1NA0A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
119
structure length
119
Chain Sequence
b'NSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed protein CTPR3
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
total genus 50
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na0A00
3VTYA 2PQNA 1QZ2A 2FBNA 2KATA 4UI9C 3QDNA 3ZHEA 4HOSA 2YHCA 4JHRA 2C2LA 2WQHA 2FF4A 3MA5A 3ZHEB 4G23A 1YA0A 2C0MA 4XI0A 2GW1A 3PE4A 4CGWA 1TJCA 1WAO1 5KJMA 3R9AB 4BTAA 4JL0A 1KT0A 5KJKA 4HOQA 3S7BA 4KBQA 1HXIA 4W9RA 4KXKB 2J9QA 3GZ2A 4J8EA 4AIFA 4APOA 2VSYA 3CK7A 2PZIA 4GZ3A 4WNGA 3GW4A 5CCLA 3CKBA 5BW8C 4N5CA 2YQ8A 4UI9J 5C1DA 5FJYA 2NC9A 4JA9A 4GA0A 4A1SA 4I17A 3NF1A 4RG6A 2BUGA 5BNWA 5G04C 3RKVA 1W3BA 2FO7A 4U04A 3UPVA 3SZ7A 5CCMA 2PL2A 3RO3A 4AY6A 1P5QA 5D0OD 3LKUA 1KT1A 4B94A 5FT9A 3U3WA 4J8FA 3LY9A 4G25A 1XNFA 3Q15A 4UQZA 5EKQD 3CVLA 1E96B 4H7XA 3IEGA 2ONDA 4NQ0A 2OOEA 4GYYA 2AVPA 3CVNA 2VGXA 3UQ3A 4HOTA 2UY1A 3PE3A 5G05C 2KCLA 4WUYA 4WNEA 3WXXA 3S7DA 4EQFA 2VGXB 4GZ6A 2UY1B 4GCOA 4BWRA 3FFLA 4I9CA 2FEZA 5D0QD 2LSUA 1PC2A 1A17A 5FZSA 5JJTA 3E4BA 3LY7A 4NRHB 3BEEA 3KAEA 3QKYA 4WNDA 2QFCA 3FP3A 2L6JA 2LNIA 4AM9A 4YVQC 2E2EA 2HR2A 4G24A 3U4TA 3Q4AB 4JA7A 4ABNA 3TG4A 3CVPA 2KCKA 4GCNA 2V5FA 4AY5A 2VSNA 5G05J 3SF4A 3AS4A 2Y4UA 3CK8A 3QOUA 2WPVA 4BTBA 4U0ZA 2VGYA 3LYAA 3JYSA 1HH8A 3MV3B 3CKCA 5EX3A 1ELRA 3GZ1A 4IN3B 3TAXA 2Q7FA 3TG5A 3ZPJA 2XGSA 3Q49B 3CEQA 1NA3A 1IYGA 4U0SA 5A6CA 2MHKA 3Q47B 1Y8MA 2UWJG 2I6HA 4GZ5A 3O48A 1FCHA 1OUVA 5KJLA 5DIZA 2XPIA 3CK9A 2FI7A 3MEKA 3VTXA 2XEVA 5FTPA 4BT8A 1ZU2A 3MKRA 3S7FA 4ME2A 4U0UA 4GPKA 4I2WA 1QQEA 5HI7A 2IFUA 5CHEE 3LCAA 2VYIA 5G04J 3ASGA 4I9EA 4UI9K 3HYMB 3ASFA 1NA0A 5ARGA 3UUXA 3K9IA 5LCWC 1IHGA 5FZQA 4G26A 5KJNA 3LY8A 2LSVA 4N39A 3ASDA 3ASHA 3AS8A 4U07A 5ARFA 3TGOA 3RU0A 4KYOB 3ZN3A 1WM5A 2P58C 3ZFWA 4RG9A 4XIFA 4UQYA 3GYZA 5AYWD 4CGVA 5A7DB 3MV2B 3QWPA 4J0UA 2JLBA 3OXGA 4G1TA 4WNFA 4O6FA 4Y6WA 4HORA 1KLXA 4BT9A 3EDTB 4F3VA 4UQXA 2KC7A 5LCWJ 2VQ2A 2DBAA 4N3CA 4N2SA 3AS5A 1ELWA 5M72A 4Y6CA 3CVQA 3FWVA 3S7JA 4GYWA 2HYZA 4J8DA 3OXFA 4LEUA 4YVOA 3CV0A 5EX0A 3RO2A 4GYOA 3QWWA 2XCBA 3PDNA 3Q5MA 4GA1A 2XGOA 4HOUA 4N3BA 4YNDA 3RJVA 4I1AA 3ZGQA 2Y4TA 3URZA 3ESKA 3KD7A 4G2VA 5JJ6A 1ZBPA 4H7YA 2XGMA 3ULQA 4XI9A 2R5SA 2PQRA 2IF4A 1B89A 2KCVA 5HQ8A 4N2QA 4CDRA 3OXLA 5JJ7A 3KS2A 5BT1A 1HZ4A 3QWVA 2C0LA 2HO1A 3N71A 3LPZA 4N3AA 1NZNA 5DBKA 2XCCA 4I2ZA 5FZRA 3RIBA 4GA2A
chains in the Genus database with same CATH superfamily
2PQNA 5ENPD 2FBNA 3GZSA 4UI9C 1UJJA 3FUIA 3APDA 3CIAA 4JHRA 4BEPA 2E0IA 4I6EA 2WXFA 4ANXA 3EHNA 2XEHA 2AW6A 4BERA 2GW1A 3PE4A 2Y1LE 2F0YA 4CGWA 2VSOE 2WXLA 1EF1C 3FEYA 4PH4B 3SGHA 4PS3A 3S7BA 1E8YA 3PZ1A 3V2XA 3TWVA 3CLJA 2AXZA 5AQBA 1HXIA 2LXLA 1Z6TA 3UI2A 4W9RA 1HX8A 1N4PA 1OT8A 3CK7A 4GZ3A 4JZYA 3GW4A 3LVQE 3Q7FA 5AJDA 2DZNA 5CCLA 1A5EA 3FU5A 2ZXWE 3NBNB 3EU9A 2OV8A 2NC9A 2KZTA 3TWRA 4AJWA 2I9CA 4RG6A 1O1SA 2V4HC 2EIJE 4R7LA 2FO7A 2KZTB 3D9KA 1NI1A 1N9AA 2PL2A 3E34A 3RO3A 3ZYMA 3RSEG 1P5QA 4X8QA 5D0OD 4LNUD 5E75A 3B7UX 2CHXA 4DX2A 4G8KA 3U3WA 4J8FA 2R59A 3Q78A 3LY9A 1QYMA 4DPRA 4WWPA 1BI8B 1XNFA 3UMVA 4HLEA 5EKQD 5E76A 1E96B 4KZ0A 3UKUG 4H7XA 4BSXA 3AU5A 4KT6B 2OOEA 2AVPA 4F7AA 5J90A 2EQXA 2WXQA 3PE3A 5G05C 1TEZA 4WUYA 2DVWA 3WXXA 3S7DA 3G2TA 3RK6A 4NIKA 3W9FA 1OWPA 1Y6IA 1PC2A 3T5VA 3APCA 4MBGA 1A17A 3D9MA 1OCZE 1NL4A 4M3OA 3BEEA 3FEXA 1UOHA 2J4DA 1IQRA 3FUJA 2QFCA 2P9KG 2LNIA 1FT1A 4LNBA 4JA7A 3CVPA 2QY7A 3R7RA 3V79K 2V5FA 4AY5A 2V4LA 1OXJA 3SF4A 2Y4UA 5AAOA 4AOFA 3CK8A 4BTBA 3HHMA 2B6CA 4BY6A 3JYSA 5BV1A 3MV3B 4J8SA 2P9UG 2DYRE 2DCPA 3SFZA 4I6JA 3QC1A 4NACA 3UM1A 1K8KG 1IYGA 5FWQA 3QAQA 5JMND 1MX4A 1SQMA 3RRMB 2MHKA 3Q47B 4DI3A 3D3MA 3O48A 1FCHA 4GAAA 4GMJA 3VTXA 4EZLA 1ZU2A 3HRAA 4U63A 3C72A 3ZIMA 5LP0A 4ILIA 3PUKA 5KCMA 4ME2A 3ABKE 4MS6A 4U0UA 4GPKA 4OVUA 3BU8A 2RD0A 2CHZA 3SY2A 2CFZA 1WG0A 4O60A 4A1GA 5HS0A 4B93B 4I9EA 1TNOA 3FUFA 3HYMB 4AEZC 5CRVA 3JQ1A 1PAQA 5ARGA 1N4SA 1H2TC 1UN8A 3HXBA 3K9IA 4UUCA 3TL5A 3LJ3A 5FZQA 4G26A 5KJNA 3LY8A 3EHRA 5A23A 3D9PA 4YDEA 2IOLA 3TWUA 3RU0A 3CVUA 3ZN3A 2J09A 3DRAA 4ANWA 2ETAA 4LCTA 4RG9A 2XPZA 3HXEA 3CHSA 5AYWD 3FDHA 4Q69A 1OY3D 2WMNA 2XZTG 4HBDA 4APFA 3HIZA 2V8SE 4F6RD 3R9MA 4OYSA 4RVBA 3ZXSA 3FUKA 4CT0A 2M63A 2X3MA 5ENTD 3E37A 4UWKA 1KLXA 4KVOA 1O5MA 3ULYA 2LAIA 5LCWJ 1MZCA 2DBAA 2CG3A 4N3CA 4ANVA 3AS5A 4GZCA 5FIOA 2EIME 4U8HA 3Q73A 3F6QA 3IKOB 1BU9A 3CVQA 1L5JA 3B7RL 4YVOA 3LEWA 3OXFA 4LEUA 3B7BA 3CV0A 3QB2A 4ANUA 5AIJA 3PZ3A 3QWWA 3V31A 3L82A 3PDNA 1VDYA 4D10C 4N3BA 4RLYA 1H19A 3HXCA 3ZGQA 2XQ0A 2Y4TA 4BX9A 3ENEA 1JCQA 4CCAA 5JJ6A 2P9LG 2R5SA 3DSVA 2PQRA 4JEUA 3B13A 3DBSA 3VLDA 5HQ8A 2XS8A 2L0IA 2IO3C 3KS2A 4JXTA 4L7TA 1JCSA 2MOWA 3IV0A 2CG2A 4N3AA 5ENQD 4HQDA 2XCCA 2VJ8A 5LFAA 3PZDA 1KZPA 3Q79A 3LXUX 2KBXA 2YHCA 2C2LA 2LUHA 2WQHA 4XEIG 4CZ2D 1H6PA 3CHOA 1DNPA 1YA0A 2C0MA 3QJZA 3CHMA 4FLHA 1WAO1 2QZAA 2HM8A 2WVIA 3ASNE 2QC9A 3Q9NC 2BEDA 1H0AA 4BFRA 5AARA 2GRPB 1DCQA 3CQCB 4APOA 2VSYA 4ACLA 4WNGA 4PDXA 3I3NA 5AQ9A 5BW8C 4FP7A 4CT4A 5C1DA 1N54A 3HDXA 3AG4E 4JA9A 4A1SA 4MKTA 2ILRA 2FULA 3ISMC 3KSLA 1W3BA 1EPUA 5CEDB 3SZ7A 3SBSA 1OWOA 3PZ4A 4AY6A 5BXUA 4B94A 5FT9A 3PRZA 3UKRG 2L9BA 3I5PA 4G25A 5FQ8A 3ZU7B 2WXKA 5ANLA 2EINE 4IULA 2RG8A 4GYYA 4FHJA 4HOTA 2UY1A 2IY0C 1LF8A 2FO1E 1OWMA 4EQFA 5G55A 2WXMA 1K1BA 3FU6A 4MRUA 1E8XA 2A5UA 2BTDA 2UY1B 4GCOA 4BWRA 1KZOA 3PVLA 4I9CA 3T9KA 3SFYA 4EPZA 2F37A 3ZXPA 3E32A 3KEZA 4BETA 4TXPA 2ETCA 5FQ7A 2GROB 3E4BA 2I2OA 3D9IA 3CSTA 2EILE 2XPYA 2KXPC 3FTVA 3FP3A 4L2YA 5LX8A 4YVQC 3EIJA 4ABNA 4OVVA 3NZUA 1U2VG 2MYOA 4XKBA 3PUJA 2OEWA 5CMWA 1AP7A 3O4ZA 4JEHA 4NURA 4ZHBA 5ITZF 4B89A 2V0PA 3QOUA 3FTXA 5HKPA 2WPVA 1QBQA 4TUMA 4U0ZA 3ML9A 1SZ9A 5EX3A 3CVYA 3Q7AA 2CFUA 3D9LA 3D9JA 2X6JA 4AP2A 1O1RA 4G8LA 4QQIA 1EDUA 1OCOE 2IU1A 1INZA 2AWIA 1H2VC 4Z68A 3E33A 2IONA 3HG0D 4GZ5A 2X6IA 1WY6A 1OUVA 1K3ZD 1WDYA 1JPLA 3TXMA 4J6IA 4PUCA 4GTOA 2FI7A 1H6OA 1QNFA 2R03A 3D9NA 5FTPA 3SHFA 4MLPA 3MKRA 3FHEA 5CECB 1S63A 2OVFA 3EHMA 2YHEA 5B1BE 2WM9A 2VGEA 2IFUA 2VYIA 1SVXA 4E85A 5G04J 3CSFA 3CQGB 1N94A 4PS7A 3ASFA 3D9HA 5KWDA 1IHGA 1KPSB 4DX6D 1MYOA 3FUHA 5H7PA 2P2CP 3FULA 2PM7A 3ASDA 4DRXE 3L08A 3AS8A 4U07A 4ILHB 3TJPA 4V3IA 4KYOB 4E6HA 1NP7A 3I4GA 4KVMA 2J4BA 2P58C 4CYMD 3TWXA 2IJGX 2OEVA 4TRQA 3FTZA 3OXGA 4G1TA 4JPSA 4JB8P 3T8KA 1FT2A 4WNFA 5CERB 4O6FA 4GZDA 1BLXB 2ZU6B 2VQ2A 2GRMA 4N2SA 1S70B 5FINA 4A55A 5T4YA 4JD2G 2LXMA 5J08A 1EYHA 5C2YA 4LRZA 4Y6CA 4ACKA 2HYZA 1HO8A 3RO2A 3RRUA 3ZYKA 3V30A 3Q5MA 4GA1A 4EECA 2XGOA 2X6FA 1HE8A 1D8DA 2P9NG 3FH5A 1N11A 1E8ZA 4H7YA 3ULQA 3NB2A 5EIDA 5ANRA 4CRWA 2IF4A 1B89A 5T8IA 1E90A 3L16A 3SFXA 4WAFA 3UX4A 3OAWA 2HO1A 3ML8A 3N71A 3FUEA 3LPZA 3RAUA 3DSXA 2WXRA 2P9SG 2I1KA 3UM3A 1QZ2A 1MJ0A 3L17A 4O1PA 1N4RA 4ATGA 3ZHEA 5HRYA 4GTTA 1K1AA 2PM6A 4OAVB 4FJYA 1U3DA 3ZHEB 4G23A 3UXGA 4A3VA 1IKND 4UWHA 4HI8A 4XX5A 3SI5A 4HRMB 3CVXA 1TJCA 3NOGD 5KJMA 4BTAA 1FVHA 1NFIE 4JL0A 2ZGDA 4FC8A 5FQ4A 4O1OA 3DSWA 5KJKA 4HOQA 4U8VD 4KBQA 4URKA 3JQ0A 1FPPA 2J9QA 3RRNB 3L13A 4B8AA 2R2LA 3TWTA 4N5CA 2YQ8A 3FTUA 5CRUA 5ENRD 4UI9J 3V2OA 2WMOA 4JVSA 2DIWA 3PEUB 1TNUA 1LTXA 5FQ6A 2LO6A 4GA0A 4EZKA 4I17A 3NF1A 4L9PA 2BUGA 1RZ4A 5G04C 3TWQA 3UT8A 4U04A 1TJFA 1HG2A 5CCMA 2XEEA 1OWLA 3I4RB 4TXQA 5EYPF 4GTVA 1N95A 4KZCA 3ZUVB 3MYVA 1HFAA 3FUDA 4DX1A 4DUIA 2IEJA 2A5EA 4UQZA 3FTYA 3X2QE 3IEGA 4NQ0A 3LJNA 3UM2A 3IXEA 3HXDA 5EYLA 2VGXA 3UQ3A 3ZW3A 3UM0A 4DLOA 2NXPA 4U7EB 5AQ7A 2VGXB 5BUZA 3UT4A 1UG3A 3PNTB 2JABA 4C9BB 2FEZA 3ONLA 2R05A 3QK0A 3PREA 1ELKA 3AU4A 3VLEA 3JXIA 1LD7A 4JW1A 4UWLA 3G2VA 3UTMA 1HF8A 3IHYA 5ENSD 5KNHD 2P9PG 4NRHB 3QARA 3KAEA 1Q2ZA 3DXKG 1SA4A 5CEAA 2L6JA 4AM9A 2E2EA 2HR2A 3EJNA 4G24A 3Q4AB 4M7CA 3TG4A 1SW6A 2J07A 3PH0C 3P2BA 4OAUC 3JUEA 3HXFA 2VSNA 5G05J 2AXUA 2VSXE 1IXVA 2EIKE 4AVXA 4Q94A 2VGYA 1HG5A 1DVPA 1HH8A 1UJKA 3OTNA 5T3RA 3TWSA 1ELRA 4DK5A 4IN3B 2Q7FA 4FJZA 4HB5A 3TG5A 3TAXA 3LDZA 3JUIA 4DLQA 3Q49B 3CEQA 1OCCE 2RFAA 5B1AE 4U0SA 1S0PA 3IBEA 4BSZB 2MRIA 2R02A 2UWJG 2I6HA 3DSSA 2PNNA 3CK9A 5EILA 4CDMA 3CVWA 4XKCA 5LOZA 2ZISA 4BT8A 2XRZA 3R7QA 5JHAA 2WXGA 3UT7A 1UW4B 3FU3A 2OCCE 3MCXA 4I2WA 1E7VA 1QQEA 3QNKA 2WXPA 2B0OE 5CHEE 2BKKB 3FU0A 2X38A 3LCAA 4TUUA 4HNAD 4UI9K 3SD5A 5AQAA 2L6BA 2WXNA 1NA0A 5D66A 3ZYLA 4K0RA 3UUXA 1BD8A 3DXMG 3ULEG 4YDOA 5LCWC 4DI4A 3BG1B 5EN5D 2LSVA 4WWNA 4K5BA 1TN7A 3G2SA 4L2LA 3TGOA 3L22A 2L0TB 2R17C 2OVBA 1WM5A 3DEOA 1TNBA 4UQYA 3JXJA 3GYZA 2NYJA 3DPYA 5CBOA 1D8EA 2JLBA 4TXRA 2CHWA 3MKQA 1BI7B 3FTWA 3D9OA 4Y6WA 3G2WA 4I6GA 2H6GA 4HRNA 1N4QA 3HVEA 4BT9A 2J49A 3MKQB 4EBAA 4UQXA 1TR4A 3CHRA 2QYJA 1YCSB 3W9GA 2WXJA 3L6AA 3BQOA 4GTMA 3HVEB 4AV7A 4U96D 1ELWA 1OCRE 2X6HA 1MX6A 3SQVA 3NQPA 2GGFA 3B7SA 2RFMA 5M72A 5EDSA 4C0EA 4DX7D 2GRQB 3FWVA 1DCEA 3S7JA 4J8DA 5EX0A 1BPOA 3KEAA 3ESLA 2XENA 4HRLA 3ABME 1JWGA 2WQ6A 3ASOE 4YDWA 2AXVA 3WG7E 1OWNA 3SNXA 4XZ4A 1Z3XA 4GTSA 5ENOD 3PEVB 2GRNB 1G3NB 2I1JA 3URZA 1YMPA 3KD7A 1ZBPA 3J5PA 4CDRA 4GMRA 3OXLA 3FTSA 5BT1A 4EHMA 1FVFA 4WWOA 5JHBA 3AJIA 2C0LA 5EIBE 4JHKA 4RSYA 3DWLG 4I2ZA 3VTYA 4YDYA 3Q75A 4GTRA 3FY4A 2KATA 3QDNA 4FA6A 4HOSA 4A63B 3C5RA 1HU3A 2FF4A 3MA5A 4XI0A 3UIOC 1JCRA 2GRLA 3U66A 3R9AB 5CMYA 2J8SD 4Q96A 3CVVA 4RQIA 3NAWA 1KT0A 2Y0BG 1H2UA 2GRRB 3APFA 4KXKB 3GZ2A 3C3QA 4J8EA 4AIFA 3LS8A 2PZIA 3AAAC 3CKBA 2XS1A 3CHPA 5AENA 3PZ2A 3U9WA 5FJYA 4GPMA 2BF0X 3NOCD 4J7WA 1UN9A 5BNWA 2VTBA 3RKVA 1MQSA 2F8XK 5BPPA 3UPVA 3AG3E 1MX2A 2VTBB 3ZYQA 2KM4A 4L23A 2JEKA 5KNGA 2AJAA 3LKUA 1KT1A 4HLLA 2A4ZA 1Z5SC 3U64A 4CEMA 3E30A 1PY1A 4L1BA 3EIQC 3Q15A 3FUNA 3CVLA 4K5CA 5AN8A 2QYUA 3TXNA 2ONDA 2Y3AA 3AG1E 4J8YA 3TWWA 3CVNA 4CDNA 2XHEA 2ZGGA 1N0RA 3MX3A 2KCLA 4ILGA 4WNEA 2XZDG 1O1TA 4JHJA 4LERA 4FULA 4GU5A 2HE0A 2XRYA 4GZ6A 3ZEFA 4LG6A 4N5QA 3IHVA 3FFLA 3J5QB 5D0QD 3EHQA 2LSUA 3EUVA 2H6FA 2X6KA 4JC8A 1IHBA 4ATZD 5FZSA 3ONKA 5JJTA 4F53A 3LY7A 3JCKC 1RW2A 3EU5A 3QKYA 4WNDA 3DEPA 3UIPC 3U4TA 3L9TA 1SA5A 3P1UA 2KCKA 4GCNA 3FUMA 1GW6A 3DPDA 4FADA 4BX8A 3CGHA 3AS4A 3S2AA 2IOSA 4C0MA 1V54E 1D9SA 3LYAA 4U8YD 3CKCA 5JA4D 3GZ1A 2V5QC 3ZPJA 2WXOA 2XGSA 1YYHA 1NA3A 2P9IG 5A6CA 2LAHA 3AG2E 2IQCA 3CHQA 1Y8MA 2YNQA 1LD8A 1E7UA 1TN8A 4I1OB 5KJLA 1DC2A 4KMOA 4LSZE 5DIZA 2DZOA 4HVBA 2XPIA 3MJWA 5G2NA 3MEKA 5BXOA 4K03A 4AXHA 3ZVVA 3CR3A 1TNYA 2XEVA 5AJLA 3ZNGA 3SBTB 3UINC 3S7FA 4DX5D 1V55E 1AWCB 4DJAA 5HI7A 1IQUA 4I1MA 4P29A 3DSTA 4BESA 1Z3YA 5ENNA 3ABLE 5KBAA 1X5BA 4FLBA 3ASGA 2WXIA 2WQ7A 4K5AB 4GB9A 4PS8A 2RKKA 4GTPA 2DYSE 2J08A 4U95D 5CBNA 1SZAA 3ZKJA 3KSQA 1HS6A 4N39A 5ARFA 3ASHA 4LUNU 3PS6A 3L54A 3ZFWA 4GMLA 4HXIA 4UWGA 1TN6A 4XIFA 4G11A 5BV0A 2WB2A 4CGVA 1XGWA 5A7DB 3MV2B 3QWPA 4J0UA 3T5XA 4XE0A 3MZLB 1H6KA 2H6HA 3C3OA 4HORA 4EBAG 3T8MA 4HI9A 5B3SE 2ETBA 3EDTB 4F3VA 4IYPA 1ZB1A 1TYQG 3BG0B 2KC7A 4FU3A 3ZRHA 3DSUA 3Q9UC 3B95A 3LVRE 4A3TA 4UWFA 4EZJA 4B8CB 1S64A 3VLFA 2IO2C 2ZIRA 4GYWA 3MGBA 1N52A 4GTQA 5IY5E 4TV3A 4FHKA 1N0QA 4GYOA 3C3RA 1JWFA 3G2UA 2XCBA 2F8YA 1U3CA 4C48B 3SO8A 2YINA 3B7TA 2BKGA 1MHQA 3FH7A 4HOUA 1E8WA 3C98A 3PNLB 4YNDA 4F1PA 1X81A 3RJVA 4I1AA 4ZFHA 2DWZA 2Y69E 3ESKA 3BUAA 3NZSA 4G2VA 4QFVA 2XGMA 4HS2A 4IRUA 5D2MC 4XI9A 2KCVA 2H6IA 2NSZA 4N2QA 2WXHA 5JJ7A 1TNZA 4I43A 1HZ4A 3QWVA 1JUQA 3FH8A 1NZNA 4HFGA 5DBKA 4F1SA 4LNGA 4B0ZA 5FZRA 3RIBA 4GA2A
chains in the Genus database with same CATH topology
3VTYA 2VJ8A 4YVOA 2PQNA 1QZ2A 5LFAA 3PZDA 3L17A 3FY4A 2FBNA 3GZSA 3LXUX 2KATA 4ATGA 4UI9C 1UJJA 3QDNA 3ZHEA 3FUIA 3APDA 4FA6A 2YHCA 4HOSA 3CIAA 4JHRA 2C2LA 2PM6A 2E0IA 4I6EA 2WQHA 2WXFA 1HU3A 2FF4A 4FJYA 4ANXA 1U3DA 3MA5A 3EHNA 3CHOA 3ZHEB 1DNPA 4G23A 1YA0A 2AW6A 4A3VA 2C0MA 4XI0A 3QJZA 2GW1A 3PE4A 3CHMA 4UWHA 4FLHA 2GRLA 3U66A 4CGWA 4XX5A 2VSOE 3SI5A 2WXLA 3CVXA 1EF1C 1TJCA 1WAO1 3FEYA 5KJMA 4PH4B 5CMYA 4Q96A 3R9AB 4BTAA 1FVHA 4JL0A 3CVVA 2HM8A 4FC8A 5FQ4A 1KT0A 3SGHA 4PS3A 5KJKA 4HOQA 3S7BA 1E8YA 2WVIA 1H2UA 3CLJA 2AXZA 4KBQA 1HXIA 3APFA 1Z6TA 4URKA 4W9RA 3JQ0A 1H0AA 4KXKB 2J9QA 3GZ2A 3RRNB 3L13A 4J8EA 4BFRA 4AIFA 3LS8A 3CQCB 1HX8A 4APOA 2VSYA 4JZYA 4ACLA 3CK7A 2PZIA 4GZ3A 4WNGA 3GW4A 4B8AA 3LVQE 4PDXA 5AJDA 5CCLA 3CKBA 3FU5A 3I3NA 5BW8C 4FP7A 4N5CA 2YQ8A 3FTUA 4CT4A 3CHPA 3TGOA 5AENA 4UI9J 5C1DA 2WMOA 3U9WA 4JVSA 1N54A 2DIWA 3PEUB 2OV8A 3HDXA 5FJYA 2NC9A 2KZTA 5FQ6A 2BF0X 2LO6A 4GA0A 4JA9A 4A1SA 4EZKA 4I17A 4AJWA 3NF1A 4MKTA 2I9CA 4RG6A 2BUGA 2ILRA 1UN9A 2FULA 5BNWA 2VTBA 5G04C 3RKVA 1W3BA 4R7LA 1MQSA 1EPUA 3UT8A 2FO7A 2KZTB 4U04A 1TJFA 3D9KA 5BPPA 3UPVA 1HG2A 3SZ7A 5CCMA 3SBSA 2PL2A 1OWOA 2VTBB 3ZYQA 1OWLA 3I4RB 2KM4A 4L23A 3RO3A 3ZYMA 4AY6A 1P5QA 2JEKA 5D0OD 3LKUA 5E75A 1KT1A 4B94A 5FT9A 3PRZA 4KZCA 3B7UX 2CHXA 2A4ZA 3U64A 2L9BA 4CEMA 3MYVA 1HFAA 3I5PA 1PY1A 3FUDA 3U3WA 4J8FA 2R59A 3LY9A 4G25A 5FQ8A 4DPRA 4L1BA 2WXKA 4WWPA 5ANLA 1XNFA 3EIQC 3UMVA 3Q15A 4UQZA 3FUNA 4HLEA 5EKQD 5E76A 3CVLA 1E96B 4KZ0A 4IULA 3FTYA 4H7XA 3IEGA 4BSXA 3AU5A 3TXNA 2ONDA 4KT6B 4NQ0A 2RG8A 2OOEA 2Y3AA 4GYYA 2AVPA 3CVNA 4FHJA 2VGXA 4CDNA 2XHEA 4F7AA 5J90A 3UQ3A 3MX3A 2EQXA 3ZW3A 4HOTA 2WXQA 2UY1A 3PE3A 5G05C 2KCLA 4ILGA 1LF8A 1TEZA 4WUYA 4WNEA 4DLOA 3WXXA 1OWMA 3S7DA 2NXPA 4EQFA 4JHJA 2WXMA 3FU6A 4LERA 4FULA 3G2TA 4GU5A 5G55A 4MRUA 2VGXB 2XRYA 5BUZA 4GZ6A 1E8XA 2A5UA 2BTDA 2UY1B 3RK6A 1UG3A 4GCOA 3UT4A 3ZEFA 3PNTB 3IHVA 4BWRA 3FFLA 3PVLA 4I9CA 1OWPA 4C9BB 2FEZA 5D0QD 3ONLA 4EPZA 1Y6IA 2LSUA 1PC2A 3KEZA 3T5VA 3APCA 3QK0A 5FZRA 3PREA 1A17A 1ELKA 3AU4A 3VLEA 2X6KA 4JW1A 4JC8A 4UWLA 3D9MA 5FZSA 3G2VA 5FQ7A 3ONKA 1HF8A 3IHYA 5JJTA 3E4BA 2I2OA 4F53A 4M3OA 3LY7A 3D9IA 3CSTA 4NRHB 3QARA 3BEEA 3JCKC 3KAEA 2XPYA 3FEXA 3QKYA 3FTVA 4WNDA 2J4DA 1IQRA 3FUJA 2QFCA 3FP3A 2L6JA 4L2YA 5LX8A 2LNIA 4AM9A 4YVQC 3EIJA 2E2EA 2HR2A 3EJNA 4G24A 3U4TA 3Q4AB 4JA7A 4ABNA 3TG4A 2J07A 4OVVA 3PH0C 3CVPA 3NZUA 3P1UA 2QY7A 3P2BA 3R7RA 2KCKA 4GCNA 4XKBA 3PUJA 3FUMA 5CMWA 1GW6A 2V5FA 4AY5A 2V4LA 2VSNA 5G05J 2AXUA 3DPDA 3O4ZA 4JEHA 3SF4A 2VSXE 4FADA 4BX8A 3CGHA 3AS4A 2Y4UA 4NURA 3S2AA 4AOFA 3CK8A 4B89A 2V0PA 4AVXA 3QOUA 3FTXA 2IOSA 4Q94A 4C0MA 2WPVA 4BTBA 3HHMA 4U0ZA 2VGYA 3LYAA 4BY6A 1HG5A 3JYSA 1DVPA 1HH8A 1UJKA 5BV1A 3ML9A 3MV3B 1SZ9A 3OTNA 3CKCA 5EX3A 5T3RA 4J8SA 3GZ1A 3CVYA 4DK5A 4IN3B 2DCPA 2Q7FA 4FJZA 3TAXA 3SFZA 3TG5A 3ZPJA 4I6JA 3LDZA 3JUIA 3QC1A 2CFUA 2WXOA 3D9LA 2XGSA 4DLQA 3D9JA 4NACA 2X6JA 3Q49B 3CEQA 1NA3A 4AP2A 1IYGA 5FWQA 3QAQA 4U0SA 5A6CA 2LAHA 1S0PA 3IBEA 1SQMA 3RRMB 2MHKA 3Q47B 1EDUA 1INZA 2IU1A 2IQCA 2MRIA 2AWIA 3CHQA 4DI3A 1H2VC 1Y8MA 3D3MA 2UWJG 2IONA 2YNQA 2I6HA 4GZ5A 2X6IA 3O48A 1FCHA 1OUVA 1E7UA 1WY6A 4GAAA 4I1OB 5KJLA 4GMJA 1JPLA 3TXMA 4KMOA 5DIZA 4HVBA 2XPIA 3MJWA 4J6IA 3CK9A 4PUCA 2FI7A 4CDMA 3CVWA 4XKCA 5G2NA 4EECA 1QNFA 3MEKA 3D9NA 4K03A 4AXHA 5LOZA 3ZVVA 3VTXA 3CR3A 2XEVA 5FTPA 4BT8A 3SHFA 4EZLA 1ZU2A 2XRZA 3R7QA 5JHAA 4MLPA 5AJLA 2WXGA 4U63A 1UW4B 3SBTB 3MKRA 3UT7A 3FHEA 3FU3A 3ZIMA 5LP0A 3S7FA 4ILIA 3PUKA 2OVFA 5KCMA 4ME2A 4MS6A 3EHMA 4U0UA 2YHEA 3MCXA 1E7VA 1QQEA 2WM9A 4I2WA 5HI7A 4DJAA 3QNKA 4GPKA 1IQUA 2WXPA 4I1MA 2IFUA 4P29A 4OVUA 5CHEE 1Z3YA 3FU0A 2X38A 2RD0A 2CHZA 2VYIA 3LCAA 5ENNA 2CFZA 4A1GA 1X5BA 4FLBA 4E85A 4TUUA 5G04J 3ASGA 3CSFA 4I9EA 3CQGB 2WXIA 4UI9K 3SD5A 4PS7A 2WQ7A 3FUFA 3HYMB 4AEZC 3ASFA 2WXNA 1NA0A 4GB9A 3JQ1A 4PS8A 1PAQA 5ARGA 3ZYLA 4K0RA 3UUXA 1H2TC 1UN8A 3K9IA 5LCWC 1IHGA 2J08A 3TL5A 3LJ3A 3FUHA 4G26A 5FZQA 5KJNA 4DI4A 3BG1B 1SZAA 3FULA 3LY8A 2LSVA 2PM7A 4I2ZA 1HS6A 4N39A 4WWNA 3ASDA 5A23A 3L08A 3G2SA 4L2LA 3ASHA 3AS8A 3D9PA 3L22A 4ILHB 2L0TB 2R17C 4U07A 5ARFA 2IOLA 3TJPA 4LUNU 4V3IA 3RU0A 3CVUA 4KYOB 2OVBA 3PS6A 1WM5A 2J09A 3ZN3A 4E6HA 1NP7A 3L54A 4ANWA 3I4GA 4KVMA 2J4BA 2P58C 4LCTA 3ZFWA 4GMLA 4HXIA 4UWGA 4RG9A 4G11A 4XIFA 5BV0A 2WB2A 2XPZA 4UQYA 3CHSA 3GYZA 5AYWD 3FDHA 4Q69A 4CGVA 1XGWA 2WMNA 5A7DB 2IJGX 3MV2B 4APFA 3QWPA 4J0UA 4TRQA 3T5XA 3FTZA 3HIZA 2JLBA 2V8SE 3OXGA 4OYSA 4RVBA 4XE0A 2CHWA 3MZLB 3ZXSA 3MKQA 4G1TA 4JPSA 3FUKA 4CT0A 2M63A 2X3MA 1H6KA 4WNFA 4O6FA 3FTWA 3D9OA 4Y6WA 4GZDA 4HORA 3G2WA 4EBAG 4I6GA 3T8MA 4UWKA 3HVEA 1KLXA 4BT9A 2J49A 3MKQB 4EBAA 3EDTB 4F3VA 4KVOA 2ZU6B 4IYPA 4UQXA 2LAIA 3BG0B 3CHRA 2KC7A 4FU3A 2WXJA 3L6AA 2VQ2A 5LCWJ 2DBAA 2CG3A 3HVEB 2GRMA 4N3CA 4N2SA 4ANVA 4AV7A 4A55A 5T4YA 3ZRHA 3AS5A 4GZCA 1ELWA 2X6HA 5J08A 4U8HA 3NQPA 2GGFA 3IKOB 3B7SA 1EYHA 5C2YA 5M72A 5EDSA 4LRZA 3LVRE 4A3TA 4UWFA 4Y6CA 3CVQA 4ACKA 4B8CB 4C0EA 4EZJA 3FWVA 1L5JA 3VLFA 3B7RL 3S7JA 3MGBA 1N52A 2HYZA 3LEWA 1HO8A 3OXFA 3CV0A 4GYWA 3QB2A 4J8DA 4LEUA 4ANUA 4TV3A 5EX0A 1BPOA 4FHKA 3RO2A 3RRUA 4GYOA 3ESLA 1JWFA 3QWWA 3G2UA 5AIJA 2XCBA 1JWGA 2WQ6A 3ZYKA 1U3CA 3PDNA 2AXVA 1VDYA 4D10C 2YINA 1OWNA 3B7TA 3Q5MA 4GA1A 4XZ4A 3SNXA 2XGOA 3FH7A 1MHQA 4HOUA 2X6FA 4N3BA 1Z3XA 1E8WA 3C98A 3PNLB 3PEVB 4YNDA 1H19A 1HE8A 3RJVA 4I1AA 3ZGQA 2XQ0A 2Y4TA 3FH5A 2I1JA 4BX9A 3URZA 3ENEA 3ESKA 3KD7A 1E8ZA 4CCAA 3NZSA 4G2VA 5JJ6A 1ZBPA 4H7YA 4QFVA 2XGMA 4HS2A 4IRUA 3ULQA 4XI9A 2R5SA 5ANRA 2PQRA 4CRWA 2IF4A 1B89A 4JEUA 2KCVA 3B13A 5T8IA 3DBSA 3VLDA 5HQ8A 1E90A 2NSZA 4N2QA 2L0IA 2WXHA 3L16A 4CDRA 3OXLA 3FTSA 5JJ7A 4I43A 3KS2A 4JXTA 5BT1A 4WAFA 1HZ4A 3QWVA 1FVFA 4WWOA 3UX4A 5JHBA 2C0LA 3OAWA 1JUQA 2HO1A 4L7TA 3ML8A 3N71A 4JHKA 3FUEA 3LPZA 2MOWA 3IV0A 3FH8A 2CG2A 4N3AA 1NZNA 4HFGA 4RSYA 5DBKA 2XCCA 4F1SA 2WXRA 4B0ZA 2I1KA 1ELRA 3RIBA 4GA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTY A;  2PQN A;  1QZ2 A;  2FBN A;  2KAT A;  4UI9 C;  3QDN A;  3ZHE A;  4HOS A;  2YHC A;  4JHR A;  2C2L A;  2WQH A;  2FF4 A;  3MA5 A;  3ZHE B;  4G23 A;  1YA0 A;  2C0M A;  4XI0 A;  2GW1 A;  3PE4 A;  4CGW A;  1TJC A;  1WAO 1;  5KJM A;  3R9A B;  4BTA A;  4JL0 A;  1KT0 A;  5KJK A;  4HOQ A;  3S7B A;  4KBQ A;  1HXI A;  4W9R A;  4KXK B;  2J9Q A;  3GZ2 A;  4J8E A;  4AIF A;  4APO A;  2VSY A;  3CK7 A;  2PZI A;  4GZ3 A;  4WNG A;  3GW4 A;  5CCL A;  3CKB A;  5BW8 C;  4N5C A;  2YQ8 A;  4UI9 J;  5C1D A;  5FJY A;  2NC9 A;  4JA9 A;  4GA0 A;  4A1S A;  4I17 A;  3NF1 A;  4RG6 A;  2BUG A;  5BNW A;  5G04 C;  3RKV A;  1W3B A;  2FO7 A;  4U04 A;  3UPV A;  3SZ7 A;  5CCM A;  2PL2 A;  3RO3 A;  4AY6 A;  1P5Q A;  5D0O D;  3LKU A;  1KT1 A;  4B94 A;  5FT9 A;  3U3W A;  4J8F A;  3LY9 A;  4G25 A;  1XNF A;  3Q15 A;  4UQZ A;  5EKQ D;  3CVL A;  1E96 B;  4H7X A;  3IEG A;  2OND A;  4NQ0 A;  2OOE A;  4GYY A;  2AVP A;  3CVN A;  2VGX A;  3UQ3 A;  4HOT A;  2UY1 A;  3PE3 A;  5G05 C;  2KCL A;  4WUY A;  4WNE A;  3WXX A;  3S7D A;  4EQF A;  2VGX B;  4GZ6 A;  2UY1 B;  4GCO A;  4BWR A;  3FFL A;  4I9C A;  2FEZ A;  5D0Q D;  2LSU A;  1PC2 A;  1A17 A;  5FZS A;  5JJT A;  3E4B A;  3LY7 A;  4NRH B;  3BEE A;  3KAE A;  3QKY A;  4WND A;  2QFC A;  3FP3 A;  2L6J A;  2LNI A;  4AM9 A;  4YVQ C;  2E2E A;  2HR2 A;  4G24 A;  3U4T A;  3Q4A B;  4JA7 A;  4ABN A;  3TG4 A;  3CVP A;  2KCK A;  4GCN A;  2V5F A;  4AY5 A;  2VSN A;  5G05 J;  3SF4 A;  3AS4 A;  2Y4U A;  3CK8 A;  3QOU A;  2WPV A;  4BTB A;  4U0Z A;  2VGY A;  3LYA A;  3JYS A;  1HH8 A;  3MV3 B;  3CKC A;  5EX3 A;  1ELR A;  3GZ1 A;  4IN3 B;  3TAX A;  2Q7F A;  3TG5 A;  3ZPJ A;  2XGS A;  3Q49 B;  3CEQ A;  1NA3 A;  1IYG A;  4U0S A;  5A6C A;  2MHK A;  3Q47 B;  1Y8M A;  2UWJ G;  2I6H A;  4GZ5 A;  3O48 A;  1FCH A;  1OUV A;  5KJL A;  5DIZ A;  2XPI A;  3CK9 A;  2FI7 A;  3MEK A;  3VTX A;  2XEV A;  5FTP A;  4BT8 A;  1ZU2 A;  3MKR A;  3S7F A;  4ME2 A;  4U0U A;  4GPK A;  4I2W A;  1QQE A;  5HI7 A;  2IFU A;  5CHE E;  3LCA A;  2VYI A;  5G04 J;  3ASG A;  4I9E A;  4UI9 K;  3HYM B;  3ASF A;  1NA0 A;  5ARG A;  3UUX A;  3K9I A;  5LCW C;  1IHG A;  5FZQ A;  4G26 A;  5KJN A;  3LY8 A;  2LSV A;  4N39 A;  3ASD A;  3ASH A;  3AS8 A;  4U07 A;  5ARF A;  3TGO A;  3RU0 A;  4KYO B;  3ZN3 A;  1WM5 A;  2P58 C;  3ZFW A;  4RG9 A;  4XIF A;  4UQY A;  3GYZ A;  5AYW D;  4CGV A;  5A7D B;  3MV2 B;  3QWP A;  4J0U A;  2JLB A;  3OXG A;  4G1T A;  4WNF A;  4O6F A;  4Y6W A;  4HOR A;  1KLX A;  4BT9 A;  3EDT B;  4F3V A;  4UQX A;  2KC7 A;  5LCW J;  2VQ2 A;  2DBA A;  4N3C A;  4N2S A;  3AS5 A;  1ELW A;  5M72 A;  4Y6C A;  3CVQ A;  3FWV A;  3S7J A;  4GYW A;  2HYZ A;  4J8D A;  3OXF A;  4LEU A;  4YVO A;  3CV0 A;  5EX0 A;  3RO2 A;  4GYO A;  3QWW A;  2XCB A;  3PDN A;  3Q5M A;  4GA1 A;  2XGO A;  4HOU A;  4N3B A;  4YND A;  3RJV A;  4I1A A;  3ZGQ A;  2Y4T A;  3URZ A;  3ESK A;  3KD7 A;  4G2V A;  5JJ6 A;  1ZBP A;  4H7Y A;  2XGM A;  3ULQ A;  4XI9 A;  2R5S A;  2PQR A;  2IF4 A;  1B89 A;  2KCV A;  5HQ8 A;  4N2Q A;  4CDR A;  3OXL A;  5JJ7 A;  3KS2 A;  5BT1 A;  1HZ4 A;  3QWV A;  2C0L A;  2HO1 A;  3N71 A;  3LPZ A;  4N3A A;  1NZN A;  5DBK A;  2XCC A;  4I2Z A;  5FZR A;  3RIB A;  4GA2 A; 
#chains in the Genus database with same CATH topology
 2PQN A;  5ENP D;  2FBN A;  3GZS A;  4UI9 C;  1UJJ A;  3FUI A;  3APD A;  3CIA A;  4JHR A;  4BEP A;  2E0I A;  4I6E A;  2WXF A;  4ANX A;  3EHN A;  2XEH A;  2AW6 A;  4BER A;  2GW1 A;  3PE4 A;  2Y1L E;  2F0Y A;  4CGW A;  2VSO E;  2WXL A;  1EF1 C;  3FEY A;  4PH4 B;  3SGH A;  4PS3 A;  3S7B A;  1E8Y A;  3PZ1 A;  3V2X A;  3TWV A;  3CLJ A;  2AXZ A;  5AQB A;  1HXI A;  2LXL A;  1Z6T A;  3UI2 A;  4W9R A;  1HX8 A;  1N4P A;  1OT8 A;  3CK7 A;  4GZ3 A;  4JZY A;  3GW4 A;  3LVQ E;  3Q7F A;  5AJD A;  2DZN A;  5CCL A;  1A5E A;  3FU5 A;  2ZXW E;  3NBN B;  3EU9 A;  2OV8 A;  2NC9 A;  2KZT A;  3TWR A;  4AJW A;  2I9C A;  4RG6 A;  1O1S A;  2V4H C;  2EIJ E;  4R7L A;  2FO7 A;  2KZT B;  3D9K A;  1NI1 A;  1N9A A;  2PL2 A;  3E34 A;  3RO3 A;  3ZYM A;  3RSE G;  1P5Q A;  4X8Q A;  5D0O D;  4LNU D;  5E75 A;  3B7U X;  2CHX A;  4DX2 A;  4G8K A;  3U3W A;  4J8F A;  2R59 A;  3Q78 A;  3LY9 A;  1QYM A;  4DPR A;  4WWP A;  1BI8 B;  1XNF A;  3UMV A;  4HLE A;  5EKQ D;  5E76 A;  1E96 B;  4KZ0 A;  3UKU G;  4H7X A;  4BSX A;  3AU5 A;  4KT6 B;  2OOE A;  2AVP A;  4F7A A;  5J90 A;  2EQX A;  2WXQ A;  3PE3 A;  5G05 C;  1TEZ A;  4WUY A;  2DVW A;  3WXX A;  3S7D A;  3G2T A;  3RK6 A;  4NIK A;  3W9F A;  1OWP A;  1Y6I A;  1PC2 A;  3T5V A;  3APC A;  4MBG A;  1A17 A;  3D9M A;  1OCZ E;  1NL4 A;  4M3O A;  3BEE A;  3FEX A;  1UOH A;  2J4D A;  1IQR A;  3FUJ A;  2QFC A;  2P9K G;  2LNI A;  1FT1 A;  4LNB A;  4JA7 A;  3CVP A;  2QY7 A;  3R7R A;  3V79 K;  2V5F A;  4AY5 A;  2V4L A;  1OXJ A;  3SF4 A;  2Y4U A;  5AAO A;  4AOF A;  3CK8 A;  4BTB A;  3HHM A;  2B6C A;  4BY6 A;  3JYS A;  5BV1 A;  3MV3 B;  4J8S A;  2P9U G;  2DYR E;  2DCP A;  3SFZ A;  4I6J A;  3QC1 A;  4NAC A;  3UM1 A;  1K8K G;  1IYG A;  5FWQ A;  3QAQ A;  5JMN D;  1MX4 A;  1SQM A;  3RRM B;  2MHK A;  3Q47 B;  4DI3 A;  3D3M A;  3O48 A;  1FCH A;  4GAA A;  4GMJ A;  3VTX A;  4EZL A;  1ZU2 A;  3HRA A;  4U63 A;  3C72 A;  3ZIM A;  5LP0 A;  4ILI A;  3PUK A;  5KCM A;  4ME2 A;  3ABK E;  4MS6 A;  4U0U A;  4GPK A;  4OVU A;  3BU8 A;  2RD0 A;  2CHZ A;  3SY2 A;  2CFZ A;  1WG0 A;  4O60 A;  4A1G A;  5HS0 A;  4B93 B;  4I9E A;  1TNO A;  3FUF A;  3HYM B;  4AEZ C;  5CRV A;  3JQ1 A;  1PAQ A;  5ARG A;  1N4S A;  1H2T C;  1UN8 A;  3HXB A;  3K9I A;  4UUC A;  3TL5 A;  3LJ3 A;  5FZQ A;  4G26 A;  5KJN A;  3LY8 A;  3EHR A;  5A23 A;  3D9P A;  4YDE A;  2IOL A;  3TWU A;  3RU0 A;  3CVU A;  3ZN3 A;  2J09 A;  3DRA A;  4ANW A;  2ETA A;  4LCT A;  4RG9 A;  2XPZ A;  3HXE A;  3CHS A;  5AYW D;  3FDH A;  4Q69 A;  1OY3 D;  2WMN A;  2XZT G;  4HBD A;  4APF A;  3HIZ A;  2V8S E;  4F6R D;  3R9M A;  4OYS A;  4RVB A;  3ZXS A;  3FUK A;  4CT0 A;  2M63 A;  2X3M A;  5ENT D;  3E37 A;  4UWK A;  1KLX A;  4KVO A;  1O5M A;  3ULY A;  2LAI A;  5LCW J;  1MZC A;  2DBA A;  2CG3 A;  4N3C A;  4ANV A;  3AS5 A;  4GZC A;  5FIO A;  2EIM E;  4U8H A;  3Q73 A;  3F6Q A;  3IKO B;  1BU9 A;  3CVQ A;  1L5J A;  3B7R L;  4YVO A;  3LEW A;  3OXF A;  4LEU A;  3B7B A;  3CV0 A;  3QB2 A;  4ANU A;  5AIJ A;  3PZ3 A;  3QWW A;  3V31 A;  3L82 A;  3PDN A;  1VDY A;  4D10 C;  4N3B A;  4RLY A;  1H19 A;  3HXC A;  3ZGQ A;  2XQ0 A;  2Y4T A;  4BX9 A;  3ENE A;  1JCQ A;  4CCA A;  5JJ6 A;  2P9L G;  2R5S A;  3DSV A;  2PQR A;  4JEU A;  3B13 A;  3DBS A;  3VLD A;  5HQ8 A;  2XS8 A;  2L0I A;  2IO3 C;  3KS2 A;  4JXT A;  4L7T A;  1JCS A;  2MOW A;  3IV0 A;  2CG2 A;  4N3A A;  5ENQ D;  4HQD A;  2XCC A;  2VJ8 A;  5LFA A;  3PZD A;  1KZP A;  3Q79 A;  3LXU X;  2KBX A;  2YHC A;  2C2L A;  2LUH A;  2WQH A;  4XEI G;  4CZ2 D;  1H6P A;  3CHO A;  1DNP A;  1YA0 A;  2C0M A;  3QJZ A;  3CHM A;  4FLH A;  1WAO 1;  2QZA A;  2HM8 A;  2WVI A;  3ASN E;  2QC9 A;  3Q9N C;  2BED A;  1H0A A;  4BFR A;  5AAR A;  2GRP B;  1DCQ A;  3CQC B;  4APO A;  2VSY A;  4ACL A;  4WNG A;  4PDX A;  3I3N A;  5AQ9 A;  5BW8 C;  4FP7 A;  4CT4 A;  5C1D A;  1N54 A;  3HDX A;  3AG4 E;  4JA9 A;  4A1S A;  4MKT A;  2ILR A;  2FUL A;  3ISM C;  3KSL A;  1W3B A;  1EPU A;  5CED B;  3SZ7 A;  3SBS A;  1OWO A;  3PZ4 A;  4AY6 A;  5BXU A;  4B94 A;  5FT9 A;  3PRZ A;  3UKR G;  2L9B A;  3I5P A;  4G25 A;  5FQ8 A;  3ZU7 B;  2WXK A;  5ANL A;  2EIN E;  4IUL A;  2RG8 A;  4GYY A;  4FHJ A;  4HOT A;  2UY1 A;  2IY0 C;  1LF8 A;  2FO1 E;  1OWM A;  4EQF A;  5G55 A;  2WXM A;  1K1B A;  3FU6 A;  4MRU A;  1E8X A;  2A5U A;  2BTD A;  2UY1 B;  4GCO A;  4BWR A;  1KZO A;  3PVL A;  4I9C A;  3T9K A;  3SFY A;  4EPZ A;  2F37 A;  3ZXP A;  3E32 A;  3KEZ A;  4BET A;  4TXP A;  2ETC A;  5FQ7 A;  2GRO B;  3E4B A;  2I2O A;  3D9I A;  3CST A;  2EIL E;  2XPY A;  2KXP C;  3FTV A;  3FP3 A;  4L2Y A;  5LX8 A;  4YVQ C;  3EIJ A;  4ABN A;  4OVV A;  3NZU A;  1U2V G;  2MYO A;  4XKB A;  3PUJ A;  2OEW A;  5CMW A;  1AP7 A;  3O4Z A;  4JEH A;  4NUR A;  4ZHB A;  5ITZ F;  4B89 A;  2V0P A;  3QOU A;  3FTX A;  5HKP A;  2WPV A;  1QBQ A;  4TUM A;  4U0Z A;  3ML9 A;  1SZ9 A;  5EX3 A;  3CVY A;  3Q7A A;  2CFU A;  3D9L A;  3D9J A;  2X6J A;  4AP2 A;  1O1R A;  4G8L A;  4QQI A;  1EDU A;  1OCO E;  2IU1 A;  1INZ A;  2AWI A;  1H2V C;  4Z68 A;  3E33 A;  2ION A;  3HG0 D;  4GZ5 A;  2X6I A;  1WY6 A;  1OUV A;  1K3Z D;  1WDY A;  1JPL A;  3TXM A;  4J6I A;  4PUC A;  4GTO A;  2FI7 A;  1H6O A;  1QNF A;  2R03 A;  3D9N A;  5FTP A;  3SHF A;  4MLP A;  3MKR A;  3FHE A;  5CEC B;  1S63 A;  2OVF A;  3EHM A;  2YHE A;  5B1B E;  2WM9 A;  2VGE A;  2IFU A;  2VYI A;  1SVX A;  4E85 A;  5G04 J;  3CSF A;  3CQG B;  1N94 A;  4PS7 A;  3ASF A;  3D9H A;  5KWD A;  1IHG A;  1KPS B;  4DX6 D;  1MYO A;  3FUH A;  5H7P A;  2P2C P;  3FUL A;  2PM7 A;  3ASD A;  4DRX E;  3L08 A;  3AS8 A;  4U07 A;  4ILH B;  3TJP A;  4V3I A;  4KYO B;  4E6H A;  1NP7 A;  3I4G A;  4KVM A;  2J4B A;  2P58 C;  4CYM D;  3TWX A;  2IJG X;  2OEV A;  4TRQ A;  3FTZ A;  3OXG A;  4G1T A;  4JPS A;  4JB8 P;  3T8K A;  1FT2 A;  4WNF A;  5CER B;  4O6F A;  4GZD A;  1BLX B;  2ZU6 B;  2VQ2 A;  2GRM A;  4N2S A;  1S70 B;  5FIN A;  4A55 A;  5T4Y A;  4JD2 G;  2LXM A;  5J08 A;  1EYH A;  5C2Y A;  4LRZ A;  4Y6C A;  4ACK A;  2HYZ A;  1HO8 A;  3RO2 A;  3RRU A;  3ZYK A;  3V30 A;  3Q5M A;  4GA1 A;  4EEC A;  2XGO A;  2X6F A;  1HE8 A;  1D8D A;  2P9N G;  3FH5 A;  1N11 A;  1E8Z A;  4H7Y A;  3ULQ A;  3NB2 A;  5EID A;  5ANR A;  4CRW A;  2IF4 A;  1B89 A;  5T8I A;  1E90 A;  3L16 A;  3SFX A;  4WAF A;  3UX4 A;  3OAW A;  2HO1 A;  3ML8 A;  3N71 A;  3FUE A;  3LPZ A;  3RAU A;  3DSX A;  2WXR A;  2P9S G;  2I1K A;  3UM3 A;  1QZ2 A;  1MJ0 A;  3L17 A;  4O1P A;  1N4R A;  4ATG A;  3ZHE A;  5HRY A;  4GTT A;  1K1A A;  2PM6 A;  4OAV B;  4FJY A;  1U3D A;  3ZHE B;  4G23 A;  3UXG A;  4A3V A;  1IKN D;  4UWH A;  4HI8 A;  4XX5 A;  3SI5 A;  4HRM B;  3CVX A;  1TJC A;  3NOG D;  5KJM A;  4BTA A;  1FVH A;  1NFI E;  4JL0 A;  2ZGD A;  4FC8 A;  5FQ4 A;  4O1O A;  3DSW A;  5KJK A;  4HOQ A;  4U8V D;  4KBQ A;  4URK A;  3JQ0 A;  1FPP A;  2J9Q A;  3RRN B;  3L13 A;  4B8A A;  2R2L A;  3TWT A;  4N5C A;  2YQ8 A;  3FTU A;  5CRU A;  5ENR D;  4UI9 J;  3V2O A;  2WMO A;  4JVS A;  2DIW A;  3PEU B;  1TNU A;  1LTX A;  5FQ6 A;  2LO6 A;  4GA0 A;  4EZK A;  4I17 A;  3NF1 A;  4L9P A;  2BUG A;  1RZ4 A;  5G04 C;  3TWQ A;  3UT8 A;  4U04 A;  1TJF A;  1HG2 A;  5CCM A;  2XEE A;  1OWL A;  3I4R B;  4TXQ A;  5EYP F;  4GTV A;  1N95 A;  4KZC A;  3ZUV B;  3MYV A;  1HFA A;  3FUD A;  4DX1 A;  4DUI A;  2IEJ A;  2A5E A;  4UQZ A;  3FTY A;  3X2Q E;  3IEG A;  4NQ0 A;  3LJN A;  3UM2 A;  3IXE A;  3HXD A;  5EYL A;  2VGX A;  3UQ3 A;  3ZW3 A;  3UM0 A;  4DLO A;  2NXP A;  4U7E B;  5AQ7 A;  2VGX B;  5BUZ A;  3UT4 A;  1UG3 A;  3PNT B;  2JAB A;  4C9B B;  2FEZ A;  3ONL A;  2R05 A;  3QK0 A;  3PRE A;  1ELK A;  3AU4 A;  3VLE A;  3JXI A;  1LD7 A;  4JW1 A;  4UWL A;  3G2V A;  3UTM A;  1HF8 A;  3IHY A;  5ENS D;  5KNH D;  2P9P G;  4NRH B;  3QAR A;  3KAE A;  1Q2Z A;  3DXK G;  1SA4 A;  5CEA A;  2L6J A;  4AM9 A;  2E2E A;  2HR2 A;  3EJN A;  4G24 A;  3Q4A B;  4M7C A;  3TG4 A;  1SW6 A;  2J07 A;  3PH0 C;  3P2B A;  4OAU C;  3JUE A;  3HXF A;  2VSN A;  5G05 J;  2AXU A;  2VSX E;  1IXV A;  2EIK E;  4AVX A;  4Q94 A;  2VGY A;  1HG5 A;  1DVP A;  1HH8 A;  1UJK A;  3OTN A;  5T3R A;  3TWS A;  1ELR A;  4DK5 A;  4IN3 B;  2Q7F A;  4FJZ A;  4HB5 A;  3TG5 A;  3TAX A;  3LDZ A;  3JUI A;  4DLQ A;  3Q49 B;  3CEQ A;  1OCC E;  2RFA A;  5B1A E;  4U0S A;  1S0P A;  3IBE A;  4BSZ B;  2MRI A;  2R02 A;  2UWJ G;  2I6H A;  3DSS A;  2PNN A;  3CK9 A;  5EIL A;  4CDM A;  3CVW A;  4XKC A;  5LOZ A;  2ZIS A;  4BT8 A;  2XRZ A;  3R7Q A;  5JHA A;  2WXG A;  3UT7 A;  1UW4 B;  3FU3 A;  2OCC E;  3MCX A;  4I2W A;  1E7V A;  1QQE A;  3QNK A;  2WXP A;  2B0O E;  5CHE E;  2BKK B;  3FU0 A;  2X38 A;  3LCA A;  4TUU A;  4HNA D;  4UI9 K;  3SD5 A;  5AQA A;  2L6B A;  2WXN A;  1NA0 A;  5D66 A;  3ZYL A;  4K0R A;  3UUX A;  1BD8 A;  3DXM G;  3ULE G;  4YDO A;  5LCW C;  4DI4 A;  3BG1 B;  5EN5 D;  2LSV A;  4WWN A;  4K5B A;  1TN7 A;  3G2S A;  4L2L A;  3TGO A;  3L22 A;  2L0T B;  2R17 C;  2OVB A;  1WM5 A;  3DEO A;  1TNB A;  4UQY A;  3JXJ A;  3GYZ A;  2NYJ A;  3DPY A;  5CBO A;  1D8E A;  2JLB A;  4TXR A;  2CHW A;  3MKQ A;  1BI7 B;  3FTW A;  3D9O A;  4Y6W A;  3G2W A;  4I6G A;  2H6G A;  4HRN A;  1N4Q A;  3HVE A;  4BT9 A;  2J49 A;  3MKQ B;  4EBA A;  4UQX A;  1TR4 A;  3CHR A;  2QYJ A;  1YCS B;  3W9G A;  2WXJ A;  3L6A A;  3BQO A;  4GTM A;  3HVE B;  4AV7 A;  4U96 D;  1ELW A;  1OCR E;  2X6H A;  1MX6 A;  3SQV A;  3NQP A;  2GGF A;  3B7S A;  2RFM A;  5M72 A;  5EDS A;  4C0E A;  4DX7 D;  2GRQ B;  3FWV A;  1DCE A;  3S7J A;  4J8D A;  5EX0 A;  1BPO A;  3KEA A;  3ESL A;  2XEN A;  4HRL A;  3ABM E;  1JWG A;  2WQ6 A;  3ASO E;  4YDW A;  2AXV A;  3WG7 E;  1OWN A;  3SNX A;  4XZ4 A;  1Z3X A;  4GTS A;  5ENO D;  3PEV B;  2GRN B;  1G3N B;  2I1J A;  3URZ A;  1YMP A;  3KD7 A;  1ZBP A;  3J5P A;  4CDR A;  4GMR A;  3OXL A;  3FTS A;  5BT1 A;  4EHM A;  1FVF A;  4WWO A;  5JHB A;  3AJI A;  2C0L A;  5EIB E;  4JHK A;  4RSY A;  3DWL G;  4I2Z A;  3VTY A;  4YDY A;  3Q75 A;  4GTR A;  3FY4 A;  2KAT A;  3QDN A;  4FA6 A;  4HOS A;  4A63 B;  3C5R A;  1HU3 A;  2FF4 A;  3MA5 A;  4XI0 A;  3UIO C;  1JCR A;  2GRL A;  3U66 A;  3R9A B;  5CMY A;  2J8S D;  4Q96 A;  3CVV A;  4RQI A;  3NAW A;  1KT0 A;  2Y0B G;  1H2U A;  2GRR B;  3APF A;  4KXK B;  3GZ2 A;  3C3Q A;  4J8E A;  4AIF A;  3LS8 A;  2PZI A;  3AAA C;  3CKB A;  2XS1 A;  3CHP A;  5AEN A;  3PZ2 A;  3U9W A;  5FJY A;  4GPM A;  2BF0 X;  3NOC D;  4J7W A;  1UN9 A;  5BNW A;  2VTB A;  3RKV A;  1MQS A;  2F8X K;  5BPP A;  3UPV A;  3AG3 E;  1MX2 A;  2VTB B;  3ZYQ A;  2KM4 A;  4L23 A;  2JEK A;  5KNG A;  2AJA A;  3LKU A;  1KT1 A;  4HLL A;  2A4Z A;  1Z5S C;  3U64 A;  4CEM A;  3E30 A;  1PY1 A;  4L1B A;  3EIQ C;  3Q15 A;  3FUN A;  3CVL A;  4K5C A;  5AN8 A;  2QYU A;  3TXN A;  2OND A;  2Y3A A;  3AG1 E;  4J8Y A;  3TWW A;  3CVN A;  4CDN A;  2XHE A;  2ZGG A;  1N0R A;  3MX3 A;  2KCL A;  4ILG A;  4WNE A;  2XZD G;  1O1T A;  4JHJ A;  4LER A;  4FUL A;  4GU5 A;  2HE0 A;  2XRY A;  4GZ6 A;  3ZEF A;  4LG6 A;  4N5Q A;  3IHV A;  3FFL A;  3J5Q B;  5D0Q D;  3EHQ A;  2LSU A;  3EUV A;  2H6F A;  2X6K A;  4JC8 A;  1IHB A;  4ATZ D;  5FZS A;  3ONK A;  5JJT A;  4F53 A;  3LY7 A;  3JCK C;  1RW2 A;  3EU5 A;  3QKY A;  4WND A;  3DEP A;  3UIP C;  3U4T A;  3L9T A;  1SA5 A;  3P1U A;  2KCK A;  4GCN A;  3FUM A;  1GW6 A;  3DPD A;  4FAD A;  4BX8 A;  3CGH A;  3AS4 A;  3S2A A;  2IOS A;  4C0M A;  1V54 E;  1D9S A;  3LYA A;  4U8Y D;  3CKC A;  5JA4 D;  3GZ1 A;  2V5Q C;  3ZPJ A;  2WXO A;  2XGS A;  1YYH A;  1NA3 A;  2P9I G;  5A6C A;  2LAH A;  3AG2 E;  2IQC A;  3CHQ A;  1Y8M A;  2YNQ A;  1LD8 A;  1E7U A;  1TN8 A;  4I1O B;  5KJL A;  1DC2 A;  4KMO A;  4LSZ E;  5DIZ A;  2DZO A;  4HVB A;  2XPI A;  3MJW A;  5G2N A;  3MEK A;  5BXO A;  4K03 A;  4AXH A;  3ZVV A;  3CR3 A;  1TNY A;  2XEV A;  5AJL A;  3ZNG A;  3SBT B;  3UIN C;  3S7F A;  4DX5 D;  1V55 E;  1AWC B;  4DJA A;  5HI7 A;  1IQU A;  4I1M A;  4P29 A;  3DST A;  4BES A;  1Z3Y A;  5ENN A;  3ABL E;  5KBA A;  1X5B A;  4FLB A;  3ASG A;  2WXI A;  2WQ7 A;  4K5A B;  4GB9 A;  4PS8 A;  2RKK A;  4GTP A;  2DYS E;  2J08 A;  4U95 D;  5CBN A;  1SZA A;  3ZKJ A;  3KSQ A;  1HS6 A;  4N39 A;  5ARF A;  3ASH A;  4LUN U;  3PS6 A;  3L54 A;  3ZFW A;  4GML A;  4HXI A;  4UWG A;  1TN6 A;  4XIF A;  4G11 A;  5BV0 A;  2WB2 A;  4CGV A;  1XGW A;  5A7D B;  3MV2 B;  3QWP A;  4J0U A;  3T5X A;  4XE0 A;  3MZL B;  1H6K A;  2H6H A;  3C3O A;  4HOR A;  4EBA G;  3T8M A;  4HI9 A;  5B3S E;  2ETB A;  3EDT B;  4F3V A;  4IYP A;  1ZB1 A;  1TYQ G;  3BG0 B;  2KC7 A;  4FU3 A;  3ZRH A;  3DSU A;  3Q9U C;  3B95 A;  3LVR E;  4A3T A;  4UWF A;  4EZJ A;  4B8C B;  1S64 A;  3VLF A;  2IO2 C;  2ZIR A;  4GYW A;  3MGB A;  1N52 A;  4GTQ A;  5IY5 E;  4TV3 A;  4FHK A;  1N0Q A;  4GYO A;  3C3R A;  1JWF A;  3G2U A;  2XCB A;  2F8Y A;  1U3C A;  4C48 B;  3SO8 A;  2YIN A;  3B7T A;  2BKG A;  1MHQ A;  3FH7 A;  4HOU A;  1E8W A;  3C98 A;  3PNL B;  4YND A;  4F1P A;  1X81 A;  3RJV A;  4I1A A;  4ZFH A;  2DWZ A;  2Y69 E;  3ESK A;  3BUA A;  3NZS A;  4G2V A;  4QFV A;  2XGM A;  4HS2 A;  4IRU A;  5D2M C;  4XI9 A;  2KCV A;  2H6I A;  2NSZ A;  4N2Q A;  2WXH A;  5JJ7 A;  1TNZ A;  4I43 A;  1HZ4 A;  3QWV A;  1JUQ A;  3FH8 A;  1NZN A;  4HFG A;  5DBK A;  4F1S A;  4LNG A;  4B0Z A;  5FZR A;  3RIB A;  4GA2 A; 
#chains in the Genus database with same CATH homology
 3VTY A;  2VJ8 A;  4YVO A;  2PQN A;  1QZ2 A;  5LFA A;  3PZD A;  3L17 A;  3FY4 A;  2FBN A;  3GZS A;  3LXU X;  2KAT A;  4ATG A;  4UI9 C;  1UJJ A;  3QDN A;  3ZHE A;  3FUI A;  3APD A;  4FA6 A;  2YHC A;  4HOS A;  3CIA A;  4JHR A;  2C2L A;  2PM6 A;  2E0I A;  4I6E A;  2WQH A;  2WXF A;  1HU3 A;  2FF4 A;  4FJY A;  4ANX A;  1U3D A;  3MA5 A;  3EHN A;  3CHO A;  3ZHE B;  1DNP A;  4G23 A;  1YA0 A;  2AW6 A;  4A3V A;  2C0M A;  4XI0 A;  3QJZ A;  2GW1 A;  3PE4 A;  3CHM A;  4UWH A;  4FLH A;  2GRL A;  3U66 A;  4CGW A;  4XX5 A;  2VSO E;  3SI5 A;  2WXL A;  3CVX A;  1EF1 C;  1TJC A;  1WAO 1;  3FEY A;  5KJM A;  4PH4 B;  5CMY A;  4Q96 A;  3R9A B;  4BTA A;  1FVH A;  4JL0 A;  3CVV A;  2HM8 A;  4FC8 A;  5FQ4 A;  1KT0 A;  3SGH A;  4PS3 A;  5KJK A;  4HOQ A;  3S7B A;  1E8Y A;  2WVI A;  1H2U A;  3CLJ A;  2AXZ A;  4KBQ A;  1HXI A;  3APF A;  1Z6T A;  4URK A;  4W9R A;  3JQ0 A;  1H0A A;  4KXK B;  2J9Q A;  3GZ2 A;  3RRN B;  3L13 A;  4J8E A;  4BFR A;  4AIF A;  3LS8 A;  3CQC B;  1HX8 A;  4APO A;  2VSY A;  4JZY A;  4ACL A;  3CK7 A;  2PZI A;  4GZ3 A;  4WNG A;  3GW4 A;  4B8A A;  3LVQ E;  4PDX A;  5AJD A;  5CCL A;  3CKB A;  3FU5 A;  3I3N A;  5BW8 C;  4FP7 A;  4N5C A;  2YQ8 A;  3FTU A;  4CT4 A;  3CHP A;  3TGO A;  5AEN A;  4UI9 J;  5C1D A;  2WMO A;  3U9W A;  4JVS A;  1N54 A;  2DIW A;  3PEU B;  2OV8 A;  3HDX A;  5FJY A;  2NC9 A;  2KZT A;  5FQ6 A;  2BF0 X;  2LO6 A;  4GA0 A;  4JA9 A;  4A1S A;  4EZK A;  4I17 A;  4AJW A;  3NF1 A;  4MKT A;  2I9C A;  4RG6 A;  2BUG A;  2ILR A;  1UN9 A;  2FUL A;  5BNW A;  2VTB A;  5G04 C;  3RKV A;  1W3B A;  4R7L A;  1MQS A;  1EPU A;  3UT8 A;  2FO7 A;  2KZT B;  4U04 A;  1TJF A;  3D9K A;  5BPP A;  3UPV A;  1HG2 A;  3SZ7 A;  5CCM A;  3SBS A;  2PL2 A;  1OWO A;  2VTB B;  3ZYQ A;  1OWL A;  3I4R B;  2KM4 A;  4L23 A;  3RO3 A;  3ZYM A;  4AY6 A;  1P5Q A;  2JEK A;  5D0O D;  3LKU A;  5E75 A;  1KT1 A;  4B94 A;  5FT9 A;  3PRZ A;  4KZC A;  3B7U X;  2CHX A;  2A4Z A;  3U64 A;  2L9B A;  4CEM A;  3MYV A;  1HFA A;  3I5P A;  1PY1 A;  3FUD A;  3U3W A;  4J8F A;  2R59 A;  3LY9 A;  4G25 A;  5FQ8 A;  4DPR A;  4L1B A;  2WXK A;  4WWP A;  5ANL A;  1XNF A;  3EIQ C;  3UMV A;  3Q15 A;  4UQZ A;  3FUN A;  4HLE A;  5EKQ D;  5E76 A;  3CVL A;  1E96 B;  4KZ0 A;  4IUL A;  3FTY A;  4H7X A;  3IEG A;  4BSX A;  3AU5 A;  3TXN A;  2OND A;  4KT6 B;  4NQ0 A;  2RG8 A;  2OOE A;  2Y3A A;  4GYY A;  2AVP A;  3CVN A;  4FHJ A;  2VGX A;  4CDN A;  2XHE A;  4F7A A;  5J90 A;  3UQ3 A;  3MX3 A;  2EQX A;  3ZW3 A;  4HOT A;  2WXQ A;  2UY1 A;  3PE3 A;  5G05 C;  2KCL A;  4ILG A;  1LF8 A;  1TEZ A;  4WUY A;  4WNE A;  4DLO A;  3WXX A;  1OWM A;  3S7D A;  2NXP A;  4EQF A;  4JHJ A;  2WXM A;  3FU6 A;  4LER A;  4FUL A;  3G2T A;  4GU5 A;  5G55 A;  4MRU A;  2VGX B;  2XRY A;  5BUZ A;  4GZ6 A;  1E8X A;  2A5U A;  2BTD A;  2UY1 B;  3RK6 A;  1UG3 A;  4GCO A;  3UT4 A;  3ZEF A;  3PNT B;  3IHV A;  4BWR A;  3FFL A;  3PVL A;  4I9C A;  1OWP A;  4C9B B;  2FEZ A;  5D0Q D;  3ONL A;  4EPZ A;  1Y6I A;  2LSU A;  1PC2 A;  3KEZ A;  3T5V A;  3APC A;  3QK0 A;  5FZR A;  3PRE A;  1A17 A;  1ELK A;  3AU4 A;  3VLE A;  2X6K A;  4JW1 A;  4JC8 A;  4UWL A;  3D9M A;  5FZS A;  3G2V A;  5FQ7 A;  3ONK A;  1HF8 A;  3IHY A;  5JJT A;  3E4B A;  2I2O A;  4F53 A;  4M3O A;  3LY7 A;  3D9I A;  3CST A;  4NRH B;  3QAR A;  3BEE A;  3JCK C;  3KAE A;  2XPY A;  3FEX A;  3QKY A;  3FTV A;  4WND A;  2J4D A;  1IQR A;  3FUJ A;  2QFC A;  3FP3 A;  2L6J A;  4L2Y A;  5LX8 A;  2LNI A;  4AM9 A;  4YVQ C;  3EIJ A;  2E2E A;  2HR2 A;  3EJN A;  4G24 A;  3U4T A;  3Q4A B;  4JA7 A;  4ABN A;  3TG4 A;  2J07 A;  4OVV A;  3PH0 C;  3CVP A;  3NZU A;  3P1U A;  2QY7 A;  3P2B A;  3R7R A;  2KCK A;  4GCN A;  4XKB A;  3PUJ A;  3FUM A;  5CMW A;  1GW6 A;  2V5F A;  4AY5 A;  2V4L A;  2VSN A;  5G05 J;  2AXU A;  3DPD A;  3O4Z A;  4JEH A;  3SF4 A;  2VSX E;  4FAD A;  4BX8 A;  3CGH A;  3AS4 A;  2Y4U A;  4NUR A;  3S2A A;  4AOF A;  3CK8 A;  4B89 A;  2V0P A;  4AVX A;  3QOU A;  3FTX A;  2IOS A;  4Q94 A;  4C0M A;  2WPV A;  4BTB A;  3HHM A;  4U0Z A;  2VGY A;  3LYA A;  4BY6 A;  1HG5 A;  3JYS A;  1DVP A;  1HH8 A;  1UJK A;  5BV1 A;  3ML9 A;  3MV3 B;  1SZ9 A;  3OTN A;  3CKC A;  5EX3 A;  5T3R A;  4J8S A;  3GZ1 A;  3CVY A;  4DK5 A;  4IN3 B;  2DCP A;  2Q7F A;  4FJZ A;  3TAX A;  3SFZ A;  3TG5 A;  3ZPJ A;  4I6J A;  3LDZ A;  3JUI A;  3QC1 A;  2CFU A;  2WXO A;  3D9L A;  2XGS A;  4DLQ A;  3D9J A;  4NAC A;  2X6J A;  3Q49 B;  3CEQ A;  1NA3 A;  4AP2 A;  1IYG A;  5FWQ A;  3QAQ A;  4U0S A;  5A6C A;  2LAH A;  1S0P A;  3IBE A;  1SQM A;  3RRM B;  2MHK A;  3Q47 B;  1EDU A;  1INZ A;  2IU1 A;  2IQC A;  2MRI A;  2AWI A;  3CHQ A;  4DI3 A;  1H2V C;  1Y8M A;  3D3M A;  2UWJ G;  2ION A;  2YNQ A;  2I6H A;  4GZ5 A;  2X6I A;  3O48 A;  1FCH A;  1OUV A;  1E7U A;  1WY6 A;  4GAA A;  4I1O B;  5KJL A;  4GMJ A;  1JPL A;  3TXM A;  4KMO A;  5DIZ A;  4HVB A;  2XPI A;  3MJW A;  4J6I A;  3CK9 A;  4PUC A;  2FI7 A;  4CDM A;  3CVW A;  4XKC A;  5G2N A;  4EEC A;  1QNF A;  3MEK A;  3D9N A;  4K03 A;  4AXH A;  5LOZ A;  3ZVV A;  3VTX A;  3CR3 A;  2XEV A;  5FTP A;  4BT8 A;  3SHF A;  4EZL A;  1ZU2 A;  2XRZ A;  3R7Q A;  5JHA A;  4MLP A;  5AJL A;  2WXG A;  4U63 A;  1UW4 B;  3SBT B;  3MKR A;  3UT7 A;  3FHE A;  3FU3 A;  3ZIM A;  5LP0 A;  3S7F A;  4ILI A;  3PUK A;  2OVF A;  5KCM A;  4ME2 A;  4MS6 A;  3EHM A;  4U0U A;  2YHE A;  3MCX A;  1E7V A;  1QQE A;  2WM9 A;  4I2W A;  5HI7 A;  4DJA A;  3QNK A;  4GPK A;  1IQU A;  2WXP A;  4I1M A;  2IFU A;  4P29 A;  4OVU A;  5CHE E;  1Z3Y A;  3FU0 A;  2X38 A;  2RD0 A;  2CHZ A;  2VYI A;  3LCA A;  5ENN A;  2CFZ A;  4A1G A;  1X5B A;  4FLB A;  4E85 A;  4TUU A;  5G04 J;  3ASG A;  3CSF A;  4I9E A;  3CQG B;  2WXI A;  4UI9 K;  3SD5 A;  4PS7 A;  2WQ7 A;  3FUF A;  3HYM B;  4AEZ C;  3ASF A;  2WXN A;  1NA0 A;  4GB9 A;  3JQ1 A;  4PS8 A;  1PAQ A;  5ARG A;  3ZYL A;  4K0R A;  3UUX A;  1H2T C;  1UN8 A;  3K9I A;  5LCW C;  1IHG A;  2J08 A;  3TL5 A;  3LJ3 A;  3FUH A;  4G26 A;  5FZQ A;  5KJN A;  4DI4 A;  3BG1 B;  1SZA A;  3FUL A;  3LY8 A;  2LSV A;  2PM7 A;  4I2Z A;  1HS6 A;  4N39 A;  4WWN A;  3ASD A;  5A23 A;  3L08 A;  3G2S A;  4L2L A;  3ASH A;  3AS8 A;  3D9P A;  3L22 A;  4ILH B;  2L0T B;  2R17 C;  4U07 A;  5ARF A;  2IOL A;  3TJP A;  4LUN U;  4V3I A;  3RU0 A;  3CVU A;  4KYO B;  2OVB A;  3PS6 A;  1WM5 A;  2J09 A;  3ZN3 A;  4E6H A;  1NP7 A;  3L54 A;  4ANW A;  3I4G A;  4KVM A;  2J4B A;  2P58 C;  4LCT A;  3ZFW A;  4GML A;  4HXI A;  4UWG A;  4RG9 A;  4G11 A;  4XIF A;  5BV0 A;  2WB2 A;  2XPZ A;  4UQY A;  3CHS A;  3GYZ A;  5AYW D;  3FDH A;  4Q69 A;  4CGV A;  1XGW A;  2WMN A;  5A7D B;  2IJG X;  3MV2 B;  4APF A;  3QWP A;  4J0U A;  4TRQ A;  3T5X A;  3FTZ A;  3HIZ A;  2JLB A;  2V8S E;  3OXG A;  4OYS A;  4RVB A;  4XE0 A;  2CHW A;  3MZL B;  3ZXS A;  3MKQ A;  4G1T A;  4JPS A;  3FUK A;  4CT0 A;  2M63 A;  2X3M A;  1H6K A;  4WNF A;  4O6F A;  3FTW A;  3D9O A;  4Y6W A;  4GZD A;  4HOR A;  3G2W A;  4EBA G;  4I6G A;  3T8M A;  4UWK A;  3HVE A;  1KLX A;  4BT9 A;  2J49 A;  3MKQ B;  4EBA A;  3EDT B;  4F3V A;  4KVO A;  2ZU6 B;  4IYP A;  4UQX A;  2LAI A;  3BG0 B;  3CHR A;  2KC7 A;  4FU3 A;  2WXJ A;  3L6A A;  2VQ2 A;  5LCW J;  2DBA A;  2CG3 A;  3HVE B;  2GRM A;  4N3C A;  4N2S A;  4ANV A;  4AV7 A;  4A55 A;  5T4Y A;  3ZRH A;  3AS5 A;  4GZC A;  1ELW A;  2X6H A;  5J08 A;  4U8H A;  3NQP A;  2GGF A;  3IKO B;  3B7S A;  1EYH A;  5C2Y A;  5M72 A;  5EDS A;  4LRZ A;  3LVR E;  4A3T A;  4UWF A;  4Y6C A;  3CVQ A;  4ACK A;  4B8C B;  4C0E A;  4EZJ A;  3FWV A;  1L5J A;  3VLF A;  3B7R L;  3S7J A;  3MGB A;  1N52 A;  2HYZ A;  3LEW A;  1HO8 A;  3OXF A;  3CV0 A;  4GYW A;  3QB2 A;  4J8D A;  4LEU A;  4ANU A;  4TV3 A;  5EX0 A;  1BPO A;  4FHK A;  3RO2 A;  3RRU A;  4GYO A;  3ESL A;  1JWF A;  3QWW A;  3G2U A;  5AIJ A;  2XCB A;  1JWG A;  2WQ6 A;  3ZYK A;  1U3C A;  3PDN A;  2AXV A;  1VDY A;  4D10 C;  2YIN A;  1OWN A;  3B7T A;  3Q5M A;  4GA1 A;  4XZ4 A;  3SNX A;  2XGO A;  3FH7 A;  1MHQ A;  4HOU A;  2X6F A;  4N3B A;  1Z3X A;  1E8W A;  3C98 A;  3PNL B;  3PEV B;  4YND A;  1H19 A;  1HE8 A;  3RJV A;  4I1A A;  3ZGQ A;  2XQ0 A;  2Y4T A;  3FH5 A;  2I1J A;  4BX9 A;  3URZ A;  3ENE A;  3ESK A;  3KD7 A;  1E8Z A;  4CCA A;  3NZS A;  4G2V A;  5JJ6 A;  1ZBP A;  4H7Y A;  4QFV A;  2XGM A;  4HS2 A;  4IRU A;  3ULQ A;  4XI9 A;  2R5S A;  5ANR A;  2PQR A;  4CRW A;  2IF4 A;  1B89 A;  4JEU A;  2KCV A;  3B13 A;  5T8I A;  3DBS A;  3VLD A;  5HQ8 A;  1E90 A;  2NSZ A;  4N2Q A;  2L0I A;  2WXH A;  3L16 A;  4CDR A;  3OXL A;  3FTS A;  5JJ7 A;  4I43 A;  3KS2 A;  4JXT A;  5BT1 A;  4WAF A;  1HZ4 A;  3QWV A;  1FVF A;  4WWO A;  3UX4 A;  5JHB A;  2C0L A;  3OAW A;  1JUQ A;  2HO1 A;  4L7T A;  3ML8 A;  3N71 A;  4JHK A;  3FUE A;  3LPZ A;  2MOW A;  3IV0 A;  3FH8 A;  2CG2 A;  4N3A A;  1NZN A;  4HFG A;  4RSY A;  5DBK A;  2XCC A;  4F1S A;  2WXR A;  4B0Z A;  2I1K A;  1ELR A;  3RIB A;  4GA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...