1MHQA

Crystal structure of human gga2 vhs domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
SLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA2
publication title Crystal structure of GGA2 VHS domain and its implication in plasticity in the ligand binding pocket
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1mhqA00
3ZYKA 1ELKA 3D9JA 3D9OA 1H0AA 3LDZA 5CMYA 3G2TA 4FLBA 3ZYLA 4FU3A 4GZCA 1HF8A 2MOWA 3D9PA 3G2VA 3G2WA 3ZYMA 1MHQA 1PY1A 1HFAA 2KM4A 1SZ9A 3D9NA 2BF0X 3ONKA 1SZAA 5LP0A 1HG5A 3D9IA 1DVPA 3ONLA 1LF8A 5CMWA 1JPLA 1VDYA 2QY7A 4AVXA 5LOZA 1UJJA 1X5BA 2L0IA 3G2SA 3ZYQA 3RRUA 2L0TB 4JXTA 1XGWA 2DIWA 1JWGA 3CLJA 3D9KA 1INZA 4Q96A 1JWFA 1EDUA 2V8SE 1EYHA 4NACA 1HG2A 3G2UA 3D9MA 4Q94A 1HX8A 4HFGA 4GZDA 3D9LA 2DCPA 1UJKA 5J08A 2LO6A 1JUQA
chains in the Genus database with same CATH superfamily
3CSTA 2DYSE 3LXUX 5CBNA 4MBGA 1HO8A 2WB2A 3CHOA 2L0IA 4PS8A 4EZLA 4TXRA 2WQHA 2WMNA 3UT7A 1JWGA 4Q96A 5BPPA 3FUKA 4OVVA 1IXVA 3DXKG 1BPOA 5FZRA 3DBSA 3APDA 1DCQA 4FJZA 3FUDA 4JA7A 3FH8A 3B7RL 5KJMA 1D8EA 3I4RB 3CHSA 4HBDA 4N2SA 3CV0A 1H2UA 2KATA 1OUVA 4GTOA 4O1OA 4U63A 3MZLB 2GRNB 3U66A 5ENQD 5HKPA 2VTBB 4EPZA 3UTMA 2WXQA 2KBXA 2P9KG 3TXMA 4JA9A 4LG6A 1BLXB 4B8AA 2LAIA 3EU9A 5HQ8A 1H2TC 3LCAA 3EHMA 3ASNE 2P2CP 4AOFA 5EYLA 2IFUA 1WAO1 4FP7A 3JXJA 3ZYKA 3HDXA 3RO3A 3ISMC 3JYSA 3ZXPA 4GTTA 2H6IA 3PZ1A 3G2SA 3MJWA 4NURA 2ZGGA 2RFMA 3QJZA 3QB2A 4O1PA 1WY6A 5JMND 2A4ZA 1KT1A 3ASFA 2LSUA 1H0AA 2KCVA 5FINA 4HS2A 3VTYA 3AJIA 5CRUA 3AS8A 4AEZC 3V79K 5CEAA 3OAWA 4WNEA 3BEEA 1S70B 2KZTB 2WXLA 3PVLA 3L9TA 3LDZA 2ETCA 5HI7A 3LY9A 4DI4A 1P5QA 5T3RA 3CVLA 2GRQB 4IYPA 1AP7A 4N3AA 4UI9J 4WNFA 3CQGB 1O1TA 3TWRA 3ABME 4I6GA 3HXFA 2OVFA 1UG3A 5KNGA 3FFLA 1Y8MA 4ZHBA 1LD7A 3IEGA 3D9PA 3CKCA 3IXEA 3Q79A 3RJVA 3VTXA 2IJGX 5EIBE 1FT2A 3TAXA 3UIOC 1IYGA 2AXVA 1AWCB 1HG2A 2WXFA 4IULA 3P2BA 4EZJA 5CCLA 3C98A 3QOUA 4FU3A 5FQ6A 5FWQA 2X6JA 2VYIA 3MGBA 5LX8A 2FI7A 4UI9K 2A5UA 1IHBA 3ASHA 2WQ7A 4JL0A 1ZU2A 3FU3A 3Q75A 4NQ0A 2XEEA 4H7YA 3S7JA 5KJKA 3HXBA 5LCWJ 3J5PA 2FEZA 1INZA 4HOQA 5D2MC 2XZDG 2XGSA 3EHRA 4J8EA 3UT8A 3L08A 1JUQA 3B7SA 3PNLB 5EKQD 2HYZA 2J8SD 3U64A 1JCRA 1A17A 2ZGDA 3B95A 3DPYA 2FO7A 1FVFA 3EJNA 4U04A 2CHZA 2EIJE 1TNOA 1JPLA 2PNNA 3FUEA 2XEVA 1G3NB 2PL2A 4ILIA 4UWFA 2FULA 4A55A 2L6BA 4XEIG 4JVSA 5AN8A 3SZ7A 2RKKA 3CKBA 1RW2A 3G2VA 5JJ7A 5CRVA 1Y6IA 2CHXA 2YHCA 2I1KA 2WXRA 3QK0A 3S7BA 1S0PA 3SFZA 4GYWA 5A23A 1N52A 3O4ZA 3NZUA 4CCAA 5AAOA 4KBQA 3CVYA 5BW8C 3S7FA 4MKTA 4TRQA 3ESLA 1NL4A 4PS7A 4OAUC 2LO6A 2VQ2A 3FP3A 5LCWC 3C3RA 2VTBA 2JLBA 3RKVA 1WDYA 4HNAD 4UWKA 1TJCA 3AG4E 3EU5A 2UY1A 3CHPA 2IO2C 3CK8A 3HVEA 1SA5A 3UKRG 3KEZA 3L16A 4RLYA 4XKCA 2EQXA 4QQIA 4F6RD 5G55A 4ANWA 1SZAA 2XPYA 5KWDA 4GA2A 3AU4A 5IY5E 3IHYA 4I1AA 3T5VA 1TYQG 3OXGA 4XE0A 5BXUA 5ENSD 1TN8A 4GTMA 3L6AA 5CMWA 3RSEG 3MKRA 5G05C 1GW6A 1WG0A 1MYOA 5D0OD 2XCBA 2WM9A 3HXEA 3FY4A 4ABNA 3ULEG 5CMYA 1O1RA 4EQFA 3FTZA 4FJYA 3LKUA 3PZ2A 2KZTA 4CT0A 3B7TA 1UJJA 1E90A 4I1MA 3VLEA 1BD8A 4FULA 1YYHA 5ITZF 5G2NA 4LRZA 4L2LA 5D66A 3SBSA 3LY8A 4U0UA 4B8CB 3ZPJA 2MHKA 2WXMA 3FTVA 4CT4A 2X6KA 4N5QA 4GPKA 3TWQA 4FLBA 3ML8A 2OVBA 2EIKE 3BG0B 3KS2A 1BI7B 2BUGA 4RG9A 3U9WA 4K03A 1OWNA 4G8KA 3FUHA 3DRAA 3E34A 3NBNB 4L7TA 3L22A 2AXUA 3RK6A 4KZCA 1WM5A 4GAAA 4DK5A 5B1AE 1HS6A 2XGMA 4C0EA 1MX4A 3LVRE 3KD7A 3ZHEB 2E2EA 4N5CA 5LP0A 1LF8A 3UM0A 4K5AB 4N39A 2V4LA 3FULA 1PAQA 5FIOA 4GMRA 2NYJA 2R2LA 5EILA 1KPSB 3TXNA 4D10C 5D0QD 2ZXWE 3K9IA 2IEJA 3CK7A 1MHQA 1HE8A 3I3NA 4I17A 1IHGA 5ENTD 4QFVA 4CDRA 2XCCA 5ENPD 2J09A 1H6OA 2EILE 1X81A 1OY3D 4JZYA 4APOA 4URKA 3SQVA 3ASGA 3HYMB 3PE3A 3V2OA 4LCTA 3ZUVB 1O1SA 5T8IA 4I6EA 3D9KA 4UUCA 1U3CA 2FBNA 2GW1A 3NOCD 4G26A 4GMLA 4U0ZA 4ME2A 3LPZA 3Q7FA 2H6FA 4GCNA 2WMOA 4O6FA 2QYUA 3IHVA 4I43A 4B93B 3ZGQA 3QWVA 4TXQA 4CEMA 1E7VA 4V3IA 5AQ7A 1S63A 3FWVA 1JWFA 3AS5A 5E76A 4XX5A 2IQCA 2LSVA 4TXPA 3LS8A 3ASOE 3CVXA 4JW1A 4RQIA 1N95A 4BESA 1OCCE 3DSXA 3FTUA 2VSYA 1N11A 3UIPC 4EZKA 1TNYA 4YVQC 2GRLA 1TN7A 3ZVVA 2P9LG 3FTWA 1N4PA 3LVQE 3NF1A 2UY1B 4A3VA 3CQCB 1LD8A 3PEVB 4HRMB 3HVEB 1N9AA 4YDEA 2H6HA 2I1JA 3TWVA 1U3DA 3UT4A 1KZPA 5G04C 4JC8A 3QC1A 4DX7D 1K1BA 4G2VA 3TG4A 4ATGA 5E75A 4ANXA 1N4RA 4I9CA 1OCRE 4GTRA 4UQZA 4BERA 1TJFA 1SZ9A 4WNGA 4TV3A 4AVXA 3ZIMA 2F37A 3T8MA 4UQXA 1QQEA 2V8SE 2DYRE 3GW4A 3QDNA 4I6JA 4Y6CA 2BKGA 3JUIA 4CGVA 3G2TA 4KMOA 4K5BA 3SY2A 1EPUA 4M3OA 5FQ4A 3W9FA 4G25A 4DI3A 1MX2A 3PUKA 4GTQA 3SD5A 3ZXSA 3ASDA 1KLXA 3D9MA 3HG0D 3MCXA 2NC9A 3V2XA 4GMJA 4U8YD 5AYWD 3FDHA 3HXDA 4KVOA 4JHRA 2XGOA 3APFA 1DCEA 3EHQA 4U8VD 3P1UA 4YNDA 3FEXA 2V0PA 3AU5A 1FVHA 3VLFA 1UN8A 2VJ8A 5EX3A 4NRHB 1UOHA 4N3CA 4L1BA 2WQ6A 2QZAA 4G8LA 4EHMA 2FO1E 3Q73A 4J0UA 1H19A 2DZOA 4K0RA 1E8ZA 5LOZA 2J07A 4WAFA 2V4HC 2VSXE 4GPMA 1YA0A 4A1SA 3R9AB 4GTVA 1E8XA 2I6HA 3ENEA 2RD0A 2UWJG 4TUMA 4UQYA 2ILRA 4GZCA 2ETAA 3CVUA 5CEDB 2PQNA 4ACLA 1UN9A 5ENOD 2VGYA 3SF4A 1H6PA 3UM1A 2I9CA 3BQOA 2JABA 4ACKA 1XNFA 4J6IA 4OVUA 4U96D 1V55E 4L9PA 4N2QA 3ZHEA 5FQ7A 3MEKA 3MA5A 4JEUA 4J8DA 2J4DA 4EECA 5KBAA 3X2QE 2IU1A 3AG2E 4HRLA 4GTSA 3EDTB 2WXGA 4LERA 3FUIA 1N4QA 3I5PA 2DBAA 4NIKA 1QBQA 3QNKA 3FU6A 4BTAA 2MOWA 2LNIA 4XIFA 1IQUA 4BEPA 2EIME 2QYJA 3C5RA 4E85A 4AY6A 3ZKJA 2ZU6B 1EDUA 3EUVA 3GYZA 3RO2A 3DEPA 2KXPC 4FHKA 4LSZE 4AV7A 5EDSA 4J8FA 4GB9A 3B7BA 3O48A 3Q7AA 2DWZA 3FH5A 4BX8A 2XENA 2WXNA 2XRZA 3AAAC 3DSSA 4HRNA 4G1TA 4FADA 3D9LA 5G05J 3BU8A 3D9JA 2J4BA 1NA0A 2J08A 2P9NG 4GCOA 5CECB 1TNUA 1S64A 3CVPA 4XI0A 3DSTA 3NAWA 3PREA 2QY7A 3E30A 3E33A 5BT1A 1IQRA 3DWLG 3TWTA 5CBOA 4I1OB 2C0MA 4G23A 4TUUA 3UKUG 1L5JA 3PEUB 3CEQA 3B7UX 5BNWA 2OOEA 5EIDA 2X6IA 4BETA 1Z5SC 3RRUA 2PZIA 3CLJA 5CHEE 5ENRD 3UX4A 4HORA 1U2VG 3UM2A 2CFZA 4A3TA 1HG5A 3FUMA 2VGEA 2YHEA 3FTYA 4HLEA 2XRYA 1BU9A 3QAQA 3CVQA 4DX5D 1QNFA 1ELRA 3PZ3A 2BTDA 3TL5A 3WXXA 3IKOB 4B94A 4RG6A 2B0OE 4JXTA 2X6HA 5BXOA 2VGXA 4OYSA 1TNZA 5T4YA 4P29A 4DRXE 5ANRA 1HFAA 1NZNA 2ZISA 3R7RA 2XS1A 3C3OA 1DNPA 3SO8A 4A1GA 4Q69A 3FTXA 1FPPA 1HX8A 3ZN3A 4YDWA 2HO1A 1OWOA 4F53A 4KXKB 4LUNU 2WXIA 4WWNA 3KSLA 2AWIA 3OXLA 3TJPA 1JCSA 4Z68A 3Q15A 4LNGA 1K1AA 1Z3XA 3D9HA 2AJAA 1H6KA 4UWLA 3KAEA 4DX1A 1ZB1A 4H7XA 3UUXA 4CZ2D 3RIBA 2GROB 5LFAA 1TNBA 4GA1A 4PS3A 5AJLA 2Y0BG 2AW6A 3CVWA 2GRMA 1HU3A 3QWWA 3ZRHA 3J5QB 3ABLE 2ONDA 1HZ4A 3HRAA 4YDOA 5C2YA 2Y1LE 3PZDA 1A5EA 2BEDA 2Y4UA 3HHMA 3NQPA 3MYVA 3QARA 1OXJA 2J49A 3Q78A 4DLOA 2IO3C 5JHAA 3L17A 4JD2G 3SFYA 4KT6B 3HIZA 2J9QA 5ARFA 1Z6TA 3ABKE 1OWPA 2L9BA 3KEAA 1SQMA 3UM3A 2B6CA 4U8HA 3Q9UC 4KYOB 4UWGA 1V54E 2IOSA 3KSQA 1HXIA 3T5XA 1VDYA 3RU0A 1MX6A 3IBEA 4G11A 2DIWA 1FT1A 4J8YA 2YQ8A 1K8KG 3PE4A 2DVWA 2MRIA 4B89A 3CVNA 1Q2ZA 4I2WA 5FTPA 4YVOA 5G04J 5B3SE 4FHJA 1NFIE 3HXCA 4KZ0A 4BY6A 2X38A 3EIJA 5AARA 3TWXA 3LEWA 2OEVA 5CCMA 2GRRB 4YDYA 2NSZA 2AVPA 3G2UA 1EF1C 2E0IA 3UXGA 3TGOA 3SFXA 3AG3E 4GZ5A 2LXLA 1QZ2A 1YCSB 4J8SA 3MV3B 3V30A 2IY0C 4JB8P 2VSNA 3GZ2A 3DPDA 2FF4A 4R7LA 3FEYA 3PNTB 2C2LA 4HVBA 3TG5A 4WWOA 4HXIA 4CGWA 4HLLA 2WXOA 3I4GA 4HB5A 4UWHA 5H7PA 1JCQA 2LAHA 4DUIA 4O60A 4C9BB 1SA4A 4HQDA 3D9OA 3QKYA 2EINE 2XHEA 2XQ0A 2R59A 4BWRA 3Q4AB 2P58C 2HR2A 4CDMA 2YNQA 5J90A 2L0TB 4JEHA 1N0QA 2XZTG 3L54A 3IV0A 3ZU7B 4GYOA 5AENA 5DIZA 2GRPB 1N4SA 1ZBPA 3SHFA 1D8DA 4F1SA 4GZ3A 4K5CA 4JPSA 2F8YA 2WXPA 3FHEA 4GA0A 4C48B 2RG8A 1EYHA 4KVMA 1HH8A 3UINC 3JQ0A 3T8KA 3CHRA 4WUYA 2LUHA 2VGXB 4GU5A 3FUJA 3CSFA 2A5EA 5CERB 2PM7A 2AXZA 3E32A 3PH0C 2Q7FA 2F8XK 4HFGA 2OCCE 4HI8A 1SVXA 4I9EA 4JHJA 4MS6A 2V5FA 2L6JA 1OWLA 2JEKA 2R02A 2I2OA 3C3QA 3MKQB 5A7DB 1SW6A 3BUAA 3FUNA 3V31A 3AS4A 3TWWA 5ARGA 3Q9NC 4AP2A 2P9PG 1TEZA 3C72A 3JCKC 3UQ3A 4F7AA 5AIJA 2M63A 3ZYQA 4M7CA 4C0MA 3N71A 3FU0A 3PRZA 4Q94A 2WVIA 5J08A 3LYAA 5ENNA 3ULYA 3E4BA 4PUCA 1YMPA 3UPVA 2DZNA 4ANUA 3D9NA 4GTPA 5BV1A 4HOTA 5AQAA 3D9IA 2QC9A 2WXHA 4DPRA 4OAVB 2R17C 5HS0A 2IF4A 3SGHA 3CVVA 3E37A 4FLHA 3GZSA 4B0ZA 4AXHA 3OXFA 1N0RA 1IKND 5M72A 3ONKA 1E7UA 2P9IG 3VLDA 4U7EB 3Q5MA 1H2VC 2Y4TA 5AJDA 1TR4A 3FH7A 3R9MA 4AY5A 1E8WA 3PDNA 4J7WA 1UJKA 4XZ4A 4L2YA 1E96B 1N94A 2R05A 4ZFHA 3CHQA 3ZYMA 3JQ1A 3JXIA 2WXKA 3TWSA 2HE0A 3CIAA 2OEWA 3PUJA 1ELWA 4XI9A 4CYMD 4DX6D 5BV0A 4XKBA 4UI9C 3DXMG 2C0LA 4U95D 2RFAA 5AQ9A 2ETBA 2HM8A 3ZYLA 4ILGA 2CHWA 1PY1A 4ATZD 4BFRA 3ONLA 1X5BA 2V5QC 4AM9A 3CK9A 2YINA 4W9RA 2VSOE 2KC7A 2QFCA 4AJWA 4U07A 5HRYA 3LJNA 3UMVA 3BG1B 4DLQA 2X6FA 3OTNA 2BKKB 2NXPA 1FCHA 1DC2A 4HOSA 1OWMA 4MRUA 4WNDA 2KCLA 2XPIA 2R5SA 4PH4B 1K3ZD 5EX0A 3QWPA 4LEUA 5KCMA 2LXMA 3EIQC 3RAUA 4F1PA 3SI5A 3TWUA 3D3MA 3NB2A 2XEHA 4GYYA 2H6GA 1XGWA 4IN3B 4NACA 1W3BA 3APCA 4BT8A 4BTBA 3FU5A 1RZ4A 4U0SA 3DSVA 2IONA 4ANVA 3Q49B 3W9GA 3SBTB 4DJAA 4I2ZA 4G24A 1UW4B 4GZDA 3PZ4A 2Y69E 2DCPA 3NZSA 5FJYA 4FC8A 4EBAA 2PM6A 5ANLA 5C1DA 3JUEA 4RVBA 5EYPF 1NP7A 3DEOA 3ZFWA 2CFUA 5A6CA 3ZNGA 3RRNB 4RSYA 1NI1A 4BSXA 4LNBA 4A63B 1NA3A 2P9SG 3FUFA 3MX3A 4Y6WA 2PQRA 1Z3YA 4ILHB 3G2WA 2MYOA 3LY7A 4EBAG 5DBKA 2BF0X 2Y3AA 3F6QA 3MV2B 4HI9A 3U4TA 4MLPA 5KJNA 2P9UG 3EHNA 5B1BE 3B13A 4JHKA 3CR3A 1MZCA 3MKQA 3UI2A 5FQ8A 1PC2A 4APFA 1OCZE 1QYMA 3WG7E 1B89A 5KJLA 4DX2A 1E8YA 3ZEFA 2ZIRA 1N54A 4BT9A 4WWPA 1LTXA 5FT9A 2XPZA 1HF8A 2F0YA 3R7QA 3FTSA 1BI8B 3CGHA 3ML9A 1D9SA 4IRUA 3DSUA 4N3BA 4E6HA 5FZSA 2CG3A 2KCKA 3ZW3A 3ULQA 5BUZA 3U3WA 3GZ1A 3URZA 2X3MA 4BSZB 5AQBA 3DSWA 2KM4A 4GZ6A 2XS8A 1DVPA 3LJ3A 1KZOA 4FA6A 1KT0A 4LNUD 5JJ6A 5JHBA 5EN5D 2WXJA 3NOGD 5JJTA 4BX9A 5JA4D 1MJ0A 3L13A 2WPVA 5KNHD 3CHMA 1OCOE 3Q47B 4CDNA 1OT8A 3SNXA 2GGFA 4F3VA 3L82A 4HOUA 3S7DA 3RRMB 1MQSA 4CRWA 2CG2A 3AG1E 5FZQA 3T9KA 1O5MA 1ELKA 2IOLA 4L23A 4PDXA 3S2AA 3ESKA 3PS6A 1TN6A 4X8QA 2R03A 2OV8A 4AIFA
chains in the Genus database with same CATH topology
5EDSA 4J8FA 4GB9A 3CSTA 5CMYA 4JHJA 3LXUX 4MS6A 4EQFA 2V5FA 3FTZA 2L6JA 3O48A 4FJYA 1OWLA 3FH5A 3LKUA 2KZTA 4CT0A 3B7TA 4BX8A 1HO8A 2WXNA 2JEKA 3CHOA 2WB2A 1UJJA 2L0IA 2XRZA 4PS8A 4EZLA 2I2OA 3MKQB 5A7DB 2WQHA 2WMNA 3UT7A 1E90A 1JWGA 4I1MA 4Q96A 3VLEA 5BPPA 4FULA 3FUNA 3FUKA 4OVVA 4G1TA 3AS4A 1BPOA 5FZRA 3DBSA 3D9LA 5ARGA 4FADA 3APDA 5G05J 3D9JA 4AP2A 5G2NA 4LRZA 2J4BA 1NA0A 4L2LA 2J08A 1TEZA 3SBSA 4GCOA 3LY8A 4FJZA 3FUDA 3JCKC 3UQ3A 4JA7A 3CVPA 4XI0A 3FH8A 4F7AA 3PREA 5AIJA 4U0UA 2QY7A 2M63A 3ZYQA 3B7RL 4C0MA 4B8CB 3N71A 5KJMA 3ZPJA 2MHKA 2WXMA 1IQRA 3FTVA 5BT1A 3FU0A 3PRZA 2X6KA 4CT4A 4I1OB 4Q94A 3I4RB 3CHSA 4N2SA 2WVIA 4GPKA 3CV0A 1H2UA 2C0MA 5J08A 2KATA 3LYAA 4G23A 5ENNA 1OUVA 4TUUA 1L5JA 4FLBA 3E4BA 3ML8A 4PUCA 3PEUB 2OVBA 3CEQA 3B7UX 3BG0B 3MZLB 4U63A 4ANUA 3UPVA 3KS2A 2BUGA 3D9NA 4RG9A 5BNWA 3U9WA 5BV1A 4K03A 4HOTA 2OOEA 3D9IA 2X6IA 1OWNA 3FUHA 3U66A 2WXHA 3RRUA 4DPRA 2PZIA 4L7TA 3L22A 3CLJA 2R17C 2AXUA 3RK6A 4KZCA 2VTBB 1WM5A 4GAAA 2IF4A 3SGHA 4DK5A 4EPZA 3CVVA 2WXQA 4FLHA 1HS6A 5CHEE 2XGMA 4C0EA 3UX4A 3LVRE 4HORA 3GZSA 4B0ZA 4AXHA 3OXFA 3KD7A 3TXMA 3ZHEB 2CFZA 2E2EA 4A3TA 5M72A 4JA9A 3ONKA 4B8AA 1E7UA 1HG5A 3FUMA 4N5CA 5LP0A 1LF8A 3VLDA 2LAIA 3Q5MA 2YHEA 4N39A 2V4LA 3FULA 1H2VC 2Y4TA 5HQ8A 3FTYA 1H2TC 1PAQA 3LCAA 5AJDA 4HLEA 3EHMA 3FH7A 4AY5A 1E8WA 3PDNA 4AOFA 1UJKA 2IFUA 2XRYA 4XZ4A 3TXNA 1WAO1 3QAQA 4FP7A 4L2YA 1E96B 3ZYKA 4D10C 3CVQA 3HDXA 1QNFA 1ELRA 5D0QD 3K9IA 3CHQA 3RO3A 3CK7A 2BTDA 3JQ1A 3TL5A 1MHQA 3JYSA 3WXXA 3ZYMA 2WXKA 1HE8A 3I3NA 3IKOB 4I17A 4B94A 1IHGA 4QFVA 4CDRA 3G2SA 3CIAA 4RG6A 2XCCA 4JXTA 2X6HA 3MJWA 2J09A 3PUJA 1ELWA 4NURA 4XI9A 2VGXA 3QJZA 3QB2A 5BV0A 1WY6A 4OYSA 4UI9C 4XKBA 2A4ZA 2C0LA 1KT1A 3ASFA 2LSUA 1H0AA 2KCVA 3ZYLA 5T4YA 2HM8A 4HS2A 4P29A 4ILGA 4JZYA 5ANRA 3VTYA 2CHWA 4APOA 1PY1A 3AS8A 1HFAA 4AEZC 4URKA 1NZNA 4BFRA 3ASGA 3R7RA 3HYMB 3ONLA 3PE3A 1X5BA 4LCTA 3OAWA 4AM9A 5T8IA 3CK9A 4I6EA 1DNPA 3D9KA 3BEEA 4WNEA 4A1GA 4Q69A 2KZTB 1U3CA 3FTXA 2FBNA 2GW1A 4G26A 4GMLA 4U0ZA 2YINA 4ME2A 1HX8A 3ZN3A 2WXLA 4W9RA 3PVLA 2HO1A 2VSOE 1OWOA 4F53A 4KXKB 2KC7A 2QFCA 3LDZA 4LUNU 2WXIA 4U07A 4AJWA 5HI7A 3UMVA 4WWNA 4DLQA 3BG1B 3LY9A 4GCNA 2WMOA 4O6FA 1P5QA 3IHVA 4I43A 3CVLA 5T3RA 2AWIA 4IYPA 3OXLA 3ZGQA 3QWVA 2X6FA 4N3AA 4UI9J 4CEMA 3OTNA 4WNFA 3CQGB 3TJPA 1E7VA 4V3IA 3Q15A 3FWVA 4I6GA 2NXPA 1Z3XA 1FCHA 1JWFA 2OVFA 3AS5A 5E76A 4HOSA 4XX5A 1OWMA 2IQCA 2LSVA 1H6KA 4MRUA 4WNDA 1UG3A 2KCLA 3LS8A 4UWLA 2XPIA 1Y8MA 2R5SA 3FFLA 3CVXA 4JW1A 3IEGA 3KAEA 3D9PA 3CKCA 4PH4B 4H7XA 3RJVA 3VTXA 2IJGX 5EX0A 3QWPA 3UUXA 3RIBA 4LEUA 5KCMA 5LFAA 3EIQC 3SI5A 3FTUA 4GA1A 2VSYA 4PS3A 3TAXA 3D3MA 1IYGA 2AXVA 5AJLA 4GYYA 4EZKA 2AW6A 3CVWA 2GRMA 1XGWA 4IN3B 4YVQC 1HU3A 2GRLA 3QWWA 4NACA 3ZVVA 1HG2A 3ZRHA 2WXFA 2ONDA 1HZ4A 1W3BA 3APCA 4IULA 3FU5A 3P2BA 4AIFA 4BT8A 4BTBA 5C2YA 4EZJA 3C98A 3FTWA 3QOUA 5CCLA 4U0SA 3PZDA 2IONA 4ANVA 3LVQE 2Y4UA 3NF1A 4FU3A 2UY1B 3HHMA 5FQ6A 4A3VA 3CQCB 5FWQA 3PEVB 2X6JA 3Q49B 3NQPA 3HVEB 3MYVA 2VYIA 3QARA 2J49A 3MGBA 2I1JA 3UT4A 4DLOA 1U3DA 5JHAA 3SBTB 5LX8A 2FI7A 3L17A 4UI9K 2A5UA 4DJAA 4I2ZA 2WQ7A 3ASHA 5G04C 4G24A 4JC8A 4JL0A 4KT6B 1UW4B 3QC1A 4G2VA 3TG4A 1ZU2A 4GZDA 3FU3A 3HIZA 2J9QA 4ATGA 2DCPA 5ARFA 3NZSA 5E75A 1Z6TA 5FJYA 4ANXA 1OWPA 2L9BA 4FC8A 4EBAA 4I9CA 4NQ0A 1SQMA 4H7YA 4U8HA 3S7JA 4KYOB 2PM6A 4UQZA 4UWGA 5ANLA 5C1DA 5KJKA 4RVBA 1TJFA 1SZ9A 1NP7A 2IOSA 3ZFWA 1HXIA 2CFUA 3T5XA 4WNGA 1VDYA 3RU0A 4TV3A 4AVXA 3IBEA 3ZIMA 5A6CA 5LCWJ 3RRNB 4G11A 4RSYA 3T8MA 4BSXA 4UQXA 2FEZA 2DIWA 1INZA 1QQEA 2V8SE 2YQ8A 4HOQA 3GW4A 3PE4A 2XGSA 3QDNA 1NA3A 4I6JA 4J8EA 3UT8A 2MRIA 4Y6CA 3JUIA 3L08A 3FUFA 4B89A 3MX3A 4Y6WA 1JUQA 3B7SA 3CVNA 4CGVA 3PNLB 4I2WA 2PQRA 3G2TA 1Z3YA 5FTPA 4ILHB 2HYZA 3G2WA 4YVOA 5EKQD 5G04J 4KMOA 3LY7A 1EPUA 4FHJA 5DBKA 2BF0X 4M3OA 4EBAG 5FQ4A 3U64A 4KZ0A 4G25A 4BY6A 2X38A 3EIJA 2Y3AA 4DI3A 3LEWA 3PUKA 3SD5A 1A17A 3ZXSA 3MV2B 5CCMA 2NSZA 2AVPA 3ASDA 1KLXA 3G2UA 3D9MA 3MCXA 1EF1C 2NC9A 3U4TA 2E0IA 4GMJA 4MLPA 5KJNA 3TGOA 5AYWD 3FDHA 3EHNA 4KVOA 3B13A 2FO7A 3CR3A 4JHKA 4JHRA 4GZ5A 2XGOA 3APFA 1QZ2A 1FVFA 3MKQA 4J8SA 5FQ8A 3MV3B 3EJNA 1PC2A 4U04A 2CHZA 1JPLA 3P1UA 4APFA 4YNDA 3FEXA 2VSNA 3FUEA 2XEVA 3GZ2A 2V0PA 2PL2A 3DPDA 3AU5A 1B89A 4ILIA 4UWFA 5KJLA 2FULA 1FVHA 2FF4A 4A55A 3VLFA 1UN8A 1E8YA 2VJ8A 5EX3A 3ZEFA 1N54A 4BT9A 4NRHB 4R7LA 4JVSA 4WWPA 3FEYA 3PNTB 2C2LA 4HVBA 4N3CA 5FT9A 3SZ7A 4L1BA 2WQ6A 2XPZA 3CKBA 3TG5A 1HF8A 3G2VA 4WWOA 3R7QA 3FTSA 5JJ7A 1Y6IA 2CHXA 3CGHA 2YHCA 4HXIA 4J0UA 1H19A 2I1KA 2WXRA 3QK0A 3S7BA 4CGWA 3ML9A 4K0RA 1E8ZA 5LOZA 2J07A 4WAFA 2WXOA 1S0PA 3I4GA 4IRUA 4UWHA 3SFZA 4GYWA 5A23A 1N52A 4N3BA 4E6HA 2VSXE 3O4ZA 3NZUA 5FZSA 4CCAA 1YA0A 4KBQA 3CVYA 4A1SA 2CG3A 5BW8C 3R9AB 3S7FA 2KCKA 4MKTA 4TRQA 1E8XA 3ESLA 4PS7A 2LAHA 3ZW3A 2I6HA 3ENEA 3ULQA 4C9BB 5BUZA 4DI4A 3U3WA 2LO6A 2VQ2A 3GZ1A 3FP3A 2RD0A 2UWJG 3D9OA 3QKYA 5LCWC 4UQYA 3URZA 2ILRA 4GZCA 2X3MA 3CVUA 2PQNA 2KM4A 2XHEA 2XQ0A 4ACLA 1UN9A 2R59A 4GZ6A 4BWRA 2VGYA 3SF4A 3Q4AB 2P58C 2HR2A 1DVPA 3LJ3A 2VTBA 2JLBA 3RKVA 4CDMA 2YNQA 2I9CA 5J90A 2L0TB 1XNFA 1TJCA 4JEHA 4UWKA 4J6IA 4OVUA 3L54A 4ACKA 4FA6A 1KT0A 2UY1A 3IV0A 3CHPA 4GYOA 5AENA 4N2QA 5DIZA 3CK8A 3ZHEA 3HVEA 5FQ7A 1ZBPA 5JJ6A 3KEZA 3L16A 5JHBA 3MEKA 3SHFA 2WXJA 4XKCA 3MA5A 4F1SA 4GZ3A 4JEUA 4J8DA 2J4DA 4JPSA 4BX9A 4EECA 5JJTA 2EQXA 2WXPA 3FHEA 3L13A 2WPVA 3CHMA 5G55A 4ANWA 1SZAA 2IU1A 2XPYA 3Q47B 4CDNA 4GA0A 2RG8A 4GA2A 2GGFA 3EDTB 2WXGA 4LERA 3SNXA 4HOUA 4F3VA 3FUIA 3S7DA 1EYHA 3RRMB 3AU4A 1MQSA 3I5PA 2DBAA 4CRWA 2CG2A 3IHYA 4KVMA 1HH8A 5FZQA 3QNKA 4I1AA 3FU6A 3T5VA 3JQ0A 3CHRA 4WUYA 1ELKA 4BTAA 2IOLA 3OXGA 4L23A 4XE0A 2MOWA 4PDXA 2LNIA 2VGXB 4XIFA 1IQUA 4GU5A 3FUJA 3CSFA 2PM7A 3L6AA 5CMWA 3MKRA 4E85A 5G05C 1GW6A 4AY6A 3S2AA 3ESKA 2ZU6B 5D0OD 3PS6A 2XCBA 2AXZA 1EDUA 2WM9A 3PH0C 3FY4A 2Q7FA 3GYZA 4HFGA 3RO2A 4FHKA 4ABNA 2OV8A 4AV7A 3LPZA 4I9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYK A;  1ELK A;  3D9J A;  3D9O A;  1H0A A;  3LDZ A;  5CMY A;  3G2T A;  4FLB A;  3ZYL A;  4FU3 A;  4GZC A;  1HF8 A;  2MOW A;  3D9P A;  3G2V A;  3G2W A;  3ZYM A;  1MHQ A;  1PY1 A;  1HFA A;  2KM4 A;  1SZ9 A;  3D9N A;  2BF0 X;  3ONK A;  1SZA A;  5LP0 A;  1HG5 A;  3D9I A;  1DVP A;  3ONL A;  1LF8 A;  5CMW A;  1JPL A;  1VDY A;  2QY7 A;  4AVX A;  5LOZ A;  1UJJ A;  1X5B A;  2L0I A;  3G2S A;  3ZYQ A;  3RRU A;  2L0T B;  4JXT A;  1XGW A;  2DIW A;  1JWG A;  3CLJ A;  3D9K A;  1INZ A;  4Q96 A;  1JWF A;  1EDU A;  2V8S E;  1EYH A;  4NAC A;  1HG2 A;  3G2U A;  3D9M A;  4Q94 A;  1HX8 A;  4HFG A;  4GZD A;  3D9L A;  2DCP A;  1UJK A;  5J08 A;  2LO6 A;  1JUQ A; 
#chains in the Genus database with same CATH topology
 3CST A;  2DYS E;  3LXU X;  5CBN A;  4MBG A;  1HO8 A;  2WB2 A;  3CHO A;  2L0I A;  4PS8 A;  4EZL A;  4TXR A;  2WQH A;  2WMN A;  3UT7 A;  1JWG A;  4Q96 A;  5BPP A;  3FUK A;  4OVV A;  1IXV A;  3DXK G;  1BPO A;  5FZR A;  3DBS A;  3APD A;  1DCQ A;  4FJZ A;  3FUD A;  4JA7 A;  3FH8 A;  3B7R L;  5KJM A;  1D8E A;  3I4R B;  3CHS A;  4HBD A;  4N2S A;  3CV0 A;  1H2U A;  2KAT A;  1OUV A;  4GTO A;  4O1O A;  4U63 A;  3MZL B;  2GRN B;  3U66 A;  5ENQ D;  5HKP A;  2VTB B;  4EPZ A;  3UTM A;  2WXQ A;  2KBX A;  2P9K G;  3TXM A;  4JA9 A;  4LG6 A;  1BLX B;  4B8A A;  2LAI A;  3EU9 A;  5HQ8 A;  1H2T C;  3LCA A;  3EHM A;  3ASN E;  2P2C P;  4AOF A;  5EYL A;  2IFU A;  1WAO 1;  4FP7 A;  3JXJ A;  3ZYK A;  3HDX A;  3RO3 A;  3ISM C;  3JYS A;  3ZXP A;  4GTT A;  2H6I A;  3PZ1 A;  3G2S A;  3MJW A;  4NUR A;  2ZGG A;  2RFM A;  3QJZ A;  3QB2 A;  4O1P A;  1WY6 A;  5JMN D;  2A4Z A;  1KT1 A;  3ASF A;  2LSU A;  1H0A A;  2KCV A;  5FIN A;  4HS2 A;  3VTY A;  3AJI A;  5CRU A;  3AS8 A;  4AEZ C;  3V79 K;  5CEA A;  3OAW A;  4WNE A;  3BEE A;  1S70 B;  2KZT B;  2WXL A;  3PVL A;  3L9T A;  3LDZ A;  2ETC A;  5HI7 A;  3LY9 A;  4DI4 A;  1P5Q A;  5T3R A;  3CVL A;  2GRQ B;  4IYP A;  1AP7 A;  4N3A A;  4UI9 J;  4WNF A;  3CQG B;  1O1T A;  3TWR A;  3ABM E;  4I6G A;  3HXF A;  2OVF A;  1UG3 A;  5KNG A;  3FFL A;  1Y8M A;  4ZHB A;  1LD7 A;  3IEG A;  3D9P A;  3CKC A;  3IXE A;  3Q79 A;  3RJV A;  3VTX A;  2IJG X;  5EIB E;  1FT2 A;  3TAX A;  3UIO C;  1IYG A;  2AXV A;  1AWC B;  1HG2 A;  2WXF A;  4IUL A;  3P2B A;  4EZJ A;  5CCL A;  3C98 A;  3QOU A;  4FU3 A;  5FQ6 A;  5FWQ A;  2X6J A;  2VYI A;  3MGB A;  5LX8 A;  2FI7 A;  4UI9 K;  2A5U A;  1IHB A;  3ASH A;  2WQ7 A;  4JL0 A;  1ZU2 A;  3FU3 A;  3Q75 A;  4NQ0 A;  2XEE A;  4H7Y A;  3S7J A;  5KJK A;  3HXB A;  5LCW J;  3J5P A;  2FEZ A;  1INZ A;  4HOQ A;  5D2M C;  2XZD G;  2XGS A;  3EHR A;  4J8E A;  3UT8 A;  3L08 A;  1JUQ A;  3B7S A;  3PNL B;  5EKQ D;  2HYZ A;  2J8S D;  3U64 A;  1JCR A;  1A17 A;  2ZGD A;  3B95 A;  3DPY A;  2FO7 A;  1FVF A;  3EJN A;  4U04 A;  2CHZ A;  2EIJ E;  1TNO A;  1JPL A;  2PNN A;  3FUE A;  2XEV A;  1G3N B;  2PL2 A;  4ILI A;  4UWF A;  2FUL A;  4A55 A;  2L6B A;  4XEI G;  4JVS A;  5AN8 A;  3SZ7 A;  2RKK A;  3CKB A;  1RW2 A;  3G2V A;  5JJ7 A;  5CRV A;  1Y6I A;  2CHX A;  2YHC A;  2I1K A;  2WXR A;  3QK0 A;  3S7B A;  1S0P A;  3SFZ A;  4GYW A;  5A23 A;  1N52 A;  3O4Z A;  3NZU A;  4CCA A;  5AAO A;  4KBQ A;  3CVY A;  5BW8 C;  3S7F A;  4MKT A;  4TRQ A;  3ESL A;  1NL4 A;  4PS7 A;  4OAU C;  2LO6 A;  2VQ2 A;  3FP3 A;  5LCW C;  3C3R A;  2VTB A;  2JLB A;  3RKV A;  1WDY A;  4HNA D;  4UWK A;  1TJC A;  3AG4 E;  3EU5 A;  2UY1 A;  3CHP A;  2IO2 C;  3CK8 A;  3HVE A;  1SA5 A;  3UKR G;  3KEZ A;  3L16 A;  4RLY A;  4XKC A;  2EQX A;  4QQI A;  4F6R D;  5G55 A;  4ANW A;  1SZA A;  2XPY A;  5KWD A;  4GA2 A;  3AU4 A;  5IY5 E;  3IHY A;  4I1A A;  3T5V A;  1TYQ G;  3OXG A;  4XE0 A;  5BXU A;  5ENS D;  1TN8 A;  4GTM A;  3L6A A;  5CMW A;  3RSE G;  3MKR A;  5G05 C;  1GW6 A;  1WG0 A;  1MYO A;  5D0O D;  2XCB A;  2WM9 A;  3HXE A;  3FY4 A;  4ABN A;  3ULE G;  5CMY A;  1O1R A;  4EQF A;  3FTZ A;  4FJY A;  3LKU A;  3PZ2 A;  2KZT A;  4CT0 A;  3B7T A;  1UJJ A;  1E90 A;  4I1M A;  3VLE A;  1BD8 A;  4FUL A;  1YYH A;  5ITZ F;  5G2N A;  4LRZ A;  4L2L A;  5D66 A;  3SBS A;  3LY8 A;  4U0U A;  4B8C B;  3ZPJ A;  2MHK A;  2WXM A;  3FTV A;  4CT4 A;  2X6K A;  4N5Q A;  4GPK A;  3TWQ A;  4FLB A;  3ML8 A;  2OVB A;  2EIK E;  3BG0 B;  3KS2 A;  1BI7 B;  2BUG A;  4RG9 A;  3U9W A;  4K03 A;  1OWN A;  4G8K A;  3FUH A;  3DRA A;  3E34 A;  3NBN B;  4L7T A;  3L22 A;  2AXU A;  3RK6 A;  4KZC A;  1WM5 A;  4GAA A;  4DK5 A;  5B1A E;  1HS6 A;  2XGM A;  4C0E A;  1MX4 A;  3LVR E;  3KD7 A;  3ZHE B;  2E2E A;  4N5C A;  5LP0 A;  1LF8 A;  3UM0 A;  4K5A B;  4N39 A;  2V4L A;  3FUL A;  1PAQ A;  5FIO A;  4GMR A;  2NYJ A;  2R2L A;  5EIL A;  1KPS B;  3TXN A;  4D10 C;  5D0Q D;  2ZXW E;  3K9I A;  2IEJ A;  3CK7 A;  1MHQ A;  1HE8 A;  3I3N A;  4I17 A;  1IHG A;  5ENT D;  4QFV A;  4CDR A;  2XCC A;  5ENP D;  2J09 A;  1H6O A;  2EIL E;  1X81 A;  1OY3 D;  4JZY A;  4APO A;  4URK A;  3SQV A;  3ASG A;  3HYM B;  3PE3 A;  3V2O A;  4LCT A;  3ZUV B;  1O1S A;  5T8I A;  4I6E A;  3D9K A;  4UUC A;  1U3C A;  2FBN A;  2GW1 A;  3NOC D;  4G26 A;  4GML A;  4U0Z A;  4ME2 A;  3LPZ A;  3Q7F A;  2H6F A;  4GCN A;  2WMO A;  4O6F A;  2QYU A;  3IHV A;  4I43 A;  4B93 B;  3ZGQ A;  3QWV A;  4TXQ A;  4CEM A;  1E7V A;  4V3I A;  5AQ7 A;  1S63 A;  3FWV A;  1JWF A;  3AS5 A;  5E76 A;  4XX5 A;  2IQC A;  2LSV A;  4TXP A;  3LS8 A;  3ASO E;  3CVX A;  4JW1 A;  4RQI A;  1N95 A;  4BES A;  1OCC E;  3DSX A;  3FTU A;  2VSY A;  1N11 A;  3UIP C;  4EZK A;  1TNY A;  4YVQ C;  2GRL A;  1TN7 A;  3ZVV A;  2P9L G;  3FTW A;  1N4P A;  3LVQ E;  3NF1 A;  2UY1 B;  4A3V A;  3CQC B;  1LD8 A;  3PEV B;  4HRM B;  3HVE B;  1N9A A;  4YDE A;  2H6H A;  2I1J A;  3TWV A;  1U3D A;  3UT4 A;  1KZP A;  5G04 C;  4JC8 A;  3QC1 A;  4DX7 D;  1K1B A;  4G2V A;  3TG4 A;  4ATG A;  5E75 A;  4ANX A;  1N4R A;  4I9C A;  1OCR E;  4GTR A;  4UQZ A;  4BER A;  1TJF A;  1SZ9 A;  4WNG A;  4TV3 A;  4AVX A;  3ZIM A;  2F37 A;  3T8M A;  4UQX A;  1QQE A;  2V8S E;  2DYR E;  3GW4 A;  3QDN A;  4I6J A;  4Y6C A;  2BKG A;  3JUI A;  4CGV A;  3G2T A;  4KMO A;  4K5B A;  3SY2 A;  1EPU A;  4M3O A;  5FQ4 A;  3W9F A;  4G25 A;  4DI3 A;  1MX2 A;  3PUK A;  4GTQ A;  3SD5 A;  3ZXS A;  3ASD A;  1KLX A;  3D9M A;  3HG0 D;  3MCX A;  2NC9 A;  3V2X A;  4GMJ A;  4U8Y D;  5AYW D;  3FDH A;  3HXD A;  4KVO A;  4JHR A;  2XGO A;  3APF A;  1DCE A;  3EHQ A;  4U8V D;  3P1U A;  4YND A;  3FEX A;  2V0P A;  3AU5 A;  1FVH A;  3VLF A;  1UN8 A;  2VJ8 A;  5EX3 A;  4NRH B;  1UOH A;  4N3C A;  4L1B A;  2WQ6 A;  2QZA A;  4G8L A;  4EHM A;  2FO1 E;  3Q73 A;  4J0U A;  1H19 A;  2DZO A;  4K0R A;  1E8Z A;  5LOZ A;  2J07 A;  4WAF A;  2V4H C;  2VSX E;  4GPM A;  1YA0 A;  4A1S A;  3R9A B;  4GTV A;  1E8X A;  2I6H A;  3ENE A;  2RD0 A;  2UWJ G;  4TUM A;  4UQY A;  2ILR A;  4GZC A;  2ETA A;  3CVU A;  5CED B;  2PQN A;  4ACL A;  1UN9 A;  5ENO D;  2VGY A;  3SF4 A;  1H6P A;  3UM1 A;  2I9C A;  3BQO A;  2JAB A;  4ACK A;  1XNF A;  4J6I A;  4OVU A;  4U96 D;  1V55 E;  4L9P A;  4N2Q A;  3ZHE A;  5FQ7 A;  3MEK A;  3MA5 A;  4JEU A;  4J8D A;  2J4D A;  4EEC A;  5KBA A;  3X2Q E;  2IU1 A;  3AG2 E;  4HRL A;  4GTS A;  3EDT B;  2WXG A;  4LER A;  3FUI A;  1N4Q A;  3I5P A;  2DBA A;  4NIK A;  1QBQ A;  3QNK A;  3FU6 A;  4BTA A;  2MOW A;  2LNI A;  4XIF A;  1IQU A;  4BEP A;  2EIM E;  2QYJ A;  3C5R A;  4E85 A;  4AY6 A;  3ZKJ A;  2ZU6 B;  1EDU A;  3EUV A;  3GYZ A;  3RO2 A;  3DEP A;  2KXP C;  4FHK A;  4LSZ E;  4AV7 A;  5EDS A;  4J8F A;  4GB9 A;  3B7B A;  3O48 A;  3Q7A A;  2DWZ A;  3FH5 A;  4BX8 A;  2XEN A;  2WXN A;  2XRZ A;  3AAA C;  3DSS A;  4HRN A;  4G1T A;  4FAD A;  3D9L A;  5G05 J;  3BU8 A;  3D9J A;  2J4B A;  1NA0 A;  2J08 A;  2P9N G;  4GCO A;  5CEC B;  1TNU A;  1S64 A;  3CVP A;  4XI0 A;  3DST A;  3NAW A;  3PRE A;  2QY7 A;  3E30 A;  3E33 A;  5BT1 A;  1IQR A;  3DWL G;  3TWT A;  5CBO A;  4I1O B;  2C0M A;  4G23 A;  4TUU A;  3UKU G;  1L5J A;  3PEU B;  3CEQ A;  3B7U X;  5BNW A;  2OOE A;  5EID A;  2X6I A;  4BET A;  1Z5S C;  3RRU A;  2PZI A;  3CLJ A;  5CHE E;  5ENR D;  3UX4 A;  4HOR A;  1U2V G;  3UM2 A;  2CFZ A;  4A3T A;  1HG5 A;  3FUM A;  2VGE A;  2YHE A;  3FTY A;  4HLE A;  2XRY A;  1BU9 A;  3QAQ A;  3CVQ A;  4DX5 D;  1QNF A;  1ELR A;  3PZ3 A;  2BTD A;  3TL5 A;  3WXX A;  3IKO B;  4B94 A;  4RG6 A;  2B0O E;  4JXT A;  2X6H A;  5BXO A;  2VGX A;  4OYS A;  1TNZ A;  5T4Y A;  4P29 A;  4DRX E;  5ANR A;  1HFA A;  1NZN A;  2ZIS A;  3R7R A;  2XS1 A;  3C3O A;  1DNP A;  3SO8 A;  4A1G A;  4Q69 A;  3FTX A;  1FPP A;  1HX8 A;  3ZN3 A;  4YDW A;  2HO1 A;  1OWO A;  4F53 A;  4KXK B;  4LUN U;  2WXI A;  4WWN A;  3KSL A;  2AWI A;  3OXL A;  3TJP A;  1JCS A;  4Z68 A;  3Q15 A;  4LNG A;  1K1A A;  1Z3X A;  3D9H A;  2AJA A;  1H6K A;  4UWL A;  3KAE A;  4DX1 A;  1ZB1 A;  4H7X A;  3UUX A;  4CZ2 D;  3RIB A;  2GRO B;  5LFA A;  1TNB A;  4GA1 A;  4PS3 A;  5AJL A;  2Y0B G;  2AW6 A;  3CVW A;  2GRM A;  1HU3 A;  3QWW A;  3ZRH A;  3J5Q B;  3ABL E;  2OND A;  1HZ4 A;  3HRA A;  4YDO A;  5C2Y A;  2Y1L E;  3PZD A;  1A5E A;  2BED A;  2Y4U A;  3HHM A;  3NQP A;  3MYV A;  3QAR A;  1OXJ A;  2J49 A;  3Q78 A;  4DLO A;  2IO3 C;  5JHA A;  3L17 A;  4JD2 G;  3SFY A;  4KT6 B;  3HIZ A;  2J9Q A;  5ARF A;  1Z6T A;  3ABK E;  1OWP A;  2L9B A;  3KEA A;  1SQM A;  3UM3 A;  2B6C A;  4U8H A;  3Q9U C;  4KYO B;  4UWG A;  1V54 E;  2IOS A;  3KSQ A;  1HXI A;  3T5X A;  1VDY A;  3RU0 A;  1MX6 A;  3IBE A;  4G11 A;  2DIW A;  1FT1 A;  4J8Y A;  2YQ8 A;  1K8K G;  3PE4 A;  2DVW A;  2MRI A;  4B89 A;  3CVN A;  1Q2Z A;  4I2W A;  5FTP A;  4YVO A;  5G04 J;  5B3S E;  4FHJ A;  1NFI E;  3HXC A;  4KZ0 A;  4BY6 A;  2X38 A;  3EIJ A;  5AAR A;  3TWX A;  3LEW A;  2OEV A;  5CCM A;  2GRR B;  4YDY A;  2NSZ A;  2AVP A;  3G2U A;  1EF1 C;  2E0I A;  3UXG A;  3TGO A;  3SFX A;  3AG3 E;  4GZ5 A;  2LXL A;  1QZ2 A;  1YCS B;  4J8S A;  3MV3 B;  3V30 A;  2IY0 C;  4JB8 P;  2VSN A;  3GZ2 A;  3DPD A;  2FF4 A;  4R7L A;  3FEY A;  3PNT B;  2C2L A;  4HVB A;  3TG5 A;  4WWO A;  4HXI A;  4CGW A;  4HLL A;  2WXO A;  3I4G A;  4HB5 A;  4UWH A;  5H7P A;  1JCQ A;  2LAH A;  4DUI A;  4O60 A;  4C9B B;  1SA4 A;  4HQD A;  3D9O A;  3QKY A;  2EIN E;  2XHE A;  2XQ0 A;  2R59 A;  4BWR A;  3Q4A B;  2P58 C;  2HR2 A;  4CDM A;  2YNQ A;  5J90 A;  2L0T B;  4JEH A;  1N0Q A;  2XZT G;  3L54 A;  3IV0 A;  3ZU7 B;  4GYO A;  5AEN A;  5DIZ A;  2GRP B;  1N4S A;  1ZBP A;  3SHF A;  1D8D A;  4F1S A;  4GZ3 A;  4K5C A;  4JPS A;  2F8Y A;  2WXP A;  3FHE A;  4GA0 A;  4C48 B;  2RG8 A;  1EYH A;  4KVM A;  1HH8 A;  3UIN C;  3JQ0 A;  3T8K A;  3CHR A;  4WUY A;  2LUH A;  2VGX B;  4GU5 A;  3FUJ A;  3CSF A;  2A5E A;  5CER B;  2PM7 A;  2AXZ A;  3E32 A;  3PH0 C;  2Q7F A;  2F8X K;  4HFG A;  2OCC E;  4HI8 A;  1SVX A;  4I9E A;  4JHJ A;  4MS6 A;  2V5F A;  2L6J A;  1OWL A;  2JEK A;  2R02 A;  2I2O A;  3C3Q A;  3MKQ B;  5A7D B;  1SW6 A;  3BUA A;  3FUN A;  3V31 A;  3AS4 A;  3TWW A;  5ARG A;  3Q9N C;  4AP2 A;  2P9P G;  1TEZ A;  3C72 A;  3JCK C;  3UQ3 A;  4F7A A;  5AIJ A;  2M63 A;  3ZYQ A;  4M7C A;  4C0M A;  3N71 A;  3FU0 A;  3PRZ A;  4Q94 A;  2WVI A;  5J08 A;  3LYA A;  5ENN A;  3ULY A;  3E4B A;  4PUC A;  1YMP A;  3UPV A;  2DZN A;  4ANU A;  3D9N A;  4GTP A;  5BV1 A;  4HOT A;  5AQA A;  3D9I A;  2QC9 A;  2WXH A;  4DPR A;  4OAV B;  2R17 C;  5HS0 A;  2IF4 A;  3SGH A;  3CVV A;  3E37 A;  4FLH A;  3GZS A;  4B0Z A;  4AXH A;  3OXF A;  1N0R A;  1IKN D;  5M72 A;  3ONK A;  1E7U A;  2P9I G;  3VLD A;  4U7E B;  3Q5M A;  1H2V C;  2Y4T A;  5AJD A;  1TR4 A;  3FH7 A;  3R9M A;  4AY5 A;  1E8W A;  3PDN A;  4J7W A;  1UJK A;  4XZ4 A;  4L2Y A;  1E96 B;  1N94 A;  2R05 A;  4ZFH A;  3CHQ A;  3ZYM A;  3JQ1 A;  3JXI A;  2WXK A;  3TWS A;  2HE0 A;  3CIA A;  2OEW A;  3PUJ A;  1ELW A;  4XI9 A;  4CYM D;  4DX6 D;  5BV0 A;  4XKB A;  4UI9 C;  3DXM G;  2C0L A;  4U95 D;  2RFA A;  5AQ9 A;  2ETB A;  2HM8 A;  3ZYL A;  4ILG A;  2CHW A;  1PY1 A;  4ATZ D;  4BFR A;  3ONL A;  1X5B A;  2V5Q C;  4AM9 A;  3CK9 A;  2YIN A;  4W9R A;  2VSO E;  2KC7 A;  2QFC A;  4AJW A;  4U07 A;  5HRY A;  3LJN A;  3UMV A;  3BG1 B;  4DLQ A;  2X6F A;  3OTN A;  2BKK B;  2NXP A;  1FCH A;  1DC2 A;  4HOS A;  1OWM A;  4MRU A;  4WND A;  2KCL A;  2XPI A;  2R5S A;  4PH4 B;  1K3Z D;  5EX0 A;  3QWP A;  4LEU A;  5KCM A;  2LXM A;  3EIQ C;  3RAU A;  4F1P A;  3SI5 A;  3TWU A;  3D3M A;  3NB2 A;  2XEH A;  4GYY A;  2H6G A;  1XGW A;  4IN3 B;  4NAC A;  1W3B A;  3APC A;  4BT8 A;  4BTB A;  3FU5 A;  1RZ4 A;  4U0S A;  3DSV A;  2ION A;  4ANV A;  3Q49 B;  3W9G A;  3SBT B;  4DJA A;  4I2Z A;  4G24 A;  1UW4 B;  4GZD A;  3PZ4 A;  2Y69 E;  2DCP A;  3NZS A;  5FJY A;  4FC8 A;  4EBA A;  2PM6 A;  5ANL A;  5C1D A;  3JUE A;  4RVB A;  5EYP F;  1NP7 A;  3DEO A;  3ZFW A;  2CFU A;  5A6C A;  3ZNG A;  3RRN B;  4RSY A;  1NI1 A;  4BSX A;  4LNB A;  4A63 B;  1NA3 A;  2P9S G;  3FUF A;  3MX3 A;  4Y6W A;  2PQR A;  1Z3Y A;  4ILH B;  3G2W A;  2MYO A;  3LY7 A;  4EBA G;  5DBK A;  2BF0 X;  2Y3A A;  3F6Q A;  3MV2 B;  4HI9 A;  3U4T A;  4MLP A;  5KJN A;  2P9U G;  3EHN A;  5B1B E;  3B13 A;  4JHK A;  3CR3 A;  1MZC A;  3MKQ A;  3UI2 A;  5FQ8 A;  1PC2 A;  4APF A;  1OCZ E;  1QYM A;  3WG7 E;  1B89 A;  5KJL A;  4DX2 A;  1E8Y A;  3ZEF A;  2ZIR A;  1N54 A;  4BT9 A;  4WWP A;  1LTX A;  5FT9 A;  2XPZ A;  1HF8 A;  2F0Y A;  3R7Q A;  3FTS A;  1BI8 B;  3CGH A;  3ML9 A;  1D9S A;  4IRU A;  3DSU A;  4N3B A;  4E6H A;  5FZS A;  2CG3 A;  2KCK A;  3ZW3 A;  3ULQ A;  5BUZ A;  3U3W A;  3GZ1 A;  3URZ A;  2X3M A;  4BSZ B;  5AQB A;  3DSW A;  2KM4 A;  4GZ6 A;  2XS8 A;  1DVP A;  3LJ3 A;  1KZO A;  4FA6 A;  1KT0 A;  4LNU D;  5JJ6 A;  5JHB A;  5EN5 D;  2WXJ A;  3NOG D;  5JJT A;  4BX9 A;  5JA4 D;  1MJ0 A;  3L13 A;  2WPV A;  5KNH D;  3CHM A;  1OCO E;  3Q47 B;  4CDN A;  1OT8 A;  3SNX A;  2GGF A;  4F3V A;  3L82 A;  4HOU A;  3S7D A;  3RRM B;  1MQS A;  4CRW A;  2CG2 A;  3AG1 E;  5FZQ A;  3T9K A;  1O5M A;  1ELK A;  2IOL A;  4L23 A;  4PDX A;  3S2A A;  3ESK A;  3PS6 A;  1TN6 A;  4X8Q A;  2R03 A;  2OV8 A;  4AIF A; 
#chains in the Genus database with same CATH homology
 5EDS A;  4J8F A;  4GB9 A;  3CST A;  5CMY A;  4JHJ A;  3LXU X;  4MS6 A;  4EQF A;  2V5F A;  3FTZ A;  2L6J A;  3O48 A;  4FJY A;  1OWL A;  3FH5 A;  3LKU A;  2KZT A;  4CT0 A;  3B7T A;  4BX8 A;  1HO8 A;  2WXN A;  2JEK A;  3CHO A;  2WB2 A;  1UJJ A;  2L0I A;  2XRZ A;  4PS8 A;  4EZL A;  2I2O A;  3MKQ B;  5A7D B;  2WQH A;  2WMN A;  3UT7 A;  1E90 A;  1JWG A;  4I1M A;  4Q96 A;  3VLE A;  5BPP A;  4FUL A;  3FUN A;  3FUK A;  4OVV A;  4G1T A;  3AS4 A;  1BPO A;  5FZR A;  3DBS A;  3D9L A;  5ARG A;  4FAD A;  3APD A;  5G05 J;  3D9J A;  4AP2 A;  5G2N A;  4LRZ A;  2J4B A;  1NA0 A;  4L2L A;  2J08 A;  1TEZ A;  3SBS A;  4GCO A;  3LY8 A;  4FJZ A;  3FUD A;  3JCK C;  3UQ3 A;  4JA7 A;  3CVP A;  4XI0 A;  3FH8 A;  4F7A A;  3PRE A;  5AIJ A;  4U0U A;  2QY7 A;  2M63 A;  3ZYQ A;  3B7R L;  4C0M A;  4B8C B;  3N71 A;  5KJM A;  3ZPJ A;  2MHK A;  2WXM A;  1IQR A;  3FTV A;  5BT1 A;  3FU0 A;  3PRZ A;  2X6K A;  4CT4 A;  4I1O B;  4Q94 A;  3I4R B;  3CHS A;  4N2S A;  2WVI A;  4GPK A;  3CV0 A;  1H2U A;  2C0M A;  5J08 A;  2KAT A;  3LYA A;  4G23 A;  5ENN A;  1OUV A;  4TUU A;  1L5J A;  4FLB A;  3E4B A;  3ML8 A;  4PUC A;  3PEU B;  2OVB A;  3CEQ A;  3B7U X;  3BG0 B;  3MZL B;  4U63 A;  4ANU A;  3UPV A;  3KS2 A;  2BUG A;  3D9N A;  4RG9 A;  5BNW A;  3U9W A;  5BV1 A;  4K03 A;  4HOT A;  2OOE A;  3D9I A;  2X6I A;  1OWN A;  3FUH A;  3U66 A;  2WXH A;  3RRU A;  4DPR A;  2PZI A;  4L7T A;  3L22 A;  3CLJ A;  2R17 C;  2AXU A;  3RK6 A;  4KZC A;  2VTB B;  1WM5 A;  4GAA A;  2IF4 A;  3SGH A;  4DK5 A;  4EPZ A;  3CVV A;  2WXQ A;  4FLH A;  1HS6 A;  5CHE E;  2XGM A;  4C0E A;  3UX4 A;  3LVR E;  4HOR A;  3GZS A;  4B0Z A;  4AXH A;  3OXF A;  3KD7 A;  3TXM A;  3ZHE B;  2CFZ A;  2E2E A;  4A3T A;  5M72 A;  4JA9 A;  3ONK A;  4B8A A;  1E7U A;  1HG5 A;  3FUM A;  4N5C A;  5LP0 A;  1LF8 A;  3VLD A;  2LAI A;  3Q5M A;  2YHE A;  4N39 A;  2V4L A;  3FUL A;  1H2V C;  2Y4T A;  5HQ8 A;  3FTY A;  1H2T C;  1PAQ A;  3LCA A;  5AJD A;  4HLE A;  3EHM A;  3FH7 A;  4AY5 A;  1E8W A;  3PDN A;  4AOF A;  1UJK A;  2IFU A;  2XRY A;  4XZ4 A;  3TXN A;  1WAO 1;  3QAQ A;  4FP7 A;  4L2Y A;  1E96 B;  3ZYK A;  4D10 C;  3CVQ A;  3HDX A;  1QNF A;  1ELR A;  5D0Q D;  3K9I A;  3CHQ A;  3RO3 A;  3CK7 A;  2BTD A;  3JQ1 A;  3TL5 A;  1MHQ A;  3JYS A;  3WXX A;  3ZYM A;  2WXK A;  1HE8 A;  3I3N A;  3IKO B;  4I17 A;  4B94 A;  1IHG A;  4QFV A;  4CDR A;  3G2S A;  3CIA A;  4RG6 A;  2XCC A;  4JXT A;  2X6H A;  3MJW A;  2J09 A;  3PUJ A;  1ELW A;  4NUR A;  4XI9 A;  2VGX A;  3QJZ A;  3QB2 A;  5BV0 A;  1WY6 A;  4OYS A;  4UI9 C;  4XKB A;  2A4Z A;  2C0L A;  1KT1 A;  3ASF A;  2LSU A;  1H0A A;  2KCV A;  3ZYL A;  5T4Y A;  2HM8 A;  4HS2 A;  4P29 A;  4ILG A;  4JZY A;  5ANR A;  3VTY A;  2CHW A;  4APO A;  1PY1 A;  3AS8 A;  1HFA A;  4AEZ C;  4URK A;  1NZN A;  4BFR A;  3ASG A;  3R7R A;  3HYM B;  3ONL A;  3PE3 A;  1X5B A;  4LCT A;  3OAW A;  4AM9 A;  5T8I A;  3CK9 A;  4I6E A;  1DNP A;  3D9K A;  3BEE A;  4WNE A;  4A1G A;  4Q69 A;  2KZT B;  1U3C A;  3FTX A;  2FBN A;  2GW1 A;  4G26 A;  4GML A;  4U0Z A;  2YIN A;  4ME2 A;  1HX8 A;  3ZN3 A;  2WXL A;  4W9R A;  3PVL A;  2HO1 A;  2VSO E;  1OWO A;  4F53 A;  4KXK B;  2KC7 A;  2QFC A;  3LDZ A;  4LUN U;  2WXI A;  4U07 A;  4AJW A;  5HI7 A;  3UMV A;  4WWN A;  4DLQ A;  3BG1 B;  3LY9 A;  4GCN A;  2WMO A;  4O6F A;  1P5Q A;  3IHV A;  4I43 A;  3CVL A;  5T3R A;  2AWI A;  4IYP A;  3OXL A;  3ZGQ A;  3QWV A;  2X6F A;  4N3A A;  4UI9 J;  4CEM A;  3OTN A;  4WNF A;  3CQG B;  3TJP A;  1E7V A;  4V3I A;  3Q15 A;  3FWV A;  4I6G A;  2NXP A;  1Z3X A;  1FCH A;  1JWF A;  2OVF A;  3AS5 A;  5E76 A;  4HOS A;  4XX5 A;  1OWM A;  2IQC A;  2LSV A;  1H6K A;  4MRU A;  4WND A;  1UG3 A;  2KCL A;  3LS8 A;  4UWL A;  2XPI A;  1Y8M A;  2R5S A;  3FFL A;  3CVX A;  4JW1 A;  3IEG A;  3KAE A;  3D9P A;  3CKC A;  4PH4 B;  4H7X A;  3RJV A;  3VTX A;  2IJG X;  5EX0 A;  3QWP A;  3UUX A;  3RIB A;  4LEU A;  5KCM A;  5LFA A;  3EIQ C;  3SI5 A;  3FTU A;  4GA1 A;  2VSY A;  4PS3 A;  3TAX A;  3D3M A;  1IYG A;  2AXV A;  5AJL A;  4GYY A;  4EZK A;  2AW6 A;  3CVW A;  2GRM A;  1XGW A;  4IN3 B;  4YVQ C;  1HU3 A;  2GRL A;  3QWW A;  4NAC A;  3ZVV A;  1HG2 A;  3ZRH A;  2WXF A;  2OND A;  1HZ4 A;  1W3B A;  3APC A;  4IUL A;  3FU5 A;  3P2B A;  4AIF A;  4BT8 A;  4BTB A;  5C2Y A;  4EZJ A;  3C98 A;  3FTW A;  3QOU A;  5CCL A;  4U0S A;  3PZD A;  2ION A;  4ANV A;  3LVQ E;  2Y4U A;  3NF1 A;  4FU3 A;  2UY1 B;  3HHM A;  5FQ6 A;  4A3V A;  3CQC B;  5FWQ A;  3PEV B;  2X6J A;  3Q49 B;  3NQP A;  3HVE B;  3MYV A;  2VYI A;  3QAR A;  2J49 A;  3MGB A;  2I1J A;  3UT4 A;  4DLO A;  1U3D A;  5JHA A;  3SBT B;  5LX8 A;  2FI7 A;  3L17 A;  4UI9 K;  2A5U A;  4DJA A;  4I2Z A;  2WQ7 A;  3ASH A;  5G04 C;  4G24 A;  4JC8 A;  4JL0 A;  4KT6 B;  1UW4 B;  3QC1 A;  4G2V A;  3TG4 A;  1ZU2 A;  4GZD A;  3FU3 A;  3HIZ A;  2J9Q A;  4ATG A;  2DCP A;  5ARF A;  3NZS A;  5E75 A;  1Z6T A;  5FJY A;  4ANX A;  1OWP A;  2L9B A;  4FC8 A;  4EBA A;  4I9C A;  4NQ0 A;  1SQM A;  4H7Y A;  4U8H A;  3S7J A;  4KYO B;  2PM6 A;  4UQZ A;  4UWG A;  5ANL A;  5C1D A;  5KJK A;  4RVB A;  1TJF A;  1SZ9 A;  1NP7 A;  2IOS A;  3ZFW A;  1HXI A;  2CFU A;  3T5X A;  4WNG A;  1VDY A;  3RU0 A;  4TV3 A;  4AVX A;  3IBE A;  3ZIM A;  5A6C A;  5LCW J;  3RRN B;  4G11 A;  4RSY A;  3T8M A;  4BSX A;  4UQX A;  2FEZ A;  2DIW A;  1INZ A;  1QQE A;  2V8S E;  2YQ8 A;  4HOQ A;  3GW4 A;  3PE4 A;  2XGS A;  3QDN A;  1NA3 A;  4I6J A;  4J8E A;  3UT8 A;  2MRI A;  4Y6C A;  3JUI A;  3L08 A;  3FUF A;  4B89 A;  3MX3 A;  4Y6W A;  1JUQ A;  3B7S A;  3CVN A;  4CGV A;  3PNL B;  4I2W A;  2PQR A;  3G2T A;  1Z3Y A;  5FTP A;  4ILH B;  2HYZ A;  3G2W A;  4YVO A;  5EKQ D;  5G04 J;  4KMO A;  3LY7 A;  1EPU A;  4FHJ A;  5DBK A;  2BF0 X;  4M3O A;  4EBA G;  5FQ4 A;  3U64 A;  4KZ0 A;  4G25 A;  4BY6 A;  2X38 A;  3EIJ A;  2Y3A A;  4DI3 A;  3LEW A;  3PUK A;  3SD5 A;  1A17 A;  3ZXS A;  3MV2 B;  5CCM A;  2NSZ A;  2AVP A;  3ASD A;  1KLX A;  3G2U A;  3D9M A;  3MCX A;  1EF1 C;  2NC9 A;  3U4T A;  2E0I A;  4GMJ A;  4MLP A;  5KJN A;  3TGO A;  5AYW D;  3FDH A;  3EHN A;  4KVO A;  3B13 A;  2FO7 A;  3CR3 A;  4JHK A;  4JHR A;  4GZ5 A;  2XGO A;  3APF A;  1QZ2 A;  1FVF A;  3MKQ A;  4J8S A;  5FQ8 A;  3MV3 B;  3EJN A;  1PC2 A;  4U04 A;  2CHZ A;  1JPL A;  3P1U A;  4APF A;  4YND A;  3FEX A;  2VSN A;  3FUE A;  2XEV A;  3GZ2 A;  2V0P A;  2PL2 A;  3DPD A;  3AU5 A;  1B89 A;  4ILI A;  4UWF A;  5KJL A;  2FUL A;  1FVH A;  2FF4 A;  4A55 A;  3VLF A;  1UN8 A;  1E8Y A;  2VJ8 A;  5EX3 A;  3ZEF A;  1N54 A;  4BT9 A;  4NRH B;  4R7L A;  4JVS A;  4WWP A;  3FEY A;  3PNT B;  2C2L A;  4HVB A;  4N3C A;  5FT9 A;  3SZ7 A;  4L1B A;  2WQ6 A;  2XPZ A;  3CKB A;  3TG5 A;  1HF8 A;  3G2V A;  4WWO A;  3R7Q A;  3FTS A;  5JJ7 A;  1Y6I A;  2CHX A;  3CGH A;  2YHC A;  4HXI A;  4J0U A;  1H19 A;  2I1K A;  2WXR A;  3QK0 A;  3S7B A;  4CGW A;  3ML9 A;  4K0R A;  1E8Z A;  5LOZ A;  2J07 A;  4WAF A;  2WXO A;  1S0P A;  3I4G A;  4IRU A;  4UWH A;  3SFZ A;  4GYW A;  5A23 A;  1N52 A;  4N3B A;  4E6H A;  2VSX E;  3O4Z A;  3NZU A;  5FZS A;  4CCA A;  1YA0 A;  4KBQ A;  3CVY A;  4A1S A;  2CG3 A;  5BW8 C;  3R9A B;  3S7F A;  2KCK A;  4MKT A;  4TRQ A;  1E8X A;  3ESL A;  4PS7 A;  2LAH A;  3ZW3 A;  2I6H A;  3ENE A;  3ULQ A;  4C9B B;  5BUZ A;  4DI4 A;  3U3W A;  2LO6 A;  2VQ2 A;  3GZ1 A;  3FP3 A;  2RD0 A;  2UWJ G;  3D9O A;  3QKY A;  5LCW C;  4UQY A;  3URZ A;  2ILR A;  4GZC A;  2X3M A;  3CVU A;  2PQN A;  2KM4 A;  2XHE A;  2XQ0 A;  4ACL A;  1UN9 A;  2R59 A;  4GZ6 A;  4BWR A;  2VGY A;  3SF4 A;  3Q4A B;  2P58 C;  2HR2 A;  1DVP A;  3LJ3 A;  2VTB A;  2JLB A;  3RKV A;  4CDM A;  2YNQ A;  2I9C A;  5J90 A;  2L0T B;  1XNF A;  1TJC A;  4JEH A;  4UWK A;  4J6I A;  4OVU A;  3L54 A;  4ACK A;  4FA6 A;  1KT0 A;  2UY1 A;  3IV0 A;  3CHP A;  4GYO A;  5AEN A;  4N2Q A;  5DIZ A;  3CK8 A;  3ZHE A;  3HVE A;  5FQ7 A;  1ZBP A;  5JJ6 A;  3KEZ A;  3L16 A;  5JHB A;  3MEK A;  3SHF A;  2WXJ A;  4XKC A;  3MA5 A;  4F1S A;  4GZ3 A;  4JEU A;  4J8D A;  2J4D A;  4JPS A;  4BX9 A;  4EEC A;  5JJT A;  2EQX A;  2WXP A;  3FHE A;  3L13 A;  2WPV A;  3CHM A;  5G55 A;  4ANW A;  1SZA A;  2IU1 A;  2XPY A;  3Q47 B;  4CDN A;  4GA0 A;  2RG8 A;  4GA2 A;  2GGF A;  3EDT B;  2WXG A;  4LER A;  3SNX A;  4HOU A;  4F3V A;  3FUI A;  3S7D A;  1EYH A;  3RRM B;  3AU4 A;  1MQS A;  3I5P A;  2DBA A;  4CRW A;  2CG2 A;  3IHY A;  4KVM A;  1HH8 A;  5FZQ A;  3QNK A;  4I1A A;  3FU6 A;  3T5V A;  3JQ0 A;  3CHR A;  4WUY A;  1ELK A;  4BTA A;  2IOL A;  3OXG A;  4L23 A;  4XE0 A;  2MOW A;  4PDX A;  2LNI A;  2VGX B;  4XIF A;  1IQU A;  4GU5 A;  3FUJ A;  3CSF A;  2PM7 A;  3L6A A;  5CMW A;  3MKR A;  4E85 A;  5G05 C;  1GW6 A;  4AY6 A;  3S2A A;  3ESK A;  2ZU6 B;  5D0O D;  3PS6 A;  2XCB A;  2AXZ A;  1EDU A;  2WM9 A;  3PH0 C;  3FY4 A;  2Q7F A;  3GYZ A;  4HFG A;  3RO2 A;  4FHK A;  4ABN A;  2OV8 A;  4AV7 A;  3LPZ A;  4I9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...