1NA0A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
119
structure length
119
Chain Sequence
NSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed protein CTPR3
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 50
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na0A00
4J8FA 4RG9A 4U0ZA 3VTXA 3S7BA 4N2SA 2FO7A 4J8DA 1PC2A 1ZBPA 4GYOA 2PZIA 2LSVA 4U04A 2NC9A 4XIFA 4GCOA 2V5FA 3ASHA 2VGXA 3RIBA 4LEUA 3RO2A 3TAXA 1HXIA 4GZ3A 3QDNA 4N2QA 5A7DB 3ULQA 4AY6A 3LYAA 3JYSA 1ELWA 3HYMB 4O6FA 2R5SA 5EX3A 4GYWA 1ELRA 3OXFA 4CGVA 4GA0A 3Q4AB 2AVPA 3S7JA 3OXGA 1WM5A 2WQHA 5D0OD 3U3WA 4AM9A 2VQ2A 5FJYA 4U07A 2HO1A 2VGXB 4U0UA 3GZ1A 3SF4A 1YA0A 4UI9J 4I2ZA 5FZSA 3ZHEA 4KBQA 4GZ6A 4UQYA 4YNDA 2KCKA 4I9EA 4GCNA 3LPZA 3QWWA 1P5QA 2QFCA 4WUYA 2OOEA 1HH8A 3SZ7A 3CKCA 3CVLA 4NRHB 3LY8A 3QKYA 2MHKA 2PQRA 2C0LA 5LCWJ 1XNFA 2Q7FA 3Q47B 4G2VA 5KJNA 5KJMA 4HOTA 4BTAA 4G25A 4GPKA 5FT9A 2LSUA 2IFUA 2ONDA 4WNFA 1ZU2A 4J0UA 1NZNA 2Y4TA 2L6JA 4I17A 2BUGA 3KS2A 3EDTB 3ZHEB 4NQ0A 5G05J 1WAO1 5M72A 2JLBA 3OXLA 3E4BA 4N39A 2PQNA 3MV2B 4H7YA 5JJ7A 4J8EA 3UQ3A 1IHGA 4I9CA 2E2EA 5LCWC 4YVQC 4GA2A 3MA5A 4HORA 3FFLA 5G04C 5CCLA 4EQFA 5FZQA 5HI7A 5KJKA 4UI9K 3FWVA 1A17A 2C2LA 2I6HA 3LY7A 4G24A 3WXXA 4CGWA 2XGOA 3ZN3A 5D0QD 4N3BA 4F3VA 3LCAA 2PL2A 4UQXA 3RJVA 4A1SA 1OUVA 4N3AA 2GW1A 3RKVA 2DBAA 2VSYA 1KLXA 4H7XA 1IYGA 1QZ2A 3CVNA 3CK8A 1NA0A 2VSNA 4GZ5A 2P58C 3CKBA 2UWJG 3CK7A 4AY5A 4XI0A 1Y8MA 2J9QA 2FEZA 5HQ8A 2UY1B 2KCVA 2YHCA 3ZPJA 2HYZA 3ZGQA 4WNDA 5ARFA 4WNEA 5C1DA 3PE4A 5CCMA 4G23A 3LY9A 3QOUA 5CHEE 4BTBA 4ME2A 1E96B 3PE3A 4JA9A 2HR2A 2XGSA 3MV3B 4HOUA 3KAEA 5KJLA 3CVQA 3UUXA 2XCCA 2FI7A 4RG6A 3TG4A 1B89A 1TJCA 4UI9C 5BT1A 3BEEA 3TG5A 3MKRA 3Q15A 3GYZA 4GYYA 4HOSA 3RO3A 1HZ4A 5A6CA 4JL0A 3ASFA 4U0SA 2LNIA 2XPIA 3GW4A 5EX0A 2FBNA 5BNWA 3QWVA 5EKQD 2XEVA 5FZRA 3UPVA 4I1AA 1W3BA 3K9IA 4W9RA 2IF4A 2VYIA 2WPVA 3NF1A 3ZFWA 1NA3A 3VTYA 3RU0A 4Y6WA 2UY1A 4HOQA 3MEKA 3AS4A 3URZA 4ABNA 4GA1A 3TGOA 2KCLA 4WNGA 3CK9A 3U4TA 5JJTA 3IEGA 5G05C 3AS5A 4UQZA 2KATA 5ARGA 4I2WA 3R9AB 4G1TA 1QQEA 3O48A 3S7DA 5AYWD 3AS8A 3ESKA 4KYOB 4JHRA 4YVOA 4N3CA 3N71A 4AIFA 5FTPA 3S7FA 3FP3A 3CV0A 3LKUA 2XGMA 4Y6CA 3CVPA 4N5CA 3GZ2A 5DIZA 4APOA 4BT9A 4B94A 4CDRA 5DBKA 1KT0A 1FCHA 2FF4A 2KC7A 3Q5MA 4G26A 3ASGA 3Q49B 2VGYA 5BW8C 4BWRA 4BT8A 3CEQA 4JA7A 4XI9A 5JJ6A 2C0MA 3KD7A 2XCBA 2YQ8A 1KT1A 4IN3B 4KXKB 5G04J 3PDNA 3ASDA 3QWPA 2Y4UA
chains in the Genus database with same CATH superfamily
3AG3E 5KCMA 5BPPA 3VTXA 4E85A 3O4ZA 4GMRA 4N2SA 2FO7A 2ZGDA 3KEZA 4U04A 2ETCA 4GCOA 4ATGA 1MQSA 3IXEA 2OVBA 3D9HA 2P9NG 2IO3C 3FU6A 4HFGA 4LEUA 3TWQA 4BEPA 1AWCB 5JA4D 2P9PG 3Q7FA 1BLXB 3TAXA 3WG7E 4O60A 2Y0BG 3HXDA 4HI8A 4GZ3A 3E37A 3DBSA 4N2QA 2XEHA 5E75A 2XQ0A 4IULA 5D2MC 5AENA 3LYAA 4XZ4A 2WQ7A 3TWUA 3JYSA 4EECA 4L23A 4APFA 4KZ0A 2LXMA 2R5SA 2QYUA 1E8WA 1AP7A 3OXFA 4CGVA 1OCOE 2BF0X 1HE8A 4RQIA 2ZU6B 2AVPA 2WMOA 5LP0A 3OXGA 3PNTB 5AQ7A 4HQDA 3D9NA 1FVFA 3MX3A 3FTSA 4AM9A 2VQ2A 4U07A 4L2YA 1YMPA 2LUHA 3FTUA 2H6GA 1D9SA 2ZGGA 3UIPC 4PUCA 3L13A 4DX6D 2GGFA 1TEZA 3ASNE 4DX1A 4YNDA 2KCKA 2OCCE 3UM3A 1N0QA 3J5PA 4XE0A 4DUIA 4WUYA 3MYVA 3TWSA 1E8ZA 1EPUA 2PQRA 3B7BA 2C0LA 3ONLA 4XKBA 5LCWJ 3Q47B 3MKQA 2RD0A 3IBEA 5KJNA 4HOTA 1K1BA 4BTAA 4GMLA 1E90A 1DC2A 2KBXA 4G25A 2LSUA 1SA4A 2ONDA 1SQMA 3FH5A 1L5JA 2RFAA 4K03A 3FUNA 2Y4TA 3E30A 3F6QA 3LVQE 3KS2A 3EDTB 4NQ0A 1E7UA 2VTBA 3AU5A 5KNGA 4ANWA 3UMVA 2X6HA 3OXLA 4F1SA 3E4BA 2WXGA 3SNXA 1VDYA 4H7YA 4FC8A 3LS8A 3AG1E 4N5QA 5KNHD 4ZHBA 3ABME 4GA2A 4PS7A 3L16A 5A23A 5G04C 5CCLA 2WXNA 4F7AA 3EUVA 5AJLA 3SGHA 3B7RL 2CHXA 2J07A 3LY7A 4G24A 4F3VA 3CHQA 4D10C 3ABLE 3BU8A 3UXGA 4DPRA 2X6IA 3UM1A 4JPSA 4H7XA 2VSNA 2DVWA 3ZYQA 2GROB 3ZNGA 1SZAA 1H19A 5AQAA 4XI0A 1HU3A 2J9QA 5HQ8A 2KCVA 2IQCA 4JW1A 2XRZA 3P1UA 3ZRHA 4L9PA 3D9MA 4UWHA 1IXVA 4WNEA 3PUKA 5CCMA 4ANVA 5T3RA 1LF8A 3QOUA 5CHEE 5AIJA 4R7LA 2EIME 3DSTA 4LRZA 2HR2A 5IY5E 1SW6A 1MHQA 1TNUA 1E8XA 3ZUVB 1JCRA 3DWLG 1N4RA 3ML8A 2J4DA 3OAWA 3BG0B 3V2XA 3LJNA 4HOSA 3RO3A 1V55E 4M3OA 3PEVB 3MCXA 1HZ4A 5A6CA 4JL0A 5ITZF 4F6RD 4DLOA 2LNIA 3CGHA 3UINC 3S2AA 3W9FA 5CMYA 5EKQD 5FZRA 3D9LA 3DRAA 1EDUA 3K9IA 2IF4A 5EYLA 4RVBA 4LNGA 5JHAA 3UX4A 3V2OA 4WWPA 4GB9A 3D3MA 3VLDA 3LXUX 3RU0A 2GRPB 4HOQA 4K0RA 3AS4A 3HXBA 4DLQA 2VSXE 1HG5A 3PZ3A 4I6EA 4GA1A 3JQ1A 3SFXA 3LEWA 4GTRA 3CHOA 2L0IA 4NURA 3FUEA 3D9IA 4GTPA 2KATA 4I2WA 2CHWA 3NBNB 2E0IA 2WXJA 5D66A 2XHEA 5T8IA 1OY3D 3N71A 3PEUB 4KMOA 2OEWA 4JZYA 4IYPA 5FQ4A 3CVPA 4PS8A 3GZ2A 2EIKE 1KZPA 1XGWA 3L17A 1NI1A 3I5PA 4ANUA 1NL4A 3PRZA 3OTNA 1JCQA 3ASGA 4PH4B 4GTQA 3UT7A 2DIWA 2AWIA 4M7CA 3TJPA 2CG3A 5FQ6A 2M63A 3FTZA 3L9TA 5KWDA 4WAFA 5FINA 1KT1A 2OV8A 4LNUD 2DWZA 4KXKB 1FPPA 2A5EA 3QC1A 1DNPA 3UI2A 1WDYA 5ENQD 3SFZA 3ZU7B 4RG9A 1O1SA 3HXEA 2YINA 1E8YA 2PZIA 4ATZD 2XEEA 4XIFA 1S64A 3QJZA 3ASHA 3ULYA 3RRMB 3ZKJA 4HB5A 4JC8A 2RG8A 3TL5A 1OWMA 1TN7A 3CHRA 4KVOA 1DCQA 1ZB1A 5CMWA 3ULEG 1UG3A 4CZ2D 1LD8A 3QDNA 4BSXA 5FQ7A 4UWLA 3BG1B 1PAQA 5CRUA 3FH8A 1UW4B 1QBQA 1WG0A 3CQGB 1ELWA 4O6FA 4BESA 1TNOA 4GTVA 2IJGX 3GZSA 4GYWA 4JXTA 4GZDA 2KM4A 4GA0A 4LG6A 2IOLA 2P2CP 3S7JA 4FU3A 3B7UX 3FU3A 4Q96A 2WQHA 4B89A 1IKND 5D0OD 1IQRA 4F1PA 2EINE 2HO1A 3QARA 1UJJA 2KZTA 3T5XA 4U0UA 3SF4A 3R9MA 3L82A 3APCA 5CEDB 3PNLB 4KBQA 4CRWA 4GZ6A 4UQYA 2XS1A 4GTMA 4I9EA 3E33A 4K5CA 4J8SA 1P5QA 2QFCA 4DK5A 4G8KA 3FTXA 3SZ7A 1YYHA 3CVLA 3FHEA 3QKYA 1NP7A 3RSEG 4JHKA 2MHKA 3FULA 5HKPA 4EHMA 3HVEB 2DCPA 1RZ4A 5FT9A 3JXIA 4XEIG 2WXKA 4I17A 4HNAD 5AJDA 4TRQA 1K3ZD 4I1MA 3ZHEB 4I43A 1WAO1 2LAHA 4BETA 5M72A 2QC9A 1HG2A 4N39A 4HXIA 2PQNA 2P9UG 2Y69E 4K5AB 3ZEFA 4YDEA 1TNYA 3UQ3A 3DEPA 3MZLB 3AJIA 4L1BA 2P9LG 3MA5A 4UWKA 4MKTA 1ELKA 5CERB 3C5RA 3CVVA 3C3OA 2DYRE 2I6HA 5B1BE 2XGOA 3DSUA 5D0QD 2GRLA 1SZ9A 4UQXA 3QB2A 2LO6A 4CEMA 5HS0A 1OUVA 1DCEA 5E76A 4O1OA 2BTDA 3ENEA 1IYGA 3G2SA 1IQUA 2P58C 3E32A 2UWJG 3L54A 4AY5A 4NIKA 5BXUA 3CQCB 4ZFHA 2CFUA 3QK0A 5G55A 2EILE 5AQ9A 2YHCA 3ZPJA 4EBAA 2HYZA 3ZGQA 5ARFA 3FY4A 3NZUA 2V4HC 2WXOA 4L2LA 3C3QA 4G23A 2WXHA 4BTBA 2FO1E 1E96B 5H7PA 4YDYA 1BPOA 4JA9A 2L0TB 1H6KA 2XGSA 2XS8A 3ONKA 3TXMA 2LXLA 3KAEA 1X5BA 1MJ0A 3FU5A 3ESLA 3TG5A 4B8CB 3MKRA 4GYYA 4Z68A 4I1OB 3FUJA 3FUDA 2H6IA 3UT8A 3GW4A 4CDNA 3QWVA 2WXRA 2WM9A 4QFVA 3FEXA 4PDXA 1W3BA 2I1KA 4W9RA 1BD8A 2VYIA 2WPVA 3D9OA 3APFA 4BY6A 4Y6WA 2UY1A 5BUZA 3URZA 3DPYA 3EU5A 1JWGA 3DSXA 4A1GA 4X8QA 2KCLA 5JJTA 4LUNU 3U64A 4MRUA 3NB2A 5ANRA 4TXPA 5AAOA 2X38A 2Y3AA 3BUAA 5ARGA 4G1TA 3SD5A 4OAUC 3CIAA 1FT2A 3S7DA 4ACKA 4BSZB 4KYOB 2PNNA 3G2WA 4AIFA 5ENTD 4XKCA 3RRUA 2J4BA 3CLJA 3ZW3A 4KZCA 3CSFA 3LKUA 2XGMA 3KSQA 1N95A 2A5UA 3FH7A 2WB2A 4HLLA 5B3SE 1WY6A 4BT9A 3PS6A 1KT0A 3L22A 4FLHA 3U9WA 3Q5MA 2XRYA 3R7QA 2R03A 3NZSA 4BWRA 2AXVA 3EHQA 5LX8A 1BI8B 1TNBA 1Q2ZA 4JA7A 2C0MA 3KD7A 3VLEA 2XCBA 3ZYMA 2YQ8A 5AQBA 5JHBA 2OEVA 3NOGD 1DVPA 3D9PA 3EIQC 4ILHB 3E34A 4FULA 2F0YA 4HVBA 3FUMA 3QWPA 2I9CA 3PVLA 2P9KG 2XPZA 4YDOA 2Y4UA 1H0AA 5BV1A 3V79K 4U0ZA 5HRYA 2R59A 3S7BA 4RSYA 4DI3A 3B7TA 4J8DA 1H2TC 5FWQA 4P29A 1Z3XA 4GYOA 1O1RA 4EZJA 4OVVA 2NC9A 1OCZE 2IOSA 4JEHA 4TV3A 3CVUA 3RO2A 3HHMA 3ZXPA 3TWWA 4XX5A 4BX9A 5A7DB 5ANLA 1OCRE 1MX2A 4MLPA 4U63A 1SVXA 2WQ6A 3T9KA 4G8LA 3PUJA 3AAAC 4DJAA 3PZ2A 3FU0A 3IV0A 2VTBB 5AN8A 4TXRA 5FJYA 2ETBA 2RKKA 1Y6IA 3QNKA 2VGXB 3GZ1A 4A3VA 4CCAA 4I2ZA 5FZSA 2GRMA 3ZHEA 4GTTA 4JB8P 2XZTG 5EDSA 2B0OE 3ZIMA 5ENNA 2OOEA 3FTYA 4ACLA 4NRHB 3LY8A 3FTVA 1G3NB 3ZXSA 2L9BA 4A3TA 1N54A 3FUFA 2ETAA 4G2VA 3QAQA 4QQIA 3JUEA 4GPKA 2NYJA 2IFUA 4FLBA 1JWFA 3R7RA 4WNFA 1ZU2A 1HF8A 2B6CA 3DSWA 1NZNA 3PZ1A 3HXCA 4ANXA 3HIZA 3DXKG 3DEOA 4HBDA 5G05J 4HRMB 2F37A 4FADA 1SA5A 3TWXA 3Q73A 1IHGA 2ZISA 2WXPA 4MBGA 1EF1C 4DX2A 3JUIA 3FFLA 2X6JA 4EQFA 5HI7A 2WXFA 5KJKA 1K8KG 4GTOA 2BEDA 2WVIA 2C2LA 3DSVA 2GRNB 4UWGA 4AJWA 3ZN3A 4N3BA 4GU5A 4FJZA 2PL2A 1EYHA 3SY2A 4LSZE 4A1SA 1JPLA 2P9SG 2WXQA 2XPYA 2DBAA 2J09A 4CDMA 5J90A 1KLXA 4PS3A 3CVNA 1NA0A 2GRRB 3NAWA 4GZ5A 4URKA 3CKBA 4A63B 3NQPA 3CK7A 3B13A 5C2YA 1JUQA 1OCCE 5LOZA 1X81A 4FHJA 1OWNA 2WXMA 2QY7A 4WNDA 3C72A 4GZCA 2R05A 5C1DA 3PE4A 5CBOA 3FEYA 2JABA 4HLEA 4ME2A 3PE3A 1N4SA 3HXFA 3W9GA 4HI9A 4B93B 3CVQA 5KJLA 3UUXA 4EPZA 2XCCA 2FI7A 5JMND 3TG4A 4I6JA 4HS2A 5BT1A 1PY1A 2RFMA 2L6BA 3SHFA 4B0ZA 3UTMA 3UT4A 1FT1A 4C9BB 1TR4A 2FBNA 4BX8A 5BNWA 3T8KA 2XEVA 3ISMC 4AV7A 3AU4A 2NSZA 5EN5D 3CVWA 3NF1A 3B95A 1NFIE 1NA3A 1N0RA 1OXJA 3APDA 3EHNA 3MEKA 3IKOB 3ABKE 4ABNA 4WNGA 3CK9A 3ML9A 2R17C 1TN6A 1OWPA 5G05C 3AS5A 3R9AB 1QQEA 4UUCA 4U8YD 3X2QE 1MX4A 1HFAA 3CHSA 5CECB 4N3CA 2IU1A 3MGBA 1LTXA 3S7FA 2IEJA 3FP3A 1LD7A 1V54E 4GMJA 1FVHA 4Y6CA 3Q79A 1BU9A 5CEAA 5DIZA 4APOA 1OWLA 1FCHA 2AJAA 2DYSE 2FF4A 2A4ZA 3FUKA 2X6KA 4KT6B 3Q49B 3Q9NC 5BW8C 4LNBA 1E7VA 5EILA 4AEZC 5JJ6A 2XENA 2CFZA 4RLYA 5ENOD 4AXHA 3JXJA 5J08A 3LJ3A 1H6PA 3V30A 4OAVB 3TWVA 3PDNA 4NACA 1N11A 1QNFA 3CHPA 1OWOA 3ASDA 1N94A 3HDXA 3Q9UC 3UKRG 2KZTB 4J8FA 2NXPA 3PH0C 2Y1LE 4DX7D 1UJKA 4WWOA 4EZLA 1PC2A 1Z3YA 1UOHA 1K1AA 1ZBPA 1OT8A 2LSVA 1N52A 2IO2C 4U8HA 3G2TA 4L7TA 5CRVA 2V5FA 2BKKB 3L6AA 2VGXA 3ZYLA 3RIBA 4U8VD 4CT4A 3AG2E 2JEKA 5EIDA 3D9KA 2VGEA 5T4YA 5BXOA 3SBTB 4EZKA 1HXIA 1MX6A 2MOWA 3P2BA 1D8EA 3DPDA 3ULQA 2EIJE 4AY6A 2CHZA 1TNZA 4O1PA 2YHEA 3HYMB 4B8AA 2ILRA 3DXMG 4BERA 5EX3A 1ELRA 2VSOE 1Z5SC 2WXIA 1RW2A 1U3DA 2AXZA 3Q4AB 4CYMD 3FTWA 2R2LA 1S0PA 1WM5A 2HE0A 4FA6A 4J8YA 3U3WA 3T8MA 5LFAA 3V31A 3C3RA 5KBAA 2CG2A 1YA0A 3SQVA 3TWTA 2MRIA 4UI9J 5CBNA 4E6HA 2ZXWE 3UM0A 4OYSA 3IHVA 4AOFA 4LCTA 4GCNA 3LPZA 3QWWA 1INZA 3PZ4A 5EIBE 1HH8A 3CKCA 3G2UA 1TYQG 2QYJA 1IHBA 1XNFA 2Q7FA 3EIJA 4G11A 1GW6A 3Q78A 3DSSA 4YDWA 5KJMA 1A5EA 3D9JA 2BKGA 3EJNA 2I1JA 3EHRA 2MYOA 5FQ8A 1H2VC 2R02A 3PZDA 3Q75A 4J0UA 3AG4E 2L6JA 3FUHA 3CR3A 1HS6A 2BUGA 1S70B 4ILGA 4AVXA 1MZCA 4DX5D 1MYOA 3LVRE 3EU9A 1N4QA 2JLBA 3TXNA 3MV2B 5JJ7A 5B1AE 4Q69A 4J8EA 4I9CA 3SO8A 2E2EA 5LCWC 4YVQC 5G2NA 3MKQB 4FJYA 4OVUA 4HORA 5FZQA 4UI9K 3FWVA 2PM7A 1A17A 3G2VA 4J7WA 2H6FA 3HVEA 2X3MA 4GAAA 4FP7A 5ENSD 3WXXA 4CGWA 1U2VG 3HG0D 4J6IA 3LCAA 2I2OA 3RJVA 3T5VA 4HRNA 3JQ0A 3VLFA 4N3AA 2GW1A 3RKVA 2DZOA 3CSTA 5FIOA 2EQXA 2VSYA 3JCKC 3ZVVA 4C0MA 2FULA 2DZNA 4U96D 2VJ8A 1O5MA 2V4LA 2X6FA 3ASOE 1BI7B 5AARA 1QZ2A 3CK8A 3I3NA 3UM2A 3HRAA 4TUUA 1KZOA 1Y8MA 2P9IG 2FEZA 4F53A 2QZAA 2UY1B 4MS6A 3FDHA 3KSLA 1YCSB 3C98A 1TN8A 3CVXA 3UIOC 2ZIRA 4BFRA 3CVYA 3LY9A 4C0EA 5BV0A 3Q7AA 1N9AA 3MJWA 3MV3B 4HOUA 1S63A 2J49A 4RG6A 1B89A 1TJCA 4UI9C 4JD2G 3BEEA 3Q15A 3SBSA 3GYZA 2GRQB 1Z6TA 4JHJA 4TUMA 5ENPD 3ASFA 4JEUA 4U0SA 4LERA 2XPIA 2IY0C 3CHMA 3RAUA 5EX0A 4KVMA 4AP2A 5ENRD 3B7SA 1U3CA 1H6OA 2J8SD 3UPVA 1O1TA 4I1AA 2J08A 4U7EB 4U95D 2AW6A 1D8DA 1N4PA 3ZFWA 3VTYA 4WWNA 3KEAA 1TJFA 3J5QB 4C48B 3EHMA 3NOCD 3SI5A 3UKUG 3TGOA 4DI4A 1JCSA 4Q94A 2WMNA 4EBAG 4A55A 3U4TA 4I6GA 2YNQA 3IEGA 4GTSA 4UQZA 3FUIA 3IHYA 1H2UA 1QYMA 3O48A 5AYWD 4DRXE 3AS8A 4UWFA 3ESKA 4JHRA 4YVOA 4HRLA 5FTPA 3U66A 3LDZA 4TXQA 3RRNB 2IONA 3L08A 1HO8A 3CV0A 4ILIA 4N5CA 1UN9A 2H6HA 2V0PA 1KPSB 4B94A 4CDRA 2KXPC 5DBKA 4CT0A 4K5BA 3SFYA 2KC7A 2AXUA 4G26A 3I4GA 3ZYKA 2HM8A 4JVSA 3TWRA 2V8SE 2VGYA 3I4RB 3BQOA 2F8YA 4BT8A 2F8XK 2XZDG 4GPMA 2LAIA 3PREA 3CEQA 4XI9A 4IRUA 4IN3B 2OVFA 3RK6A 5G04J 2V5QC 5EYPF 2PM6A 1UN8A 4V3IA 4FHKA 1HX8A 2WXLA
chains in the Genus database with same CATH topology
4J8FA 4RG9A 2NXPA 1H0AA 5KCMA 5BV1A 2YINA 4U0ZA 3PH0C 5BPPA 2R59A 3S7BA 3VTXA 4E85A 3O4ZA 1E8YA 4RSYA 4DI3A 3B7TA 1UJKA 4WWOA 2FO7A 4N2SA 4J8DA 4EZLA 1H2TC 5FWQA 1PC2A 1Z3YA 4P29A 1Z3XA 1ZBPA 4GYOA 4EZJA 4OVVA 2PZIA 2LSVA 3KEZA 1N52A 4U04A 2NC9A 4U8HA 4XIFA 2IOSA 3G2TA 3QJZA 4GCOA 4L7TA 2V5FA 3ASHA 3L6AA 4ATGA 2VGXA 3ZYLA 4JEHA 1MQSA 3RRMB 4TV3A 3RIBA 3CVUA 4CT4A 2OVBA 2JEKA 3TL5A 4JC8A 2RG8A 3FU6A 4HFGA 4LEUA 1OWMA 3CHRA 3D9KA 4KVOA 3RO2A 3TAXA 5T4YA 5CMWA 3HHMA 3SBTB 4EZKA 1HXIA 1UG3A 4GZ3A 3QDNA 4BSXA 2MOWA 3P2BA 4XX5A 3DBSA 5FQ7A 4N2QA 4UWLA 5E75A 3BG1B 1PAQA 5ANLA 3DPDA 5A7DB 4BX9A 2XQ0A 3FH8A 4IULA 3ULQA 1UW4B 5AENA 4AY6A 3LYAA 4XZ4A 2CHZA 2WQ7A 3CQGB 3JYSA 2YHEA 4EECA 1ELWA 3HYMB 4B8AA 4O6FA 2ILRA 4MLPA 4L23A 4U63A 4APFA 4KZ0A 2IJGX 2R5SA 1E8WA 3GZSA 5EX3A 2WQ6A 4GYWA 4JXTA 1ELRA 3OXFA 4GZDA 4CGVA 2VSOE 2BF0X 2WXIA 3PUJA 1HE8A 2KM4A 4GA0A 1U3DA 2AXZA 2IOLA 2ZU6B 3Q4AB 4DJAA 3FTWA 2AVPA 2WMOA 3S7JA 4FU3A 3B7UX 1S0PA 3OXGA 3FU3A 1WM5A 5LP0A 4FA6A 3FU0A 3PNTB 4Q96A 2WQHA 4B89A 3IV0A 2VTBB 3D9NA 1FVFA 5D0OD 3MX3A 1IQRA 3FTSA 3U3WA 4AM9A 2VQ2A 5FJYA 4U07A 4L2YA 2HO1A 3QARA 1UJJA 2KZTA 3T8MA 1Y6IA 3QNKA 5LFAA 2VGXB 3T5XA 3FTUA 3GZ1A 4U0UA 3SF4A 2CG2A 1YA0A 4PUCA 3L13A 4A3VA 4CCAA 2MRIA 3APCA 2GGFA 4I2ZA 4UI9J 5FZSA 2GRMA 3ZHEA 4E6HA 1TEZA 3PNLB 4KBQA 4CRWA 4GZ6A 4UQYA 4OYSA 3IHVA 4YNDA 2KCKA 4I9EA 4AOFA 5EDSA 4LCTA 4GCNA 4J8SA 3LPZA 3QWWA 4XE0A 1P5QA 3ZIMA 5ENNA 1INZA 2QFCA 4WUYA 4DK5A 2OOEA 3MYVA 3FTXA 3FTYA 1HH8A 3SZ7A 3CKCA 4ACLA 3G2UA 3CVLA 4NRHB 3FHEA 3FTVA 1NP7A 3LY8A 3QKYA 4JHKA 1E8ZA 2MHKA 3ZXSA 1EPUA 2PQRA 2C0LA 3FULA 3ONLA 2L9BA 4XKBA 5LCWJ 1XNFA 2Q7FA 3EIJA 4A3TA 3Q47B 4G11A 3MKQA 1N54A 1GW6A 2RD0A 3IBEA 3HVEB 2DCPA 3FUFA 4G2VA 5KJNA 5KJMA 4HOTA 4BTAA 4GMLA 3QAQA 3D9JA 1E90A 4G25A 4GPKA 5FT9A 2LSUA 2IFUA 3EJNA 4FLBA 1JWFA 2I1JA 3R7RA 5FQ8A 2ONDA 4WNFA 1H2VC 1SQMA 1ZU2A 3FH5A 1L5JA 3PZDA 1HF8A 4K03A 4J0UA 1NZNA 3FUNA 2Y4TA 2WXKA 2L6JA 4I17A 3FUHA 3CR3A 1HS6A 2BUGA 4ANXA 3LVQE 4ILGA 3KS2A 5AJDA 4AVXA 4TRQA 3EDTB 3HIZA 3ZHEB 4I1MA 3LVRE 4I43A 4NQ0A 1E7UA 5G05J 2VTBA 1WAO1 3AU5A 2LAHA 5M72A 2JLBA 3TXNA 4ANWA 3UMVA 2X6HA 3OXLA 1HG2A 4F1SA 3E4BA 4HXIA 2PQNA 4N39A 3MV2B 2WXGA 3SNXA 3ZEFA 1VDYA 4H7YA 5JJ7A 4FC8A 3LS8A 4Q69A 4FADA 4J8EA 3UQ3A 1IHGA 3MZLB 4I9CA 2E2EA 4L1BA 5LCWC 4YVQC 2WXPA 5G2NA 4GA2A 3MA5A 4UWKA 3MKQB 1EF1C 4FJYA 4MKTA 4PS7A 4OVUA 1ELKA 3L16A 3JUIA 5A23A 4HORA 3FFLA 5G04C 2X6JA 4EQFA 2WXNA 5CCLA 5FZQA 4F7AA 5HI7A 3CVVA 5AJLA 2WXFA 3SGHA 5KJKA 4UI9K 3B7RL 3FWVA 2PM7A 2CHXA 1A17A 3G2VA 2WVIA 2C2LA 3HVEA 2J07A 2X3MA 2I6HA 3LY7A 4FP7A 4GAAA 4G24A 3WXXA 4CGWA 4UWGA 4AJWA 2XGOA 3ZN3A 5D0QD 4N3BA 4F3VA 2GRLA 4J6IA 3CHQA 3LCAA 4GU5A 4FJZA 2PL2A 1EYHA 1SZ9A 2I2OA 4UQXA 3RJVA 4D10C 3T5VA 3QB2A 2LO6A 4CEMA 4A1SA 3JQ0A 1JPLA 3VLFA 1OUVA 4N3AA 2WXQA 2GW1A 3RKVA 2XPYA 3CSTA 2DBAA 2J09A 2EQXA 2VSYA 2X6IA 5E76A 4CDMA 4DPRA 5J90A 3JCKC 3ZVVA 4C0MA 2FULA 4JPSA 2VJ8A 2BTDA 1KLXA 2V4LA 3ENEA 4H7XA 4PS3A 2X6FA 1IYGA 1QZ2A 3CVNA 3CK8A 1NA0A 2VSNA 3G2SA 3I3NA 3ZYQA 4GZ5A 4TUUA 4URKA 1IQUA 2P58C 3CKBA 1SZAA 2UWJG 3NQPA 3CK7A 3L54A 4AY5A 3B13A 1H19A 4XI0A 1Y8MA 5C2YA 1HU3A 2J9QA 3CQCB 2FEZA 4F53A 1JUQA 5HQ8A 2CFUA 2UY1B 3FDHA 3QK0A 4MS6A 5G55A 5LOZA 2KCVA 4FHJA 2IQCA 1OWNA 2YHCA 4JW1A 2WXMA 2QY7A 3ZPJA 4EBAA 2XRZA 2HYZA 3ZGQA 4WNDA 3C98A 3P1UA 5ARFA 3ZRHA 3D9MA 4UWHA 4WNEA 3FY4A 3NZUA 3PUKA 4GZCA 5C1DA 3CVXA 3PE4A 5CCMA 3FEYA 4ANVA 4BFRA 2WXOA 4L2LA 3CVYA 5T3RA 1LF8A 4G23A 2WXHA 3LY9A 3QOUA 5CHEE 5AIJA 4C0EA 4BTBA 4R7LA 4HLEA 5BV0A 4ME2A 1E96B 3PE3A 1BPOA 4LRZA 2L0TB 2HR2A 4JA9A 3MJWA 1MHQA 1H6KA 2XGSA 3MV3B 3ONKA 4HOUA 1E8XA 3TXMA 3KAEA 5KJLA 3CVQA 1X5BA 3FU5A 3UUXA 4EPZA 2XCCA 2FI7A 2J49A 3ESLA 4I6JA 4RG6A 1B89A 1TJCA 3ML8A 4HS2A 4UI9C 3TG4A 1PY1A 3BEEA 5BT1A 2J4DA 3OAWA 3TG5A 4B8CB 3BG0B 3MKRA 3Q15A 3SBSA 3GYZA 4GYYA 4HOSA 3RO3A 4M3OA 3PEVB 1Z6TA 4I1OB 3MCXA 3SHFA 4B0ZA 1HZ4A 4JHJA 3FUJA 3FUDA 3UT4A 5A6CA 3UT8A 4JL0A 3ASFA 4JEUA 4DLOA 4U0SA 2LNIA 4C9BB 3CGHA 4LERA 3S2AA 2XPIA 3CHMA 3GW4A 5EX0A 4CDNA 4KVMA 5CMYA 2FBNA 4BX8A 4AP2A 3QWVA 5BNWA 5EKQD 3B7SA 2WXRA 1U3CA 2WM9A 2XEVA 5FZRA 3UPVA 3D9LA 4QFVA 3FEXA 4AV7A 1EDUA 3AU4A 4I1AA 4PDXA 2J08A 1W3BA 3K9IA 2I1KA 4W9RA 2IF4A 2VYIA 2NSZA 2WPVA 3CVWA 3D9OA 3NF1A 4RVBA 2AW6A 3APFA 3ZFWA 1NA3A 3VTYA 5JHAA 3UX4A 4BY6A 4WWNA 4WWPA 4GB9A 3D3MA 3VLDA 3LXUX 1TJFA 3RU0A 4Y6WA 2UY1A 4HOQA 3APDA 3AS4A 3EHNA 3MEKA 4K0RA 3IKOB 5BUZA 3URZA 4DLQA 3EHMA 2VSXE 1HG5A 1JWGA 4I6EA 4A1GA 4ABNA 4GA1A 3SI5A 3JQ1A 3TGOA 2KCLA 4DI4A 4Q94A 4WNGA 2WMNA 3CK9A 3ML9A 4EBAG 4A55A 3U4TA 2R17C 3LEWA 4LUNU 3U64A 5JJTA 4I6GA 3CHOA 2L0IA 2YNQA 3IEGA 4MRUA 4NURA 5ANRA 3FUEA 1OWPA 3D9IA 3AS5A 5G05C 2X38A 4UQZA 2KATA 2Y3AA 3FUIA 5ARGA 4I2WA 3R9AB 4G1TA 1QQEA 3SD5A 2CHWA 3IHYA 1H2UA 3O48A 2E0IA 2WXJA 3CIAA 3S7DA 5AYWD 2XHEA 3AS8A 4UWFA 4ACKA 3ESKA 4KYOB 5T8IA 3G2WA 4JHRA 4YVOA 1HFAA 3CHSA 4N3CA 3N71A 3PEUB 2IU1A 4AIFA 3MGBA 4XKCA 5FTPA 3LDZA 2J4BA 3RRUA 3U66A 3CLJA 3RRNB 3ZW3A 4KMOA 3S7FA 2IONA 3FP3A 4KZCA 3CSFA 3L08A 4GMJA 1FVHA 1HO8A 3CV0A 3LKUA 4IYPA 4JZYA 2XGMA 4Y6CA 5FQ4A 3CVPA 4ILIA 4PS8A 3FH7A 2A5UA 4N5CA 3GZ2A 5DIZA 1UN9A 2WB2A 2V0PA 1XGWA 4APOA 3L17A 1WY6A 3I5PA 4BT9A 4B94A 1OWLA 4CDRA 5DBKA 4CT0A 3PS6A 1KT0A 4ANUA 3L22A 1FCHA 4FLHA 3PRZA 3OTNA 2FF4A 3U9WA 2KC7A 2A4ZA 2AXUA 3FUKA 3Q5MA 4G26A 3I4GA 3ASGA 3ZYKA 2X6KA 4PH4B 2HM8A 4KT6B 4JVSA 2DIWA 2V8SE 3Q49B 2XRYA 3UT7A 3R7QA 2VGYA 5BW8C 3I4RB 2AWIA 3NZSA 4BWRA 3TJPA 2CG3A 5FQ6A 2AXVA 4BT8A 5LX8A 2LAIA 1E7VA 3PREA 4AEZC 3CEQA 4JA7A 4XI9A 5JJ6A 2C0MA 2M63A 3FTZA 3KD7A 3VLEA 2CFZA 2XCBA 3ZYMA 4WAFA 4AXHA 2YQ8A 5J08A 3LJ3A 4IRUA 1KT1A 2OV8A 4IN3B 5JHBA 4KXKB 1DVPA 3D9PA 2OVFA 3RK6A 5G04J 3PDNA 3EIQC 4NACA 3CHPA 1QNFA 2PM6A 4ILHB 1UN8A 1OWOA 3ASDA 3QC1A 4FULA 1DNPA 4HVBA 3HDXA 3FUMA 3QWPA 2I9CA 3PVLA 4V3IA 2XPZA 4FHKA 2Y4UA 3SFZA 2KZTB 1HX8A 2WXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8F A;  4RG9 A;  4U0Z A;  3VTX A;  3S7B A;  4N2S A;  2FO7 A;  4J8D A;  1PC2 A;  1ZBP A;  4GYO A;  2PZI A;  2LSV A;  4U04 A;  2NC9 A;  4XIF A;  4GCO A;  2V5F A;  3ASH A;  2VGX A;  3RIB A;  4LEU A;  3RO2 A;  3TAX A;  1HXI A;  4GZ3 A;  3QDN A;  4N2Q A;  5A7D B;  3ULQ A;  4AY6 A;  3LYA A;  3JYS A;  1ELW A;  3HYM B;  4O6F A;  2R5S A;  5EX3 A;  4GYW A;  1ELR A;  3OXF A;  4CGV A;  4GA0 A;  3Q4A B;  2AVP A;  3S7J A;  3OXG A;  1WM5 A;  2WQH A;  5D0O D;  3U3W A;  4AM9 A;  2VQ2 A;  5FJY A;  4U07 A;  2HO1 A;  2VGX B;  4U0U A;  3GZ1 A;  3SF4 A;  1YA0 A;  4UI9 J;  4I2Z A;  5FZS A;  3ZHE A;  4KBQ A;  4GZ6 A;  4UQY A;  4YND A;  2KCK A;  4I9E A;  4GCN A;  3LPZ A;  3QWW A;  1P5Q A;  2QFC A;  4WUY A;  2OOE A;  1HH8 A;  3SZ7 A;  3CKC A;  3CVL A;  4NRH B;  3LY8 A;  3QKY A;  2MHK A;  2PQR A;  2C0L A;  5LCW J;  1XNF A;  2Q7F A;  3Q47 B;  4G2V A;  5KJN A;  5KJM A;  4HOT A;  4BTA A;  4G25 A;  4GPK A;  5FT9 A;  2LSU A;  2IFU A;  2OND A;  4WNF A;  1ZU2 A;  4J0U A;  1NZN A;  2Y4T A;  2L6J A;  4I17 A;  2BUG A;  3KS2 A;  3EDT B;  3ZHE B;  4NQ0 A;  5G05 J;  1WAO 1;  5M72 A;  2JLB A;  3OXL A;  3E4B A;  4N39 A;  2PQN A;  3MV2 B;  4H7Y A;  5JJ7 A;  4J8E A;  3UQ3 A;  1IHG A;  4I9C A;  2E2E A;  5LCW C;  4YVQ C;  4GA2 A;  3MA5 A;  4HOR A;  3FFL A;  5G04 C;  5CCL A;  4EQF A;  5FZQ A;  5HI7 A;  5KJK A;  4UI9 K;  3FWV A;  1A17 A;  2C2L A;  2I6H A;  3LY7 A;  4G24 A;  3WXX A;  4CGW A;  2XGO A;  3ZN3 A;  5D0Q D;  4N3B A;  4F3V A;  3LCA A;  2PL2 A;  4UQX A;  3RJV A;  4A1S A;  1OUV A;  4N3A A;  2GW1 A;  3RKV A;  2DBA A;  2VSY A;  1KLX A;  4H7X A;  1IYG A;  1QZ2 A;  3CVN A;  3CK8 A;  1NA0 A;  2VSN A;  4GZ5 A;  2P58 C;  3CKB A;  2UWJ G;  3CK7 A;  4AY5 A;  4XI0 A;  1Y8M A;  2J9Q A;  2FEZ A;  5HQ8 A;  2UY1 B;  2KCV A;  2YHC A;  3ZPJ A;  2HYZ A;  3ZGQ A;  4WND A;  5ARF A;  4WNE A;  5C1D A;  3PE4 A;  5CCM A;  4G23 A;  3LY9 A;  3QOU A;  5CHE E;  4BTB A;  4ME2 A;  1E96 B;  3PE3 A;  4JA9 A;  2HR2 A;  2XGS A;  3MV3 B;  4HOU A;  3KAE A;  5KJL A;  3CVQ A;  3UUX A;  2XCC A;  2FI7 A;  4RG6 A;  3TG4 A;  1B89 A;  1TJC A;  4UI9 C;  5BT1 A;  3BEE A;  3TG5 A;  3MKR A;  3Q15 A;  3GYZ A;  4GYY A;  4HOS A;  3RO3 A;  1HZ4 A;  5A6C A;  4JL0 A;  3ASF A;  4U0S A;  2LNI A;  2XPI A;  3GW4 A;  5EX0 A;  2FBN A;  5BNW A;  3QWV A;  5EKQ D;  2XEV A;  5FZR A;  3UPV A;  4I1A A;  1W3B A;  3K9I A;  4W9R A;  2IF4 A;  2VYI A;  2WPV A;  3NF1 A;  3ZFW A;  1NA3 A;  3VTY A;  3RU0 A;  4Y6W A;  2UY1 A;  4HOQ A;  3MEK A;  3AS4 A;  3URZ A;  4ABN A;  4GA1 A;  3TGO A;  2KCL A;  4WNG A;  3CK9 A;  3U4T A;  5JJT A;  3IEG A;  5G05 C;  3AS5 A;  4UQZ A;  2KAT A;  5ARG A;  4I2W A;  3R9A B;  4G1T A;  1QQE A;  3O48 A;  3S7D A;  5AYW D;  3AS8 A;  3ESK A;  4KYO B;  4JHR A;  4YVO A;  4N3C A;  3N71 A;  4AIF A;  5FTP A;  3S7F A;  3FP3 A;  3CV0 A;  3LKU A;  2XGM A;  4Y6C A;  3CVP A;  4N5C A;  3GZ2 A;  5DIZ A;  4APO A;  4BT9 A;  4B94 A;  4CDR A;  5DBK A;  1KT0 A;  1FCH A;  2FF4 A;  2KC7 A;  3Q5M A;  4G26 A;  3ASG A;  3Q49 B;  2VGY A;  5BW8 C;  4BWR A;  4BT8 A;  3CEQ A;  4JA7 A;  4XI9 A;  5JJ6 A;  2C0M A;  3KD7 A;  2XCB A;  2YQ8 A;  1KT1 A;  4IN3 B;  4KXK B;  5G04 J;  3PDN A;  3ASD A;  3QWP A;  2Y4U A; 
#chains in the Genus database with same CATH topology
 3AG3 E;  5KCM A;  5BPP A;  3VTX A;  4E85 A;  3O4Z A;  4GMR A;  4N2S A;  2FO7 A;  2ZGD A;  3KEZ A;  4U04 A;  2ETC A;  4GCO A;  4ATG A;  1MQS A;  3IXE A;  2OVB A;  3D9H A;  2P9N G;  2IO3 C;  3FU6 A;  4HFG A;  4LEU A;  3TWQ A;  4BEP A;  1AWC B;  5JA4 D;  2P9P G;  3Q7F A;  1BLX B;  3TAX A;  3WG7 E;  4O60 A;  2Y0B G;  3HXD A;  4HI8 A;  4GZ3 A;  3E37 A;  3DBS A;  4N2Q A;  2XEH A;  5E75 A;  2XQ0 A;  4IUL A;  5D2M C;  5AEN A;  3LYA A;  4XZ4 A;  2WQ7 A;  3TWU A;  3JYS A;  4EEC A;  4L23 A;  4APF A;  4KZ0 A;  2LXM A;  2R5S A;  2QYU A;  1E8W A;  1AP7 A;  3OXF A;  4CGV A;  1OCO E;  2BF0 X;  1HE8 A;  4RQI A;  2ZU6 B;  2AVP A;  2WMO A;  5LP0 A;  3OXG A;  3PNT B;  5AQ7 A;  4HQD A;  3D9N A;  1FVF A;  3MX3 A;  3FTS A;  4AM9 A;  2VQ2 A;  4U07 A;  4L2Y A;  1YMP A;  2LUH A;  3FTU A;  2H6G A;  1D9S A;  2ZGG A;  3UIP C;  4PUC A;  3L13 A;  4DX6 D;  2GGF A;  1TEZ A;  3ASN E;  4DX1 A;  4YND A;  2KCK A;  2OCC E;  3UM3 A;  1N0Q A;  3J5P A;  4XE0 A;  4DUI A;  4WUY A;  3MYV A;  3TWS A;  1E8Z A;  1EPU A;  2PQR A;  3B7B A;  2C0L A;  3ONL A;  4XKB A;  5LCW J;  3Q47 B;  3MKQ A;  2RD0 A;  3IBE A;  5KJN A;  4HOT A;  1K1B A;  4BTA A;  4GML A;  1E90 A;  1DC2 A;  2KBX A;  4G25 A;  2LSU A;  1SA4 A;  2OND A;  1SQM A;  3FH5 A;  1L5J A;  2RFA A;  4K03 A;  3FUN A;  2Y4T A;  3E30 A;  3F6Q A;  3LVQ E;  3KS2 A;  3EDT B;  4NQ0 A;  1E7U A;  2VTB A;  3AU5 A;  5KNG A;  4ANW A;  3UMV A;  2X6H A;  3OXL A;  4F1S A;  3E4B A;  2WXG A;  3SNX A;  1VDY A;  4H7Y A;  4FC8 A;  3LS8 A;  3AG1 E;  4N5Q A;  5KNH D;  4ZHB A;  3ABM E;  4GA2 A;  4PS7 A;  3L16 A;  5A23 A;  5G04 C;  5CCL A;  2WXN A;  4F7A A;  3EUV A;  5AJL A;  3SGH A;  3B7R L;  2CHX A;  2J07 A;  3LY7 A;  4G24 A;  4F3V A;  3CHQ A;  4D10 C;  3ABL E;  3BU8 A;  3UXG A;  4DPR A;  2X6I A;  3UM1 A;  4JPS A;  4H7X A;  2VSN A;  2DVW A;  3ZYQ A;  2GRO B;  3ZNG A;  1SZA A;  1H19 A;  5AQA A;  4XI0 A;  1HU3 A;  2J9Q A;  5HQ8 A;  2KCV A;  2IQC A;  4JW1 A;  2XRZ A;  3P1U A;  3ZRH A;  4L9P A;  3D9M A;  4UWH A;  1IXV A;  4WNE A;  3PUK A;  5CCM A;  4ANV A;  5T3R A;  1LF8 A;  3QOU A;  5CHE E;  5AIJ A;  4R7L A;  2EIM E;  3DST A;  4LRZ A;  2HR2 A;  5IY5 E;  1SW6 A;  1MHQ A;  1TNU A;  1E8X A;  3ZUV B;  1JCR A;  3DWL G;  1N4R A;  3ML8 A;  2J4D A;  3OAW A;  3BG0 B;  3V2X A;  3LJN A;  4HOS A;  3RO3 A;  1V55 E;  4M3O A;  3PEV B;  3MCX A;  1HZ4 A;  5A6C A;  4JL0 A;  5ITZ F;  4F6R D;  4DLO A;  2LNI A;  3CGH A;  3UIN C;  3S2A A;  3W9F A;  5CMY A;  5EKQ D;  5FZR A;  3D9L A;  3DRA A;  1EDU A;  3K9I A;  2IF4 A;  5EYL A;  4RVB A;  4LNG A;  5JHA A;  3UX4 A;  3V2O A;  4WWP A;  4GB9 A;  3D3M A;  3VLD A;  3LXU X;  3RU0 A;  2GRP B;  4HOQ A;  4K0R A;  3AS4 A;  3HXB A;  4DLQ A;  2VSX E;  1HG5 A;  3PZ3 A;  4I6E A;  4GA1 A;  3JQ1 A;  3SFX A;  3LEW A;  4GTR A;  3CHO A;  2L0I A;  4NUR A;  3FUE A;  3D9I A;  4GTP A;  2KAT A;  4I2W A;  2CHW A;  3NBN B;  2E0I A;  2WXJ A;  5D66 A;  2XHE A;  5T8I A;  1OY3 D;  3N71 A;  3PEU B;  4KMO A;  2OEW A;  4JZY A;  4IYP A;  5FQ4 A;  3CVP A;  4PS8 A;  3GZ2 A;  2EIK E;  1KZP A;  1XGW A;  3L17 A;  1NI1 A;  3I5P A;  4ANU A;  1NL4 A;  3PRZ A;  3OTN A;  1JCQ A;  3ASG A;  4PH4 B;  4GTQ A;  3UT7 A;  2DIW A;  2AWI A;  4M7C A;  3TJP A;  2CG3 A;  5FQ6 A;  2M63 A;  3FTZ A;  3L9T A;  5KWD A;  4WAF A;  5FIN A;  1KT1 A;  2OV8 A;  4LNU D;  2DWZ A;  4KXK B;  1FPP A;  2A5E A;  3QC1 A;  1DNP A;  3UI2 A;  1WDY A;  5ENQ D;  3SFZ A;  3ZU7 B;  4RG9 A;  1O1S A;  3HXE A;  2YIN A;  1E8Y A;  2PZI A;  4ATZ D;  2XEE A;  4XIF A;  1S64 A;  3QJZ A;  3ASH A;  3ULY A;  3RRM B;  3ZKJ A;  4HB5 A;  4JC8 A;  2RG8 A;  3TL5 A;  1OWM A;  1TN7 A;  3CHR A;  4KVO A;  1DCQ A;  1ZB1 A;  5CMW A;  3ULE G;  1UG3 A;  4CZ2 D;  1LD8 A;  3QDN A;  4BSX A;  5FQ7 A;  4UWL A;  3BG1 B;  1PAQ A;  5CRU A;  3FH8 A;  1UW4 B;  1QBQ A;  1WG0 A;  3CQG B;  1ELW A;  4O6F A;  4BES A;  1TNO A;  4GTV A;  2IJG X;  3GZS A;  4GYW A;  4JXT A;  4GZD A;  2KM4 A;  4GA0 A;  4LG6 A;  2IOL A;  2P2C P;  3S7J A;  4FU3 A;  3B7U X;  3FU3 A;  4Q96 A;  2WQH A;  4B89 A;  1IKN D;  5D0O D;  1IQR A;  4F1P A;  2EIN E;  2HO1 A;  3QAR A;  1UJJ A;  2KZT A;  3T5X A;  4U0U A;  3SF4 A;  3R9M A;  3L82 A;  3APC A;  5CED B;  3PNL B;  4KBQ A;  4CRW A;  4GZ6 A;  4UQY A;  2XS1 A;  4GTM A;  4I9E A;  3E33 A;  4K5C A;  4J8S A;  1P5Q A;  2QFC A;  4DK5 A;  4G8K A;  3FTX A;  3SZ7 A;  1YYH A;  3CVL A;  3FHE A;  3QKY A;  1NP7 A;  3RSE G;  4JHK A;  2MHK A;  3FUL A;  5HKP A;  4EHM A;  3HVE B;  2DCP A;  1RZ4 A;  5FT9 A;  3JXI A;  4XEI G;  2WXK A;  4I17 A;  4HNA D;  5AJD A;  4TRQ A;  1K3Z D;  4I1M A;  3ZHE B;  4I43 A;  1WAO 1;  2LAH A;  4BET A;  5M72 A;  2QC9 A;  1HG2 A;  4N39 A;  4HXI A;  2PQN A;  2P9U G;  2Y69 E;  4K5A B;  3ZEF A;  4YDE A;  1TNY A;  3UQ3 A;  3DEP A;  3MZL B;  3AJI A;  4L1B A;  2P9L G;  3MA5 A;  4UWK A;  4MKT A;  1ELK A;  5CER B;  3C5R A;  3CVV A;  3C3O A;  2DYR E;  2I6H A;  5B1B E;  2XGO A;  3DSU A;  5D0Q D;  2GRL A;  1SZ9 A;  4UQX A;  3QB2 A;  2LO6 A;  4CEM A;  5HS0 A;  1OUV A;  1DCE A;  5E76 A;  4O1O A;  2BTD A;  3ENE A;  1IYG A;  3G2S A;  1IQU A;  2P58 C;  3E32 A;  2UWJ G;  3L54 A;  4AY5 A;  4NIK A;  5BXU A;  3CQC B;  4ZFH A;  2CFU A;  3QK0 A;  5G55 A;  2EIL E;  5AQ9 A;  2YHC A;  3ZPJ A;  4EBA A;  2HYZ A;  3ZGQ A;  5ARF A;  3FY4 A;  3NZU A;  2V4H C;  2WXO A;  4L2L A;  3C3Q A;  4G23 A;  2WXH A;  4BTB A;  2FO1 E;  1E96 B;  5H7P A;  4YDY A;  1BPO A;  4JA9 A;  2L0T B;  1H6K A;  2XGS A;  2XS8 A;  3ONK A;  3TXM A;  2LXL A;  3KAE A;  1X5B A;  1MJ0 A;  3FU5 A;  3ESL A;  3TG5 A;  4B8C B;  3MKR A;  4GYY A;  4Z68 A;  4I1O B;  3FUJ A;  3FUD A;  2H6I A;  3UT8 A;  3GW4 A;  4CDN A;  3QWV A;  2WXR A;  2WM9 A;  4QFV A;  3FEX A;  4PDX A;  1W3B A;  2I1K A;  4W9R A;  1BD8 A;  2VYI A;  2WPV A;  3D9O A;  3APF A;  4BY6 A;  4Y6W A;  2UY1 A;  5BUZ A;  3URZ A;  3DPY A;  3EU5 A;  1JWG A;  3DSX A;  4A1G A;  4X8Q A;  2KCL A;  5JJT A;  4LUN U;  3U64 A;  4MRU A;  3NB2 A;  5ANR A;  4TXP A;  5AAO A;  2X38 A;  2Y3A A;  3BUA A;  5ARG A;  4G1T A;  3SD5 A;  4OAU C;  3CIA A;  1FT2 A;  3S7D A;  4ACK A;  4BSZ B;  4KYO B;  2PNN A;  3G2W A;  4AIF A;  5ENT D;  4XKC A;  3RRU A;  2J4B A;  3CLJ A;  3ZW3 A;  4KZC A;  3CSF A;  3LKU A;  2XGM A;  3KSQ A;  1N95 A;  2A5U A;  3FH7 A;  2WB2 A;  4HLL A;  5B3S E;  1WY6 A;  4BT9 A;  3PS6 A;  1KT0 A;  3L22 A;  4FLH A;  3U9W A;  3Q5M A;  2XRY A;  3R7Q A;  2R03 A;  3NZS A;  4BWR A;  2AXV A;  3EHQ A;  5LX8 A;  1BI8 B;  1TNB A;  1Q2Z A;  4JA7 A;  2C0M A;  3KD7 A;  3VLE A;  2XCB A;  3ZYM A;  2YQ8 A;  5AQB A;  5JHB A;  2OEV A;  3NOG D;  1DVP A;  3D9P A;  3EIQ C;  4ILH B;  3E34 A;  4FUL A;  2F0Y A;  4HVB A;  3FUM A;  3QWP A;  2I9C A;  3PVL A;  2P9K G;  2XPZ A;  4YDO A;  2Y4U A;  1H0A A;  5BV1 A;  3V79 K;  4U0Z A;  5HRY A;  2R59 A;  3S7B A;  4RSY A;  4DI3 A;  3B7T A;  4J8D A;  1H2T C;  5FWQ A;  4P29 A;  1Z3X A;  4GYO A;  1O1R A;  4EZJ A;  4OVV A;  2NC9 A;  1OCZ E;  2IOS A;  4JEH A;  4TV3 A;  3CVU A;  3RO2 A;  3HHM A;  3ZXP A;  3TWW A;  4XX5 A;  4BX9 A;  5A7D B;  5ANL A;  1OCR E;  1MX2 A;  4MLP A;  4U63 A;  1SVX A;  2WQ6 A;  3T9K A;  4G8L A;  3PUJ A;  3AAA C;  4DJA A;  3PZ2 A;  3FU0 A;  3IV0 A;  2VTB B;  5AN8 A;  4TXR A;  5FJY A;  2ETB A;  2RKK A;  1Y6I A;  3QNK A;  2VGX B;  3GZ1 A;  4A3V A;  4CCA A;  4I2Z A;  5FZS A;  2GRM A;  3ZHE A;  4GTT A;  4JB8 P;  2XZT G;  5EDS A;  2B0O E;  3ZIM A;  5ENN A;  2OOE A;  3FTY A;  4ACL A;  4NRH B;  3LY8 A;  3FTV A;  1G3N B;  3ZXS A;  2L9B A;  4A3T A;  1N54 A;  3FUF A;  2ETA A;  4G2V A;  3QAQ A;  4QQI A;  3JUE A;  4GPK A;  2NYJ A;  2IFU A;  4FLB A;  1JWF A;  3R7R A;  4WNF A;  1ZU2 A;  1HF8 A;  2B6C A;  3DSW A;  1NZN A;  3PZ1 A;  3HXC A;  4ANX A;  3HIZ A;  3DXK G;  3DEO A;  4HBD A;  5G05 J;  4HRM B;  2F37 A;  4FAD A;  1SA5 A;  3TWX A;  3Q73 A;  1IHG A;  2ZIS A;  2WXP A;  4MBG A;  1EF1 C;  4DX2 A;  3JUI A;  3FFL A;  2X6J A;  4EQF A;  5HI7 A;  2WXF A;  5KJK A;  1K8K G;  4GTO A;  2BED A;  2WVI A;  2C2L A;  3DSV A;  2GRN B;  4UWG A;  4AJW A;  3ZN3 A;  4N3B A;  4GU5 A;  4FJZ A;  2PL2 A;  1EYH A;  3SY2 A;  4LSZ E;  4A1S A;  1JPL A;  2P9S G;  2WXQ A;  2XPY A;  2DBA A;  2J09 A;  4CDM A;  5J90 A;  1KLX A;  4PS3 A;  3CVN A;  1NA0 A;  2GRR B;  3NAW A;  4GZ5 A;  4URK A;  3CKB A;  4A63 B;  3NQP A;  3CK7 A;  3B13 A;  5C2Y A;  1JUQ A;  1OCC E;  5LOZ A;  1X81 A;  4FHJ A;  1OWN A;  2WXM A;  2QY7 A;  4WND A;  3C72 A;  4GZC A;  2R05 A;  5C1D A;  3PE4 A;  5CBO A;  3FEY A;  2JAB A;  4HLE A;  4ME2 A;  3PE3 A;  1N4S A;  3HXF A;  3W9G A;  4HI9 A;  4B93 B;  3CVQ A;  5KJL A;  3UUX A;  4EPZ A;  2XCC A;  2FI7 A;  5JMN D;  3TG4 A;  4I6J A;  4HS2 A;  5BT1 A;  1PY1 A;  2RFM A;  2L6B A;  3SHF A;  4B0Z A;  3UTM A;  3UT4 A;  1FT1 A;  4C9B B;  1TR4 A;  2FBN A;  4BX8 A;  5BNW A;  3T8K A;  2XEV A;  3ISM C;  4AV7 A;  3AU4 A;  2NSZ A;  5EN5 D;  3CVW A;  3NF1 A;  3B95 A;  1NFI E;  1NA3 A;  1N0R A;  1OXJ A;  3APD A;  3EHN A;  3MEK A;  3IKO B;  3ABK E;  4ABN A;  4WNG A;  3CK9 A;  3ML9 A;  2R17 C;  1TN6 A;  1OWP A;  5G05 C;  3AS5 A;  3R9A B;  1QQE A;  4UUC A;  4U8Y D;  3X2Q E;  1MX4 A;  1HFA A;  3CHS A;  5CEC B;  4N3C A;  2IU1 A;  3MGB A;  1LTX A;  3S7F A;  2IEJ A;  3FP3 A;  1LD7 A;  1V54 E;  4GMJ A;  1FVH A;  4Y6C A;  3Q79 A;  1BU9 A;  5CEA A;  5DIZ A;  4APO A;  1OWL A;  1FCH A;  2AJA A;  2DYS E;  2FF4 A;  2A4Z A;  3FUK A;  2X6K A;  4KT6 B;  3Q49 B;  3Q9N C;  5BW8 C;  4LNB A;  1E7V A;  5EIL A;  4AEZ C;  5JJ6 A;  2XEN A;  2CFZ A;  4RLY A;  5ENO D;  4AXH A;  3JXJ A;  5J08 A;  3LJ3 A;  1H6P A;  3V30 A;  4OAV B;  3TWV A;  3PDN A;  4NAC A;  1N11 A;  1QNF A;  3CHP A;  1OWO A;  3ASD A;  1N94 A;  3HDX A;  3Q9U C;  3UKR G;  2KZT B;  4J8F A;  2NXP A;  3PH0 C;  2Y1L E;  4DX7 D;  1UJK A;  4WWO A;  4EZL A;  1PC2 A;  1Z3Y A;  1UOH A;  1K1A A;  1ZBP A;  1OT8 A;  2LSV A;  1N52 A;  2IO2 C;  4U8H A;  3G2T A;  4L7T A;  5CRV A;  2V5F A;  2BKK B;  3L6A A;  2VGX A;  3ZYL A;  3RIB A;  4U8V D;  4CT4 A;  3AG2 E;  2JEK A;  5EID A;  3D9K A;  2VGE A;  5T4Y A;  5BXO A;  3SBT B;  4EZK A;  1HXI A;  1MX6 A;  2MOW A;  3P2B A;  1D8E A;  3DPD A;  3ULQ A;  2EIJ E;  4AY6 A;  2CHZ A;  1TNZ A;  4O1P A;  2YHE A;  3HYM B;  4B8A A;  2ILR A;  3DXM G;  4BER A;  5EX3 A;  1ELR A;  2VSO E;  1Z5S C;  2WXI A;  1RW2 A;  1U3D A;  2AXZ A;  3Q4A B;  4CYM D;  3FTW A;  2R2L A;  1S0P A;  1WM5 A;  2HE0 A;  4FA6 A;  4J8Y A;  3U3W A;  3T8M A;  5LFA A;  3V31 A;  3C3R A;  5KBA A;  2CG2 A;  1YA0 A;  3SQV A;  3TWT A;  2MRI A;  4UI9 J;  5CBN A;  4E6H A;  2ZXW E;  3UM0 A;  4OYS A;  3IHV A;  4AOF A;  4LCT A;  4GCN A;  3LPZ A;  3QWW A;  1INZ A;  3PZ4 A;  5EIB E;  1HH8 A;  3CKC A;  3G2U A;  1TYQ G;  2QYJ A;  1IHB A;  1XNF A;  2Q7F A;  3EIJ A;  4G11 A;  1GW6 A;  3Q78 A;  3DSS A;  4YDW A;  5KJM A;  1A5E A;  3D9J A;  2BKG A;  3EJN A;  2I1J A;  3EHR A;  2MYO A;  5FQ8 A;  1H2V C;  2R02 A;  3PZD A;  3Q75 A;  4J0U A;  3AG4 E;  2L6J A;  3FUH A;  3CR3 A;  1HS6 A;  2BUG A;  1S70 B;  4ILG A;  4AVX A;  1MZC A;  4DX5 D;  1MYO A;  3LVR E;  3EU9 A;  1N4Q A;  2JLB A;  3TXN A;  3MV2 B;  5JJ7 A;  5B1A E;  4Q69 A;  4J8E A;  4I9C A;  3SO8 A;  2E2E A;  5LCW C;  4YVQ C;  5G2N A;  3MKQ B;  4FJY A;  4OVU A;  4HOR A;  5FZQ A;  4UI9 K;  3FWV A;  2PM7 A;  1A17 A;  3G2V A;  4J7W A;  2H6F A;  3HVE A;  2X3M A;  4GAA A;  4FP7 A;  5ENS D;  3WXX A;  4CGW A;  1U2V G;  3HG0 D;  4J6I A;  3LCA A;  2I2O A;  3RJV A;  3T5V A;  4HRN A;  3JQ0 A;  3VLF A;  4N3A A;  2GW1 A;  3RKV A;  2DZO A;  3CST A;  5FIO A;  2EQX A;  2VSY A;  3JCK C;  3ZVV A;  4C0M A;  2FUL A;  2DZN A;  4U96 D;  2VJ8 A;  1O5M A;  2V4L A;  2X6F A;  3ASO E;  1BI7 B;  5AAR A;  1QZ2 A;  3CK8 A;  3I3N A;  3UM2 A;  3HRA A;  4TUU A;  1KZO A;  1Y8M A;  2P9I G;  2FEZ A;  4F53 A;  2QZA A;  2UY1 B;  4MS6 A;  3FDH A;  3KSL A;  1YCS B;  3C98 A;  1TN8 A;  3CVX A;  3UIO C;  2ZIR A;  4BFR A;  3CVY A;  3LY9 A;  4C0E A;  5BV0 A;  3Q7A A;  1N9A A;  3MJW A;  3MV3 B;  4HOU A;  1S63 A;  2J49 A;  4RG6 A;  1B89 A;  1TJC A;  4UI9 C;  4JD2 G;  3BEE A;  3Q15 A;  3SBS A;  3GYZ A;  2GRQ B;  1Z6T A;  4JHJ A;  4TUM A;  5ENP D;  3ASF A;  4JEU A;  4U0S A;  4LER A;  2XPI A;  2IY0 C;  3CHM A;  3RAU A;  5EX0 A;  4KVM A;  4AP2 A;  5ENR D;  3B7S A;  1U3C A;  1H6O A;  2J8S D;  3UPV A;  1O1T A;  4I1A A;  2J08 A;  4U7E B;  4U95 D;  2AW6 A;  1D8D A;  1N4P A;  3ZFW A;  3VTY A;  4WWN A;  3KEA A;  1TJF A;  3J5Q B;  4C48 B;  3EHM A;  3NOC D;  3SI5 A;  3UKU G;  3TGO A;  4DI4 A;  1JCS A;  4Q94 A;  2WMN A;  4EBA G;  4A55 A;  3U4T A;  4I6G A;  2YNQ A;  3IEG A;  4GTS A;  4UQZ A;  3FUI A;  3IHY A;  1H2U A;  1QYM A;  3O48 A;  5AYW D;  4DRX E;  3AS8 A;  4UWF A;  3ESK A;  4JHR A;  4YVO A;  4HRL A;  5FTP A;  3U66 A;  3LDZ A;  4TXQ A;  3RRN B;  2ION A;  3L08 A;  1HO8 A;  3CV0 A;  4ILI A;  4N5C A;  1UN9 A;  2H6H A;  2V0P A;  1KPS B;  4B94 A;  4CDR A;  2KXP C;  5DBK A;  4CT0 A;  4K5B A;  3SFY A;  2KC7 A;  2AXU A;  4G26 A;  3I4G A;  3ZYK A;  2HM8 A;  4JVS A;  3TWR A;  2V8S E;  2VGY A;  3I4R B;  3BQO A;  2F8Y A;  4BT8 A;  2F8X K;  2XZD G;  4GPM A;  2LAI A;  3PRE A;  3CEQ A;  4XI9 A;  4IRU A;  4IN3 B;  2OVF A;  3RK6 A;  5G04 J;  2V5Q C;  5EYP F;  2PM6 A;  1UN8 A;  4V3I A;  4FHK A;  1HX8 A;  2WXL A; 
#chains in the Genus database with same CATH homology
 4J8F A;  4RG9 A;  2NXP A;  1H0A A;  5KCM A;  5BV1 A;  2YIN A;  4U0Z A;  3PH0 C;  5BPP A;  2R59 A;  3S7B A;  3VTX A;  4E85 A;  3O4Z A;  1E8Y A;  4RSY A;  4DI3 A;  3B7T A;  1UJK A;  4WWO A;  2FO7 A;  4N2S A;  4J8D A;  4EZL A;  1H2T C;  5FWQ A;  1PC2 A;  1Z3Y A;  4P29 A;  1Z3X A;  1ZBP A;  4GYO A;  4EZJ A;  4OVV A;  2PZI A;  2LSV A;  3KEZ A;  1N52 A;  4U04 A;  2NC9 A;  4U8H A;  4XIF A;  2IOS A;  3G2T A;  3QJZ A;  4GCO A;  4L7T A;  2V5F A;  3ASH A;  3L6A A;  4ATG A;  2VGX A;  3ZYL A;  4JEH A;  1MQS A;  3RRM B;  4TV3 A;  3RIB A;  3CVU A;  4CT4 A;  2OVB A;  2JEK A;  3TL5 A;  4JC8 A;  2RG8 A;  3FU6 A;  4HFG A;  4LEU A;  1OWM A;  3CHR A;  3D9K A;  4KVO A;  3RO2 A;  3TAX A;  5T4Y A;  5CMW A;  3HHM A;  3SBT B;  4EZK A;  1HXI A;  1UG3 A;  4GZ3 A;  3QDN A;  4BSX A;  2MOW A;  3P2B A;  4XX5 A;  3DBS A;  5FQ7 A;  4N2Q A;  4UWL A;  5E75 A;  3BG1 B;  1PAQ A;  5ANL A;  3DPD A;  5A7D B;  4BX9 A;  2XQ0 A;  3FH8 A;  4IUL A;  3ULQ A;  1UW4 B;  5AEN A;  4AY6 A;  3LYA A;  4XZ4 A;  2CHZ A;  2WQ7 A;  3CQG B;  3JYS A;  2YHE A;  4EEC A;  1ELW A;  3HYM B;  4B8A A;  4O6F A;  2ILR A;  4MLP A;  4L23 A;  4U63 A;  4APF A;  4KZ0 A;  2IJG X;  2R5S A;  1E8W A;  3GZS A;  5EX3 A;  2WQ6 A;  4GYW A;  4JXT A;  1ELR A;  3OXF A;  4GZD A;  4CGV A;  2VSO E;  2BF0 X;  2WXI A;  3PUJ A;  1HE8 A;  2KM4 A;  4GA0 A;  1U3D A;  2AXZ A;  2IOL A;  2ZU6 B;  3Q4A B;  4DJA A;  3FTW A;  2AVP A;  2WMO A;  3S7J A;  4FU3 A;  3B7U X;  1S0P A;  3OXG A;  3FU3 A;  1WM5 A;  5LP0 A;  4FA6 A;  3FU0 A;  3PNT B;  4Q96 A;  2WQH A;  4B89 A;  3IV0 A;  2VTB B;  3D9N A;  1FVF A;  5D0O D;  3MX3 A;  1IQR A;  3FTS A;  3U3W A;  4AM9 A;  2VQ2 A;  5FJY A;  4U07 A;  4L2Y A;  2HO1 A;  3QAR A;  1UJJ A;  2KZT A;  3T8M A;  1Y6I A;  3QNK A;  5LFA A;  2VGX B;  3T5X A;  3FTU A;  3GZ1 A;  4U0U A;  3SF4 A;  2CG2 A;  1YA0 A;  4PUC A;  3L13 A;  4A3V A;  4CCA A;  2MRI A;  3APC A;  2GGF A;  4I2Z A;  4UI9 J;  5FZS A;  2GRM A;  3ZHE A;  4E6H A;  1TEZ A;  3PNL B;  4KBQ A;  4CRW A;  4GZ6 A;  4UQY A;  4OYS A;  3IHV A;  4YND A;  2KCK A;  4I9E A;  4AOF A;  5EDS A;  4LCT A;  4GCN A;  4J8S A;  3LPZ A;  3QWW A;  4XE0 A;  1P5Q A;  3ZIM A;  5ENN A;  1INZ A;  2QFC A;  4WUY A;  4DK5 A;  2OOE A;  3MYV A;  3FTX A;  3FTY A;  1HH8 A;  3SZ7 A;  3CKC A;  4ACL A;  3G2U A;  3CVL A;  4NRH B;  3FHE A;  3FTV A;  1NP7 A;  3LY8 A;  3QKY A;  4JHK A;  1E8Z A;  2MHK A;  3ZXS A;  1EPU A;  2PQR A;  2C0L A;  3FUL A;  3ONL A;  2L9B A;  4XKB A;  5LCW J;  1XNF A;  2Q7F A;  3EIJ A;  4A3T A;  3Q47 B;  4G11 A;  3MKQ A;  1N54 A;  1GW6 A;  2RD0 A;  3IBE A;  3HVE B;  2DCP A;  3FUF A;  4G2V A;  5KJN A;  5KJM A;  4HOT A;  4BTA A;  4GML A;  3QAQ A;  3D9J A;  1E90 A;  4G25 A;  4GPK A;  5FT9 A;  2LSU A;  2IFU A;  3EJN A;  4FLB A;  1JWF A;  2I1J A;  3R7R A;  5FQ8 A;  2OND A;  4WNF A;  1H2V C;  1SQM A;  1ZU2 A;  3FH5 A;  1L5J A;  3PZD A;  1HF8 A;  4K03 A;  4J0U A;  1NZN A;  3FUN A;  2Y4T A;  2WXK A;  2L6J A;  4I17 A;  3FUH A;  3CR3 A;  1HS6 A;  2BUG A;  4ANX A;  3LVQ E;  4ILG A;  3KS2 A;  5AJD A;  4AVX A;  4TRQ A;  3EDT B;  3HIZ A;  3ZHE B;  4I1M A;  3LVR E;  4I43 A;  4NQ0 A;  1E7U A;  5G05 J;  2VTB A;  1WAO 1;  3AU5 A;  2LAH A;  5M72 A;  2JLB A;  3TXN A;  4ANW A;  3UMV A;  2X6H A;  3OXL A;  1HG2 A;  4F1S A;  3E4B A;  4HXI A;  2PQN A;  4N39 A;  3MV2 B;  2WXG A;  3SNX A;  3ZEF A;  1VDY A;  4H7Y A;  5JJ7 A;  4FC8 A;  3LS8 A;  4Q69 A;  4FAD A;  4J8E A;  3UQ3 A;  1IHG A;  3MZL B;  4I9C A;  2E2E A;  4L1B A;  5LCW C;  4YVQ C;  2WXP A;  5G2N A;  4GA2 A;  3MA5 A;  4UWK A;  3MKQ B;  1EF1 C;  4FJY A;  4MKT A;  4PS7 A;  4OVU A;  1ELK A;  3L16 A;  3JUI A;  5A23 A;  4HOR A;  3FFL A;  5G04 C;  2X6J A;  4EQF A;  2WXN A;  5CCL A;  5FZQ A;  4F7A A;  5HI7 A;  3CVV A;  5AJL A;  2WXF A;  3SGH A;  5KJK A;  4UI9 K;  3B7R L;  3FWV A;  2PM7 A;  2CHX A;  1A17 A;  3G2V A;  2WVI A;  2C2L A;  3HVE A;  2J07 A;  2X3M A;  2I6H A;  3LY7 A;  4FP7 A;  4GAA A;  4G24 A;  3WXX A;  4CGW A;  4UWG A;  4AJW A;  2XGO A;  3ZN3 A;  5D0Q D;  4N3B A;  4F3V A;  2GRL A;  4J6I A;  3CHQ A;  3LCA A;  4GU5 A;  4FJZ A;  2PL2 A;  1EYH A;  1SZ9 A;  2I2O A;  4UQX A;  3RJV A;  4D10 C;  3T5V A;  3QB2 A;  2LO6 A;  4CEM A;  4A1S A;  3JQ0 A;  1JPL A;  3VLF A;  1OUV A;  4N3A A;  2WXQ A;  2GW1 A;  3RKV A;  2XPY A;  3CST A;  2DBA A;  2J09 A;  2EQX A;  2VSY A;  2X6I A;  5E76 A;  4CDM A;  4DPR A;  5J90 A;  3JCK C;  3ZVV A;  4C0M A;  2FUL A;  4JPS A;  2VJ8 A;  2BTD A;  1KLX A;  2V4L A;  3ENE A;  4H7X A;  4PS3 A;  2X6F A;  1IYG A;  1QZ2 A;  3CVN A;  3CK8 A;  1NA0 A;  2VSN A;  3G2S A;  3I3N A;  3ZYQ A;  4GZ5 A;  4TUU A;  4URK A;  1IQU A;  2P58 C;  3CKB A;  1SZA A;  2UWJ G;  3NQP A;  3CK7 A;  3L54 A;  4AY5 A;  3B13 A;  1H19 A;  4XI0 A;  1Y8M A;  5C2Y A;  1HU3 A;  2J9Q A;  3CQC B;  2FEZ A;  4F53 A;  1JUQ A;  5HQ8 A;  2CFU A;  2UY1 B;  3FDH A;  3QK0 A;  4MS6 A;  5G55 A;  5LOZ A;  2KCV A;  4FHJ A;  2IQC A;  1OWN A;  2YHC A;  4JW1 A;  2WXM A;  2QY7 A;  3ZPJ A;  4EBA A;  2XRZ A;  2HYZ A;  3ZGQ A;  4WND A;  3C98 A;  3P1U A;  5ARF A;  3ZRH A;  3D9M A;  4UWH A;  4WNE A;  3FY4 A;  3NZU A;  3PUK A;  4GZC A;  5C1D A;  3CVX A;  3PE4 A;  5CCM A;  3FEY A;  4ANV A;  4BFR A;  2WXO A;  4L2L A;  3CVY A;  5T3R A;  1LF8 A;  4G23 A;  2WXH A;  3LY9 A;  3QOU A;  5CHE E;  5AIJ A;  4C0E A;  4BTB A;  4R7L A;  4HLE A;  5BV0 A;  4ME2 A;  1E96 B;  3PE3 A;  1BPO A;  4LRZ A;  2L0T B;  2HR2 A;  4JA9 A;  3MJW A;  1MHQ A;  1H6K A;  2XGS A;  3MV3 B;  3ONK A;  4HOU A;  1E8X A;  3TXM A;  3KAE A;  5KJL A;  3CVQ A;  1X5B A;  3FU5 A;  3UUX A;  4EPZ A;  2XCC A;  2FI7 A;  2J49 A;  3ESL A;  4I6J A;  4RG6 A;  1B89 A;  1TJC A;  3ML8 A;  4HS2 A;  4UI9 C;  3TG4 A;  1PY1 A;  3BEE A;  5BT1 A;  2J4D A;  3OAW A;  3TG5 A;  4B8C B;  3BG0 B;  3MKR A;  3Q15 A;  3SBS A;  3GYZ A;  4GYY A;  4HOS A;  3RO3 A;  4M3O A;  3PEV B;  1Z6T A;  4I1O B;  3MCX A;  3SHF A;  4B0Z A;  1HZ4 A;  4JHJ A;  3FUJ A;  3FUD A;  3UT4 A;  5A6C A;  3UT8 A;  4JL0 A;  3ASF A;  4JEU A;  4DLO A;  4U0S A;  2LNI A;  4C9B B;  3CGH A;  4LER A;  3S2A A;  2XPI A;  3CHM A;  3GW4 A;  5EX0 A;  4CDN A;  4KVM A;  5CMY A;  2FBN A;  4BX8 A;  4AP2 A;  3QWV A;  5BNW A;  5EKQ D;  3B7S A;  2WXR A;  1U3C A;  2WM9 A;  2XEV A;  5FZR A;  3UPV A;  3D9L A;  4QFV A;  3FEX A;  4AV7 A;  1EDU A;  3AU4 A;  4I1A A;  4PDX A;  2J08 A;  1W3B A;  3K9I A;  2I1K A;  4W9R A;  2IF4 A;  2VYI A;  2NSZ A;  2WPV A;  3CVW A;  3D9O A;  3NF1 A;  4RVB A;  2AW6 A;  3APF A;  3ZFW A;  1NA3 A;  3VTY A;  5JHA A;  3UX4 A;  4BY6 A;  4WWN A;  4WWP A;  4GB9 A;  3D3M A;  3VLD A;  3LXU X;  1TJF A;  3RU0 A;  4Y6W A;  2UY1 A;  4HOQ A;  3APD A;  3AS4 A;  3EHN A;  3MEK A;  4K0R A;  3IKO B;  5BUZ A;  3URZ A;  4DLQ A;  3EHM A;  2VSX E;  1HG5 A;  1JWG A;  4I6E A;  4A1G A;  4ABN A;  4GA1 A;  3SI5 A;  3JQ1 A;  3TGO A;  2KCL A;  4DI4 A;  4Q94 A;  4WNG A;  2WMN A;  3CK9 A;  3ML9 A;  4EBA G;  4A55 A;  3U4T A;  2R17 C;  3LEW A;  4LUN U;  3U64 A;  5JJT A;  4I6G A;  3CHO A;  2L0I A;  2YNQ A;  3IEG A;  4MRU A;  4NUR A;  5ANR A;  3FUE A;  1OWP A;  3D9I A;  3AS5 A;  5G05 C;  2X38 A;  4UQZ A;  2KAT A;  2Y3A A;  3FUI A;  5ARG A;  4I2W A;  3R9A B;  4G1T A;  1QQE A;  3SD5 A;  2CHW A;  3IHY A;  1H2U A;  3O48 A;  2E0I A;  2WXJ A;  3CIA A;  3S7D A;  5AYW D;  2XHE A;  3AS8 A;  4UWF A;  4ACK A;  3ESK A;  4KYO B;  5T8I A;  3G2W A;  4JHR A;  4YVO A;  1HFA A;  3CHS A;  4N3C A;  3N71 A;  3PEU B;  2IU1 A;  4AIF A;  3MGB A;  4XKC A;  5FTP A;  3LDZ A;  2J4B A;  3RRU A;  3U66 A;  3CLJ A;  3RRN B;  3ZW3 A;  4KMO A;  3S7F A;  2ION A;  3FP3 A;  4KZC A;  3CSF A;  3L08 A;  4GMJ A;  1FVH A;  1HO8 A;  3CV0 A;  3LKU A;  4IYP A;  4JZY A;  2XGM A;  4Y6C A;  5FQ4 A;  3CVP A;  4ILI A;  4PS8 A;  3FH7 A;  2A5U A;  4N5C A;  3GZ2 A;  5DIZ A;  1UN9 A;  2WB2 A;  2V0P A;  1XGW A;  4APO A;  3L17 A;  1WY6 A;  3I5P A;  4BT9 A;  4B94 A;  1OWL A;  4CDR A;  5DBK A;  4CT0 A;  3PS6 A;  1KT0 A;  4ANU A;  3L22 A;  1FCH A;  4FLH A;  3PRZ A;  3OTN A;  2FF4 A;  3U9W A;  2KC7 A;  2A4Z A;  2AXU A;  3FUK A;  3Q5M A;  4G26 A;  3I4G A;  3ASG A;  3ZYK A;  2X6K A;  4PH4 B;  2HM8 A;  4KT6 B;  4JVS A;  2DIW A;  2V8S E;  3Q49 B;  2XRY A;  3UT7 A;  3R7Q A;  2VGY A;  5BW8 C;  3I4R B;  2AWI A;  3NZS A;  4BWR A;  3TJP A;  2CG3 A;  5FQ6 A;  2AXV A;  4BT8 A;  5LX8 A;  2LAI A;  1E7V A;  3PRE A;  4AEZ C;  3CEQ A;  4JA7 A;  4XI9 A;  5JJ6 A;  2C0M A;  2M63 A;  3FTZ A;  3KD7 A;  3VLE A;  2CFZ A;  2XCB A;  3ZYM A;  4WAF A;  4AXH A;  2YQ8 A;  5J08 A;  3LJ3 A;  4IRU A;  1KT1 A;  2OV8 A;  4IN3 B;  5JHB A;  4KXK B;  1DVP A;  3D9P A;  2OVF A;  3RK6 A;  5G04 J;  3PDN A;  3EIQ C;  4NAC A;  3CHP A;  1QNF A;  2PM6 A;  4ILH B;  1UN8 A;  1OWO A;  3ASD A;  3QC1 A;  4FUL A;  1DNP A;  4HVB A;  3HDX A;  3FUM A;  3QWP A;  2I9C A;  3PVL A;  4V3I A;  2XPZ A;  4FHK A;  2Y4U A;  3SFZ A;  2KZT B;  1HX8 A;  2WXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...