1MHQA

Crystal structure of human gga2 vhs domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
SLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GGA2 VHS domain and its implication in plasticity in the ligand binding pocket
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA2
total genus 50
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1mhqA00
2BF0X 4NACA 3D9NA 5CMWA 4Q96A 2DCPA 3D9PA 3ZYKA 1XGWA 1INZA 1PY1A 1JWGA 2MOWA 3D9LA 3G2TA 3RRUA 1UJKA 3G2VA 3D9MA 1DVPA 3LDZA 3G2WA 3G2UA 3D9JA 4HFGA 3ZYMA 1ELKA 2LO6A 1JWFA 4JXTA 3CLJA 1SZAA 3D9OA 1X5BA 2KM4A 1EDUA 3G2SA 3ONLA 4Q94A 1LF8A 1VDYA 5LOZA 4GZCA 2L0TB 1MHQA 4FU3A 1H0AA 1SZ9A 2L0IA 4FLBA 3ZYQA 5LP0A 2V8SE 2DIWA 1JPLA 1HG5A 3ONKA 3D9KA 1UJJA 5J08A 1HFAA 1HX8A 1EYHA 3ZYLA 4AVXA 1HF8A 4GZDA 1HG2A 5CMYA 2QY7A 3D9IA 1JUQA
chains in the Genus database with same CATH superfamily
5EX0A 3DSSA 1FT2A 2UWJG 2J9QA 4GTQA 3R9AB 2EQXA 3ONLA 2J4DA 4JC8A 1OY3D 4G11A 3CHSA 2DWZA 3JCKC 5CMYA 4U0SA 3D9IA 3ZFWA 3TJPA 4GPMA 5G2NA 1IQUA 2XPZA 1DVPA 3SBTB 5LFAA 4NRHB 5FQ6A 5ENSD 3V2XA 2CHWA 2QYUA 2VQ2A 2I6HA 4KT6B 2IU1A 3RJVA 3FU6A 2P9LG 4BY6A 4JVSA 3OXLA 1DCQA 3FU3A 3DSWA 4K5AB 1TJCA 1JCQA 4GTMA 5FT9A 4UQYA 4F3VA 5KJLA 3AG2E 2WMNA 2FO7A 4KZCA 1A5EA 4GYWA 4F1SA 5JHAA 3ZN3A 4GA2A 1K1BA 2UY1B 3CVWA 4FJYA 2FO1E 3HXFA 1N0RA 3SFYA 3HVEA 3ZPJA 3TWUA 1HFAA 2VJ8A 4YNDA 3V31A 4C48B 2XCCA 3TWSA 1EPUA 3S7DA 3PH0C 3QB2A 4TUMA 4UQXA 5EIDA 2GRLA 5EIBE 4HOSA 1TN6A 4AJWA 4MBGA 1YYHA 3CVUA 1WM5A 2P2CP 3FUIA 1LTXA 1N0QA 1LD7A 2CHZA 2H6HA 3PE4A 3C98A 1E8WA 1TNBA 3DWLG 3CVLA 3VLDA 2XCBA 1UN8A 4A3VA 4A3TA 3CEQA 2CFUA 2Y4TA 3UT7A 4JA9A 2XEVA 1SW6A 3C3RA 4GA0A 1HS6A 3Q7AA 4L2LA 4L23A 3UINC 3EUVA 2XS8A 2MHKA 5E75A 2GROB 3ASOE 3MZLB 3B7SA 3ASDA 3D9NA 2BKKB 2MRIA 4BT8A 2WXJA 4HS2A 2XZTG 2P9PG 3TWWA 3ZXSA 2OV8A 1LF8A 1OWMA 2WXRA 3NAWA 4U96D 4GB9A 2IONA 5AIJA 3APCA 5J90A 3MA5A 1N4SA 4HLLA 3UXGA 3CHOA 4J6IA 2R5SA 1S64A 2IJGX 4ANWA 4L7TA 3Q5MA 4M3OA 2LUHA 4I17A 3C72A 4FADA 3B95A 1H2TC 1H6OA 3ENEA 2L9BA 3E34A 3CKBA 4J8EA 3ZHEA 5B3SE 5ENPD 3CVXA 4ACLA 1NA0A 3RO3A 3TWTA 1HXIA 5FINA 5AJLA 4OVUA 4WNFA 2P9NG 2LSUA 2J49A 5EN5D 1WY6A 4AEZC 4ACKA 4FHJA 4AOFA 3S2AA 4ATGA 2C0LA 2QFCA 4N5QA 4EHMA 4F6RD 4ILHB 3ZU7B 3AU5A 4FU3A 4A1GA 3NZSA 4NQ0A 5BUZA 4UWFA 1HG2A 2RFMA 3KEZA 2E0IA 4OYSA 1D8EA 1E90A 3URZA 3CVPA 4N3BA 5G04C 2A5UA 1TNOA 3L22A 2JABA 3L6AA 5C1DA 3E32A 3TGOA 2HM8A 4I6JA 2KBXA 4DX2A 1MZCA 3CVYA 4B93B 3B7TA 3NZUA 3JQ1A 2LAHA 2MOWA 5HKPA 1KT0A 4C0MA 2ZGGA 4CZ2D 3V2OA 3QWPA 5KWDA 3RO2A 3C3OA 3CSFA 5HS0A 1AP7A 3UX4A 3Q47B 5EILA 2Y3AA 3CK9A 3TWQA 1SA5A 2J09A 1FT1A 1U3CA 3IHVA 3UM2A 4PS8A 4I6EA 4XI0A 4GYOA 3BEEA 5AYWD 1UJJA 3CKCA 5T3RA 2PM7A 1OCCE 3APDA 4TUUA 1BD8A 3FUFA 3AG1E 5ENRD 3T5XA 2AVPA 1X5BA 3LVQE 4K5CA 2CFZA 3ZYQA 2WXMA 3FHEA 4HOTA 3FEXA 4MLPA 3GZ1A 3PZ3A 1W3BA 4OVVA 2IEJA 1WDYA 2R02A 4G8KA 3CVVA 5ARGA 3ZXPA 3UTMA 4DX1A 3ESKA 3B7BA 3UMVA 2GRPB 4GZ3A 4E85A 1BI8B 4YDOA 3FU5A 3UIPC 2B0OE 3PUKA 1V55E 5G55A 3O48A 3ZUVB 1U3DA 4UUCA 2WMOA 2ZIRA 5HQ8A 4HFGA 5E76A 3PEVB 1D9SA 3I3NA 3ASNE 5EYPF 4UWHA 4JPSA 3KSLA 4RG9A 2L0IA 1FCHA 4GPKA 2H6GA 3X2QE 3QWVA 3CHMA 3TWVA 5HRYA 2XRZA 2XHEA 4XKBA 3E33A 4IYPA 3JYSA 2VGYA 2AXZA 4L2YA 4DRXE 3F6QA 3QARA 3DSVA 1IHGA 3HVEB 3OTNA 3ASHA 3NB2A 2YINA 1TN7A 4Q69A 4CRWA 3IHYA 1D8DA 2LNIA 3ONKA 3I4RB 2F8XK 2XS1A 2FULA 4JA7A 2X6HA 1OWPA 5KJKA 2V5QC 4Q96A 1Y8MA 4QQIA 2DZNA 3LPZA 2OCCE 1BI7B 3U3WA 4FP7A 2WQ7A 5AQAA 3FY4A 5AQBA 1MX2A 4OAUC 3GZ2A 4KBQA 1SA4A 3IV0A 4AIFA 4HI8A 2IO3C 2AXVA 2RG8A 3DSXA 2RD0A 4B0ZA 2FI7A 4KVMA 4YVOA 4MKTA 4L9PA 2FF4A 4I9EA 4DI3A 3FEYA 4TXQA 1O1SA 2QZAA 3MEKA 2PL2A 5CBNA 2DIWA 2V0PA 3SQVA 1U2VG 1O5MA 3SD5A 2WXPA 3ULEG 3KEAA 4GTTA 4ANUA 1N4PA 3UM1A 2AJAA 4H7YA 3FTZA 5CECB 3FTYA 2XGOA 4XIFA 2WXIA 4IRUA 4GZCA 3LYAA 3Q15A 4LG6A 3T9KA 3PZ2A 3FTXA 4FA6A 1UG3A 4K0RA 2X6JA 3NOCD 1IXVA 1OWLA 3ZIMA 1NZNA 1V54E 2OVBA 4BSZB 4U95D 2WB2A 5JHBA 1N4QA 4WNDA 3L17A 4FULA 4HOQA 5EX3A 5KJNA 4GYYA 2FBNA 3FUKA 1H2UA 5BXUA 1NA3A 2XENA 3LY8A 4ME2A 5KCMA 5FZQA 2KZTB 4O1PA 3S7FA 4J8FA 4MRUA 4JEUA 4CEMA 3QK0A 3R7RA 3EJNA 5AN8A 4CT4A 5EDSA 2I1KA 2DYSE 4GZ6A 1X81A 1OUVA 1S70B 4F7AA 3FDHA 1OT8A 3SGHA 4BX9A 3B13A 2F0YA 4GTVA 2X3MA 1OXJA 2P9IG 1FVHA 3FUDA 5D66A 4GZDA 2WXFA 4N39A 4AY6A 1JUQA 3APFA 3PE3A 2Y4UA 2JLBA 2HR2A 5FZRA 3SNXA 2GRMA 4U63A 4DK5A 1WAO1 3FUNA 3EHQA 3V30A 3PZ1A 3GZSA 3QNKA 4ZFHA 3UPVA 3LCAA 1TNZA 4CGWA 1FPPA 3AJIA 4HNAD 3QJZA 3DSUA 3TXNA 2WXGA 3GYZA 2XGMA 3ULQA 1H6KA 5T8IA 2BUGA 4DX6D 4GTRA 3Q75A 3MV3B 3SFXA 3EIQC 4JD2G 4CT0A 1JPLA 4DUIA 3L08A 5BT1A 2KZTA 4AVXA 1E96B 4GU5A 2H6FA 3AS8A 4U0UA 2IO2C 2KC7A 2ILRA 5KNGA 4EBAG 1IHBA 4U0ZA 4I1AA 4TXRA 4PDXA 3AAAC 1OCZE 2KCVA 1EYHA 2IY0C 4G2VA 1E8YA 1H6PA 4DI4A 1N9AA 3C5RA 4E6HA 1N54A 4YDEA 4Z68A 4EZLA 1A17A 5FJYA 4C9BB 5JMND 3SHFA 2BTDA 2HO1A 1TNYA 1WG0A 4XE0A 1HG5A 3E4BA 1N52A 3TAXA 3ZRHA 3JXIA 4DJAA 3EHNA 1Q2ZA 2OVFA 3DEOA 4A1SA 1SQMA 3HXDA 2AW6A 5CHEE 5IY5E 3IBEA 2A4ZA 1BPOA 3FH8A 1NP7A 1KT1A 3S7JA 3FUEA 4J0UA 2WXQA 2BEDA 1NL4A 3ML8A 3CQGB 2LXLA 2L6BA 3CVNA 4U04A 4JHRA 2NSZA 5BNWA 3ZYMA 2VGEA 1RW2A 3FUJA 2WVIA 3DPDA 2GW1A 4CDRA 5BXOA 5KJMA 1UJKA 3CHRA 2B6CA 4XX5A 4JB8P 1G3NB 5B1BE 1N4RA 4FHKA 4B89A 2ZGDA 4PS7A 3L9TA 1O1TA 3PREA 2WXHA 4GA1A 3Q49B 3CGHA 1AWCB 4ILGA 4GTSA 4JXTA 1EDUA 1MQSA 4CDMA 4RVBA 4DLOA 2LXMA 3HXCA 1HF8A 3MGBA 1TNUA 2VGXB 3R9MA 4JHJA 4EBAA 5JJ7A 5BV0A 3N71A 4WWNA 3PEUB 4TRQA 3ZNGA 4I1MA 4N3AA 4BSXA 3QAQA 4LRZA 3ESLA 4WUYA 4BEPA 4WWOA 5ITZF 4ILIA 4IULA 4UWGA 3T8MA 3ZKJA 3JXJA 3RAUA 2WM9A 5FQ7A 1DCEA 4BWRA 5A23A 1VDYA 1MHQA 2ZU6B 4XI9A 2YHEA 2F37A 4XEIG 2YNQA 2VSXE 4NIKA 3UKRG 4KYOB 2XQ0A 1E8XA 1QYMA 2XPYA 2CHXA 3VTXA 1L5JA 1BLXB 2XPIA 1NI1A 3AS5A 3CVQA 5B1AE 2F8YA 4WNEA 1KZPA 3B7UX 3I4GA 3SY2A 3AG4E 2P58C 5DBKA 5EYLA 4GZ5A 2DZOA 1HO8A 4UQZA 1E7UA 3FTVA 1K8KG 4RG6A 2EIKE 4EECA 3TG5A 3S7BA 1YCSB 2R05A 4BESA 1K1AA 4O6FA 2LSVA 4J7WA 4LCTA 4B94A 3LJNA 5CMWA 1INZA 3FU0A 3G2WA 4CYMD 4JHKA 3BG1B 4PUCA 3SBSA 2YQ8A 3KSQA 5T4YA 3EU5A 3MCXA 2VGXA 5FTPA 5FQ8A 4G26A 4HOUA 4YVQC 3FFLA 3ML9A 1KPSB 3HRAA 2IFUA 3PZDA 4BETA 3Q78A 4F53A 4BX8A 1SZAA 3D9OA 2VSYA 4XZ4A 1ELWA 5CRUA 1S0PA 3Q79A 5CEAA 2LAIA 2I2OA 2Q7FA 4IN3B 3D9HA 3VLEA 5G05C 2VTBA 2IQCA 3BG0B 4R7LA 4A63B 2EINE 4KXKB 3D9LA 1N11A 4FLHA 3ABKE 3VLFA 2KATA 1TR4A 3VTYA 5CEDB 5G04J 2JEKA 2WXLA 3ASGA 2XZDG 2R17C 3EHRA 2WQ6A 2P9KG 2X6FA 1QBQA 4KZ0A 2J4BA 5AARA 3B7RL 4UI9C 2IOSA 1IQRA 4LSZE 1KZOA 1JWFA 4M7CA 3CK8A 2J08A 4O60A 5CBOA 2X38A 4HVBA 3DXMG 2L0TB 2Y1LE 4JZYA 4TXPA 5D0QD 2Y69E 2VSNA 4APOA 3Q9UC 1PC2A 2ZXWE 3U66A 3SF4A 5AJDA 3FUHA 3HXEA 4HORA 3CV0A 4J8SA 3P2BA 3AS4A 4I43A 3PRZA 2RKKA 1E8ZA 4URKA 3KS2A 5H7PA 4B8CB 1O1RA 3Q9NC 5FIOA 1SZ9A 3QKYA 4N2QA 1Z3YA 3ABLE 4HI9A 4PS3A 4DPRA 3L13A 4AY5A 2C2LA 1OWNA 3ZEFA 2VYIA 1UN9A 3D9PA 3QOUA 3U64A 1FVFA 1YA0A 4G24A 4ZHBA 2GRNB 4GMJA 1H19A 3PS6A 5LOZA 3HDXA 3QWWA 3AG3E 3QDNA 3PNTB 3LJ3A 1HX8A 3ZYLA 2KCKA 3EIJA 1Z6TA 3CR3A 5LCWJ 4Y6WA 1JWGA 4RQIA 3BU8A 4RLYA 1ZU2A 1Y6IA 1YMPA 4I6GA 4XKCA 3RRNB 2QYJA 3EHMA 3QC1A 3SI5A 4EQFA 4GTPA 2EIME 3HYMB 4Y6CA 3W9FA 3T8KA 2DBAA 2C0MA 1XNFA 3L82A 4U07A 4KMOA 2KXPC 4EZJA 3TWRA 4HRNA 4BT9A 3D9KA 5ENTD 1MYOA 2WPVA 2GRQB 2IF4A 5ENOD 4QFVA 2ETBA 4UI9K 2LO6A 2CG3A 3SO8A 4D10C 2XGSA 1HE8A 3LKUA 2GGFA 2KCLA 3TL5A 5FWQA 3BQOA 3ZYKA 5AQ9A 3RSEG 3D9JA 3P1UA 4JW1A 4I9CA 5ANRA 4I1OB 4C0EA 3IKOB 4G25A 4U7EB 4N3CA 4HBDA 3TXMA 3J5QB 4LNGA 1MJ0A 2NYJA 5LX8A 5EKQD 3JQ0A 2I9CA 1HU3A 5LCWC 4LUNU 1K3ZD 4GTOA 1XGWA 4LNUD 3FP3A 2H6IA 4G8LA 3BUAA 3OXGA 3PVLA 4WWPA 4FJZA 2OOEA 1E7VA 1GW6A 3FTUA 3NQPA 2UY1A 4HRMB 5KNHD 3CIAA 3OAWA 5ARFA 2PZIA 4U8VD 2BF0X 4O1OA 4UI9J 5JA4D 3NOGD 2A5EA 4NURA 4ABNA 1JCRA 4YDWA 5G05J 4ANXA 5ANLA 1BU9A 3T5VA 3G2SA 3FULA 1OWOA 3WXXA 3L16A 5M72A 4AXHA 3SFZA 2MYOA 3KD7A 3FH5A 3IXEA 3Q7FA 4CGVA 5A7DB 3ISMC 2DVWA 3WG7E 4I2ZA 4P29A 5AAOA 4FC8A 1NFIE 3ZHEB 3FTSA 2R03A 3TG4A 3OXFA 4JL0A 4TV3A 2VSOE 2AWIA 2X6KA 2EILE 3R7QA 3ULYA 4HB5A 4RSYA 3MKQB 3DEPA 2ONDA 2CG2A 2X6IA 3UM3A 5CERB 3Q73A 3UIOC 1OCRE 3NF1A 3J5PA 4GMRA 3ZW3A 1QZ2A 1RZ4A 2PQNA 2WXKA 3D9MA 1EF1C 3I5PA 2XRYA 3MX3A 3MJWA 4BERA 3AU4A 4U8HA 4CCAA 1PAQA 2FEZA 4A55A 3HXBA 2WXOA 4DLQA 3HG0D 4V3IA 3GW4A 2EIJE 3K9IA 2XEHA 3G2TA 4CDNA 3G2VA 4AP2A 3CLJA 2OEVA 5DIZA 1UOHA 3DBSA 5BV1A 3LXUX 4X8QA 1ZBPA 1N95A 3ZVVA 2R59A 4U8YD 3TWXA 3EU9A 4GCOA 3UQ3A 2E2EA 3LDZA 1UW4B 4HQDA 2KM4A 1HH8A 4F1PA 4FLBA 3UT8A 4BTAA 2HYZA 2V8SE 1TYQG 3KAEA 2GRRB 4DX7D 3V79K 4AV7A 3DRAA 3DSTA 2R2LA 3UUXA 4W9RA 4K03A 1QQEA 4EZKA 5ENQD 5FQ4A 1HZ4A 4PH4B 4G23A 2AXUA 3JUIA 3UKUG 4ANVA 2DCPA 2ZISA 3RK6A 2HE0A 3HIZA 1ELKA 5ENNA 2DYRE 1OCOE 4HXIA 3RIBA 1TN8A 1MX4A 1SVXA 4Q94A 4KVOA 4B8AA 5CCMA 3UM0A 4YDYA 4BFRA 3JUEA 4J8YA 3FWVA 2NC9A 4I2WA 3CSTA 1QNFA 3FUMA 2M63A 4L1BA 4WNGA 5CRVA 2XEEA 5JJTA 1Z5SC 2P9SG 4BTBA 4MS6A 4EPZA 2QC9A 3CHPA 4K5BA 3PDNA 4HRLA 5D0OD 1LD8A 2Y0BG 3Q4AB 3LY7A 3IEGA 1H0AA 3ABME 1Z3XA 1JCSA 1TJFA 3MYVA 2ETAA 4WAFA 1IKND 3LEWA 4GAAA 3ASFA 5JJ6A 3CK7A 5CCLA 1ELRA 5AQ7A 5AENA 1PY1A 3CHQA 3E30A 3G2UA 4G1TA 5HI7A 1DC2A 3UT4A 2V4LA 5D2MC 3UI2A 4LNBA 2PM6A 5C2YA 2IOLA 3DXKG 2QY7A 5KBAA 2NXPA 3FH7A 3D3MA 3RRUA 3LY9A 3ZGQA 4J8DA 2V5FA 2WQHA 2L6JA 2PNNA 4H7XA 1DNPA 3HHMA 1N94A 5A6CA 5LP0A 4ATZD 3O4ZA 3L54A 3FTWA 2I1JA 3PZ4A 3U4TA 1H2VC 3U9WA 1P5QA 5BW8C 3RKVA 4HLEA 3RRMB 4JEHA 1S63A 3EDTB 3MKQA 2J07A 3W9GA 1B89A 2P9UG 5J08A 4AM9A 3C3QA 3LS8A 1KLXA 4N5CA 2OEWA 4NACA 3LVRE 4GCNA 3NBNB 3RU0A 3PNLB 2V4HC 3E37A 2BKGA 4UWKA 4APFA 5BPPA 3MKRA 1IYGA 2J8SD 4OAVB 3SZ7A 4GMLA 4LERA 4N2SA 3PUJA 3DPYA 1TEZA 1ZB1A 2WXNA 3MV2B 2RFAA 4DX5D 1MX6A 4UWLA 5FZSA 2PQRA 2VTBB 2ETCA 2YHCA 4LEUA 3CQCB
chains in the Genus database with same CATH topology
3CHMA 3PREA 2WXHA 4LUNU 4GA1A 3Q49B 1XGWA 3CGHA 3FP3A 5EX0A 4ILGA 2XRZA 2XHEA 3OXGA 2UWJG 4XKBA 2J9QA 3PVLA 4IYPA 4JXTA 4WWPA 3R9AB 2EQXA 1EDUA 3ONLA 2OOEA 4FJZA 3JYSA 1MQSA 1E7VA 2AXZA 2J4DA 2VGYA 1GW6A 4CDMA 4JC8A 4L2YA 3FTUA 4RVBA 3NQPA 4G11A 2UY1A 4DLOA 3CIAA 3OAWA 3CHSA 1HF8A 5ARFA 3JCKC 2PZIA 3MGBA 5CMYA 4U0SA 3D9IA 3QARA 3ZFWA 3TJPA 2BF0X 4UI9J 5G2NA 2VGXB 4NURA 1IHGA 3HVEB 1IQUA 2XPZA 3OTNA 4ABNA 5G05J 4ANXA 1DVPA 3SBTB 5ANLA 4JHJA 3T5VA 4EBAA 3ASHA 5LFAA 5JJ7A 4NRHB 3G2SA 5BV0A 3FULA 3N71A 4WWNA 5FQ6A 2YINA 3PEUB 1OWOA 3WXXA 3L16A 5M72A 4AXHA 3SFZA 4TRQA 4Q69A 4CRWA 3IHYA 2CHWA 3KD7A 2VQ2A 3FH5A 2LNIA 4CGVA 4I1MA 2I6HA 3ONKA 5A7DB 3I4RB 4N3AA 4BSXA 4KT6B 2IU1A 2FULA 3QAQA 3RJVA 4JA7A 2X6HA 1OWPA 4LRZA 5KJKA 3ESLA 3FU6A 4WUYA 4I2ZA 4WWOA 4Q96A 1Y8MA 4ILIA 4BY6A 4IULA 4P29A 4UWGA 4JVSA 3T8MA 4FC8A 3LPZA 3ZIMA 3OXLA 3U3WA 2WM9A 5FQ7A 3FU3A 4FP7A 4BWRA 5A23A 2WQ7A 1VDYA 3FY4A 1MHQA 2ZU6B 3ZHEB 3FTSA 4XI9A 2YHEA 3GZ2A 3TG4A 1TJCA 3OXFA 4KBQA 2YNQA 5FT9A 3IV0A 4UQYA 4JL0A 4AIFA 4F3VA 5KJLA 2VSXE 4TV3A 2WMNA 2VSOE 2AWIA 2FO7A 4KZCA 2AXVA 2X6KA 2RG8A 2RD0A 4KYOB 4B0ZA 2XQ0A 2FI7A 3R7QA 1E8XA 4KVMA 4YVOA 2XPYA 4GYWA 4F1SA 5JHAA 4MKTA 2CHXA 3ZN3A 4GA2A 3VTXA 1L5JA 2FF4A 4I9EA 4RSYA 3MKQB 2XPIA 2UY1B 4DI3A 3CVWA 4FJYA 3FEYA 3MEKA 3AS5A 2PL2A 2DIWA 2V0PA 2ONDA 3HVEA 2CG2A 3CVQA 3ZPJA 2X6IA 1HFAA 2VJ8A 4YNDA 2XCCA 4WNEA 1EPUA 3B7UX 3I4GA 3SD5A 3S7DA 2WXPA 2P58C 5DBKA 3PH0C 4GZ5A 3QB2A 4UQXA 2GRLA 3NF1A 1HO8A 3ZW3A 4UQZA 1QZ2A 3D9MA 2PQNA 2WXKA 1E7UA 1EF1C 4HOSA 3FTVA 4AJWA 4ANUA 3I5PA 4RG6A 4EECA 2XRYA 3CVUA 1WM5A 4H7YA 3TG5A 3S7BA 3FUIA 3FTZA 3MX3A 3MJWA 2CHZA 3FTYA 3AU4A 4U8HA 4CCAA 3PE4A 1PAQA 3C98A 1E8WA 4O6FA 2LSVA 2FEZA 4A55A 3CVLA 2WXOA 2XCBA 3VLDA 5T4YA 2XGOA 4XIFA 4LCTA 4B94A 2WXIA 4DLQA 4IRUA 4GZCA 4V3IA 1UN8A 5CMWA 3LYAA 3GW4A 3Q15A 4A3VA 4A3TA 1INZA 3K9IA 3CEQA 3FTXA 2CFUA 3G2TA 4CDNA 1UG3A 4FA6A 3G2VA 3FU0A 4K0RA 3G2WA 4JHKA 4AP2A 2Y4TA 3BG1B 2X6JA 4PUCA 3UT7A 3SBSA 3CLJA 2YQ8A 4JA9A 1OWLA 2XEVA 1NZNA 4GA0A 5DIZA 1HS6A 3DBSA 2OVBA 3MCXA 4L2LA 2VGXA 4L23A 5FTPA 3LXUX 5BV1A 5FQ8A 1ZBPA 2WB2A 4G26A 4HOUA 4YVQC 5JHBA 3FFLA 2MHKA 3ZVVA 4WNDA 3ML9A 2R59A 3L17A 5E75A 4FULA 3MZLB 3B7SA 2IFUA 3ASDA 3D9NA 4HOQA 5EX3A 4GCOA 5KJNA 2MRIA 4BT8A 3PZDA 4GYYA 2FBNA 3FUKA 1H2UA 2E2EA 2WXJA 3UQ3A 3LDZA 1NA3A 3LY8A 4HS2A 4ME2A 5KCMA 3ZXSA 1UW4B 2OV8A 5FZQA 2KZTB 4F53A 4BX8A 1SZAA 3D9OA 2KM4A 1HH8A 2VSYA 4XZ4A 1LF8A 1ELWA 1OWMA 3S7FA 4J8FA 2WXRA 4MRUA 4JEUA 4CEMA 3QK0A 4FLBA 3UT8A 3ZEFA 4BTAA 2HYZA 1S0PA 2V8SE 3R7RA 2LAIA 2I2OA 2Q7FA 4IN3B 4GB9A 3KAEA 3EJNA 2IONA 5G05C 3VLEA 2VTBA 2IQCA 4CT4A 5EDSA 5AIJA 2I1KA 3APCA 4AV7A 5J90A 3BG0B 4R7LA 3MA5A 4GZ6A 4KXKB 3D9LA 1OUVA 4FLHA 3CHOA 3FDHA 4F7AA 4J6IA 2R5SA 3UUXA 3SGHA 2IJGX 4BX9A 3B13A 3VLFA 4W9RA 2KATA 3VTYA 4K03A 4ANWA 4L7TA 1QQEA 3Q5MA 4M3OA 4EZKA 5G04J 2X3MA 2JEKA 4LEUA 2WXLA 3ASGA 5FQ4A 2R17C 1HZ4A 4I17A 1FVHA 2WQ6A 3FUDA 4FADA 4GZDA 2WXFA 4N39A 4PH4B 2X6FA 4AY6A 1JUQA 1H2TC 3APFA 4G23A 4KZ0A 2J4BA 2AXUA 3ENEA 3JUIA 4ANVA 2DCPA 2L9BA 3CKBA 3B7RL 2Y4UA 3PE3A 4J8EA 3ZHEA 4UI9C 2IOSA 1IQRA 3RK6A 2JLBA 1ELKA 3HIZA 5ENNA 2HR2A 1JWFA 4HXIA 3CK8A 5FZRA 3RIBA 2J08A 3SNXA 2GRMA 4U63A 4Q94A 3CVXA 4ACLA 1NA0A 3RO3A 4KVOA 4B8AA 4DK5A 5CCMA 2X38A 4HVBA 1HXIA 2L0TB 1WAO1 4OVUA 4WNFA 5AJLA 3FUNA 2LSUA 2J49A 4JZYA 1WY6A 4BFRA 5D0QD 2VSNA 4APOA 4AEZC 3FWVA 1PC2A 2NC9A 4I2WA 4ACKA 4FHJA 4AOFA 3S2AA 2I9CA 4ATGA 3GZSA 2C0LA 2QFCA 3CSTA 1QNFA 3QNKA 3FUMA 3U66A 2M63A 4L1BA 4ILHB 3UPVA 3AU5A 3LCAA 4FU3A 4A1GA 3NZSA 3SF4A 4NQ0A 5AJDA 4WNGA 3FUHA 5BUZA 4HORA 4UWFA 3CV0A 5JJTA 4J8SA 1HG2A 4CGWA 3P2BA 3AS4A 4BTBA 4I43A 4MS6A 3KEZA 3PRZA 3QJZA 4EPZA 2E0IA 4OYSA 3CHPA 1E90A 3TXNA 1E8ZA 2WXGA 3GYZA 2XGMA 3URZA 3ULQA 1H6KA 3CVPA 3PDNA 4URKA 3KS2A 2BUGA 4N3BA 5G04C 5T8IA 2A5UA 3L22A 5D0OD 4B8CB 3Q4AB 3L6AA 3LY7A 3MV3B 3EIQC 3IEGA 5C1DA 1H0AA 1SZ9A 4CT0A 3QKYA 2HM8A 4I6JA 1Z3XA 3TGOA 4N2QA 1JPLA 1Z3YA 1TJFA 3MYVA 3L08A 5BT1A 2KZTA 4WAFA 4AVXA 1E96B 4PS3A 4DPRA 3LEWA 3CVYA 3L13A 4GAAA 4AY5A 3ASFA 3B7TA 3NZUA 4GU5A 2C2LA 3JQ1A 3AS8A 5JJ6A 1OWNA 4U0UA 2VYIA 1UN9A 2KC7A 2LAHA 2ILRA 3CK7A 1ELRA 3D9PA 3QOUA 3U64A 5AENA 5CCLA 1FVFA 1PY1A 2MOWA 1YA0A 1KT0A 3CHQA 4G24A 4EBAG 4C0MA 3G2UA 4GMJA 4G1TA 4U0ZA 4I1AA 1H19A 3QWPA 5HI7A 3PS6A 4PDXA 3UT4A 2V4LA 5LOZA 3RO2A 3HDXA 3QWWA 3CSFA 2KCVA 3QDNA 3PNTB 3LJ3A 1HX8A 1EYHA 3UX4A 3ZYLA 2PM6A 5C2YA 2IOLA 2QY7A 3Q47B 4G2VA 2KCKA 3EIJA 1E8YA 2Y3AA 2NXPA 3CK9A 1Z6TA 3FH7A 4DI4A 3D3MA 3CR3A 5LCWJ 4Y6WA 1JWGA 3LY9A 3RRUA 3ZGQA 2J09A 1U3CA 3IHVA 4J8DA 4E6HA 2V5FA 4PS8A 1ZU2A 2L6JA 1N54A 2WQHA 1Y6IA 4I6EA 4H7XA 4EZLA 1A17A 4XI0A 1DNPA 3HHMA 5FJYA 4GYOA 4C9BB 5A6CA 4I6GA 3SHFA 3BEEA 2BTDA 2HO1A 4XKCA 5AYWD 5LP0A 4XE0A 1HG5A 3RRNB 1UJJA 3EHMA 3E4BA 3QC1A 3CKCA 5T3RA 1N52A 2PM7A 3O4ZA 3L54A 3FTWA 2I1JA 3SI5A 3TAXA 4EQFA 3ZRHA 3U4TA 4DJAA 3HYMB 3EHNA 4Y6CA 3APDA 4TUUA 2OVFA 1H2VC 3FUFA 2DBAA 3U9WA 3T5XA 2C0MA 1XNFA 4A1SA 1SQMA 1P5QA 2AW6A 5BW8C 4U07A 4KMOA 2AVPA 1X5BA 3RKVA 3LVQE 4HLEA 5CHEE 3RRMB 4JEHA 4EZJA 3IBEA 3EDTB 2A4ZA 1BPOA 2CFZA 2J07A 3FH8A 2WXMA 3MKQA 3ZYQA 3FHEA 1NP7A 1KT1A 1B89A 3S7JA 4BT9A 4HOTA 3D9KA 5J08A 3FEXA 4AM9A 3FUEA 4J0UA 3LS8A 4MLPA 3GZ1A 1W3BA 2WXQA 4OVVA 1KLXA 4N5CA 4NACA 2WPVA 3CVVA 3LVRE 5ARGA 2IF4A 3ML8A 4QFVA 3CQGB 3CVNA 4GCNA 4U04A 3ESKA 2NSZA 4JHRA 3RU0A 4UI9K 3UMVA 2LO6A 3ZYMA 3PNLB 5BNWA 2CG3A 4GZ3A 4E85A 3FUJA 2WVIA 4D10C 3FU5A 3DPDA 4UWKA 2XGSA 3PUKA 1HE8A 4APFA 5BPPA 3MKRA 1IYGA 2GW1A 3LKUA 5G55A 3O48A 2GGFA 2KCLA 3TL5A 5FWQA 3ZYKA 1U3DA 4CDRA 2WMOA 5KJMA 3SZ7A 1UJKA 4GMLA 5HQ8A 4LERA 4N2SA 3D9JA 4HFGA 5E76A 3CHRA 3P1UA 3PUJA 4JW1A 4I9CA 3PEVB 4I1OB 4XX5A 3IKOB 5ANRA 3I3NA 4C0EA 4G25A 4UWHA 4N3CA 1TEZA 4JPSA 4RG9A 2WXNA 3TXMA 2L0IA 3MV2B 4FHKA 4B89A 1FCHA 4GPKA 4UWLA 5FZSA 2PQRA 4PS7A 2VTBB 3QWVA 2YHCA 5LX8A 5EKQD 3JQ0A 1HU3A 5LCWC 3CQCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BF0 X;  4NAC A;  3D9N A;  5CMW A;  4Q96 A;  2DCP A;  3D9P A;  3ZYK A;  1XGW A;  1INZ A;  1PY1 A;  1JWG A;  2MOW A;  3D9L A;  3G2T A;  3RRU A;  1UJK A;  3G2V A;  3D9M A;  1DVP A;  3LDZ A;  3G2W A;  3G2U A;  3D9J A;  4HFG A;  3ZYM A;  1ELK A;  2LO6 A;  1JWF A;  4JXT A;  3CLJ A;  1SZA A;  3D9O A;  1X5B A;  2KM4 A;  1EDU A;  3G2S A;  3ONL A;  4Q94 A;  1LF8 A;  1VDY A;  5LOZ A;  4GZC A;  2L0T B;  1MHQ A;  4FU3 A;  1H0A A;  1SZ9 A;  2L0I A;  4FLB A;  3ZYQ A;  5LP0 A;  2V8S E;  2DIW A;  1JPL A;  1HG5 A;  3ONK A;  3D9K A;  1UJJ A;  5J08 A;  1HFA A;  1HX8 A;  1EYH A;  3ZYL A;  4AVX A;  1HF8 A;  4GZD A;  1HG2 A;  5CMY A;  2QY7 A;  3D9I A;  1JUQ A; 
#chains in the Genus database with same CATH topology
 5EX0 A;  3DSS A;  1FT2 A;  2UWJ G;  2J9Q A;  4GTQ A;  3R9A B;  2EQX A;  3ONL A;  2J4D A;  4JC8 A;  1OY3 D;  4G11 A;  3CHS A;  2DWZ A;  3JCK C;  5CMY A;  4U0S A;  3D9I A;  3ZFW A;  3TJP A;  4GPM A;  5G2N A;  1IQU A;  2XPZ A;  1DVP A;  3SBT B;  5LFA A;  4NRH B;  5FQ6 A;  5ENS D;  3V2X A;  2CHW A;  2QYU A;  2VQ2 A;  2I6H A;  4KT6 B;  2IU1 A;  3RJV A;  3FU6 A;  2P9L G;  4BY6 A;  4JVS A;  3OXL A;  1DCQ A;  3FU3 A;  3DSW A;  4K5A B;  1TJC A;  1JCQ A;  4GTM A;  5FT9 A;  4UQY A;  4F3V A;  5KJL A;  3AG2 E;  2WMN A;  2FO7 A;  4KZC A;  1A5E A;  4GYW A;  4F1S A;  5JHA A;  3ZN3 A;  4GA2 A;  1K1B A;  2UY1 B;  3CVW A;  4FJY A;  2FO1 E;  3HXF A;  1N0R A;  3SFY A;  3HVE A;  3ZPJ A;  3TWU A;  1HFA A;  2VJ8 A;  4YND A;  3V31 A;  4C48 B;  2XCC A;  3TWS A;  1EPU A;  3S7D A;  3PH0 C;  3QB2 A;  4TUM A;  4UQX A;  5EID A;  2GRL A;  5EIB E;  4HOS A;  1TN6 A;  4AJW A;  4MBG A;  1YYH A;  3CVU A;  1WM5 A;  2P2C P;  3FUI A;  1LTX A;  1N0Q A;  1LD7 A;  2CHZ A;  2H6H A;  3PE4 A;  3C98 A;  1E8W A;  1TNB A;  3DWL G;  3CVL A;  3VLD A;  2XCB A;  1UN8 A;  4A3V A;  4A3T A;  3CEQ A;  2CFU A;  2Y4T A;  3UT7 A;  4JA9 A;  2XEV A;  1SW6 A;  3C3R A;  4GA0 A;  1HS6 A;  3Q7A A;  4L2L A;  4L23 A;  3UIN C;  3EUV A;  2XS8 A;  2MHK A;  5E75 A;  2GRO B;  3ASO E;  3MZL B;  3B7S A;  3ASD A;  3D9N A;  2BKK B;  2MRI A;  4BT8 A;  2WXJ A;  4HS2 A;  2XZT G;  2P9P G;  3TWW A;  3ZXS A;  2OV8 A;  1LF8 A;  1OWM A;  2WXR A;  3NAW A;  4U96 D;  4GB9 A;  2ION A;  5AIJ A;  3APC A;  5J90 A;  3MA5 A;  1N4S A;  4HLL A;  3UXG A;  3CHO A;  4J6I A;  2R5S A;  1S64 A;  2IJG X;  4ANW A;  4L7T A;  3Q5M A;  4M3O A;  2LUH A;  4I17 A;  3C72 A;  4FAD A;  3B95 A;  1H2T C;  1H6O A;  3ENE A;  2L9B A;  3E34 A;  3CKB A;  4J8E A;  3ZHE A;  5B3S E;  5ENP D;  3CVX A;  4ACL A;  1NA0 A;  3RO3 A;  3TWT A;  1HXI A;  5FIN A;  5AJL A;  4OVU A;  4WNF A;  2P9N G;  2LSU A;  2J49 A;  5EN5 D;  1WY6 A;  4AEZ C;  4ACK A;  4FHJ A;  4AOF A;  3S2A A;  4ATG A;  2C0L A;  2QFC A;  4N5Q A;  4EHM A;  4F6R D;  4ILH B;  3ZU7 B;  3AU5 A;  4FU3 A;  4A1G A;  3NZS A;  4NQ0 A;  5BUZ A;  4UWF A;  1HG2 A;  2RFM A;  3KEZ A;  2E0I A;  4OYS A;  1D8E A;  1E90 A;  3URZ A;  3CVP A;  4N3B A;  5G04 C;  2A5U A;  1TNO A;  3L22 A;  2JAB A;  3L6A A;  5C1D A;  3E32 A;  3TGO A;  2HM8 A;  4I6J A;  2KBX A;  4DX2 A;  1MZC A;  3CVY A;  4B93 B;  3B7T A;  3NZU A;  3JQ1 A;  2LAH A;  2MOW A;  5HKP A;  1KT0 A;  4C0M A;  2ZGG A;  4CZ2 D;  3V2O A;  3QWP A;  5KWD A;  3RO2 A;  3C3O A;  3CSF A;  5HS0 A;  1AP7 A;  3UX4 A;  3Q47 B;  5EIL A;  2Y3A A;  3CK9 A;  3TWQ A;  1SA5 A;  2J09 A;  1FT1 A;  1U3C A;  3IHV A;  3UM2 A;  4PS8 A;  4I6E A;  4XI0 A;  4GYO A;  3BEE A;  5AYW D;  1UJJ A;  3CKC A;  5T3R A;  2PM7 A;  1OCC E;  3APD A;  4TUU A;  1BD8 A;  3FUF A;  3AG1 E;  5ENR D;  3T5X A;  2AVP A;  1X5B A;  3LVQ E;  4K5C A;  2CFZ A;  3ZYQ A;  2WXM A;  3FHE A;  4HOT A;  3FEX A;  4MLP A;  3GZ1 A;  3PZ3 A;  1W3B A;  4OVV A;  2IEJ A;  1WDY A;  2R02 A;  4G8K A;  3CVV A;  5ARG A;  3ZXP A;  3UTM A;  4DX1 A;  3ESK A;  3B7B A;  3UMV A;  2GRP B;  4GZ3 A;  4E85 A;  1BI8 B;  4YDO A;  3FU5 A;  3UIP C;  2B0O E;  3PUK A;  1V55 E;  5G55 A;  3O48 A;  3ZUV B;  1U3D A;  4UUC A;  2WMO A;  2ZIR A;  5HQ8 A;  4HFG A;  5E76 A;  3PEV B;  1D9S A;  3I3N A;  3ASN E;  5EYP F;  4UWH A;  4JPS A;  3KSL A;  4RG9 A;  2L0I A;  1FCH A;  4GPK A;  2H6G A;  3X2Q E;  3QWV A;  3CHM A;  3TWV A;  5HRY A;  2XRZ A;  2XHE A;  4XKB A;  3E33 A;  4IYP A;  3JYS A;  2VGY A;  2AXZ A;  4L2Y A;  4DRX E;  3F6Q A;  3QAR A;  3DSV A;  1IHG A;  3HVE B;  3OTN A;  3ASH A;  3NB2 A;  2YIN A;  1TN7 A;  4Q69 A;  4CRW A;  3IHY A;  1D8D A;  2LNI A;  3ONK A;  3I4R B;  2F8X K;  2XS1 A;  2FUL A;  4JA7 A;  2X6H A;  1OWP A;  5KJK A;  2V5Q C;  4Q96 A;  1Y8M A;  4QQI A;  2DZN A;  3LPZ A;  2OCC E;  1BI7 B;  3U3W A;  4FP7 A;  2WQ7 A;  5AQA A;  3FY4 A;  5AQB A;  1MX2 A;  4OAU C;  3GZ2 A;  4KBQ A;  1SA4 A;  3IV0 A;  4AIF A;  4HI8 A;  2IO3 C;  2AXV A;  2RG8 A;  3DSX A;  2RD0 A;  4B0Z A;  2FI7 A;  4KVM A;  4YVO A;  4MKT A;  4L9P A;  2FF4 A;  4I9E A;  4DI3 A;  3FEY A;  4TXQ A;  1O1S A;  2QZA A;  3MEK A;  2PL2 A;  5CBN A;  2DIW A;  2V0P A;  3SQV A;  1U2V G;  1O5M A;  3SD5 A;  2WXP A;  3ULE G;  3KEA A;  4GTT A;  4ANU A;  1N4P A;  3UM1 A;  2AJA A;  4H7Y A;  3FTZ A;  5CEC B;  3FTY A;  2XGO A;  4XIF A;  2WXI A;  4IRU A;  4GZC A;  3LYA A;  3Q15 A;  4LG6 A;  3T9K A;  3PZ2 A;  3FTX A;  4FA6 A;  1UG3 A;  4K0R A;  2X6J A;  3NOC D;  1IXV A;  1OWL A;  3ZIM A;  1NZN A;  1V54 E;  2OVB A;  4BSZ B;  4U95 D;  2WB2 A;  5JHB A;  1N4Q A;  4WND A;  3L17 A;  4FUL A;  4HOQ A;  5EX3 A;  5KJN A;  4GYY A;  2FBN A;  3FUK A;  1H2U A;  5BXU A;  1NA3 A;  2XEN A;  3LY8 A;  4ME2 A;  5KCM A;  5FZQ A;  2KZT B;  4O1P A;  3S7F A;  4J8F A;  4MRU A;  4JEU A;  4CEM A;  3QK0 A;  3R7R A;  3EJN A;  5AN8 A;  4CT4 A;  5EDS A;  2I1K A;  2DYS E;  4GZ6 A;  1X81 A;  1OUV A;  1S70 B;  4F7A A;  3FDH A;  1OT8 A;  3SGH A;  4BX9 A;  3B13 A;  2F0Y A;  4GTV A;  2X3M A;  1OXJ A;  2P9I G;  1FVH A;  3FUD A;  5D66 A;  4GZD A;  2WXF A;  4N39 A;  4AY6 A;  1JUQ A;  3APF A;  3PE3 A;  2Y4U A;  2JLB A;  2HR2 A;  5FZR A;  3SNX A;  2GRM A;  4U63 A;  4DK5 A;  1WAO 1;  3FUN A;  3EHQ A;  3V30 A;  3PZ1 A;  3GZS A;  3QNK A;  4ZFH A;  3UPV A;  3LCA A;  1TNZ A;  4CGW A;  1FPP A;  3AJI A;  4HNA D;  3QJZ A;  3DSU A;  3TXN A;  2WXG A;  3GYZ A;  2XGM A;  3ULQ A;  1H6K A;  5T8I A;  2BUG A;  4DX6 D;  4GTR A;  3Q75 A;  3MV3 B;  3SFX A;  3EIQ C;  4JD2 G;  4CT0 A;  1JPL A;  4DUI A;  3L08 A;  5BT1 A;  2KZT A;  4AVX A;  1E96 B;  4GU5 A;  2H6F A;  3AS8 A;  4U0U A;  2IO2 C;  2KC7 A;  2ILR A;  5KNG A;  4EBA G;  1IHB A;  4U0Z A;  4I1A A;  4TXR A;  4PDX A;  3AAA C;  1OCZ E;  2KCV A;  1EYH A;  2IY0 C;  4G2V A;  1E8Y A;  1H6P A;  4DI4 A;  1N9A A;  3C5R A;  4E6H A;  1N54 A;  4YDE A;  4Z68 A;  4EZL A;  1A17 A;  5FJY A;  4C9B B;  5JMN D;  3SHF A;  2BTD A;  2HO1 A;  1TNY A;  1WG0 A;  4XE0 A;  1HG5 A;  3E4B A;  1N52 A;  3TAX A;  3ZRH A;  3JXI A;  4DJA A;  3EHN A;  1Q2Z A;  2OVF A;  3DEO A;  4A1S A;  1SQM A;  3HXD A;  2AW6 A;  5CHE E;  5IY5 E;  3IBE A;  2A4Z A;  1BPO A;  3FH8 A;  1NP7 A;  1KT1 A;  3S7J A;  3FUE A;  4J0U A;  2WXQ A;  2BED A;  1NL4 A;  3ML8 A;  3CQG B;  2LXL A;  2L6B A;  3CVN A;  4U04 A;  4JHR A;  2NSZ A;  5BNW A;  3ZYM A;  2VGE A;  1RW2 A;  3FUJ A;  2WVI A;  3DPD A;  2GW1 A;  4CDR A;  5BXO A;  5KJM A;  1UJK A;  3CHR A;  2B6C A;  4XX5 A;  4JB8 P;  1G3N B;  5B1B E;  1N4R A;  4FHK A;  4B89 A;  2ZGD A;  4PS7 A;  3L9T A;  1O1T A;  3PRE A;  2WXH A;  4GA1 A;  3Q49 B;  3CGH A;  1AWC B;  4ILG A;  4GTS A;  4JXT A;  1EDU A;  1MQS A;  4CDM A;  4RVB A;  4DLO A;  2LXM A;  3HXC A;  1HF8 A;  3MGB A;  1TNU A;  2VGX B;  3R9M A;  4JHJ A;  4EBA A;  5JJ7 A;  5BV0 A;  3N71 A;  4WWN A;  3PEU B;  4TRQ A;  3ZNG A;  4I1M A;  4N3A A;  4BSX A;  3QAQ A;  4LRZ A;  3ESL A;  4WUY A;  4BEP A;  4WWO A;  5ITZ F;  4ILI A;  4IUL A;  4UWG A;  3T8M A;  3ZKJ A;  3JXJ A;  3RAU A;  2WM9 A;  5FQ7 A;  1DCE A;  4BWR A;  5A23 A;  1VDY A;  1MHQ A;  2ZU6 B;  4XI9 A;  2YHE A;  2F37 A;  4XEI G;  2YNQ A;  2VSX E;  4NIK A;  3UKR G;  4KYO B;  2XQ0 A;  1E8X A;  1QYM A;  2XPY A;  2CHX A;  3VTX A;  1L5J A;  1BLX B;  2XPI A;  1NI1 A;  3AS5 A;  3CVQ A;  5B1A E;  2F8Y A;  4WNE A;  1KZP A;  3B7U X;  3I4G A;  3SY2 A;  3AG4 E;  2P58 C;  5DBK A;  5EYL A;  4GZ5 A;  2DZO A;  1HO8 A;  4UQZ A;  1E7U A;  3FTV A;  1K8K G;  4RG6 A;  2EIK E;  4EEC A;  3TG5 A;  3S7B A;  1YCS B;  2R05 A;  4BES A;  1K1A A;  4O6F A;  2LSV A;  4J7W A;  4LCT A;  4B94 A;  3LJN A;  5CMW A;  1INZ A;  3FU0 A;  3G2W A;  4CYM D;  4JHK A;  3BG1 B;  4PUC A;  3SBS A;  2YQ8 A;  3KSQ A;  5T4Y A;  3EU5 A;  3MCX A;  2VGX A;  5FTP A;  5FQ8 A;  4G26 A;  4HOU A;  4YVQ C;  3FFL A;  3ML9 A;  1KPS B;  3HRA A;  2IFU A;  3PZD A;  4BET A;  3Q78 A;  4F53 A;  4BX8 A;  1SZA A;  3D9O A;  2VSY A;  4XZ4 A;  1ELW A;  5CRU A;  1S0P A;  3Q79 A;  5CEA A;  2LAI A;  2I2O A;  2Q7F A;  4IN3 B;  3D9H A;  3VLE A;  5G05 C;  2VTB A;  2IQC A;  3BG0 B;  4R7L A;  4A63 B;  2EIN E;  4KXK B;  3D9L A;  1N11 A;  4FLH A;  3ABK E;  3VLF A;  2KAT A;  1TR4 A;  3VTY A;  5CED B;  5G04 J;  2JEK A;  2WXL A;  3ASG A;  2XZD G;  2R17 C;  3EHR A;  2WQ6 A;  2P9K G;  2X6F A;  1QBQ A;  4KZ0 A;  2J4B A;  5AAR A;  3B7R L;  4UI9 C;  2IOS A;  1IQR A;  4LSZ E;  1KZO A;  1JWF A;  4M7C A;  3CK8 A;  2J08 A;  4O60 A;  5CBO A;  2X38 A;  4HVB A;  3DXM G;  2L0T B;  2Y1L E;  4JZY A;  4TXP A;  5D0Q D;  2Y69 E;  2VSN A;  4APO A;  3Q9U C;  1PC2 A;  2ZXW E;  3U66 A;  3SF4 A;  5AJD A;  3FUH A;  3HXE A;  4HOR A;  3CV0 A;  4J8S A;  3P2B A;  3AS4 A;  4I43 A;  3PRZ A;  2RKK A;  1E8Z A;  4URK A;  3KS2 A;  5H7P A;  4B8C B;  1O1R A;  3Q9N C;  5FIO A;  1SZ9 A;  3QKY A;  4N2Q A;  1Z3Y A;  3ABL E;  4HI9 A;  4PS3 A;  4DPR A;  3L13 A;  4AY5 A;  2C2L A;  1OWN A;  3ZEF A;  2VYI A;  1UN9 A;  3D9P A;  3QOU A;  3U64 A;  1FVF A;  1YA0 A;  4G24 A;  4ZHB A;  2GRN B;  4GMJ A;  1H19 A;  3PS6 A;  5LOZ A;  3HDX A;  3QWW A;  3AG3 E;  3QDN A;  3PNT B;  3LJ3 A;  1HX8 A;  3ZYL A;  2KCK A;  3EIJ A;  1Z6T A;  3CR3 A;  5LCW J;  4Y6W A;  1JWG A;  4RQI A;  3BU8 A;  4RLY A;  1ZU2 A;  1Y6I A;  1YMP A;  4I6G A;  4XKC A;  3RRN B;  2QYJ A;  3EHM A;  3QC1 A;  3SI5 A;  4EQF A;  4GTP A;  2EIM E;  3HYM B;  4Y6C A;  3W9F A;  3T8K A;  2DBA A;  2C0M A;  1XNF A;  3L82 A;  4U07 A;  4KMO A;  2KXP C;  4EZJ A;  3TWR A;  4HRN A;  4BT9 A;  3D9K A;  5ENT D;  1MYO A;  2WPV A;  2GRQ B;  2IF4 A;  5ENO D;  4QFV A;  2ETB A;  4UI9 K;  2LO6 A;  2CG3 A;  3SO8 A;  4D10 C;  2XGS A;  1HE8 A;  3LKU A;  2GGF A;  2KCL A;  3TL5 A;  5FWQ A;  3BQO A;  3ZYK A;  5AQ9 A;  3RSE G;  3D9J A;  3P1U A;  4JW1 A;  4I9C A;  5ANR A;  4I1O B;  4C0E A;  3IKO B;  4G25 A;  4U7E B;  4N3C A;  4HBD A;  3TXM A;  3J5Q B;  4LNG A;  1MJ0 A;  2NYJ A;  5LX8 A;  5EKQ D;  3JQ0 A;  2I9C A;  1HU3 A;  5LCW C;  4LUN U;  1K3Z D;  4GTO A;  1XGW A;  4LNU D;  3FP3 A;  2H6I A;  4G8L A;  3BUA A;  3OXG A;  3PVL A;  4WWP A;  4FJZ A;  2OOE A;  1E7V A;  1GW6 A;  3FTU A;  3NQP A;  2UY1 A;  4HRM B;  5KNH D;  3CIA A;  3OAW A;  5ARF A;  2PZI A;  4U8V D;  2BF0 X;  4O1O A;  4UI9 J;  5JA4 D;  3NOG D;  2A5E A;  4NUR A;  4ABN A;  1JCR A;  4YDW A;  5G05 J;  4ANX A;  5ANL A;  1BU9 A;  3T5V A;  3G2S A;  3FUL A;  1OWO A;  3WXX A;  3L16 A;  5M72 A;  4AXH A;  3SFZ A;  2MYO A;  3KD7 A;  3FH5 A;  3IXE A;  3Q7F A;  4CGV A;  5A7D B;  3ISM C;  2DVW A;  3WG7 E;  4I2Z A;  4P29 A;  5AAO A;  4FC8 A;  1NFI E;  3ZHE B;  3FTS A;  2R03 A;  3TG4 A;  3OXF A;  4JL0 A;  4TV3 A;  2VSO E;  2AWI A;  2X6K A;  2EIL E;  3R7Q A;  3ULY A;  4HB5 A;  4RSY A;  3MKQ B;  3DEP A;  2OND A;  2CG2 A;  2X6I A;  3UM3 A;  5CER B;  3Q73 A;  3UIO C;  1OCR E;  3NF1 A;  3J5P A;  4GMR A;  3ZW3 A;  1QZ2 A;  1RZ4 A;  2PQN A;  2WXK A;  3D9M A;  1EF1 C;  3I5P A;  2XRY A;  3MX3 A;  3MJW A;  4BER A;  3AU4 A;  4U8H A;  4CCA A;  1PAQ A;  2FEZ A;  4A55 A;  3HXB A;  2WXO A;  4DLQ A;  3HG0 D;  4V3I A;  3GW4 A;  2EIJ E;  3K9I A;  2XEH A;  3G2T A;  4CDN A;  3G2V A;  4AP2 A;  3CLJ A;  2OEV A;  5DIZ A;  1UOH A;  3DBS A;  5BV1 A;  3LXU X;  4X8Q A;  1ZBP A;  1N95 A;  3ZVV A;  2R59 A;  4U8Y D;  3TWX A;  3EU9 A;  4GCO A;  3UQ3 A;  2E2E A;  3LDZ A;  1UW4 B;  4HQD A;  2KM4 A;  1HH8 A;  4F1P A;  4FLB A;  3UT8 A;  4BTA A;  2HYZ A;  2V8S E;  1TYQ G;  3KAE A;  2GRR B;  4DX7 D;  3V79 K;  4AV7 A;  3DRA A;  3DST A;  2R2L A;  3UUX A;  4W9R A;  4K03 A;  1QQE A;  4EZK A;  5ENQ D;  5FQ4 A;  1HZ4 A;  4PH4 B;  4G23 A;  2AXU A;  3JUI A;  3UKU G;  4ANV A;  2DCP A;  2ZIS A;  3RK6 A;  2HE0 A;  3HIZ A;  1ELK A;  5ENN A;  2DYR E;  1OCO E;  4HXI A;  3RIB A;  1TN8 A;  1MX4 A;  1SVX A;  4Q94 A;  4KVO A;  4B8A A;  5CCM A;  3UM0 A;  4YDY A;  4BFR A;  3JUE A;  4J8Y A;  3FWV A;  2NC9 A;  4I2W A;  3CST A;  1QNF A;  3FUM A;  2M63 A;  4L1B A;  4WNG A;  5CRV A;  2XEE A;  5JJT A;  1Z5S C;  2P9S G;  4BTB A;  4MS6 A;  4EPZ A;  2QC9 A;  3CHP A;  4K5B A;  3PDN A;  4HRL A;  5D0O D;  1LD8 A;  2Y0B G;  3Q4A B;  3LY7 A;  3IEG A;  1H0A A;  3ABM E;  1Z3X A;  1JCS A;  1TJF A;  3MYV A;  2ETA A;  4WAF A;  1IKN D;  3LEW A;  4GAA A;  3ASF A;  5JJ6 A;  3CK7 A;  5CCL A;  1ELR A;  5AQ7 A;  5AEN A;  1PY1 A;  3CHQ A;  3E30 A;  3G2U A;  4G1T A;  5HI7 A;  1DC2 A;  3UT4 A;  2V4L A;  5D2M C;  3UI2 A;  4LNB A;  2PM6 A;  5C2Y A;  2IOL A;  3DXK G;  2QY7 A;  5KBA A;  2NXP A;  3FH7 A;  3D3M A;  3RRU A;  3LY9 A;  3ZGQ A;  4J8D A;  2V5F A;  2WQH A;  2L6J A;  2PNN A;  4H7X A;  1DNP A;  3HHM A;  1N94 A;  5A6C A;  5LP0 A;  4ATZ D;  3O4Z A;  3L54 A;  3FTW A;  2I1J A;  3PZ4 A;  3U4T A;  1H2V C;  3U9W A;  1P5Q A;  5BW8 C;  3RKV A;  4HLE A;  3RRM B;  4JEH A;  1S63 A;  3EDT B;  3MKQ A;  2J07 A;  3W9G A;  1B89 A;  2P9U G;  5J08 A;  4AM9 A;  3C3Q A;  3LS8 A;  1KLX A;  4N5C A;  2OEW A;  4NAC A;  3LVR E;  4GCN A;  3NBN B;  3RU0 A;  3PNL B;  2V4H C;  3E37 A;  2BKG A;  4UWK A;  4APF A;  5BPP A;  3MKR A;  1IYG A;  2J8S D;  4OAV B;  3SZ7 A;  4GML A;  4LER A;  4N2S A;  3PUJ A;  3DPY A;  1TEZ A;  1ZB1 A;  2WXN A;  3MV2 B;  2RFA A;  4DX5 D;  1MX6 A;  4UWL A;  5FZS A;  2PQR A;  2VTB B;  2ETC A;  2YHC A;  4LEU A;  3CQC B; 
#chains in the Genus database with same CATH homology
 3CHM A;  3PRE A;  2WXH A;  4LUN U;  4GA1 A;  3Q49 B;  1XGW A;  3CGH A;  3FP3 A;  5EX0 A;  4ILG A;  2XRZ A;  2XHE A;  3OXG A;  2UWJ G;  4XKB A;  2J9Q A;  3PVL A;  4IYP A;  4JXT A;  4WWP A;  3R9A B;  2EQX A;  1EDU A;  3ONL A;  2OOE A;  4FJZ A;  3JYS A;  1MQS A;  1E7V A;  2AXZ A;  2J4D A;  2VGY A;  1GW6 A;  4CDM A;  4JC8 A;  4L2Y A;  3FTU A;  4RVB A;  3NQP A;  4G11 A;  2UY1 A;  4DLO A;  3CIA A;  3OAW A;  3CHS A;  1HF8 A;  5ARF A;  3JCK C;  2PZI A;  3MGB A;  5CMY A;  4U0S A;  3D9I A;  3QAR A;  3ZFW A;  3TJP A;  2BF0 X;  4UI9 J;  5G2N A;  2VGX B;  4NUR A;  1IHG A;  3HVE B;  1IQU A;  2XPZ A;  3OTN A;  4ABN A;  5G05 J;  4ANX A;  1DVP A;  3SBT B;  5ANL A;  4JHJ A;  3T5V A;  4EBA A;  3ASH A;  5LFA A;  5JJ7 A;  4NRH B;  3G2S A;  5BV0 A;  3FUL A;  3N71 A;  4WWN A;  5FQ6 A;  2YIN A;  3PEU B;  1OWO A;  3WXX A;  3L16 A;  5M72 A;  4AXH A;  3SFZ A;  4TRQ A;  4Q69 A;  4CRW A;  3IHY A;  2CHW A;  3KD7 A;  2VQ2 A;  3FH5 A;  2LNI A;  4CGV A;  4I1M A;  2I6H A;  3ONK A;  5A7D B;  3I4R B;  4N3A A;  4BSX A;  4KT6 B;  2IU1 A;  2FUL A;  3QAQ A;  3RJV A;  4JA7 A;  2X6H A;  1OWP A;  4LRZ A;  5KJK A;  3ESL A;  3FU6 A;  4WUY A;  4I2Z A;  4WWO A;  4Q96 A;  1Y8M A;  4ILI A;  4BY6 A;  4IUL A;  4P29 A;  4UWG A;  4JVS A;  3T8M A;  4FC8 A;  3LPZ A;  3ZIM A;  3OXL A;  3U3W A;  2WM9 A;  5FQ7 A;  3FU3 A;  4FP7 A;  4BWR A;  5A23 A;  2WQ7 A;  1VDY A;  3FY4 A;  1MHQ A;  2ZU6 B;  3ZHE B;  3FTS A;  4XI9 A;  2YHE A;  3GZ2 A;  3TG4 A;  1TJC A;  3OXF A;  4KBQ A;  2YNQ A;  5FT9 A;  3IV0 A;  4UQY A;  4JL0 A;  4AIF A;  4F3V A;  5KJL A;  2VSX E;  4TV3 A;  2WMN A;  2VSO E;  2AWI A;  2FO7 A;  4KZC A;  2AXV A;  2X6K A;  2RG8 A;  2RD0 A;  4KYO B;  4B0Z A;  2XQ0 A;  2FI7 A;  3R7Q A;  1E8X A;  4KVM A;  4YVO A;  2XPY A;  4GYW A;  4F1S A;  5JHA A;  4MKT A;  2CHX A;  3ZN3 A;  4GA2 A;  3VTX A;  1L5J A;  2FF4 A;  4I9E A;  4RSY A;  3MKQ B;  2XPI A;  2UY1 B;  4DI3 A;  3CVW A;  4FJY A;  3FEY A;  3MEK A;  3AS5 A;  2PL2 A;  2DIW A;  2V0P A;  2OND A;  3HVE A;  2CG2 A;  3CVQ A;  3ZPJ A;  2X6I A;  1HFA A;  2VJ8 A;  4YND A;  2XCC A;  4WNE A;  1EPU A;  3B7U X;  3I4G A;  3SD5 A;  3S7D A;  2WXP A;  2P58 C;  5DBK A;  3PH0 C;  4GZ5 A;  3QB2 A;  4UQX A;  2GRL A;  3NF1 A;  1HO8 A;  3ZW3 A;  4UQZ A;  1QZ2 A;  3D9M A;  2PQN A;  2WXK A;  1E7U A;  1EF1 C;  4HOS A;  3FTV A;  4AJW A;  4ANU A;  3I5P A;  4RG6 A;  4EEC A;  2XRY A;  3CVU A;  1WM5 A;  4H7Y A;  3TG5 A;  3S7B A;  3FUI A;  3FTZ A;  3MX3 A;  3MJW A;  2CHZ A;  3FTY A;  3AU4 A;  4U8H A;  4CCA A;  3PE4 A;  1PAQ A;  3C98 A;  1E8W A;  4O6F A;  2LSV A;  2FEZ A;  4A55 A;  3CVL A;  2WXO A;  2XCB A;  3VLD A;  5T4Y A;  2XGO A;  4XIF A;  4LCT A;  4B94 A;  2WXI A;  4DLQ A;  4IRU A;  4GZC A;  4V3I A;  1UN8 A;  5CMW A;  3LYA A;  3GW4 A;  3Q15 A;  4A3V A;  4A3T A;  1INZ A;  3K9I A;  3CEQ A;  3FTX A;  2CFU A;  3G2T A;  4CDN A;  1UG3 A;  4FA6 A;  3G2V A;  3FU0 A;  4K0R A;  3G2W A;  4JHK A;  4AP2 A;  2Y4T A;  3BG1 B;  2X6J A;  4PUC A;  3UT7 A;  3SBS A;  3CLJ A;  2YQ8 A;  4JA9 A;  1OWL A;  2XEV A;  1NZN A;  4GA0 A;  5DIZ A;  1HS6 A;  3DBS A;  2OVB A;  3MCX A;  4L2L A;  2VGX A;  4L23 A;  5FTP A;  3LXU X;  5BV1 A;  5FQ8 A;  1ZBP A;  2WB2 A;  4G26 A;  4HOU A;  4YVQ C;  5JHB A;  3FFL A;  2MHK A;  3ZVV A;  4WND A;  3ML9 A;  2R59 A;  3L17 A;  5E75 A;  4FUL A;  3MZL B;  3B7S A;  2IFU A;  3ASD A;  3D9N A;  4HOQ A;  5EX3 A;  4GCO A;  5KJN A;  2MRI A;  4BT8 A;  3PZD A;  4GYY A;  2FBN A;  3FUK A;  1H2U A;  2E2E A;  2WXJ A;  3UQ3 A;  3LDZ A;  1NA3 A;  3LY8 A;  4HS2 A;  4ME2 A;  5KCM A;  3ZXS A;  1UW4 B;  2OV8 A;  5FZQ A;  2KZT B;  4F53 A;  4BX8 A;  1SZA A;  3D9O A;  2KM4 A;  1HH8 A;  2VSY A;  4XZ4 A;  1LF8 A;  1ELW A;  1OWM A;  3S7F A;  4J8F A;  2WXR A;  4MRU A;  4JEU A;  4CEM A;  3QK0 A;  4FLB A;  3UT8 A;  3ZEF A;  4BTA A;  2HYZ A;  1S0P A;  2V8S E;  3R7R A;  2LAI A;  2I2O A;  2Q7F A;  4IN3 B;  4GB9 A;  3KAE A;  3EJN A;  2ION A;  5G05 C;  3VLE A;  2VTB A;  2IQC A;  4CT4 A;  5EDS A;  5AIJ A;  2I1K A;  3APC A;  4AV7 A;  5J90 A;  3BG0 B;  4R7L A;  3MA5 A;  4GZ6 A;  4KXK B;  3D9L A;  1OUV A;  4FLH A;  3CHO A;  3FDH A;  4F7A A;  4J6I A;  2R5S A;  3UUX A;  3SGH A;  2IJG X;  4BX9 A;  3B13 A;  3VLF A;  4W9R A;  2KAT A;  3VTY A;  4K03 A;  4ANW A;  4L7T A;  1QQE A;  3Q5M A;  4M3O A;  4EZK A;  5G04 J;  2X3M A;  2JEK A;  4LEU A;  2WXL A;  3ASG A;  5FQ4 A;  2R17 C;  1HZ4 A;  4I17 A;  1FVH A;  2WQ6 A;  3FUD A;  4FAD A;  4GZD A;  2WXF A;  4N39 A;  4PH4 B;  2X6F A;  4AY6 A;  1JUQ A;  1H2T C;  3APF A;  4G23 A;  4KZ0 A;  2J4B A;  2AXU A;  3ENE A;  3JUI A;  4ANV A;  2DCP A;  2L9B A;  3CKB A;  3B7R L;  2Y4U A;  3PE3 A;  4J8E A;  3ZHE A;  4UI9 C;  2IOS A;  1IQR A;  3RK6 A;  2JLB A;  1ELK A;  3HIZ A;  5ENN A;  2HR2 A;  1JWF A;  4HXI A;  3CK8 A;  5FZR A;  3RIB A;  2J08 A;  3SNX A;  2GRM A;  4U63 A;  4Q94 A;  3CVX A;  4ACL A;  1NA0 A;  3RO3 A;  4KVO A;  4B8A A;  4DK5 A;  5CCM A;  2X38 A;  4HVB A;  1HXI A;  2L0T B;  1WAO 1;  4OVU A;  4WNF A;  5AJL A;  3FUN A;  2LSU A;  2J49 A;  4JZY A;  1WY6 A;  4BFR A;  5D0Q D;  2VSN A;  4APO A;  4AEZ C;  3FWV A;  1PC2 A;  2NC9 A;  4I2W A;  4ACK A;  4FHJ A;  4AOF A;  3S2A A;  2I9C A;  4ATG A;  3GZS A;  2C0L A;  2QFC A;  3CST A;  1QNF A;  3QNK A;  3FUM A;  3U66 A;  2M63 A;  4L1B A;  4ILH B;  3UPV A;  3AU5 A;  3LCA A;  4FU3 A;  4A1G A;  3NZS A;  3SF4 A;  4NQ0 A;  5AJD A;  4WNG A;  3FUH A;  5BUZ A;  4HOR A;  4UWF A;  3CV0 A;  5JJT A;  4J8S A;  1HG2 A;  4CGW A;  3P2B A;  3AS4 A;  4BTB A;  4I43 A;  4MS6 A;  3KEZ A;  3PRZ A;  3QJZ A;  4EPZ A;  2E0I A;  4OYS A;  3CHP A;  1E90 A;  3TXN A;  1E8Z A;  2WXG A;  3GYZ A;  2XGM A;  3URZ A;  3ULQ A;  1H6K A;  3CVP A;  3PDN A;  4URK A;  3KS2 A;  2BUG A;  4N3B A;  5G04 C;  5T8I A;  2A5U A;  3L22 A;  5D0O D;  4B8C B;  3Q4A B;  3L6A A;  3LY7 A;  3MV3 B;  3EIQ C;  3IEG A;  5C1D A;  1H0A A;  1SZ9 A;  4CT0 A;  3QKY A;  2HM8 A;  4I6J A;  1Z3X A;  3TGO A;  4N2Q A;  1JPL A;  1Z3Y A;  1TJF A;  3MYV A;  3L08 A;  5BT1 A;  2KZT A;  4WAF A;  4AVX A;  1E96 B;  4PS3 A;  4DPR A;  3LEW A;  3CVY A;  3L13 A;  4GAA A;  4AY5 A;  3ASF A;  3B7T A;  3NZU A;  4GU5 A;  2C2L A;  3JQ1 A;  3AS8 A;  5JJ6 A;  1OWN A;  4U0U A;  2VYI A;  1UN9 A;  2KC7 A;  2LAH A;  2ILR A;  3CK7 A;  1ELR A;  3D9P A;  3QOU A;  3U64 A;  5AEN A;  5CCL A;  1FVF A;  1PY1 A;  2MOW A;  1YA0 A;  1KT0 A;  3CHQ A;  4G24 A;  4EBA G;  4C0M A;  3G2U A;  4GMJ A;  4G1T A;  4U0Z A;  4I1A A;  1H19 A;  3QWP A;  5HI7 A;  3PS6 A;  4PDX A;  3UT4 A;  2V4L A;  5LOZ A;  3RO2 A;  3HDX A;  3QWW A;  3CSF A;  2KCV A;  3QDN A;  3PNT B;  3LJ3 A;  1HX8 A;  1EYH A;  3UX4 A;  3ZYL A;  2PM6 A;  5C2Y A;  2IOL A;  2QY7 A;  3Q47 B;  4G2V A;  2KCK A;  3EIJ A;  1E8Y A;  2Y3A A;  2NXP A;  3CK9 A;  1Z6T A;  3FH7 A;  4DI4 A;  3D3M A;  3CR3 A;  5LCW J;  4Y6W A;  1JWG A;  3LY9 A;  3RRU A;  3ZGQ A;  2J09 A;  1U3C A;  3IHV A;  4J8D A;  4E6H A;  2V5F A;  4PS8 A;  1ZU2 A;  2L6J A;  1N54 A;  2WQH A;  1Y6I A;  4I6E A;  4H7X A;  4EZL A;  1A17 A;  4XI0 A;  1DNP A;  3HHM A;  5FJY A;  4GYO A;  4C9B B;  5A6C A;  4I6G A;  3SHF A;  3BEE A;  2BTD A;  2HO1 A;  4XKC A;  5AYW D;  5LP0 A;  4XE0 A;  1HG5 A;  3RRN B;  1UJJ A;  3EHM A;  3E4B A;  3QC1 A;  3CKC A;  5T3R A;  1N52 A;  2PM7 A;  3O4Z A;  3L54 A;  3FTW A;  2I1J A;  3SI5 A;  3TAX A;  4EQF A;  3ZRH A;  3U4T A;  4DJA A;  3HYM B;  3EHN A;  4Y6C A;  3APD A;  4TUU A;  2OVF A;  1H2V C;  3FUF A;  2DBA A;  3U9W A;  3T5X A;  2C0M A;  1XNF A;  4A1S A;  1SQM A;  1P5Q A;  2AW6 A;  5BW8 C;  4U07 A;  4KMO A;  2AVP A;  1X5B A;  3RKV A;  3LVQ E;  4HLE A;  5CHE E;  3RRM B;  4JEH A;  4EZJ A;  3IBE A;  3EDT B;  2A4Z A;  1BPO A;  2CFZ A;  2J07 A;  3FH8 A;  2WXM A;  3MKQ A;  3ZYQ A;  3FHE A;  1NP7 A;  1KT1 A;  1B89 A;  3S7J A;  4BT9 A;  4HOT A;  3D9K A;  5J08 A;  3FEX A;  4AM9 A;  3FUE A;  4J0U A;  3LS8 A;  4MLP A;  3GZ1 A;  1W3B A;  2WXQ A;  4OVV A;  1KLX A;  4N5C A;  4NAC A;  2WPV A;  3CVV A;  3LVR E;  5ARG A;  2IF4 A;  3ML8 A;  4QFV A;  3CQG B;  3CVN A;  4GCN A;  4U04 A;  3ESK A;  2NSZ A;  4JHR A;  3RU0 A;  4UI9 K;  3UMV A;  2LO6 A;  3ZYM A;  3PNL B;  5BNW A;  2CG3 A;  4GZ3 A;  4E85 A;  3FUJ A;  2WVI A;  4D10 C;  3FU5 A;  3DPD A;  4UWK A;  2XGS A;  3PUK A;  1HE8 A;  4APF A;  5BPP A;  3MKR A;  1IYG A;  2GW1 A;  3LKU A;  5G55 A;  3O48 A;  2GGF A;  2KCL A;  3TL5 A;  5FWQ A;  3ZYK A;  1U3D A;  4CDR A;  2WMO A;  5KJM A;  3SZ7 A;  1UJK A;  4GML A;  5HQ8 A;  4LER A;  4N2S A;  3D9J A;  4HFG A;  5E76 A;  3CHR A;  3P1U A;  3PUJ A;  4JW1 A;  4I9C A;  3PEV B;  4I1O B;  4XX5 A;  3IKO B;  5ANR A;  3I3N A;  4C0E A;  4G25 A;  4UWH A;  4N3C A;  1TEZ A;  4JPS A;  4RG9 A;  2WXN A;  3TXM A;  2L0I A;  3MV2 B;  4FHK A;  4B89 A;  1FCH A;  4GPK A;  4UWL A;  5FZS A;  2PQR A;  4PS7 A;  2VTB B;  3QWV A;  2YHC A;  5LX8 A;  5EKQ D;  3JQ0 A;  1HU3 A;  5LCW C;  3CQC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...