2ETBA

Crystal structure of the ankyrin repeat domain of trpv2
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
252
structure length
252
Chain Sequence
FDRDRLFSVVSRGVPEELTGLLEYLRWNSKYLTDSAYTEGSTGKTCLMKAVLNLQDGVNACIMPLLQIDKDSGNPKPLVNAQCTDEFYQGHSALHIAIEKRSLQCVKLLVENGADVHLRACGRFFQKHQGTCFYFGELPLSLAACTKQWDVVTYLLENPHQPASLEATDSLGNTVLHALVMIADNSPENSALVIHMYDGLLQMGARLCPTVQLEEISNHQGLTPLKLAAKEGKIEIFRHILQREFSGAAAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-terminal Ankyrin Repeat Domain of the TRPV2 Ion Channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords Transient receptor potential cation channel subfamily V memb
total genus 94
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2etbA00
2ETCA 2NYJA 4DX2A 3NOGD 4HRNA 5ENQD 2RFMA 1QYMA 3IXEA 2HE0A 5CBOA 4HI8A 5FINA 4GMRA 5JMND 5EYLA 3C5RA 3V2XA 3W9FA 1DCQA 2DZOA 1N0QA 3EHRA 3NBNB 4U95D 1YMPA 3HG0D 1BD8A 2MYOA 1OY3D 1K1AA 4J7WA 4BERA 4O1OA 5KNGA 2A5EA 3UXGA 4O60A 4YDWA 5D66A 1K1BA 2QC9A 3ZKJA 4CYMD 2XZTG 5CEAA 5JA4D 4OAUC 1A5EA 3TWXA 4U96D 3NOCD 3UTMA 1S70B 3UI2A 2VGEA 3TWVA 2Y0BG 3TWUA 3V30A 5CECB 2F8YA 3TWSA 2BKGA 2ETAA 3B7BA 4OAVB 4RLYA 1N0RA 2J8SD 3AAAC 3KEAA 3J5PA 2ZGGA 1NFIE 4G8KA 4QFVA 4G8LA 4DRXE 5EIBE 4BESA 3DEPA 2JABA 3JXJA 1MYOA 3JXIA 1MJ0A 1UOHA 2XEEA 4O1PA 2ZGDA 4HQDA 4ZHBA 4LNUD 1IKND 5BXOA 3B95A 4NIKA 5CBNA 4K5CA 4K5BA 1G3NB 1TR4A 3TWTA 3TWRA 1SVXA 3V2OA 3F6QA 5AQBA 4U8YD 4HLLA 5HRYA 1AWCB 3AJIA 2AJAA 4J8YA 1AP7A 1N11A 1MX2A 2RFAA 4LSZE 4N5QA 3Q9UC 2L6BA 2V4HC 1BI8B 5AN8A 2V5QC 5ENPD 1MX4A 2F8XK 4YDYA 2F37A 2XZDG 4BETA 4ZFHA 2ETBA 5AQAA 4HB5A 4A63B 4DX5D 4Z68A 1MX6A 3DEOA 3TWQA 4C48B 4K5AB 5FIOA 4HBDA 2DZNA 3HRAA 4DX1A 3Q9NC 3JUEA 4DUIA 4B93B 1WG0A 1SW6A 3T8KA 1WDYA 1K3ZD 2XEHA 4DX7D 3V31A 3LJNA 2B0OE 1OT8A 2KXPC 2P2CP 2DVWA 2Y1LE 5ENOD 5ENRD 5ENTD 4ATZD 4F1PA 4LG6A 5KBAA 5HKPA 4F6RD 3ZU7B 5CEDB 5EYPF 1YCSB 2KBXA 3J5QB 5AQ7A 4BSZB 4HRLA 4DX6D 5AQ9A 4TUMA 2XENA 4HI9A 5KNHD 1BU9A 3TWWA 4BEPA 5ENSD 3W9GA 5CERB 5EILA 2DWZA 5EN5D 5BXUA 5HS0A 3ZUVB 3V79K 1D9SA 1DC2A 1BI7B 1IXVA 5KWDA 2QYJA 4UUCA 5EIDA 5ITZF 4U8VD 2PNNA 3T9KA 2BKKB 4HRMB 2FO1E 4CZ2D 4HNAD 4GPMA 3EU9A 1YYHA 1IHBA 3D9HA 1BLXB 3EHQA 4QQIA 3SO8A 4JB8P 5AARA 5AAOA 3ZNGA
chains in the Genus database with same CATH superfamily
4GU5A 4B8CB 2VSYA 1RZ4A 2KC7A 2MRIA 3FUMA 4BERA 4YDWA 1BPOA 4L7TA 3V30A 2VYIA 4RG9A 3ULQA 3L13A 4G8KA 1LD8A 3CVYA 4NACA 3PEUB 1UOHA 3MV3B 3AS4A 3TG4A 1Y6IA 3G2TA 1HZ4A 3V2OA 4FC8A 2X6IA 1OWOA 2AJAA 3U4TA 3SQVA 4N5QA 2R02A 5AYWD 4HB5A 5CHEE 4KMOA 2P9UG 4FA6A 5BNWA 4J8DA 4I2WA 3CK8A 2IQCA 1H6OA 3P2BA 5CEDB 3J5QB 5AQ9A 4LNGA 2YNQA 2ZU6B 1IXVA 1ELKA 2OEWA 4BTAA 5EIDA 3T9KA 2BKKB 4TRQA 2EIME 3LPZA 5BPPA 3C72A 3CSTA 2XRYA 5AARA 5ENNA 4DX2A 5G2NA 5ENQD 5LX8A 4GMRA 2AWIA 2CHWA 3GZSA 4GTRA 2QY7A 3R7RA 3NB2A 1K1AA 3PZ4A 3TG5A 4WWNA 2A5EA 1E90A 3Q4AB 1H2UA 3ZXPA 4AM9A 3AS8A 3QWVA 3ASDA 2HM8A 4JC8A 2ETAA 2WVIA 1LD7A 3KEAA 3LCAA 4DJAA 2FBNA 4FHKA 2P9IG 3E32A 4G23A 3JXIA 4WUYA 1TEZA 3B95A 2NSZA 2C0LA 3FUNA 3CVXA 3SD5A 3CHPA 1MX4A 3VLDA 3HXDA 4ATGA 3D9JA 2WMNA 3CVQA 1VDYA 2GRPB 3Q9NC 5G05J 1H2VC 2VGXA 4JEHA 4CT0A 4FP7A 2XGMA 3PVLA 2FEZA 4BX8A 3ASFA 4APOA 4F1PA 3MX3A 1HG2A 4WNEA 2P9LG 5FWQA 3KAEA 1P5QA 3ASOE 5LP0A 4K0RA 1D9SA 4BX9A 3CVLA 4GTSA 4I1MA 5D2MC 4CRWA 1FPPA 2WXPA 3FTWA 4U0UA 3EU9A 5FQ4A 4U07A 3ZRHA 3NAWA 4HS2A 3GZ1A 3IXEA 3RKVA 4BT9A 2EIKE 5FJYA 3CHMA 3ZXSA 5EX3A 3CSFA 2WXIA 1IYGA 4Q96A 1OY3D 2FF4A 3I4GA 4N2QA 3UT7A 3CK7A 4F3VA 5LFAA 3PS6A 4FLBA 4BFRA 3D9LA 4ANXA 2F8YA 3G2VA 3S7JA 4JHJA 2KZTB 4YDEA 2MHKA 1N52A 4FU3A 4G8LA 3MCXA 3BU8A 4LNUD 1LTXA 2QZAA 2XGSA 3TWTA 1TR4A 4FJYA 2IEJA 3QJZA 1AWCB 2F8XK 2F37A 2ETBA 4UQYA 4A63B 3HXEA 4G11A 1KLXA 1WAO1 1KPSB 3CHRA 3ENEA 2GRMA 2YINA 4H7XA 1INZA 4AV7A 3B7RL 3NF1A 2CG2A 4N39A 5CMWA 4PS8A 1QNFA 1YYHA 1NI1A 3HXFA 4KYOB 3NQPA 1V55E 3IEGA 2GROB 4GA1A 4TXQA 4EPZA 5FINA 4KZCA 2XCCA 1E8ZA 1X81A 3EDTB 1N4QA 2CHZA 4L2LA 4KVOA 2WXJA 3P1UA 4U0SA 3DBSA 3CHQA 4OYSA 3ABKE 2P9KG 1TNBA 4HFGA 5IY5E 3NOCD 2B6CA 4GCOA 2ILRA 1HO8A 4XIFA 2LXMA 2XS1A 5JJ7A 3PREA 5T4YA 3GW4A 1AP7A 2GRNB 2KATA 2WMOA 4BETA 3ONKA 4F7AA 2Y3AA 4EZJA 1PC2A 1UN9A 3CHSA 3UT8A 5B1BE 3UM1A 3APCA 3L22A 2GGFA 2ONDA 1WDYA 2PL2A 2AXZA 2CHXA 2IOLA 1IQRA 5HQ8A 5FQ7A 2CG3A 2J08A 3QC1A 1H6KA 4FHJA 4GZ5A 3VLEA 2JLBA 2NXPA 3OXFA 4KXKB 5BUZA 3RRNB 3UQ3A 5ITZF 1FCHA 2PM6A 1A17A 4GTPA 1IHBA 5AAOA 4HRNA 2E2EA 5EYLA 2DZOA 1IQUA 1N0QA 4GB9A 4M7CA 1ELWA 1N4RA 3UT4A 3EIJA 3ONLA 2AVPA 3UMVA 3I4RB 3FEXA 4TUUA 4HOSA 3K9IA 2XZTG 3CKCA 1A5EA 1SA4A 4TXPA 3DPDA 3LJ3A 4I2ZA 2WB2A 5CECB 4DK5A 1PAQA 4I9CA 4GYYA 2JABA 4MLPA 3AG2E 1MYOA 3X2QE 4UWHA 3PEVB 2P9SG 5BXOA 4NIKA 1D8DA 3AG3E 1E7UA 4Q94A 3ZYQA 4J8YA 2QFCA 4PS7A 5FZRA 2V5QC 3OAWA 1DC2A 2XZDG 5LCWJ 3RSEG 4UI9C 4I43A 2VGYA 3HRAA 2I1KA 4JA7A 1OWMA 4GCNA 1X5BA 3D9IA 5C1DA 3LVRE 3CK9A 2WXFA 2IU1A 3LJNA 2QYUA 3IHVA 5ENTD 4ATZD 4GAAA 1S64A 1HU3A 2DBAA 3QK0A 2XQ0A 1S0PA 5BV0A 3FEYA 1HFAA 5ANLA 2XPZA 3L9TA 4YNDA 5FZSA 3I5PA 3FTVA 2CFZA 3ZW3A 5EX0A 4U8VD 1WM5A 5JHBA 2KZTA 2BF0X 4DLOA 1S63A 3D9PA 4R7LA 1H0AA 3LY7A 3DSUA 2FULA 2X6JA 4G26A 4P29A 3C5RA 4BSXA 5T8IA 2FO7A 2XEVA 3Q75A 1RW2A 3FTYA 1TNOA 2P9PG 4NRHB 4G24A 3QARA 4FJZA 2WXQA 5KJKA 3TWXA 4Y6CA 3KD7A 4ANVA 3CR3A 2WXLA 1OXJA 2AW6A 4GZ6A 2XEEA 4JD2G 4FULA 3PZ1A 4UWGA 3ABLE 4ZHBA 4XX5A 5AQBA 4A1SA 1E8YA 2L0IA 2ZISA 4DI3A 4JHRA 4XKBA 5FIOA 3FU6A 4KVMA 3MEKA 3IHYA 1SW6A 4ABNA 5ENRD 1O1SA 3PZ2A 3S2AA 3PDNA 3O4ZA 4WNGA 3JQ0A 2XS8A 1HXIA 1MZCA 3FHEA 4UWFA 3V79K 3SNXA 1OWLA 5KWDA 3CVUA 2QYJA 4L1BA 4N3BA 3U66A 4YVQC 4CZ2D 2IF4A 4ANUA 3FTUA 4JB8P 3ZNGA 5G04J 2NYJA 3SBSA 4EBAA 3Q5MA 5CCMA 3HG0D 3Q47B 3BG1B 3TAXA 3HVEA 1N4PA 3HHMA 3FUJA 2A4ZA 2OVFA 4U96D 4HOUA 3B7BA 3EJNA 4RLYA 5KJNA 1IHGA 2Y4TA 2PQRA 4JHKA 4XI0A 5M72A 3ZYLA 4XEIG 3D9NA 1Z6TA 2OVBA 4IRUA 4WWOA 4GTVA 1D8EA 1FVFA 2V4HC 3DSSA 3PNTB 3HVEB 2L6JA 1MX6A 4ACKA 4DX1A 3JQ1A 1Q2ZA 4LNBA 1HE8A 3DXMG 1OWNA 4H7YA 4N3AA 3V31A 3RRUA 1DCEA 5ENOD 4F6RD 3ZEFA 1BU9A 2GRRB 3Q7AA 5ENSD 5CERB 3PRZA 4XI9A 4BT8A 5A6CA 3ML9A 2DYSE 3IBEA 4E85A 2I6HA 2PNNA 3UKRG 4CT4A 2UWJG 3RAUA 3RK6A 4QQIA 3BQOA 4DI4A 3UM3A 2CFUA 4C0EA 4LUNU 3ABME 4HOTA 1JCQA 5KCMA 5CBOA 1UG3A 3B7TA 1N54A 3DXKG 4LERA 4HORA 5FZQA 1JUQA 4X8QA 3ASHA 2MYOA 5KNGA 3QOUA 3UIOC 2IO2C 3MKRA 5D0OD 1NA0A 1O1RA 4EQFA 2BKGA 2LNIA 4PS3A 3AU4A 2EILE 4UWKA 2WXNA 3VTYA 2HR2A 3WG7E 4B8AA 3TWRA 1DVPA 4GMJA 4AY6A 2H6FA 2J07A 1MX2A 4GZDA 2ZXWE 3PH0C 2RFAA 3Q9UC 3AS5A 2IY0C 4APFA 5ENPD 5FTPA 2GW1A 4NURA 4DX5D 2UY1A 2XRZA 3JCKC 2LSUA 4HBDA 5ANRA 3ML8A 4B94A 4B89A 3TXNA 1HS6A 2DYRE 3T8KA 3CQCB 3RU0A 1OT8A 3UM2A 3C3OA 3Q78A 1QZ2A 2HO1A 3W9GA 5FT9A 2J49A 1UN8A 3LKUA 2VTBB 4GYOA 3UIPC 4CEMA 3ZIMA 1E7VA 3N71A 1YMPA 4N3CA 2IO3C 5A23A 2C2LA 3B7UX 4O6FA 1H2TC 1NP7A 3L82A 4GTMA 4JA9A 4BTBA 4OAUC 1HH8A 4ANWA 3E34A 3R9MA 3S7DA 1EDUA 4XZ4A 3TWSA 2EIJE 3FH7A 3J5PA 3Q73A 4MBGA 2I9CA 4ILHB 3FP3A 4DRXE 3JXJA 3DSVA 1XNFA 4WNDA 1Z5SC 4HLEA 1U3CA 2R17C 2LXLA 5A7DB 3ISMC 2YHCA 1H6PA 3QDNA 5AQAA 2XCBA 1KZPA 2GRLA 3MZLB 2J4DA 1ZBPA 3RIBA 3UKUG 5CCLA 2F0YA 2B0OE 2UY1B 2DVWA 1NZNA 5AJDA 5E76A 3LS8A 4DX6D 2XENA 1HG5A 3TWWA 3LEWA 3KEZA 1OCRE 3FULA 4I1AA 4YDOA 1JWGA 1TJFA 5G55A 3UUXA 2V0PA 3MGBA 3HYMB 3CV0A 4HRMB 1K8KG 3D9OA 4JL0A 2XPYA 4UQXA 3KSQA 3SO8A 1LF8A 3LY9A 1QYMA 3B13A 1DCQA 3EHRA 3HDXA 3FUIA 5B3SE 1O5MA 4G1TA 4TXRA 1K1BA 4PH4B 4ME2A 4MKTA 1ZB1A 2P9NG 4GYWA 5ARFA 3T5XA 4EBAG 2X6HA 4K03A 4QFVA 5EIBE 3QWPA 2LSVA 3WXXA 4O1PA 1V54E 2ZGDA 2RKKA 4AJWA 3TGOA 3L17A 3LVQE 3ZGQA 1OCZE 1N11A 4V3IA 4OVUA 1BI8B 1TN7A 4YDYA 3TL5A 2OV8A 4U04A 3DEOA 4PUCA 4K5AB 1DNPA 2V4LA 3EU5A 3DPYA 4UI9K 2R05A 4Q69A 4L2YA 3MA5A 1Z3XA 2XEHA 4WAFA 4JW1A 4AY5A 3PZDA 5KBAA 1KT0A 1OCCE 3G2WA 4D10C 3PZ3A 2XGOA 5AQ7A 4JEUA 2H6HA 2LO6A 2WQ6A 3FTSA 3FUHA 4J8FA 3EHMA 4EECA 4E6HA 4I6GA 3FWVA 5DIZA 1BLXB 1L5JA 2JEKA 3BG0B 4EZKA 3C3RA 3E4BA 3D9MA 4HI8A 4HVBA 3UX4A 3W9FA 3EUVA 2J09A 4G25A 5T3RA 2EQXA 3PUJA 3UM0A 1O1TA 3L54A 3U3WA 2VGEA 3TWUA 2DIWA 3FUFA 3UPVA 1KZOA 4IN3B 4EZLA 3URZA 2M63A 2X38A 2WQ7A 4DLQA 4K5CA 4GTQA 4K5BA 5JJ6A 2A5UA 3IV0A 1E96B 2R03A 4MS6A 5AN8A 3DWLG 1H19A 4I1OB 3TWQA 2L9BA 2WXOA 3MKQB 3JUEA 4B0ZA 1K3ZD 4URKA 4BWRA 2E0IA 2VQ2A 4KZ0A 4RQIA 4AOFA 2DCPA 4JXTA 1HF8A 5KNHD 3ZVVA 4ACLA 4IULA 3DSXA 2WQHA 4J8EA 3U64A 2H6IA 1EYHA 4Y6WA 3ULYA 2KCLA 2RFMA 2HE0A 1UJKA 2VGXB 4U95D 4C0MA 5EKQD 2IOSA 3LDZA 5LOZA 2MOWA 3SI5A 2Y4UA 1ZU2A 4KT6B 3Q15A 2QC9A 4RVBA 5LCWC 3ZKJA 4CYMD 5AIJA 1EF1C 4LCTA 3FUEA 1S70B 4AEZC 2J8SD 5FQ6A 3O48A 3LXUX 2KM4A 1FT1A 5CRUA 4L23A 5CBNA 1G3NB 3NZSA 3SGHA 3APFA 2BTDA 1MHQA 4UQZA 1FVHA 5HRYA 2VTBA 4NQ0A 4GTOA 2X6KA 3AG1E 4ZFHA 4CDNA 2PQNA 4OVVA 4AXHA 3TJPA 3ZPJA 2KCKA 4XKCA 4B93B 4WNFA 4GPKA 3FU3A 2I1JA 3FTZA 3CHOA 3CEQA 5HKPA 4UI9J 4RSYA 1YCSB 5CEAA 4HRLA 2WXMA 5EILA 3D3MA 5HS0A 3ZUVB 2IJGX 5KJLA 1N94A 3DSTA 3HIZA 5BT1A 2IFUA 4J8SA 2BEDA 3I3NA 3CQGB 2R2LA 4HNAD 4I6JA 2LAIA 3EHQA 1JWFA 4OAVB 2ETCA 4TV3A 1HX8A 3FDHA 5G04C 2L0TB 5JMND 3ZHEA 4U8HA 3G2UA 3RO2A 2VSNA 5KJMA 2NC9A 4O60A 3CVWA 1UJJA 2YQ8A 3UTMA 3PE3A 4U0ZA 1YA0A 1JCSA 1PY1A 2WXKA 1NL4A 4HQDA 2RD0A 4CGWA 3ZHEB 3F6QA 3OXLA 3AJIA 3L08A 3ASNE 2C0MA 3CGHA 2L6BA 1B89A 3RRMB 4JPSA 4C48B 3QKYA 3PE4A 4JVSA 1W3BA 1WG0A 5G05C 3G2SA 3MYVA 3MKQA 4JZYA 4N2SA 2OEVA 3DSWA 2PZIA 4LG6A 2ZIRA 3FH8A 3SY2A 2KBXA 1TNYA 4WWPA 3CVNA 3T5VA 2Q7FA 3ZFWA 3VTXA 3IKOB 2WM9A 1BI7B 4F53A 2FI7A 4C9BB 4UUCA 1XGWA 4F1SA 2FO1E 1JPLA 3CVVA 5ARGA 2R5SA 3D9HA 4FADA 4I17A 1SZAA 1SZ9A 4GTTA 3NBNB 1TN6A 2H6GA 5BW8C 3Q79A 4PDXA 1BD8A 3QAQA 3S7FA 3QWWA 4HOQA 4J0UA 3SF4A 2VJ8A 3ZYKA 3TWVA 1E8XA 4A1GA 4I6EA 4I9EA 2WXHA 4BESA 1MJ0A 2RG8A 5J08A 1IKND 2EINE 1NA3A 3CVPA 4N5CA 1Y8MA 4HLLA 3BEEA 2LUHA 3SFZA 4Z68A 4CDRA 1TJCA 4XE0A 2OCCE 3FUDA 3FH5A 2VSOE 1SQMA 3RO3A 1U2VG 1OUVA 1TN8A 3EHNA 5C2YA 5EDSA 2J9QA 1SA5A 1FT2A 2P2CP 2KXPC 3ESKA 3JYSA 3PNLB 2PM7A 4AVXA 2GRQB 3ZU7B 3Q49B 5EYPF 2XHEA 2R59A 3R7QA 1MQSA 4BSZB 4TUMA 4BEPA 3SHFA 5EN5D 4FLHA 2J4BA 3CIAA 4GZCA 4EHMA 4GZ3A 3FU5A 2WPVA 1GW6A 3KSLA 3OXGA 4GPMA 5J90A 1N9AA 3AG4E 4RG6A 3ASGA 3EIQC 5H7PA 3VLFA 3ESLA 3L16A 5B1AE 2X3MA 3FTXA 3RJVA 3E37A 5AENA 4J7WA 3Q7FA 4UWLA 3SBTB 5D66A 3ULEG 4ILIA 4J6IA 3C3QA 2LAHA 5JA4D 3NZUA 4CCAA 3JUIA 1TNUA 1U3DA 5AJLA 1N0RA 4GMLA 2ZGGA 4YVOA 3D9KA 2P58C 4CGVA 3E30A 5JJTA 3SFYA 5CRVA 4U8YD 5D0QD 3CKBA 3S7BA 2WXGA 1JCRA 3HXCA 3E33A 4AP2A 4HXIA 3DRAA 4GA0A 3PUKA 2DZNA 3U9WA 3C98A 4DUIA 4GA2A 2Y69E 2Y1LE 3UINC 3HXBA 2KCVA 3LYAA 2VSXE 5FQ8A 3ZYMA 3B7SA 2X6FA 4HI9A 2V5FA 2IONA 3QNKA 5BXUA 3LY8A 2AXUA 3FY4A 5JHAA 4CDMA 2WXRA 4ILGA 3KS2A 3NOGD 4DPRA 1QBQA 3V2XA 4W9RA 2AXVA 3FFLA 3GZ2A 1UW4B 4KBQA 5E75A 4A55A 4U7EB 4O1OA 3UXGA 4IYPA 5BV1A 4BY6A 4A3VA 2HYZA 3MJWA 3L6AA 3MV2B 3SFXA 3UI2A 2Y0BG 4MRUA 3AAAC 1N95A 1TNZA 4G2VA 3BUAA 2YHEA 1NFIE 3DEPA 3TXMA 1Z3YA 3CLJA 1SVXA 1E8WA 5DBKA 3SZ7A 3APDA 4LSZE 3ZN3A 5HI7A 2V8SE 4A3TA 1QQEA 2XPIA 3GYZA 4L9PA 1KT1A 3AU5A 1ELRA 4U63A 1WY6A 4DX7D 3R9AB 3FU0A 5CMYA 1N4SA 4AIFA 2DWZA 3QB2A 1EPUA 3OTNA 1OCOE 4M3OA 3FUKA 2I2OA 1OWPA 4LRZA 1TYQG 3T8MA 2BUGA 4LEUA 2OOEA
chains in the Genus database with same CATH topology
2ETCA 2NYJA 4DX2A 3NOGD 4HRNA 5ENQD 2RFMA 1QYMA 3IXEA 2HE0A 5CBOA 4HI8A 5FINA 4GMRA 5JMND 5EYLA 3C5RA 3V2XA 3W9FA 1DCQA 2DZOA 1N0QA 3EHRA 3NBNB 4U95D 1YMPA 3HG0D 1BD8A 2MYOA 1OY3D 1K1AA 4J7WA 4BERA 4O1OA 5KNGA 2A5EA 3UXGA 4O60A 4YDWA 5D66A 1K1BA 2QC9A 3ZKJA 4CYMD 2XZTG 5CEAA 5JA4D 4OAUC 1A5EA 3TWXA 4U96D 3NOCD 3UTMA 1S70B 3UI2A 2VGEA 3TWVA 2Y0BG 3TWUA 3V30A 5CECB 2F8YA 3TWSA 2BKGA 2ETAA 3B7BA 4OAVB 4RLYA 1N0RA 2J8SD 3AAAC 3KEAA 3J5PA 2ZGGA 1NFIE 4G8KA 4QFVA 4G8LA 4DRXE 5EIBE 4BESA 3DEPA 2JABA 3JXJA 1MYOA 3JXIA 1MJ0A 1UOHA 2XEEA 4O1PA 2ZGDA 4HQDA 4ZHBA 4LNUD 1IKND 5BXOA 3B95A 4NIKA 5CBNA 4K5CA 4K5BA 1G3NB 1TR4A 3TWTA 3TWRA 1SVXA 3V2OA 3F6QA 5AQBA 4U8YD 4HLLA 5HRYA 1AWCB 3AJIA 2AJAA 4J8YA 1AP7A 1N11A 1MX2A 2RFAA 4LSZE 4N5QA 3Q9UC 2L6BA 2V4HC 1BI8B 5AN8A 2V5QC 5ENPD 1MX4A 2F8XK 4YDYA 2F37A 2XZDG 4BETA 4ZFHA 2ETBA 5AQAA 4HB5A 4A63B 4DX5D 4Z68A 1MX6A 3DEOA 3TWQA 4C48B 4K5AB 5FIOA 4HBDA 2DZNA 3HRAA 4DX1A 3Q9NC 3JUEA 4DUIA 4B93B 1WG0A 1SW6A 3T8KA 1WDYA 1K3ZD 2XEHA 4DX7D 3V31A 3LJNA 2B0OE 1OT8A 2KXPC 2P2CP 2DVWA 2Y1LE 5ENOD 5ENRD 5ENTD 4ATZD 4F1PA 4LG6A 5KBAA 5HKPA 4F6RD 3ZU7B 5CEDB 5EYPF 1YCSB 2KBXA 3J5QB 5AQ7A 4BSZB 4HRLA 4DX6D 5AQ9A 4TUMA 2XENA 4HI9A 5KNHD 1BU9A 3TWWA 4BEPA 5ENSD 3W9GA 5CERB 5EILA 2DWZA 5EN5D 5BXUA 5HS0A 3ZUVB 3V79K 1D9SA 1DC2A 1BI7B 1IXVA 5KWDA 2QYJA 4UUCA 5EIDA 5ITZF 4U8VD 2PNNA 3T9KA 2BKKB 4HRMB 2FO1E 4CZ2D 4HNAD 4GPMA 3EU9A 1YYHA 1IHBA 3D9HA 1BLXB 3EHQA 4QQIA 3SO8A 4JB8P 5AARA 5AAOA 3ZNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETC A;  2NYJ A;  4DX2 A;  3NOG D;  4HRN A;  5ENQ D;  2RFM A;  1QYM A;  3IXE A;  2HE0 A;  5CBO A;  4HI8 A;  5FIN A;  4GMR A;  5JMN D;  5EYL A;  3C5R A;  3V2X A;  3W9F A;  1DCQ A;  2DZO A;  1N0Q A;  3EHR A;  3NBN B;  4U95 D;  1YMP A;  3HG0 D;  1BD8 A;  2MYO A;  1OY3 D;  1K1A A;  4J7W A;  4BER A;  4O1O A;  5KNG A;  2A5E A;  3UXG A;  4O60 A;  4YDW A;  5D66 A;  1K1B A;  2QC9 A;  3ZKJ A;  4CYM D;  2XZT G;  5CEA A;  5JA4 D;  4OAU C;  1A5E A;  3TWX A;  4U96 D;  3NOC D;  3UTM A;  1S70 B;  3UI2 A;  2VGE A;  3TWV A;  2Y0B G;  3TWU A;  3V30 A;  5CEC B;  2F8Y A;  3TWS A;  2BKG A;  2ETA A;  3B7B A;  4OAV B;  4RLY A;  1N0R A;  2J8S D;  3AAA C;  3KEA A;  3J5P A;  2ZGG A;  1NFI E;  4G8K A;  4QFV A;  4G8L A;  4DRX E;  5EIB E;  4BES A;  3DEP A;  2JAB A;  3JXJ A;  1MYO A;  3JXI A;  1MJ0 A;  1UOH A;  2XEE A;  4O1P A;  2ZGD A;  4HQD A;  4ZHB A;  4LNU D;  1IKN D;  5BXO A;  3B95 A;  4NIK A;  5CBN A;  4K5C A;  4K5B A;  1G3N B;  1TR4 A;  3TWT A;  3TWR A;  1SVX A;  3V2O A;  3F6Q A;  5AQB A;  4U8Y D;  4HLL A;  5HRY A;  1AWC B;  3AJI A;  2AJA A;  4J8Y A;  1AP7 A;  1N11 A;  1MX2 A;  2RFA A;  4LSZ E;  4N5Q A;  3Q9U C;  2L6B A;  2V4H C;  1BI8 B;  5AN8 A;  2V5Q C;  5ENP D;  1MX4 A;  2F8X K;  4YDY A;  2F37 A;  2XZD G;  4BET A;  4ZFH A;  2ETB A;  5AQA A;  4HB5 A;  4A63 B;  4DX5 D;  4Z68 A;  1MX6 A;  3DEO A;  3TWQ A;  4C48 B;  4K5A B;  5FIO A;  4HBD A;  2DZN A;  3HRA A;  4DX1 A;  3Q9N C;  3JUE A;  4DUI A;  4B93 B;  1WG0 A;  1SW6 A;  3T8K A;  1WDY A;  1K3Z D;  2XEH A;  4DX7 D;  3V31 A;  3LJN A;  2B0O E;  1OT8 A;  2KXP C;  2P2C P;  2DVW A;  2Y1L E;  5ENO D;  5ENR D;  5ENT D;  4ATZ D;  4F1P A;  4LG6 A;  5KBA A;  5HKP A;  4F6R D;  3ZU7 B;  5CED B;  5EYP F;  1YCS B;  2KBX A;  3J5Q B;  5AQ7 A;  4BSZ B;  4HRL A;  4DX6 D;  5AQ9 A;  4TUM A;  2XEN A;  4HI9 A;  5KNH D;  1BU9 A;  3TWW A;  4BEP A;  5ENS D;  3W9G A;  5CER B;  5EIL A;  2DWZ A;  5EN5 D;  5BXU A;  5HS0 A;  3ZUV B;  3V79 K;  1D9S A;  1DC2 A;  1BI7 B;  1IXV A;  5KWD A;  2QYJ A;  4UUC A;  5EID A;  5ITZ F;  4U8V D;  2PNN A;  3T9K A;  2BKK B;  4HRM B;  2FO1 E;  4CZ2 D;  4HNA D;  4GPM A;  3EU9 A;  1YYH A;  1IHB A;  3D9H A;  1BLX B;  3EHQ A;  4QQI A;  3SO8 A;  4JB8 P;  5AAR A;  5AAO A;  3ZNG A; 
#chains in the Genus database with same CATH topology
 4GU5 A;  4B8C B;  2VSY A;  1RZ4 A;  2KC7 A;  2MRI A;  3FUM A;  4BER A;  4YDW A;  1BPO A;  4L7T A;  3V30 A;  2VYI A;  4RG9 A;  3ULQ A;  3L13 A;  4G8K A;  1LD8 A;  3CVY A;  4NAC A;  3PEU B;  1UOH A;  3MV3 B;  3AS4 A;  3TG4 A;  1Y6I A;  3G2T A;  1HZ4 A;  3V2O A;  4FC8 A;  2X6I A;  1OWO A;  2AJA A;  3U4T A;  3SQV A;  4N5Q A;  2R02 A;  5AYW D;  4HB5 A;  5CHE E;  4KMO A;  2P9U G;  4FA6 A;  5BNW A;  4J8D A;  4I2W A;  3CK8 A;  2IQC A;  1H6O A;  3P2B A;  5CED B;  3J5Q B;  5AQ9 A;  4LNG A;  2YNQ A;  2ZU6 B;  1IXV A;  1ELK A;  2OEW A;  4BTA A;  5EID A;  3T9K A;  2BKK B;  4TRQ A;  2EIM E;  3LPZ A;  5BPP A;  3C72 A;  3CST A;  2XRY A;  5AAR A;  5ENN A;  4DX2 A;  5G2N A;  5ENQ D;  5LX8 A;  4GMR A;  2AWI A;  2CHW A;  3GZS A;  4GTR A;  2QY7 A;  3R7R A;  3NB2 A;  1K1A A;  3PZ4 A;  3TG5 A;  4WWN A;  2A5E A;  1E90 A;  3Q4A B;  1H2U A;  3ZXP A;  4AM9 A;  3AS8 A;  3QWV A;  3ASD A;  2HM8 A;  4JC8 A;  2ETA A;  2WVI A;  1LD7 A;  3KEA A;  3LCA A;  4DJA A;  2FBN A;  4FHK A;  2P9I G;  3E32 A;  4G23 A;  3JXI A;  4WUY A;  1TEZ A;  3B95 A;  2NSZ A;  2C0L A;  3FUN A;  3CVX A;  3SD5 A;  3CHP A;  1MX4 A;  3VLD A;  3HXD A;  4ATG A;  3D9J A;  2WMN A;  3CVQ A;  1VDY A;  2GRP B;  3Q9N C;  5G05 J;  1H2V C;  2VGX A;  4JEH A;  4CT0 A;  4FP7 A;  2XGM A;  3PVL A;  2FEZ A;  4BX8 A;  3ASF A;  4APO A;  4F1P A;  3MX3 A;  1HG2 A;  4WNE A;  2P9L G;  5FWQ A;  3KAE A;  1P5Q A;  3ASO E;  5LP0 A;  4K0R A;  1D9S A;  4BX9 A;  3CVL A;  4GTS A;  4I1M A;  5D2M C;  4CRW A;  1FPP A;  2WXP A;  3FTW A;  4U0U A;  3EU9 A;  5FQ4 A;  4U07 A;  3ZRH A;  3NAW A;  4HS2 A;  3GZ1 A;  3IXE A;  3RKV A;  4BT9 A;  2EIK E;  5FJY A;  3CHM A;  3ZXS A;  5EX3 A;  3CSF A;  2WXI A;  1IYG A;  4Q96 A;  1OY3 D;  2FF4 A;  3I4G A;  4N2Q A;  3UT7 A;  3CK7 A;  4F3V A;  5LFA A;  3PS6 A;  4FLB A;  4BFR A;  3D9L A;  4ANX A;  2F8Y A;  3G2V A;  3S7J A;  4JHJ A;  2KZT B;  4YDE A;  2MHK A;  1N52 A;  4FU3 A;  4G8L A;  3MCX A;  3BU8 A;  4LNU D;  1LTX A;  2QZA A;  2XGS A;  3TWT A;  1TR4 A;  4FJY A;  2IEJ A;  3QJZ A;  1AWC B;  2F8X K;  2F37 A;  2ETB A;  4UQY A;  4A63 B;  3HXE A;  4G11 A;  1KLX A;  1WAO 1;  1KPS B;  3CHR A;  3ENE A;  2GRM A;  2YIN A;  4H7X A;  1INZ A;  4AV7 A;  3B7R L;  3NF1 A;  2CG2 A;  4N39 A;  5CMW A;  4PS8 A;  1QNF A;  1YYH A;  1NI1 A;  3HXF A;  4KYO B;  3NQP A;  1V55 E;  3IEG A;  2GRO B;  4GA1 A;  4TXQ A;  4EPZ A;  5FIN A;  4KZC A;  2XCC A;  1E8Z A;  1X81 A;  3EDT B;  1N4Q A;  2CHZ A;  4L2L A;  4KVO A;  2WXJ A;  3P1U A;  4U0S A;  3DBS A;  3CHQ A;  4OYS A;  3ABK E;  2P9K G;  1TNB A;  4HFG A;  5IY5 E;  3NOC D;  2B6C A;  4GCO A;  2ILR A;  1HO8 A;  4XIF A;  2LXM A;  2XS1 A;  5JJ7 A;  3PRE A;  5T4Y A;  3GW4 A;  1AP7 A;  2GRN B;  2KAT A;  2WMO A;  4BET A;  3ONK A;  4F7A A;  2Y3A A;  4EZJ A;  1PC2 A;  1UN9 A;  3CHS A;  3UT8 A;  5B1B E;  3UM1 A;  3APC A;  3L22 A;  2GGF A;  2OND A;  1WDY A;  2PL2 A;  2AXZ A;  2CHX A;  2IOL A;  1IQR A;  5HQ8 A;  5FQ7 A;  2CG3 A;  2J08 A;  3QC1 A;  1H6K A;  4FHJ A;  4GZ5 A;  3VLE A;  2JLB A;  2NXP A;  3OXF A;  4KXK B;  5BUZ A;  3RRN B;  3UQ3 A;  5ITZ F;  1FCH A;  2PM6 A;  1A17 A;  4GTP A;  1IHB A;  5AAO A;  4HRN A;  2E2E A;  5EYL A;  2DZO A;  1IQU A;  1N0Q A;  4GB9 A;  4M7C A;  1ELW A;  1N4R A;  3UT4 A;  3EIJ A;  3ONL A;  2AVP A;  3UMV A;  3I4R B;  3FEX A;  4TUU A;  4HOS A;  3K9I A;  2XZT G;  3CKC A;  1A5E A;  1SA4 A;  4TXP A;  3DPD A;  3LJ3 A;  4I2Z A;  2WB2 A;  5CEC B;  4DK5 A;  1PAQ A;  4I9C A;  4GYY A;  2JAB A;  4MLP A;  3AG2 E;  1MYO A;  3X2Q E;  4UWH A;  3PEV B;  2P9S G;  5BXO A;  4NIK A;  1D8D A;  3AG3 E;  1E7U A;  4Q94 A;  3ZYQ A;  4J8Y A;  2QFC A;  4PS7 A;  5FZR A;  2V5Q C;  3OAW A;  1DC2 A;  2XZD G;  5LCW J;  3RSE G;  4UI9 C;  4I43 A;  2VGY A;  3HRA A;  2I1K A;  4JA7 A;  1OWM A;  4GCN A;  1X5B A;  3D9I A;  5C1D A;  3LVR E;  3CK9 A;  2WXF A;  2IU1 A;  3LJN A;  2QYU A;  3IHV A;  5ENT D;  4ATZ D;  4GAA A;  1S64 A;  1HU3 A;  2DBA A;  3QK0 A;  2XQ0 A;  1S0P A;  5BV0 A;  3FEY A;  1HFA A;  5ANL A;  2XPZ A;  3L9T A;  4YND A;  5FZS A;  3I5P A;  3FTV A;  2CFZ A;  3ZW3 A;  5EX0 A;  4U8V D;  1WM5 A;  5JHB A;  2KZT A;  2BF0 X;  4DLO A;  1S63 A;  3D9P A;  4R7L A;  1H0A A;  3LY7 A;  3DSU A;  2FUL A;  2X6J A;  4G26 A;  4P29 A;  3C5R A;  4BSX A;  5T8I A;  2FO7 A;  2XEV A;  3Q75 A;  1RW2 A;  3FTY A;  1TNO A;  2P9P G;  4NRH B;  4G24 A;  3QAR A;  4FJZ A;  2WXQ A;  5KJK A;  3TWX A;  4Y6C A;  3KD7 A;  4ANV A;  3CR3 A;  2WXL A;  1OXJ A;  2AW6 A;  4GZ6 A;  2XEE A;  4JD2 G;  4FUL A;  3PZ1 A;  4UWG A;  3ABL E;  4ZHB A;  4XX5 A;  5AQB A;  4A1S A;  1E8Y A;  2L0I A;  2ZIS A;  4DI3 A;  4JHR A;  4XKB A;  5FIO A;  3FU6 A;  4KVM A;  3MEK A;  3IHY A;  1SW6 A;  4ABN A;  5ENR D;  1O1S A;  3PZ2 A;  3S2A A;  3PDN A;  3O4Z A;  4WNG A;  3JQ0 A;  2XS8 A;  1HXI A;  1MZC A;  3FHE A;  4UWF A;  3V79 K;  3SNX A;  1OWL A;  5KWD A;  3CVU A;  2QYJ A;  4L1B A;  4N3B A;  3U66 A;  4YVQ C;  4CZ2 D;  2IF4 A;  4ANU A;  3FTU A;  4JB8 P;  3ZNG A;  5G04 J;  2NYJ A;  3SBS A;  4EBA A;  3Q5M A;  5CCM A;  3HG0 D;  3Q47 B;  3BG1 B;  3TAX A;  3HVE A;  1N4P A;  3HHM A;  3FUJ A;  2A4Z A;  2OVF A;  4U96 D;  4HOU A;  3B7B A;  3EJN A;  4RLY A;  5KJN A;  1IHG A;  2Y4T A;  2PQR A;  4JHK A;  4XI0 A;  5M72 A;  3ZYL A;  4XEI G;  3D9N A;  1Z6T A;  2OVB A;  4IRU A;  4WWO A;  4GTV A;  1D8E A;  1FVF A;  2V4H C;  3DSS A;  3PNT B;  3HVE B;  2L6J A;  1MX6 A;  4ACK A;  4DX1 A;  3JQ1 A;  1Q2Z A;  4LNB A;  1HE8 A;  3DXM G;  1OWN A;  4H7Y A;  4N3A A;  3V31 A;  3RRU A;  1DCE A;  5ENO D;  4F6R D;  3ZEF A;  1BU9 A;  2GRR B;  3Q7A A;  5ENS D;  5CER B;  3PRZ A;  4XI9 A;  4BT8 A;  5A6C A;  3ML9 A;  2DYS E;  3IBE A;  4E85 A;  2I6H A;  2PNN A;  3UKR G;  4CT4 A;  2UWJ G;  3RAU A;  3RK6 A;  4QQI A;  3BQO A;  4DI4 A;  3UM3 A;  2CFU A;  4C0E A;  4LUN U;  3ABM E;  4HOT A;  1JCQ A;  5KCM A;  5CBO A;  1UG3 A;  3B7T A;  1N54 A;  3DXK G;  4LER A;  4HOR A;  5FZQ A;  1JUQ A;  4X8Q A;  3ASH A;  2MYO A;  5KNG A;  3QOU A;  3UIO C;  2IO2 C;  3MKR A;  5D0O D;  1NA0 A;  1O1R A;  4EQF A;  2BKG A;  2LNI A;  4PS3 A;  3AU4 A;  2EIL E;  4UWK A;  2WXN A;  3VTY A;  2HR2 A;  3WG7 E;  4B8A A;  3TWR A;  1DVP A;  4GMJ A;  4AY6 A;  2H6F A;  2J07 A;  1MX2 A;  4GZD A;  2ZXW E;  3PH0 C;  2RFA A;  3Q9U C;  3AS5 A;  2IY0 C;  4APF A;  5ENP D;  5FTP A;  2GW1 A;  4NUR A;  4DX5 D;  2UY1 A;  2XRZ A;  3JCK C;  2LSU A;  4HBD A;  5ANR A;  3ML8 A;  4B94 A;  4B89 A;  3TXN A;  1HS6 A;  2DYR E;  3T8K A;  3CQC B;  3RU0 A;  1OT8 A;  3UM2 A;  3C3O A;  3Q78 A;  1QZ2 A;  2HO1 A;  3W9G A;  5FT9 A;  2J49 A;  1UN8 A;  3LKU A;  2VTB B;  4GYO A;  3UIP C;  4CEM A;  3ZIM A;  1E7V A;  3N71 A;  1YMP A;  4N3C A;  2IO3 C;  5A23 A;  2C2L A;  3B7U X;  4O6F A;  1H2T C;  1NP7 A;  3L82 A;  4GTM A;  4JA9 A;  4BTB A;  4OAU C;  1HH8 A;  4ANW A;  3E34 A;  3R9M A;  3S7D A;  1EDU A;  4XZ4 A;  3TWS A;  2EIJ E;  3FH7 A;  3J5P A;  3Q73 A;  4MBG A;  2I9C A;  4ILH B;  3FP3 A;  4DRX E;  3JXJ A;  3DSV A;  1XNF A;  4WND A;  1Z5S C;  4HLE A;  1U3C A;  2R17 C;  2LXL A;  5A7D B;  3ISM C;  2YHC A;  1H6P A;  3QDN A;  5AQA A;  2XCB A;  1KZP A;  2GRL A;  3MZL B;  2J4D A;  1ZBP A;  3RIB A;  3UKU G;  5CCL A;  2F0Y A;  2B0O E;  2UY1 B;  2DVW A;  1NZN A;  5AJD A;  5E76 A;  3LS8 A;  4DX6 D;  2XEN A;  1HG5 A;  3TWW A;  3LEW A;  3KEZ A;  1OCR E;  3FUL A;  4I1A A;  4YDO A;  1JWG A;  1TJF A;  5G55 A;  3UUX A;  2V0P A;  3MGB A;  3HYM B;  3CV0 A;  4HRM B;  1K8K G;  3D9O A;  4JL0 A;  2XPY A;  4UQX A;  3KSQ A;  3SO8 A;  1LF8 A;  3LY9 A;  1QYM A;  3B13 A;  1DCQ A;  3EHR A;  3HDX A;  3FUI A;  5B3S E;  1O5M A;  4G1T A;  4TXR A;  1K1B A;  4PH4 B;  4ME2 A;  4MKT A;  1ZB1 A;  2P9N G;  4GYW A;  5ARF A;  3T5X A;  4EBA G;  2X6H A;  4K03 A;  4QFV A;  5EIB E;  3QWP A;  2LSV A;  3WXX A;  4O1P A;  1V54 E;  2ZGD A;  2RKK A;  4AJW A;  3TGO A;  3L17 A;  3LVQ E;  3ZGQ A;  1OCZ E;  1N11 A;  4V3I A;  4OVU A;  1BI8 B;  1TN7 A;  4YDY A;  3TL5 A;  2OV8 A;  4U04 A;  3DEO A;  4PUC A;  4K5A B;  1DNP A;  2V4L A;  3EU5 A;  3DPY A;  4UI9 K;  2R05 A;  4Q69 A;  4L2Y A;  3MA5 A;  1Z3X A;  2XEH A;  4WAF A;  4JW1 A;  4AY5 A;  3PZD A;  5KBA A;  1KT0 A;  1OCC E;  3G2W A;  4D10 C;  3PZ3 A;  2XGO A;  5AQ7 A;  4JEU A;  2H6H A;  2LO6 A;  2WQ6 A;  3FTS A;  3FUH A;  4J8F A;  3EHM A;  4EEC A;  4E6H A;  4I6G A;  3FWV A;  5DIZ A;  1BLX B;  1L5J A;  2JEK A;  3BG0 B;  4EZK A;  3C3R A;  3E4B A;  3D9M A;  4HI8 A;  4HVB A;  3UX4 A;  3W9F A;  3EUV A;  2J09 A;  4G25 A;  5T3R A;  2EQX A;  3PUJ A;  3UM0 A;  1O1T A;  3L54 A;  3U3W A;  2VGE A;  3TWU A;  2DIW A;  3FUF A;  3UPV A;  1KZO A;  4IN3 B;  4EZL A;  3URZ A;  2M63 A;  2X38 A;  2WQ7 A;  4DLQ A;  4K5C A;  4GTQ A;  4K5B A;  5JJ6 A;  2A5U A;  3IV0 A;  1E96 B;  2R03 A;  4MS6 A;  5AN8 A;  3DWL G;  1H19 A;  4I1O B;  3TWQ A;  2L9B A;  2WXO A;  3MKQ B;  3JUE A;  4B0Z A;  1K3Z D;  4URK A;  4BWR A;  2E0I A;  2VQ2 A;  4KZ0 A;  4RQI A;  4AOF A;  2DCP A;  4JXT A;  1HF8 A;  5KNH D;  3ZVV A;  4ACL A;  4IUL A;  3DSX A;  2WQH A;  4J8E A;  3U64 A;  2H6I A;  1EYH A;  4Y6W A;  3ULY A;  2KCL A;  2RFM A;  2HE0 A;  1UJK A;  2VGX B;  4U95 D;  4C0M A;  5EKQ D;  2IOS A;  3LDZ A;  5LOZ A;  2MOW A;  3SI5 A;  2Y4U A;  1ZU2 A;  4KT6 B;  3Q15 A;  2QC9 A;  4RVB A;  5LCW C;  3ZKJ A;  4CYM D;  5AIJ A;  1EF1 C;  4LCT A;  3FUE A;  1S70 B;  4AEZ C;  2J8S D;  5FQ6 A;  3O48 A;  3LXU X;  2KM4 A;  1FT1 A;  5CRU A;  4L23 A;  5CBN A;  1G3N B;  3NZS A;  3SGH A;  3APF A;  2BTD A;  1MHQ A;  4UQZ A;  1FVH A;  5HRY A;  2VTB A;  4NQ0 A;  4GTO A;  2X6K A;  3AG1 E;  4ZFH A;  4CDN A;  2PQN A;  4OVV A;  4AXH A;  3TJP A;  3ZPJ A;  2KCK A;  4XKC A;  4B93 B;  4WNF A;  4GPK A;  3FU3 A;  2I1J A;  3FTZ A;  3CHO A;  3CEQ A;  5HKP A;  4UI9 J;  4RSY A;  1YCS B;  5CEA A;  4HRL A;  2WXM A;  5EIL A;  3D3M A;  5HS0 A;  3ZUV B;  2IJG X;  5KJL A;  1N94 A;  3DST A;  3HIZ A;  5BT1 A;  2IFU A;  4J8S A;  2BED A;  3I3N A;  3CQG B;  2R2L A;  4HNA D;  4I6J A;  2LAI A;  3EHQ A;  1JWF A;  4OAV B;  2ETC A;  4TV3 A;  1HX8 A;  3FDH A;  5G04 C;  2L0T B;  5JMN D;  3ZHE A;  4U8H A;  3G2U A;  3RO2 A;  2VSN A;  5KJM A;  2NC9 A;  4O60 A;  3CVW A;  1UJJ A;  2YQ8 A;  3UTM A;  3PE3 A;  4U0Z A;  1YA0 A;  1JCS A;  1PY1 A;  2WXK A;  1NL4 A;  4HQD A;  2RD0 A;  4CGW A;  3ZHE B;  3F6Q A;  3OXL A;  3AJI A;  3L08 A;  3ASN E;  2C0M A;  3CGH A;  2L6B A;  1B89 A;  3RRM B;  4JPS A;  4C48 B;  3QKY A;  3PE4 A;  4JVS A;  1W3B A;  1WG0 A;  5G05 C;  3G2S A;  3MYV A;  3MKQ A;  4JZY A;  4N2S A;  2OEV A;  3DSW A;  2PZI A;  4LG6 A;  2ZIR A;  3FH8 A;  3SY2 A;  2KBX A;  1TNY A;  4WWP A;  3CVN A;  3T5V A;  2Q7F A;  3ZFW A;  3VTX A;  3IKO B;  2WM9 A;  1BI7 B;  4F53 A;  2FI7 A;  4C9B B;  4UUC A;  1XGW A;  4F1S A;  2FO1 E;  1JPL A;  3CVV A;  5ARG A;  2R5S A;  3D9H A;  4FAD A;  4I17 A;  1SZA A;  1SZ9 A;  4GTT A;  3NBN B;  1TN6 A;  2H6G A;  5BW8 C;  3Q79 A;  4PDX A;  1BD8 A;  3QAQ A;  3S7F A;  3QWW A;  4HOQ A;  4J0U A;  3SF4 A;  2VJ8 A;  3ZYK A;  3TWV A;  1E8X A;  4A1G A;  4I6E A;  4I9E A;  2WXH A;  4BES A;  1MJ0 A;  2RG8 A;  5J08 A;  1IKN D;  2EIN E;  1NA3 A;  3CVP A;  4N5C A;  1Y8M A;  4HLL A;  3BEE A;  2LUH A;  3SFZ A;  4Z68 A;  4CDR A;  1TJC A;  4XE0 A;  2OCC E;  3FUD A;  3FH5 A;  2VSO E;  1SQM A;  3RO3 A;  1U2V G;  1OUV A;  1TN8 A;  3EHN A;  5C2Y A;  5EDS A;  2J9Q A;  1SA5 A;  1FT2 A;  2P2C P;  2KXP C;  3ESK A;  3JYS A;  3PNL B;  2PM7 A;  4AVX A;  2GRQ B;  3ZU7 B;  3Q49 B;  5EYP F;  2XHE A;  2R59 A;  3R7Q A;  1MQS A;  4BSZ B;  4TUM A;  4BEP A;  3SHF A;  5EN5 D;  4FLH A;  2J4B A;  3CIA A;  4GZC A;  4EHM A;  4GZ3 A;  3FU5 A;  2WPV A;  1GW6 A;  3KSL A;  3OXG A;  4GPM A;  5J90 A;  1N9A A;  3AG4 E;  4RG6 A;  3ASG A;  3EIQ C;  5H7P A;  3VLF A;  3ESL A;  3L16 A;  5B1A E;  2X3M A;  3FTX A;  3RJV A;  3E37 A;  5AEN A;  4J7W A;  3Q7F A;  4UWL A;  3SBT B;  5D66 A;  3ULE G;  4ILI A;  4J6I A;  3C3Q A;  2LAH A;  5JA4 D;  3NZU A;  4CCA A;  3JUI A;  1TNU A;  1U3D A;  5AJL A;  1N0R A;  4GML A;  2ZGG A;  4YVO A;  3D9K A;  2P58 C;  4CGV A;  3E30 A;  5JJT A;  3SFY A;  5CRV A;  4U8Y D;  5D0Q D;  3CKB A;  3S7B A;  2WXG A;  1JCR A;  3HXC A;  3E33 A;  4AP2 A;  4HXI A;  3DRA A;  4GA0 A;  3PUK A;  2DZN A;  3U9W A;  3C98 A;  4DUI A;  4GA2 A;  2Y69 E;  2Y1L E;  3UIN C;  3HXB A;  2KCV A;  3LYA A;  2VSX E;  5FQ8 A;  3ZYM A;  3B7S A;  2X6F A;  4HI9 A;  2V5F A;  2ION A;  3QNK A;  5BXU A;  3LY8 A;  2AXU A;  3FY4 A;  5JHA A;  4CDM A;  2WXR A;  4ILG A;  3KS2 A;  3NOG D;  4DPR A;  1QBQ A;  3V2X A;  4W9R A;  2AXV A;  3FFL A;  3GZ2 A;  1UW4 B;  4KBQ A;  5E75 A;  4A55 A;  4U7E B;  4O1O A;  3UXG A;  4IYP A;  5BV1 A;  4BY6 A;  4A3V A;  2HYZ A;  3MJW A;  3L6A A;  3MV2 B;  3SFX A;  3UI2 A;  2Y0B G;  4MRU A;  3AAA C;  1N95 A;  1TNZ A;  4G2V A;  3BUA A;  2YHE A;  1NFI E;  3DEP A;  3TXM A;  1Z3Y A;  3CLJ A;  1SVX A;  1E8W A;  5DBK A;  3SZ7 A;  3APD A;  4LSZ E;  3ZN3 A;  5HI7 A;  2V8S E;  4A3T A;  1QQE A;  2XPI A;  3GYZ A;  4L9P A;  1KT1 A;  3AU5 A;  1ELR A;  4U63 A;  1WY6 A;  4DX7 D;  3R9A B;  3FU0 A;  5CMY A;  1N4S A;  4AIF A;  2DWZ A;  3QB2 A;  1EPU A;  3OTN A;  1OCO E;  4M3O A;  3FUK A;  2I2O A;  1OWP A;  4LRZ A;  1TYQ G;  3T8M A;  2BUG A;  4LEU A;  2OOE A; 
#chains in the Genus database with same CATH homology
 2ETC A;  2NYJ A;  4DX2 A;  3NOG D;  4HRN A;  5ENQ D;  2RFM A;  1QYM A;  3IXE A;  2HE0 A;  5CBO A;  4HI8 A;  5FIN A;  4GMR A;  5JMN D;  5EYL A;  3C5R A;  3V2X A;  3W9F A;  1DCQ A;  2DZO A;  1N0Q A;  3EHR A;  3NBN B;  4U95 D;  1YMP A;  3HG0 D;  1BD8 A;  2MYO A;  1OY3 D;  1K1A A;  4J7W A;  4BER A;  4O1O A;  5KNG A;  2A5E A;  3UXG A;  4O60 A;  4YDW A;  5D66 A;  1K1B A;  2QC9 A;  3ZKJ A;  4CYM D;  2XZT G;  5CEA A;  5JA4 D;  4OAU C;  1A5E A;  3TWX A;  4U96 D;  3NOC D;  3UTM A;  1S70 B;  3UI2 A;  2VGE A;  3TWV A;  2Y0B G;  3TWU A;  3V30 A;  5CEC B;  2F8Y A;  3TWS A;  2BKG A;  2ETA A;  3B7B A;  4OAV B;  4RLY A;  1N0R A;  2J8S D;  3AAA C;  3KEA A;  3J5P A;  2ZGG A;  1NFI E;  4G8K A;  4QFV A;  4G8L A;  4DRX E;  5EIB E;  4BES A;  3DEP A;  2JAB A;  3JXJ A;  1MYO A;  3JXI A;  1MJ0 A;  1UOH A;  2XEE A;  4O1P A;  2ZGD A;  4HQD A;  4ZHB A;  4LNU D;  1IKN D;  5BXO A;  3B95 A;  4NIK A;  5CBN A;  4K5C A;  4K5B A;  1G3N B;  1TR4 A;  3TWT A;  3TWR A;  1SVX A;  3V2O A;  3F6Q A;  5AQB A;  4U8Y D;  4HLL A;  5HRY A;  1AWC B;  3AJI A;  2AJA A;  4J8Y A;  1AP7 A;  1N11 A;  1MX2 A;  2RFA A;  4LSZ E;  4N5Q A;  3Q9U C;  2L6B A;  2V4H C;  1BI8 B;  5AN8 A;  2V5Q C;  5ENP D;  1MX4 A;  2F8X K;  4YDY A;  2F37 A;  2XZD G;  4BET A;  4ZFH A;  2ETB A;  5AQA A;  4HB5 A;  4A63 B;  4DX5 D;  4Z68 A;  1MX6 A;  3DEO A;  3TWQ A;  4C48 B;  4K5A B;  5FIO A;  4HBD A;  2DZN A;  3HRA A;  4DX1 A;  3Q9N C;  3JUE A;  4DUI A;  4B93 B;  1WG0 A;  1SW6 A;  3T8K A;  1WDY A;  1K3Z D;  2XEH A;  4DX7 D;  3V31 A;  3LJN A;  2B0O E;  1OT8 A;  2KXP C;  2P2C P;  2DVW A;  2Y1L E;  5ENO D;  5ENR D;  5ENT D;  4ATZ D;  4F1P A;  4LG6 A;  5KBA A;  5HKP A;  4F6R D;  3ZU7 B;  5CED B;  5EYP F;  1YCS B;  2KBX A;  3J5Q B;  5AQ7 A;  4BSZ B;  4HRL A;  4DX6 D;  5AQ9 A;  4TUM A;  2XEN A;  4HI9 A;  5KNH D;  1BU9 A;  3TWW A;  4BEP A;  5ENS D;  3W9G A;  5CER B;  5EIL A;  2DWZ A;  5EN5 D;  5BXU A;  5HS0 A;  3ZUV B;  3V79 K;  1D9S A;  1DC2 A;  1BI7 B;  1IXV A;  5KWD A;  2QYJ A;  4UUC A;  5EID A;  5ITZ F;  4U8V D;  2PNN A;  3T9K A;  2BKK B;  4HRM B;  2FO1 E;  4CZ2 D;  4HNA D;  4GPM A;  3EU9 A;  1YYH A;  1IHB A;  3D9H A;  1BLX B;  3EHQ A;  4QQI A;  3SO8 A;  4JB8 P;  5AAR A;  5AAO A;  3ZNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...