A;  3HDX A;  1TNU A;  4TXR A;  3R9A B;  1D9S A;  3L82 A;  4W9R A;  3CIA A;  3UT8 A;  5A7D B;  3ZPJ A;  3JXJ A;  4JHJ A;  2HO1 A;  4PS8 A;  5J90 A;  5JA4 D;  1UJJ A;  2XZT G;  2CFU A;  3MX3 A;  3IBE A;  3UKU G;  3AU5 A;  1DCE A;  3AU4 A;  4J6I A;  2WMN A;  4PDX A;  2EIK E;  5G05 J;  4K5C A;  2WQ7 A;  4G8K A;  3C3Q A;  3RO2 A;  3DEO A;  3D9N A;  1YA0 A;  5CHE E;  1B89 A;  3EU5 A;  1E8X A;  2WXO A;  3EHQ A;  4GB9 A;  1N95 A;  3TGO A;  3G2T A;  2QFC A;  2L6J A;  3L16 A;  1OWN A;  4IN3 B;  2OVF A;  4HI8 A;  4BX8 A;  4GTS A;  5J08 A;  3ZKJ A;  3KAE A;  4A63 B;  4GML A;  1N0Q A;  4UQX A;  2XS1 A;  1IHB A;  3NZS A;  4V3I A;  3FH7 A;  4TRQ A;  2UY1 B;  5E76 A;  4U07 A;  3EHR A;  3PH0 C;  3MKR A;  4XI9 A;  4GMR A;  2GGF A;  4BET A;  3CVY A;  5T4Y A;  2PQR A;  4LSZ E;  3MCX A;  4U04 A;  3Q7F A;  3TJP A;  1TJC A;  2R02 A;  2OEV A;  3FY4 A;  2I9C A;  2V5F A;  2BF0 X;  3L6A A;  4AY6 A;  3UI2 A;  4WND A;  4FUL A;  4HRN A;  2WXI A;  2DYR E;  2LXL A;  4UWF A;  2I2O A;  2XZD G;  3NZU A;  3CK9 A;  3HXE A;  2BTD A;  5CRV A;  4DX5 D;  3LKU A;  2R03 A;  5ENQ D;  4CEM A;  4HQD A;  3I4R B;  5AAR A;  1SZA A;  2CG3 A;  2NYJ A;  3I4G A;  4HRL A;  5EIB E;  1ELR A;  4JVS A;  4JA7 A;  1KT1 A;  3AG3 E;  1DVP A;  2AXU A;  4N3B A;  4JXT A;  4JEH A;  3CHQ A;  1H6P A;  3SD5 A;  4CYM D;  4UWK A;  1U3C A;  5FJY A;  2CHW A;  3PE4 A;  4GYW A;  4GTM A;  2AJA A;  1E96 B;  2WXR A;  4GTT A;  5EYP F;  5E75 A;  3ABK E;  3UKR G;  3B7S A;  1HH8 A;  3U9W A;  5HQ8 A;  4IRU A;  4F53 A;  5G2N A;  1EYH A;  2L0T B;  3C98 A;  3URZ A;  3D9K A;  3B13 A;  4ZFH A;  1OT8 A;  4X8Q A;  1WM5 A;  3FUN A;  3PZ4 A;  1S0P A;  3FEY A;  5HI7 A;  4C9B B;  2P9U G;  3DEP A;  3JQ1 A;  3HYM B;  4I2W A;  3QB2 A;  2I1K A;  4GPK A;  1A5E A;  5CED B;  2WXM A;  3L08 A;  3PNT B;  1LTX A;  1H2V C;  1U2V G;  3ULY A;  3D9P A;  1TNO A;  1BI8 B;  3HVE A;  4HFG A;  3UXG A;  5AYW D;  3CHS A;  4EEC A;  3S2A A;  3HXF A;  5FZQ A;  1TR4 A;  4B94 A;  4EQF A;  3OXL A;  2OCC E;  2XQ0 A;  4GMJ A;  2B6C A;  3ZFW A;  3QWW A;  1NI1 A;  3FUL A;  4J8D A;  5ANL A;  4URK A;  1SQM A;  3JXI A;  2XCB A;  3B95 A;  5CBN A;  4M3O A;  4O1O A;  5LP0 A;  3EHM A;  2F8X K;  1Q2Z A;  3V30 A;  3TWV A;  2RG8 A;  2NXP A;  5KNG A;  4OVV A;  4I2Z A;  3DWL G;  3DPD A;  3TL5 A;  1QZ2 A;  2WQH A;  3FUH A;  4RVB A;  2GRP B;  3ZHE A;  2A5E A;  1ELK A;  4PH4 B;  4XKB A;  1UG3 A;  1HFA A;  4MLP A;  2AXV A;  2VQ2 A;  3VLE A;  1K8K G;  3CKC A;  4YDO A;  2R59 A;  1MYO A;  3LJ3 A;  4TUM A;  4I1O B;  3Q78 A;  3SBS A;  4F3V A;  4FP7 A;  4E85 A;  4N2S A;  1TNY A;  4UWG A;  3ZIM A;  4J0U A;  2QZA A;  1H19 A;  2XEN A;  2XGM A;  1UW4 B;  4K5A B;  3FU3 A;  4NIK A;  1HS6 A;  5FZS A;  2E0I A;  4I1M A;  4B0Z A;  3ASH A;  5C1D A;  4NUR A;  3PRE A;  2J4B A;  2Y4U A;  4WNG A;  3SF4 A;  3J5P A;  3IEG A;  4FHJ A;  2WPV A;  3BQO A;  4FA6 A;  3ESK A;  4JPS A;  3QWV A;  1MX4 A;  3KS2 A;  4BTB A;  5FQ4 A;  4IUL A;  1UOH A;  4MRU A;  4BT8 A;  3UTM A;  5D0Q D;  2QYJ A;  1MHQ A;  3PNL B;  5D66 A;  1Z5S C;  2XRZ A;  5FQ8 A;  3FHE A;  4N39 A;  5CMW A;  2AWI A;  4JB8 P;  3CSF A;  3EU9 A;  4WAF A;  1HE8 A;  3TWX A;  2Y0B G;  3HXC A;  4L2Y A;  1O1S A;  4G11 A;  1AP7 A;  4O60 A;  2P2C P;  3EUV A;  3NOC D;  4ILG A;  4BT9 A;  3LVQ E;  1W3B A;  1OCR E;  4FU3 A;  3FWV A;  3ASF A;  3MKQ B;  4I1A A;  3ZVV A;  1ZU2 A;  4ME2 A;  5A6C A;  2IOS A;  2X6J A;  2QY7 A;  3RKV A;  2ZGG A;  2IFU A;  3HG0 D;  4GZ6 A;  4WNF A;  1DC2 A;  5EX0 A;  3Q79 A;  1KZO A;  3CHP A;  2MOW A;  3G2S A;  3JCK C;  3NBN B;  5CRU A;  3G2W A;  2HR2 A;  1OCC E;  4ANW A;  1IHG A;  3O4Z A;  1Z6T A;  4ILH B;  1PY1 A;  3NF1 A;  3LY8 A;  2P9L G;  3CHR A;  5FIN A;  3IHY A;  2X6H A;  4J7W A;  4B8C B;  1LF8 A;  4XX5 A;  4HOS A;  3IKO B;  3TAX A;  3TG5 A;  3BU8 A;  1V54 E;  3DXM G;  4C48 B;  1HU3 A;  2WXN A;  5LX8 A;  4I17 A;  3APD A;  3AS5 A;  4BES A;  4UWL A;  2KZT A;  5JJ6 A;  2NSZ A;  1JCS A;  3GZS A;  3R7Q A;  3MV2 B;  3GW4 A;  4RQI A;  4EZK A;  1ZB1 A;  3FUI A;  3PDN A;  3DSU A;  3U64 A;  4XE0 A;  4FAD A;  1MX2 A;  2MRI A;  3Q9U C;  3DSX A;  3HHM A;  1NA3 A;  2ZIR A;  4XEI G;  2VSO E;  4HLL A;  3LDZ A;  4RG9 A;  3V2X A;  2DIW A;  2WXK A;  3ESL A;  3FU5 A;  4DUI A;  1X81 A;  4EBA A;  3Q5M A;  1N4P A;  2Y4T A;  3ZYL A;  1YCS B;  3QKY A;  2WVI A;  4UQZ A;  5ENN A;  2WXH A;  4U8Y D;  5JJT A;  4CGV A;  1NZN A;  4NAC A;  4UI9 J;  4AV7 A;  3GZ1 A;  2V4L A;  2DCP A;  3FTV A;  3K9I A;  4TUU A;  4CT4 A;  2OVB A;  1G3N B;  4L7T A;  1E8Z A;  5LFA A;  4DLO A;  4O1P A;  1H6K A;  2Q7F A;  3Q15 A;  3AG4 E;  4LCT A;  2P9N G;  2UWJ G;  3RO3 A;  2YQ8 A;  3SFZ A;  4AM9 A;  5EYL A;  1RZ4 A;  1E8W A;  3IV0 A;  4XZ4 A;  3ASO E;  3TXN A;  3D9M A;  3UPV A;  4C0E A;  3E37 A;  1PC2 A;  5KJK A;  3HXB A;  2L6B A;  3PVL A;  5AQ7 A;  3PZ1 A;  5KNH D;  1OUV A;  4MKT A;  4U63 A;  4G8L A;  3W9G A;  1EDU A;  2KM4 A;  2XEE A;  3C3R A;  1E90 A;  5CER B;  4APF A;  2WM9 A;  3EDT B;  2LUH A;  1SZ9 A;  3LVR E;  5EKQ D;  5LCW C;  3ZN3 A;  4I43 A;  5AQA A;  4RSY A;  5B1A E;  2ILR A;  4LER A;  2M63 A;  1P5Q A;  1FVH A;  4FLB A;  1K3Z D;  1X5B A;  3RAU A;  3ULE G;  2P58 C;  2IJG X;  2ZU6 B;  4CDM A;  1OCZ E;  5AAO A;  4J8E A;  5CCL A;  1A17 A;  2LSU A;  1AWC B;  1E8Y A;  3DRA A;  3L9T A;  3PZD A;  4HBD A;  5ENS D;  1E7V A;  1O5M A;  4BX9 A;  1HF8 A;  4HVB A;  2PM6 A;  3HRA A;  2R2L A;  5AQ9 A;  4I6E A;  3J5Q B;  4ATZ D;  2VGY A;  3ZUV B;  1S64 A;  3CVQ A;  2PQN A;  2DVW A;  2IO3 C;  3TWU A;  4YDY A;  2X3M A;  5KJN A;  2OOE A;  3RK6 A;  3QOU A;  1Y6I A;  1NL4 A;  1TNB A;  1K1B A;  4AY5 A;  4G24 A;  2YNQ A;  3VLF A;  5G04 C;  5AEN A;  3DBS A;  4ILI A;  3RIB A;  2OEW A;  3V2O A;  4GU5 A;  4YDW A;  1MX6 A;  3ZU7 B;  4GTR A;  2ETB A;  4U8H A;  1N4S A;  4Y6W A;  1JWF A;  4WUY A;  2F37 A;  3LXU X;  1DNP A;  2J08 A;  4EZJ A;  3CHM A;  3PUJ A;  2LAH A;  3UT7 A;  1IKN D;  3QK0 A;  4WWO A;  3UM3 A;  2VTB A;  1L5J A;  3CST A;  5BXO A;  4ACL A;  4APO A;  1UJK A;  5HS0 A;  1N0R A;  2V4H C;  4OVU A;  3FUJ A;  1OWM A;  2PM7 A;  1EF1 C;  4N3A A;  4U8V D;  4YND A;  4GCO A;  3UUX A;  4KZC A;  4ABN A;  4JD2 G;  4Y6C A;  3DST A;  3PZ3 A;  5BUZ A;  5A23 A;  4G2V A;  3FFL A;  4GPM A;  3JUE A;  4GYY A;  3D9J A;  3D3M A;  1N4R A;  4G25 A;  2XS8 A;  3CVN A;  3PRZ A;  4IYP A;  3MZL B;  2KZT B;  2AW6 A;  3TWR A;  3QJZ A;  4F1P A;  1UN8 A;  3AJI A;  2WXP A;  2WB2 A;  2XPY A;  3KEZ A;  2EIN E;  2JEK A;  1WAO 1;  2OND A;  3AS8 A;  1WDY A;  1O1R A;  3SQV A;  3ZXS A;  1FVF A;  4BER A;  3EHN A;  2J49 A;  3ZGQ A;  2R17 C;  4G1T A;  5G55 A;  4J8Y A;  1WY6 A;  2LNI A;  2P9K G;  3APF A; 
#chains in the Genus database with same CATH homology
 3NBN B;  4HRM B;  5BXO A;  2FO1 E;  5ITZ F;  3NOG D;  3AAA C;  5HS0 A;  4BEP A;  4DX5 D;  4K5C A;  1MX4 A;  5ENQ D;  1N0R A;  4G8K A;  1G3N B;  1OY3 D;  5AAO A;  4HQD A;  5AAR A;  3JXI A;  4DX2 A;  2V4H C;  2RFA A;  4U95 D;  3DEO A;  5AQB A;  5CEA A;  1UOH A;  2NYJ A;  3B95 A;  5CBN A;  5ENT D;  5CBO A;  1AWC B;  4O1O A;  4O1P A;  4HRL A;  4U8V D;  3F6Q A;  5EIB E;  3EHQ A;  4OAV B;  3C5R A;  4HBD A;  5ENS D;  3V79 K;  5FIN A;  4RLY A;  3UTM A;  2QYJ A;  2F8X K;  3W9F A;  4QFV A;  5D66 A;  3TWW A;  3V30 A;  4N5Q A;  3TWV A;  2B0O E;  4QQI A;  4J7W A;  3HRA A;  5EYL A;  2BKK B;  2J8S D;  4CYM D;  4Z68 A;  5AQ9 A;  5KNG A;  1BLX B;  2KXP C;  2PNN A;  3J5Q B;  2KBX A;  3B7B A;  5EIL A;  1DCQ A;  1SVX A;  4UUC A;  3D9H A;  2AJA A;  4HB5 A;  4GPM A;  3V31 A;  4ATZ D;  4JB8 P;  4LG6 A;  2A5E A;  3EU9 A;  5EYP F;  3ZUV B;  4DX7 D;  3JUE A;  3Q9N C;  3TWX A;  5ENR D;  2Y0B G;  4HI8 A;  3T8K A;  3TWS A;  2DVW A;  5JMN D;  1MJ0 A;  4C48 B;  5AN8 A;  1IXV A;  3ZKJ A;  5FIO A;  3TWU A;  4A63 B;  4YDY A;  3ZNG A;  1K1A A;  2L6B A;  1N0Q A;  2XEH A;  4O60 A;  5AQ7 A;  4ZFH A;  1AP7 A;  5EN5 D;  1OT8 A;  3IXE A;  4BES A;  5KNH D;  1IHB A;  4U96 D;  1QYM A;  2P2C P;  1BU9 A;  1K1B A;  1MYO A;  2DZO A;  5HRY A;  5CEC B;  4G8L A;  2JAB A;  3TWR A;  4TUM A;  3TWQ A;  3W9G A;  4DX1 A;  2V5Q C;  3NOC D;  4F1P A;  3AJI A;  4OAU C;  2XEE A;  2ETC A;  3DEP A;  4HNA D;  3TWT A;  1S70 B;  1YMP A;  5CER B;  3EHR A;  3LJN A;  3V2O A;  2F8Y A;  1YYH A;  4F6R D;  1BD8 A;  3KEA A;  2QC9 A;  2DWZ A;  4HI9 A;  1MX2 A;  4YDW A;  1A5E A;  4GMR A;  5CED B;  4BET A;  4DX6 D;  1MX6 A;  2DZN A;  2MYO A;  3ZU7 B;  3Q9U C;  4LSZ E;  2ETB A;  3J5P A;  5ENP D;  4HLL A;  5AQA A;  1BI8 B;  5HKP A;  4B93 B;  3V2X A;  1D9S A;  3T9K A;  1BI7 B;  3UXG A;  2ETA A;  2HE0 A;  1WDY A;  4CZ2 D;  2F37 A;  3SO8 A;  3JXJ A;  1SW6 A;  2XEN A;  5ENO D;  4DUI A;  5BXU A;  4K5A B;  4BER A;  4NIK A;  1K3Z D;  2BKG A;  3UI2 A;  2ZGG A;  5EID A;  2ZGD A;  3HG0 D;  4ZHB A;  5JA4 D;  5KWD A;  1DC2 A;  4HRN A;  2Y1L E;  1TR4 A;  2XZT G;  1NFI E;  4K5B A;  1YCS B;  2RFM A;  4J8Y A;  4U8Y D;  1IKN D;  4BSZ B;  4DRX E;  1N11 A;  5KBA A;  4LNU D;  2VGE A;  2XZD G;  1WG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...