1MHQA

Crystal structure of human gga2 vhs domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
SLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor binding protein GGA2
publication title Crystal structure of GGA2 VHS domain and its implication in plasticity in the ligand binding pocket
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1mhqA00
1UJJA 2MOWA 1HG2A 1HFAA 1HG5A 1H0AA 1EYHA 3G2TA 2LO6A 4GZCA 4HFGA 2L0TB 1SZ9A 1JUQA 4Q96A 1MHQA 3G2SA 1XGWA 3CLJA 2BF0X 2KM4A 1HX8A 3D9OA 3D9LA 4GZDA 3D9NA 2L0IA 4FU3A 1JPLA 5LP0A 3ZYLA 1DVPA 3D9KA 3D9MA 3G2WA 2DIWA 3ONKA 4AVXA 1SZAA 4NACA 1JWGA 1PY1A 2QY7A 1JWFA 1X5BA 3D9IA 3ZYKA 3D9PA 4Q94A 1EDUA 3LDZA 1HF8A 3ZYQA 5CMYA 5LOZA 2DCPA 3G2VA 1INZA 3ONLA 3G2UA 3ZYMA 1UJKA 2V8SE 1VDYA 4JXTA 1LF8A 5CMWA 3RRUA 5J08A 1ELKA 3D9JA 4FLBA
chains in the Genus database with same CATH superfamily
5DIZA 3RSEG 5D0OD 4HFGA 3CR3A 4HNAD 2R59A 4DI4A 2WB2A 3C98A 1OCRE 3FEXA 4AXHA 2HR2A 3NZUA 4KYOB 5G04C 2F8XK 4UQZA 3SF4A 4I6EA 2OVFA 4HVBA 3U4TA 3MA5A 4APOA 4AIFA 3MEKA 3CHRA 4DX5D 4E85A 3I5PA 3UTMA 3Q47B 3TL5A 5CBNA 5EDSA 1E7VA 3AU5A 3MKQB 4DI3A 4XI9A 4ANVA 4HOUA 3SI5A 4AV7A 1EF1C 3ZUVB 2XRZA 3UM1A 2KATA 2QZAA 3PVLA 1H6KA 1VDYA 3ZXSA 2WMNA 3EHRA 3AU4A 4N2SA 1RZ4A 3IHYA 4PS3A 3FDHA 3I3NA 3CEQA 3B7SA 1SA5A 3QWVA 5HQ8A 4JC8A 3DBSA 3D9IA 1U3CA 4G25A 4L7TA 3AG4E 5EILA 1N94A 1O1SA 4U07A 4E6HA 1JUQA 3FWVA 4BWRA 2QYUA 3JYSA 3CVWA 4GCOA 4ATZD 4A63B 3ZXPA 4GAAA 2GRNB 5G2NA 2VQ2A 3LY9A 2WQHA 4O60A 5FQ7A 5BV0A 3UT4A 4A3TA 5IY5E 2J4BA 3JUIA 2KXPC 3OXLA 2FO1E 4J6IA 2EIJE 4TV3A 5JHAA 2EIME 5HI7A 4ANUA 4ILHB 1S0PA 2KC7A 3ML8A 2XS1A 3PZDA 4O1OA 3NF1A 3R9MA 1SZ9A 1U3DA 5EX0A 2VSXE 3U3WA 2IONA 4GYWA 4N3AA 2V4HC 4W9RA 2DIWA 3GZ2A 3QARA 3R9AB 5JJ7A 3SFZA 4C0MA 5BUZA 1K8KG 5D2MC 2VSYA 4GZCA 1OWMA 5KJLA 4G23A 2VSOE 1NP7A 5FQ6A 2FBNA 3UT8A 1K3ZD 3C3QA 4NACA 4U7EB 3GZ1A 2UY1B 3MCXA 4H7XA 1H2UA 3UINC 1E8ZA 3CVQA 1BD8A 3TWVA 4L2LA 3N71A 3E4BA 3I4GA 3ZRHA 2FF4A 2R17C 3UT7A 1QZ2A 3ABKE 1D8EA 2EILE 1KZPA 3E37A 1OWLA 3C5RA 2BKGA 4GA0A 4UI9C 2X6KA 4Z68A 1NZNA 3HVEB 2IU1A 3X2QE 1A17A 4DX6D 2X6IA 5CERB 4FLHA 5EIBE 4I43A 3PNTB 3LS8A 5G04J 3T9KA 3S2AA 3ZHEA 3DRAA 2WQ7A 1SQMA 4CT4A 4EBAG 5FQ8A 3V30A 3LJ3A 2VGXA 2XS8A 3OTNA 4G8LA 1B89A 4LG6A 1MQSA 3DSSA 3Q7AA 1HH8A 1DVPA 2ZISA 5KBAA 4CRWA 1L5JA 2WVIA 5ENQD 2I6HA 3J5PA 1ELRA 4BT8A 3EHNA 2IOSA 3UM3A 4ACKA 3Q15A 3PEVB 2EQXA 2YQ8A 4UWKA 3ZPJA 4B89A 4ZHBA 4JB8P 2QFCA 3JQ1A 4J8SA 5LP0A 2BUGA 2LXMA 1P5QA 3FH8A 1EPUA 5FZQA 3HG0D 3FUMA 2OCCE 5B1AE 2XCCA 4JXTA 4LSZE 5CEDB 3ULEG 4BTAA 3C72A 3ASFA 3WXXA 4YDOA 2P9IG 2XZDG 2BF0X 5AQBA 1HX8A 4CEMA 2XPYA 3PDNA 4LEUA 4AM9A 2HYZA 3FUDA 4PUCA 1S70B 5FINA 5H7PA 3DSVA 4UI9K 1HXIA 4JD2G 3SD5A 5LFAA 2R5SA 3D9OA 4A1GA 3ZYLA 2RD0A 3CV0A 2QYJA 4FP7A 1OWPA 1X5BA 4BEPA 3UMVA 3JXJA 4PS7A 3S7DA 4Y6WA 3FP3A 5T3RA 2C0LA 4GYOA 3EUVA 3D9JA 4F1SA 1HZ4A 1WDYA 3KAEA 4OYSA 3CQGB 4L2YA 3MKRA 4N3BA 4V3IA 5E75A 3L08A 3T5VA 4LNUD 1PY1A 3QNKA 2GRLA 4I17A 3ABLE 1OCOE 2PZIA 4U95D 2IQCA 1HO8A 1ELKA 4I1AA 3CK9A 2OVBA 2J07A 1E8WA 4YDYA 2AWIA 3SBTB 5ENPD 2DYSE 2B0OE 2C2LA 2GW1A 4JVSA 2DCPA 2IOLA 3V2OA 1ZBPA 3QC1A 3CHSA 4YVOA 3ASGA 4WNGA 4ABNA 3D9NA 4ATGA 4HBDA 2Q7FA 3P2BA 3ESKA 4HLLA 3FTSA 3FFLA 3OXGA 2AXZA 4UWGA 1IKND 1HG2A 5A7DB 1N0QA 3BU8A 4XZ4A 2PQNA 2GRPB 4UI9J 2J4DA 4DX2A 3Q49B 3HXDA 1EDUA 5ARGA 1N4RA 3RO2A 1BU9A 1OT8A 4K03A 3DSWA 2R02A 1K1AA 5G55A 3UXGA 1UG3A 1Q2ZA 4WNDA 5AAOA 4G11A 4F1PA 1MYOA 3DSXA 3CVUA 4BX9A 1NL4A 4K0RA 1MX2A 1S64A 3G2WA 3RJVA 4DLOA 2WXMA 1FCHA 4RG6A 1O1RA 1BI7B 5KJMA 4FLBA 2R05A 4H7YA 4U96D 2WQ6A 4FHJA 3O4ZA 3D9LA 4EQFA 1MX6A 1JWFA 3CVNA 1FT2A 3LEWA 4NURA 3MYVA 2BEDA 1EYHA 3BQOA 2V5QC 1OCCE 4EPZA 5CBOA 2LSVA 5CHEE 3LY8A 2BKKB 4GMLA 1GW6A 3ASNE 1JCRA 3TG5A 4ANWA 3L16A 3AJIA 1HF8A 4OAUC 2GGFA 4MRUA 1TNBA 3HXEA 1YCSB 4DK5A 3IKOB 3APFA 3NBNB 4ANXA 4D10C 5EIDA 1TN8A 2PL2A 3Q75A 3ZN3A 2OEVA 4JA7A 2RKKA 3SZ7A 3PREA 3NQPA 3ZIMA 3EIQC 2NSZA 1H19A 1QNFA 4TUUA 3BG1B 5FZRA 2XCBA 4I2ZA 3C3RA 1XNFA 3T8KA 3S7BA 3S7FA 1IXVA 1V55E 5FQ4A 1TR4A 4NRHB 3EHMA 1TNUA 2KCVA 2A5UA 1LD8A 4XI0A 1DCQA 3FUJA 3L13A 3KSQA 3HHMA 3FTWA 3HDXA 2QC9A 4BY6A 3QWWA 4EZKA 3AS5A 1KT0A 3P1UA 5BNWA 1SW6A 4ME2A 1JCSA 4EHMA 2XEEA 3C3OA 2XEVA 4UWFA 2Y0BG 4IULA 5AYWD 3L54A 4BSZB 3ASOE 3E33A 3QKYA 3RAUA 1LF8A 2IY0C 5ENSD 3MJWA 1N0RA 4J0UA 3ZHEB 1KT1A 1LTXA 4HOQA 4U8HA 2J09A 2KCLA 5ENRD 4U8YD 3ABME 1TEZA 3ZFWA 1AWCB 2VTBA 1DCEA 2NXPA 4YNDA 2MHKA 3R7QA 3TJPA 1JWGA 4U0UA 2VGXB 1N4QA 4EBAA 4J8YA 4ILGA 4L1BA 3RKVA 2XENA 4GB9A 3Q9UC 3FUKA 4HRNA 2FEZA 4UWLA 4I1OB 1UJKA 5CMWA 3IV0A 3UI2A 3W9GA 2XRYA 4I1MA 3HXCA 2LSUA 3TWUA 2WXLA 4TXPA 3FULA 1UOHA 2Y69E 4ACLA 5ENTD 4XKBA 5J90A 2ZGGA 2HE0A 1ELWA 1WM5A 1S63A 1OWOA 4FJYA 5AN8A 4F53A 4B8AA 2GRMA 4HLEA 2E2EA 3DEOA 3KD7A 3V79K 2AJAA 5KCMA 5CCMA 4L23A 3VLFA 2L0IA 4WNEA 4RLYA 5KNGA 4HOSA 3AG3E 4DX1A 3PH0C 4QQIA 3QAQA 4N3CA 3SGHA 2FULA 4PH4B 2PNNA 3Q7FA 2H6HA 5BT1A 3EU9A 2KZTB 2WXPA 5AJLA 4KT6B 3DSTA 2DWZA 4GTMA 3ONKA 1HU3A 1OUVA 3D9PA 3UM2A 4HI8A 1FT1A 3ZYQA 2LNIA 3ZU7B 5CECB 2CG3A 2XPIA 3HIZA 1E90A 2EIKE 4RG9A 4LRZA 3IBEA 2X38A 2ILRA 3BEEA 3CHOA 1TNYA 1LD7A 3ASHA 3CVXA 3FTZA 3SQVA 2XPZA 3FUEA 2P9UG 1NFIE 3RRMB 4MBGA 4WWNA 2PM6A 5A23A 4KMOA 2WXRA 3ZNGA 1E96B 4I9CA 2WXFA 3V2XA 2VGYA 3VTYA 4CGWA 4DRXE 2XGSA 4WAFA 3FUHA 4FADA 2Y4TA 2NYJA 1IQUA 3ONLA 5CRUA 5HKPA 4K5BA 5LX8A 3B13A 1V54E 5BW8C 2DVWA 4O1PA 2DYRE 2YHCA 5CRVA 4UWHA 2Y1LE 4FC8A 1OXJA 4HOTA 2FI7A 1YA0A 3NB2A 3SBSA 3FTYA 4GA2A 2XZTG 3TWRA 3K9IA 2ZXWE 1Z6TA 5ANRA 2WXIA 1KPSB 5ANLA 2VSNA 3LJNA 1OY3D 3D9MA 3FUIA 4XKCA 3PE4A 4RQIA 1Y6IA 3RRNB 4BSXA 5AQ7A 3UKUG 3ISMC 5KJNA 4GTVA 3DXMG 3L17A 1O5MA 3FHEA 1PAQA 4N5QA 1BLXB 5BV1A 5T4YA 3TWQA 5FTPA 4HRLA 3HXFA 3RRUA 3RK6A 3TWXA 2ETBA 3FTUA 3UM0A 2IEJA 3W9FA 4G26A 3URZA 2H6IA 2IJGX 3LKUA 5AQ9A 4XEIG 2XEHA 2KZTA 4IYPA 3BUAA 1SZAA 1JCQA 4C0EA 3QWPA 2WM9A 5J08A 3Q9NC 3CGHA 3VLEA 1FVFA 3RO3A 4GMJA 3ESLA 5AQAA 3APCA 2FO7A 1YMPA 2ZU6B 4F3VA 5FJYA 3LCAA 1YYHA 3DWLG 1O1TA 3E30A 3CK8A 1DNPA 1HS6A 3PUJA 4YVQC 2IO3C 2XGMA 2V5FA 4G2VA 5C2YA 5A6CA 3CSFA 3TWWA 1WAO1 5T8IA 3B7BA 3NAWA 3BG0B 2WXJA 3PEUB 4TUMA 3GW4A 4CDMA 1N11A 3DPYA 5HRYA 2GROB 4OAVB 2LUHA 1SA4A 3Q73A 4G24A 5JJTA 4OVVA 3B7RL 3VTXA 1OWNA 3UPVA 3FEYA 1AP7A 4AVXA 2L6BA 4Y6CA 2H6GA 4UQYA 4GZ6A 4B94A 2CFUA 4U8VD 4C9BB 3ZGQA 2WXKA 1Y8MA 1E7UA 4HS2A 1Z3YA 2HM8A 3CIAA 2HO1A 3IHVA 4BT9A 4G8KA 2ETCA 4U0SA 4KBQA 2WXQA 3T8MA 3E34A 4LERA 3TG4A 2C0MA 5ENNA 3EHQA 2JEKA 2P9SG 2VTBB 4ILIA 3OAWA 3FU5A 4A1SA 5CCLA 1BPOA 2I9CA 3MGBA 3ASDA 3CK7A 4P29A 3CKCA 3APDA 3CVVA 3LPZA 1SVXA 1TJFA 3TWTA 3JXIA 4N39A 3UIOC 1E8XA 3ZEFA 5KJKA 2Y4UA 2P9LG 2WXOA 4BESA 5G05C 4GCNA 2JLBA 1TYQG 2IF4A 1K1BA 3TXMA 4M7CA 4CT0A 3CHQA 4QFVA 1OCZE 4IN3B 3PE3A 1NI1A 3S7JA 2CHZA 3AAAC 4GTTA 3Q4AB 4BETA 3ENEA 3F6QA 5FT9A 2UWJG 1N4PA 4BX8A 5CMYA 2F37A 3DXKG 3RU0A 1TN7A 3QB2A 2LO6A 1TNZA 1NA0A 3HYMB 3CKBA 1MX4A 2X6HA 2V0PA 3FUFA 3CHPA 3LDZA 3L6AA 3QK0A 4JEHA 3SNXA 3FTXA 4R7LA 5FIOA 4JZYA 1XGWA 4PS8A 4LUNU 3DSUA 4AEZC 2M63A 3ZKJA 2J8SD 4N2QA 4B0ZA 3Q78A 1H6OA 3CSTA 3U66A 3MV3B 4MS6A 3SFYA 4LCTA 4GZ5A 1NA3A 4KVMA 4AP2A 2WPVA 3OXFA 4XIFA 3FU6A 1MJ0A 3PZ2A 1G3NB 5EX3A 2YNQA 4BFRA 4LNGA 2CG2A 1KLXA 3FTVA 4GTPA 1UN9A 1UW4B 3TXNA 4HXIA 4A3VA 1W3BA 5FWQA 5EYLA 1H6PA 3UIPC 5BPPA 3D9KA 3KEZA 4HQDA 2GRQB 4B93B 2CFZA 5LCWC 3PUKA 4L9PA 2I1JA 1UJJA 3PZ3A 3L82A 3QOUA 3WG7E 3MZLB 4CDRA 4I6GA 3GYZA 2J9QA 5BXOA 4UUCA 3SFXA 1BI8B 1E8YA 4WNFA 2PM7A 5EN5D 5EYPF 1TJCA 2MRIA 3HRAA 4JPSA 4TXRA 1DC2A 4RVBA 5KNHD 4F7AA 3UX4A 2WXHA 2JABA 4KZ0A 3ZYKA 2I1KA 3HXBA 2LAIA 3D9HA 3G2VA 3QDNA 3G2UA 1QBQA 3TGOA 2AVPA 3DEPA 1D8DA 2ZIRA 2L6JA 4GZ3A 2XGOA 4WWOA 3PZ1A 5M72A 3IEGA 3ML9A 3VLDA 3CQCB 4GTOA 4XX5A 4KZCA 2X6JA 4CYMD 5HS0A 2V8SE 4U0ZA 1MZCA 4YDWA 4NIKA 1HG5A 2V4LA 4AY5A 1IQRA 3G2SA 5AJDA 5G05J 1QYMA 1JPLA 3EU5A 1KZOA 3JUEA 4WUYA 1TN6A 4HRMB 4NQ0A 2X6FA 3E32A 3R7RA 3AS8A 3ZYMA 4B8CB 3AS4A 4CDNA 2PQRA 2L0TB 3T5XA 2E0IA 5JJ6A 2KM4A 1ZU2A 2OOEA 2P58C 5KWDA 1HE8A 2RG8A 5D66A 3PNLB 4FHKA 1N9AA 3MKQA 2XHEA 4O6FA 4AJWA 3NOGD 3U9WA 1H0AA 3FH7A 3MV2B 4I9EA 1ZB1A 4BTBA 2GRRB 4MLPA 2J49A 3B7UX 3FU0A 4DUIA 1IHGA 4ZFHA 1H2TC 5LOZA 4PDXA 2YINA 1Z5SC 4KXKB 4EECA 4JL0A 3FUNA 3G2TA 4J8DA 4GTRA 1QQEA 2H6FA 4J8FA 5AIJA 2EINE 2P9PG 3LVQE 2ZGDA 2I2OA 3UUXA 4WWPA 3KEAA 1PC2A 2YHEA 5JMND 1IYGA 4AY6A 3U64A 2AXUA 2MYOA 4EZLA 3AG2E 3L22A 1N4SA 3L9TA 3NOCD 3Q79A 3I4RB 1U2VG 4MKTA 2OV8A 2IO2C 5E76A 4APFA 4A55A 4K5AB 4IRUA 3PS6A 1FPPA 3UQ3A 4GYYA 4FJZA 3J5QB 2DZNA 4GZDA 4I6JA 2ONDA 3QJZA 4GPKA 4FA6A 4DX7D 2P9KG 4URKA 5LCWJ 3V31A 2CHXA 2F0YA 4AOFA 1TNOA 5C1DA 3FY4A 2P9NG 1MHQA 2VGEA 1RW2A 2RFMA 3RIBA 4GTSA 4GA1A 5ITZF 1WY6A 4RSYA 1H2VC 4U04A 5DBKA 2L9BA 2F8YA 2UY1A 2A5EA 4TRQA 3ULQA 4JHKA 2AXVA 1FVHA 3KSLA 3TWSA 4EZJA 3NZSA 3CVPA 5JA4D 3PRZA 3FH5A 3SY2A 3UKRG 2WXNA 4DLQA 2AW6A 4N5CA 4G1TA 2OEWA 4YDEA 2XQ0A 3AG1E 4F6RD 5EKQD 3B7TA 3HVEA 4Q94A 3KS2A 1N52A 1INZA 1WG0A 2X3MA 2ETAA 4CZ2D 4FULA 5JHBA 5B3SE 1HFAA 3JCKC 5FZSA 4JA9A 2IFUA 2DBAA 3CLJA 3FU3A 4HORA 4Q69A 4TXQA 4FU3A 5AARA 4JHJA 3LVRE 2RFAA 3EIJA 1N95A 2KCKA 3ULYA 2NC9A 3GZSA 1IHBA 4K5CA 3TAXA 4GU5A 2MOWA 1X81A 2LXLA 3ZW3A 2Y3AA 4GPMA 4UQXA 2CHWA 4M3OA 4X8QA 4J7WA 2DZOA 2VJ8A 2B6CA 2QY7A 5BXUA 3MX3A 3SO8A 4XE0A 4C48B 5CEAA 2VYIA 4GTQA 3EJNA 3IXEA 4HB5A 5B1BE 2P2CP 3LY7A 3JQ0A 4CCAA 4JEUA 3O48A 2KBXA 5ENOD 4OVUA 3EDTB 4JHRA 3CVLA 4U63A 2J08A 4HI9A 3ZVVA 5AENA 1D9SA 4Q96A 4GMRA 3DPDA 3D3MA 2R2LA 4I2WA 3LXUX 1UN8A 3CVYA 2LAHA 2R03A 1Z3XA 1A5EA 2BTDA 1N54A 4J8EA 3SHFA 3PZ4A 4DJAA 3Q5MA 3CHMA 3LYAA 4KVOA 5D0QD 2WXGA 2A4ZA 4JW1A 2WMOA 3B95A 4CGVA 5ARFA 4DPRA 4LNBA 4BERA
chains in the Genus database with same CATH topology
3CK9A 5DIZA 2OVBA 2J07A 4JPSA 1E8WA 5D0OD 4HFGA 5BW8C 3CR3A 4RVBA 4F7AA 3UX4A 2WXHA 2R59A 2AWIA 3SBTB 2YHCA 4DI4A 4UWHA 2WB2A 3C98A 4KZ0A 4FC8A 3ZYKA 2C2LA 4HOTA 2FI7A 2I1KA 3FEXA 2LAIA 2GW1A 4AXHA 2HR2A 3NZUA 2DCPA 3G2VA 3QDNA 1YA0A 2IOLA 4JVSA 3G2UA 1ZBPA 3FTYA 3SBSA 3QC1A 4KYOB 5G04C 3TGOA 3CHSA 4GA2A 2AVPA 4UQZA 3SF4A 3K9IA 4I6EA 2OVFA 4HVBA 3U4TA 1Z6TA 4YVOA 5ANRA 3ASGA 2WXIA 2L6JA 3MA5A 4GZ3A 4APOA 5ANLA 2XGOA 2VSNA 4WNGA 4WWOA 4ABNA 3D9NA 4AIFA 5M72A 3D9MA 3FUIA 3IEGA 3MEKA 3CHRA 3ML9A 3VLDA 4XKCA 4ATGA 3PE4A 2Q7FA 4E85A 1Y6IA 3CQCB 3ESKA 3P2BA 3RRNB 3I5PA 4XX5A 4BSXA 4KZCA 2X6JA 3FTSA 2V8SE 3FFLA 3OXGA 2AXZA 4U0ZA 4UWGA 3Q47B 5KJNA 3TL5A 1HG2A 1HG5A 5A7DB 2V4LA 4AY5A 5EDSA 1IQRA 3G2SA 1E7VA 3AU5A 4XZ4A 2PQNA 3L17A 5AJDA 4UI9J 5G05J 3FHEA 1PAQA 3MKQB 1JPLA 2J4DA 4DI3A 4XI9A 4ANVA 4HOUA 3SI5A 5BV1A 5T4YA 3Q49B 4AV7A 4WUYA 5FTPA 1EDUA 1EF1C 5ARGA 2XRZA 4NQ0A 3RO2A 2KATA 2X6FA 3PVLA 3R7RA 3AS8A 4K03A 3ZYMA 1H6KA 1VDYA 3ZXSA 3RRUA 4B8CB 3RK6A 3AS4A 3FTUA 5G55A 2WMNA 1UG3A 4G26A 4WNDA 4CDNA 3URZA 2PQRA 2IJGX 3AU4A 4G11A 2L0TB 4N2SA 3T5XA 3CVUA 2E0IA 3IHYA 3LKUA 4BX9A 4PS3A 4K0RA 5JJ6A 2KM4A 3FDHA 3I3NA 3CEQA 1ZU2A 2OOEA 3B7SA 2KZTA 3G2WA 2P58C 4IYPA 3QWVA 3RJVA 5HQ8A 1SZAA 4JC8A 1HE8A 2RG8A 3DBSA 3D9IA 4DLOA 3PNLB 1U3CA 4G25A 4L7TA 4C0EA 2WXMA 4FHKA 3MKQA 1FCHA 4RG6A 2XHEA 3QWPA 4O6FA 4U07A 2WM9A 5J08A 5KJMA 4FLBA 3CGHA 3VLEA 4AJWA 1FVFA 4H7YA 3RO3A 3U9WA 1H0AA 3FH7A 4GMJA 4E6HA 3MV2B 4I9EA 1JUQA 4BTBA 2WQ6A 4MLPA 4FHJA 3FWVA 2J49A 3B7UX 4BWRA 3ESLA 3APCA 3O4ZA 3D9LA 3FU0A 2FO7A 1IHGA 3JYSA 4EQFA 2ZU6B 4F3VA 3CVWA 5FJYA 4GCOA 1JWFA 3CVNA 3LCAA 3CK8A 4GAAA 1DNPA 1H2TC 1HS6A 2VQ2A 3PUJA 4YVQC 5G2NA 5LOZA 4PDXA 2YINA 3LY9A 2XGMA 2WQHA 2V5FA 4G2VA 4KXKB 5C2YA 5FQ7A 5BV0A 5A6CA 3CSFA 4EECA 3LEWA 4JL0A 4NURA 3FUNA 3MYVA 1WAO1 3UT4A 5T8IA 1EYHA 3G2TA 4J8DA 4A3TA 2J4BA 3BG0B 3JUIA 4EPZA 2WXJA 1QQEA 2LSVA 3PEUB 4J8FA 5CHEE 3GW4A 3LY8A 3OXLA 5AIJA 4CDMA 3LVQE 4GMLA 1GW6A 2I2OA 4J6IA 3TG5A 4ANWA 3UUXA 3L16A 4TV3A 5JHAA 4WWPA 1HF8A 1PC2A 2GGFA 5HI7A 4ANUA 4MRUA 4G24A 1S0PA 2KC7A 4ILHB 2YHEA 3ML8A 3PZDA 4DK5A 3IKOB 3NF1A 5JJTA 4OVVA 1IYGA 3APFA 1SZ9A 1U3DA 5EX0A 3B7RL 4AY6A 3U64A 2VSXE 5LCWC 3U3WA 2IONA 2AXUA 3VTXA 1OWNA 4ANXA 4D10C 4GYWA 4N3AA 3UPVA 3FEYA 2PL2A 2DIWA 3GZ2A 3QARA 4W9RA 4AVXA 4EZLA 3R9AB 3L22A 4Y6CA 5JJ7A 3ZN3A 4JA7A 3SFZA 4C0MA 4UQYA 4GZ6A 4B94A 2CFUA 3SZ7A 3PREA 5BUZA 3I4RB 3NQPA 3ZIMA 4C9BB 4MKTA 2OV8A 3ZGQA 2WXKA 1Y8MA 3EIQC 2NSZA 5E76A 1E7UA 1H19A 4HS2A 1QNFA 2VSYA 1Z3YA 4TUUA 3BG1B 4APFA 5FZRA 4GZCA 1OWMA 3PS6A 4IRUA 4A55A 5KJLA 4G23A 2XCBA 4I2ZA 2HM8A 3UQ3A 3CIAA 4GYYA 2VSOE 1NP7A 2HO1A 1XNFA 4FJZA 3IHVA 4GZDA 5FQ6A 2FBNA 4I6JA 3S7BA 2ONDA 3S7FA 3UT8A 4BT9A 3QJZA 5FQ4A 4GPKA 4NACA 4U0SA 4KBQA 2WXQA 4FA6A 4NRHB 3EHMA 3T8MA 3GZ1A 4URKA 2KCVA 2A5UA 4LERA 3TG4A 2UY1B 3MCXA 4H7XA 4XI0A 1H2UA 3FUJA 1E8ZA 5LCWJ 2C0MA 3CVQA 5ENNA 2CHXA 2JEKA 4AOFA 4L2LA 2VTBB 3L13A 5C1DA 3FY4A 3HHMA 3N71A 3FTWA 3HDXA 4BY6A 1MHQA 3QWWA 4ILIA 3OAWA 3E4BA 3I4GA 3AS5A 1HO8A 4EZKA 3FU5A 1KT0A 4A1SA 3P1UA 5CCLA 3ZRHA 2FF4A 1BPOA 2I9CA 2R17C 4ME2A 3UT7A 5BNWA 3MGBA 1QZ2A 3ASDA 2XEVA 3CK7A 4P29A 3RIBA 4UWFA 4GA1A 4IULA 3CKCA 5AYWD 3APDA 1WY6A 3L54A 3LPZA 3CVVA 3QKYA 4RSYA 1TJFA 1H2VC 1LF8A 4U04A 4N39A 5DBKA 1OWLA 2L9BA 1E8XA 3MJWA 3ZEFA 4J0UA 3ZHEB 2UY1A 2Y4UA 4GA0A 1KT1A 5KJKA 4HOQA 4U8HA 2J09A 2KCLA 2WXOA 4TRQA 2X6KA 4UI9C 5G05C 1TEZA 3ZFWA 1NZNA 3ULQA 4JHKA 3HVEB 2IU1A 2VTBA 2NXPA 2AXVA 4GCNA 4YNDA 1FVHA 2MHKA 2JLBA 3R7QA 3TJPA 1JWGA 4EZJA 3NZSA 3CVPA 1A17A 2IF4A 2X6IA 4U0UA 2VGXB 4FLHA 3PRZA 3TXMA 4EBAA 3FH5A 4I43A 3PNTB 4ILGA 2WXNA 4CT0A 3CHQA 3LS8A 4QFVA 4DLQA 4L1BA 2AW6A 4IN3B 5G04J 3RKVA 4N5CA 4G1TA 4GB9A 3PE3A 3S7JA 2CHZA 2XQ0A 3S2AA 3ZHEA 3Q4AB 3FUKA 3ENEA 5EKQD 3B7TA 5FT9A 2UWJG 2WQ7A 3HVEA 1SQMA 4Q94A 3KS2A 4CT4A 4EBAG 4BX8A 1N52A 5FQ8A 5CMYA 1INZA 2FEZA 3RU0A 4UWLA 4I1OB 1UJKA 2X3MA 3LJ3A 5CMWA 3IV0A 2VGXA 4FULA 5JHBA 3QB2A 1HFAA 3JCKC 5FZSA 4JA9A 2LO6A 2XRYA 2IFUA 4I1MA 1NA0A 3OTNA 2DBAA 3CLJA 1B89A 2LSUA 3FU3A 3HYMB 1MQSA 4HORA 3CKBA 2WXLA 1HH8A 4Q69A 4FU3A 1DVPA 3FULA 4ACLA 1L5JA 2WVIA 2X6HA 4JHJA 4CRWA 3LVRE 4XKBA 2V0PA 5J90A 2I6HA 3EIJA 3FUFA 3CHPA 1ELRA 2KCKA 4BT8A 2NC9A 3EHNA 3L6AA 3GZSA 3LDZA 3QK0A 2IOSA 1ELWA 4ACKA 1WM5A 4FJYA 1OWOA 3Q15A 3PEVB 4F53A 3TAXA 4JEHA 4B8AA 2YQ8A 2EQXA 4UWKA 2GRMA 4HLEA 4GU5A 2MOWA 2E2EA 3SNXA 3ZW3A 3FTXA 4R7LA 2Y3AA 3KD7A 4UQXA 2CHWA 4M3OA 3ZPJA 4B89A 4JZYA 1XGWA 2QFCA 5KCMA 3JQ1A 5CCMA 4L23A 4J8SA 2VJ8A 3VLFA 4PS8A 2L0IA 2BUGA 4WNEA 5LP0A 4LUNU 4AEZC 4HOSA 2M63A 1P5QA 3FH8A 2QY7A 4N2QA 3MX3A 3PH0C 4B0ZA 1EPUA 5FZQA 3CSTA 3QAQA 4XE0A 3FUMA 3U66A 4N3CA 3SGHA 2FULA 2XCCA 3MV3B 4MS6A 4PH4B 4JXTA 5BT1A 4BTAA 4LCTA 3ASFA 2VYIA 4GZ5A 3WXXA 2KZTB 2WXPA 5AJLA 1NA3A 4KT6B 4KVMA 4AP2A 2WPVA 3EJNA 3OXFA 2BF0X 1HX8A 3LY7A 4XIFA 3JQ0A 4CEMA 3ONKA 3FU6A 4CCAA 2XPYA 1HU3A 4JEUA 3PDNA 4LEUA 1OUVA 3O48A 2HYZA 3D9PA 3FUDA 4PUCA 4AM9A 3ZYQA 2LNIA 4OVUA 5EX3A 2YNQA 4BFRA 2CG3A 2XPIA 2CG2A 3HIZA 1KLXA 1E90A 3FTVA 4RG9A 3EDTB 4JHRA 3CVLA 4LRZA 4U63A 1UN9A 2J08A 1UW4B 3IBEA 2X38A 4UI9K 3ZVVA 5AENA 3TXNA 2ILRA 4Q96A 1HXIA 3BEEA 4HXIA 3SD5A 4A3VA 5LFAA 3CHOA 1W3BA 2R5SA 3D9OA 5FWQA 4A1GA 3ZYLA 5BPPA 3D9KA 3DPDA 3KEZA 2RD0A 3CV0A 3D3MA 4I2WA 3LXUX 4FP7A 3ASHA 1UN8A 1OWPA 1X5BA 3CVXA 3FTZA 3CVYA 2CFZA 2LAHA 3UMVA 2XPZA 1Z3XA 3PUKA 4PS7A 4Y6WA 2BTDA 1N54A 3FP3A 4J8EA 5T3RA 3S7DA 3FUEA 2C0LA 4GYOA 2I1JA 3RRMB 3D9JA 3SHFA 1UJJA 4WWNA 4F1SA 2PM6A 1HZ4A 5A23A 3QOUA 3KAEA 4OYSA 3CQGB 4DJAA 4KMOA 4L2YA 3MZLB 4CDRA 4I6GA 2WXRA 3GYZA 3Q5MA 1E96B 3CHMA 3MKRA 4N3BA 3LYAA 2J9QA 4I9CA 4KVOA 2WXFA 4V3IA 2VGYA 5D0QD 3VTYA 5E75A 4CGWA 2XGSA 2WXGA 3L08A 3T5VA 2A4ZA 1PY1A 4JW1A 4WAFA 3FUHA 4FADA 2Y4TA 3QNKA 2WMOA 1E8YA 2GRLA 4I17A 4WNFA 2PM7A 4CGVA 1IQUA 1TJCA 2MRIA 2PZIA 3ONLA 5ARFA 4DPRA 2IQCA 5LX8A 1ELKA 3B13A 4I1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJJ A;  2MOW A;  1HG2 A;  1HFA A;  1HG5 A;  1H0A A;  1EYH A;  3G2T A;  2LO6 A;  4GZC A;  4HFG A;  2L0T B;  1SZ9 A;  1JUQ A;  4Q96 A;  1MHQ A;  3G2S A;  1XGW A;  3CLJ A;  2BF0 X;  2KM4 A;  1HX8 A;  3D9O A;  3D9L A;  4GZD A;  3D9N A;  2L0I A;  4FU3 A;  1JPL A;  5LP0 A;  3ZYL A;  1DVP A;  3D9K A;  3D9M A;  3G2W A;  2DIW A;  3ONK A;  4AVX A;  1SZA A;  4NAC A;  1JWG A;  1PY1 A;  2QY7 A;  1JWF A;  1X5B A;  3D9I A;  3ZYK A;  3D9P A;  4Q94 A;  1EDU A;  3LDZ A;  1HF8 A;  3ZYQ A;  5CMY A;  5LOZ A;  2DCP A;  3G2V A;  1INZ A;  3ONL A;  3G2U A;  3ZYM A;  1UJK A;  2V8S E;  1VDY A;  4JXT A;  1LF8 A;  5CMW A;  3RRU A;  5J08 A;  1ELK A;  3D9J A;  4FLB A; 
#chains in the Genus database with same CATH topology
 5DIZ A;  3RSE G;  5D0O D;  4HFG A;  3CR3 A;  4HNA D;  2R59 A;  4DI4 A;  2WB2 A;  3C98 A;  1OCR E;  3FEX A;  4AXH A;  2HR2 A;  3NZU A;  4KYO B;  5G04 C;  2F8X K;  4UQZ A;  3SF4 A;  4I6E A;  2OVF A;  4HVB A;  3U4T A;  3MA5 A;  4APO A;  4AIF A;  3MEK A;  3CHR A;  4DX5 D;  4E85 A;  3I5P A;  3UTM A;  3Q47 B;  3TL5 A;  5CBN A;  5EDS A;  1E7V A;  3AU5 A;  3MKQ B;  4DI3 A;  4XI9 A;  4ANV A;  4HOU A;  3SI5 A;  4AV7 A;  1EF1 C;  3ZUV B;  2XRZ A;  3UM1 A;  2KAT A;  2QZA A;  3PVL A;  1H6K A;  1VDY A;  3ZXS A;  2WMN A;  3EHR A;  3AU4 A;  4N2S A;  1RZ4 A;  3IHY A;  4PS3 A;  3FDH A;  3I3N A;  3CEQ A;  3B7S A;  1SA5 A;  3QWV A;  5HQ8 A;  4JC8 A;  3DBS A;  3D9I A;  1U3C A;  4G25 A;  4L7T A;  3AG4 E;  5EIL A;  1N94 A;  1O1S A;  4U07 A;  4E6H A;  1JUQ A;  3FWV A;  4BWR A;  2QYU A;  3JYS A;  3CVW A;  4GCO A;  4ATZ D;  4A63 B;  3ZXP A;  4GAA A;  2GRN B;  5G2N A;  2VQ2 A;  3LY9 A;  2WQH A;  4O60 A;  5FQ7 A;  5BV0 A;  3UT4 A;  4A3T A;  5IY5 E;  2J4B A;  3JUI A;  2KXP C;  3OXL A;  2FO1 E;  4J6I A;  2EIJ E;  4TV3 A;  5JHA A;  2EIM E;  5HI7 A;  4ANU A;  4ILH B;  1S0P A;  2KC7 A;  3ML8 A;  2XS1 A;  3PZD A;  4O1O A;  3NF1 A;  3R9M A;  1SZ9 A;  1U3D A;  5EX0 A;  2VSX E;  3U3W A;  2ION A;  4GYW A;  4N3A A;  2V4H C;  4W9R A;  2DIW A;  3GZ2 A;  3QAR A;  3R9A B;  5JJ7 A;  3SFZ A;  4C0M A;  5BUZ A;  1K8K G;  5D2M C;  2VSY A;  4GZC A;  1OWM A;  5KJL A;  4G23 A;  2VSO E;  1NP7 A;  5FQ6 A;  2FBN A;  3UT8 A;  1K3Z D;  3C3Q A;  4NAC A;  4U7E B;  3GZ1 A;  2UY1 B;  3MCX A;  4H7X A;  1H2U A;  3UIN C;  1E8Z A;  3CVQ A;  1BD8 A;  3TWV A;  4L2L A;  3N71 A;  3E4B A;  3I4G A;  3ZRH A;  2FF4 A;  2R17 C;  3UT7 A;  1QZ2 A;  3ABK E;  1D8E A;  2EIL E;  1KZP A;  3E37 A;  1OWL A;  3C5R A;  2BKG A;  4GA0 A;  4UI9 C;  2X6K A;  4Z68 A;  1NZN A;  3HVE B;  2IU1 A;  3X2Q E;  1A17 A;  4DX6 D;  2X6I A;  5CER B;  4FLH A;  5EIB E;  4I43 A;  3PNT B;  3LS8 A;  5G04 J;  3T9K A;  3S2A A;  3ZHE A;  3DRA A;  2WQ7 A;  1SQM A;  4CT4 A;  4EBA G;  5FQ8 A;  3V30 A;  3LJ3 A;  2VGX A;  2XS8 A;  3OTN A;  4G8L A;  1B89 A;  4LG6 A;  1MQS A;  3DSS A;  3Q7A A;  1HH8 A;  1DVP A;  2ZIS A;  5KBA A;  4CRW A;  1L5J A;  2WVI A;  5ENQ D;  2I6H A;  3J5P A;  1ELR A;  4BT8 A;  3EHN A;  2IOS A;  3UM3 A;  4ACK A;  3Q15 A;  3PEV B;  2EQX A;  2YQ8 A;  4UWK A;  3ZPJ A;  4B89 A;  4ZHB A;  4JB8 P;  2QFC A;  3JQ1 A;  4J8S A;  5LP0 A;  2BUG A;  2LXM A;  1P5Q A;  3FH8 A;  1EPU A;  5FZQ A;  3HG0 D;  3FUM A;  2OCC E;  5B1A E;  2XCC A;  4JXT A;  4LSZ E;  5CED B;  3ULE G;  4BTA A;  3C72 A;  3ASF A;  3WXX A;  4YDO A;  2P9I G;  2XZD G;  2BF0 X;  5AQB A;  1HX8 A;  4CEM A;  2XPY A;  3PDN A;  4LEU A;  4AM9 A;  2HYZ A;  3FUD A;  4PUC A;  1S70 B;  5FIN A;  5H7P A;  3DSV A;  4UI9 K;  1HXI A;  4JD2 G;  3SD5 A;  5LFA A;  2R5S A;  3D9O A;  4A1G A;  3ZYL A;  2RD0 A;  3CV0 A;  2QYJ A;  4FP7 A;  1OWP A;  1X5B A;  4BEP A;  3UMV A;  3JXJ A;  4PS7 A;  3S7D A;  4Y6W A;  3FP3 A;  5T3R A;  2C0L A;  4GYO A;  3EUV A;  3D9J A;  4F1S A;  1HZ4 A;  1WDY A;  3KAE A;  4OYS A;  3CQG B;  4L2Y A;  3MKR A;  4N3B A;  4V3I A;  5E75 A;  3L08 A;  3T5V A;  4LNU D;  1PY1 A;  3QNK A;  2GRL A;  4I17 A;  3ABL E;  1OCO E;  2PZI A;  4U95 D;  2IQC A;  1HO8 A;  1ELK A;  4I1A A;  3CK9 A;  2OVB A;  2J07 A;  1E8W A;  4YDY A;  2AWI A;  3SBT B;  5ENP D;  2DYS E;  2B0O E;  2C2L A;  2GW1 A;  4JVS A;  2DCP A;  2IOL A;  3V2O A;  1ZBP A;  3QC1 A;  3CHS A;  4YVO A;  3ASG A;  4WNG A;  4ABN A;  3D9N A;  4ATG A;  4HBD A;  2Q7F A;  3P2B A;  3ESK A;  4HLL A;  3FTS A;  3FFL A;  3OXG A;  2AXZ A;  4UWG A;  1IKN D;  1HG2 A;  5A7D B;  1N0Q A;  3BU8 A;  4XZ4 A;  2PQN A;  2GRP B;  4UI9 J;  2J4D A;  4DX2 A;  3Q49 B;  3HXD A;  1EDU A;  5ARG A;  1N4R A;  3RO2 A;  1BU9 A;  1OT8 A;  4K03 A;  3DSW A;  2R02 A;  1K1A A;  5G55 A;  3UXG A;  1UG3 A;  1Q2Z A;  4WND A;  5AAO A;  4G11 A;  4F1P A;  1MYO A;  3DSX A;  3CVU A;  4BX9 A;  1NL4 A;  4K0R A;  1MX2 A;  1S64 A;  3G2W A;  3RJV A;  4DLO A;  2WXM A;  1FCH A;  4RG6 A;  1O1R A;  1BI7 B;  5KJM A;  4FLB A;  2R05 A;  4H7Y A;  4U96 D;  2WQ6 A;  4FHJ A;  3O4Z A;  3D9L A;  4EQF A;  1MX6 A;  1JWF A;  3CVN A;  1FT2 A;  3LEW A;  4NUR A;  3MYV A;  2BED A;  1EYH A;  3BQO A;  2V5Q C;  1OCC E;  4EPZ A;  5CBO A;  2LSV A;  5CHE E;  3LY8 A;  2BKK B;  4GML A;  1GW6 A;  3ASN E;  1JCR A;  3TG5 A;  4ANW A;  3L16 A;  3AJI A;  1HF8 A;  4OAU C;  2GGF A;  4MRU A;  1TNB A;  3HXE A;  1YCS B;  4DK5 A;  3IKO B;  3APF A;  3NBN B;  4ANX A;  4D10 C;  5EID A;  1TN8 A;  2PL2 A;  3Q75 A;  3ZN3 A;  2OEV A;  4JA7 A;  2RKK A;  3SZ7 A;  3PRE A;  3NQP A;  3ZIM A;  3EIQ C;  2NSZ A;  1H19 A;  1QNF A;  4TUU A;  3BG1 B;  5FZR A;  2XCB A;  4I2Z A;  3C3R A;  1XNF A;  3T8K A;  3S7B A;  3S7F A;  1IXV A;  1V55 E;  5FQ4 A;  1TR4 A;  4NRH B;  3EHM A;  1TNU A;  2KCV A;  2A5U A;  1LD8 A;  4XI0 A;  1DCQ A;  3FUJ A;  3L13 A;  3KSQ A;  3HHM A;  3FTW A;  3HDX A;  2QC9 A;  4BY6 A;  3QWW A;  4EZK A;  3AS5 A;  1KT0 A;  3P1U A;  5BNW A;  1SW6 A;  4ME2 A;  1JCS A;  4EHM A;  2XEE A;  3C3O A;  2XEV A;  4UWF A;  2Y0B G;  4IUL A;  5AYW D;  3L54 A;  4BSZ B;  3ASO E;  3E33 A;  3QKY A;  3RAU A;  1LF8 A;  2IY0 C;  5ENS D;  3MJW A;  1N0R A;  4J0U A;  3ZHE B;  1KT1 A;  1LTX A;  4HOQ A;  4U8H A;  2J09 A;  2KCL A;  5ENR D;  4U8Y D;  3ABM E;  1TEZ A;  3ZFW A;  1AWC B;  2VTB A;  1DCE A;  2NXP A;  4YND A;  2MHK A;  3R7Q A;  3TJP A;  1JWG A;  4U0U A;  2VGX B;  1N4Q A;  4EBA A;  4J8Y A;  4ILG A;  4L1B A;  3RKV A;  2XEN A;  4GB9 A;  3Q9U C;  3FUK A;  4HRN A;  2FEZ A;  4UWL A;  4I1O B;  1UJK A;  5CMW A;  3IV0 A;  3UI2 A;  3W9G A;  2XRY A;  4I1M A;  3HXC A;  2LSU A;  3TWU A;  2WXL A;  4TXP A;  3FUL A;  1UOH A;  2Y69 E;  4ACL A;  5ENT D;  4XKB A;  5J90 A;  2ZGG A;  2HE0 A;  1ELW A;  1WM5 A;  1S63 A;  1OWO A;  4FJY A;  5AN8 A;  4F53 A;  4B8A A;  2GRM A;  4HLE A;  2E2E A;  3DEO A;  3KD7 A;  3V79 K;  2AJA A;  5KCM A;  5CCM A;  4L23 A;  3VLF A;  2L0I A;  4WNE A;  4RLY A;  5KNG A;  4HOS A;  3AG3 E;  4DX1 A;  3PH0 C;  4QQI A;  3QAQ A;  4N3C A;  3SGH A;  2FUL A;  4PH4 B;  2PNN A;  3Q7F A;  2H6H A;  5BT1 A;  3EU9 A;  2KZT B;  2WXP A;  5AJL A;  4KT6 B;  3DST A;  2DWZ A;  4GTM A;  3ONK A;  1HU3 A;  1OUV A;  3D9P A;  3UM2 A;  4HI8 A;  1FT1 A;  3ZYQ A;  2LNI A;  3ZU7 B;  5CEC B;  2CG3 A;  2XPI A;  3HIZ A;  1E90 A;  2EIK E;  4RG9 A;  4LRZ A;  3IBE A;  2X38 A;  2ILR A;  3BEE A;  3CHO A;  1TNY A;  1LD7 A;  3ASH A;  3CVX A;  3FTZ A;  3SQV A;  2XPZ A;  3FUE A;  2P9U G;  1NFI E;  3RRM B;  4MBG A;  4WWN A;  2PM6 A;  5A23 A;  4KMO A;  2WXR A;  3ZNG A;  1E96 B;  4I9C A;  2WXF A;  3V2X A;  2VGY A;  3VTY A;  4CGW A;  4DRX E;  2XGS A;  4WAF A;  3FUH A;  4FAD A;  2Y4T A;  2NYJ A;  1IQU A;  3ONL A;  5CRU A;  5HKP A;  4K5B A;  5LX8 A;  3B13 A;  1V54 E;  5BW8 C;  2DVW A;  4O1P A;  2DYR E;  2YHC A;  5CRV A;  4UWH A;  2Y1L E;  4FC8 A;  1OXJ A;  4HOT A;  2FI7 A;  1YA0 A;  3NB2 A;  3SBS A;  3FTY A;  4GA2 A;  2XZT G;  3TWR A;  3K9I A;  2ZXW E;  1Z6T A;  5ANR A;  2WXI A;  1KPS B;  5ANL A;  2VSN A;  3LJN A;  1OY3 D;  3D9M A;  3FUI A;  4XKC A;  3PE4 A;  4RQI A;  1Y6I A;  3RRN B;  4BSX A;  5AQ7 A;  3UKU G;  3ISM C;  5KJN A;  4GTV A;  3DXM G;  3L17 A;  1O5M A;  3FHE A;  1PAQ A;  4N5Q A;  1BLX B;  5BV1 A;  5T4Y A;  3TWQ A;  5FTP A;  4HRL A;  3HXF A;  3RRU A;  3RK6 A;  3TWX A;  2ETB A;  3FTU A;  3UM0 A;  2IEJ A;  3W9F A;  4G26 A;  3URZ A;  2H6I A;  2IJG X;  3LKU A;  5AQ9 A;  4XEI G;  2XEH A;  2KZT A;  4IYP A;  3BUA A;  1SZA A;  1JCQ A;  4C0E A;  3QWP A;  2WM9 A;  5J08 A;  3Q9N C;  3CGH A;  3VLE A;  1FVF A;  3RO3 A;  4GMJ A;  3ESL A;  5AQA A;  3APC A;  2FO7 A;  1YMP A;  2ZU6 B;  4F3V A;  5FJY A;  3LCA A;  1YYH A;  3DWL G;  1O1T A;  3E30 A;  3CK8 A;  1DNP A;  1HS6 A;  3PUJ A;  4YVQ C;  2IO3 C;  2XGM A;  2V5F A;  4G2V A;  5C2Y A;  5A6C A;  3CSF A;  3TWW A;  1WAO 1;  5T8I A;  3B7B A;  3NAW A;  3BG0 B;  2WXJ A;  3PEU B;  4TUM A;  3GW4 A;  4CDM A;  1N11 A;  3DPY A;  5HRY A;  2GRO B;  4OAV B;  2LUH A;  1SA4 A;  3Q73 A;  4G24 A;  5JJT A;  4OVV A;  3B7R L;  3VTX A;  1OWN A;  3UPV A;  3FEY A;  1AP7 A;  4AVX A;  2L6B A;  4Y6C A;  2H6G A;  4UQY A;  4GZ6 A;  4B94 A;  2CFU A;  4U8V D;  4C9B B;  3ZGQ A;  2WXK A;  1Y8M A;  1E7U A;  4HS2 A;  1Z3Y A;  2HM8 A;  3CIA A;  2HO1 A;  3IHV A;  4BT9 A;  4G8K A;  2ETC A;  4U0S A;  4KBQ A;  2WXQ A;  3T8M A;  3E34 A;  4LER A;  3TG4 A;  2C0M A;  5ENN A;  3EHQ A;  2JEK A;  2P9S G;  2VTB B;  4ILI A;  3OAW A;  3FU5 A;  4A1S A;  5CCL A;  1BPO A;  2I9C A;  3MGB A;  3ASD A;  3CK7 A;  4P29 A;  3CKC A;  3APD A;  3CVV A;  3LPZ A;  1SVX A;  1TJF A;  3TWT A;  3JXI A;  4N39 A;  3UIO C;  1E8X A;  3ZEF A;  5KJK A;  2Y4U A;  2P9L G;  2WXO A;  4BES A;  5G05 C;  4GCN A;  2JLB A;  1TYQ G;  2IF4 A;  1K1B A;  3TXM A;  4M7C A;  4CT0 A;  3CHQ A;  4QFV A;  1OCZ E;  4IN3 B;  3PE3 A;  1NI1 A;  3S7J A;  2CHZ A;  3AAA C;  4GTT A;  3Q4A B;  4BET A;  3ENE A;  3F6Q A;  5FT9 A;  2UWJ G;  1N4P A;  4BX8 A;  5CMY A;  2F37 A;  3DXK G;  3RU0 A;  1TN7 A;  3QB2 A;  2LO6 A;  1TNZ A;  1NA0 A;  3HYM B;  3CKB A;  1MX4 A;  2X6H A;  2V0P A;  3FUF A;  3CHP A;  3LDZ A;  3L6A A;  3QK0 A;  4JEH A;  3SNX A;  3FTX A;  4R7L A;  5FIO A;  4JZY A;  1XGW A;  4PS8 A;  4LUN U;  3DSU A;  4AEZ C;  2M63 A;  3ZKJ A;  2J8S D;  4N2Q A;  4B0Z A;  3Q78 A;  1H6O A;  3CST A;  3U66 A;  3MV3 B;  4MS6 A;  3SFY A;  4LCT A;  4GZ5 A;  1NA3 A;  4KVM A;  4AP2 A;  2WPV A;  3OXF A;  4XIF A;  3FU6 A;  1MJ0 A;  3PZ2 A;  1G3N B;  5EX3 A;  2YNQ A;  4BFR A;  4LNG A;  2CG2 A;  1KLX A;  3FTV A;  4GTP A;  1UN9 A;  1UW4 B;  3TXN A;  4HXI A;  4A3V A;  1W3B A;  5FWQ A;  5EYL A;  1H6P A;  3UIP C;  5BPP A;  3D9K A;  3KEZ A;  4HQD A;  2GRQ B;  4B93 B;  2CFZ A;  5LCW C;  3PUK A;  4L9P A;  2I1J A;  1UJJ A;  3PZ3 A;  3L82 A;  3QOU A;  3WG7 E;  3MZL B;  4CDR A;  4I6G A;  3GYZ A;  2J9Q A;  5BXO A;  4UUC A;  3SFX A;  1BI8 B;  1E8Y A;  4WNF A;  2PM7 A;  5EN5 D;  5EYP F;  1TJC A;  2MRI A;  3HRA A;  4JPS A;  4TXR A;  1DC2 A;  4RVB A;  5KNH D;  4F7A A;  3UX4 A;  2WXH A;  2JAB A;  4KZ0 A;  3ZYK A;  2I1K A;  3HXB A;  2LAI A;  3D9H A;  3G2V A;  3QDN A;  3G2U A;  1QBQ A;  3TGO A;  2AVP A;  3DEP A;  1D8D A;  2ZIR A;  2L6J A;  4GZ3 A;  2XGO A;  4WWO A;  3PZ1 A;  5M72 A;  3IEG A;  3ML9 A;  3VLD A;  3CQC B;  4GTO A;  4XX5 A;  4KZC A;  2X6J A;  4CYM D;  5HS0 A;  2V8S E;  4U0Z A;  1MZC A;  4YDW A;  4NIK A;  1HG5 A;  2V4L A;  4AY5 A;  1IQR A;  3G2S A;  5AJD A;  5G05 J;  1QYM A;  1JPL A;  3EU5 A;  1KZO A;  3JUE A;  4WUY A;  1TN6 A;  4HRM B;  4NQ0 A;  2X6F A;  3E32 A;  3R7R A;  3AS8 A;  3ZYM A;  4B8C B;  3AS4 A;  4CDN A;  2PQR A;  2L0T B;  3T5X A;  2E0I A;  5JJ6 A;  2KM4 A;  1ZU2 A;  2OOE A;  2P58 C;  5KWD A;  1HE8 A;  2RG8 A;  5D66 A;  3PNL B;  4FHK A;  1N9A A;  3MKQ A;  2XHE A;  4O6F A;  4AJW A;  3NOG D;  3U9W A;  1H0A A;  3FH7 A;  3MV2 B;  4I9E A;  1ZB1 A;  4BTB A;  2GRR B;  4MLP A;  2J49 A;  3B7U X;  3FU0 A;  4DUI A;  1IHG A;  4ZFH A;  1H2T C;  5LOZ A;  4PDX A;  2YIN A;  1Z5S C;  4KXK B;  4EEC A;  4JL0 A;  3FUN A;  3G2T A;  4J8D A;  4GTR A;  1QQE A;  2H6F A;  4J8F A;  5AIJ A;  2EIN E;  2P9P G;  3LVQ E;  2ZGD A;  2I2O A;  3UUX A;  4WWP A;  3KEA A;  1PC2 A;  2YHE A;  5JMN D;  1IYG A;  4AY6 A;  3U64 A;  2AXU A;  2MYO A;  4EZL A;  3AG2 E;  3L22 A;  1N4S A;  3L9T A;  3NOC D;  3Q79 A;  3I4R B;  1U2V G;  4MKT A;  2OV8 A;  2IO2 C;  5E76 A;  4APF A;  4A55 A;  4K5A B;  4IRU A;  3PS6 A;  1FPP A;  3UQ3 A;  4GYY A;  4FJZ A;  3J5Q B;  2DZN A;  4GZD A;  4I6J A;  2OND A;  3QJZ A;  4GPK A;  4FA6 A;  4DX7 D;  2P9K G;  4URK A;  5LCW J;  3V31 A;  2CHX A;  2F0Y A;  4AOF A;  1TNO A;  5C1D A;  3FY4 A;  2P9N G;  1MHQ A;  2VGE A;  1RW2 A;  2RFM A;  3RIB A;  4GTS A;  4GA1 A;  5ITZ F;  1WY6 A;  4RSY A;  1H2V C;  4U04 A;  5DBK A;  2L9B A;  2F8Y A;  2UY1 A;  2A5E A;  4TRQ A;  3ULQ A;  4JHK A;  2AXV A;  1FVH A;  3KSL A;  3TWS A;  4EZJ A;  3NZS A;  3CVP A;  5JA4 D;  3PRZ A;  3FH5 A;  3SY2 A;  3UKR G;  2WXN A;  4DLQ A;  2AW6 A;  4N5C A;  4G1T A;  2OEW A;  4YDE A;  2XQ0 A;  3AG1 E;  4F6R D;  5EKQ D;  3B7T A;  3HVE A;  4Q94 A;  3KS2 A;  1N52 A;  1INZ A;  1WG0 A;  2X3M A;  2ETA A;  4CZ2 D;  4FUL A;  5JHB A;  5B3S E;  1HFA A;  3JCK C;  5FZS A;  4JA9 A;  2IFU A;  2DBA A;  3CLJ A;  3FU3 A;  4HOR A;  4Q69 A;  4TXQ A;  4FU3 A;  5AAR A;  4JHJ A;  3LVR E;  2RFA A;  3EIJ A;  1N95 A;  2KCK A;  3ULY A;  2NC9 A;  3GZS A;  1IHB A;  4K5C A;  3TAX A;  4GU5 A;  2MOW A;  1X81 A;  2LXL A;  3ZW3 A;  2Y3A A;  4GPM A;  4UQX A;  2CHW A;  4M3O A;  4X8Q A;  4J7W A;  2DZO A;  2VJ8 A;  2B6C A;  2QY7 A;  5BXU A;  3MX3 A;  3SO8 A;  4XE0 A;  4C48 B;  5CEA A;  2VYI A;  4GTQ A;  3EJN A;  3IXE A;  4HB5 A;  5B1B E;  2P2C P;  3LY7 A;  3JQ0 A;  4CCA A;  4JEU A;  3O48 A;  2KBX A;  5ENO D;  4OVU A;  3EDT B;  4JHR A;  3CVL A;  4U63 A;  2J08 A;  4HI9 A;  3ZVV A;  5AEN A;  1D9S A;  4Q96 A;  4GMR A;  3DPD A;  3D3M A;  2R2L A;  4I2W A;  3LXU X;  1UN8 A;  3CVY A;  2LAH A;  2R03 A;  1Z3X A;  1A5E A;  2BTD A;  1N54 A;  4J8E A;  3SHF A;  3PZ4 A;  4DJA A;  3Q5M A;  3CHM A;  3LYA A;  4KVO A;  5D0Q D;  2WXG A;  2A4Z A;  4JW1 A;  2WMO A;  3B95 A;  4CGV A;  5ARF A;  4DPR A;  4LNB A;  4BER A; 
#chains in the Genus database with same CATH homology
 3CK9 A;  5DIZ A;  2OVB A;  2J07 A;  4JPS A;  1E8W A;  5D0O D;  4HFG A;  5BW8 C;  3CR3 A;  4RVB A;  4F7A A;  3UX4 A;  2WXH A;  2R59 A;  2AWI A;  3SBT B;  2YHC A;  4DI4 A;  4UWH A;  2WB2 A;  3C98 A;  4KZ0 A;  4FC8 A;  3ZYK A;  2C2L A;  4HOT A;  2FI7 A;  2I1K A;  3FEX A;  2LAI A;  2GW1 A;  4AXH A;  2HR2 A;  3NZU A;  2DCP A;  3G2V A;  3QDN A;  1YA0 A;  2IOL A;  4JVS A;  3G2U A;  1ZBP A;  3FTY A;  3SBS A;  3QC1 A;  4KYO B;  5G04 C;  3TGO A;  3CHS A;  4GA2 A;  2AVP A;  4UQZ A;  3SF4 A;  3K9I A;  4I6E A;  2OVF A;  4HVB A;  3U4T A;  1Z6T A;  4YVO A;  5ANR A;  3ASG A;  2WXI A;  2L6J A;  3MA5 A;  4GZ3 A;  4APO A;  5ANL A;  2XGO A;  2VSN A;  4WNG A;  4WWO A;  4ABN A;  3D9N A;  4AIF A;  5M72 A;  3D9M A;  3FUI A;  3IEG A;  3MEK A;  3CHR A;  3ML9 A;  3VLD A;  4XKC A;  4ATG A;  3PE4 A;  2Q7F A;  4E85 A;  1Y6I A;  3CQC B;  3ESK A;  3P2B A;  3RRN B;  3I5P A;  4XX5 A;  4BSX A;  4KZC A;  2X6J A;  3FTS A;  2V8S E;  3FFL A;  3OXG A;  2AXZ A;  4U0Z A;  4UWG A;  3Q47 B;  5KJN A;  3TL5 A;  1HG2 A;  1HG5 A;  5A7D B;  2V4L A;  4AY5 A;  5EDS A;  1IQR A;  3G2S A;  1E7V A;  3AU5 A;  4XZ4 A;  2PQN A;  3L17 A;  5AJD A;  4UI9 J;  5G05 J;  3FHE A;  1PAQ A;  3MKQ B;  1JPL A;  2J4D A;  4DI3 A;  4XI9 A;  4ANV A;  4HOU A;  3SI5 A;  5BV1 A;  5T4Y A;  3Q49 B;  4AV7 A;  4WUY A;  5FTP A;  1EDU A;  1EF1 C;  5ARG A;  2XRZ A;  4NQ0 A;  3RO2 A;  2KAT A;  2X6F A;  3PVL A;  3R7R A;  3AS8 A;  4K03 A;  3ZYM A;  1H6K A;  1VDY A;  3ZXS A;  3RRU A;  4B8C B;  3RK6 A;  3AS4 A;  3FTU A;  5G55 A;  2WMN A;  1UG3 A;  4G26 A;  4WND A;  4CDN A;  3URZ A;  2PQR A;  2IJG X;  3AU4 A;  4G11 A;  2L0T B;  4N2S A;  3T5X A;  3CVU A;  2E0I A;  3IHY A;  3LKU A;  4BX9 A;  4PS3 A;  4K0R A;  5JJ6 A;  2KM4 A;  3FDH A;  3I3N A;  3CEQ A;  1ZU2 A;  2OOE A;  3B7S A;  2KZT A;  3G2W A;  2P58 C;  4IYP A;  3QWV A;  3RJV A;  5HQ8 A;  1SZA A;  4JC8 A;  1HE8 A;  2RG8 A;  3DBS A;  3D9I A;  4DLO A;  3PNL B;  1U3C A;  4G25 A;  4L7T A;  4C0E A;  2WXM A;  4FHK A;  3MKQ A;  1FCH A;  4RG6 A;  2XHE A;  3QWP A;  4O6F A;  4U07 A;  2WM9 A;  5J08 A;  5KJM A;  4FLB A;  3CGH A;  3VLE A;  4AJW A;  1FVF A;  4H7Y A;  3RO3 A;  3U9W A;  1H0A A;  3FH7 A;  4GMJ A;  4E6H A;  3MV2 B;  4I9E A;  1JUQ A;  4BTB A;  2WQ6 A;  4MLP A;  4FHJ A;  3FWV A;  2J49 A;  3B7U X;  4BWR A;  3ESL A;  3APC A;  3O4Z A;  3D9L A;  3FU0 A;  2FO7 A;  1IHG A;  3JYS A;  4EQF A;  2ZU6 B;  4F3V A;  3CVW A;  5FJY A;  4GCO A;  1JWF A;  3CVN A;  3LCA A;  3CK8 A;  4GAA A;  1DNP A;  1H2T C;  1HS6 A;  2VQ2 A;  3PUJ A;  4YVQ C;  5G2N A;  5LOZ A;  4PDX A;  2YIN A;  3LY9 A;  2XGM A;  2WQH A;  2V5F A;  4G2V A;  4KXK B;  5C2Y A;  5FQ7 A;  5BV0 A;  5A6C A;  3CSF A;  4EEC A;  3LEW A;  4JL0 A;  4NUR A;  3FUN A;  3MYV A;  1WAO 1;  3UT4 A;  5T8I A;  1EYH A;  3G2T A;  4J8D A;  4A3T A;  2J4B A;  3BG0 B;  3JUI A;  4EPZ A;  2WXJ A;  1QQE A;  2LSV A;  3PEU B;  4J8F A;  5CHE E;  3GW4 A;  3LY8 A;  3OXL A;  5AIJ A;  4CDM A;  3LVQ E;  4GML A;  1GW6 A;  2I2O A;  4J6I A;  3TG5 A;  4ANW A;  3UUX A;  3L16 A;  4TV3 A;  5JHA A;  4WWP A;  1HF8 A;  1PC2 A;  2GGF A;  5HI7 A;  4ANU A;  4MRU A;  4G24 A;  1S0P A;  2KC7 A;  4ILH B;  2YHE A;  3ML8 A;  3PZD A;  4DK5 A;  3IKO B;  3NF1 A;  5JJT A;  4OVV A;  1IYG A;  3APF A;  1SZ9 A;  1U3D A;  5EX0 A;  3B7R L;  4AY6 A;  3U64 A;  2VSX E;  5LCW C;  3U3W A;  2ION A;  2AXU A;  3VTX A;  1OWN A;  4ANX A;  4D10 C;  4GYW A;  4N3A A;  3UPV A;  3FEY A;  2PL2 A;  2DIW A;  3GZ2 A;  3QAR A;  4W9R A;  4AVX A;  4EZL A;  3R9A B;  3L22 A;  4Y6C A;  5JJ7 A;  3ZN3 A;  4JA7 A;  3SFZ A;  4C0M A;  4UQY A;  4GZ6 A;  4B94 A;  2CFU A;  3SZ7 A;  3PRE A;  5BUZ A;  3I4R B;  3NQP A;  3ZIM A;  4C9B B;  4MKT A;  2OV8 A;  3ZGQ A;  2WXK A;  1Y8M A;  3EIQ C;  2NSZ A;  5E76 A;  1E7U A;  1H19 A;  4HS2 A;  1QNF A;  2VSY A;  1Z3Y A;  4TUU A;  3BG1 B;  4APF A;  5FZR A;  4GZC A;  1OWM A;  3PS6 A;  4IRU A;  4A55 A;  5KJL A;  4G23 A;  2XCB A;  4I2Z A;  2HM8 A;  3UQ3 A;  3CIA A;  4GYY A;  2VSO E;  1NP7 A;  2HO1 A;  1XNF A;  4FJZ A;  3IHV A;  4GZD A;  5FQ6 A;  2FBN A;  4I6J A;  3S7B A;  2OND A;  3S7F A;  3UT8 A;  4BT9 A;  3QJZ A;  5FQ4 A;  4GPK A;  4NAC A;  4U0S A;  4KBQ A;  2WXQ A;  4FA6 A;  4NRH B;  3EHM A;  3T8M A;  3GZ1 A;  4URK A;  2KCV A;  2A5U A;  4LER A;  3TG4 A;  2UY1 B;  3MCX A;  4H7X A;  4XI0 A;  1H2U A;  3FUJ A;  1E8Z A;  5LCW J;  2C0M A;  3CVQ A;  5ENN A;  2CHX A;  2JEK A;  4AOF A;  4L2L A;  2VTB B;  3L13 A;  5C1D A;  3FY4 A;  3HHM A;  3N71 A;  3FTW A;  3HDX A;  4BY6 A;  1MHQ A;  3QWW A;  4ILI A;  3OAW A;  3E4B A;  3I4G A;  3AS5 A;  1HO8 A;  4EZK A;  3FU5 A;  1KT0 A;  4A1S A;  3P1U A;  5CCL A;  3ZRH A;  2FF4 A;  1BPO A;  2I9C A;  2R17 C;  4ME2 A;  3UT7 A;  5BNW A;  3MGB A;  1QZ2 A;  3ASD A;  2XEV A;  3CK7 A;  4P29 A;  3RIB A;  4UWF A;  4GA1 A;  4IUL A;  3CKC A;  5AYW D;  3APD A;  1WY6 A;  3L54 A;  3LPZ A;  3CVV A;  3QKY A;  4RSY A;  1TJF A;  1H2V C;  1LF8 A;  4U04 A;  4N39 A;  5DBK A;  1OWL A;  2L9B A;  1E8X A;  3MJW A;  3ZEF A;  4J0U A;  3ZHE B;  2UY1 A;  2Y4U A;  4GA0 A;  1KT1 A;  5KJK A;  4HOQ A;  4U8H A;  2J09 A;  2KCL A;  2WXO A;  4TRQ A;  2X6K A;  4UI9 C;  5G05 C;  1TEZ A;  3ZFW A;  1NZN A;  3ULQ A;  4JHK A;  3HVE B;  2IU1 A;  2VTB A;  2NXP A;  2AXV A;  4GCN A;  4YND A;  1FVH A;  2MHK A;  2JLB A;  3R7Q A;  3TJP A;  1JWG A;  4EZJ A;  3NZS A;  3CVP A;  1A17 A;  2IF4 A;  2X6I A;  4U0U A;  2VGX B;  4FLH A;  3PRZ A;  3TXM A;  4EBA A;  3FH5 A;  4I43 A;  3PNT B;  4ILG A;  2WXN A;  4CT0 A;  3CHQ A;  3LS8 A;  4QFV A;  4DLQ A;  4L1B A;  2AW6 A;  4IN3 B;  5G04 J;  3RKV A;  4N5C A;  4G1T A;  4GB9 A;  3PE3 A;  3S7J A;  2CHZ A;  2XQ0 A;  3S2A A;  3ZHE A;  3Q4A B;  3FUK A;  3ENE A;  5EKQ D;  3B7T A;  5FT9 A;  2UWJ G;  2WQ7 A;  3HVE A;  1SQM A;  4Q94 A;  3KS2 A;  4CT4 A;  4EBA G;  4BX8 A;  1N52 A;  5FQ8 A;  5CMY A;  1INZ A;  2FEZ A;  3RU0 A;  4UWL A;  4I1O B;  1UJK A;  2X3M A;  3LJ3 A;  5CMW A;  3IV0 A;  2VGX A;  4FUL A;  5JHB A;  3QB2 A;  1HFA A;  3JCK C;  5FZS A;  4JA9 A;  2LO6 A;  2XRY A;  2IFU A;  4I1M A;  1NA0 A;  3OTN A;  2DBA A;  3CLJ A;  1B89 A;  2LSU A;  3FU3 A;  3HYM B;  1MQS A;  4HOR A;  3CKB A;  2WXL A;  1HH8 A;  4Q69 A;  4FU3 A;  1DVP A;  3FUL A;  4ACL A;  1L5J A;  2WVI A;  2X6H A;  4JHJ A;  4CRW A;  3LVR E;  4XKB A;  2V0P A;  5J90 A;  2I6H A;  3EIJ A;  3FUF A;  3CHP A;  1ELR A;  2KCK A;  4BT8 A;  2NC9 A;  3EHN A;  3L6A A;  3GZS A;  3LDZ A;  3QK0 A;  2IOS A;  1ELW A;  4ACK A;  1WM5 A;  4FJY A;  1OWO A;  3Q15 A;  3PEV B;  4F53 A;  3TAX A;  4JEH A;  4B8A A;  2YQ8 A;  2EQX A;  4UWK A;  2GRM A;  4HLE A;  4GU5 A;  2MOW A;  2E2E A;  3SNX A;  3ZW3 A;  3FTX A;  4R7L A;  2Y3A A;  3KD7 A;  4UQX A;  2CHW A;  4M3O A;  3ZPJ A;  4B89 A;  4JZY A;  1XGW A;  2QFC A;  5KCM A;  3JQ1 A;  5CCM A;  4L23 A;  4J8S A;  2VJ8 A;  3VLF A;  4PS8 A;  2L0I A;  2BUG A;  4WNE A;  5LP0 A;  4LUN U;  4AEZ C;  4HOS A;  2M63 A;  1P5Q A;  3FH8 A;  2QY7 A;  4N2Q A;  3MX3 A;  3PH0 C;  4B0Z A;  1EPU A;  5FZQ A;  3CST A;  3QAQ A;  4XE0 A;  3FUM A;  3U66 A;  4N3C A;  3SGH A;  2FUL A;  2XCC A;  3MV3 B;  4MS6 A;  4PH4 B;  4JXT A;  5BT1 A;  4BTA A;  4LCT A;  3ASF A;  2VYI A;  4GZ5 A;  3WXX A;  2KZT B;  2WXP A;  5AJL A;  1NA3 A;  4KT6 B;  4KVM A;  4AP2 A;  2WPV A;  3EJN A;  3OXF A;  2BF0 X;  1HX8 A;  3LY7 A;  4XIF A;  3JQ0 A;  4CEM A;  3ONK A;  3FU6 A;  4CCA A;  2XPY A;  1HU3 A;  4JEU A;  3PDN A;  4LEU A;  1OUV A;  3O48 A;  2HYZ A;  3D9P A;  3FUD A;  4PUC A;  4AM9 A;  3ZYQ A;  2LNI A;  4OVU A;  5EX3 A;  2YNQ A;  4BFR A;  2CG3 A;  2XPI A;  2CG2 A;  3HIZ A;  1KLX A;  1E90 A;  3FTV A;  4RG9 A;  3EDT B;  4JHR A;  3CVL A;  4LRZ A;  4U63 A;  1UN9 A;  2J08 A;  1UW4 B;  3IBE A;  2X38 A;  4UI9 K;  3ZVV A;  5AEN A;  3TXN A;  2ILR A;  4Q96 A;  1HXI A;  3BEE A;  4HXI A;  3SD5 A;  4A3V A;  5LFA A;  3CHO A;  1W3B A;  2R5S A;  3D9O A;  5FWQ A;  4A1G A;  3ZYL A;  5BPP A;  3D9K A;  3DPD A;  3KEZ A;  2RD0 A;  3CV0 A;  3D3M A;  4I2W A;  3LXU X;  4FP7 A;  3ASH A;  1UN8 A;  1OWP A;  1X5B A;  3CVX A;  3FTZ A;  3CVY A;  2CFZ A;  2LAH A;  3UMV A;  2XPZ A;  1Z3X A;  3PUK A;  4PS7 A;  4Y6W A;  2BTD A;  1N54 A;  3FP3 A;  4J8E A;  5T3R A;  3S7D A;  3FUE A;  2C0L A;  4GYO A;  2I1J A;  3RRM B;  3D9J A;  3SHF A;  1UJJ A;  4WWN A;  4F1S A;  2PM6 A;  1HZ4 A;  5A23 A;  3QOU A;  3KAE A;  4OYS A;  3CQG B;  4DJA A;  4KMO A;  4L2Y A;  3MZL B;  4CDR A;  4I6G A;  2WXR A;  3GYZ A;  3Q5M A;  1E96 B;  3CHM A;  3MKR A;  4N3B A;  3LYA A;  2J9Q A;  4I9C A;  4KVO A;  2WXF A;  4V3I A;  2VGY A;  5D0Q D;  3VTY A;  5E75 A;  4CGW A;  2XGS A;  2WXG A;  3L08 A;  3T5V A;  2A4Z A;  1PY1 A;  4JW1 A;  4WAF A;  3FUH A;  4FAD A;  2Y4T A;  3QNK A;  2WMO A;  1E8Y A;  2GRL A;  4I17 A;  4WNF A;  2PM7 A;  4CGV A;  1IQU A;  1TJC A;  2MRI A;  2PZI A;  3ONL A;  5ARF A;  4DPR A;  2IQC A;  5LX8 A;  1ELK A;  3B13 A;  4I1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...