1NA0A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
119
structure length
119
Chain Sequence
NSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
molecule tags De novo protein
molecule keywords designed protein CTPR3
total genus 50
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na0A00
5DBKA 3ZPJA 4BTBA 2R5SA 3LKUA 1QQEA 2IFUA 2WPVA 2PL2A 4NRHB 4N3CA 3TG5A 5C1DA 5JJ6A 3LY8A 5EX0A 2AVPA 5D0QD 3NF1A 3GZ2A 4I9CA 2NC9A 2PZIA 1OUVA 2Y4TA 3EDTB 4O6FA 4WNEA 3CVQA 2L6JA 1ZBPA 4N2SA 4JHRA 4XI0A 3QWVA 3S7FA 3Q5MA 4HOSA 4J8FA 4GYOA 4U0UA 5FTPA 2MHKA 3CEQA 3AS4A 2WQHA 2HR2A 3MA5A 3Q15A 4UI9J 5FZQA 4G1TA 3RIBA 3BEEA 4AM9A 4BTAA 4CGWA 2J9QA 1IYGA 3QOUA 3E4BA 4I2ZA 3QDNA 2XGMA 4LEUA 5LCWJ 4CGVA 4ME2A 5AYWD 3QWPA 4HOQA 4RG9A 2E2EA 4I2WA 3RJVA 4AY6A 2HYZA 3ESKA 3FFLA 2LSUA 2PQRA 4GYYA 4GZ3A 4I1AA 5EX3A 3S7JA 5BNWA 3UPVA 2YQ8A 2OOEA 4GA1A 3Q49B 2HO1A 3VTYA 4KBQA 3MEKA 5ARFA 3ZN3A 3QKYA 5LCWC 4BT8A 2FEZA 1P5QA 3CK7A 3U3WA 1TJCA 2FBNA 3O48A 3MV3B 1HH8A 3LCAA 4GCNA 3SZ7A 3OXFA 4BT9A 4CDRA 5G05J 1HXIA 5KJNA 4ABNA 2XPIA 4YVQC 4GPKA 5D0OD 2ONDA 4NQ0A 4GZ5A 2VGYA 3Q47B 4Y6CA 4I17A 5KJMA 5BT1A 3HYMB 2VSYA 1NA0A 4JL0A 3GYZA 4AY5A 3U4TA 3CK9A 3ASHA 3KD7A 4G26A 2KC7A 4N3AA 3ZGQA 3AS5A 3CK8A 2Y4UA 2KCLA 2QFCA 4B94A 1B89A 4I9EA 4H7XA 3S7DA 4GCOA 1ELRA 2FI7A 3FP3A 1ZU2A 3OXGA 3CV0A 4J8EA 1WM5A 2C2LA 3ASFA 4YVOA 4G25A 5EKQD 4AIFA 2FF4A 3K9IA 3LY7A 5KJKA 3S7BA 4APOA 1FCHA 1W3BA 3LPZA 1IHGA 2UY1B 5G05C 4HOTA 4N5CA 4U04A 1KLXA 2KATA 4G23A 3UQ3A 3OXLA 4XI9A 3R9AB 4H7YA 3CKBA 1A17A 2JLBA 3ZFWA 4F3VA 2V5FA 3CVLA 3KAEA 3N71A 2KCVA 1PC2A 3CVNA 3ASDA 4UI9K 3RU0A 3ZHEB 5A6CA 3VTXA 2Q7FA 1KT1A 3AS8A 3IEGA 1KT0A 5DIZA 2PQNA 2DBAA 1XNFA 4UQYA 3ZHEA 4UQZA 4EQFA 4J8DA 5FZRA 4KYOB 3URZA 4U07A 3Q4AB 5CHEE 4HORA 4W9RA 5CCLA 4WNDA 3RKVA 5M72A 4KXKB 5FZSA 4IN3B 3WXXA 4JA9A 4WNFA 2P58C 3GW4A 5HQ8A 4N39A 4GYWA 1NA3A 4UI9C 4YNDA 3TAXA 1E96B 3QWWA 5CCMA 3CVPA 3JYSA 2VGXB 3KS2A 4WNGA 2KCKA 3LYAA 2C0MA 4J0UA 1NZNA 4BWRA 2VSNA 2GW1A 4U0SA 4N3BA 5FJYA 3PDNA 2XGOA 3PE3A 4G2VA 4WUYA 1HZ4A 3GZ1A 3CKCA 5A7DB 3PE4A 3TG4A 3ULQA 3SF4A 3MV2B 2YHCA 1WAO1 2FO7A 2BUGA 4G24A 2UWJG 4JA7A 4RG6A 3UUXA 5KJLA 2C0LA 4GA0A 2LSVA 5BW8C 3MKRA 5G04J 2UY1A 2VQ2A 5JJ7A 1YA0A 2VGXA 2XCBA 3FWVA 3LY9A 5HI7A 2XEVA 3ASGA 4GZ6A 4Y6WA 5JJTA 4N2QA 2I6HA 4GA2A 2XGSA 4U0ZA 3RO2A 4XIFA 4HOUA 2LNIA 2VYIA 2XCCA 4A1SA 1QZ2A 3RO3A 1ELWA 5FT9A 3TGOA 1Y8MA 2IF4A 5G04C 4UQXA 5ARGA
chains in the Genus database with same CATH superfamily
5JHBA 3ZPJA 4BTBA 1LTXA 1UN9A 2R17C 3UI2A 2WXHA 4U95D 3PRZA 4I9CA 2F0YA 1H2VC 4N5QA 4LNBA 2AWIA 3APFA 3PNLB 5FQ6A 4JZYA 3SBTB 3FUIA 4FU3A 2J49A 2QC9A 4LEUA 4U8VD 3UM3A 5H7PA 3MGBA 4DPRA 3RJVA 4G11A 3B7BA 2F37A 3ZN3A 4CT4A 4GPMA 2CHZA 3U64A 3W9GA 3W9FA 3PREA 4BT9A 4AXHA 5LFAA 2ZIRA 3CV0A 3V2OA 5EYPF 1IHGA 4HRMB 5LX8A 3R9AB 3KAEA 1PC2A 4WWOA 2CFZA 3G2SA 4J8DA 5J90A 4U63A 2BEDA 2GRQB 3L08A 2WXMA 4HS2A 3Q9UC 4FA6A 4APOA 3CKCA 3LDZA 4KVMA 2P9UG 4G24A 2ILRA 2C0LA 2LSVA 2DCPA 1YA0A 4FULA 2VGXA 5CECB 5CBOA 3AJIA 2VYIA 1E7UA 4PS3A 3JQ0A 2Y3AA 2IO3C 2R5SA 3MKQA 4C0MA 3RAUA 1LD8A 5EX0A 1JWFA 4DX5D 2QZAA 5A23A 3G2TA 2WXKA 4WNEA 4F7AA 3QWVA 3TWTA 2MHKA 4HFGA 4G1TA 4OYSA 1S70B 1S64A 4HLLA 1YCSB 3FEYA 3C98A 1X81A 3UT4A 3FU0A 4CDRA 3OXFA 4J8YA 5KJNA 3FH8A 1K1BA 2GRPB 2IO2C 4I17A 1YMPA 1DNPA 3MZLB 1HG2A 3CK9A 3KD7A 3P1UA 3F6QA 3QARA 2OEWA 4WAFA 1O1RA 2WXOA 3DRAA 3D9MA 3HIZA 5JJ7A 3ML8A 2DBAA 4O60A 5FQ4A 4IN3B 2LAIA 1OY3D 1JCSA 2DWZA 4U0SA 2XEHA 1O1SA 3DXMG 2YHCA 2F8XK 4RG6A 4GA0A 5G04J 3L17A 4DX2A 3D9PA 2XCBA 4EZKA 1AWCB 3KSQA 3UT7A 4JPSA 2B6CA 3UXGA 2CHXA 2ZGDA 1TEZA 3SGHA 3ZXPA 2EIKE 4KVOA 3KEAA 1ZBPA 4J8FA 5D2MC 5EIDA 4UI9J 1MQSA 1G3NB 4BTAA 3CLJA 3HHMA 5ANLA 4A63B 4RG9A 3RK6A 3CVYA 2JABA 1H2TC 2LXLA 2V5QC 4B89A 3RRNB 3HXDA 3MKQB 1OT8A 5BT1A 3RRUA 4GMLA 3IV0A 4R7LA 2XQ0A 3RRMB 1WM5A 1PY1A 4JW1A 2WXQA 4K0RA 4O1OA 3CKBA 4UWKA 4P29A 2X3MA 5ENPD 5A6CA 3DPYA 2NSZA 4UQZA 3D9HA 4U07A 2XPYA 4XKBA 2XS1A 3C3QA 3FTUA 3LEWA 3QWWA 3BUAA 3LYAA 4K03A 1UG3A 5ENNA 3SF4A 4JA7A 2VQ2A 2L0IA 1E8ZA 3PH0C 4U0ZA 2LNIA 3PVLA 1ELWA 2IF4A 4NRHB 4F6RD 2PM6A 2WPVA 4J6IA 3SO8A 3DEOA 3U66A 4UUCA 2EIJE 4O1PA 4EHMA 4EBAA 3PNTB 4I43A 3ASNE 5FWQA 2WXPA 4FADA 1IHBA 3QAQA 1S63A 1DCEA 2I1KA 3S7JA 4DI3A 4CDMA 4I6JA 1Z3XA 3C3OA 1P5QA 3FUHA 2J4DA 3G2UA 3L13A 4DUIA 3HDXA 4FHKA 3ASHA 3EU9A 3PEUB 5IY5E 1W3BA 4GTSA 1FT2A 1SA4A 4M7CA 2V5FA 3RU0A 3ASDA 4GTVA 3VTXA 3UIOC 4HI8A 2XEEA 1X5BA 2LAHA 5CMYA 3RSEG 4JB8P 3WXXA 2ZGGA 3GW4A 1QBQA 4DX1A 2C0MA 2GRNB 3NBNB 2VSNA 2QYJA 3UIPC 4OAVB 5FIOA 3J5QB 4HQDA 3UUXA 4Q69A 4GB9A 3UKRG 3UTMA 5E75A 3ZU7B 3B7RL 3FY4A 4ZFHA 4L2LA 5FT9A 4K5CA 3TWWA 4GZCA 5CRUA 2AXVA 4BY6A 3LKUA 1UJJA 3GZ2A 3ESLA 2LUHA 3DSVA 4JHRA 3SI5A 5JA4D 3U3WA 3ULYA 4BESA 4TXQA 3D9IA 1E8YA 1MJ0A 3AG2E 4ME2A 1LD7A 5FINA 4HOQA 3TWVA 4I1MA 2IY0C 1E8WA 3FUJA 3EIQC 4HRNA 2F8YA 1OCZE 3CQGB 2XPZA 2BF0X 2AXZA 2B0OE 2VGYA 2IONA 4AY5A 3CHSA 4LNUD 3U4TA 3L54A 1BI8B 2QFCA 4FLHA 3ZIMA 3OXGA 5JHAA 3MCXA 4AIFA 2VJ8A 2H6HA 1UN8A 5G05C 3UMVA 4N5CA 1SA5A 3ZHEA 4FP7A 2P9LG 3D9LA 5HRYA 5ANRA 1OCOE 1NL4A 1MZCA 2RG8A 4F1PA 3P2BA 5E76A 2P58C 2KBXA 2DYRE 2E0IA 2KCKA 2GGFA 3TG4A 2WVIA 3MV2B 1UW4B 4YDOA 1IQRA 3CSFA 3T8MA 5JJTA 4X8QA 3PZ3A 2XCCA 1TJFA 1TR4A 3PS6A 2OEVA 3GZSA 5JJ6A 2Y0BG 3Q78A 1WDYA 4U7EB 3L82A 3CVQA 2L6JA 1SZAA 4CEMA 3S7FA 3Q5MA 1Z3YA 2OVBA 3B13A 3ZKJA 3VLDA 3E4BA 3L6AA 4CT0A 1RW2A 3E37A 4GYYA 3Q49B 3VTYA 4KBQA 1SVXA 3R7QA 2FEZA 3CK7A 3LCAA 5EILA 3SFZA 4ABNA 3Q47B 3E33A 4QFVA 3VLFA 2Y4UA 2KM4A 1B89A 3AG3E 4H7XA 4BSXA 4PS8A 2C2LA 2FULA 4ACKA 2WM9A 5AQBA 3TWUA 5CCLA 3ZXSA 1A5EA 3TWXA 5FZSA 3CHPA 1FT1A 4UI9C 1E96B 2X6HA 3FTZA 3EHQA 3EHNA 3TWQA 3V79K 5A7DB 1NFIE 1HU3A 3DSXA 3OAWA 4JC8A 3FHEA 3FUFA 2XZTG 4J7WA 5KNHD 5G04C 3T5VA 1QQEA 4DX7D 4ILHB 4NIKA 2X6JA 3APDA 2AVPA 3PZDA 1KZOA 4IULA 3FTXA 1MX4A 5FTPA 2HR2A 3FH7A 2BKKB 3BEEA 3ONKA 4CGWA 2MRIA 2XGMA 4GTTA 4K5AB 2E2EA 3SNXA 3J5PA 4GZ3A 5D66A 2I2OA 5LCWC 4APFA 3MYVA 1JWGA 2GRLA 4NQ0A 5BXOA 1NA0A 2IOSA 1U2VG 1PAQA 1H6OA 5AIJA 2MYOA 4YVOA 2P9NG 3DPDA 1BD8A 1FCHA 2I9CA 4EZJA 3OXLA 4V3IA 5CBNA 3CVLA 3V31A 4C0EA 3ZHEB 1N4QA 2GROB 4ATGA 4WNDA 3CHOA 4OVVA 3B7TA 3TAXA 4WNGA 3EHRA 3FU5A 3LS8A 3HG0D 3ABLE 2ZU6B 3LVQE 2XENA 3MKRA 2FO1E 3ULEG 4GU5A 4GZ6A 2A4ZA 2I6HA 5FQ8A 2AJAA 3HRAA 5CEDB 2RD0A 5J08A 4OVUA 4JHKA 3LY8A 5T8IA 4LG6A 2X6KA 5AARA 4N2SA 2PM7A 4GTQA 3V30A 4KMOA 2P9PG 2J9QA 3Q9NC 1IYGA 4AJWA 3G2VA 5G2NA 2HYZA 5EX3A 1MHQA 2I1JA 3AG1E 3NZUA 3ABKE 4GMRA 1YYHA 2WQ6A 4YVQC 2ONDA 5AQ9A 2VSOE 4L23A 4JL0A 2R59A 3FTSA 3QNKA 2WXGA 2KCLA 5LOZA 3D9OA 2WXRA 5KJKA 3TXNA 1BPOA 3DWLG 3UQ3A 2KATA 4F3VA 1V55E 3IEGA 3PZ2A 4L9PA 4ANWA 3Q4AB 4MKTA 3UT8A 4GTPA 1UOHA 3FUKA 3EJNA 4MRUA 5AJLA 3KS2A 2VGEA 4IRUA 4J0UA 4PDXA 1E7VA 3RIBA 4HVBA 3PDNA 3GZ1A 3PUKA 3C72A 4CCAA 1WAO1 2X6FA 4DLOA 1N94A 2UY1A 5CMWA 4PS7A 1OWPA 3LY9A 2WMNA 4HI9A 4HOUA 4A1SA 1FVHA 2OV8A 4AY6A 5DBKA 4WWNA 1XGWA 4D10C 1WG0A 5FQ7A 1INZA 4AEZC 3Q75A 1OWLA 1TNOA 1N4PA 1HO8A 3FULA 4O6FA 3CGHA 3FH5A 4U0UA 5BXUA 4PH4B 5FZQA 2R02A 3CIAA 4AM9A 2KZTB 3EUVA 4I2ZA 1EF1C 3R7RA 2OCCE 4I1AA 4B8AA 3QK0A 3FTVA 2YQ8A 2ZISA 3MV3B 3CVWA 3Q79A 4E6HA 5JMND 4C9BB 1JPLA 5ENOD 5B1AE 3BG0B 2NYJA 1ZB1A 3ZYLA 3IKOB 4URKA 1HFAA 1OCCE 1A17A 4ATZD 4G8LA 4UI9K 4I1OB 2L9BA 3LJ3A 5T3RA 2ZXWE 4HXIA 3ZEFA 4KYOB 2WB2A 5KWDA 2IEJA 1TNZA 4TXRA 5CEAA 1HF8A 4MBGA 5HQ8A 5KCMA 4DJAA 4UWHA 3PE3A 3BU8A 3PE4A 1MYOA 3ZRHA 3UX4A 3SFXA 2XHEA 2DIWA 4RVBA 4GA2A 3JUEA 3RO3A 4NURA 4XE0A 1BI7B 2WXIA 3JCKC 4GYOA 1QYMA 3Q15A 3OTNA 4C48B 2RKKA 1NI1A 2L0TB 1DVPA 5AYWD 5AQAA 1Q2ZA 3ESKA 2PQRA 5AN8A 3ZVVA 2OOEA 2V4LA 3CVVA 3AU5A 1H6KA 3B7SA 1QNFA 1S0PA 3HXBA 3O48A 5EIBE 1Z6TA 1HH8A 3SZ7A 2J07A 1NP7A 4A3VA 4AVXA 3HVEA 2BTDA 4XEIG 4I9EA 3CVUA 3FP3A 4J8EA 4G25A 3APCA 1SQMA 2IJGX 2P9IG 3JXJA 4XI9A 4H7YA 3V2XA 3JXIA 2KCVA 3UM2A 1HE8A 3B95A 4HORA 3AAAC 3HXCA 4XZ4A 4YNDA 1N54A 5KNGA 2MOWA 1FPPA 2XGOA 4WUYA 1D8EA 4HBDA 1N95A 4KZ0A 4ILGA 4E85A 2ETAA 1DC2A 3JQ1A 4KT6B 3NOGD 2IOLA 5ARGA 4UWLA 1OCRE 4JHJA 5LP0A 5KBAA 4XKCA 2NC9A 2PZIA 1OUVA 2DVWA 4U8HA 1VDYA 1SZ9A 1N11A 3FUDA 4AV7A 4F53A 3I4GA 4DX6D 3QWPA 4EECA 4LCTA 3L9TA 5ARFA 3U9WA 2FBNA 3FEXA 2L6BA 1HXIA 3CVXA 5KJMA 2A5UA 2VSYA 2J8SD 3FDHA 3SFYA 2M63A 4B94A 5ENRD 2EQXA 3K9IA 3LXUX 3LPZA 1E90A 4U04A 1O1TA 3KSLA 1MX2A 3MJWA 2AXUA 2GRMA 3URZA 3R9MA 5BV1A 3DXKG 3EIJA 4GYWA 2WMOA 1U3CA 2BKGA 1EDUA 3NOCD 3ULQA 5EYLA 2BUGA 4DI4A 1BLXB 3EU5A 5ITZF 3CHRA 3PZ1A 4MS6A 2LO6A 4BFRA 5EDSA 2V8SE 2XEVA 3TWRA 2XGSA 3S2AA 3Q7AA 3TGOA 2X6IA 2Y1LE 1K8KG 4U96D 4G8KA 1TN6A 3T5XA 3HVEB 2P9KG 5C2YA 2J08A 3TJPA 3T9KA 4BETA 2XRZA 4NACA 4ANXA 4HOSA 1WY6A 4ANUA 1TYQG 5ENSD 3SHFA 4CGVA 5T4YA 3D9NA 3FTWA 4GA1A 3L22A 3MEKA 3QKYA 3I5PA 2IQCA 4LRZA 5G05J 2PNNA 3ZUVB 2KC7A 4CZ2D 3CK8A 2GRRB 4LSZE 4JXTA 4IYPA 4TUUA 2FI7A 1ZU2A 5EKQD 5AQ7A 3ASFA 2UY1B 4HOTA 3QB2A 4G23A 2WXNA 3JUIA 3ZFWA 4FC8A 3BG1B 3CVNA 4A1GA 3TWSA 1XNFA 3LVRE 1K3ZD 2WXJA 3DEPA 3NZSA 4KXKB 2XRYA 5G55A 3ZYQA 4JA9A 4N39A 1NA3A 1TN8A 3CHMA 1ELKA 4TUMA 5HKPA 4PUCA 4HRLA 2CFUA 1NZNA 4YDEA 3AU4A 4JVSA 3HXFA 1BU9A 3FUMA 4J8SA 3PUJA 3DSWA 4HNAD 3X2QE 4Y6WA 5HS0A 1Y8MA 1IQUA 3ML9A 4CDNA 2IFUA 2YINA 5D0QD 2Y4TA 4GAAA 2RFAA 4LUNU 5CERB 3ABME 3D3MA 4B93B 3ONLA 3ZW3A 3QJZA 2VTBA 3B7UX 4ANVA 3QDNA 3CSTA 4A3TA 3UPVA 4L2YA 4GZDA 4BT8A 1TJCA 3DSUA 1TNUA 3VLEA 3AS5A 4MLPA 2DZOA 1H19A 4EPZA 4HB5A 4AP2A 2FF4A 4BSZB 1TNBA 2EINE 1K1AA 1GW6A 1OWOA 3N71A 1E8XA 1KT0A 4QQIA 3AG4E 4YDWA 5CHEE 3IBEA 2EILE 1H6PA 3RKVA 4EZLA 5M72A 3Q73A 2VGXB 2J09A 1U3DA 2ETCA 3WG7E 4JD2G 3DSTA 1N52A 4GMJA 4WWPA 3EHMA 1OXJA 1JCRA 4EBAG 2LXMA 1TNYA 4XIFA 3CHQA 3SBSA 4GTOA 5ENQD 5B1BE 4B0ZA 4Z68A 4M3OA 3TG5A 4JEHA 4DLQA 4XI0A 3CEQA 3MA5A 1FVFA 3UM0A 2HE0A 1LF8A 3QOUA 3MX3A 5LCWJ 2WQ7A 4K5BA 3FFLA 5BNWA 2YHEA 3NQPA 2RFMA 5BPPA 5D0OD 1DCQA 3ZYMA 3HYMB 2HM8A 3S7DA 1ELRA 3LJNA 2P9SG 1HX8A 2QYUA 3S7BA 2XZDG 4EQFA 2J4BA 2JLBA 3G2WA 4RSYA 3AS8A 5DIZA 4UQYA 3Q7FA 3UINC 1H2UA 5FZRA 3FTYA 5CCMA 3CVPA 3L16A 4RQIA 4F1SA 4N3BA 2Y69E 4G2VA 2R03A 4ACLA 3TL5A 3ISMC 3KEZA 5B3SE 5KJLA 2NXPA 5EN5D 2V4HC 1L5JA 2QY7A 2H6IA 3HXEA 3ENEA 1QZ2A 1IKND 3SD5A 4AOFA 2H6GA 3I4RB 3E30A 2VTBB 3PZ4A 3T8KA 2PL2A 4N3CA 3UM1A 3EDTB 3ZYKA 2H6FA 2R2LA 2R05A 3AS4A 2WQHA 1RZ4A 4LERA 3DSSA 4Q94A 1JCQA 4I2WA 1D9SA 2CHWA 4CYMD 4GCNA 1N4SA 2DYSE 4GZ5A 3UKUG 5AENA 3GYZA 4G26A 4A55A 3ZGQA 4N3AA 4UWFA 3IHVA 4WNFA 3LY7A 4GTRA 1OWMA 1Y6IA 3FU3A 3ASOE 2CG2A 3CR3A 1O5MA 1KLXA 2X38A 4TV3A 1HG5A 5BV0A 2CG3A 1KT1A 2ETBA 2PQNA 3QC1A 3NAWA 3TXMA 3FUNA 3FUEA 4BERA 3JYSA 3SQVA 1AP7A 2V0PA 4BWRA 2DZNA 5FJYA 1HZ4A 2P2CP 2AW6A 1IXVA 3IXEA 2A5EA 2IU1A 1D8DA 2UWJG 2KXPC 2WXFA 5BW8C 4BX8A 3E32A 5HI7A 1TN7A 3ASGA 5CRVA 4N2QA 4HLEA 4YDYA 4DRXE 4BX9A 3PEVB 1N0RA 1KPSB 1UJKA 5C1DA 4GTMA 3SY2A 3NF1A 4BEPA 2EIME 3FU6A 1EPUA 1N4RA 1KZPA 3ZNGA 4OAUC 5AJDA 2VSXE 2WXLA 2LSUA 5ENTD 1SW6A 2HO1A 4U8YD 3NB2A 3BQOA 5BUZA 4LNGA 3CQCB 2XPIA 4GPKA 4I6EA 4Y6CA 3C5RA 2YNQA 4UWGA 1HS6A 3C3RA 4GCOA 4ZHBA 1OWNA 4CRWA 4JEUA 2KZTA 1EYHA 4L1BA 1H0AA 5AAOA 2Q7FA 4L7TA 3DBSA 1N9AA 3E34A 1Z5SC 1N0QA 4W9RA 3IHYA 1JUQA 4RLYA 4XX5A 2OVFA 3I3NA 2XS8A 2JEKA 4B8CB 4TRQA 4Q96A 4TXPA 4FJZA 4DK5A 4FJYA 3D9KA 2GW1A 3O4ZA 4FLBA 4FHJA 4ILIA 4I6GA 2FO7A 1MX6A 1V54E 3FWVA 4KZCA 3RO2A 3D9JA 4UQXA
chains in the Genus database with same CATH topology
2AXVA 5DBKA 4WWNA 1XGWA 3ML9A 3ZPJA 3LKUA 4BTBA 4BY6A 2IFUA 4CDNA 4D10C 1UJJA 5FQ7A 1INZA 1UN9A 2R17C 4AEZC 1OWLA 2YINA 2WXHA 5D0QD 3PRZA 1HO8A 3FULA 3GZ2A 4I9CA 4O6FA 2Y4TA 3ESLA 3CGHA 4GAAA 1H2VC 4LUNU 3FH5A 4JHRA 2AWIA 3APFA 3D3MA 3PNLB 5FQ6A 3SI5A 4JZYA 3ONLA 3ZW3A 4U0UA 3U3WA 4PH4B 5FZQA 3SBTB 3D9IA 3QJZA 1E8YA 3B7UX 3CIAA 3FUIA 2KZTB 4AM9A 4FU3A 4ANVA 2VTBA 2J49A 4I2ZA 4LEUA 3QDNA 4ME2A 3MGBA 4DPRA 1EF1C 3CSTA 4HOQA 3RJVA 3R7RA 4I1MA 4I1AA 4B8AA 4A3TA 3QK0A 4G11A 3FTVA 3UPVA 2YQ8A 1E8WA 3FUJA 4L2YA 3EIQC 4GZDA 3ZN3A 4CT4A 4BT8A 1TJCA 3CQGB 2CHZA 2XPZA 3MV3B 3U64A 4BT9A 3CVWA 3PREA 2BF0X 4AXHA 2AXZA 2VGYA 4E6HA 3VLEA 5LFAA 2IONA 4AY5A 3CHSA 3U4TA 3AS5A 3L54A 4MLPA 2QFCA 4FLHA 1H19A 3ZIMA 3OXGA 4C9BB 3CV0A 4EPZA 1JPLA 5JHAA 3MCXA 4AIFA 2FF4A 4AP2A 3BG0B 2VJ8A 1IHGA 3ZYLA 1UN8A 5G05C 3UMVA 5LX8A 4N5CA 3IKOB 1GW6A 3R9AB 1HFAA 1OWOA 1A17A 4URKA 3KAEA 3N71A 4UI9K 1PC2A 4I1OB 2L9BA 3LJ3A 4WWOA 5T3RA 1E8XA 1KT0A 2CFZA 3ZHEA 3G2SA 4HXIA 3ZEFA 4J8DA 4FP7A 5J90A 4KYOB 5CHEE 3D9LA 3IBEA 2WB2A 4U63A 5ANRA 3RKVA 2RG8A 4EZLA 5M72A 3P2BA 5E76A 2P58C 1HF8A 5HQ8A 3L08A 2WXMA 5KCMA 4DJAA 4UWHA 4HS2A 2VGXB 2E0IA 2J09A 2KCKA 2GGFA 4FA6A 1U3DA 3PE3A 4APOA 3CKCA 3LDZA 3PE4A 3TG4A 3ZRHA 4KVMA 2WVIA 3MV2B 3UX4A 4G24A 2ILRA 1UW4B 2XHEA 1N52A 2C0LA 2LSVA 4GMJA 1IQRA 2DCPA 4WWPA 1YA0A 3EHMA 4FULA 2VGXA 3CSFA 3T8MA 2DIWA 5JJTA 4EBAG 4RVBA 4GA2A 4XIFA 2VYIA 2XCCA 3RO3A 3CHQA 3SBSA 1E7UA 4PS3A 1TJFA 4NURA 3JQ0A 3PS6A 2Y3AA 2R5SA 3MKQA 4B0ZA 4C0MA 4XE0A 3GZSA 4M3OA 3TG5A 5JJ6A 4JEHA 5EX0A 1JWFA 5A23A 3G2TA 2WXKA 4WNEA 2WXIA 2L6JA 3CVQA 4DLQA 1SZAA 3JCKC 4XI0A 3QWVA 4CEMA 3S7FA 4F7AA 3Q5MA 1Z3YA 2OVBA 3B13A 4GYOA 2MHKA 3CEQA 3MA5A 3Q15A 3OTNA 4HFGA 1FVFA 4G1TA 3VLDA 1LF8A 3QOUA 3E4BA 3MX3A 5LCWJ 2WQ7A 4OYSA 2L0TB 1DVPA 3L6AA 5AYWD 4CT0A 3ESKA 3FFLA 2PQRA 4GYYA 3ZVVA 5BNWA 2OOEA 2V4LA 3Q49B 3VTYA 4KBQA 2YHEA 3FEYA 3R7QA 3AU5A 3C98A 1H6KA 3B7SA 3FU0A 3NQPA 3UT4A 1QNFA 1S0PA 2FEZA 3CK7A 3O48A 1Z6TA 1HH8A 3LCAA 3SZ7A 4CDRA 3OXFA 5BPPA 5KJNA 3SFZA 4ABNA 2J07A 3FH8A 5D0OD 1NP7A 3ZYMA 3Q47B 4I17A 1DNPA 3HYMB 3MZLB 3HVEA 4A3VA 1HG2A 4AVXA 2HM8A 4QFVA 3CK9A 3KD7A 3P1UA 3VLFA 2BTDA 2Y4UA 2KM4A 1B89A 4I9EA 4H7XA 3S7DA 3QARA 3CVUA 1ELRA 4BSXA 3FP3A 4J8EA 4PS8A 2C2LA 4WAFA 4G25A 2FULA 1HX8A 3APCA 2WXOA 3S7BA 1SQMA 2IJGX 3D9MA 4EQFA 4XI9A 3HIZA 4H7YA 2J4BA 2JLBA 4ACKA 3G2WA 4RSYA 5JJ7A 2KCVA 2WM9A 1HE8A 3AS8A 3ML8A 5DIZA 2DBAA 4UQYA 5FQ4A 1H2UA 5FZRA 4HORA 5CCLA 3ZXSA 3FTYA 5FZSA 4IN3B 3CHPA 2LAIA 4UI9C 4XZ4A 4YNDA 1N54A 3CVVA 1E96B 2MOWA 2X6HA 3CVPA 5CCMA 3FTZA 3L16A 3EHNA 4U0SA 4N3BA 5A7DB 4F1SA 2XGOA 4WUYA 4G2VA 1HU3A 4ACLA 3TL5A 3OAWA 2YHCA 3KEZA 4RG6A 5KJLA 4GA0A 5G04J 2NXPA 3L17A 3D9PA 4JC8A 3FHEA 4KZ0A 2XCBA 4EZKA 3FUFA 1L5JA 2QY7A 4ILGA 4E85A 3ENEA 1QZ2A 3SD5A 3JQ1A 3UT7A 4KT6B 4AOFA 2IOLA 3I4RB 4JPSA 5G04C 5ARGA 2VTBB 4UWLA 5JHBA 3T5VA 1QQEA 2PL2A 4N3CA 4ILHB 4JHJA 2CHXA 2X6JA 3APDA 2AVPA 5LP0A 1TEZA 3SGHA 3PZDA 4XKCA 2NC9A 2PZIA 1OUVA 3EDTB 4KVOA 3ZYKA 1ZBPA 4IULA 3FTXA 4J8FA 4U8HA 5FTPA 3AS4A 2WQHA 2HR2A 4UI9J 1MQSA 3FH7A 1VDYA 3BEEA 4BTAA 1SZ9A 3ONKA 4CGWA 3CLJA 3FUDA 2MRIA 2XGMA 3HHMA 4LERA 4AV7A 4Q94A 5ANLA 4F53A 3I4GA 3QWPA 4RG9A 2E2EA 4I2WA 3SNXA 4AY6A 4GZ3A 4EECA 4LCTA 5ARFA 3RK6A 2CHWA 3U9WA 2I2OA 5LCWC 3CVYA 4APFA 3MYVA 2FBNA 1JWGA 3FEXA 4GCNA 2GRLA 1H2TC 1HXIA 3CVXA 4B89A 4NQ0A 3RRNB 4GZ5A 5KJMA 3MKQB 5BT1A 3RRUA 2A5UA 1NA0A 2VSYA 3GYZA 4GMLA 5AENA 4G26A 4A55A 2IOSA 3ZGQA 3IV0A 4N3AA 4UWFA 3FDHA 4R7LA 2M63A 1PAQA 4B94A 5AIJA 3IHVA 2XQ0A 3RRMB 4WNFA 4YVOA 1WM5A 3DPDA 2EQXA 3K9IA 3LY7A 1PY1A 1OWMA 1Y6IA 3FU3A 4JW1A 1FCHA 3LXUX 3LPZA 2CG2A 1E90A 2WXQA 2I9CA 3CR3A 4U04A 1KLXA 4EZJA 2X38A 4K0RA 3OXLA 4V3IA 3CKBA 4TV3A 4UWKA 4P29A 2X3MA 3CVLA 1HG5A 4C0EA 5A6CA 3ZHEB 5BV0A 2CG3A 1KT1A 2PQNA 3QC1A 2NSZA 3MJWA 4UQZA 2AXUA 2GRMA 3URZA 4U07A 4ATGA 2XPYA 4XKBA 4WNDA 5BV1A 3TXMA 3CHOA 3FUNA 4OVVA 3FUEA 3B7TA 3FTUA 3EIJA 4GYWA 2WMOA 3TAXA 1U3CA 3LEWA 3QWWA 3JYSA 4WNGA 3LYAA 3FU5A 2V0PA 1EDUA 3LS8A 4K03A 4BWRA 1UG3A 5FJYA 2ZU6B 1Y8MA 1HZ4A 2AW6A 3ULQA 5ENNA 3SF4A 2BUGA 2IU1A 2UWJG 3LVQE 4JA7A 4DI4A 2WXFA 5BW8C 4BX8A 3MKRA 2VQ2A 2L0IA 4GU5A 3CHRA 4MS6A 2LO6A 4BFRA 5EDSA 1E8ZA 5HI7A 2V8SE 2XEVA 3ASGA 3PH0C 4GZ6A 2A4ZA 2I6HA 4N2QA 2XGSA 4U0ZA 2LNIA 5FQ8A 3S2AA 3PVLA 4HLEA 4BX9A 1ELWA 3PEVB 2X6IA 3TGOA 2IF4A 4NRHB 1UJKA 2PM6A 2WPVA 2RD0A 3T5XA 5C1DA 3HVEB 5J08A 4OVUA 4JHKA 3LY8A 5T8IA 4J6IA 3U66A 3NF1A 5C2YA 2J08A 3TJPA 2X6KA 2XRZA 4N2SA 4NACA 4ANXA 4HOSA 2PM7A 1WY6A 4KMOA 4ANUA 3FU6A 4EBAA 2J9QA 3PNTB 4I43A 1IYGA 5FWQA 2WXPA 1EPUA 4FADA 3SHFA 4CGVA 4AJWA 3G2VA 3QAQA 5G2NA 5AJDA 2VSXE 2HYZA 2WXLA 5EX3A 2LSUA 2I1KA 1MHQA 5T4YA 3D9NA 2I1JA 3FTWA 3NZUA 3S7JA 4GA1A 4CDMA 4DI3A 2HO1A 3L22A 3MEKA 4I6JA 1Z3XA 3QKYA 1P5QA 3FUHA 3I5PA 5BUZA 2IQCA 3CQCB 4LRZA 2WQ6A 5G05J 2J4DA 2XPIA 4YVQC 3G2UA 3L13A 2ONDA 4I6EA 4GPKA 4Y6CA 2VSOE 2YNQA 3HDXA 4L23A 4UWGA 4JL0A 4FHKA 2R59A 3ASHA 1HS6A 2KC7A 3FTSA 3QNKA 2WXGA 3CK8A 2KCLA 5LOZA 3PEUB 4JXTA 3D9OA 4GCOA 2WXRA 2FI7A 4IYPA 1OWNA 1ZU2A 4TUUA 5EKQD 5KJKA 3ASFA 3TXNA 4CRWA 1W3BA 1BPOA 2UY1B 4JEUA 4HOTA 3QB2A 3UQ3A 2KZTA 2KATA 4G23A 2WXNA 3JUIA 3ZFWA 4F3VA 2V5FA 4FC8A 1EYHA 3BG1B 3CVNA 3ASDA 3RU0A 4L1BA 1H0AA 4A1GA 3VTXA 2Q7FA 3IEGA 4L7TA 1XNFA 3DBSA 3LVRE 2WXJA 1X5BA 4ANWA 3NZSA 3Q4AB 2LAHA 4MKTA 3IHYA 4W9RA 3UT8A 1JUQA 5CMYA 4XX5A 4KXKB 2XRYA 5G55A 2OVFA 3FUKA 3EJNA 3ZYQA 3WXXA 3I3NA 4JA9A 2JEKA 3GW4A 4MRUA 4N39A 4B8CB 1NA3A 3CHMA 5AJLA 1ELKA 4TRQA 3KS2A 4FJZA 4IRUA 2C0MA 4PUCA 2CFUA 1NZNA 4FJYA 4J0UA 3D9KA 4Q96A 4PDXA 4DK5A 1E7VA 2VSNA 2GW1A 3RIBA 4HVBA 3AU4A 3O4ZA 3PDNA 4FLBA 4FHJA 4ILIA 3GZ1A 4JVSA 4I6GA 3PUKA 3FUMA 4CCAA 1WAO1 2FO7A 4J8SA 3UUXA 2X6FA 4DLOA 4Q69A 3PUJA 2UY1A 4GB9A 5CMWA 4PS7A 1OWPA 3FWVA 3LY9A 2WMNA 5E75A 4KZCA 4Y6WA 3RO2A 4HOUA 3B7RL 4UQXA 4A1SA 3FY4A 4L2LA 5FT9A 1FVHA 2OV8A 3D9JA 4GZCA 1IQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBK A;  3ZPJ A;  4BTB A;  2R5S A;  3LKU A;  1QQE A;  2IFU A;  2WPV A;  2PL2 A;  4NRH B;  4N3C A;  3TG5 A;  5C1D A;  5JJ6 A;  3LY8 A;  5EX0 A;  2AVP A;  5D0Q D;  3NF1 A;  3GZ2 A;  4I9C A;  2NC9 A;  2PZI A;  1OUV A;  2Y4T A;  3EDT B;  4O6F A;  4WNE A;  3CVQ A;  2L6J A;  1ZBP A;  4N2S A;  4JHR A;  4XI0 A;  3QWV A;  3S7F A;  3Q5M A;  4HOS A;  4J8F A;  4GYO A;  4U0U A;  5FTP A;  2MHK A;  3CEQ A;  3AS4 A;  2WQH A;  2HR2 A;  3MA5 A;  3Q15 A;  4UI9 J;  5FZQ A;  4G1T A;  3RIB A;  3BEE A;  4AM9 A;  4BTA A;  4CGW A;  2J9Q A;  1IYG A;  3QOU A;  3E4B A;  4I2Z A;  3QDN A;  2XGM A;  4LEU A;  5LCW J;  4CGV A;  4ME2 A;  5AYW D;  3QWP A;  4HOQ A;  4RG9 A;  2E2E A;  4I2W A;  3RJV A;  4AY6 A;  2HYZ A;  3ESK A;  3FFL A;  2LSU A;  2PQR A;  4GYY A;  4GZ3 A;  4I1A A;  5EX3 A;  3S7J A;  5BNW A;  3UPV A;  2YQ8 A;  2OOE A;  4GA1 A;  3Q49 B;  2HO1 A;  3VTY A;  4KBQ A;  3MEK A;  5ARF A;  3ZN3 A;  3QKY A;  5LCW C;  4BT8 A;  2FEZ A;  1P5Q A;  3CK7 A;  3U3W A;  1TJC A;  2FBN A;  3O48 A;  3MV3 B;  1HH8 A;  3LCA A;  4GCN A;  3SZ7 A;  3OXF A;  4BT9 A;  4CDR A;  5G05 J;  1HXI A;  5KJN A;  4ABN A;  2XPI A;  4YVQ C;  4GPK A;  5D0O D;  2OND A;  4NQ0 A;  4GZ5 A;  2VGY A;  3Q47 B;  4Y6C A;  4I17 A;  5KJM A;  5BT1 A;  3HYM B;  2VSY A;  1NA0 A;  4JL0 A;  3GYZ A;  4AY5 A;  3U4T A;  3CK9 A;  3ASH A;  3KD7 A;  4G26 A;  2KC7 A;  4N3A A;  3ZGQ A;  3AS5 A;  3CK8 A;  2Y4U A;  2KCL A;  2QFC A;  4B94 A;  1B89 A;  4I9E A;  4H7X A;  3S7D A;  4GCO A;  1ELR A;  2FI7 A;  3FP3 A;  1ZU2 A;  3OXG A;  3CV0 A;  4J8E A;  1WM5 A;  2C2L A;  3ASF A;  4YVO A;  4G25 A;  5EKQ D;  4AIF A;  2FF4 A;  3K9I A;  3LY7 A;  5KJK A;  3S7B A;  4APO A;  1FCH A;  1W3B A;  3LPZ A;  1IHG A;  2UY1 B;  5G05 C;  4HOT A;  4N5C A;  4U04 A;  1KLX A;  2KAT A;  4G23 A;  3UQ3 A;  3OXL A;  4XI9 A;  3R9A B;  4H7Y A;  3CKB A;  1A17 A;  2JLB A;  3ZFW A;  4F3V A;  2V5F A;  3CVL A;  3KAE A;  3N71 A;  2KCV A;  1PC2 A;  3CVN A;  3ASD A;  4UI9 K;  3RU0 A;  3ZHE B;  5A6C A;  3VTX A;  2Q7F A;  1KT1 A;  3AS8 A;  3IEG A;  1KT0 A;  5DIZ A;  2PQN A;  2DBA A;  1XNF A;  4UQY A;  3ZHE A;  4UQZ A;  4EQF A;  4J8D A;  5FZR A;  4KYO B;  3URZ A;  4U07 A;  3Q4A B;  5CHE E;  4HOR A;  4W9R A;  5CCL A;  4WND A;  3RKV A;  5M72 A;  4KXK B;  5FZS A;  4IN3 B;  3WXX A;  4JA9 A;  4WNF A;  2P58 C;  3GW4 A;  5HQ8 A;  4N39 A;  4GYW A;  1NA3 A;  4UI9 C;  4YND A;  3TAX A;  1E96 B;  3QWW A;  5CCM A;  3CVP A;  3JYS A;  2VGX B;  3KS2 A;  4WNG A;  2KCK A;  3LYA A;  2C0M A;  4J0U A;  1NZN A;  4BWR A;  2VSN A;  2GW1 A;  4U0S A;  4N3B A;  5FJY A;  3PDN A;  2XGO A;  3PE3 A;  4G2V A;  4WUY A;  1HZ4 A;  3GZ1 A;  3CKC A;  5A7D B;  3PE4 A;  3TG4 A;  3ULQ A;  3SF4 A;  3MV2 B;  2YHC A;  1WAO 1;  2FO7 A;  2BUG A;  4G24 A;  2UWJ G;  4JA7 A;  4RG6 A;  3UUX A;  5KJL A;  2C0L A;  4GA0 A;  2LSV A;  5BW8 C;  3MKR A;  5G04 J;  2UY1 A;  2VQ2 A;  5JJ7 A;  1YA0 A;  2VGX A;  2XCB A;  3FWV A;  3LY9 A;  5HI7 A;  2XEV A;  3ASG A;  4GZ6 A;  4Y6W A;  5JJT A;  4N2Q A;  2I6H A;  4GA2 A;  2XGS A;  4U0Z A;  3RO2 A;  4XIF A;  4HOU A;  2LNI A;  2VYI A;  2XCC A;  4A1S A;  1QZ2 A;  3RO3 A;  1ELW A;  5FT9 A;  3TGO A;  1Y8M A;  2IF4 A;  5G04 C;  4UQX A;  5ARG A; 
#chains in the Genus database with same CATH topology
 5JHB A;  3ZPJ A;  4BTB A;  1LTX A;  1UN9 A;  2R17 C;  3UI2 A;  2WXH A;  4U95 D;  3PRZ A;  4I9C A;  2F0Y A;  1H2V C;  4N5Q A;  4LNB A;  2AWI A;  3APF A;  3PNL B;  5FQ6 A;  4JZY A;  3SBT B;  3FUI A;  4FU3 A;  2J49 A;  2QC9 A;  4LEU A;  4U8V D;  3UM3 A;  5H7P A;  3MGB A;  4DPR A;  3RJV A;  4G11 A;  3B7B A;  2F37 A;  3ZN3 A;  4CT4 A;  4GPM A;  2CHZ A;  3U64 A;  3W9G A;  3W9F A;  3PRE A;  4BT9 A;  4AXH A;  5LFA A;  2ZIR A;  3CV0 A;  3V2O A;  5EYP F;  1IHG A;  4HRM B;  5LX8 A;  3R9A B;  3KAE A;  1PC2 A;  4WWO A;  2CFZ A;  3G2S A;  4J8D A;  5J90 A;  4U63 A;  2BED A;  2GRQ B;  3L08 A;  2WXM A;  4HS2 A;  3Q9U C;  4FA6 A;  4APO A;  3CKC A;  3LDZ A;  4KVM A;  2P9U G;  4G24 A;  2ILR A;  2C0L A;  2LSV A;  2DCP A;  1YA0 A;  4FUL A;  2VGX A;  5CEC B;  5CBO A;  3AJI A;  2VYI A;  1E7U A;  4PS3 A;  3JQ0 A;  2Y3A A;  2IO3 C;  2R5S A;  3MKQ A;  4C0M A;  3RAU A;  1LD8 A;  5EX0 A;  1JWF A;  4DX5 D;  2QZA A;  5A23 A;  3G2T A;  2WXK A;  4WNE A;  4F7A A;  3QWV A;  3TWT A;  2MHK A;  4HFG A;  4G1T A;  4OYS A;  1S70 B;  1S64 A;  4HLL A;  1YCS B;  3FEY A;  3C98 A;  1X81 A;  3UT4 A;  3FU0 A;  4CDR A;  3OXF A;  4J8Y A;  5KJN A;  3FH8 A;  1K1B A;  2GRP B;  2IO2 C;  4I17 A;  1YMP A;  1DNP A;  3MZL B;  1HG2 A;  3CK9 A;  3KD7 A;  3P1U A;  3F6Q A;  3QAR A;  2OEW A;  4WAF A;  1O1R A;  2WXO A;  3DRA A;  3D9M A;  3HIZ A;  5JJ7 A;  3ML8 A;  2DBA A;  4O60 A;  5FQ4 A;  4IN3 B;  2LAI A;  1OY3 D;  1JCS A;  2DWZ A;  4U0S A;  2XEH A;  1O1S A;  3DXM G;  2YHC A;  2F8X K;  4RG6 A;  4GA0 A;  5G04 J;  3L17 A;  4DX2 A;  3D9P A;  2XCB A;  4EZK A;  1AWC B;  3KSQ A;  3UT7 A;  4JPS A;  2B6C A;  3UXG A;  2CHX A;  2ZGD A;  1TEZ A;  3SGH A;  3ZXP A;  2EIK E;  4KVO A;  3KEA A;  1ZBP A;  4J8F A;  5D2M C;  5EID A;  4UI9 J;  1MQS A;  1G3N B;  4BTA A;  3CLJ A;  3HHM A;  5ANL A;  4A63 B;  4RG9 A;  3RK6 A;  3CVY A;  2JAB A;  1H2T C;  2LXL A;  2V5Q C;  4B89 A;  3RRN B;  3HXD A;  3MKQ B;  1OT8 A;  5BT1 A;  3RRU A;  4GML A;  3IV0 A;  4R7L A;  2XQ0 A;  3RRM B;  1WM5 A;  1PY1 A;  4JW1 A;  2WXQ A;  4K0R A;  4O1O A;  3CKB A;  4UWK A;  4P29 A;  2X3M A;  5ENP D;  5A6C A;  3DPY A;  2NSZ A;  4UQZ A;  3D9H A;  4U07 A;  2XPY A;  4XKB A;  2XS1 A;  3C3Q A;  3FTU A;  3LEW A;  3QWW A;  3BUA A;  3LYA A;  4K03 A;  1UG3 A;  5ENN A;  3SF4 A;  4JA7 A;  2VQ2 A;  2L0I A;  1E8Z A;  3PH0 C;  4U0Z A;  2LNI A;  3PVL A;  1ELW A;  2IF4 A;  4NRH B;  4F6R D;  2PM6 A;  2WPV A;  4J6I A;  3SO8 A;  3DEO A;  3U66 A;  4UUC A;  2EIJ E;  4O1P A;  4EHM A;  4EBA A;  3PNT B;  4I43 A;  3ASN E;  5FWQ A;  2WXP A;  4FAD A;  1IHB A;  3QAQ A;  1S63 A;  1DCE A;  2I1K A;  3S7J A;  4DI3 A;  4CDM A;  4I6J A;  1Z3X A;  3C3O A;  1P5Q A;  3FUH A;  2J4D A;  3G2U A;  3L13 A;  4DUI A;  3HDX A;  4FHK A;  3ASH A;  3EU9 A;  3PEU B;  5IY5 E;  1W3B A;  4GTS A;  1FT2 A;  1SA4 A;  4M7C A;  2V5F A;  3RU0 A;  3ASD A;  4GTV A;  3VTX A;  3UIO C;  4HI8 A;  2XEE A;  1X5B A;  2LAH A;  5CMY A;  3RSE G;  4JB8 P;  3WXX A;  2ZGG A;  3GW4 A;  1QBQ A;  4DX1 A;  2C0M A;  2GRN B;  3NBN B;  2VSN A;  2QYJ A;  3UIP C;  4OAV B;  5FIO A;  3J5Q B;  4HQD A;  3UUX A;  4Q69 A;  4GB9 A;  3UKR G;  3UTM A;  5E75 A;  3ZU7 B;  3B7R L;  3FY4 A;  4ZFH A;  4L2L A;  5FT9 A;  4K5C A;  3TWW A;  4GZC A;  5CRU A;  2AXV A;  4BY6 A;  3LKU A;  1UJJ A;  3GZ2 A;  3ESL A;  2LUH A;  3DSV A;  4JHR A;  3SI5 A;  5JA4 D;  3U3W A;  3ULY A;  4BES A;  4TXQ A;  3D9I A;  1E8Y A;  1MJ0 A;  3AG2 E;  4ME2 A;  1LD7 A;  5FIN A;  4HOQ A;  3TWV A;  4I1M A;  2IY0 C;  1E8W A;  3FUJ A;  3EIQ C;  4HRN A;  2F8Y A;  1OCZ E;  3CQG B;  2XPZ A;  2BF0 X;  2AXZ A;  2B0O E;  2VGY A;  2ION A;  4AY5 A;  3CHS A;  4LNU D;  3U4T A;  3L54 A;  1BI8 B;  2QFC A;  4FLH A;  3ZIM A;  3OXG A;  5JHA A;  3MCX A;  4AIF A;  2VJ8 A;  2H6H A;  1UN8 A;  5G05 C;  3UMV A;  4N5C A;  1SA5 A;  3ZHE A;  4FP7 A;  2P9L G;  3D9L A;  5HRY A;  5ANR A;  1OCO E;  1NL4 A;  1MZC A;  2RG8 A;  4F1P A;  3P2B A;  5E76 A;  2P58 C;  2KBX A;  2DYR E;  2E0I A;  2KCK A;  2GGF A;  3TG4 A;  2WVI A;  3MV2 B;  1UW4 B;  4YDO A;  1IQR A;  3CSF A;  3T8M A;  5JJT A;  4X8Q A;  3PZ3 A;  2XCC A;  1TJF A;  1TR4 A;  3PS6 A;  2OEV A;  3GZS A;  5JJ6 A;  2Y0B G;  3Q78 A;  1WDY A;  4U7E B;  3L82 A;  3CVQ A;  2L6J A;  1SZA A;  4CEM A;  3S7F A;  3Q5M A;  1Z3Y A;  2OVB A;  3B13 A;  3ZKJ A;  3VLD A;  3E4B A;  3L6A A;  4CT0 A;  1RW2 A;  3E37 A;  4GYY A;  3Q49 B;  3VTY A;  4KBQ A;  1SVX A;  3R7Q A;  2FEZ A;  3CK7 A;  3LCA A;  5EIL A;  3SFZ A;  4ABN A;  3Q47 B;  3E33 A;  4QFV A;  3VLF A;  2Y4U A;  2KM4 A;  1B89 A;  3AG3 E;  4H7X A;  4BSX A;  4PS8 A;  2C2L A;  2FUL A;  4ACK A;  2WM9 A;  5AQB A;  3TWU A;  5CCL A;  3ZXS A;  1A5E A;  3TWX A;  5FZS A;  3CHP A;  1FT1 A;  4UI9 C;  1E96 B;  2X6H A;  3FTZ A;  3EHQ A;  3EHN A;  3TWQ A;  3V79 K;  5A7D B;  1NFI E;  1HU3 A;  3DSX A;  3OAW A;  4JC8 A;  3FHE A;  3FUF A;  2XZT G;  4J7W A;  5KNH D;  5G04 C;  3T5V A;  1QQE A;  4DX7 D;  4ILH B;  4NIK A;  2X6J A;  3APD A;  2AVP A;  3PZD A;  1KZO A;  4IUL A;  3FTX A;  1MX4 A;  5FTP A;  2HR2 A;  3FH7 A;  2BKK B;  3BEE A;  3ONK A;  4CGW A;  2MRI A;  2XGM A;  4GTT A;  4K5A B;  2E2E A;  3SNX A;  3J5P A;  4GZ3 A;  5D66 A;  2I2O A;  5LCW C;  4APF A;  3MYV A;  1JWG A;  2GRL A;  4NQ0 A;  5BXO A;  1NA0 A;  2IOS A;  1U2V G;  1PAQ A;  1H6O A;  5AIJ A;  2MYO A;  4YVO A;  2P9N G;  3DPD A;  1BD8 A;  1FCH A;  2I9C A;  4EZJ A;  3OXL A;  4V3I A;  5CBN A;  3CVL A;  3V31 A;  4C0E A;  3ZHE B;  1N4Q A;  2GRO B;  4ATG A;  4WND A;  3CHO A;  4OVV A;  3B7T A;  3TAX A;  4WNG A;  3EHR A;  3FU5 A;  3LS8 A;  3HG0 D;  3ABL E;  2ZU6 B;  3LVQ E;  2XEN A;  3MKR A;  2FO1 E;  3ULE G;  4GU5 A;  4GZ6 A;  2A4Z A;  2I6H A;  5FQ8 A;  2AJA A;  3HRA A;  5CED B;  2RD0 A;  5J08 A;  4OVU A;  4JHK A;  3LY8 A;  5T8I A;  4LG6 A;  2X6K A;  5AAR A;  4N2S A;  2PM7 A;  4GTQ A;  3V30 A;  4KMO A;  2P9P G;  2J9Q A;  3Q9N C;  1IYG A;  4AJW A;  3G2V A;  5G2N A;  2HYZ A;  5EX3 A;  1MHQ A;  2I1J A;  3AG1 E;  3NZU A;  3ABK E;  4GMR A;  1YYH A;  2WQ6 A;  4YVQ C;  2OND A;  5AQ9 A;  2VSO E;  4L23 A;  4JL0 A;  2R59 A;  3FTS A;  3QNK A;  2WXG A;  2KCL A;  5LOZ A;  3D9O A;  2WXR A;  5KJK A;  3TXN A;  1BPO A;  3DWL G;  3UQ3 A;  2KAT A;  4F3V A;  1V55 E;  3IEG A;  3PZ2 A;  4L9P A;  4ANW A;  3Q4A B;  4MKT A;  3UT8 A;  4GTP A;  1UOH A;  3FUK A;  3EJN A;  4MRU A;  5AJL A;  3KS2 A;  2VGE A;  4IRU A;  4J0U A;  4PDX A;  1E7V A;  3RIB A;  4HVB A;  3PDN A;  3GZ1 A;  3PUK A;  3C72 A;  4CCA A;  1WAO 1;  2X6F A;  4DLO A;  1N94 A;  2UY1 A;  5CMW A;  4PS7 A;  1OWP A;  3LY9 A;  2WMN A;  4HI9 A;  4HOU A;  4A1S A;  1FVH A;  2OV8 A;  4AY6 A;  5DBK A;  4WWN A;  1XGW A;  4D10 C;  1WG0 A;  5FQ7 A;  1INZ A;  4AEZ C;  3Q75 A;  1OWL A;  1TNO A;  1N4P A;  1HO8 A;  3FUL A;  4O6F A;  3CGH A;  3FH5 A;  4U0U A;  5BXU A;  4PH4 B;  5FZQ A;  2R02 A;  3CIA A;  4AM9 A;  2KZT B;  3EUV A;  4I2Z A;  1EF1 C;  3R7R A;  2OCC E;  4I1A A;  4B8A A;  3QK0 A;  3FTV A;  2YQ8 A;  2ZIS A;  3MV3 B;  3CVW A;  3Q79 A;  4E6H A;  5JMN D;  4C9B B;  1JPL A;  5ENO D;  5B1A E;  3BG0 B;  2NYJ A;  1ZB1 A;  3ZYL A;  3IKO B;  4URK A;  1HFA A;  1OCC E;  1A17 A;  4ATZ D;  4G8L A;  4UI9 K;  4I1O B;  2L9B A;  3LJ3 A;  5T3R A;  2ZXW E;  4HXI A;  3ZEF A;  4KYO B;  2WB2 A;  5KWD A;  2IEJ A;  1TNZ A;  4TXR A;  5CEA A;  1HF8 A;  4MBG A;  5HQ8 A;  5KCM A;  4DJA A;  4UWH A;  3PE3 A;  3BU8 A;  3PE4 A;  1MYO A;  3ZRH A;  3UX4 A;  3SFX A;  2XHE A;  2DIW A;  4RVB A;  4GA2 A;  3JUE A;  3RO3 A;  4NUR A;  4XE0 A;  1BI7 B;  2WXI A;  3JCK C;  4GYO A;  1QYM A;  3Q15 A;  3OTN A;  4C48 B;  2RKK A;  1NI1 A;  2L0T B;  1DVP A;  5AYW D;  5AQA A;  1Q2Z A;  3ESK A;  2PQR A;  5AN8 A;  3ZVV A;  2OOE A;  2V4L A;  3CVV A;  3AU5 A;  1H6K A;  3B7S A;  1QNF A;  1S0P A;  3HXB A;  3O48 A;  5EIB E;  1Z6T A;  1HH8 A;  3SZ7 A;  2J07 A;  1NP7 A;  4A3V A;  4AVX A;  3HVE A;  2BTD A;  4XEI G;  4I9E A;  3CVU A;  3FP3 A;  4J8E A;  4G25 A;  3APC A;  1SQM A;  2IJG X;  2P9I G;  3JXJ A;  4XI9 A;  4H7Y A;  3V2X A;  3JXI A;  2KCV A;  3UM2 A;  1HE8 A;  3B95 A;  4HOR A;  3AAA C;  3HXC A;  4XZ4 A;  4YND A;  1N54 A;  5KNG A;  2MOW A;  1FPP A;  2XGO A;  4WUY A;  1D8E A;  4HBD A;  1N95 A;  4KZ0 A;  4ILG A;  4E85 A;  2ETA A;  1DC2 A;  3JQ1 A;  4KT6 B;  3NOG D;  2IOL A;  5ARG A;  4UWL A;  1OCR E;  4JHJ A;  5LP0 A;  5KBA A;  4XKC A;  2NC9 A;  2PZI A;  1OUV A;  2DVW A;  4U8H A;  1VDY A;  1SZ9 A;  1N11 A;  3FUD A;  4AV7 A;  4F53 A;  3I4G A;  4DX6 D;  3QWP A;  4EEC A;  4LCT A;  3L9T A;  5ARF A;  3U9W A;  2FBN A;  3FEX A;  2L6B A;  1HXI A;  3CVX A;  5KJM A;  2A5U A;  2VSY A;  2J8S D;  3FDH A;  3SFY A;  2M63 A;  4B94 A;  5ENR D;  2EQX A;  3K9I A;  3LXU X;  3LPZ A;  1E90 A;  4U04 A;  1O1T A;  3KSL A;  1MX2 A;  3MJW A;  2AXU A;  2GRM A;  3URZ A;  3R9M A;  5BV1 A;  3DXK G;  3EIJ A;  4GYW A;  2WMO A;  1U3C A;  2BKG A;  1EDU A;  3NOC D;  3ULQ A;  5EYL A;  2BUG A;  4DI4 A;  1BLX B;  3EU5 A;  5ITZ F;  3CHR A;  3PZ1 A;  4MS6 A;  2LO6 A;  4BFR A;  5EDS A;  2V8S E;  2XEV A;  3TWR A;  2XGS A;  3S2A A;  3Q7A A;  3TGO A;  2X6I A;  2Y1L E;  1K8K G;  4U96 D;  4G8K A;  1TN6 A;  3T5X A;  3HVE B;  2P9K G;  5C2Y A;  2J08 A;  3TJP A;  3T9K A;  4BET A;  2XRZ A;  4NAC A;  4ANX A;  4HOS A;  1WY6 A;  4ANU A;  1TYQ G;  5ENS D;  3SHF A;  4CGV A;  5T4Y A;  3D9N A;  3FTW A;  4GA1 A;  3L22 A;  3MEK A;  3QKY A;  3I5P A;  2IQC A;  4LRZ A;  5G05 J;  2PNN A;  3ZUV B;  2KC7 A;  4CZ2 D;  3CK8 A;  2GRR B;  4LSZ E;  4JXT A;  4IYP A;  4TUU A;  2FI7 A;  1ZU2 A;  5EKQ D;  5AQ7 A;  3ASF A;  2UY1 B;  4HOT A;  3QB2 A;  4G23 A;  2WXN A;  3JUI A;  3ZFW A;  4FC8 A;  3BG1 B;  3CVN A;  4A1G A;  3TWS A;  1XNF A;  3LVR E;  1K3Z D;  2WXJ A;  3DEP A;  3NZS A;  4KXK B;  2XRY A;  5G55 A;  3ZYQ A;  4JA9 A;  4N39 A;  1NA3 A;  1TN8 A;  3CHM A;  1ELK A;  4TUM A;  5HKP A;  4PUC A;  4HRL A;  2CFU A;  1NZN A;  4YDE A;  3AU4 A;  4JVS A;  3HXF A;  1BU9 A;  3FUM A;  4J8S A;  3PUJ A;  3DSW A;  4HNA D;  3X2Q E;  4Y6W A;  5HS0 A;  1Y8M A;  1IQU A;  3ML9 A;  4CDN A;  2IFU A;  2YIN A;  5D0Q D;  2Y4T A;  4GAA A;  2RFA A;  4LUN U;  5CER B;  3ABM E;  3D3M A;  4B93 B;  3ONL A;  3ZW3 A;  3QJZ A;  2VTB A;  3B7U X;  4ANV A;  3QDN A;  3CST A;  4A3T A;  3UPV A;  4L2Y A;  4GZD A;  4BT8 A;  1TJC A;  3DSU A;  1TNU A;  3VLE A;  3AS5 A;  4MLP A;  2DZO A;  1H19 A;  4EPZ A;  4HB5 A;  4AP2 A;  2FF4 A;  4BSZ B;  1TNB A;  2EIN E;  1K1A A;  1GW6 A;  1OWO A;  3N71 A;  1E8X A;  1KT0 A;  4QQI A;  3AG4 E;  4YDW A;  5CHE E;  3IBE A;  2EIL E;  1H6P A;  3RKV A;  4EZL A;  5M72 A;  3Q73 A;  2VGX B;  2J09 A;  1U3D A;  2ETC A;  3WG7 E;  4JD2 G;  3DST A;  1N52 A;  4GMJ A;  4WWP A;  3EHM A;  1OXJ A;  1JCR A;  4EBA G;  2LXM A;  1TNY A;  4XIF A;  3CHQ A;  3SBS A;  4GTO A;  5ENQ D;  5B1B E;  4B0Z A;  4Z68 A;  4M3O A;  3TG5 A;  4JEH A;  4DLQ A;  4XI0 A;  3CEQ A;  3MA5 A;  1FVF A;  3UM0 A;  2HE0 A;  1LF8 A;  3QOU A;  3MX3 A;  5LCW J;  2WQ7 A;  4K5B A;  3FFL A;  5BNW A;  2YHE A;  3NQP A;  2RFM A;  5BPP A;  5D0O D;  1DCQ A;  3ZYM A;  3HYM B;  2HM8 A;  3S7D A;  1ELR A;  3LJN A;  2P9S G;  1HX8 A;  2QYU A;  3S7B A;  2XZD G;  4EQF A;  2J4B A;  2JLB A;  3G2W A;  4RSY A;  3AS8 A;  5DIZ A;  4UQY A;  3Q7F A;  3UIN C;  1H2U A;  5FZR A;  3FTY A;  5CCM A;  3CVP A;  3L16 A;  4RQI A;  4F1S A;  4N3B A;  2Y69 E;  4G2V A;  2R03 A;  4ACL A;  3TL5 A;  3ISM C;  3KEZ A;  5B3S E;  5KJL A;  2NXP A;  5EN5 D;  2V4H C;  1L5J A;  2QY7 A;  2H6I A;  3HXE A;  3ENE A;  1QZ2 A;  1IKN D;  3SD5 A;  4AOF A;  2H6G A;  3I4R B;  3E30 A;  2VTB B;  3PZ4 A;  3T8K A;  2PL2 A;  4N3C A;  3UM1 A;  3EDT B;  3ZYK A;  2H6F A;  2R2L A;  2R05 A;  3AS4 A;  2WQH A;  1RZ4 A;  4LER A;  3DSS A;  4Q94 A;  1JCQ A;  4I2W A;  1D9S A;  2CHW A;  4CYM D;  4GCN A;  1N4S A;  2DYS E;  4GZ5 A;  3UKU G;  5AEN A;  3GYZ A;  4G26 A;  4A55 A;  3ZGQ A;  4N3A A;  4UWF A;  3IHV A;  4WNF A;  3LY7 A;  4GTR A;  1OWM A;  1Y6I A;  3FU3 A;  3ASO E;  2CG2 A;  3CR3 A;  1O5M A;  1KLX A;  2X38 A;  4TV3 A;  1HG5 A;  5BV0 A;  2CG3 A;  1KT1 A;  2ETB A;  2PQN A;  3QC1 A;  3NAW A;  3TXM A;  3FUN A;  3FUE A;  4BER A;  3JYS A;  3SQV A;  1AP7 A;  2V0P A;  4BWR A;  2DZN A;  5FJY A;  1HZ4 A;  2P2C P;  2AW6 A;  1IXV A;  3IXE A;  2A5E A;  2IU1 A;  1D8D A;  2UWJ G;  2KXP C;  2WXF A;  5BW8 C;  4BX8 A;  3E32 A;  5HI7 A;  1TN7 A;  3ASG A;  5CRV A;  4N2Q A;  4HLE A;  4YDY A;  4DRX E;  4BX9 A;  3PEV B;  1N0R A;  1KPS B;  1UJK A;  5C1D A;  4GTM A;  3SY2 A;  3NF1 A;  4BEP A;  2EIM E;  3FU6 A;  1EPU A;  1N4R A;  1KZP A;  3ZNG A;  4OAU C;  5AJD A;  2VSX E;  2WXL A;  2LSU A;  5ENT D;  1SW6 A;  2HO1 A;  4U8Y D;  3NB2 A;  3BQO A;  5BUZ A;  4LNG A;  3CQC B;  2XPI A;  4GPK A;  4I6E A;  4Y6C A;  3C5R A;  2YNQ A;  4UWG A;  1HS6 A;  3C3R A;  4GCO A;  4ZHB A;  1OWN A;  4CRW A;  4JEU A;  2KZT A;  1EYH A;  4L1B A;  1H0A A;  5AAO A;  2Q7F A;  4L7T A;  3DBS A;  1N9A A;  3E34 A;  1Z5S C;  1N0Q A;  4W9R A;  3IHY A;  1JUQ A;  4RLY A;  4XX5 A;  2OVF A;  3I3N A;  2XS8 A;  2JEK A;  4B8C B;  4TRQ A;  4Q96 A;  4TXP A;  4FJZ A;  4DK5 A;  4FJY A;  3D9K A;  2GW1 A;  3O4Z A;  4FLB A;  4FHJ A;  4ILI A;  4I6G A;  2FO7 A;  1MX6 A;  1V54 E;  3FWV A;  4KZC A;  3RO2 A;  3D9J A;  4UQX A; 
#chains in the Genus database with same CATH homology
 2AXV A;  5DBK A;  4WWN A;  1XGW A;  3ML9 A;  3ZPJ A;  3LKU A;  4BTB A;  4BY6 A;  2IFU A;  4CDN A;  4D10 C;  1UJJ A;  5FQ7 A;  1INZ A;  1UN9 A;  2R17 C;  4AEZ C;  1OWL A;  2YIN A;  2WXH A;  5D0Q D;  3PRZ A;  1HO8 A;  3FUL A;  3GZ2 A;  4I9C A;  4O6F A;  2Y4T A;  3ESL A;  3CGH A;  4GAA A;  1H2V C;  4LUN U;  3FH5 A;  4JHR A;  2AWI A;  3APF A;  3D3M A;  3PNL B;  5FQ6 A;  3SI5 A;  4JZY A;  3ONL A;  3ZW3 A;  4U0U A;  3U3W A;  4PH4 B;  5FZQ A;  3SBT B;  3D9I A;  3QJZ A;  1E8Y A;  3B7U X;  3CIA A;  3FUI A;  2KZT B;  4AM9 A;  4FU3 A;  4ANV A;  2VTB A;  2J49 A;  4I2Z A;  4LEU A;  3QDN A;  4ME2 A;  3MGB A;  4DPR A;  1EF1 C;  3CST A;  4HOQ A;  3RJV A;  3R7R A;  4I1M A;  4I1A A;  4B8A A;  4A3T A;  3QK0 A;  4G11 A;  3FTV A;  3UPV A;  2YQ8 A;  1E8W A;  3FUJ A;  4L2Y A;  3EIQ C;  4GZD A;  3ZN3 A;  4CT4 A;  4BT8 A;  1TJC A;  3CQG B;  2CHZ A;  2XPZ A;  3MV3 B;  3U64 A;  4BT9 A;  3CVW A;  3PRE A;  2BF0 X;  4AXH A;  2AXZ A;  2VGY A;  4E6H A;  3VLE A;  5LFA A;  2ION A;  4AY5 A;  3CHS A;  3U4T A;  3AS5 A;  3L54 A;  4MLP A;  2QFC A;  4FLH A;  1H19 A;  3ZIM A;  3OXG A;  4C9B B;  3CV0 A;  4EPZ A;  1JPL A;  5JHA A;  3MCX A;  4AIF A;  2FF4 A;  4AP2 A;  3BG0 B;  2VJ8 A;  1IHG A;  3ZYL A;  1UN8 A;  5G05 C;  3UMV A;  5LX8 A;  4N5C A;  3IKO B;  1GW6 A;  3R9A B;  1HFA A;  1OWO A;  1A17 A;  4URK A;  3KAE A;  3N71 A;  4UI9 K;  1PC2 A;  4I1O B;  2L9B A;  3LJ3 A;  4WWO A;  5T3R A;  1E8X A;  1KT0 A;  2CFZ A;  3ZHE A;  3G2S A;  4HXI A;  3ZEF A;  4J8D A;  4FP7 A;  5J90 A;  4KYO B;  5CHE E;  3D9L A;  3IBE A;  2WB2 A;  4U63 A;  5ANR A;  3RKV A;  2RG8 A;  4EZL A;  5M72 A;  3P2B A;  5E76 A;  2P58 C;  1HF8 A;  5HQ8 A;  3L08 A;  2WXM A;  5KCM A;  4DJA A;  4UWH A;  4HS2 A;  2VGX B;  2E0I A;  2J09 A;  2KCK A;  2GGF A;  4FA6 A;  1U3D A;  3PE3 A;  4APO A;  3CKC A;  3LDZ A;  3PE4 A;  3TG4 A;  3ZRH A;  4KVM A;  2WVI A;  3MV2 B;  3UX4 A;  4G24 A;  2ILR A;  1UW4 B;  2XHE A;  1N52 A;  2C0L A;  2LSV A;  4GMJ A;  1IQR A;  2DCP A;  4WWP A;  1YA0 A;  3EHM A;  4FUL A;  2VGX A;  3CSF A;  3T8M A;  2DIW A;  5JJT A;  4EBA G;  4RVB A;  4GA2 A;  4XIF A;  2VYI A;  2XCC A;  3RO3 A;  3CHQ A;  3SBS A;  1E7U A;  4PS3 A;  1TJF A;  4NUR A;  3JQ0 A;  3PS6 A;  2Y3A A;  2R5S A;  3MKQ A;  4B0Z A;  4C0M A;  4XE0 A;  3GZS A;  4M3O A;  3TG5 A;  5JJ6 A;  4JEH A;  5EX0 A;  1JWF A;  5A23 A;  3G2T A;  2WXK A;  4WNE A;  2WXI A;  2L6J A;  3CVQ A;  4DLQ A;  1SZA A;  3JCK C;  4XI0 A;  3QWV A;  4CEM A;  3S7F A;  4F7A A;  3Q5M A;  1Z3Y A;  2OVB A;  3B13 A;  4GYO A;  2MHK A;  3CEQ A;  3MA5 A;  3Q15 A;  3OTN A;  4HFG A;  1FVF A;  4G1T A;  3VLD A;  1LF8 A;  3QOU A;  3E4B A;  3MX3 A;  5LCW J;  2WQ7 A;  4OYS A;  2L0T B;  1DVP A;  3L6A A;  5AYW D;  4CT0 A;  3ESK A;  3FFL A;  2PQR A;  4GYY A;  3ZVV A;  5BNW A;  2OOE A;  2V4L A;  3Q49 B;  3VTY A;  4KBQ A;  2YHE A;  3FEY A;  3R7Q A;  3AU5 A;  3C98 A;  1H6K A;  3B7S A;  3FU0 A;  3NQP A;  3UT4 A;  1QNF A;  1S0P A;  2FEZ A;  3CK7 A;  3O48 A;  1Z6T A;  1HH8 A;  3LCA A;  3SZ7 A;  4CDR A;  3OXF A;  5BPP A;  5KJN A;  3SFZ A;  4ABN A;  2J07 A;  3FH8 A;  5D0O D;  1NP7 A;  3ZYM A;  3Q47 B;  4I17 A;  1DNP A;  3HYM B;  3MZL B;  3HVE A;  4A3V A;  1HG2 A;  4AVX A;  2HM8 A;  4QFV A;  3CK9 A;  3KD7 A;  3P1U A;  3VLF A;  2BTD A;  2Y4U A;  2KM4 A;  1B89 A;  4I9E A;  4H7X A;  3S7D A;  3QAR A;  3CVU A;  1ELR A;  4BSX A;  3FP3 A;  4J8E A;  4PS8 A;  2C2L A;  4WAF A;  4G25 A;  2FUL A;  1HX8 A;  3APC A;  2WXO A;  3S7B A;  1SQM A;  2IJG X;  3D9M A;  4EQF A;  4XI9 A;  3HIZ A;  4H7Y A;  2J4B A;  2JLB A;  4ACK A;  3G2W A;  4RSY A;  5JJ7 A;  2KCV A;  2WM9 A;  1HE8 A;  3AS8 A;  3ML8 A;  5DIZ A;  2DBA A;  4UQY A;  5FQ4 A;  1H2U A;  5FZR A;  4HOR A;  5CCL A;  3ZXS A;  3FTY A;  5FZS A;  4IN3 B;  3CHP A;  2LAI A;  4UI9 C;  4XZ4 A;  4YND A;  1N54 A;  3CVV A;  1E96 B;  2MOW A;  2X6H A;  3CVP A;  5CCM A;  3FTZ A;  3L16 A;  3EHN A;  4U0S A;  4N3B A;  5A7D B;  4F1S A;  2XGO A;  4WUY A;  4G2V A;  1HU3 A;  4ACL A;  3TL5 A;  3OAW A;  2YHC A;  3KEZ A;  4RG6 A;  5KJL A;  4GA0 A;  5G04 J;  2NXP A;  3L17 A;  3D9P A;  4JC8 A;  3FHE A;  4KZ0 A;  2XCB A;  4EZK A;  3FUF A;  1L5J A;  2QY7 A;  4ILG A;  4E85 A;  3ENE A;  1QZ2 A;  3SD5 A;  3JQ1 A;  3UT7 A;  4KT6 B;  4AOF A;  2IOL A;  3I4R B;  4JPS A;  5G04 C;  5ARG A;  2VTB B;  4UWL A;  5JHB A;  3T5V A;  1QQE A;  2PL2 A;  4N3C A;  4ILH B;  4JHJ A;  2CHX A;  2X6J A;  3APD A;  2AVP A;  5LP0 A;  1TEZ A;  3SGH A;  3PZD A;  4XKC A;  2NC9 A;  2PZI A;  1OUV A;  3EDT B;  4KVO A;  3ZYK A;  1ZBP A;  4IUL A;  3FTX A;  4J8F A;  4U8H A;  5FTP A;  3AS4 A;  2WQH A;  2HR2 A;  4UI9 J;  1MQS A;  3FH7 A;  1VDY A;  3BEE A;  4BTA A;  1SZ9 A;  3ONK A;  4CGW A;  3CLJ A;  3FUD A;  2MRI A;  2XGM A;  3HHM A;  4LER A;  4AV7 A;  4Q94 A;  5ANL A;  4F53 A;  3I4G A;  3QWP A;  4RG9 A;  2E2E A;  4I2W A;  3SNX A;  4AY6 A;  4GZ3 A;  4EEC A;  4LCT A;  5ARF A;  3RK6 A;  2CHW A;  3U9W A;  2I2O A;  5LCW C;  3CVY A;  4APF A;  3MYV A;  2FBN A;  1JWG A;  3FEX A;  4GCN A;  2GRL A;  1H2T C;  1HXI A;  3CVX A;  4B89 A;  4NQ0 A;  3RRN B;  4GZ5 A;  5KJM A;  3MKQ B;  5BT1 A;  3RRU A;  2A5U A;  1NA0 A;  2VSY A;  3GYZ A;  4GML A;  5AEN A;  4G26 A;  4A55 A;  2IOS A;  3ZGQ A;  3IV0 A;  4N3A A;  4UWF A;  3FDH A;  4R7L A;  2M63 A;  1PAQ A;  4B94 A;  5AIJ A;  3IHV A;  2XQ0 A;  3RRM B;  4WNF A;  4YVO A;  1WM5 A;  3DPD A;  2EQX A;  3K9I A;  3LY7 A;  1PY1 A;  1OWM A;  1Y6I A;  3FU3 A;  4JW1 A;  1FCH A;  3LXU X;  3LPZ A;  2CG2 A;  1E90 A;  2WXQ A;  2I9C A;  3CR3 A;  4U04 A;  1KLX A;  4EZJ A;  2X38 A;  4K0R A;  3OXL A;  4V3I A;  3CKB A;  4TV3 A;  4UWK A;  4P29 A;  2X3M A;  3CVL A;  1HG5 A;  4C0E A;  5A6C A;  3ZHE B;  5BV0 A;  2CG3 A;  1KT1 A;  2PQN A;  3QC1 A;  2NSZ A;  3MJW A;  4UQZ A;  2AXU A;  2GRM A;  3URZ A;  4U07 A;  4ATG A;  2XPY A;  4XKB A;  4WND A;  5BV1 A;  3TXM A;  3CHO A;  3FUN A;  4OVV A;  3FUE A;  3B7T A;  3FTU A;  3EIJ A;  4GYW A;  2WMO A;  3TAX A;  1U3C A;  3LEW A;  3QWW A;  3JYS A;  4WNG A;  3LYA A;  3FU5 A;  2V0P A;  1EDU A;  3LS8 A;  4K03 A;  4BWR A;  1UG3 A;  5FJY A;  2ZU6 B;  1Y8M A;  1HZ4 A;  2AW6 A;  3ULQ A;  5ENN A;  3SF4 A;  2BUG A;  2IU1 A;  2UWJ G;  3LVQ E;  4JA7 A;  4DI4 A;  2WXF A;  5BW8 C;  4BX8 A;  3MKR A;  2VQ2 A;  2L0I A;  4GU5 A;  3CHR A;  4MS6 A;  2LO6 A;  4BFR A;  5EDS A;  1E8Z A;  5HI7 A;  2V8S E;  2XEV A;  3ASG A;  3PH0 C;  4GZ6 A;  2A4Z A;  2I6H A;  4N2Q A;  2XGS A;  4U0Z A;  2LNI A;  5FQ8 A;  3S2A A;  3PVL A;  4HLE A;  4BX9 A;  1ELW A;  3PEV B;  2X6I A;  3TGO A;  2IF4 A;  4NRH B;  1UJK A;  2PM6 A;  2WPV A;  2RD0 A;  3T5X A;  5C1D A;  3HVE B;  5J08 A;  4OVU A;  4JHK A;  3LY8 A;  5T8I A;  4J6I A;  3U66 A;  3NF1 A;  5C2Y A;  2J08 A;  3TJP A;  2X6K A;  2XRZ A;  4N2S A;  4NAC A;  4ANX A;  4HOS A;  2PM7 A;  1WY6 A;  4KMO A;  4ANU A;  3FU6 A;  4EBA A;  2J9Q A;  3PNT B;  4I43 A;  1IYG A;  5FWQ A;  2WXP A;  1EPU A;  4FAD A;  3SHF A;  4CGV A;  4AJW A;  3G2V A;  3QAQ A;  5G2N A;  5AJD A;  2VSX E;  2HYZ A;  2WXL A;  5EX3 A;  2LSU A;  2I1K A;  1MHQ A;  5T4Y A;  3D9N A;  2I1J A;  3FTW A;  3NZU A;  3S7J A;  4GA1 A;  4CDM A;  4DI3 A;  2HO1 A;  3L22 A;  3MEK A;  4I6J A;  1Z3X A;  3QKY A;  1P5Q A;  3FUH A;  3I5P A;  5BUZ A;  2IQC A;  3CQC B;  4LRZ A;  2WQ6 A;  5G05 J;  2J4D A;  2XPI A;  4YVQ C;  3G2U A;  3L13 A;  2OND A;  4I6E A;  4GPK A;  4Y6C A;  2VSO E;  2YNQ A;  3HDX A;  4L23 A;  4UWG A;  4JL0 A;  4FHK A;  2R59 A;  3ASH A;  1HS6 A;  2KC7 A;  3FTS A;  3QNK A;  2WXG A;  3CK8 A;  2KCL A;  5LOZ A;  3PEU B;  4JXT A;  3D9O A;  4GCO A;  2WXR A;  2FI7 A;  4IYP A;  1OWN A;  1ZU2 A;  4TUU A;  5EKQ D;  5KJK A;  3ASF A;  3TXN A;  4CRW A;  1W3B A;  1BPO A;  2UY1 B;  4JEU A;  4HOT A;  3QB2 A;  3UQ3 A;  2KZT A;  2KAT A;  4G23 A;  2WXN A;  3JUI A;  3ZFW A;  4F3V A;  2V5F A;  4FC8 A;  1EYH A;  3BG1 B;  3CVN A;  3ASD A;  3RU0 A;  4L1B A;  1H0A A;  4A1G A;  3VTX A;  2Q7F A;  3IEG A;  4L7T A;  1XNF A;  3DBS A;  3LVR E;  2WXJ A;  1X5B A;  4ANW A;  3NZS A;  3Q4A B;  2LAH A;  4MKT A;  3IHY A;  4W9R A;  3UT8 A;  1JUQ A;  5CMY A;  4XX5 A;  4KXK B;  2XRY A;  5G55 A;  2OVF A;  3FUK A;  3EJN A;  3ZYQ A;  3WXX A;  3I3N A;  4JA9 A;  2JEK A;  3GW4 A;  4MRU A;  4N39 A;  4B8C B;  1NA3 A;  3CHM A;  5AJL A;  1ELK A;  4TRQ A;  3KS2 A;  4FJZ A;  4IRU A;  2C0M A;  4PUC A;  2CFU A;  1NZN A;  4FJY A;  4J0U A;  3D9K A;  4Q96 A;  4PDX A;  4DK5 A;  1E7V A;  2VSN A;  2GW1 A;  3RIB A;  4HVB A;  3AU4 A;  3O4Z A;  3PDN A;  4FLB A;  4FHJ A;  4ILI A;  3GZ1 A;  4JVS A;  4I6G A;  3PUK A;  3FUM A;  4CCA A;  1WAO 1;  2FO7 A;  4J8S A;  3UUX A;  2X6F A;  4DLO A;  4Q69 A;  3PUJ A;  2UY1 A;  4GB9 A;  5CMW A;  4PS7 A;  1OWP A;  3FWV A;  3LY9 A;  2WMN A;  5E75 A;  4KZC A;  4Y6W A;  3RO2 A;  4HOU A;  3B7R L;  4UQX A;  4A1S A;  3FY4 A;  4L2L A;  5FT9 A;  1FVH A;  2OV8 A;  3D9J A;  4GZC A;  1IQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...