1MHQA

Crystal structure of human gga2 vhs domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
b'SLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor binding protein GGA2
publication title Crystal structure of GGA2 VHS domain and its implication in plasticity in the ligand binding pocket
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1mhqA00
1JWFA 3ZYKA 1HX8A 1PY1A 2MOWA 3D9LA 1UJKA 1LF8A 4HFGA 2QY7A 3LDZA 3CLJA 2DCPA 3G2TA 4NACA 3ONKA 3G2UA 4GZCA 1UJJA 3D9MA 3ONLA 3RRUA 5LP0A 4FU3A 5LOZA 3G2SA 4Q96A 1EYHA 1HF8A 1JWGA 3D9NA 2KM4A 3D9JA 1SZ9A 2BF0X 3D9IA 3ZYLA 3D9PA 5CMWA 5CMYA 4Q94A 1XGWA 2L0IA 1SZAA 2LO6A 2DIWA 1H0AA 4GZDA 3ZYQA 4AVXA 1ELKA 3D9OA 5J08A 3G2WA 3D9KA 4FLBA 1MHQA 1HG5A 1INZA 1HG2A 1VDYA 3G2VA 1JUQA 2L0TB 1HFAA 1X5BA 1JPLA 3ZYMA 2V8SE 4JXTA 1DVPA 1EDUA
chains in the Genus database with same CATH superfamily
3CVNA 3ZYKA 1N9AA 2H6HA 4RLYA 3ABLE 3JYSA 4Q69A 4L1BA 3ASNE 4FLHA 5CHEE 5KNHD 5LCWJ 2M63A 3ZYQA 4BX9A 2F8YA 3CHOA 5FZQA 2CG2A 1BD8A 4MLPA 1DNPA 3VTYA 2F37A 4G2VA 4HFGA 5BV0A 3TWSA 3SNXA 3DBSA 4UWGA 5HRYA 3NZSA 4F6RD 3FY4A 4HOTA 2ETCA 2P9LG 4UUCA 1E8ZA 4B8CB 1OWMA 4M3OA 3MYVA 5KWDA 3MKQB 3S7BA 4Y6CA 4EECA 3L9TA 4HLEA 4X8QA 3TJPA 4HNAD 5G04C 1RZ4A 3UM0A 3PRZA 2J4DA 2X38A 3D9NA 3EHRA 2UY1B 4TXRA 3C3QA 3FUKA 5KJMA 2YINA 4ACLA 2B0OE 4YDYA 3IV0A 3EU9A 3ULEG 3Q7FA 2L0TB 2R2LA 1NZNA 1OCOE 3DPDA 1O1RA 4I2WA 3AG2E 1HX8A 3IXEA 3T5XA 4B93B 3MCXA 1MZCA 1E8XA 1WDYA 2BUGA 1TN7A 5DBKA 4P29A 1RW2A 2YHEA 3TGOA 2UY1A 2ETBA 4EBAG 3I3NA 5LX8A 4RQIA 4N2QA 4PS8A 3Q79A 4HI9A 3DSVA 3APDA 1BI8B 5CMWA 2XPYA 3TG4A 4LRZA 1FVFA 1TNYA 4F3VA 1KLXA 1IYGA 4F1SA 3CVXA 5ENQD 3HRAA 4CGWA 5BV1A 3BQOA 3CGHA 2WXKA 4FLBA 2GRPB 4YVOA 1TR4A 3Q49B 3OTNA 1H2UA 2CHZA 1Y6IA 3UM2A 3GYZA 3TXMA 3LVRE 4CCAA 4J8YA 2OVFA 4U8HA 2LO6A 2CG3A 4OYSA 5JHBA 1KPSB 5G05J 3CHPA 3W9FA 1WG0A 2IO3C 3FEXA 1MX4A 3TXNA 2ZXWE 3FH5A 2C2LA 3Q75A 1H6OA 4WNDA 2Y3AA 3MV3B 4U07A 4IRUA 3FUJA 4BT9A 2V4HC 5FQ6A 2XHEA 4G8KA 4DLQA 4GTQA 1OWOA 5AQAA 4BEPA 3FUIA 4FJZA 3CVWA 3FTUA 3MEKA 3FTXA 3KAEA 4OVUA 3QAQA 5ENRD 3QJZA 2EIKE 5D66A 2IONA 5G55A 3K9IA 2OCCE 3SD5A 4UWHA 4DRXE 4JEUA 2PQNA 1U3CA 3SY2A 4GZ6A 3UIOC 1TN8A 1U2VG 4JA7A 3CKCA 3UQ3A 3ZN3A 4HRLA 4O1PA 4DX6D 5CERB 4D10C 2VYIA 4N3AA 4I6JA 1N4PA 3ISMC 1QZ2A 4CRWA 4JEHA 5CRUA 3JXJA 2IOLA 3BG1B 4FP7A 3AG3E 2OV8A 4B94A 3V31A 4FADA 4XI9A 4BY6A 1LTXA 1TN6A 3MKRA 3BU8A 5CCMA 3AS8A 3EUVA 4EZJA 3Q15A 4PDXA 3X2QE 3CVYA 2LUHA 2P9PG 1N0QA 2R03A 3EDTB 3RAUA 1V54E 1YYHA 3CLJA 4A1GA 2MRIA 3UT4A 3J5QB 4B0ZA 4U7EB 1ELKA 1INZA 3PZ1A 3CVVA 2IFUA 5FJYA 3CHQA 5B3SE 3ONKA 3S7JA 2X6FA 1IQRA 1AWCB 2WPVA 3PUKA 1N0RA 3E34A 5ANRA 4GA1A 2WVIA 3HVEB 1L5JA 4WWOA 4BWRA 4UWFA 3V79K 3B7TA 3NAWA 4DX2A 3V2OA 4JHRA 4C9BB 1PAQA 4JXTA 5ENOD 2WXGA 1YA0A 1OCZE 4HI8A 4G26A 1D8DA 4HOQA 4GZ5A 3JUEA 2WXMA 1S0PA 2P9UG 4IULA 1K8KG 1NA3A 5EYPF 3DSXA 4GMRA 2P9KG 2AW6A 3G2VA 2KATA 3O4ZA 3JXIA 3JQ1A 2AXZA 1NI1A 3Q5MA 4H7YA 4O60A 3ML8A 4BX8A 4Z68A 3QWWA 2GGFA 4N3CA 2WXOA 2FBNA 3R9MA 2GRQB 3TWUA 3NBNB 2WMNA 4GTOA 3PZ3A 2XS1A 4UI9K 2XEEA 2WB2A 4FHJA 5AQBA 3T8MA 3AS4A 5BUZA 3ENEA 1SQMA 5BXOA 5EDSA 2BEDA 3ESLA 2DBAA 4I1AA 3LY7A 4JZYA 3IHYA 4UI9C 3KS2A 1PC2A 3DEOA 3ABME 4CYMD 4L2LA 3LJ3A 2R17C 2V0PA 2VSNA 5AJDA 2J07A 4DX7D 4HRMB 4L23A 1DCEA 5CEAA 3CVUA 2J8SD 3B7SA 4GYWA 3TWTA 2RD0A 3PUJA 3ZU7B 4J8DA 4EPZA 3J5PA 1DVPA 4DK5A 5IY5E 3CVQA 5JJ7A 3ZXPA 3UT8A 1BLXB 3FFLA 5D0QD 2FULA 5FINA 4U96D 1NA0A 3SBTB 2IQCA 4ANXA 3PS6A 3FTZA 1A5EA 1E8YA 4GTRA 1N11A 2KCVA 2CFZA 4AOFA 2CHWA 4FC8A 2XPIA 5KNGA 4KMOA 1TYQG 2NXPA 2QC9A 3ZW3A 3DSUA 5FWQA 2VJ8A 4BTAA 1MYOA 4ILHB 3V2XA 3QK0A 5AAOA 5KJLA 2RFMA 5D0OD 2XS8A 5ARFA 3QWPA 5HQ8A 4JHJA 4BT8A 4WWPA 3G2UA 1ZB1A 3ONLA 4U95D 2WXHA 4XX5A 3UKRG 1K3ZD 3LPZA 1S70B 1SA5A 2WXPA 3FUMA 4AEZC 4NIKA 2V4LA 5JHAA 2KXPC 4J8EA 4UWLA 4ATZD 4L2YA 4GAAA 4PS7A 1Z5SC 3GZ1A 2CHXA 4G1TA 2F8XK 4GTTA 3LCAA 5T8IA 4AP2A 3QKYA 1BPOA 3S2AA 3F6QA 4DX5D 2GRMA 5G2NA 3R7QA 3FEYA 2ZU6B 4F1PA 5LP0A 2I6HA 3C72A 5BXUA 5AENA 1UG3A 3RRMB 3ZGQA 2WQ7A 2V5QC 3KEAA 1VDYA 4KVMA 3MJWA 1KT0A 4JVSA 1PY1A 2XGMA 4G8LA 2EINE 3IKOB 5KBAA 2DZNA 2VGXA 3SI5A 2EILE 3ML9A 2A4ZA 1HG5A 2BKGA 1Z3XA 1JCRA 3KSQA 4U8YD 3ZUVB 3QNKA 4XKBA 2HYZA 4APOA 1HU3A 4I6GA 4RG6A 4GZDA 1S63A 5FTPA 4EQFA 2WMOA 2L6BA 2H6IA 3LVQE 3Q78A 1JUQA 2E0IA 4GA2A 4YDOA 3UI2A 2XEVA 1N54A 4DJAA 4O6FA 2JEKA 1XGWA 4LCTA 2ZIRA 2FI7A 1K1AA 3PE4A 3Q9NC 5BT1A 2Y69E 3PH0C 4LUNU 4AXHA 3P1UA 5DIZA 5JJ6A 5FZRA 2XZDG 2Y1LE 4RVBA 2L0IA 4LNBA 4DPRA 4I1OB 1G3NB 2J4BA 4K5CA 5ENTD 2WXNA 3L22A 4Y6WA 1H2VC 3Q9UC 2ILRA 2Y4TA 5ANLA 3URZA 3RU0A 4GCOA 4JPSA 4GZCA 3RK6A 3RRUA 4TRQA 1N52A 3QDNA 1UW4B 4CDRA 1SZAA 2NSZA 4GCNA 2J9QA 3U4TA 1X5BA 5CCLA 4HS2A 4HXIA 3HXFA 3PNLB 3TWXA 3UM1A 4BSXA 5BNWA 3LYAA 3FULA 4NURA 3FTSA 4YDEA 2PM7A 3DSWA 2ZISA 4QFVA 2ZGDA 5A7DB 5EIDA 2CFUA 4AVXA 4ANUA 4MKTA 4GA0A 3CK7A 3FUEA 3FH8A 3GZ2A 1UN8A 3HXEA 4E85A 3U66A 5KJNA 3UT7A 1H19A 1IHGA 1EYHA 2UWJG 2EIJE 1HH8A 4JHKA 4CEMA 3LEWA 3ZPJA 1HZ4A 2IF4A 3Q47B 4APFA 1FVHA 4L9PA 1O1TA 2ETAA 3CHSA 2RFAA 1E90A 3KSLA 2WXIA 2VQ2A 4YDWA 1W3BA 4UQYA 3LY8A 2OVBA 2XQ0A 3IHVA 4HLLA 4CT4A 2VTBA 2OEVA 4O1OA 3QOUA 3E37A 3NF1A 3FTYA 1JCQA 1Z6TA 1TEZA 4U0UA 4JD2G 3CQGB 1H2TC 1OUVA 3DWLG 3S7FA 3I4GA 1EPUA 5KJKA 3D9HA 3D9IA 2GRRB 1DC2A 3HXBA 4WWNA 1MHQA 1WAO1 3TWRA 4UQXA 5A23A 3PEVB 5G04J 5JA4D 4BETA 5D2MC 2PZIA 2LNIA 3PE3A 1E8WA 4AM9A 1WM5A 2IEJA 2KC7A 3RSEG 5AIJA 3L82A 3SGHA 2OOEA 2VGEA 4FU3A 3MV2B 3OXLA 2Y4UA 2XCBA 4MRUA 3L16A 2LSVA 5H7PA 3ABKE 2I1KA 3APFA 4C0EA 2IOSA 4A3VA 2KBXA 1OWLA 5LCWC 2I9CA 2X6HA 4WNGA 2BKKB 3SO8A 1N4SA 3G2WA 4KZ0A 4RG9A 2WXRA 3HG0D 3L17A 3ZHEA 1E96B 3HDXA 3AG4E 3ZRHA 2DZOA 4AV7A 2XEHA 2WM9A 1UJJA 3IBEA 3D9MA 1XNFA 1SZ9A 3I5PA 2L9BA 3BEEA 2WQHA 4A1SA 5FQ7A 4LERA 1MJ0A 2XZTG 5AARA 3FWVA 2WXLA 4DUIA 4UQZA 1Z3YA 3ZYMA 2GRNB 3NZUA 4N5QA 3E32A 3UUXA 2KM4A 3EHMA 1SW6A 3E33A 3C5RA 3ASFA 4I9CA 2IU1A 5E75A 5AQ9A 2XPZA 2BTDA 5FZSA 5J90A 1V55E 4I9EA 2MHKA 3VTXA 1JPLA 4U04A 2VSOE 3KEZA 5JMND 4N3BA 1A17A 3Q73A 2YQ8A 3C3RA 5CBNA 4MS6A 5LOZA 2P58C 5AQ7A 4N5CA 4URKA 2P2CP 1IKND 4M7CA 3CEQA 2LSUA 3AU4A 4KZCA 2H6FA 4K03A 1JWFA 3UM3A 1KT1A 1NFIE 2VGYA 4ABNA 2C0LA 1K1BA 4FULA 3FUHA 2HE0A 2P9SG 3ULYA 3OXGA 1GW6A 3E4BA 3MZLB 4OVVA 4J7WA 2YHCA 4EBAA 2A5EA 2QYJA 2LXMA 1QNFA 4JW1A 2P9IG 1ZBPA 3LY9A 1LD8A 2IY0C 2DCPA 2Q7FA 5AYWD 4LG6A 4ZFHA 3CSFA 3LKUA 4TXQA 1ZU2A 4GU5A 3FTWA 5ENSD 2EQXA 3GW4A 5AJLA 1H6KA 1OCRE 3RO2A 4BSZB 3FUFA 5J08A 5EX0A 2XGOA 1YMPA 1MQSA 4J0UA 2I1JA 3B7BA 2J49A 4GB9A 2KZTB 2B6CA 1ELRA 5FQ8A 2R5SA 3U3WA 3TWWA 3E30A 1IXVA 1H0AA 3FDHA 4BFRA 2I2OA 2QFCA 3PZ4A 3CR3A 4GTMA 3ASDA 2XGSA 3HYMB 2PNNA 1FT2A 2Y0BG 4TXPA 2WXJA 1BU9A 3WXXA 4DLOA 5CEDB 3EIJA 4FJYA 2GROB 2KZTA 4H7XA 3RKVA 4B89A 4CDMA 2XENA 1TJCA 4ATGA 4YNDA 1OCCE 3DSSA 2VGXB 4DI3A 3UIPC 3R9AB 3V30A 4CDNA 4ILIA 2FF4A 5KCMA 2KCLA 1AP7A 3IEGA 3CVLA 4AJWA 3FU5A 1TJFA 5EILA 3W9GA 4J8FA 4NACA 1NP7A 3ZXSA 2ONDA 3ASOE 3DXMG 3ZNGA 1NL4A 3NB2A 2LAHA 1FT1A 3N71A 4G23A 2X6IA 3CK9A 3FU0A 3LDZA 3AU5A 1OT8A 1D8EA 3NOCD 5T4YA 1HF8A 3WG7E 4G25A 2BF0X 3NQPA 3U9WA 5CECB 2HO1A 1N94A 3DRAA 4GTPA 5ARGA 4FHKA 1HO8A 1TNZA 4U8VD 3MKQA 2AXVA 3AJIA 3T9KA 1B89A 1JCSA 3RRNB 4HOSA 3HXCA 4K5AB 3TL5A 3C98A 4E6HA 2H6GA 4N39A 2GRLA 2FEZA 3ZYLA 3HIZA 4UI9J 3D9OA 3HHMA 3P2BA 3T8KA 3PEUB 3SZ7A 2DYSE 4XKCA 5CRVA 1OY3D 4LEUA 4G11A 3ZKJA 2PQRA 3SF4A 3ULQA 1FPPA 1IHBA 3HXDA 4HVBA 5E76A 3UXGA 1N95A 3ZIMA 4EZLA 3OAWA 4TUMA 3T5VA 2FO7A 3TWQA 3FU3A 2P9NG 5LFAA 4KT6B 4WUYA 4A55A 1OWNA 3UPVA 3PDNA 5BPPA 3O48A 4I43A 4EZKA 2RG8A 3RJVA 3ZVVA 3LJNA 3AS5A 3LS8A 2X3MA 5JJTA 4BERA 4F7AA 5T3RA 4XI0A 1WY6A 2QYUA 4N2SA 3D3MA 1EF1C 2GW1A 4GPMA 1KZOA 3CK8A 2R59A 5HI7A 3EU5A 3EHNA 2L6JA 3KD7A 4XZ4A 3B7RL 2DVWA 4KXKB 3FP3A 2JLBA 4PUCA 4GMJA 4A63B 2V8SE 1UOHA 3FTVA 3G2TA 3FH7A 4ILGA 3G2SA 1QQEA 2VTBB 4ME2A 2DIWA 5EYLA 2VSXE 4JB8P 2J08A 4XEIG 4ACKA 1O5MA 2ZGGA 3BG0B 4I6EA 3UKUG 3SBSA 3JUIA 4AY6A 3CIAA 3U64A 1D9SA 4B8AA 3MA5A 4PS3A 2DYRE 4KYOB 5ENNA 1HXIA 3L6AA 5B1AE 2A5UA 4J6IA 4OAUC 4CT0A 4CZ2D 4XE0A 5M72A 3VLFA 4OAVB 4GYYA 4HB5A 1U3DA 3DSTA 3SQVA 2KCKA 2QY7A 3RIBA 4TV3A 5A6CA 4AY5A 2PL2A 1TNUA 2NC9A 1E7VA 3D9PA 3CHMA 4DI4A 2V5FA 3RO3A 4DX1A 1YCSB 1HFAA 3CKBA 4XIFA 4I1MA 2MOWA 3ZFWA 5FIOA 4YVQC 3JQ0A 1HS6A 4I2ZA 1SVXA 3FU6A 3EJNA 3AAAC 2R05A 4V3IA 4RSYA 3ZHEB 4ZHBA 4NRHB 3MX3A 3LXUX 4I17A 1X81A 2AWIA 1EDUA 1HE8A 1Y8MA 5C2YA 1LF8A 3VLDA 1UN9A 5ENPD 5FT9A 4U63A 4CGVA 4K0RA 1FCHA 2AJAA 5AN8A 1TNBA 3D9KA 3UINC 2AVPA 4JA9A 2WXQA 4F53A 2XRYA 1N4RA 3CSTA 3ESKA 2OEWA 3TG5A 5EX3A 4GPKA 3CV0A 3L08A 3FUDA 5EKQD 1LD7A 1Q2ZA 2WQ6A 5HS0A 2J09A 3Q7AA 4HOUA 4AIFA 2LAIA 3CHRA 3D9JA 4GTVA 3CVPA 4IYPA 3TAXA 3Q4AB 1E7UA 3OXFA 3SFYA 4TUUA 3SFXA 1H6PA 4WNEA 3ASGA 3PZ2A 4LNGA 1IQUA 1S64A 4Q94A 3DEPA 4HRNA 3C3OA 4GZ3A 1O1SA 3APCA 3HVEA 3EIQC 2FO1E 4WNFA 4BESA 2NYJA 4UWKA 5B1BE 1TNOA 1N4QA 3DPYA 3TWVA 3ASHA 4FA6A 3JCKC 3EHQA 3PREA 2HM8A 1OXJA 1ELWA 2RKKA 4GYOA 2IJGX 5BW8C 4PH4B 3UMVA 5CBOA 2X6JA 4K5BA 2XRZA 2MYOA 4ANWA 5ITZF 2DWZA 3DXKG 2F0YA 2WXFA 4Q96A 2LXLA 3NOGD 2E2EA 3QC1A 5EN5D 1SA4A 5C1DA 4U0SA 3PZDA 2IO2C 3L13A 2VSYA 4MBGA 1MX2A 3PNTB 4JC8A 3SFZA 4KVOA 3B95A 5EIBE 4ANVA 4HORA 4HQDA 2JABA 4LNUD 1HG2A 3MGBA 1BI7B 3QWVA 2R02A 5HKPA 3D9LA 4GMLA 1MX6A 2PM6A 2X6KA 4HBDA 3FUNA 3QARA 3R7RA 1QYMA 1P5QA 2HR2A 3FHEA 2AXUA 4G24A 4U0ZA 4EHMA 3BUAA 3SHFA 4C0MA 3GZSA 5G05C 3ZEFA 3L54A 3AG1E 4NQ0A 4C48B 4L7TA 4W9RA 1KZPA 4QQIA 2QZAA 4WAFA 4IN3B 3S7DA 2C0MA 3I4RB 3B13A 4A3TA 4BTBA 3PVLA 1UJKA 4R7LA 4GTSA 4JL0A 1OWPA 1JWGA 1QBQA 4J8SA 3QB2A 5CMYA 3UTMA 3B7UX 3VLEA 3UX4A 4KBQA 2XCCA 2YNQA 4LSZE 1DCQA 2EIME 5FQ4A 3CQCB
chains in the Genus database with same CATH topology
3CVNA 4UI9K 3ZYKA 5LFAA 4KT6B 3PEVB 2WB2A 5G04J 4WUYA 4A55A 1OWNA 3UPVA 3JYSA 4Q69A 3PDNA 4FHJA 4L1BA 4FLHA 3T8MA 2PZIA 3AS4A 2LNIA 5CHEE 5BUZA 5BPPA 5LCWJ 3ENEA 1SQMA 3PE3A 3O48A 1E8WA 4AM9A 2M63A 4I43A 5EDSA 4EZKA 2RG8A 1WM5A 3RJVA 3ESLA 2DBAA 4I1AA 3ZYQA 3LY7A 3ZVVA 4BX9A 3AS5A 3LS8A 3CHOA 4JZYA 3IHYA 5FZQA 2X3MA 4UI9C 3KS2A 1PC2A 2CG2A 4MLPA 5JJTA 1DNPA 2KC7A 4F7AA 5T3RA 4XI0A 1WY6A 3VTYA 5AIJA 4N2SA 4G2VA 3D3MA 1EF1C 2GW1A 4HFGA 3SGHA 4L2LA 5BV0A 3LJ3A 3SNXA 3CK8A 2OOEA 3DBSA 2R17C 2V0PA 2R59A 2VSNA 3MV2B 3OXLA 4FU3A 4UWGA 5AJDA 5HI7A 2J07A 3NZSA 4HOTA 3FY4A 3EHNA 4L23A 2Y4UA 3CVUA 1E8ZA 2L6JA 3KD7A 4B8CB 1OWMA 4XZ4A 2XCBA 3B7RL 3MYVA 3B7SA 4M3OA 4MRUA 4GYWA 3MKQB 2RD0A 3L16A 2LSVA 4KXKB 3FP3A 3PUJA 4J8DA 3S7BA 2JLBA 4PUCA 4GMJA 4EPZA 4Y6CA 4EECA 2V8SE 1DVPA 4HLEA 4DK5A 2I1KA 3TJPA 3FTVA 3CVQA 3G2TA 5JJ7A 3UT8A 3FH7A 4ILGA 5G04C 3G2SA 1QQEA 3APFA 3FFLA 2VTBB 3PRZA 2J4DA 2X38A 3D9NA 4ME2A 2UY1B 2FULA 2IOSA 3FUKA 5D0QD 4A3VA 4C0EA 1OWLA 5KJMA 5LCWC 2YINA 2I9CA 2X6HA 4WNGA 4ACLA 2DIWA 1NA0A 3SBTB 3G2WA 3IV0A 2VSXE 4KZ0A 2J08A 2WXRA 2IQCA 4RG9A 4ACKA 3PS6A 4ANXA 3FTZA 3L17A 2L0TB 3BG0B 1E8YA 3ZHEA 4I6EA 1E96B 1NZNA 3DPDA 3HDXA 4I2WA 3ZRHA 1HX8A 2KCVA 2CFZA 4AV7A 4AOFA 2CHWA 4FC8A 3T5XA 3MCXA 2XPIA 2WM9A 1UJJA 3IBEA 3JUIA 3D9MA 3SBSA 4KMOA 4AY6A 3CIAA 1XNFA 1E8XA 2NXPA 1SZ9A 3I5PA 3ZW3A 2BUGA 3U64A 2L9BA 5FWQA 3BEEA 2WQHA 4A1SA 4B8AA 2VJ8A 5DBKA 4BTAA 3MA5A 4ILHB 4P29A 5FQ7A 4LERA 3QK0A 4PS3A 5KJLA 2YHEA 3TGOA 5D0OD 4KYOB 3FWVA 2WXLA 2UY1A 5ARFA 3QWPA 1Z3YA 4UQZA 3ZYMA 5ENNA 5HQ8A 1HXIA 4JHJA 3I3NA 3NZUA 4BT8A 4EBAG 5LX8A 3L6AA 2A5UA 4J6IA 4WWPA 4N2QA 3G2UA 3ONLA 4CT0A 4PS8A 2WXHA 3UUXA 4XX5A 2KM4A 4XE0A 3EHMA 3APDA 3LPZA 5CMWA 5M72A 3ASFA 3VLFA 2XPYA 4I9CA 4GYYA 2IU1A 4LRZA 1U3DA 5E75A 1FVFA 3TG4A 2XPZA 2BTDA 5FZSA 4F3VA 2WXPA 3FUMA 4AEZC 5J90A 2V4LA 4I9EA 2MHKA 1KLXA 3VTXA 5JHAA 1JPLA 4J8EA 4U04A 4UWLA 1IYGA 2VSOE 2KCKA 4F1SA 4L2YA 3KEZA 4GAAA 4N3BA 2QY7A 1A17A 3RIBA 3CVXA 4TV3A 5A6CA 2YQ8A 4PS7A 4AY5A 4MS6A 5LOZA 3GZ1A 2P58C 2CHXA 2PL2A 4G1TA 2NC9A 4CGWA 3LCAA 1E7VA 3D9PA 5BV1A 5T8IA 4N5CA 3CHMA 4URKA 4AP2A 3QKYA 3CGHA 2WXKA 1BPOA 3S2AA 4DI4A 4FLBA 2V5FA 3RO3A 3CEQA 4YVOA 2LSUA 3AU4A 2GRMA 5G2NA 3Q49B 4KZCA 1HFAA 3CKBA 3OTNA 3R7QA 4XIFA 4K03A 1H2UA 1JWFA 1KT1A 3FEYA 4I1MA 2MOWA 3ZFWA 2CHZA 1Y6IA 2ZU6B 2VGYA 4YVQC 3GYZA 3JQ0A 4ABNA 1HS6A 4I2ZA 2C0LA 4FULA 3FU6A 3FUHA 5LP0A 2I6HA 3EJNA 3TXMA 3LVRE 4CCAA 4V3IA 4RSYA 2OVFA 4U8HA 1UG3A 3ZHEB 4NRHB 5AENA 3OXGA 2LO6A 2CG3A 4OYSA 1GW6A 3RRMB 5JHBA 3E4BA 3MX3A 3MZLB 3ZGQA 5G05J 2WQ7A 3LXUX 4I17A 2AWIA 1VDYA 3CHPA 4OVVA 4KVMA 2YHCA 3MJWA 4EBAA 1KT0A 3FEXA 1QNFA 1EDUA 4JW1A 4JVSA 1ZBPA 3LY9A 3TXNA 1HE8A 1PY1A 1Y8MA 3FH5A 5C2YA 1LF8A 3VLDA 2C2LA 1UN9A 2DCPA 2Q7FA 5AYWD 2XGMA 5FT9A 4U63A 4WNDA 2Y3AA 4CGVA 3CSFA 3MV3B 4K0RA 3LKUA 4U07A 1FCHA 3IKOB 4IRUA 2VGXA 3FUJA 4BT9A 1ZU2A 3SI5A 5FQ6A 2XHEA 3ML9A 3D9KA 2A4ZA 1HG5A 4DLQA 2AVPA 4GU5A 2WXQA 3FTWA 4JA9A 4F53A 2EQXA 2XRYA 1OWOA 3CSTA 3ESKA 3TG5A 5EX3A 1Z3XA 3GW4A 4GPKA 5AJLA 3CV0A 3L08A 3FUIA 1H6KA 3FUDA 5EKQD 3QNKA 4FJZA 4XKBA 2WQ6A 2HYZA 3RO2A 4APOA 1HU3A 2J09A 4I6GA 3CVWA 3FTUA 4HOUA 3MEKA 2LAIA 4AIFA 3CHRA 3D9JA 3FTXA 4RG6A 4GZDA 3CVPA 5FTPA 3FUFA 3KAEA 4IYPA 2WMOA 4OVUA 4EQFA 5J08A 3QAQA 3LVQE 3TAXA 3QJZA 1JUQA 5EX0A 2XGOA 2E0IA 4GA2A 1MQSA 2IONA 4J0UA 2I1JA 3Q4AB 1E7UA 2XEVA 5G55A 2J49A 3K9IA 3SD5A 3OXFA 4GB9A 4UWHA 2KZTB 1N54A 1ELRA 4TUUA 4DJAA 4O6FA 4WNEA 5FQ8A 3ASGA 4JEUA 2PQNA 2R5SA 1U3CA 3U3WA 1IQUA 2JEKA 4Q94A 1XGWA 4GZ6A 4LCTA 1H0AA 3FDHA 2FI7A 4BFRA 2I2OA 3PE4A 5BT1A 2QFCA 4GZ3A 3APCA 3CR3A 3EIQC 3HVEA 4JA7A 3PH0C 4LUNU 4AXHA 3ASDA 2XGSA 3CKCA 3UQ3A 3HYMB 3P1UA 3ZN3A 4WNFA 5DIZA 4D10C 5JJ6A 5FZRA 2VYIA 4N3AA 2WXJA 4UWKA 4I6JA 3WXXA 4DLOA 3ASHA 3EIJA 4FA6A 1QZ2A 3JCKC 3PREA 4FJYA 4RVBA 2HM8A 2L0IA 1ELWA 4I1OB 4CRWA 2KZTA 4DPRA 4H7XA 2J4BA 3RKVA 4JEHA 4GYOA 2WXNA 4B89A 4CDMA 2IJGX 2IOLA 3BG1B 3L22A 4Y6WA 1H2VC 5BW8C 4PH4B 4FP7A 3UMVA 1TJCA 2OV8A 2X6JA 4ATGA 4B94A 4FADA 2ILRA 2Y4TA 4YNDA 5ANLA 3URZA 2XRZA 4ANWA 2VGXB 4XI9A 3RU0A 4BY6A 4GCOA 4DI3A 4JPSA 3MKRA 4GZCA 3RK6A 3RRUA 2WXFA 4Q96A 3R9AB 5CCMA 4TRQA 1N52A 2E2EA 3QC1A 4CDNA 3QDNA 4ILIA 1UW4B 5C1DA 3AS8A 4CDRA 4U0SA 1SZAA 2FF4A 5KCMA 4EZJA 2KCLA 3PZDA 3Q15A 4PDXA 2NSZA 3CVYA 3IEGA 4GCNA 2J9QA 3CVLA 3U4TA 4AJWA 1X5BA 5CCLA 4HS2A 4HXIA 3FU5A 3PNLB 3EDTB 3L13A 1TJFA 4BSXA 5BNWA 4J8FA 3LYAA 2VSYA 3CLJA 4A1GA 4NACA 1NP7A 3FULA 4JC8A 3PNTB 4NURA 3FTSA 2MRIA 3UT4A 3SFZA 2PM7A 4KVOA 3ZXSA 4ANVA 2ONDA 4B0ZA 4QFVA 5A7DB 4HORA 2CFUA 1ELKA 4AVXA 4ANUA 1INZA 1HG2A 4MKTA 4GA0A 3CK7A 3MGBA 2LAHA 3CVVA 3QWVA 2IFUA 3N71A 5FJYA 3CHQA 4G23A 3FUEA 3ONKA 3S7JA 2X6IA 3CK9A 2X6FA 1IQRA 3FU0A 2WPVA 3D9LA 3FH8A 3GZ2A 3PUKA 4GMLA 3LDZA 1UN8A 4E85A 2PM6A 3AU5A 2X6KA 3U66A 5ANRA 5T4YA 3FUNA 1H19A 1IHGA 3UT7A 5KJNA 1EYHA 1HF8A 4GA1A 3QARA 2UWJG 2WVIA 2BF0X 3HVEB 4G25A 3R7RA 1HH8A 1P5QA 3NQPA 4JHKA 1L5JA 3LEWA 2HR2A 3U9WA 2HO1A 3ZPJA 4CEMA 4WWOA 3FHEA 1HZ4A 2AXUA 4G24A 4BWRA 2IF4A 4U0ZA 3Q47B 4UWFA 4APFA 1FVHA 3B7TA 5ARGA 4FHKA 3SHFA 1HO8A 4JHRA 4C0MA 4C9BB 3GZSA 5G05C 3ZEFA 1PAQA 4JXTA 2WXGA 1YA0A 3CHSA 3MKQA 3L54A 2AXVA 1E90A 4NQ0A 4L7TA 2WXIA 4W9RA 1B89A 4G26A 2VQ2A 3RRNB 4HOSA 4HOQA 4GZ5A 3TL5A 3C98A 4E6HA 2WXMA 4N39A 1S0PA 1W3BA 2GRLA 4IULA 2FEZA 4UQYA 3ZYLA 4WAFA 4IN3B 1NA3A 3LY8A 3HIZA 4UI9J 2OVBA 3S7DA 2XQ0A 3IHVA 3D9OA 3HHMA 3P2BA 3PEUB 2C0MA 4CT4A 2AW6A 3I4RB 3G2VA 2VTBA 3B13A 3QOUA 4A3TA 2KATA 3SZ7A 4BTBA 3O4ZA 4XKCA 3NF1A 3FTYA 4LEUA 1Z6TA 3PVLA 1TEZA 4U0UA 4G11A 3JQ1A 1UJKA 2AXZA 4R7LA 3CQGB 1H2TC 4JL0A 1OUVA 2PQRA 3Q5MA 1OWPA 4H7YA 3SF4A 3ML8A 3ULQA 4BX8A 3S7FA 3I4GA 1EPUA 5KJKA 1JWGA 4J8SA 3D9IA 3QB2A 3QWWA 5CMYA 4HVBA 5E76A 2GGFA 3B7UX 3VLEA 3UX4A 4WWNA 4N3CA 3ZIMA 4EZLA 2WXOA 4KBQA 1MHQA 3OAWA 3T5VA 1WAO1 2FBNA 2XCCA 2YNQA 2FO7A 4UQXA 2WMNA 5A23A 5FQ4A 3FU3A 3CQCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWF A;  3ZYK A;  1HX8 A;  1PY1 A;  2MOW A;  3D9L A;  1UJK A;  1LF8 A;  4HFG A;  2QY7 A;  3LDZ A;  3CLJ A;  2DCP A;  3G2T A;  4NAC A;  3ONK A;  3G2U A;  4GZC A;  1UJJ A;  3D9M A;  3ONL A;  3RRU A;  5LP0 A;  4FU3 A;  5LOZ A;  3G2S A;  4Q96 A;  1EYH A;  1HF8 A;  1JWG A;  3D9N A;  2KM4 A;  3D9J A;  1SZ9 A;  2BF0 X;  3D9I A;  3ZYL A;  3D9P A;  5CMW A;  5CMY A;  4Q94 A;  1XGW A;  2L0I A;  1SZA A;  2LO6 A;  2DIW A;  1H0A A;  4GZD A;  3ZYQ A;  4AVX A;  1ELK A;  3D9O A;  5J08 A;  3G2W A;  3D9K A;  4FLB A;  1MHQ A;  1HG5 A;  1INZ A;  1HG2 A;  1VDY A;  3G2V A;  1JUQ A;  2L0T B;  1HFA A;  1X5B A;  1JPL A;  3ZYM A;  2V8S E;  4JXT A;  1DVP A;  1EDU A; 
#chains in the Genus database with same CATH topology
 3CVN A;  3ZYK A;  1N9A A;  2H6H A;  4RLY A;  3ABL E;  3JYS A;  4Q69 A;  4L1B A;  3ASN E;  4FLH A;  5CHE E;  5KNH D;  5LCW J;  2M63 A;  3ZYQ A;  4BX9 A;  2F8Y A;  3CHO A;  5FZQ A;  2CG2 A;  1BD8 A;  4MLP A;  1DNP A;  3VTY A;  2F37 A;  4G2V A;  4HFG A;  5BV0 A;  3TWS A;  3SNX A;  3DBS A;  4UWG A;  5HRY A;  3NZS A;  4F6R D;  3FY4 A;  4HOT A;  2ETC A;  2P9L G;  4UUC A;  1E8Z A;  4B8C B;  1OWM A;  4M3O A;  3MYV A;  5KWD A;  3MKQ B;  3S7B A;  4Y6C A;  4EEC A;  3L9T A;  4HLE A;  4X8Q A;  3TJP A;  4HNA D;  5G04 C;  1RZ4 A;  3UM0 A;  3PRZ A;  2J4D A;  2X38 A;  3D9N A;  3EHR A;  2UY1 B;  4TXR A;  3C3Q A;  3FUK A;  5KJM A;  2YIN A;  4ACL A;  2B0O E;  4YDY A;  3IV0 A;  3EU9 A;  3ULE G;  3Q7F A;  2L0T B;  2R2L A;  1NZN A;  1OCO E;  3DPD A;  1O1R A;  4I2W A;  3AG2 E;  1HX8 A;  3IXE A;  3T5X A;  4B93 B;  3MCX A;  1MZC A;  1E8X A;  1WDY A;  2BUG A;  1TN7 A;  5DBK A;  4P29 A;  1RW2 A;  2YHE A;  3TGO A;  2UY1 A;  2ETB A;  4EBA G;  3I3N A;  5LX8 A;  4RQI A;  4N2Q A;  4PS8 A;  3Q79 A;  4HI9 A;  3DSV A;  3APD A;  1BI8 B;  5CMW A;  2XPY A;  3TG4 A;  4LRZ A;  1FVF A;  1TNY A;  4F3V A;  1KLX A;  1IYG A;  4F1S A;  3CVX A;  5ENQ D;  3HRA A;  4CGW A;  5BV1 A;  3BQO A;  3CGH A;  2WXK A;  4FLB A;  2GRP B;  4YVO A;  1TR4 A;  3Q49 B;  3OTN A;  1H2U A;  2CHZ A;  1Y6I A;  3UM2 A;  3GYZ A;  3TXM A;  3LVR E;  4CCA A;  4J8Y A;  2OVF A;  4U8H A;  2LO6 A;  2CG3 A;  4OYS A;  5JHB A;  1KPS B;  5G05 J;  3CHP A;  3W9F A;  1WG0 A;  2IO3 C;  3FEX A;  1MX4 A;  3TXN A;  2ZXW E;  3FH5 A;  2C2L A;  3Q75 A;  1H6O A;  4WND A;  2Y3A A;  3MV3 B;  4U07 A;  4IRU A;  3FUJ A;  4BT9 A;  2V4H C;  5FQ6 A;  2XHE A;  4G8K A;  4DLQ A;  4GTQ A;  1OWO A;  5AQA A;  4BEP A;  3FUI A;  4FJZ A;  3CVW A;  3FTU A;  3MEK A;  3FTX A;  3KAE A;  4OVU A;  3QAQ A;  5ENR D;  3QJZ A;  2EIK E;  5D66 A;  2ION A;  5G55 A;  3K9I A;  2OCC E;  3SD5 A;  4UWH A;  4DRX E;  4JEU A;  2PQN A;  1U3C A;  3SY2 A;  4GZ6 A;  3UIO C;  1TN8 A;  1U2V G;  4JA7 A;  3CKC A;  3UQ3 A;  3ZN3 A;  4HRL A;  4O1P A;  4DX6 D;  5CER B;  4D10 C;  2VYI A;  4N3A A;  4I6J A;  1N4P A;  3ISM C;  1QZ2 A;  4CRW A;  4JEH A;  5CRU A;  3JXJ A;  2IOL A;  3BG1 B;  4FP7 A;  3AG3 E;  2OV8 A;  4B94 A;  3V31 A;  4FAD A;  4XI9 A;  4BY6 A;  1LTX A;  1TN6 A;  3MKR A;  3BU8 A;  5CCM A;  3AS8 A;  3EUV A;  4EZJ A;  3Q15 A;  4PDX A;  3X2Q E;  3CVY A;  2LUH A;  2P9P G;  1N0Q A;  2R03 A;  3EDT B;  3RAU A;  1V54 E;  1YYH A;  3CLJ A;  4A1G A;  2MRI A;  3UT4 A;  3J5Q B;  4B0Z A;  4U7E B;  1ELK A;  1INZ A;  3PZ1 A;  3CVV A;  2IFU A;  5FJY A;  3CHQ A;  5B3S E;  3ONK A;  3S7J A;  2X6F A;  1IQR A;  1AWC B;  2WPV A;  3PUK A;  1N0R A;  3E34 A;  5ANR A;  4GA1 A;  2WVI A;  3HVE B;  1L5J A;  4WWO A;  4BWR A;  4UWF A;  3V79 K;  3B7T A;  3NAW A;  4DX2 A;  3V2O A;  4JHR A;  4C9B B;  1PAQ A;  4JXT A;  5ENO D;  2WXG A;  1YA0 A;  1OCZ E;  4HI8 A;  4G26 A;  1D8D A;  4HOQ A;  4GZ5 A;  3JUE A;  2WXM A;  1S0P A;  2P9U G;  4IUL A;  1K8K G;  1NA3 A;  5EYP F;  3DSX A;  4GMR A;  2P9K G;  2AW6 A;  3G2V A;  2KAT A;  3O4Z A;  3JXI A;  3JQ1 A;  2AXZ A;  1NI1 A;  3Q5M A;  4H7Y A;  4O60 A;  3ML8 A;  4BX8 A;  4Z68 A;  3QWW A;  2GGF A;  4N3C A;  2WXO A;  2FBN A;  3R9M A;  2GRQ B;  3TWU A;  3NBN B;  2WMN A;  4GTO A;  3PZ3 A;  2XS1 A;  4UI9 K;  2XEE A;  2WB2 A;  4FHJ A;  5AQB A;  3T8M A;  3AS4 A;  5BUZ A;  3ENE A;  1SQM A;  5BXO A;  5EDS A;  2BED A;  3ESL A;  2DBA A;  4I1A A;  3LY7 A;  4JZY A;  3IHY A;  4UI9 C;  3KS2 A;  1PC2 A;  3DEO A;  3ABM E;  4CYM D;  4L2L A;  3LJ3 A;  2R17 C;  2V0P A;  2VSN A;  5AJD A;  2J07 A;  4DX7 D;  4HRM B;  4L23 A;  1DCE A;  5CEA A;  3CVU A;  2J8S D;  3B7S A;  4GYW A;  3TWT A;  2RD0 A;  3PUJ A;  3ZU7 B;  4J8D A;  4EPZ A;  3J5P A;  1DVP A;  4DK5 A;  5IY5 E;  3CVQ A;  5JJ7 A;  3ZXP A;  3UT8 A;  1BLX B;  3FFL A;  5D0Q D;  2FUL A;  5FIN A;  4U96 D;  1NA0 A;  3SBT B;  2IQC A;  4ANX A;  3PS6 A;  3FTZ A;  1A5E A;  1E8Y A;  4GTR A;  1N11 A;  2KCV A;  2CFZ A;  4AOF A;  2CHW A;  4FC8 A;  2XPI A;  5KNG A;  4KMO A;  1TYQ G;  2NXP A;  2QC9 A;  3ZW3 A;  3DSU A;  5FWQ A;  2VJ8 A;  4BTA A;  1MYO A;  4ILH B;  3V2X A;  3QK0 A;  5AAO A;  5KJL A;  2RFM A;  5D0O D;  2XS8 A;  5ARF A;  3QWP A;  5HQ8 A;  4JHJ A;  4BT8 A;  4WWP A;  3G2U A;  1ZB1 A;  3ONL A;  4U95 D;  2WXH A;  4XX5 A;  3UKR G;  1K3Z D;  3LPZ A;  1S70 B;  1SA5 A;  2WXP A;  3FUM A;  4AEZ C;  4NIK A;  2V4L A;  5JHA A;  2KXP C;  4J8E A;  4UWL A;  4ATZ D;  4L2Y A;  4GAA A;  4PS7 A;  1Z5S C;  3GZ1 A;  2CHX A;  4G1T A;  2F8X K;  4GTT A;  3LCA A;  5T8I A;  4AP2 A;  3QKY A;  1BPO A;  3S2A A;  3F6Q A;  4DX5 D;  2GRM A;  5G2N A;  3R7Q A;  3FEY A;  2ZU6 B;  4F1P A;  5LP0 A;  2I6H A;  3C72 A;  5BXU A;  5AEN A;  1UG3 A;  3RRM B;  3ZGQ A;  2WQ7 A;  2V5Q C;  3KEA A;  1VDY A;  4KVM A;  3MJW A;  1KT0 A;  4JVS A;  1PY1 A;  2XGM A;  4G8L A;  2EIN E;  3IKO B;  5KBA A;  2DZN A;  2VGX A;  3SI5 A;  2EIL E;  3ML9 A;  2A4Z A;  1HG5 A;  2BKG A;  1Z3X A;  1JCR A;  3KSQ A;  4U8Y D;  3ZUV B;  3QNK A;  4XKB A;  2HYZ A;  4APO A;  1HU3 A;  4I6G A;  4RG6 A;  4GZD A;  1S63 A;  5FTP A;  4EQF A;  2WMO A;  2L6B A;  2H6I A;  3LVQ E;  3Q78 A;  1JUQ A;  2E0I A;  4GA2 A;  4YDO A;  3UI2 A;  2XEV A;  1N54 A;  4DJA A;  4O6F A;  2JEK A;  1XGW A;  4LCT A;  2ZIR A;  2FI7 A;  1K1A A;  3PE4 A;  3Q9N C;  5BT1 A;  2Y69 E;  3PH0 C;  4LUN U;  4AXH A;  3P1U A;  5DIZ A;  5JJ6 A;  5FZR A;  2XZD G;  2Y1L E;  4RVB A;  2L0I A;  4LNB A;  4DPR A;  4I1O B;  1G3N B;  2J4B A;  4K5C A;  5ENT D;  2WXN A;  3L22 A;  4Y6W A;  1H2V C;  3Q9U C;  2ILR A;  2Y4T A;  5ANL A;  3URZ A;  3RU0 A;  4GCO A;  4JPS A;  4GZC A;  3RK6 A;  3RRU A;  4TRQ A;  1N52 A;  3QDN A;  1UW4 B;  4CDR A;  1SZA A;  2NSZ A;  4GCN A;  2J9Q A;  3U4T A;  1X5B A;  5CCL A;  4HS2 A;  4HXI A;  3HXF A;  3PNL B;  3TWX A;  3UM1 A;  4BSX A;  5BNW A;  3LYA A;  3FUL A;  4NUR A;  3FTS A;  4YDE A;  2PM7 A;  3DSW A;  2ZIS A;  4QFV A;  2ZGD A;  5A7D B;  5EID A;  2CFU A;  4AVX A;  4ANU A;  4MKT A;  4GA0 A;  3CK7 A;  3FUE A;  3FH8 A;  3GZ2 A;  1UN8 A;  3HXE A;  4E85 A;  3U66 A;  5KJN A;  3UT7 A;  1H19 A;  1IHG A;  1EYH A;  2UWJ G;  2EIJ E;  1HH8 A;  4JHK A;  4CEM A;  3LEW A;  3ZPJ A;  1HZ4 A;  2IF4 A;  3Q47 B;  4APF A;  1FVH A;  4L9P A;  1O1T A;  2ETA A;  3CHS A;  2RFA A;  1E90 A;  3KSL A;  2WXI A;  2VQ2 A;  4YDW A;  1W3B A;  4UQY A;  3LY8 A;  2OVB A;  2XQ0 A;  3IHV A;  4HLL A;  4CT4 A;  2VTB A;  2OEV A;  4O1O A;  3QOU A;  3E37 A;  3NF1 A;  3FTY A;  1JCQ A;  1Z6T A;  1TEZ A;  4U0U A;  4JD2 G;  3CQG B;  1H2T C;  1OUV A;  3DWL G;  3S7F A;  3I4G A;  1EPU A;  5KJK A;  3D9H A;  3D9I A;  2GRR B;  1DC2 A;  3HXB A;  4WWN A;  1MHQ A;  1WAO 1;  3TWR A;  4UQX A;  5A23 A;  3PEV B;  5G04 J;  5JA4 D;  4BET A;  5D2M C;  2PZI A;  2LNI A;  3PE3 A;  1E8W A;  4AM9 A;  1WM5 A;  2IEJ A;  2KC7 A;  3RSE G;  5AIJ A;  3L82 A;  3SGH A;  2OOE A;  2VGE A;  4FU3 A;  3MV2 B;  3OXL A;  2Y4U A;  2XCB A;  4MRU A;  3L16 A;  2LSV A;  5H7P A;  3ABK E;  2I1K A;  3APF A;  4C0E A;  2IOS A;  4A3V A;  2KBX A;  1OWL A;  5LCW C;  2I9C A;  2X6H A;  4WNG A;  2BKK B;  3SO8 A;  1N4S A;  3G2W A;  4KZ0 A;  4RG9 A;  2WXR A;  3HG0 D;  3L17 A;  3ZHE A;  1E96 B;  3HDX A;  3AG4 E;  3ZRH A;  2DZO A;  4AV7 A;  2XEH A;  2WM9 A;  1UJJ A;  3IBE A;  3D9M A;  1XNF A;  1SZ9 A;  3I5P A;  2L9B A;  3BEE A;  2WQH A;  4A1S A;  5FQ7 A;  4LER A;  1MJ0 A;  2XZT G;  5AAR A;  3FWV A;  2WXL A;  4DUI A;  4UQZ A;  1Z3Y A;  3ZYM A;  2GRN B;  3NZU A;  4N5Q A;  3E32 A;  3UUX A;  2KM4 A;  3EHM A;  1SW6 A;  3E33 A;  3C5R A;  3ASF A;  4I9C A;  2IU1 A;  5E75 A;  5AQ9 A;  2XPZ A;  2BTD A;  5FZS A;  5J90 A;  1V55 E;  4I9E A;  2MHK A;  3VTX A;  1JPL A;  4U04 A;  2VSO E;  3KEZ A;  5JMN D;  4N3B A;  1A17 A;  3Q73 A;  2YQ8 A;  3C3R A;  5CBN A;  4MS6 A;  5LOZ A;  2P58 C;  5AQ7 A;  4N5C A;  4URK A;  2P2C P;  1IKN D;  4M7C A;  3CEQ A;  2LSU A;  3AU4 A;  4KZC A;  2H6F A;  4K03 A;  1JWF A;  3UM3 A;  1KT1 A;  1NFI E;  2VGY A;  4ABN A;  2C0L A;  1K1B A;  4FUL A;  3FUH A;  2HE0 A;  2P9S G;  3ULY A;  3OXG A;  1GW6 A;  3E4B A;  3MZL B;  4OVV A;  4J7W A;  2YHC A;  4EBA A;  2A5E A;  2QYJ A;  2LXM A;  1QNF A;  4JW1 A;  2P9I G;  1ZBP A;  3LY9 A;  1LD8 A;  2IY0 C;  2DCP A;  2Q7F A;  5AYW D;  4LG6 A;  4ZFH A;  3CSF A;  3LKU A;  4TXQ A;  1ZU2 A;  4GU5 A;  3FTW A;  5ENS D;  2EQX A;  3GW4 A;  5AJL A;  1H6K A;  1OCR E;  3RO2 A;  4BSZ B;  3FUF A;  5J08 A;  5EX0 A;  2XGO A;  1YMP A;  1MQS A;  4J0U A;  2I1J A;  3B7B A;  2J49 A;  4GB9 A;  2KZT B;  2B6C A;  1ELR A;  5FQ8 A;  2R5S A;  3U3W A;  3TWW A;  3E30 A;  1IXV A;  1H0A A;  3FDH A;  4BFR A;  2I2O A;  2QFC A;  3PZ4 A;  3CR3 A;  4GTM A;  3ASD A;  2XGS A;  3HYM B;  2PNN A;  1FT2 A;  2Y0B G;  4TXP A;  2WXJ A;  1BU9 A;  3WXX A;  4DLO A;  5CED B;  3EIJ A;  4FJY A;  2GRO B;  2KZT A;  4H7X A;  3RKV A;  4B89 A;  4CDM A;  2XEN A;  1TJC A;  4ATG A;  4YND A;  1OCC E;  3DSS A;  2VGX B;  4DI3 A;  3UIP C;  3R9A B;  3V30 A;  4CDN A;  4ILI A;  2FF4 A;  5KCM A;  2KCL A;  1AP7 A;  3IEG A;  3CVL A;  4AJW A;  3FU5 A;  1TJF A;  5EIL A;  3W9G A;  4J8F A;  4NAC A;  1NP7 A;  3ZXS A;  2OND A;  3ASO E;  3DXM G;  3ZNG A;  1NL4 A;  3NB2 A;  2LAH A;  1FT1 A;  3N71 A;  4G23 A;  2X6I A;  3CK9 A;  3FU0 A;  3LDZ A;  3AU5 A;  1OT8 A;  1D8E A;  3NOC D;  5T4Y A;  1HF8 A;  3WG7 E;  4G25 A;  2BF0 X;  3NQP A;  3U9W A;  5CEC B;  2HO1 A;  1N94 A;  3DRA A;  4GTP A;  5ARG A;  4FHK A;  1HO8 A;  1TNZ A;  4U8V D;  3MKQ A;  2AXV A;  3AJI A;  3T9K A;  1B89 A;  1JCS A;  3RRN B;  4HOS A;  3HXC A;  4K5A B;  3TL5 A;  3C98 A;  4E6H A;  2H6G A;  4N39 A;  2GRL A;  2FEZ A;  3ZYL A;  3HIZ A;  4UI9 J;  3D9O A;  3HHM A;  3P2B A;  3T8K A;  3PEU B;  3SZ7 A;  2DYS E;  4XKC A;  5CRV A;  1OY3 D;  4LEU A;  4G11 A;  3ZKJ A;  2PQR A;  3SF4 A;  3ULQ A;  1FPP A;  1IHB A;  3HXD A;  4HVB A;  5E76 A;  3UXG A;  1N95 A;  3ZIM A;  4EZL A;  3OAW A;  4TUM A;  3T5V A;  2FO7 A;  3TWQ A;  3FU3 A;  2P9N G;  5LFA A;  4KT6 B;  4WUY A;  4A55 A;  1OWN A;  3UPV A;  3PDN A;  5BPP A;  3O48 A;  4I43 A;  4EZK A;  2RG8 A;  3RJV A;  3ZVV A;  3LJN A;  3AS5 A;  3LS8 A;  2X3M A;  5JJT A;  4BER A;  4F7A A;  5T3R A;  4XI0 A;  1WY6 A;  2QYU A;  4N2S A;  3D3M A;  1EF1 C;  2GW1 A;  4GPM A;  1KZO A;  3CK8 A;  2R59 A;  5HI7 A;  3EU5 A;  3EHN A;  2L6J A;  3KD7 A;  4XZ4 A;  3B7R L;  2DVW A;  4KXK B;  3FP3 A;  2JLB A;  4PUC A;  4GMJ A;  4A63 B;  2V8S E;  1UOH A;  3FTV A;  3G2T A;  3FH7 A;  4ILG A;  3G2S A;  1QQE A;  2VTB B;  4ME2 A;  2DIW A;  5EYL A;  2VSX E;  4JB8 P;  2J08 A;  4XEI G;  4ACK A;  1O5M A;  2ZGG A;  3BG0 B;  4I6E A;  3UKU G;  3SBS A;  3JUI A;  4AY6 A;  3CIA A;  3U64 A;  1D9S A;  4B8A A;  3MA5 A;  4PS3 A;  2DYR E;  4KYO B;  5ENN A;  1HXI A;  3L6A A;  5B1A E;  2A5U A;  4J6I A;  4OAU C;  4CT0 A;  4CZ2 D;  4XE0 A;  5M72 A;  3VLF A;  4OAV B;  4GYY A;  4HB5 A;  1U3D A;  3DST A;  3SQV A;  2KCK A;  2QY7 A;  3RIB A;  4TV3 A;  5A6C A;  4AY5 A;  2PL2 A;  1TNU A;  2NC9 A;  1E7V A;  3D9P A;  3CHM A;  4DI4 A;  2V5F A;  3RO3 A;  4DX1 A;  1YCS B;  1HFA A;  3CKB A;  4XIF A;  4I1M A;  2MOW A;  3ZFW A;  5FIO A;  4YVQ C;  3JQ0 A;  1HS6 A;  4I2Z A;  1SVX A;  3FU6 A;  3EJN A;  3AAA C;  2R05 A;  4V3I A;  4RSY A;  3ZHE B;  4ZHB A;  4NRH B;  3MX3 A;  3LXU X;  4I17 A;  1X81 A;  2AWI A;  1EDU A;  1HE8 A;  1Y8M A;  5C2Y A;  1LF8 A;  3VLD A;  1UN9 A;  5ENP D;  5FT9 A;  4U63 A;  4CGV A;  4K0R A;  1FCH A;  2AJA A;  5AN8 A;  1TNB A;  3D9K A;  3UIN C;  2AVP A;  4JA9 A;  2WXQ A;  4F53 A;  2XRY A;  1N4R A;  3CST A;  3ESK A;  2OEW A;  3TG5 A;  5EX3 A;  4GPK A;  3CV0 A;  3L08 A;  3FUD A;  5EKQ D;  1LD7 A;  1Q2Z A;  2WQ6 A;  5HS0 A;  2J09 A;  3Q7A A;  4HOU A;  4AIF A;  2LAI A;  3CHR A;  3D9J A;  4GTV A;  3CVP A;  4IYP A;  3TAX A;  3Q4A B;  1E7U A;  3OXF A;  3SFY A;  4TUU A;  3SFX A;  1H6P A;  4WNE A;  3ASG A;  3PZ2 A;  4LNG A;  1IQU A;  1S64 A;  4Q94 A;  3DEP A;  4HRN A;  3C3O A;  4GZ3 A;  1O1S A;  3APC A;  3HVE A;  3EIQ C;  2FO1 E;  4WNF A;  4BES A;  2NYJ A;  4UWK A;  5B1B E;  1TNO A;  1N4Q A;  3DPY A;  3TWV A;  3ASH A;  4FA6 A;  3JCK C;  3EHQ A;  3PRE A;  2HM8 A;  1OXJ A;  1ELW A;  2RKK A;  4GYO A;  2IJG X;  5BW8 C;  4PH4 B;  3UMV A;  5CBO A;  2X6J A;  4K5B A;  2XRZ A;  2MYO A;  4ANW A;  5ITZ F;  2DWZ A;  3DXK G;  2F0Y A;  2WXF A;  4Q96 A;  2LXL A;  3NOG D;  2E2E A;  3QC1 A;  5EN5 D;  1SA4 A;  5C1D A;  4U0S A;  3PZD A;  2IO2 C;  3L13 A;  2VSY A;  4MBG A;  1MX2 A;  3PNT B;  4JC8 A;  3SFZ A;  4KVO A;  3B95 A;  5EIB E;  4ANV A;  4HOR A;  4HQD A;  2JAB A;  4LNU D;  1HG2 A;  3MGB A;  1BI7 B;  3QWV A;  2R02 A;  5HKP A;  3D9L A;  4GML A;  1MX6 A;  2PM6 A;  2X6K A;  4HBD A;  3FUN A;  3QAR A;  3R7R A;  1QYM A;  1P5Q A;  2HR2 A;  3FHE A;  2AXU A;  4G24 A;  4U0Z A;  4EHM A;  3BUA A;  3SHF A;  4C0M A;  3GZS A;  5G05 C;  3ZEF A;  3L54 A;  3AG1 E;  4NQ0 A;  4C48 B;  4L7T A;  4W9R A;  1KZP A;  4QQI A;  2QZA A;  4WAF A;  4IN3 B;  3S7D A;  2C0M A;  3I4R B;  3B13 A;  4A3T A;  4BTB A;  3PVL A;  1UJK A;  4R7L A;  4GTS A;  4JL0 A;  1OWP A;  1JWG A;  1QBQ A;  4J8S A;  3QB2 A;  5CMY A;  3UTM A;  3B7U X;  3VLE A;  3UX4 A;  4KBQ A;  2XCC A;  2YNQ A;  4LSZ E;  1DCQ A;  2EIM E;  5FQ4 A;  3CQC B; 
#chains in the Genus database with same CATH homology
 3CVN A;  4UI9 K;  3ZYK A;  5LFA A;  4KT6 B;  3PEV B;  2WB2 A;  5G04 J;  4WUY A;  4A55 A;  1OWN A;  3UPV A;  3JYS A;  4Q69 A;  3PDN A;  4FHJ A;  4L1B A;  4FLH A;  3T8M A;  2PZI A;  3AS4 A;  2LNI A;  5CHE E;  5BUZ A;  5BPP A;  5LCW J;  3ENE A;  1SQM A;  3PE3 A;  3O48 A;  1E8W A;  4AM9 A;  2M63 A;  4I43 A;  5EDS A;  4EZK A;  2RG8 A;  1WM5 A;  3RJV A;  3ESL A;  2DBA A;  4I1A A;  3ZYQ A;  3LY7 A;  3ZVV A;  4BX9 A;  3AS5 A;  3LS8 A;  3CHO A;  4JZY A;  3IHY A;  5FZQ A;  2X3M A;  4UI9 C;  3KS2 A;  1PC2 A;  2CG2 A;  4MLP A;  5JJT A;  1DNP A;  2KC7 A;  4F7A A;  5T3R A;  4XI0 A;  1WY6 A;  3VTY A;  5AIJ A;  4N2S A;  4G2V A;  3D3M A;  1EF1 C;  2GW1 A;  4HFG A;  3SGH A;  4L2L A;  5BV0 A;  3LJ3 A;  3SNX A;  3CK8 A;  2OOE A;  3DBS A;  2R17 C;  2V0P A;  2R59 A;  2VSN A;  3MV2 B;  3OXL A;  4FU3 A;  4UWG A;  5AJD A;  5HI7 A;  2J07 A;  3NZS A;  4HOT A;  3FY4 A;  3EHN A;  4L23 A;  2Y4U A;  3CVU A;  1E8Z A;  2L6J A;  3KD7 A;  4B8C B;  1OWM A;  4XZ4 A;  2XCB A;  3B7R L;  3MYV A;  3B7S A;  4M3O A;  4MRU A;  4GYW A;  3MKQ B;  2RD0 A;  3L16 A;  2LSV A;  4KXK B;  3FP3 A;  3PUJ A;  4J8D A;  3S7B A;  2JLB A;  4PUC A;  4GMJ A;  4EPZ A;  4Y6C A;  4EEC A;  2V8S E;  1DVP A;  4HLE A;  4DK5 A;  2I1K A;  3TJP A;  3FTV A;  3CVQ A;  3G2T A;  5JJ7 A;  3UT8 A;  3FH7 A;  4ILG A;  5G04 C;  3G2S A;  1QQE A;  3APF A;  3FFL A;  2VTB B;  3PRZ A;  2J4D A;  2X38 A;  3D9N A;  4ME2 A;  2UY1 B;  2FUL A;  2IOS A;  3FUK A;  5D0Q D;  4A3V A;  4C0E A;  1OWL A;  5KJM A;  5LCW C;  2YIN A;  2I9C A;  2X6H A;  4WNG A;  4ACL A;  2DIW A;  1NA0 A;  3SBT B;  3G2W A;  3IV0 A;  2VSX E;  4KZ0 A;  2J08 A;  2WXR A;  2IQC A;  4RG9 A;  4ACK A;  3PS6 A;  4ANX A;  3FTZ A;  3L17 A;  2L0T B;  3BG0 B;  1E8Y A;  3ZHE A;  4I6E A;  1E96 B;  1NZN A;  3DPD A;  3HDX A;  4I2W A;  3ZRH A;  1HX8 A;  2KCV A;  2CFZ A;  4AV7 A;  4AOF A;  2CHW A;  4FC8 A;  3T5X A;  3MCX A;  2XPI A;  2WM9 A;  1UJJ A;  3IBE A;  3JUI A;  3D9M A;  3SBS A;  4KMO A;  4AY6 A;  3CIA A;  1XNF A;  1E8X A;  2NXP A;  1SZ9 A;  3I5P A;  3ZW3 A;  2BUG A;  3U64 A;  2L9B A;  5FWQ A;  3BEE A;  2WQH A;  4A1S A;  4B8A A;  2VJ8 A;  5DBK A;  4BTA A;  3MA5 A;  4ILH B;  4P29 A;  5FQ7 A;  4LER A;  3QK0 A;  4PS3 A;  5KJL A;  2YHE A;  3TGO A;  5D0O D;  4KYO B;  3FWV A;  2WXL A;  2UY1 A;  5ARF A;  3QWP A;  1Z3Y A;  4UQZ A;  3ZYM A;  5ENN A;  5HQ8 A;  1HXI A;  4JHJ A;  3I3N A;  3NZU A;  4BT8 A;  4EBA G;  5LX8 A;  3L6A A;  2A5U A;  4J6I A;  4WWP A;  4N2Q A;  3G2U A;  3ONL A;  4CT0 A;  4PS8 A;  2WXH A;  3UUX A;  4XX5 A;  2KM4 A;  4XE0 A;  3EHM A;  3APD A;  3LPZ A;  5CMW A;  5M72 A;  3ASF A;  3VLF A;  2XPY A;  4I9C A;  4GYY A;  2IU1 A;  4LRZ A;  1U3D A;  5E75 A;  1FVF A;  3TG4 A;  2XPZ A;  2BTD A;  5FZS A;  4F3V A;  2WXP A;  3FUM A;  4AEZ C;  5J90 A;  2V4L A;  4I9E A;  2MHK A;  1KLX A;  3VTX A;  5JHA A;  1JPL A;  4J8E A;  4U04 A;  4UWL A;  1IYG A;  2VSO E;  2KCK A;  4F1S A;  4L2Y A;  3KEZ A;  4GAA A;  4N3B A;  2QY7 A;  1A17 A;  3RIB A;  3CVX A;  4TV3 A;  5A6C A;  2YQ8 A;  4PS7 A;  4AY5 A;  4MS6 A;  5LOZ A;  3GZ1 A;  2P58 C;  2CHX A;  2PL2 A;  4G1T A;  2NC9 A;  4CGW A;  3LCA A;  1E7V A;  3D9P A;  5BV1 A;  5T8I A;  4N5C A;  3CHM A;  4URK A;  4AP2 A;  3QKY A;  3CGH A;  2WXK A;  1BPO A;  3S2A A;  4DI4 A;  4FLB A;  2V5F A;  3RO3 A;  3CEQ A;  4YVO A;  2LSU A;  3AU4 A;  2GRM A;  5G2N A;  3Q49 B;  4KZC A;  1HFA A;  3CKB A;  3OTN A;  3R7Q A;  4XIF A;  4K03 A;  1H2U A;  1JWF A;  1KT1 A;  3FEY A;  4I1M A;  2MOW A;  3ZFW A;  2CHZ A;  1Y6I A;  2ZU6 B;  2VGY A;  4YVQ C;  3GYZ A;  3JQ0 A;  4ABN A;  1HS6 A;  4I2Z A;  2C0L A;  4FUL A;  3FU6 A;  3FUH A;  5LP0 A;  2I6H A;  3EJN A;  3TXM A;  3LVR E;  4CCA A;  4V3I A;  4RSY A;  2OVF A;  4U8H A;  1UG3 A;  3ZHE B;  4NRH B;  5AEN A;  3OXG A;  2LO6 A;  2CG3 A;  4OYS A;  1GW6 A;  3RRM B;  5JHB A;  3E4B A;  3MX3 A;  3MZL B;  3ZGQ A;  5G05 J;  2WQ7 A;  3LXU X;  4I17 A;  2AWI A;  1VDY A;  3CHP A;  4OVV A;  4KVM A;  2YHC A;  3MJW A;  4EBA A;  1KT0 A;  3FEX A;  1QNF A;  1EDU A;  4JW1 A;  4JVS A;  1ZBP A;  3LY9 A;  3TXN A;  1HE8 A;  1PY1 A;  1Y8M A;  3FH5 A;  5C2Y A;  1LF8 A;  3VLD A;  2C2L A;  1UN9 A;  2DCP A;  2Q7F A;  5AYW D;  2XGM A;  5FT9 A;  4U63 A;  4WND A;  2Y3A A;  4CGV A;  3CSF A;  3MV3 B;  4K0R A;  3LKU A;  4U07 A;  1FCH A;  3IKO B;  4IRU A;  2VGX A;  3FUJ A;  4BT9 A;  1ZU2 A;  3SI5 A;  5FQ6 A;  2XHE A;  3ML9 A;  3D9K A;  2A4Z A;  1HG5 A;  4DLQ A;  2AVP A;  4GU5 A;  2WXQ A;  3FTW A;  4JA9 A;  4F53 A;  2EQX A;  2XRY A;  1OWO A;  3CST A;  3ESK A;  3TG5 A;  5EX3 A;  1Z3X A;  3GW4 A;  4GPK A;  5AJL A;  3CV0 A;  3L08 A;  3FUI A;  1H6K A;  3FUD A;  5EKQ D;  3QNK A;  4FJZ A;  4XKB A;  2WQ6 A;  2HYZ A;  3RO2 A;  4APO A;  1HU3 A;  2J09 A;  4I6G A;  3CVW A;  3FTU A;  4HOU A;  3MEK A;  2LAI A;  4AIF A;  3CHR A;  3D9J A;  3FTX A;  4RG6 A;  4GZD A;  3CVP A;  5FTP A;  3FUF A;  3KAE A;  4IYP A;  2WMO A;  4OVU A;  4EQF A;  5J08 A;  3QAQ A;  3LVQ E;  3TAX A;  3QJZ A;  1JUQ A;  5EX0 A;  2XGO A;  2E0I A;  4GA2 A;  1MQS A;  2ION A;  4J0U A;  2I1J A;  3Q4A B;  1E7U A;  2XEV A;  5G55 A;  2J49 A;  3K9I A;  3SD5 A;  3OXF A;  4GB9 A;  4UWH A;  2KZT B;  1N54 A;  1ELR A;  4TUU A;  4DJA A;  4O6F A;  4WNE A;  5FQ8 A;  3ASG A;  4JEU A;  2PQN A;  2R5S A;  1U3C A;  3U3W A;  1IQU A;  2JEK A;  4Q94 A;  1XGW A;  4GZ6 A;  4LCT A;  1H0A A;  3FDH A;  2FI7 A;  4BFR A;  2I2O A;  3PE4 A;  5BT1 A;  2QFC A;  4GZ3 A;  3APC A;  3CR3 A;  3EIQ C;  3HVE A;  4JA7 A;  3PH0 C;  4LUN U;  4AXH A;  3ASD A;  2XGS A;  3CKC A;  3UQ3 A;  3HYM B;  3P1U A;  3ZN3 A;  4WNF A;  5DIZ A;  4D10 C;  5JJ6 A;  5FZR A;  2VYI A;  4N3A A;  2WXJ A;  4UWK A;  4I6J A;  3WXX A;  4DLO A;  3ASH A;  3EIJ A;  4FA6 A;  1QZ2 A;  3JCK C;  3PRE A;  4FJY A;  4RVB A;  2HM8 A;  2L0I A;  1ELW A;  4I1O B;  4CRW A;  2KZT A;  4DPR A;  4H7X A;  2J4B A;  3RKV A;  4JEH A;  4GYO A;  2WXN A;  4B89 A;  4CDM A;  2IJG X;  2IOL A;  3BG1 B;  3L22 A;  4Y6W A;  1H2V C;  5BW8 C;  4PH4 B;  4FP7 A;  3UMV A;  1TJC A;  2OV8 A;  2X6J A;  4ATG A;  4B94 A;  4FAD A;  2ILR A;  2Y4T A;  4YND A;  5ANL A;  3URZ A;  2XRZ A;  4ANW A;  2VGX B;  4XI9 A;  3RU0 A;  4BY6 A;  4GCO A;  4DI3 A;  4JPS A;  3MKR A;  4GZC A;  3RK6 A;  3RRU A;  2WXF A;  4Q96 A;  3R9A B;  5CCM A;  4TRQ A;  1N52 A;  2E2E A;  3QC1 A;  4CDN A;  3QDN A;  4ILI A;  1UW4 B;  5C1D A;  3AS8 A;  4CDR A;  4U0S A;  1SZA A;  2FF4 A;  5KCM A;  4EZJ A;  2KCL A;  3PZD A;  3Q15 A;  4PDX A;  2NSZ A;  3CVY A;  3IEG A;  4GCN A;  2J9Q A;  3CVL A;  3U4T A;  4AJW A;  1X5B A;  5CCL A;  4HS2 A;  4HXI A;  3FU5 A;  3PNL B;  3EDT B;  3L13 A;  1TJF A;  4BSX A;  5BNW A;  4J8F A;  3LYA A;  2VSY A;  3CLJ A;  4A1G A;  4NAC A;  1NP7 A;  3FUL A;  4JC8 A;  3PNT B;  4NUR A;  3FTS A;  2MRI A;  3UT4 A;  3SFZ A;  2PM7 A;  4KVO A;  3ZXS A;  4ANV A;  2OND A;  4B0Z A;  4QFV A;  5A7D B;  4HOR A;  2CFU A;  1ELK A;  4AVX A;  4ANU A;  1INZ A;  1HG2 A;  4MKT A;  4GA0 A;  3CK7 A;  3MGB A;  2LAH A;  3CVV A;  3QWV A;  2IFU A;  3N71 A;  5FJY A;  3CHQ A;  4G23 A;  3FUE A;  3ONK A;  3S7J A;  2X6I A;  3CK9 A;  2X6F A;  1IQR A;  3FU0 A;  2WPV A;  3D9L A;  3FH8 A;  3GZ2 A;  3PUK A;  4GML A;  3LDZ A;  1UN8 A;  4E85 A;  2PM6 A;  3AU5 A;  2X6K A;  3U66 A;  5ANR A;  5T4Y A;  3FUN A;  1H19 A;  1IHG A;  3UT7 A;  5KJN A;  1EYH A;  1HF8 A;  4GA1 A;  3QAR A;  2UWJ G;  2WVI A;  2BF0 X;  3HVE B;  4G25 A;  3R7R A;  1HH8 A;  1P5Q A;  3NQP A;  4JHK A;  1L5J A;  3LEW A;  2HR2 A;  3U9W A;  2HO1 A;  3ZPJ A;  4CEM A;  4WWO A;  3FHE A;  1HZ4 A;  2AXU A;  4G24 A;  4BWR A;  2IF4 A;  4U0Z A;  3Q47 B;  4UWF A;  4APF A;  1FVH A;  3B7T A;  5ARG A;  4FHK A;  3SHF A;  1HO8 A;  4JHR A;  4C0M A;  4C9B B;  3GZS A;  5G05 C;  3ZEF A;  1PAQ A;  4JXT A;  2WXG A;  1YA0 A;  3CHS A;  3MKQ A;  3L54 A;  2AXV A;  1E90 A;  4NQ0 A;  4L7T A;  2WXI A;  4W9R A;  1B89 A;  4G26 A;  2VQ2 A;  3RRN B;  4HOS A;  4HOQ A;  4GZ5 A;  3TL5 A;  3C98 A;  4E6H A;  2WXM A;  4N39 A;  1S0P A;  1W3B A;  2GRL A;  4IUL A;  2FEZ A;  4UQY A;  3ZYL A;  4WAF A;  4IN3 B;  1NA3 A;  3LY8 A;  3HIZ A;  4UI9 J;  2OVB A;  3S7D A;  2XQ0 A;  3IHV A;  3D9O A;  3HHM A;  3P2B A;  3PEU B;  2C0M A;  4CT4 A;  2AW6 A;  3I4R B;  3G2V A;  2VTB A;  3B13 A;  3QOU A;  4A3T A;  2KAT A;  3SZ7 A;  4BTB A;  3O4Z A;  4XKC A;  3NF1 A;  3FTY A;  4LEU A;  1Z6T A;  3PVL A;  1TEZ A;  4U0U A;  4G11 A;  3JQ1 A;  1UJK A;  2AXZ A;  4R7L A;  3CQG B;  1H2T C;  4JL0 A;  1OUV A;  2PQR A;  3Q5M A;  1OWP A;  4H7Y A;  3SF4 A;  3ML8 A;  3ULQ A;  4BX8 A;  3S7F A;  3I4G A;  1EPU A;  5KJK A;  1JWG A;  4J8S A;  3D9I A;  3QB2 A;  3QWW A;  5CMY A;  4HVB A;  5E76 A;  2GGF A;  3B7U X;  3VLE A;  3UX4 A;  4WWN A;  4N3C A;  3ZIM A;  4EZL A;  2WXO A;  4KBQ A;  1MHQ A;  3OAW A;  3T5V A;  1WAO 1;  2FBN A;  2XCC A;  2YNQ A;  2FO7 A;  4UQX A;  2WMN A;  5A23 A;  5FQ4 A;  3FU3 A;  3CQC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...