1MHQA

Crystal structure of human gga2 vhs domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
SLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GGA2 VHS domain and its implication in plasticity in the ligand binding pocket
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA2
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1mhqA00
4NACA 1JUQA 1HG2A 1SZ9A 1VDYA 3CLJA 3D9JA 3RRUA 2MOWA 1JWFA 1HG5A 3D9PA 3ONKA 3ZYKA 1HF8A 1LF8A 1ELKA 4JXTA 2DIWA 3G2WA 4GZCA 1JPLA 3D9KA 4GZDA 2BF0X 3D9IA 1DVPA 4FLBA 5CMWA 1UJKA 3D9NA 4HFGA 1EYHA 1XGWA 3D9MA 1HFAA 1H0AA 1UJJA 2V8SE 3D9LA 1HX8A 4FU3A 3G2SA 1EDUA 3G2UA 5LP0A 5CMYA 1SZAA 5LOZA 1X5BA 2L0TB 1MHQA 3G2TA 2DCPA 3ZYLA 4AVXA 3ZYMA 3D9OA 1INZA 3ZYQA 2QY7A 3G2VA 1JWGA 2L0IA 5J08A 4Q96A 2LO6A 1PY1A 2KM4A 3LDZA 3ONLA 4Q94A
chains in the Genus database with same CATH superfamily
2DYSE 3D9JA 3LJ3A 3ONKA 2YNQA 4EPZA 3CHRA 5CMWA 3FULA 3KEAA 4ACKA 3TGOA 4HI9A 5CEAA 1H0AA 3CHOA 4I1OB 1QNFA 4J7WA 3CHMA 4OAVB 4BWRA 5KNGA 1SA5A 4GTVA 2ETBA 4URKA 5ENSD 4DX1A 4B8CB 3V31A 1OCCE 4IULA 4GA2A 2PQRA 3NZSA 1XGWA 2XCCA 1LD7A 1FPPA 3R9AB 3SFXA 2P9NG 2H6FA 2QC9A 4MS6A 2KXPC 5CERB 2OV8A 1IQUA 3HDXA 4QQIA 3AS8A 4YDEA 3PREA 4GTMA 2PM6A 4UWGA 3UM0A 2P9IG 3ZUVB 4BSZB 4LEUA 3MV3B 3IKOB 3FH8A 3CHQA 3EU5A 3FHEA 2WXQA 4MLPA 1U2VG 3Q7FA 4K5BA 3D9IA 4J8DA 3FDHA 1EYHA 3FU3A 5CEDB 1NFIE 2XENA 3SQVA 4L1BA 3N71A 3RJVA 3ZRHA 4BT9A 5B3SE 2DVWA 4BX9A 5H7PA 5EN5D 2ETCA 4N3BA 3GZ1A 4AEZC 2GW1A 4ILIA 4BEPA 4DK5A 3NAWA 3CKBA 4A3TA 4Q96A 2X38A 3AAAC 4UQYA 2I6HA 3J5QB 2WXLA 4XEIG 4HBDA 1ZBPA 5BW8C 2EIJE 4WUYA 3GYZA 5LP0A 4FHJA 4G8LA 3SNXA 3HXBA 2F8YA 1DCQA 3FH7A 2OVBA 1Z5SC 4FHKA 4E6HA 4TUUA 4CCAA 2CG2A 2XQ0A 1N94A 3S7FA 3V2XA 3DRAA 3PNLB 1H2UA 4U95D 4EBAG 1OWLA 3FU0A 3ZN3A 4JHRA 4EECA 1Q2ZA 4G8KA 3URZA 3ABKE 5JJ7A 3B7TA 4WNFA 4CDNA 2AXVA 3AG1E 4GYYA 5AENA 3JXJA 2XGSA 1S64A 3C3RA 3UT8A 3OXGA 1U3CA 1S63A 3VLEA 3UM1A 4GPKA 1KZPA 3CK7A 4HI8A 3RRNB 5JJ6A 4GA0A 3BG1B 3ASGA 2X6KA 3MA5A 4AXHA 3WXXA 3T8MA 2DWZA 4PS7A 4UI9C 2M63A 5CBNA 2P9UG 4BSXA 4YDOA 5AQAA 1HZ4A 4PDXA 1MX2A 3WG7E 5A7DB 1WY6A 2XS8A 4JL0A 4NACA 1JUQA 5FQ7A 1HG5A 3AJIA 1ELKA 2WVIA 2EIME 2XPZA 2IO3C 4ANXA 1DVPA 4TUMA 3CEQA 4FC8A 1E8XA 4BTAA 2JABA 1EF1C 4FLHA 4I9CA 2JLBA 1NL4A 4XX5A 5EIBE 2X6HA 2WXJA 3K9IA 3RKVA 2BEDA 1MYOA 3Q78A 1E8WA 4UQZA 4OVUA 2ILRA 4B94A 4HOUA 3FTZA 2J9QA 4U7EB 1UOHA 2AJAA 2L0IA 5BV0A 3IBEA 4I6GA 2P9SG 4YVOA 2LAIA 2EILE 2RFAA 3CVWA 4F7AA 1OXJA 3Q49B 3G2SA 2L0TB 1SA4A 5C1DA 1H2VC 2FO1E 1K3ZD 2HR2A 1H19A 4GTSA 1LF8A 2CFZA 4TXPA 3JUIA 4KXKB 3MYVA 3PH0C 4ACLA 3D9LA 1HE8A 1G3NB 2YHEA 3DPDA 1E90A 2IOSA 3QK0A 4HRNA 5FQ6A 3Q15A 3S7BA 3F6QA 1IQRA 2H6IA 4I43A 4GB9A 2LAHA 4ZHBA 3FTSA 3LS8A 1MX4A 3MX3A 2KBXA 5FWQA 5FZRA 5E75A 2I2OA 1OY3D 2NSZA 2BKKB 5FJYA 3TWSA 3CVXA 1FVFA 4KMOA 4W9RA 1OWMA 5JA4D 2XEEA 3ZU7B 4MKTA 4U8HA 2WXNA 2YHCA 3KSLA 2WXPA 2ZXWE 3VTXA 2RD0A 4D10C 3HRAA 4GZCA 3OTNA 3HHMA 5T8IA 4Q69A 4J6IA 3DSVA 3UXGA 2QYJA 5HS0A 3X2QE 4RSYA 4BFRA 2HE0A 4UWLA 1D8EA 3RRMB 3I5PA 1NZNA 3QWPA 2Y69E 2AWIA 4C0MA 3DWLG 3PE4A 4PS3A 3ASHA 1V55E 4N2QA 4IRUA 3E4BA 1WM5A 4GZDA 5FQ8A 3L54A 1O5MA 1KZOA 3LPZA 4GMLA 4BY6A 3FUMA 4YNDA 5AYWD 3TG4A 2QZAA 1Z6TA 2GROB 3MV2B 3MCXA 2OOEA 4LCTA 2H6GA 4GMJA 3AU4A 3W9FA 1OWNA 3E33A 3ZNGA 5G04J 4JZYA 2VTBB 2WB2A 1TNZA 2GGFA 2L6JA 4GYWA 2WQ7A 3SY2A 4QFVA 1O1SA 3ESLA 2V5QC 4LNGA 4U07A 3DXKG 3Q75A 4C9BB 2PL2A 1KT0A 4XIFA 2DCPA 2J4BA 1YMPA 4AV7A 3MKQB 2ZISA 4GCOA 4U0UA 2KM4A 3CLJA 3EJNA 3U64A 4BESA 1IXVA 2QFCA 5BV1A 3U3WA 2I9CA 3CVQA 4MRUA 3Q47B 4BETA 3HVEB 1N54A 2R59A 3FP3A 3RK6A 2IF4A 1KPSB 3FTXA 4CGWA 3ASNE 3ZIMA 3T5XA 4WNDA 3QNKA 3HXDA 3BG0B 5HRYA 3ZXPA 5HKPA 2VSYA 1WDYA 3UIPC 5BXOA 1TYQG 5ITZF 5ARFA 3C72A 1MX6A 3Q5MA 1OWPA 4Q94A 3UX4A 3RO2A 4UWFA 4DJAA 5ENRD 2WMNA 4GCNA 3BU8A 1NI1A 5DBKA 3UKRG 4EBAA 3IEGA 1E8ZA 2CHXA 2XS1A 2J4DA 4LG6A 3E34A 4G24A 5CRUA 3KEZA 4O6FA 3CIAA 3QKYA 5AJDA 3CQCB 2Q7FA 1V54E 3LEWA 5JHAA 2XRZA 2GRMA 4M7CA 3FFLA 5BPPA 3APCA 3FTWA 5G05C 2GRPB 1L5JA 4J8YA 4FJZA 2WXKA 4BX8A 5J90A 5CRVA 5ANRA 5AARA 1QQEA 1HX8A 1N0QA 1RW2A 4N39A 5G2NA 3ZKJA 4B8AA 3HXFA 3QARA 1RZ4A 3SF4A 2XGOA 1HG2A 3DEOA 4RQIA 4F1PA 2WXGA 2FEZA 4JXTA 1UW4B 3BEEA 4APOA 3S7JA 2VTBA 2R02A 1H6KA 3E32A 2V5FA 4G11A 4ME2A 3CSFA 3Q9UC 3QDNA 4CRWA 2VYIA 5EYPF 1FT1A 4I9EA 2VSOE 5FZSA 4I1MA 3RAUA 2WM9A 3PEUB 3UTMA 3TL5A 3NB2A 3QAQA 5FQ4A 4KT6B 2IFUA 2H6HA 3OAWA 4Y6WA 3NOCD 2J8SD 2L6BA 5ENTD 4HLLA 1DNPA 1WAO1 2UY1B 5D66A 2VSXE 2WMOA 1IKND 4F3VA 4K5AB 3ONLA 4HQDA 5KJNA 3AG4E 3Q79A 5AAOA 5AIJA 2A5EA 4I2WA 4NURA 4UI9K 2DZNA 2AXZA 1X81A 4BT8A 5BT1A 3ZYLA 4R7LA 4LNUD 3MZLB 2KZTB 4ATZD 2MRIA 5DIZA 4EHMA 4KZCA 3HXCA 3C5RA 4UQXA 5C2YA 2R5SA 3FUEA 4EQFA 1D8DA 4HOQA 4UWKA 4PH4B 4AOFA 2Y0BG 2A5UA 3EHQA 1TJFA 4HNAD 3CK8A 5EX0A 3AS4A 1PAQA 4YVQC 3D9NA 3NZUA 2RKKA 4GZ6A 1H6PA 2B0OE 5JMND 1TEZA 1KLXA 4G1TA 4DI3A 3W9GA 4JEUA 3FU6A 1ELRA 4FULA 3ZYMA 1H2TC 4K5CA 1WG0A 1N4QA 1YA0A 2WXOA 2XEHA 3IXEA 1K8KG 3EHRA 3SBSA 5LOZA 3ABLE 3LY9A 4DI4A 3UKUG 2QY7A 3SFYA 4DX7D 3JXIA 1TNUA 2WXHA 3RU0A 4I2ZA 4CEMA 2XZTG 3JYSA 3CK9A 4HFGA 1SQMA 4UI9J 4G2VA 3AU5A 4GYOA 4GAAA 3E30A 3FTUA 4B93B 2PQNA 3FU5A 4HLEA 4E85A 2KCLA 3ABME 3IHYA 5KCMA 2V8SE 3L6AA 3DSSA 3CGHA 3MKQA 3Q9NC 3NF1A 4GTTA 3KSQA 2OEWA 3D9HA 2VGEA 2IU1A 3G2VA 3ZVVA 1HO8A 3LDZA 1VDYA 4U8YD 3KS2A 4LUNU 2MYOA 4H7YA 3ESKA 2IJGX 1DCEA 3QWVA 1UJKA 5EKQD 3FUHA 4U63A 3TWTA 3C3OA 4GU5A 4ATGA 1SVXA 3AS5A 3RSEG 3EHMA 2GRRB 1MZCA 3I4GA 2WXIA 1HF8A 4HOSA 3LVQE 4AM9A 2BF0X 4A3VA 3TG5A 3D9MA 3I4RB 5KNHD 4CT0A 5LCWC 4C48B 5G05J 4DX6D 3FWVA 4AP2A 3PRZA 1ZU2A 4BTBA 4M3OA 1YYHA 5EDSA 3FUJA 3HXEA 2FI7A 5EYLA 4KVMA 3IV0A 3BQOA 3QB2A 1JWGA 1O1TA 4B89A 1N4PA 4WAFA 5HI7A 2XPYA 2L9BA 1JCSA 2CFUA 3MGBA 1TNBA 3EHNA 4BERA 3FEYA 4KVOA 5BNWA 2IOLA 4RVBA 4GTPA 3ZFWA 1NA3A 2IY0C 2EIKE 3FUKA 5A23A 3PZDA 3EIJA 1FVHA 3CVLA 4N5CA 4GA1A 3CHPA 4WNEA 5ENNA 3FY4A 5BUZA 5KBAA 1FCHA 4YDWA 2P9KG 4XZ4A 3KAEA 3MJWA 2X6FA 4JA9A 2MHKA 1DC2A 3FEXA 3ZYKA 4HB5A 5B1BE 5KJLA 2R17C 4EZLA 5KJKA 5FZQA 4MBGA 1K1BA 2J49A 2P2CP 3G2UA 5IY5E 4WNGA 1AWCB 2BTDA 3PEVB 4KBQA 1E96B 4G26A 4EZJA 1N9AA 2BKGA 4RLYA 3D9PA 5CCLA 5KJMA 4DUIA 2A4ZA 2WXMA 3FUDA 3UI2A 4FA6A 2VJ8A 3C98A 1BD8A 5AQ9A 4JHKA 4F6RD 4DLOA 1MJ0A 4HS2A 4ILGA 3O48A 4OYSA 2Y4TA 1TJCA 4JHJA 3CSTA 2P9LG 2B6CA 1U3DA 3LY8A 2UWJG 4I17A 5EX3A 4XE0A 1N4SA 2XZDG 3DPYA 1P5QA 5B1AE 4NIKA 3UINC 4FJYA 4AY5A 3UM2A 2F8XK 3Q7AA 3LKUA 4I6EA 2IQCA 3HIZA 3EUVA 2WXFA 5EIDA 1N95A 3UM3A 1BPOA 4GPMA 4AY6A 2E2EA 5CCMA 4DPRA 3TWUA 1A17A 1XNFA 2LXLA 4FLBA 4OVVA 4OAUC 1H6OA 3QJZA 3JCKC 2R2LA 4HORA 2P9PG 4JEHA 2IEJA 1BI8B 5E76A 2KZTA 3NOGD 4TXQA 2GRLA 2CHZA 2LUHA 3DSTA 3DBSA 1IYGA 4APFA 4O1OA 4DRXE 4YDYA 4CDRA 1JCQA 3FUFA 4HRLA 4RG9A 4C0EA 3SGHA 1Z3YA 2XCBA 2FBNA 1QZ2A 4N5QA 3PUKA 2FULA 3UUXA 2C2LA 3LCAA 4GTRA 4TV3A 1HS6A 3ZHEA 5AQBA 2VGYA 4L9PA 3TXMA 3JQ0A 5ENQD 3ASFA 1YCSB 3ENEA 2V4LA 4A63B 4XKCA 3NQPA 2X6JA 1OCZE 2Y4UA 1N11A 3UPVA 2ONDA 5KWDA 3PDNA 1HU3A 4L2LA 3L22A 4WWNA 4JC8A 2X3MA 2J07A 2UY1A 1N52A 2RG8A 4WWPA 4ILHB 3EIQC 2GRQB 2AXUA 2YINA 3FH5A 2NXPA 3R9MA 2NYJA 1ZB1A 2ZGGA 2LSUA 1E7VA 1OCOE 3L08A 3SD5A 2Y1LE 3IHVA 1X5BA 2C0MA 3U4TA 2XEVA 2ZGDA 1INZA 3ZYQA 1UN8A 2LO6A 3RO3A 3UIOC 3T5VA 1OWOA 3CVPA 4GTOA 3FUNA 5FIOA 4CDMA 3I3NA 4DLQA 2JEKA 3R7QA 1EPUA 2PNNA 3ZEFA 1BI7B 1Z3XA 4NQ0A 2LNIA 4KZ0A 1UG3A 4O60A 1O1RA 5ENPD 2WXRA 4JPSA 3E37A 2R03A 4G23A 2HM8A 3S7DA 4A1SA 4JD2G 2GRNB 4N2SA 4U0ZA 3PVLA 5AN8A 3TWWA 2AW6A 4HOTA 4A55A 3R7RA 3ZHEB 5CHEE 5CMYA 1UN9A 3QOUA 3L16A 2V4HC 3CHSA 5G55A 5JJTA 3SZ7A 2EINE 3TAXA 2CHWA 4WWOA 1NA0A 5AJLA 5CBOA 3TWXA 4Z68A 2OVFA 5FT9A 3SO8A 1TR4A 3QWWA 3TJPA 3SHFA 4CZ2D 5FINA 1N4RA 2VSNA 2FF4A 4F53A 2I1JA 3PUJA 5ARGA 4GMRA 1JCRA 1MQSA 4B0ZA 4HVBA 4AVXA 1E7UA 4FP7A 1QBQA 1IHGA 1Y8MA 3ML8A 2DYRE 1BLXB 3P1UA 1JWFA 3P2BA 5AQ7A 2F37A 1OCRE 3LYAA 3B95A 3PZ2A 2XHEA 4FU3A 5LX8A 2OEVA 2FO7A 3ULQA 1NP7A 1MHQA 5BXUA 3ML9A 5LFAA 3B7SA 5ENOD 5CECB 3RIBA 2DIWA 3D3MA 4LERA 3UQ3A 2P58C 2PZIA 3C3QA 3T8KA 3L17A 3B7BA 3HG0D 4U96D 1TN7A 4O1PA 2KCVA 4HRMB 3RRUA 4HXIA 3UMVA 1TN8A 3SI5A 2KATA 1JPLA 3D9KA 3GW4A 1LTXA 1IHBA 4I6JA 2X6IA 5A6CA 3V79K 4N3CA 5JHBA 4V3IA 4L23A 4ANUA 2WQ6A 4GZ3A 3GZSA 2C0LA 1HXIA 4JB8P 1SZ9A 2I1KA 4LNBA 4F1SA 3VLDA 1TNOA 3ULYA 1ELWA 4G25A 3O4ZA 3VLFA 4N3AA 4EZKA 3DSUA 3PS6A 3CVNA 3JUEA 4U8VD 3L13A 1PC2A 4CGVA 2BUGA 4NRHB 3CQGB 4FADA 3CKCA 1PY1A 3HYMB 4X8QA 4L2YA 4ANWA 3SFZA 3Q4AB 4DX2A 4PUCA 2E0IA 1GW6A 4JW1A 5HQ8A 4CT4A 1S70B 2J09A 3ULEG 1KT1A 2XRYA 4KYOB 4I1AA 3VTYA 4H7XA 5D0OD 2DBAA 1BU9A 2R05A 2EQXA 2PM7A 3ZXSA 3B7RL 3TWVA 2VGXB 3CV0A 2HYZA 4LRZA 4J8FA 3D9OA 3BUAA 3B7UX 5FTPA 3ZPJA 2YQ8A 5EILA 5T3RA 5G04C 2LXMA 4UUCA 1QYMA 3CVVA 2WPVA 4GTQA 5ANLA 4ANVA 3DEPA 2ZIRA 1SZAA 3U66A 3LJNA 2CG3A 4RG6A 3JQ1A 2RFMA 5J08A 2OCCE 1S0PA 3ASDA 1TN6A 2MOWA 3QC1A 3KD7A 2AVPA 3Q73A 2V0PA 1N0RA 2VQ2A 2ETAA 4XI0A 2DZOA 4UWHA 5T4YA 4TXRA 3B13A 2F0YA 1W3BA 1A5EA 1LD8A 3LXUX 1AP7A 3V2OA 3OXFA 4CYMD 4AIFA 2WQHA 3LY7A 3SBTB 3PZ1A 2XGMA 3UT4A 3S2AA 4J8EA 3PZ3A 3PNTB 4K0RA 4XKBA 2IO2C 3ASOE 4ZFHA 3FTYA 3V30A 2KCKA 2IONA 3GZ2A 3MEKA 1HFAA 5LCWJ 1EDUA 2ZU6B 3CVYA 3T9KA 3ZGQA 3APDA 1E8YA 4J0UA 3MKRA 2QYUA 4A1GA 3L82A 3EDTB 4DX5D 5D2MC 1FT2A 4U0SA 1Y6IA 1TNYA 3TWRA 4JA7A 3AG3E 4P29A 3EU9A 3LVRE 3ZW3A 4Y6CA 3G2TA 2XPIA 2VGXA 3U9WA 4LSZE 4IN3B 4L7TA 3G2WA 4ABNA 5D0QD 4TRQA 1B89A 1OT8A 3CR3A 3J5PA 3FUIA 1UJJA 2Y3AA 2LSVA 3DXMG 4JVSA 3UT7A 3APFA 5M72A 3ISMC 3OXLA 3HVEA 4IYPA 4AJWA 1D9SA 4U04A 2J08A 1OUVA 4K03A 3FTVA 3AG2E 3TWQA 1K1AA 2HO1A 4XI9A 2KC7A 3NBNB 4PS8A 4GZ5A 3DSXA 3L9TA 3DSWA 3CVUA 3PE3A 3PZ4A 4J8SA 1SW6A 2NC9A 3TXNA 1HH8A
chains in the Genus database with same CATH topology
3S7DA 4A1SA 1VDYA 3D9JA 3KS2A 3LJ3A 3RRMB 4N2SA 3ONKA 4LUNU 4U0ZA 3I5PA 1NZNA 3PVLA 3QWPA 4H7YA 2YNQA 2AW6A 3ESKA 4EPZA 2AWIA 2IJGX 4HOTA 3CHRA 3QWVA 4C0MA 5CMWA 3FULA 3PE4A 1UJKA 4ACKA 3TGOA 4A55A 1H0AA 3CHOA 4I1OB 4PS3A 3R7RA 3ZHEB 3ASHA 5CHEE 5EKQD 3FUHA 4U63A 5CMYA 4GU5A 4ATGA 4N2QA 4IRUA 1UN9A 3QOUA 3E4BA 3AS5A 3L16A 1WM5A 1QNFA 3EHMA 3CHMA 3CHSA 5G55A 5JJTA 3I4GA 3SZ7A 4BWRA 2WXIA 4GZDA 5FQ8A 3TAXA 2CHWA 4WWOA 1NA0A 3L54A 5AJLA 4URKA 1HF8A 4B8CB 3LPZA 4IULA 4HOSA 3LVQE 4GMLA 4GA2A 4BY6A 4AM9A 2BF0X 3FUMA 4YNDA 5AYWD 2PQRA 4A3VA 3TG4A 3NZSA 3TG5A 1XGWA 3D9MA 1Z6TA 3I4RB 4CT0A 5LCWC 2XCCA 3MCXA 3MV2B 2OOEA 3R9AB 4LCTA 5G05J 4GMJA 3FWVA 4AP2A 3PRZA 3AU4A 1ZU2A 2OVFA 4BTBA 4M3OA 5FT9A 1OWNA 4MS6A 5G04J 4JZYA 2VTBB 3QWWA 2WB2A 2OV8A 2GGFA 1IQUA 2L6JA 4GYWA 3SHFA 3TJPA 2WQ7A 3HDXA 5EDSA 2VSNA 4QFVA 3AS8A 2FF4A 4F53A 2I1JA 3FUJA 3ESLA 3PUJA 3PREA 5ARGA 4U07A 2FI7A 2PM6A 4UWGA 1MQSA 4KVMA 2PL2A 4C9BB 4B0ZA 1KT0A 4XIFA 4HVBA 4AVXA 2DCPA 4LEUA 1E7UA 2J4BA 3IV0A 4AV7A 3QB2A 4FP7A 1JWGA 3MKQB 1IHGA 3MV3B 4GCOA 4U0UA 2KM4A 3IKOB 4B89A 1Y8MA 3FH8A 3CHQA 3CLJA 3FHEA 3ML8A 2WXQA 3P1UA 1JWFA 4MLPA 4WAFA 3EJNA 3P2BA 3U64A 3LYAA 5HI7A 2QFCA 3D9IA 2XPYA 4J8DA 5BV1A 3FDHA 1EYHA 2L9BA 2I9CA 3CVQA 3FU3A 2CFUA 3Q47B 2XHEA 3MGBA 4MRUA 4FU3A 3HVEB 3EHNA 5LX8A 1N54A 2FO7A 3ULQA 2R59A 4L1BA 3FP3A 3FEYA 3RK6A 4KVOA 5BNWA 1NP7A 2IF4A 2IOLA 1MHQA 4RVBA 3ML9A 5LFAA 3FTXA 3N71A 3RJVA 3ZFWA 4CGWA 3ZRHA 1NA3A 3FUKA 5A23A 4BT9A 3PZDA 3ZIMA 4BX9A 3B7SA 3EIJA 3T5XA 1FVHA 3CVLA 4N5CA 4WNDA 3QNKA 4GA1A 3RIBA 3CHPA 2DIWA 3BG0B 3D3MA 2VSYA 4N3BA 4WNEA 4LERA 3GZ1A 4UWLA 5ENNA 2P58C 3UQ3A 4AEZC 3FY4A 5BUZA 2PZIA 2GW1A 1FCHA 4ILIA 4DK5A 3L17A 4XZ4A 3KAEA 5ARFA 3MJWA 3CKBA 2X6FA 4A3TA 4Q96A 4JA9A 2KCVA 3Q5MA 1OWPA 2X38A 4Q94A 2MHKA 3UX4A 3RRUA 4HXIA 3UMVA 4UQYA 2I6HA 3RO2A 4UWFA 3FEXA 3ZYKA 3SI5A 4DJAA 2WXLA 2KATA 2WMNA 1JPLA 4GCNA 3D9KA 5KJLA 5DBKA 4EBAA 1ZBPA 2R17C 3GW4A 3IEGA 5BW8C 1E8ZA 2CHXA 4EZLA 4WUYA 5KJKA 5FZQA 4I6JA 2J4DA 3GYZA 3G2UA 2J49A 5LP0A 2X6IA 5A6CA 4N3CA 3U3WA 5JHBA 4WNGA 4G24A 2BTDA 4V3IA 3KEZA 3PEVB 4FHJA 4KBQA 4L23A 4ANUA 2WQ6A 4GZ3A 3GZSA 4O6FA 3SNXA 3CIAA 1E96B 2C0LA 4G26A 3QKYA 5AJDA 1HXIA 4EZJA 1SZ9A 3CQCB 2I1KA 3D9PA 2Q7FA 5CCLA 3FH7A 3LEWA 4F1SA 2OVBA 3VLDA 4FHKA 5KJMA 4E6HA 4TUUA 4CCAA 5JHAA 2CG2A 2XQ0A 2XRZA 3S7FA 2GRMA 2A4ZA 1ELWA 3FFLA 4G25A 3PNLB 1H2UA 3O4ZA 2WXMA 3FUDA 3VLFA 4EBAG 4N3AA 4FA6A 1OWLA 5BPPA 2VJ8A 3APCA 3FU0A 3ZN3A 4EZKA 3PS6A 4JHRA 4EECA 3C98A 3CVNA 3FTWA 3URZA 3L13A 1PC2A 4JHKA 5JJ7A 5G05C 4CGVA 2BUGA 4NRHB 3CQGB 4FADA 1L5JA 3B7TA 3CKCA 4WNFA 2AXVA 4CDNA 4DLOA 1PY1A 3HYMB 4L2YA 4FJZA 4GYYA 4ANWA 4HS2A 5AENA 2WXKA 4BX8A 4ILGA 3SFZA 2XGSA 3Q4AB 5J90A 3O48A 4PUCA 4OYSA 3UT8A 3OXGA 1U3CA 2E0IA 2Y4TA 1GW6A 4JW1A 3VLEA 5ANRA 1TJCA 5HQ8A 1QQEA 4GPKA 4JHJA 1HX8A 4CT4A 3CSTA 2J09A 3CK7A 4N39A 1KT1A 5G2NA 3RRNB 2XRYA 4KYOB 1U3DA 5JJ6A 4GA0A 4B8AA 3BG1B 3QARA 3ASGA 3SF4A 3LY8A 2UWJG 4I17A 5EX3A 4XE0A 2XGOA 1HG2A 1P5QA 4I1AA 3VTYA 2X6KA 4H7XA 2WXGA 3MA5A 2FEZA 4FJYA 4JXTA 5D0OD 1UW4B 2DBAA 4AXHA 4AY5A 3WXXA 3T8MA 3BEEA 4PS7A 4APOA 3S7JA 2EQXA 2PM7A 3LKUA 3ZXSA 2VTBA 4I6EA 1H6KA 2IQCA 3B7RL 2M63A 3HIZA 4UI9C 4BSXA 2VGXB 2V5FA 3CV0A 2HYZA 4G11A 4ME2A 2WXFA 4LRZA 3CSFA 1HZ4A 4J8FA 3D9OA 3B7UX 1BPOA 3QDNA 5FTPA 4PDXA 3ZPJA 4CRWA 5A7DB 2YQ8A 5T3RA 1WY6A 2VYIA 2E2EA 5G04C 4AY6A 5CCMA 4DPRA 4JL0A 4NACA 1JUQA 4I9EA 5FQ7A 2VSOE 1HG5A 5FZSA 4I1MA 3CVVA 1A17A 2WPVA 1ELKA 2WVIA 2XPZA 1XNFA 5ANLA 2WM9A 3PEUB 4ANVA 3TL5A 4ANXA 1DVPA 3QAQA 4FLBA 4OVVA 5FQ4A 4KT6B 2IFUA 3CEQA 4FC8A 3OAWA 4Y6WA 1E8XA 3QJZA 4BTAA 1SZAA 3U66A 1EF1C 1DNPA 3JCKC 4FLHA 4I9CA 2JLBA 4HORA 1WAO1 2CG3A 4JEHA 2UY1B 4RG6A 2VSXE 2WMOA 3JQ1A 5J08A 5E76A 4F3VA 4XX5A 1S0PA 3ASDA 3ONLA 2KZTA 2X6HA 2WXJA 2MOWA 3K9IA 5KJNA 2GRLA 3RKVA 3QC1A 2CHZA 3KD7A 5AIJA 1E8WA 4UQZA 2AVPA 4I2WA 2V0PA 2VQ2A 2ILRA 3DBSA 4NURA 4OVUA 4HOUA 4UI9K 4XI0A 4B94A 3FTZA 4UWHA 5T4YA 2AXZA 2J9QA 4BT8A 1IYGA 5BT1A 3ZYLA 4R7LA 4APFA 3B13A 2L0IA 3MZLB 2KZTB 5BV0A 1W3BA 2MRIA 3IBEA 4I6GA 3LXUX 5DIZA 4CDRA 4YVOA 3FUFA 4KZCA 4RG9A 2LAIA 4C0EA 3OXFA 3SGHA 4UQXA 1Z3YA 2XCBA 3CVWA 2FBNA 4F7AA 3Q49B 1QZ2A 3G2SA 2R5SA 5C2YA 4AIFA 3FUEA 2WQHA 4EQFA 4HOQA 3LY7A 3PUKA 2L0TB 3SBTB 4UWKA 2FULA 3UUXA 4PH4B 2C2LA 4AOFA 3LCAA 4TV3A 2A5UA 2XGMA 3UT4A 5C1DA 1H2VC 1HS6A 3ZHEA 2HR2A 2VGYA 1H19A 3S2AA 4J8EA 3JQ0A 3TXMA 1TJFA 3ASFA 3PNTB 1LF8A 4K0RA 3ENEA 4XKBA 3CK8A 5EX0A 2V4LA 3AS4A 2CFZA 3JUIA 4KXKB 3FTYA 3MYVA 2KCKA 1PAQA 3NQPA 4XKCA 2IONA 4YVQC 3D9NA 3GZ2A 3NZUA 3MEKA 1HFAA 3PH0C 4ACLA 2X6JA 3D9LA 4GZ6A 5LCWJ 1HE8A 1EDUA 2ZU6B 2Y4UA 3CVYA 3UPVA 1TEZA 1KLXA 2YHEA 3DPDA 3ZGQA 1E90A 3APDA 4G1TA 1E8YA 2IOSA 4DI3A 3QK0A 2ONDA 5FQ6A 3Q15A 4J0UA 4JEUA 1IQRA 3PDNA 3S7BA 3MKRA 1HU3A 1ELRA 3FU6A 4L2LA 4A1GA 4FULA 3ZYMA 4I43A 4GB9A 3L22A 1H2TC 2LAHA 3EDTB 4WWNA 3FTSA 3LS8A 4JC8A 2X3MA 2J07A 2UY1A 1N52A 2RG8A 4WWPA 1YA0A 2WXOA 3MX3A 4ILHB 4U0SA 3EIQC 1Y6IA 3SBSA 5LOZA 4JA7A 4P29A 2AXUA 3LVRE 3ZW3A 3LY9A 2YINA 4Y6CA 3FH5A 3G2TA 5FWQA 4DI4A 2NXPA 2XPIA 5FZRA 2QY7A 5E75A 2VGXA 2I2OA 2NSZA 3U9WA 5FJYA 4IN3B 2WXHA 3RU0A 4I2ZA 4CEMA 4L7TA 3CVXA 1FVFA 3G2WA 2LSUA 3JYSA 4KMOA 1E7VA 4W9RA 4ABNA 1OWMA 3CK9A 4TRQA 5D0QD 1B89A 3SD5A 3L08A 4HFGA 3CR3A 4MKTA 3FUIA 1SQMA 3IHVA 1UJJA 4U8HA 2Y3AA 4UI9J 2LSVA 4JVSA 4G2VA 2WXNA 3UT7A 2YHCA 3AU5A 1X5BA 2WXPA 2C0MA 4GYOA 3VTXA 3APFA 4GAAA 3U4TA 2XEVA 5M72A 1INZA 3ZYQA 2RD0A 3FTUA 3OXLA 1UN8A 2LO6A 3HVEA 4IYPA 3RO3A 4AJWA 4D10C 2PQNA 4GZCA 1OWOA 2J08A 3CVPA 4U04A 3T5VA 1OUVA 3FUNA 4CDMA 3FU5A 3I3NA 4K03A 3FTVA 2JEKA 4DLQA 4E85A 4HLEA 3R7QA 1EPUA 2KCLA 3OTNA 3HHMA 3IHYA 2HO1A 5T8IA 3ZEFA 5KCMA 4XI9A 2KC7A 2V8SE 3L6AA 4Q69A 1Z3XA 4J6IA 4PS8A 4GZ5A 4NQ0A 3CGHA 3MKQA 2LNIA 3NF1A 4KZ0A 1UG3A 4RSYA 4BFRA 2IU1A 3CVUA 3G2VA 3PE3A 3ZVVA 2WXRA 1HO8A 4J8SA 4JPSA 2NC9A 4G23A 3TXNA 2HM8A 3LDZA 1HH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAC A;  1JUQ A;  1HG2 A;  1SZ9 A;  1VDY A;  3CLJ A;  3D9J A;  3RRU A;  2MOW A;  1JWF A;  1HG5 A;  3D9P A;  3ONK A;  3ZYK A;  1HF8 A;  1LF8 A;  1ELK A;  4JXT A;  2DIW A;  3G2W A;  4GZC A;  1JPL A;  3D9K A;  4GZD A;  2BF0 X;  3D9I A;  1DVP A;  4FLB A;  5CMW A;  1UJK A;  3D9N A;  4HFG A;  1EYH A;  1XGW A;  3D9M A;  1HFA A;  1H0A A;  1UJJ A;  2V8S E;  3D9L A;  1HX8 A;  4FU3 A;  3G2S A;  1EDU A;  3G2U A;  5LP0 A;  5CMY A;  1SZA A;  5LOZ A;  1X5B A;  2L0T B;  1MHQ A;  3G2T A;  2DCP A;  3ZYL A;  4AVX A;  3ZYM A;  3D9O A;  1INZ A;  3ZYQ A;  2QY7 A;  3G2V A;  1JWG A;  2L0I A;  5J08 A;  4Q96 A;  2LO6 A;  1PY1 A;  2KM4 A;  3LDZ A;  3ONL A;  4Q94 A; 
#chains in the Genus database with same CATH topology
 2DYS E;  3D9J A;  3LJ3 A;  3ONK A;  2YNQ A;  4EPZ A;  3CHR A;  5CMW A;  3FUL A;  3KEA A;  4ACK A;  3TGO A;  4HI9 A;  5CEA A;  1H0A A;  3CHO A;  4I1O B;  1QNF A;  4J7W A;  3CHM A;  4OAV B;  4BWR A;  5KNG A;  1SA5 A;  4GTV A;  2ETB A;  4URK A;  5ENS D;  4DX1 A;  4B8C B;  3V31 A;  1OCC E;  4IUL A;  4GA2 A;  2PQR A;  3NZS A;  1XGW A;  2XCC A;  1LD7 A;  1FPP A;  3R9A B;  3SFX A;  2P9N G;  2H6F A;  2QC9 A;  4MS6 A;  2KXP C;  5CER B;  2OV8 A;  1IQU A;  3HDX A;  4QQI A;  3AS8 A;  4YDE A;  3PRE A;  4GTM A;  2PM6 A;  4UWG A;  3UM0 A;  2P9I G;  3ZUV B;  4BSZ B;  4LEU A;  3MV3 B;  3IKO B;  3FH8 A;  3CHQ A;  3EU5 A;  3FHE A;  2WXQ A;  4MLP A;  1U2V G;  3Q7F A;  4K5B A;  3D9I A;  4J8D A;  3FDH A;  1EYH A;  3FU3 A;  5CED B;  1NFI E;  2XEN A;  3SQV A;  4L1B A;  3N71 A;  3RJV A;  3ZRH A;  4BT9 A;  5B3S E;  2DVW A;  4BX9 A;  5H7P A;  5EN5 D;  2ETC A;  4N3B A;  3GZ1 A;  4AEZ C;  2GW1 A;  4ILI A;  4BEP A;  4DK5 A;  3NAW A;  3CKB A;  4A3T A;  4Q96 A;  2X38 A;  3AAA C;  4UQY A;  2I6H A;  3J5Q B;  2WXL A;  4XEI G;  4HBD A;  1ZBP A;  5BW8 C;  2EIJ E;  4WUY A;  3GYZ A;  5LP0 A;  4FHJ A;  4G8L A;  3SNX A;  3HXB A;  2F8Y A;  1DCQ A;  3FH7 A;  2OVB A;  1Z5S C;  4FHK A;  4E6H A;  4TUU A;  4CCA A;  2CG2 A;  2XQ0 A;  1N94 A;  3S7F A;  3V2X A;  3DRA A;  3PNL B;  1H2U A;  4U95 D;  4EBA G;  1OWL A;  3FU0 A;  3ZN3 A;  4JHR A;  4EEC A;  1Q2Z A;  4G8K A;  3URZ A;  3ABK E;  5JJ7 A;  3B7T A;  4WNF A;  4CDN A;  2AXV A;  3AG1 E;  4GYY A;  5AEN A;  3JXJ A;  2XGS A;  1S64 A;  3C3R A;  3UT8 A;  3OXG A;  1U3C A;  1S63 A;  3VLE A;  3UM1 A;  4GPK A;  1KZP A;  3CK7 A;  4HI8 A;  3RRN B;  5JJ6 A;  4GA0 A;  3BG1 B;  3ASG A;  2X6K A;  3MA5 A;  4AXH A;  3WXX A;  3T8M A;  2DWZ A;  4PS7 A;  4UI9 C;  2M63 A;  5CBN A;  2P9U G;  4BSX A;  4YDO A;  5AQA A;  1HZ4 A;  4PDX A;  1MX2 A;  3WG7 E;  5A7D B;  1WY6 A;  2XS8 A;  4JL0 A;  4NAC A;  1JUQ A;  5FQ7 A;  1HG5 A;  3AJI A;  1ELK A;  2WVI A;  2EIM E;  2XPZ A;  2IO3 C;  4ANX A;  1DVP A;  4TUM A;  3CEQ A;  4FC8 A;  1E8X A;  4BTA A;  2JAB A;  1EF1 C;  4FLH A;  4I9C A;  2JLB A;  1NL4 A;  4XX5 A;  5EIB E;  2X6H A;  2WXJ A;  3K9I A;  3RKV A;  2BED A;  1MYO A;  3Q78 A;  1E8W A;  4UQZ A;  4OVU A;  2ILR A;  4B94 A;  4HOU A;  3FTZ A;  2J9Q A;  4U7E B;  1UOH A;  2AJA A;  2L0I A;  5BV0 A;  3IBE A;  4I6G A;  2P9S G;  4YVO A;  2LAI A;  2EIL E;  2RFA A;  3CVW A;  4F7A A;  1OXJ A;  3Q49 B;  3G2S A;  2L0T B;  1SA4 A;  5C1D A;  1H2V C;  2FO1 E;  1K3Z D;  2HR2 A;  1H19 A;  4GTS A;  1LF8 A;  2CFZ A;  4TXP A;  3JUI A;  4KXK B;  3MYV A;  3PH0 C;  4ACL A;  3D9L A;  1HE8 A;  1G3N B;  2YHE A;  3DPD A;  1E90 A;  2IOS A;  3QK0 A;  4HRN A;  5FQ6 A;  3Q15 A;  3S7B A;  3F6Q A;  1IQR A;  2H6I A;  4I43 A;  4GB9 A;  2LAH A;  4ZHB A;  3FTS A;  3LS8 A;  1MX4 A;  3MX3 A;  2KBX A;  5FWQ A;  5FZR A;  5E75 A;  2I2O A;  1OY3 D;  2NSZ A;  2BKK B;  5FJY A;  3TWS A;  3CVX A;  1FVF A;  4KMO A;  4W9R A;  1OWM A;  5JA4 D;  2XEE A;  3ZU7 B;  4MKT A;  4U8H A;  2WXN A;  2YHC A;  3KSL A;  2WXP A;  2ZXW E;  3VTX A;  2RD0 A;  4D10 C;  3HRA A;  4GZC A;  3OTN A;  3HHM A;  5T8I A;  4Q69 A;  4J6I A;  3DSV A;  3UXG A;  2QYJ A;  5HS0 A;  3X2Q E;  4RSY A;  4BFR A;  2HE0 A;  4UWL A;  1D8E A;  3RRM B;  3I5P A;  1NZN A;  3QWP A;  2Y69 E;  2AWI A;  4C0M A;  3DWL G;  3PE4 A;  4PS3 A;  3ASH A;  1V55 E;  4N2Q A;  4IRU A;  3E4B A;  1WM5 A;  4GZD A;  5FQ8 A;  3L54 A;  1O5M A;  1KZO A;  3LPZ A;  4GML A;  4BY6 A;  3FUM A;  4YND A;  5AYW D;  3TG4 A;  2QZA A;  1Z6T A;  2GRO B;  3MV2 B;  3MCX A;  2OOE A;  4LCT A;  2H6G A;  4GMJ A;  3AU4 A;  3W9F A;  1OWN A;  3E33 A;  3ZNG A;  5G04 J;  4JZY A;  2VTB B;  2WB2 A;  1TNZ A;  2GGF A;  2L6J A;  4GYW A;  2WQ7 A;  3SY2 A;  4QFV A;  1O1S A;  3ESL A;  2V5Q C;  4LNG A;  4U07 A;  3DXK G;  3Q75 A;  4C9B B;  2PL2 A;  1KT0 A;  4XIF A;  2DCP A;  2J4B A;  1YMP A;  4AV7 A;  3MKQ B;  2ZIS A;  4GCO A;  4U0U A;  2KM4 A;  3CLJ A;  3EJN A;  3U64 A;  4BES A;  1IXV A;  2QFC A;  5BV1 A;  3U3W A;  2I9C A;  3CVQ A;  4MRU A;  3Q47 B;  4BET A;  3HVE B;  1N54 A;  2R59 A;  3FP3 A;  3RK6 A;  2IF4 A;  1KPS B;  3FTX A;  4CGW A;  3ASN E;  3ZIM A;  3T5X A;  4WND A;  3QNK A;  3HXD A;  3BG0 B;  5HRY A;  3ZXP A;  5HKP A;  2VSY A;  1WDY A;  3UIP C;  5BXO A;  1TYQ G;  5ITZ F;  5ARF A;  3C72 A;  1MX6 A;  3Q5M A;  1OWP A;  4Q94 A;  3UX4 A;  3RO2 A;  4UWF A;  4DJA A;  5ENR D;  2WMN A;  4GCN A;  3BU8 A;  1NI1 A;  5DBK A;  3UKR G;  4EBA A;  3IEG A;  1E8Z A;  2CHX A;  2XS1 A;  2J4D A;  4LG6 A;  3E34 A;  4G24 A;  5CRU A;  3KEZ A;  4O6F A;  3CIA A;  3QKY A;  5AJD A;  3CQC B;  2Q7F A;  1V54 E;  3LEW A;  5JHA A;  2XRZ A;  2GRM A;  4M7C A;  3FFL A;  5BPP A;  3APC A;  3FTW A;  5G05 C;  2GRP B;  1L5J A;  4J8Y A;  4FJZ A;  2WXK A;  4BX8 A;  5J90 A;  5CRV A;  5ANR A;  5AAR A;  1QQE A;  1HX8 A;  1N0Q A;  1RW2 A;  4N39 A;  5G2N A;  3ZKJ A;  4B8A A;  3HXF A;  3QAR A;  1RZ4 A;  3SF4 A;  2XGO A;  1HG2 A;  3DEO A;  4RQI A;  4F1P A;  2WXG A;  2FEZ A;  4JXT A;  1UW4 B;  3BEE A;  4APO A;  3S7J A;  2VTB A;  2R02 A;  1H6K A;  3E32 A;  2V5F A;  4G11 A;  4ME2 A;  3CSF A;  3Q9U C;  3QDN A;  4CRW A;  2VYI A;  5EYP F;  1FT1 A;  4I9E A;  2VSO E;  5FZS A;  4I1M A;  3RAU A;  2WM9 A;  3PEU B;  3UTM A;  3TL5 A;  3NB2 A;  3QAQ A;  5FQ4 A;  4KT6 B;  2IFU A;  2H6H A;  3OAW A;  4Y6W A;  3NOC D;  2J8S D;  2L6B A;  5ENT D;  4HLL A;  1DNP A;  1WAO 1;  2UY1 B;  5D66 A;  2VSX E;  2WMO A;  1IKN D;  4F3V A;  4K5A B;  3ONL A;  4HQD A;  5KJN A;  3AG4 E;  3Q79 A;  5AAO A;  5AIJ A;  2A5E A;  4I2W A;  4NUR A;  4UI9 K;  2DZN A;  2AXZ A;  1X81 A;  4BT8 A;  5BT1 A;  3ZYL A;  4R7L A;  4LNU D;  3MZL B;  2KZT B;  4ATZ D;  2MRI A;  5DIZ A;  4EHM A;  4KZC A;  3HXC A;  3C5R A;  4UQX A;  5C2Y A;  2R5S A;  3FUE A;  4EQF A;  1D8D A;  4HOQ A;  4UWK A;  4PH4 B;  4AOF A;  2Y0B G;  2A5U A;  3EHQ A;  1TJF A;  4HNA D;  3CK8 A;  5EX0 A;  3AS4 A;  1PAQ A;  4YVQ C;  3D9N A;  3NZU A;  2RKK A;  4GZ6 A;  1H6P A;  2B0O E;  5JMN D;  1TEZ A;  1KLX A;  4G1T A;  4DI3 A;  3W9G A;  4JEU A;  3FU6 A;  1ELR A;  4FUL A;  3ZYM A;  1H2T C;  4K5C A;  1WG0 A;  1N4Q A;  1YA0 A;  2WXO A;  2XEH A;  3IXE A;  1K8K G;  3EHR A;  3SBS A;  5LOZ A;  3ABL E;  3LY9 A;  4DI4 A;  3UKU G;  2QY7 A;  3SFY A;  4DX7 D;  3JXI A;  1TNU A;  2WXH A;  3RU0 A;  4I2Z A;  4CEM A;  2XZT G;  3JYS A;  3CK9 A;  4HFG A;  1SQM A;  4UI9 J;  4G2V A;  3AU5 A;  4GYO A;  4GAA A;  3E30 A;  3FTU A;  4B93 B;  2PQN A;  3FU5 A;  4HLE A;  4E85 A;  2KCL A;  3ABM E;  3IHY A;  5KCM A;  2V8S E;  3L6A A;  3DSS A;  3CGH A;  3MKQ A;  3Q9N C;  3NF1 A;  4GTT A;  3KSQ A;  2OEW A;  3D9H A;  2VGE A;  2IU1 A;  3G2V A;  3ZVV A;  1HO8 A;  3LDZ A;  1VDY A;  4U8Y D;  3KS2 A;  4LUN U;  2MYO A;  4H7Y A;  3ESK A;  2IJG X;  1DCE A;  3QWV A;  1UJK A;  5EKQ D;  3FUH A;  4U63 A;  3TWT A;  3C3O A;  4GU5 A;  4ATG A;  1SVX A;  3AS5 A;  3RSE G;  3EHM A;  2GRR B;  1MZC A;  3I4G A;  2WXI A;  1HF8 A;  4HOS A;  3LVQ E;  4AM9 A;  2BF0 X;  4A3V A;  3TG5 A;  3D9M A;  3I4R B;  5KNH D;  4CT0 A;  5LCW C;  4C48 B;  5G05 J;  4DX6 D;  3FWV A;  4AP2 A;  3PRZ A;  1ZU2 A;  4BTB A;  4M3O A;  1YYH A;  5EDS A;  3FUJ A;  3HXE A;  2FI7 A;  5EYL A;  4KVM A;  3IV0 A;  3BQO A;  3QB2 A;  1JWG A;  1O1T A;  4B89 A;  1N4P A;  4WAF A;  5HI7 A;  2XPY A;  2L9B A;  1JCS A;  2CFU A;  3MGB A;  1TNB A;  3EHN A;  4BER A;  3FEY A;  4KVO A;  5BNW A;  2IOL A;  4RVB A;  4GTP A;  3ZFW A;  1NA3 A;  2IY0 C;  2EIK E;  3FUK A;  5A23 A;  3PZD A;  3EIJ A;  1FVH A;  3CVL A;  4N5C A;  4GA1 A;  3CHP A;  4WNE A;  5ENN A;  3FY4 A;  5BUZ A;  5KBA A;  1FCH A;  4YDW A;  2P9K G;  4XZ4 A;  3KAE A;  3MJW A;  2X6F A;  4JA9 A;  2MHK A;  1DC2 A;  3FEX A;  3ZYK A;  4HB5 A;  5B1B E;  5KJL A;  2R17 C;  4EZL A;  5KJK A;  5FZQ A;  4MBG A;  1K1B A;  2J49 A;  2P2C P;  3G2U A;  5IY5 E;  4WNG A;  1AWC B;  2BTD A;  3PEV B;  4KBQ A;  1E96 B;  4G26 A;  4EZJ A;  1N9A A;  2BKG A;  4RLY A;  3D9P A;  5CCL A;  5KJM A;  4DUI A;  2A4Z A;  2WXM A;  3FUD A;  3UI2 A;  4FA6 A;  2VJ8 A;  3C98 A;  1BD8 A;  5AQ9 A;  4JHK A;  4F6R D;  4DLO A;  1MJ0 A;  4HS2 A;  4ILG A;  3O48 A;  4OYS A;  2Y4T A;  1TJC A;  4JHJ A;  3CST A;  2P9L G;  2B6C A;  1U3D A;  3LY8 A;  2UWJ G;  4I17 A;  5EX3 A;  4XE0 A;  1N4S A;  2XZD G;  3DPY A;  1P5Q A;  5B1A E;  4NIK A;  3UIN C;  4FJY A;  4AY5 A;  3UM2 A;  2F8X K;  3Q7A A;  3LKU A;  4I6E A;  2IQC A;  3HIZ A;  3EUV A;  2WXF A;  5EID A;  1N95 A;  3UM3 A;  1BPO A;  4GPM A;  4AY6 A;  2E2E A;  5CCM A;  4DPR A;  3TWU A;  1A17 A;  1XNF A;  2LXL A;  4FLB A;  4OVV A;  4OAU C;  1H6O A;  3QJZ A;  3JCK C;  2R2L A;  4HOR A;  2P9P G;  4JEH A;  2IEJ A;  1BI8 B;  5E76 A;  2KZT A;  3NOG D;  4TXQ A;  2GRL A;  2CHZ A;  2LUH A;  3DST A;  3DBS A;  1IYG A;  4APF A;  4O1O A;  4DRX E;  4YDY A;  4CDR A;  1JCQ A;  3FUF A;  4HRL A;  4RG9 A;  4C0E A;  3SGH A;  1Z3Y A;  2XCB A;  2FBN A;  1QZ2 A;  4N5Q A;  3PUK A;  2FUL A;  3UUX A;  2C2L A;  3LCA A;  4GTR A;  4TV3 A;  1HS6 A;  3ZHE A;  5AQB A;  2VGY A;  4L9P A;  3TXM A;  3JQ0 A;  5ENQ D;  3ASF A;  1YCS B;  3ENE A;  2V4L A;  4A63 B;  4XKC A;  3NQP A;  2X6J A;  1OCZ E;  2Y4U A;  1N11 A;  3UPV A;  2OND A;  5KWD A;  3PDN A;  1HU3 A;  4L2L A;  3L22 A;  4WWN A;  4JC8 A;  2X3M A;  2J07 A;  2UY1 A;  1N52 A;  2RG8 A;  4WWP A;  4ILH B;  3EIQ C;  2GRQ B;  2AXU A;  2YIN A;  3FH5 A;  2NXP A;  3R9M A;  2NYJ A;  1ZB1 A;  2ZGG A;  2LSU A;  1E7V A;  1OCO E;  3L08 A;  3SD5 A;  2Y1L E;  3IHV A;  1X5B A;  2C0M A;  3U4T A;  2XEV A;  2ZGD A;  1INZ A;  3ZYQ A;  1UN8 A;  2LO6 A;  3RO3 A;  3UIO C;  3T5V A;  1OWO A;  3CVP A;  4GTO A;  3FUN A;  5FIO A;  4CDM A;  3I3N A;  4DLQ A;  2JEK A;  3R7Q A;  1EPU A;  2PNN A;  3ZEF A;  1BI7 B;  1Z3X A;  4NQ0 A;  2LNI A;  4KZ0 A;  1UG3 A;  4O60 A;  1O1R A;  5ENP D;  2WXR A;  4JPS A;  3E37 A;  2R03 A;  4G23 A;  2HM8 A;  3S7D A;  4A1S A;  4JD2 G;  2GRN B;  4N2S A;  4U0Z A;  3PVL A;  5AN8 A;  3TWW A;  2AW6 A;  4HOT A;  4A55 A;  3R7R A;  3ZHE B;  5CHE E;  5CMY A;  1UN9 A;  3QOU A;  3L16 A;  2V4H C;  3CHS A;  5G55 A;  5JJT A;  3SZ7 A;  2EIN E;  3TAX A;  2CHW A;  4WWO A;  1NA0 A;  5AJL A;  5CBO A;  3TWX A;  4Z68 A;  2OVF A;  5FT9 A;  3SO8 A;  1TR4 A;  3QWW A;  3TJP A;  3SHF A;  4CZ2 D;  5FIN A;  1N4R A;  2VSN A;  2FF4 A;  4F53 A;  2I1J A;  3PUJ A;  5ARG A;  4GMR A;  1JCR A;  1MQS A;  4B0Z A;  4HVB A;  4AVX A;  1E7U A;  4FP7 A;  1QBQ A;  1IHG A;  1Y8M A;  3ML8 A;  2DYR E;  1BLX B;  3P1U A;  1JWF A;  3P2B A;  5AQ7 A;  2F37 A;  1OCR E;  3LYA A;  3B95 A;  3PZ2 A;  2XHE A;  4FU3 A;  5LX8 A;  2OEV A;  2FO7 A;  3ULQ A;  1NP7 A;  1MHQ A;  5BXU A;  3ML9 A;  5LFA A;  3B7S A;  5ENO D;  5CEC B;  3RIB A;  2DIW A;  3D3M A;  4LER A;  3UQ3 A;  2P58 C;  2PZI A;  3C3Q A;  3T8K A;  3L17 A;  3B7B A;  3HG0 D;  4U96 D;  1TN7 A;  4O1P A;  2KCV A;  4HRM B;  3RRU A;  4HXI A;  3UMV A;  1TN8 A;  3SI5 A;  2KAT A;  1JPL A;  3D9K A;  3GW4 A;  1LTX A;  1IHB A;  4I6J A;  2X6I A;  5A6C A;  3V79 K;  4N3C A;  5JHB A;  4V3I A;  4L23 A;  4ANU A;  2WQ6 A;  4GZ3 A;  3GZS A;  2C0L A;  1HXI A;  4JB8 P;  1SZ9 A;  2I1K A;  4LNB A;  4F1S A;  3VLD A;  1TNO A;  3ULY A;  1ELW A;  4G25 A;  3O4Z A;  3VLF A;  4N3A A;  4EZK A;  3DSU A;  3PS6 A;  3CVN A;  3JUE A;  4U8V D;  3L13 A;  1PC2 A;  4CGV A;  2BUG A;  4NRH B;  3CQG B;  4FAD A;  3CKC A;  1PY1 A;  3HYM B;  4X8Q A;  4L2Y A;  4ANW A;  3SFZ A;  3Q4A B;  4DX2 A;  4PUC A;  2E0I A;  1GW6 A;  4JW1 A;  5HQ8 A;  4CT4 A;  1S70 B;  2J09 A;  3ULE G;  1KT1 A;  2XRY A;  4KYO B;  4I1A A;  3VTY A;  4H7X A;  5D0O D;  2DBA A;  1BU9 A;  2R05 A;  2EQX A;  2PM7 A;  3ZXS A;  3B7R L;  3TWV A;  2VGX B;  3CV0 A;  2HYZ A;  4LRZ A;  4J8F A;  3D9O A;  3BUA A;  3B7U X;  5FTP A;  3ZPJ A;  2YQ8 A;  5EIL A;  5T3R A;  5G04 C;  2LXM A;  4UUC A;  1QYM A;  3CVV A;  2WPV A;  4GTQ A;  5ANL A;  4ANV A;  3DEP A;  2ZIR A;  1SZA A;  3U66 A;  3LJN A;  2CG3 A;  4RG6 A;  3JQ1 A;  2RFM A;  5J08 A;  2OCC E;  1S0P A;  3ASD A;  1TN6 A;  2MOW A;  3QC1 A;  3KD7 A;  2AVP A;  3Q73 A;  2V0P A;  1N0R A;  2VQ2 A;  2ETA A;  4XI0 A;  2DZO A;  4UWH A;  5T4Y A;  4TXR A;  3B13 A;  2F0Y A;  1W3B A;  1A5E A;  1LD8 A;  3LXU X;  1AP7 A;  3V2O A;  3OXF A;  4CYM D;  4AIF A;  2WQH A;  3LY7 A;  3SBT B;  3PZ1 A;  2XGM A;  3UT4 A;  3S2A A;  4J8E A;  3PZ3 A;  3PNT B;  4K0R A;  4XKB A;  2IO2 C;  3ASO E;  4ZFH A;  3FTY A;  3V30 A;  2KCK A;  2ION A;  3GZ2 A;  3MEK A;  1HFA A;  5LCW J;  1EDU A;  2ZU6 B;  3CVY A;  3T9K A;  3ZGQ A;  3APD A;  1E8Y A;  4J0U A;  3MKR A;  2QYU A;  4A1G A;  3L82 A;  3EDT B;  4DX5 D;  5D2M C;  1FT2 A;  4U0S A;  1Y6I A;  1TNY A;  3TWR A;  4JA7 A;  3AG3 E;  4P29 A;  3EU9 A;  3LVR E;  3ZW3 A;  4Y6C A;  3G2T A;  2XPI A;  2VGX A;  3U9W A;  4LSZ E;  4IN3 B;  4L7T A;  3G2W A;  4ABN A;  5D0Q D;  4TRQ A;  1B89 A;  1OT8 A;  3CR3 A;  3J5P A;  3FUI A;  1UJJ A;  2Y3A A;  2LSV A;  3DXM G;  4JVS A;  3UT7 A;  3APF A;  5M72 A;  3ISM C;  3OXL A;  3HVE A;  4IYP A;  4AJW A;  1D9S A;  4U04 A;  2J08 A;  1OUV A;  4K03 A;  3FTV A;  3AG2 E;  3TWQ A;  1K1A A;  2HO1 A;  4XI9 A;  2KC7 A;  3NBN B;  4PS8 A;  4GZ5 A;  3DSX A;  3L9T A;  3DSW A;  3CVU A;  3PE3 A;  3PZ4 A;  4J8S A;  1SW6 A;  2NC9 A;  3TXN A;  1HH8 A; 
#chains in the Genus database with same CATH homology
 3S7D A;  4A1S A;  1VDY A;  3D9J A;  3KS2 A;  3LJ3 A;  3RRM B;  4N2S A;  3ONK A;  4LUN U;  4U0Z A;  3I5P A;  1NZN A;  3PVL A;  3QWP A;  4H7Y A;  2YNQ A;  2AW6 A;  3ESK A;  4EPZ A;  2AWI A;  2IJG X;  4HOT A;  3CHR A;  3QWV A;  4C0M A;  5CMW A;  3FUL A;  3PE4 A;  1UJK A;  4ACK A;  3TGO A;  4A55 A;  1H0A A;  3CHO A;  4I1O B;  4PS3 A;  3R7R A;  3ZHE B;  3ASH A;  5CHE E;  5EKQ D;  3FUH A;  4U63 A;  5CMY A;  4GU5 A;  4ATG A;  4N2Q A;  4IRU A;  1UN9 A;  3QOU A;  3E4B A;  3AS5 A;  3L16 A;  1WM5 A;  1QNF A;  3EHM A;  3CHM A;  3CHS A;  5G55 A;  5JJT A;  3I4G A;  3SZ7 A;  4BWR A;  2WXI A;  4GZD A;  5FQ8 A;  3TAX A;  2CHW A;  4WWO A;  1NA0 A;  3L54 A;  5AJL A;  4URK A;  1HF8 A;  4B8C B;  3LPZ A;  4IUL A;  4HOS A;  3LVQ E;  4GML A;  4GA2 A;  4BY6 A;  4AM9 A;  2BF0 X;  3FUM A;  4YND A;  5AYW D;  2PQR A;  4A3V A;  3TG4 A;  3NZS A;  3TG5 A;  1XGW A;  3D9M A;  1Z6T A;  3I4R B;  4CT0 A;  5LCW C;  2XCC A;  3MCX A;  3MV2 B;  2OOE A;  3R9A B;  4LCT A;  5G05 J;  4GMJ A;  3FWV A;  4AP2 A;  3PRZ A;  3AU4 A;  1ZU2 A;  2OVF A;  4BTB A;  4M3O A;  5FT9 A;  1OWN A;  4MS6 A;  5G04 J;  4JZY A;  2VTB B;  3QWW A;  2WB2 A;  2OV8 A;  2GGF A;  1IQU A;  2L6J A;  4GYW A;  3SHF A;  3TJP A;  2WQ7 A;  3HDX A;  5EDS A;  2VSN A;  4QFV A;  3AS8 A;  2FF4 A;  4F53 A;  2I1J A;  3FUJ A;  3ESL A;  3PUJ A;  3PRE A;  5ARG A;  4U07 A;  2FI7 A;  2PM6 A;  4UWG A;  1MQS A;  4KVM A;  2PL2 A;  4C9B B;  4B0Z A;  1KT0 A;  4XIF A;  4HVB A;  4AVX A;  2DCP A;  4LEU A;  1E7U A;  2J4B A;  3IV0 A;  4AV7 A;  3QB2 A;  4FP7 A;  1JWG A;  3MKQ B;  1IHG A;  3MV3 B;  4GCO A;  4U0U A;  2KM4 A;  3IKO B;  4B89 A;  1Y8M A;  3FH8 A;  3CHQ A;  3CLJ A;  3FHE A;  3ML8 A;  2WXQ A;  3P1U A;  1JWF A;  4MLP A;  4WAF A;  3EJN A;  3P2B A;  3U64 A;  3LYA A;  5HI7 A;  2QFC A;  3D9I A;  2XPY A;  4J8D A;  5BV1 A;  3FDH A;  1EYH A;  2L9B A;  2I9C A;  3CVQ A;  3FU3 A;  2CFU A;  3Q47 B;  2XHE A;  3MGB A;  4MRU A;  4FU3 A;  3HVE B;  3EHN A;  5LX8 A;  1N54 A;  2FO7 A;  3ULQ A;  2R59 A;  4L1B A;  3FP3 A;  3FEY A;  3RK6 A;  4KVO A;  5BNW A;  1NP7 A;  2IF4 A;  2IOL A;  1MHQ A;  4RVB A;  3ML9 A;  5LFA A;  3FTX A;  3N71 A;  3RJV A;  3ZFW A;  4CGW A;  3ZRH A;  1NA3 A;  3FUK A;  5A23 A;  4BT9 A;  3PZD A;  3ZIM A;  4BX9 A;  3B7S A;  3EIJ A;  3T5X A;  1FVH A;  3CVL A;  4N5C A;  4WND A;  3QNK A;  4GA1 A;  3RIB A;  3CHP A;  2DIW A;  3BG0 B;  3D3M A;  2VSY A;  4N3B A;  4WNE A;  4LER A;  3GZ1 A;  4UWL A;  5ENN A;  2P58 C;  3UQ3 A;  4AEZ C;  3FY4 A;  5BUZ A;  2PZI A;  2GW1 A;  1FCH A;  4ILI A;  4DK5 A;  3L17 A;  4XZ4 A;  3KAE A;  5ARF A;  3MJW A;  3CKB A;  2X6F A;  4A3T A;  4Q96 A;  4JA9 A;  2KCV A;  3Q5M A;  1OWP A;  2X38 A;  4Q94 A;  2MHK A;  3UX4 A;  3RRU A;  4HXI A;  3UMV A;  4UQY A;  2I6H A;  3RO2 A;  4UWF A;  3FEX A;  3ZYK A;  3SI5 A;  4DJA A;  2WXL A;  2KAT A;  2WMN A;  1JPL A;  4GCN A;  3D9K A;  5KJL A;  5DBK A;  4EBA A;  1ZBP A;  2R17 C;  3GW4 A;  3IEG A;  5BW8 C;  1E8Z A;  2CHX A;  4EZL A;  4WUY A;  5KJK A;  5FZQ A;  4I6J A;  2J4D A;  3GYZ A;  3G2U A;  2J49 A;  5LP0 A;  2X6I A;  5A6C A;  4N3C A;  3U3W A;  5JHB A;  4WNG A;  4G24 A;  2BTD A;  4V3I A;  3KEZ A;  3PEV B;  4FHJ A;  4KBQ A;  4L23 A;  4ANU A;  2WQ6 A;  4GZ3 A;  3GZS A;  4O6F A;  3SNX A;  3CIA A;  1E96 B;  2C0L A;  4G26 A;  3QKY A;  5AJD A;  1HXI A;  4EZJ A;  1SZ9 A;  3CQC B;  2I1K A;  3D9P A;  2Q7F A;  5CCL A;  3FH7 A;  3LEW A;  4F1S A;  2OVB A;  3VLD A;  4FHK A;  5KJM A;  4E6H A;  4TUU A;  4CCA A;  5JHA A;  2CG2 A;  2XQ0 A;  2XRZ A;  3S7F A;  2GRM A;  2A4Z A;  1ELW A;  3FFL A;  4G25 A;  3PNL B;  1H2U A;  3O4Z A;  2WXM A;  3FUD A;  3VLF A;  4EBA G;  4N3A A;  4FA6 A;  1OWL A;  5BPP A;  2VJ8 A;  3APC A;  3FU0 A;  3ZN3 A;  4EZK A;  3PS6 A;  4JHR A;  4EEC A;  3C98 A;  3CVN A;  3FTW A;  3URZ A;  3L13 A;  1PC2 A;  4JHK A;  5JJ7 A;  5G05 C;  4CGV A;  2BUG A;  4NRH B;  3CQG B;  4FAD A;  1L5J A;  3B7T A;  3CKC A;  4WNF A;  2AXV A;  4CDN A;  4DLO A;  1PY1 A;  3HYM B;  4L2Y A;  4FJZ A;  4GYY A;  4ANW A;  4HS2 A;  5AEN A;  2WXK A;  4BX8 A;  4ILG A;  3SFZ A;  2XGS A;  3Q4A B;  5J90 A;  3O48 A;  4PUC A;  4OYS A;  3UT8 A;  3OXG A;  1U3C A;  2E0I A;  2Y4T A;  1GW6 A;  4JW1 A;  3VLE A;  5ANR A;  1TJC A;  5HQ8 A;  1QQE A;  4GPK A;  4JHJ A;  1HX8 A;  4CT4 A;  3CST A;  2J09 A;  3CK7 A;  4N39 A;  1KT1 A;  5G2N A;  3RRN B;  2XRY A;  4KYO B;  1U3D A;  5JJ6 A;  4GA0 A;  4B8A A;  3BG1 B;  3QAR A;  3ASG A;  3SF4 A;  3LY8 A;  2UWJ G;  4I17 A;  5EX3 A;  4XE0 A;  2XGO A;  1HG2 A;  1P5Q A;  4I1A A;  3VTY A;  2X6K A;  4H7X A;  2WXG A;  3MA5 A;  2FEZ A;  4FJY A;  4JXT A;  5D0O D;  1UW4 B;  2DBA A;  4AXH A;  4AY5 A;  3WXX A;  3T8M A;  3BEE A;  4PS7 A;  4APO A;  3S7J A;  2EQX A;  2PM7 A;  3LKU A;  3ZXS A;  2VTB A;  4I6E A;  1H6K A;  2IQC A;  3B7R L;  2M63 A;  3HIZ A;  4UI9 C;  4BSX A;  2VGX B;  2V5F A;  3CV0 A;  2HYZ A;  4G11 A;  4ME2 A;  2WXF A;  4LRZ A;  3CSF A;  1HZ4 A;  4J8F A;  3D9O A;  3B7U X;  1BPO A;  3QDN A;  5FTP A;  4PDX A;  3ZPJ A;  4CRW A;  5A7D B;  2YQ8 A;  5T3R A;  1WY6 A;  2VYI A;  2E2E A;  5G04 C;  4AY6 A;  5CCM A;  4DPR A;  4JL0 A;  4NAC A;  1JUQ A;  4I9E A;  5FQ7 A;  2VSO E;  1HG5 A;  5FZS A;  4I1M A;  3CVV A;  1A17 A;  2WPV A;  1ELK A;  2WVI A;  2XPZ A;  1XNF A;  5ANL A;  2WM9 A;  3PEU B;  4ANV A;  3TL5 A;  4ANX A;  1DVP A;  3QAQ A;  4FLB A;  4OVV A;  5FQ4 A;  4KT6 B;  2IFU A;  3CEQ A;  4FC8 A;  3OAW A;  4Y6W A;  1E8X A;  3QJZ A;  4BTA A;  1SZA A;  3U66 A;  1EF1 C;  1DNP A;  3JCK C;  4FLH A;  4I9C A;  2JLB A;  4HOR A;  1WAO 1;  2CG3 A;  4JEH A;  2UY1 B;  4RG6 A;  2VSX E;  2WMO A;  3JQ1 A;  5J08 A;  5E76 A;  4F3V A;  4XX5 A;  1S0P A;  3ASD A;  3ONL A;  2KZT A;  2X6H A;  2WXJ A;  2MOW A;  3K9I A;  5KJN A;  2GRL A;  3RKV A;  3QC1 A;  2CHZ A;  3KD7 A;  5AIJ A;  1E8W A;  4UQZ A;  2AVP A;  4I2W A;  2V0P A;  2VQ2 A;  2ILR A;  3DBS A;  4NUR A;  4OVU A;  4HOU A;  4UI9 K;  4XI0 A;  4B94 A;  3FTZ A;  4UWH A;  5T4Y A;  2AXZ A;  2J9Q A;  4BT8 A;  1IYG A;  5BT1 A;  3ZYL A;  4R7L A;  4APF A;  3B13 A;  2L0I A;  3MZL B;  2KZT B;  5BV0 A;  1W3B A;  2MRI A;  3IBE A;  4I6G A;  3LXU X;  5DIZ A;  4CDR A;  4YVO A;  3FUF A;  4KZC A;  4RG9 A;  2LAI A;  4C0E A;  3OXF A;  3SGH A;  4UQX A;  1Z3Y A;  2XCB A;  3CVW A;  2FBN A;  4F7A A;  3Q49 B;  1QZ2 A;  3G2S A;  2R5S A;  5C2Y A;  4AIF A;  3FUE A;  2WQH A;  4EQF A;  4HOQ A;  3LY7 A;  3PUK A;  2L0T B;  3SBT B;  4UWK A;  2FUL A;  3UUX A;  4PH4 B;  2C2L A;  4AOF A;  3LCA A;  4TV3 A;  2A5U A;  2XGM A;  3UT4 A;  5C1D A;  1H2V C;  1HS6 A;  3ZHE A;  2HR2 A;  2VGY A;  1H19 A;  3S2A A;  4J8E A;  3JQ0 A;  3TXM A;  1TJF A;  3ASF A;  3PNT B;  1LF8 A;  4K0R A;  3ENE A;  4XKB A;  3CK8 A;  5EX0 A;  2V4L A;  3AS4 A;  2CFZ A;  3JUI A;  4KXK B;  3FTY A;  3MYV A;  2KCK A;  1PAQ A;  3NQP A;  4XKC A;  2ION A;  4YVQ C;  3D9N A;  3GZ2 A;  3NZU A;  3MEK A;  1HFA A;  3PH0 C;  4ACL A;  2X6J A;  3D9L A;  4GZ6 A;  5LCW J;  1HE8 A;  1EDU A;  2ZU6 B;  2Y4U A;  3CVY A;  3UPV A;  1TEZ A;  1KLX A;  2YHE A;  3DPD A;  3ZGQ A;  1E90 A;  3APD A;  4G1T A;  1E8Y A;  2IOS A;  4DI3 A;  3QK0 A;  2OND A;  5FQ6 A;  3Q15 A;  4J0U A;  4JEU A;  1IQR A;  3PDN A;  3S7B A;  3MKR A;  1HU3 A;  1ELR A;  3FU6 A;  4L2L A;  4A1G A;  4FUL A;  3ZYM A;  4I43 A;  4GB9 A;  3L22 A;  1H2T C;  2LAH A;  3EDT B;  4WWN A;  3FTS A;  3LS8 A;  4JC8 A;  2X3M A;  2J07 A;  2UY1 A;  1N52 A;  2RG8 A;  4WWP A;  1YA0 A;  2WXO A;  3MX3 A;  4ILH B;  4U0S A;  3EIQ C;  1Y6I A;  3SBS A;  5LOZ A;  4JA7 A;  4P29 A;  2AXU A;  3LVR E;  3ZW3 A;  3LY9 A;  2YIN A;  4Y6C A;  3FH5 A;  3G2T A;  5FWQ A;  4DI4 A;  2NXP A;  2XPI A;  5FZR A;  2QY7 A;  5E75 A;  2VGX A;  2I2O A;  2NSZ A;  3U9W A;  5FJY A;  4IN3 B;  2WXH A;  3RU0 A;  4I2Z A;  4CEM A;  4L7T A;  3CVX A;  1FVF A;  3G2W A;  2LSU A;  3JYS A;  4KMO A;  1E7V A;  4W9R A;  4ABN A;  1OWM A;  3CK9 A;  4TRQ A;  5D0Q D;  1B89 A;  3SD5 A;  3L08 A;  4HFG A;  3CR3 A;  4MKT A;  3FUI A;  1SQM A;  3IHV A;  1UJJ A;  4U8H A;  2Y3A A;  4UI9 J;  2LSV A;  4JVS A;  4G2V A;  2WXN A;  3UT7 A;  2YHC A;  3AU5 A;  1X5B A;  2WXP A;  2C0M A;  4GYO A;  3VTX A;  3APF A;  4GAA A;  3U4T A;  2XEV A;  5M72 A;  1INZ A;  3ZYQ A;  2RD0 A;  3FTU A;  3OXL A;  1UN8 A;  2LO6 A;  3HVE A;  4IYP A;  3RO3 A;  4AJW A;  4D10 C;  2PQN A;  4GZC A;  1OWO A;  2J08 A;  3CVP A;  4U04 A;  3T5V A;  1OUV A;  3FUN A;  4CDM A;  3FU5 A;  3I3N A;  4K03 A;  3FTV A;  2JEK A;  4DLQ A;  4E85 A;  4HLE A;  3R7Q A;  1EPU A;  2KCL A;  3OTN A;  3HHM A;  3IHY A;  2HO1 A;  5T8I A;  3ZEF A;  5KCM A;  4XI9 A;  2KC7 A;  2V8S E;  3L6A A;  4Q69 A;  1Z3X A;  4J6I A;  4PS8 A;  4GZ5 A;  4NQ0 A;  3CGH A;  3MKQ A;  2LNI A;  3NF1 A;  4KZ0 A;  1UG3 A;  4RSY A;  4BFR A;  2IU1 A;  3CVU A;  3G2V A;  3PE3 A;  3ZVV A;  2WXR A;  1HO8 A;  4J8S A;  4JPS A;  2NC9 A;  4G23 A;  3TXN A;  2HM8 A;  3LDZ A;  1HH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...