1NA0A

Design of stable alpha-helical arrays from an idealized tpr motif
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
119
structure length
119
Chain Sequence
NSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords designed protein CTPR3
publication title Design of Stable alpha-Helical Arrays from an Idealized TPR Motif
pubmed doi rcsb
source organism Unidentified
total genus 50
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1na0A00
2P58C 3CK7A 2UY1A 3AS8A 4HOQA 5D0QD 3OXGA 3FWVA 1Y8MA 2YHCA 4KBQA 1NA0A 5EX3A 3S7BA 2HYZA 5D0OD 2VQ2A 3CVPA 2YQ8A 5ARGA 1QZ2A 3K9IA 3TAXA 3QKYA 4GZ6A 4U0ZA 4AY5A 3N71A 4JL0A 3KS2A 3RJVA 4N3CA 2PQRA 3PE4A 3ZN3A 3VTYA 2GW1A 3LY9A 5KJKA 2FF4A 2C2LA 4KXKB 4WUYA 3ZHEA 4G1TA 5LCWC 4G25A 2KCVA 2PQNA 1NA3A 1XNFA 2XCBA 3PE3A 3GZ2A 5JJ7A 3GYZA 5DBKA 4Y6WA 4GPKA 1FCHA 1OUVA 4H7XA 2IFUA 5FZQA 5CCMA 2NC9A 3HYMB 5JJ6A 3QWVA 3TGOA 4UI9C 2V5FA 1P5QA 1NZNA 5HQ8A 2VGXB 3ASFA 5M72A 5G04J 3AS4A 4J8DA 2LNIA 3Q5MA 4N39A 5KJMA 4H7YA 3JYSA 5FTPA 4F3VA 2ONDA 3EDTB 3KD7A 2QFCA 2KCLA 2KC7A 1ZBPA 3UUXA 3LYAA 4APOA 3LY8A 4GA1A 3FP3A 2E2EA 5A6CA 4HOUA 3CEQA 3RO3A 2DBAA 3Q4AB 4N3BA 3CKBA 4UQZA 5CCLA 4N2QA 3U3WA 4GCOA 4CGWA 1KT0A 5LCWJ 4NQ0A 4CDRA 4CGVA 3ULQA 3ZPJA 1ELWA 5EX0A 4HOTA 3RO2A 4BTBA 3S7JA 3OXFA 3LY7A 3RU0A 4B94A 5A7DB 4I9EA 2FI7A 4GZ5A 2HO1A 1HXIA 2KATA 2XGMA 1IHGA 3QWPA 5KJLA 5G05C 3CV0A 4GYYA 2FEZA 1A17A 3PDNA 4GCNA 4J8EA 3IEGA 4NRHB 5BW8C 2VGYA 2UY1B 5FT9A 3BEEA 5BNWA 2VSYA 2J9QA 5EKQD 4WNGA 4G26A 2WPVA 4WNFA 4RG6A 3TG5A 4I1AA 4UQXA 4BWRA 4LEUA 4XIFA 2LSUA 3ASDA 2Y4TA 2AVPA 2R5SA 4JHRA 1WM5A 2L6JA 5C1DA 3Q49B 5HI7A 2UWJG 1QQEA 3FFLA 2BUGA 1IYGA 5ARFA 2VSNA 4G24A 4XI0A 3MEKA 4AY6A 4UI9K 4BT9A 4EQFA 3E4BA 5AYWD 1KT1A 3SZ7A 3U4TA 2LSVA 5FZRA 3ZHEB 3KAEA 4ABNA 1ELRA 4XI9A 4J8FA 4RG9A 5G05J 2PZIA 4AIFA 3MV2B 3ASHA 1PC2A 3URZA 2C0LA 3ESKA 4WNDA 1YA0A 3CVNA 2MHKA 4I17A 5KJNA 3S7FA 3R9AB 2I6HA 4YNDA 4GA2A 3Q15A 3Q47B 5JJTA 3VTXA 1HH8A 2FBNA 1B89A 4N2SA 3OXLA 1W3BA 4I2ZA 2KCKA 3AS5A 2VYIA 3CVLA 4BTAA 4I2WA 5DIZA 5G04C 2XEVA 3MV3B 4UI9J 1TJCA 3QDNA 4U0UA 4I9CA 4G2VA 2Y4UA 3QWWA 2C0MA 1KLXA 2VGXA 4JA7A 4A1SA 2OOEA 2JLBA 3WXXA 3S7DA 4GYWA 4N3AA 4N5CA 4WNEA 3SF4A 4HOSA 4YVOA 1E96B 4W9RA 3LCAA 3MA5A 4GYOA 3TG4A 3ZGQA 2WQHA 2Q7FA 4O6FA 3O48A 3ASGA 4U0SA 4HORA 3RKVA 3CVQA 2PL2A 4U07A 4KYOB 4U04A 1HZ4A 5FZSA 3CK8A 4GZ3A 3UPVA 2XPIA 4GA0A 3LPZA 5CHEE 4BT8A 3MKRA 4Y6CA 2XGOA 5BT1A 3CKCA 3GZ1A 4J0UA 4ME2A 2FO7A 3CK9A 4IN3B 4G23A 4YVQC 1WAO1 3QOUA 2XGSA 2IF4A 4AM9A 2XCCA 5FJYA 3NF1A 3RIBA 1ZU2A 3ZFWA 4UQYA 4JA9A 3LKUA 3UQ3A 2HR2A 3GW4A
chains in the Genus database with same CATH superfamily
2P58C 1HX8A 1UN8A 3CK7A 3ZW3A 1TN8A 3CHOA 1YYHA 3SNXA 4KZ0A 2LAIA 3S7BA 3DSUA 3HXDA 3FEYA 1MX6A 2HYZA 5KBAA 3CVXA 3HRAA 5ANRA 4JC8A 3N71A 2E0IA 1U3CA 1MHQA 3KS2A 3RJVA 4DI4A 2AXVA 5EIBE 2GRQB 1HF8A 3FUDA 5H7PA 3T9KA 3NZSA 3PE4A 3TWVA 3VTYA 2X6FA 5KJKA 2C2LA 2IEJA 3T5XA 1JUQA 2H6HA 4AVXA 3ZKJA 4JPSA 2PQNA 2XENA 5B1BE 4GAAA 1KZPA 5DBKA 4GPKA 4L23A 1FCHA 3DSVA 4A55A 2HE0A 5AAOA 3FUEA 3CHMA 1OWNA 2J4BA 3UI2A 2WMNA 1RW2A 4UWKA 1QYMA 4HRMB 2WXPA 1LTXA 3TGOA 3B7UX 3W9GA 1P5QA 3PEUB 5HQ8A 2VGXB 3Q9NC 5M72A 4B8CB 3B7TA 4ANUA 2LNIA 3Q5MA 3KEZA 3JYSA 1TNZA 1TN6A 2ONDA 2RFMA 1ZB1A 3LYAA 1H19A 3L9TA 4BY6A 3HXEA 2MOWA 2E2EA 3MZLB 5A6CA 2VGEA 3BQOA 3CKBA 5CCLA 3G2SA 4I1OB 4G8KA 4C48B 3E34A 4HOTA 3RO2A 4BTBA 2VJ8A 3TWTA 3KSLA 2WXKA 5LOZA 4CDMA 4B94A 5A7DB 2FI7A 4YDWA 4GTQA 2HO1A 2KM4A 2PNNA 4ILHB 2XGMA 5HKPA 2P2CP 2X38A 4GYYA 4HQDA 4OVUA 2AJAA 2NXPA 5FIOA 2FEZA 1A17A 2LXLA 4J8EA 3D9MA 3IEGA 4WWOA 4XKCA 3JQ1A 1KPSB 2ETBA 5BNWA 2J9QA 2R2LA 3PZ2A 1E8YA 5CBNA 4WNGA 4G26A 3ZYKA 2L6BA 5EYPF 4DK5A 4P29A 1U2VG 3EUVA 4WWNA 1G3NB 3V31A 1N54A 1LD8A 4JHRA 4F53A 1WM5A 1QQEA 2J49A 3Q78A 1HU3A 3DBSA 1HS6A 3MEKA 5KCMA 3Q7AA 3FUIA 1KT1A 4BERA 2J07A 3JXJA 1MZCA 4LRZA 4RQIA 4O1OA 4ABNA 4LNUD 2XEHA 1TNUA 4J8FA 3DSSA 5KNHD 4B0ZA 4I43A 4AIFA 3RK6A 3CVVA 3CVNA 1H2TC 4TXRA 3SI5A 3NQPA 3ESLA 3E32A 3Q47B 3C3QA 3CGHA 5JJTA 3TWSA 3PREA 3BG0B 3ZXPA 3VTXA 5FQ4A 1HH8A 4CRWA 4N2SA 3NOCD 4DX7D 1OCZE 4EZJA 3KEAA 3IBEA 4Q94A 5FINA 2KCKA 3D9PA 4TXPA 4EECA 4MRUA 1BD8A 4I2WA 3LXUX 1TJCA 3FH8A 3APCA 4L7TA 1H2UA 2H6IA 4U8HA 5T8IA 3SO8A 1OWLA 3RRNB 4NACA 2M63A 2KXPC 3S7DA 1V54E 3D9OA 4GYWA 3IV0A 2Y3AA 3UT7A 4HOSA 3L6AA 1HG2A 4E85A 1E96B 4W9RA 2Y69E 4EPZA 5ENTD 3V2XA 1Q2ZA 3LCAA 2IOSA 2DYSE 3MA5A 1O1SA 2Q7FA 3FEXA 5JA4D 1OCRE 4PUCA 5AQ7A 2PL2A 2J08A 3FTZA 4GZDA 4V3IA 1E8ZA 1HZ4A 3FTYA 3UPVA 3LJ3A 2R17C 4K0RA 3LPZA 2CFUA 3U9WA 2L0TB 5CHEE 4ATZD 3V2OA 3VLFA 4MBGA 5BT1A 3PUKA 3CKCA 4HI8A 2FO7A 3TWUA 3APFA 4FHKA 4YVQC 1WAO1 4D10C 3ZIMA 3NF1A 3PUJA 5LP0A 4ZFHA 3CVYA 4UQYA 2JEKA 2XPYA 5KNGA 3FTSA 1H6KA 4A3TA 5EYLA 3UQ3A 4FC8A 3GW4A 1JCSA 3OTNA 2P9PG 3PZ4A 4GMLA 4BESA 1Z5SC 2PM6A 3AS8A 1H6PA 3EU5A 3OXGA 3FWVA 4LG6A 3BG1B 4KBQA 3HHMA 1N9AA 3UKUG 2DZNA 5BV1A 3T5VA 1NA0A 5E75A 1INZA 3FTVA 3DRAA 2VQ2A 1FVFA 1NP7A 3CVPA 2IO3C 5ARGA 4F1SA 5ENQD 4BX8A 4ANWA 1Z3YA 2R03A 3FU0A 4U0ZA 4AY5A 4F6RD 4Q69A 3PH0C 3TWXA 2DYRE 3JQ0A 2AXUA 1AWCB 2ZIRA 5T3RA 3D9LA 2LO6A 2GW1A 2ETAA 4TV3A 3SQVA 3CQCB 3ZHEA 3FUKA 5ENRD 2XHEA 4G25A 1NA3A 3W9FA 1XNFA 3CHPA 3GYZA 5AIJA 2WXJA 3R7QA 1HG5A 1IHBA 5FZQA 3HYMB 1IQRA 1O1RA 1MX2A 3FUMA 4O1PA 4AJWA 4UI9C 3SFXA 4RLYA 2IOLA 3MCXA 5ANLA 2P9LG 4J8DA 4C9BB 2XQ0A 2ZISA 4N39A 2F37A 3I3NA 4F3VA 2CHZA 2QFCA 3B95A 3I4GA 5ENPD 5B3SE 3UUXA 4JB8P 3LY8A 3FU3A 2YNQA 3HDXA 4Z68A 3AJIA 3IKOB 1DC2A 5CMYA 2KZTA 2IY0C 4EZKA 2EIKE 2CG2A 5FWQA 2WM9A 3U3WA 4Q96A 3ZEFA 1S0PA 5LCWJ 2V4HC 4CDRA 3ULQA 3FTXA 3FULA 3KSQA 3ZPJA 1U3DA 3WG7E 5EX0A 4NIKA 4FJYA 2J4DA 4HRNA 1BI7B 3LY7A 3L17A 4I9EA 1BLXB 1GW6A 1K8KG 1IHGA 3QWPA 5KJLA 3HG0D 1S70B 1WDYA 3CV0A 4QFVA 3ZRHA 4GCNA 5AQAA 1MYOA 3RAUA 3FY4A 3D9NA 2OEVA 2VGYA 4JZYA 5AJDA 5AENA 3FH5A 5EKQD 4ATGA 4FULA 4X8QA 5B1AE 4C0MA 4C0EA 4XZ4A 5J08A 4DX2A 4WNFA 2I1JA 4RG6A 3E33A 1JWFA 1E7VA 4ANVA 5CRVA 3L16A 4XIFA 3ASDA 5D66A 4I1MA 2AVPA 2L6JA 4K5AB 2NSZA 3CVUA 3ZYMA 4GB9A 2OV8A 2P9KG 5HI7A 2UWJG 4LCTA 2BUGA 1IYGA 4G24A 4AV7A 2WMOA 4EQFA 4AEZC 1SW6A 4UWGA 5AYWD 4BSZB 3SZ7A 1E7UA 4PS7A 3U4TA 2LSVA 5FZRA 3ZHEB 4GTPA 1ELRA 4A3VA 2OCCE 3CR3A 4YDYA 3LVQE 5G05J 2PZIA 1UW4B 4CZ2D 4PS8A 3ASHA 3ESKA 3UMVA 4KVMA 2MHKA 3Q75A 2XRZA 5KJNA 4GA2A 1TEZA 3C5RA 1OCOE 2WXFA 2B6CA 2FBNA 2A5UA 3EIJA 4GTMA 4CCAA 3U64A 4I2ZA 1FT2A 3AS5A 3SFZA 5DIZA 3ABME 5G04C 1PY1A 4B93B 3MV3B 4UI9J 4J8SA 2DIWA 3RRUA 4OVVA 2VSOE 3QDNA 4U0UA 3ZYQA 2NYJA 2Y4UA 4F1PA 2MRIA 1D8DA 3ONLA 3CHQA 2H6FA 2KZTB 2EIJE 5C2YA 3LJNA 4BX9A 4HBDA 1Z3XA 4N5CA 1WG0A 3ASNE 4YVOA 3QARA 3DSXA 1SZ9A 3X2QE 3LS8A 3ABKE 4G8LA 3UT4A 4GTTA 3Q7FA 1NL4A 1JCQA 5J90A 2I2OA 3VLEA 2AW6A 1OWOA 4YDEA 4HORA 3CVQA 4KYOB 4G11A 4U04A 5AQBA 4N5QA 4LUNU 2XPIA 1D8EA 5EDSA 2RFAA 3QJZA 3BUAA 1TNYA 4Y6CA 2XGOA 1K3ZD 1TJFA 1EPUA 3CK9A 2BKGA 4IN3B 2BEDA 1L5JA 2IF4A 4AM9A 5FJYA 2JABA 3PVLA 3RIBA 1FPPA 2PM7A 4ILGA 5CBOA 4MS6A 2LXMA 2HM8A 3UIOC 3EU9A 1JPLA 2HR2A 3D9KA 3J5PA 1SQMA 5G55A 1K1BA 3QB2A 1TYQG 2AWIA 5D0QD 3EHNA 3MJWA 1DVPA 4U8VD 1Y8MA 3O4ZA 1H6OA 4FA6A 4GPMA 2P9UG 3L54A 3Q73A 3I5PA 1E90A 2YQ8A 2WXHA 1QZ2A 3QAQA 3K9IA 5CECB 2A5EA 2ZGGA 4GZ6A 3L13A 3UINC 4M7CA 4DI3A 5BXOA 2PQRA 5ENSD 1N0QA 2DCPA 2WXOA 1UJJA 2YINA 3LY9A 2FF4A 4LNGA 2VSXE 5CERB 5LCWC 4IRUA 5ENOD 4KZCA 4AP2A 2GRRB 1IKND 1FVHA 4XEIG 1OUVA 3SY2A 3PZ1A 3SD5A 2P9IG 3JUEA 1VDYA 1OT8A 4BEPA 2XS8A 2H6GA 1N94A 1DCEA 3HXBA 4A1GA 4XE0A 2QC9A 3FDHA 3QWVA 2Y1LE 4TUUA 2V5FA 1NZNA 4CDNA 3I4RB 3ASFA 5G04J 3AS4A 1SVXA 3PEVB 2ZGDA 5KJMA 1TNOA 2QYJA 2RD0A 3CLJA 4ANXA 4H7YA 5D2MC 3KD7A 2KCLA 4DPRA 2B0OE 4DX6D 2KC7A 1RZ4A 5BV0A 4K5BA 5CEDB 1YCSB 4GTSA 2X3MA 4APOA 2CG3A 2GRPB 3CHSA 4ACLA 4HOUA 2ILRA 3CEQA 3EHQA 4JD2G 3Q4AB 4JEUA 3D9JA 4U96D 4N2QA 4GCOA 4CGWA 1D9SA 1KT0A 3ZUVB 4J7WA 4NQ0A 1A5EA 2YHEA 3NOGD 3TWQA 1ELWA 4EZLA 1UN9A 3IXEA 4FHJA 4L1BA 4FLHA 3OXFA 5T4YA 3FU5A 2LUHA 3AG3E 4GU5A 2R05A 4GMRA 4LERA 1XGWA 4EBAG 4CYMD 4DJAA 3DSTA 3OAWA 5G05C 5LX8A 5E76A 3EJNA 4JHJA 4JHKA 3PDNA 3G2UA 3B13A 2EIME 4HXIA 5FT9A 2WQ7A 2VSYA 4PDXA 2WXMA 2CHXA 4BWRA 2IJGX 2XZDG 1E8WA 2Y4TA 3CHRA 2WXLA 3FTUA 4J8YA 3ISMC 5AN8A 3V30A 3FFLA 3AAAC 2RG8A 2VSNA 2XS1A 4WWPA 4QQIA 3QNKA 2L9BA 3TXMA 2RKKA 4CT0A 4MKTA 3G2WA 1X5BA 1DNPA 4M3OA 2V4LA 1OY3D 4B89A 3KAEA 4HFGA 5A23A 1N52A 3E37A 3EHRA 2FO1E 1MX4A 3DXMG 3MV2B 4ZHBA 2C0LA 4WNDA 2OEWA 3DEOA 4HNAD 3APDA 4GMJA 4I17A 3UM3A 1N4RA 1MJ0A 1TN7A 2V8SE 4E6HA 3FUHA 5EIDA 3R9AB 3PZ3A 2ZXWE 4YNDA 3UTMA 3PRZA 4F7AA 2DVWA 4K5CA 3SFYA 4L2LA 3UIPC 3UT8A 1B89A 3OXLA 3G2VA 4IULA 4XKBA 3SBTB 4NURA 1JWGA 2VYIA 3CVLA 5HS0A 1FT1A 3LVRE 1PAQA 4LSZE 4DX5D 1YMPA 3L08A 4G2VA 5ENNA 2QZAA 3QWWA 4RSYA 2C0MA 3ZYLA 4HLEA 2MYOA 1KLXA 3FH7A 2JLBA 5FQ6A 4FP7A 3J5QB 2QYUA 3SF4A 3NBNB 4TRQA 3FU6A 3P2BA 3L82A 3P1UA 3ZGQA 4AXHA 4O6FA 3G2TA 4KVOA 3MX3A 2GRLA 4U0SA 4URKA 5FQ8A 3RKVA 3ULYA 3PS6A 5FZSA 5IY5E 2J09A 3QK0A 2OVBA 3C72A 3UM2A 3LEWA 2KBXA 3MKRA 4U8YD 1NFIE 4G23A 3QOUA 1N11A 2ETCA 2BKKB 2XCCA 3E30A 4HS2A 2X6HA 3EHMA 4OAVB 3ABLE 4JA9A 5CRUA 1UG3A 3LKUA 3PZDA 3Q9UC 3ULEG 2UY1A 3JXIA 4HOQA 4DLQA 2L0IA 1N4PA 2YHCA 3UXGA 3DPYA 5EX3A 4FU3A 3GZSA 1OCCE 5D0OD 1AP7A 3MKQA 3DPDA 4A63B 4HI9A 4HB5A 3UM1A 4JEHA 5EN5D 3TAXA 3QKYA 3NZUA 1S63A 4JL0A 1SA5A 4N3CA 5JHAA 1IQUA 1KZOA 3U66A 2WVIA 3ZN3A 3RRMB 2J8SD 3SHFA 4J6IA 4U63A 4KXKB 4WUYA 2R02A 4DRXE 3QC1A 4HRLA 4G1TA 2CFZA 2KCVA 2P9SG 2VTBA 4PH4B 5FQ7A 3ENEA 4XX5A 2XCBA 2P9NG 3AU4A 3GZ2A 3PE3A 5JJ7A 4UWHA 4Y6WA 1DCQA 4ILIA 3C3RA 4H7XA 4DX1A 2IFUA 5CCMA 2NC9A 5G2NA 3DSWA 4WAFA 1HE8A 3TL5A 2IU1A 5JJ6A 3SGHA 4BETA 3HXCA 1N4SA 1UJKA 4UWLA 3ZNGA 1IXVA 3HXFA 3AG4E 5FTPA 3UKRG 2WXNA 3EDTB 2XZTG 5KWDA 5LFAA 2GROB 1Z6TA 2F8XK 3VLDA 1SA4A 3D9HA 1ZBPA 4U95D 1NI1A 3ONKA 3C3OA 3HIZA 4GA1A 4FLBA 1N0RA 5BUZA 3FUJA 3FP3A 3V79K 2V5QC 3RO3A 4CT4A 4FADA 2DBAA 2I9CA 4N3BA 5CEAA 4UQZA 4BFRA 4APFA 1UOHA 4CGVA 4IYPA 4MLPA 5JMND 4UUCA 3AG1E 4ACKA 3HVEA 4B8AA 3S7JA 3RU0A 4JVSA 4I6EA 4O60A 2Y0BG 3ZU7B 2CHWA 4GZ5A 3JUIA 4I6GA 1HXIA 3ML8A 2KATA 1HO8A 3AU5A 3TWRA 3UX4A 4BSXA 3D3MA 2X6JA 3R7RA 3ZVVA 2WQ6A 5AQ9A 1OXJA 2X6IA 3IHYA 4NRHB 5BW8C 2UY1B 4DUIA 5BPPA 3BEEA 1LF8A 3BU8A 1H0AA 3FUNA 2XRYA 2WPVA 3R9MA 2WXQA 3TG5A 4I1AA 2GRNB 4UQXA 1MQSA 1O1TA 3B7SA 1Y6IA 3MGBA 4OAUC 1BI8B 2BF0X 3MKQB 4LEUA 2LSUA 3ML9A 2R5SA 2AXZA 2GGFA 3IHVA 1BPOA 4JXTA 2A4ZA 4RVBA 5C1DA 3Q49B 1EF1C 3ASOE 4K03A 3RSEG 5ARFA 4JW1A 4XI0A 3CSFA 1WY6A 3T8MA 4AY6A 4UI9K 2EINE 4BT9A 3E4BA 5BXUA 3T8KA 1BU9A 4YDOA 1HFAA 1H2VC 3NB2A 5CMWA 4XI9A 4RG9A 1LD7A 3PNTB 5JHBA 3CVWA 2VTBB 3DEPA 2XEEA 2V0PA 1PC2A 3URZA 1N4QA 4GTVA 2QY7A 1QNFA 1YA0A 3PNLB 4U7EB 2IO2C 4L9PA 2WXGA 2X6KA 4L2YA 1K1AA 2R59A 1O5MA 2BTDA 3EIQC 1V55E 3S7FA 2I6HA 3DWLG 3Q15A 1QBQA 2DWZA 3SBSA 4TUMA 3TXNA 4TXQA 3B7BA 3CSTA 5AJLA 4EBAA 1OWPA 4GTOA 1W3BA 2XPZA 4PS3A 2WXRA 1ELKA 4I6JA 4AOFA 4BTAA 1E8XA 3B7RL 3Q79A 2XEVA 1TNBA 3L22A 3CIAA 4I9CA 1SZAA 3TJPA 4HLLA 3FHEA 3FUFA 4FJZA 3LDZA 3CQGB 4GZCA 2VGXA 2OVFA 4JA7A 4A1SA 2EQXA 3S2AA 2EILE 2GRMA 2OOEA 3WXXA 4N3AA 4WNEA 2WB2A 2LAHA 3HVEB 3DXKG 2F8YA 5HRYA 5ITZF 4CEMA 1X81A 3NAWA 4OYSA 3D9IA 2F0YA 4GYOA 3TG4A 1S64A 1TR4A 2WQHA 1EYHA 3TWWA 3O48A 3ASGA 1N95A 4HVBA 3ZXSA 3UM0A 4LNBA 4KMOA 3FTWA 2IONA 4U07A 3JCKC 2DZOA 2I1KA 3CK8A 4GZ3A 3MYVA 3C98A 4KT6B 4GTRA 4GA0A 4UWFA 4BT8A 2IQCA 5AARA 3GZ1A 4J0UA 1EDUA 4ME2A 2FULA 4R7LA 4DLOA 2XGSA 1JCRA 3F6QA 3AG2E 1ZU2A 3ZFWA 4EHMA 5EILA 2WXIA 1OWMA 2ZU6B
chains in the Genus database with same CATH topology
3D9KA 2P58C 1HX8A 1SQMA 3OTNA 1UN8A 3CK7A 4GMLA 2UY1A 5G55A 3QB2A 3ZW3A 2PM6A 3AS8A 3CHOA 3SNXA 4HOQA 2AWIA 5D0QD 4DLQA 3EHNA 3MJWA 2L0IA 1DVPA 3FWVA 3OXGA 1Y8MA 3BG1B 3O4ZA 2YHCA 4FA6A 4KBQA 3HHMA 4KZ0A 2LAIA 5BV1A 3T5VA 1NA0A 5EX3A 3S7BA 3L54A 3FEYA 4FU3A 5E75A 1INZA 3GZSA 2HYZA 3FTVA 5D0OD 2VQ2A 1FVFA 3MKQA 3CVXA 3I5PA 3DPDA 1E90A 1NP7A 3CVPA 2YQ8A 2WXHA 5ARGA 1QZ2A 3QAQA 3K9IA 4F1SA 4JEHA 3TAXA 4BX8A 4ANWA 3QKYA 1Z3YA 5ANRA 3NZUA 3FU0A 4GZ6A 3L13A 4U0ZA 4JC8A 4AY5A 3N71A 2E0IA 1U3CA 4JL0A 4DI3A 1MHQA 3KS2A 4Q69A 3RJVA 4DI4A 3PH0C 2AXVA 4N3CA 2PQRA 5JHAA 3JQ0A 2AXUA 1HF8A 1IQUA 2DCPA 3FUDA 5T3RA 3U66A 2WXOA 3D9LA 2WVIA 3NZSA 1UJJA 3PE4A 3ZN3A 3RRMB 2LO6A 3SHFA 3VTYA 2GW1A 2X6FA 2YINA 3LY9A 4J6IA 5KJKA 2FF4A 4TV3A 4U63A 2C2LA 4KXKB 4WUYA 2VSXE 3CQCB 3ZHEA 3T5XA 3FUKA 3QC1A 4G1TA 5LCWC 1JUQA 2CFZA 2XHEA 4G25A 4AVXA 2KCVA 4JPSA 4IRUA 2VTBA 4PH4B 2PQNA 1NA3A 5FQ7A 3ENEA 4XX5A 1XNFA 2XCBA 4GAAA 3AU4A 3GZ2A 3CHPA 3PE3A 5JJ7A 3GYZA 5DBKA 4UWHA 4KZCA 4Y6WA 5AIJA 4AP2A 2WXJA 4GPKA 4L23A 1FCHA 1FVHA 4ILIA 4A55A 3R7QA 1OUVA 1HG5A 3FUEA 3CHMA 1OWNA 4H7XA 2J4BA 2IFUA 5FZQA 3SD5A 5CCMA 2WMNA 1VDYA 4UWKA 2NC9A 5G2NA 4WAFA 3HYMB 1IQRA 1HE8A 3TL5A 2IU1A 4A1GA 2WXPA 3FUMA 4XE0A 5JJ6A 3FDHA 3QWVA 4AJWA 3SGHA 3TGOA 3B7UX 4UI9C 4TUUA 2V5FA 1P5QA 3PEUB 1NZNA 4CDNA 3I4RB 5HQ8A 2IOLA 1UJKA 2VGXB 3ASFA 4UWLA 3MCXA 5M72A 5G04J 5ANLA 4B8CB 3AS4A 4J8DA 4C9BB 2XQ0A 3B7TA 3PEVB 4ANUA 2LNIA 3Q5MA 4N39A 3CLJA 2RD0A 4ANXA 5KJMA 3I3NA 4H7YA 3KEZA 3JYSA 5FTPA 2WXNA 4F3VA 2ONDA 3EDTB 2CHZA 3KD7A 5LFAA 2QFCA 2KCLA 1Z6TA 4DPRA 3I4GA 2KC7A 3VLDA 5BV0A 1ZBPA 3UUXA 3LYAA 1H19A 3ONKA 2X3MA 4APOA 3LY8A 2CG3A 3FU3A 4BY6A 2YNQA 3HDXA 3HIZA 4GA1A 4FLBA 2MOWA 3CHSA 3FUJA 3FP3A 2E2EA 3MZLB 4ACLA 5BUZA 5A6CA 3IKOB 4HOUA 2ILRA 3CEQA 5CMYA 3RO3A 4CT4A 4FADA 2DBAA 2KZTA 3Q4AB 2I9CA 4EZKA 4N3BA 3CKBA 4UQZA 4JEUA 4BFRA 2CG2A 5FWQA 5CCLA 3D9JA 4APFA 2WM9A 3G2SA 4I1OB 4N2QA 3U3WA 4GCOA 4CGWA 4Q96A 3ZEFA 1KT0A 1S0PA 5LCWJ 4NQ0A 4CDRA 4CGVA 3ULQA 4IYPA 3FTXA 2YHEA 3FULA 3ZPJA 4EZLA 1ELWA 1UN9A 1U3DA 4MLPA 5EX0A 4HOTA 4FJYA 3RO2A 4FHJA 4BTBA 4ACKA 4L1BA 2J4DA 3HVEA 4FLHA 4B8AA 2VJ8A 3S7JA 3OXFA 3LY7A 2WXKA 5LOZA 3RU0A 5T4YA 3FU5A 3L17A 4CDMA 4JVSA 4B94A 4I6EA 4GU5A 5A7DB 4I9EA 2FI7A 4LERA 2CHWA 1XGWA 4GZ5A 3JUIA 4I6GA 2HO1A 1GW6A 2KM4A 1HXIA 3ML8A 4EBAG 4ILHB 2KATA 1HO8A 2XGMA 3AU5A 4DJAA 3UX4A 1IHGA 3QWPA 4BSXA 5KJLA 3OAWA 5G05C 3D3MA 2X6JA 3R7RA 3ZVVA 2X38A 5LX8A 5E76A 3CV0A 3EJNA 4JHJA 4QFVA 2WQ6A 4GYYA 4OVUA 2NXPA 4JHKA 3ZRHA 2FEZA 1A17A 3PDNA 4GCNA 2X6IA 4J8EA 3IHYA 3G2UA 3D9MA 3B13A 3FY4A 3IEGA 4NRHB 5BW8C 3D9NA 2VGYA 4HXIA 2UY1B 4WWOA 5FT9A 2WQ7A 4XKCA 5BPPA 3BEEA 1LF8A 4JZYA 3JQ1A 5AJDA 2VSYA 4PDXA 5AENA 2J9QA 3FH5A 5EKQD 5BNWA 4ATGA 1E8YA 1H0AA 4WNGA 3FUNA 4G26A 4FULA 2XRYA 4C0MA 2WPVA 3ZYKA 4XZ4A 2WXMA 4C0EA 5J08A 4WNFA 2I1JA 2WXQA 4RG6A 3TG5A 4I1AA 1JWFA 1E7VA 4ANVA 4UQXA 1MQSA 4DK5A 3B7SA 4P29A 1Y6IA 3L16A 2CHXA 3MGBA 4BWRA 2IJGX 2BF0X 3MKQB 4LEUA 4XIFA 1E8WA 2LSUA 3ASDA 3ML9A 4WWNA 2Y4TA 4I1MA 1N54A 2AVPA 2R5SA 2AXZA 3CHRA 4JHRA 2WXLA 4F53A 2GGFA 3FTUA 3IHVA 1WM5A 1BPOA 4JXTA 2A4ZA 2L6JA 4RVBA 5C1DA 2NSZA 3Q49B 3CVUA 3ZYMA 4GB9A 1EF1C 2OV8A 4K03A 5HI7A 2UWJG 1QQEA 4LCTA 2J49A 2BUGA 3FFLA 1IYGA 1HU3A 2RG8A 5ARFA 4JW1A 2VSNA 4G24A 4XI0A 3DBSA 4WWPA 3CSFA 3QNKA 1WY6A 4AV7A 2L9BA 1HS6A 3MEKA 2WMOA 4UI9K 5KCMA 3T8MA 3TXMA 4BT9A 4AY6A 4EQFA 4AEZC 3E4BA 4CT0A 4UWGA 4MKTA 5AYWD 3G2WA 3FUIA 1X5BA 1KT1A 3SZ7A 2J07A 1DNPA 1E7UA 4M3OA 2V4LA 4PS7A 3U4TA 2LSVA 5FZRA 4B89A 3ZHEB 3KAEA 1HFAA 1H2VC 4LRZA 4HFGA 4ABNA 1ELRA 4A3VA 1N52A 5A23A 3CR3A 5CMWA 4XI9A 4J8FA 4RG9A 5JHBA 3PNTB 3CVWA 2VTBB 3LVQE 5G05J 2PZIA 1UW4B 4B0ZA 3MV2B 4I43A 4PS8A 4AIFA 3ASHA 3RK6A 2V0PA 1PC2A 3URZA 2C0LA 3ESKA 4WNDA 2QY7A 3UMVA 1QNFA 1YA0A 3PNLB 3CVVA 3CVNA 4KVMA 3APDA 1H2TC 4GMJA 3SI5A 2MHKA 2WXGA 2X6KA 3NQPA 4I17A 4L2YA 2V8SE 4E6HA 2XRZA 2R59A 3FUHA 2BTDA 3EIQC 3ESLA 5KJNA 3S7FA 3R9AB 2I6HA 4YNDA 4GA2A 3Q15A 1TEZA 3Q47B 5JJTA 3CGHA 3PRZA 4F7AA 3SBSA 3TXNA 3PREA 3BG0B 2WXFA 3VTXA 3CSTA 4L2LA 5AJLA 5FQ4A 1HH8A 4EBAA 2FBNA 1OWPA 3UT8A 2A5UA 4CRWA 1B89A 4N2SA 3EIJA 3OXLA 3G2VA 1W3BA 4IULA 3U64A 2XPZA 4CCAA 4I2ZA 4XKBA 4EZJA 3IBEA 4Q94A 4PS3A 3SBTB 2KCKA 2WXRA 4NURA 1ELKA 3AS5A 3D9PA 1JWGA 2VYIA 3CVLA 4I6JA 4AOFA 3SFZA 4EECA 4BTAA 4MRUA 1E8XA 3LVRE 4I2WA 3B7RL 3LXUX 5DIZA 2XEVA 5G04C 1PAQA 1PY1A 3MV3B 4UI9J 1TJCA 4J8SA 3L22A 2DIWA 3RRUA 3FH8A 4OVVA 3APCA 2VSOE 3CIAA 3QDNA 4U0UA 4L7TA 1H2UA 3ZYQA 4I9CA 1SZAA 3L08A 4G2VA 4U8HA 2Y4UA 2MRIA 3TJPA 3ONLA 3FHEA 5ENNA 5T8IA 3CHQA 3QWWA 4RSYA 2C0MA 3ZYLA 2KZTB 3FUFA 4FJZA 3LDZA 3CQGB 5C2YA 4GZCA 1KLXA 2VGXA 3FH7A 4HLEA 4BX9A 1OWLA 2OVFA 4JA7A 4A1SA 3RRNB 4NACA 1Z3XA 2EQXA 2JLBA 2GRMA 2M63A 2OOEA 3S2AA 3WXXA 5FQ6A 3S7DA 4FP7A 3D9OA 4GYWA 4N3AA 3IV0A 4N5CA 4WNEA 2WB2A 3SF4A 2Y3AA 4TRQA 3UT7A 4HOSA 3L6AA 3FU6A 3P2BA 1HG2A 4YVOA 2LAHA 3HVEB 4E85A 1E96B 4W9RA 3QARA 1SZ9A 4EPZA 3LS8A 4CEMA 3LCAA 4OYSA 2IOSA 3D9IA 3UT4A 3MA5A 3P1UA 4GYOA 3TG4A 3ZGQA 2WQHA 4AXHA 2Q7FA 5J90A 4O6FA 2I2OA 3G2TA 4KVOA 1EYHA 3VLEA 3O48A 3ASGA 3FEXA 3MX3A 2GRLA 4U0SA 2AW6A 1OWOA 4HORA 4URKA 4PUCA 3ZXSA 4HVBA 5FQ8A 3RKVA 3CVQA 2PL2A 4KMOA 2J08A 3FTWA 2IONA 4U07A 3JCKC 3FTZA 4GZDA 3PS6A 4KYOB 2I1KA 4V3IA 4G11A 1E8ZA 4U04A 1HZ4A 5FZSA 3CK8A 3FTYA 4GZ3A 3UPVA 3MYVA 4LUNU 3C98A 2XPIA 2J09A 3QK0A 3LJ3A 4KT6B 2R17C 4GA0A 4K0RA 3LPZA 2CFUA 2OVBA 5EDSA 3U9WA 2L0TB 4UWFA 3QJZA 5CHEE 4BT8A 3LEWA 3MKRA 3VLFA 2IQCA 4Y6CA 2XGOA 5BT1A 3PUKA 3CKCA 3GZ1A 4J0UA 1TJFA 1EDUA 4ME2A 1EPUA 2FO7A 3CK9A 2FULA 3APFA 4IN3B 4R7LA 4FHKA 4G23A 4YVQC 1WAO1 4DLOA 3QOUA 1L5JA 2XGSA 2IF4A 4AM9A 2XCCA 4D10C 3ZIMA 5FJYA 3NF1A 4HS2A 3PVLA 3PUJA 2X6HA 3RIBA 5LP0A 1ZU2A 2PM7A 3EHMA 4ILGA 3ZFWA 3CVYA 4UQYA 2JEKA 2XPYA 4JA9A 3FTSA 2WXIA 1OWMA 4MS6A 1H6KA 1UG3A 3LKUA 3PZDA 4A3TA 2HM8A 3UQ3A 2ZU6B 1JPLA 2HR2A 4FC8A 3GW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P58 C;  3CK7 A;  2UY1 A;  3AS8 A;  4HOQ A;  5D0Q D;  3OXG A;  3FWV A;  1Y8M A;  2YHC A;  4KBQ A;  1NA0 A;  5EX3 A;  3S7B A;  2HYZ A;  5D0O D;  2VQ2 A;  3CVP A;  2YQ8 A;  5ARG A;  1QZ2 A;  3K9I A;  3TAX A;  3QKY A;  4GZ6 A;  4U0Z A;  4AY5 A;  3N71 A;  4JL0 A;  3KS2 A;  3RJV A;  4N3C A;  2PQR A;  3PE4 A;  3ZN3 A;  3VTY A;  2GW1 A;  3LY9 A;  5KJK A;  2FF4 A;  2C2L A;  4KXK B;  4WUY A;  3ZHE A;  4G1T A;  5LCW C;  4G25 A;  2KCV A;  2PQN A;  1NA3 A;  1XNF A;  2XCB A;  3PE3 A;  3GZ2 A;  5JJ7 A;  3GYZ A;  5DBK A;  4Y6W A;  4GPK A;  1FCH A;  1OUV A;  4H7X A;  2IFU A;  5FZQ A;  5CCM A;  2NC9 A;  3HYM B;  5JJ6 A;  3QWV A;  3TGO A;  4UI9 C;  2V5F A;  1P5Q A;  1NZN A;  5HQ8 A;  2VGX B;  3ASF A;  5M72 A;  5G04 J;  3AS4 A;  4J8D A;  2LNI A;  3Q5M A;  4N39 A;  5KJM A;  4H7Y A;  3JYS A;  5FTP A;  4F3V A;  2OND A;  3EDT B;  3KD7 A;  2QFC A;  2KCL A;  2KC7 A;  1ZBP A;  3UUX A;  3LYA A;  4APO A;  3LY8 A;  4GA1 A;  3FP3 A;  2E2E A;  5A6C A;  4HOU A;  3CEQ A;  3RO3 A;  2DBA A;  3Q4A B;  4N3B A;  3CKB A;  4UQZ A;  5CCL A;  4N2Q A;  3U3W A;  4GCO A;  4CGW A;  1KT0 A;  5LCW J;  4NQ0 A;  4CDR A;  4CGV A;  3ULQ A;  3ZPJ A;  1ELW A;  5EX0 A;  4HOT A;  3RO2 A;  4BTB A;  3S7J A;  3OXF A;  3LY7 A;  3RU0 A;  4B94 A;  5A7D B;  4I9E A;  2FI7 A;  4GZ5 A;  2HO1 A;  1HXI A;  2KAT A;  2XGM A;  1IHG A;  3QWP A;  5KJL A;  5G05 C;  3CV0 A;  4GYY A;  2FEZ A;  1A17 A;  3PDN A;  4GCN A;  4J8E A;  3IEG A;  4NRH B;  5BW8 C;  2VGY A;  2UY1 B;  5FT9 A;  3BEE A;  5BNW A;  2VSY A;  2J9Q A;  5EKQ D;  4WNG A;  4G26 A;  2WPV A;  4WNF A;  4RG6 A;  3TG5 A;  4I1A A;  4UQX A;  4BWR A;  4LEU A;  4XIF A;  2LSU A;  3ASD A;  2Y4T A;  2AVP A;  2R5S A;  4JHR A;  1WM5 A;  2L6J A;  5C1D A;  3Q49 B;  5HI7 A;  2UWJ G;  1QQE A;  3FFL A;  2BUG A;  1IYG A;  5ARF A;  2VSN A;  4G24 A;  4XI0 A;  3MEK A;  4AY6 A;  4UI9 K;  4BT9 A;  4EQF A;  3E4B A;  5AYW D;  1KT1 A;  3SZ7 A;  3U4T A;  2LSV A;  5FZR A;  3ZHE B;  3KAE A;  4ABN A;  1ELR A;  4XI9 A;  4J8F A;  4RG9 A;  5G05 J;  2PZI A;  4AIF A;  3MV2 B;  3ASH A;  1PC2 A;  3URZ A;  2C0L A;  3ESK A;  4WND A;  1YA0 A;  3CVN A;  2MHK A;  4I17 A;  5KJN A;  3S7F A;  3R9A B;  2I6H A;  4YND A;  4GA2 A;  3Q15 A;  3Q47 B;  5JJT A;  3VTX A;  1HH8 A;  2FBN A;  1B89 A;  4N2S A;  3OXL A;  1W3B A;  4I2Z A;  2KCK A;  3AS5 A;  2VYI A;  3CVL A;  4BTA A;  4I2W A;  5DIZ A;  5G04 C;  2XEV A;  3MV3 B;  4UI9 J;  1TJC A;  3QDN A;  4U0U A;  4I9C A;  4G2V A;  2Y4U A;  3QWW A;  2C0M A;  1KLX A;  2VGX A;  4JA7 A;  4A1S A;  2OOE A;  2JLB A;  3WXX A;  3S7D A;  4GYW A;  4N3A A;  4N5C A;  4WNE A;  3SF4 A;  4HOS A;  4YVO A;  1E96 B;  4W9R A;  3LCA A;  3MA5 A;  4GYO A;  3TG4 A;  3ZGQ A;  2WQH A;  2Q7F A;  4O6F A;  3O48 A;  3ASG A;  4U0S A;  4HOR A;  3RKV A;  3CVQ A;  2PL2 A;  4U07 A;  4KYO B;  4U04 A;  1HZ4 A;  5FZS A;  3CK8 A;  4GZ3 A;  3UPV A;  2XPI A;  4GA0 A;  3LPZ A;  5CHE E;  4BT8 A;  3MKR A;  4Y6C A;  2XGO A;  5BT1 A;  3CKC A;  3GZ1 A;  4J0U A;  4ME2 A;  2FO7 A;  3CK9 A;  4IN3 B;  4G23 A;  4YVQ C;  1WAO 1;  3QOU A;  2XGS A;  2IF4 A;  4AM9 A;  2XCC A;  5FJY A;  3NF1 A;  3RIB A;  1ZU2 A;  3ZFW A;  4UQY A;  4JA9 A;  3LKU A;  3UQ3 A;  2HR2 A;  3GW4 A; 
#chains in the Genus database with same CATH topology
 2P58 C;  1HX8 A;  1UN8 A;  3CK7 A;  3ZW3 A;  1TN8 A;  3CHO A;  1YYH A;  3SNX A;  4KZ0 A;  2LAI A;  3S7B A;  3DSU A;  3HXD A;  3FEY A;  1MX6 A;  2HYZ A;  5KBA A;  3CVX A;  3HRA A;  5ANR A;  4JC8 A;  3N71 A;  2E0I A;  1U3C A;  1MHQ A;  3KS2 A;  3RJV A;  4DI4 A;  2AXV A;  5EIB E;  2GRQ B;  1HF8 A;  3FUD A;  5H7P A;  3T9K A;  3NZS A;  3PE4 A;  3TWV A;  3VTY A;  2X6F A;  5KJK A;  2C2L A;  2IEJ A;  3T5X A;  1JUQ A;  2H6H A;  4AVX A;  3ZKJ A;  4JPS A;  2PQN A;  2XEN A;  5B1B E;  4GAA A;  1KZP A;  5DBK A;  4GPK A;  4L23 A;  1FCH A;  3DSV A;  4A55 A;  2HE0 A;  5AAO A;  3FUE A;  3CHM A;  1OWN A;  2J4B A;  3UI2 A;  2WMN A;  1RW2 A;  4UWK A;  1QYM A;  4HRM B;  2WXP A;  1LTX A;  3TGO A;  3B7U X;  3W9G A;  1P5Q A;  3PEU B;  5HQ8 A;  2VGX B;  3Q9N C;  5M72 A;  4B8C B;  3B7T A;  4ANU A;  2LNI A;  3Q5M A;  3KEZ A;  3JYS A;  1TNZ A;  1TN6 A;  2OND A;  2RFM A;  1ZB1 A;  3LYA A;  1H19 A;  3L9T A;  4BY6 A;  3HXE A;  2MOW A;  2E2E A;  3MZL B;  5A6C A;  2VGE A;  3BQO A;  3CKB A;  5CCL A;  3G2S A;  4I1O B;  4G8K A;  4C48 B;  3E34 A;  4HOT A;  3RO2 A;  4BTB A;  2VJ8 A;  3TWT A;  3KSL A;  2WXK A;  5LOZ A;  4CDM A;  4B94 A;  5A7D B;  2FI7 A;  4YDW A;  4GTQ A;  2HO1 A;  2KM4 A;  2PNN A;  4ILH B;  2XGM A;  5HKP A;  2P2C P;  2X38 A;  4GYY A;  4HQD A;  4OVU A;  2AJA A;  2NXP A;  5FIO A;  2FEZ A;  1A17 A;  2LXL A;  4J8E A;  3D9M A;  3IEG A;  4WWO A;  4XKC A;  3JQ1 A;  1KPS B;  2ETB A;  5BNW A;  2J9Q A;  2R2L A;  3PZ2 A;  1E8Y A;  5CBN A;  4WNG A;  4G26 A;  3ZYK A;  2L6B A;  5EYP F;  4DK5 A;  4P29 A;  1U2V G;  3EUV A;  4WWN A;  1G3N B;  3V31 A;  1N54 A;  1LD8 A;  4JHR A;  4F53 A;  1WM5 A;  1QQE A;  2J49 A;  3Q78 A;  1HU3 A;  3DBS A;  1HS6 A;  3MEK A;  5KCM A;  3Q7A A;  3FUI A;  1KT1 A;  4BER A;  2J07 A;  3JXJ A;  1MZC A;  4LRZ A;  4RQI A;  4O1O A;  4ABN A;  4LNU D;  2XEH A;  1TNU A;  4J8F A;  3DSS A;  5KNH D;  4B0Z A;  4I43 A;  4AIF A;  3RK6 A;  3CVV A;  3CVN A;  1H2T C;  4TXR A;  3SI5 A;  3NQP A;  3ESL A;  3E32 A;  3Q47 B;  3C3Q A;  3CGH A;  5JJT A;  3TWS A;  3PRE A;  3BG0 B;  3ZXP A;  3VTX A;  5FQ4 A;  1HH8 A;  4CRW A;  4N2S A;  3NOC D;  4DX7 D;  1OCZ E;  4EZJ A;  3KEA A;  3IBE A;  4Q94 A;  5FIN A;  2KCK A;  3D9P A;  4TXP A;  4EEC A;  4MRU A;  1BD8 A;  4I2W A;  3LXU X;  1TJC A;  3FH8 A;  3APC A;  4L7T A;  1H2U A;  2H6I A;  4U8H A;  5T8I A;  3SO8 A;  1OWL A;  3RRN B;  4NAC A;  2M63 A;  2KXP C;  3S7D A;  1V54 E;  3D9O A;  4GYW A;  3IV0 A;  2Y3A A;  3UT7 A;  4HOS A;  3L6A A;  1HG2 A;  4E85 A;  1E96 B;  4W9R A;  2Y69 E;  4EPZ A;  5ENT D;  3V2X A;  1Q2Z A;  3LCA A;  2IOS A;  2DYS E;  3MA5 A;  1O1S A;  2Q7F A;  3FEX A;  5JA4 D;  1OCR E;  4PUC A;  5AQ7 A;  2PL2 A;  2J08 A;  3FTZ A;  4GZD A;  4V3I A;  1E8Z A;  1HZ4 A;  3FTY A;  3UPV A;  3LJ3 A;  2R17 C;  4K0R A;  3LPZ A;  2CFU A;  3U9W A;  2L0T B;  5CHE E;  4ATZ D;  3V2O A;  3VLF A;  4MBG A;  5BT1 A;  3PUK A;  3CKC A;  4HI8 A;  2FO7 A;  3TWU A;  3APF A;  4FHK A;  4YVQ C;  1WAO 1;  4D10 C;  3ZIM A;  3NF1 A;  3PUJ A;  5LP0 A;  4ZFH A;  3CVY A;  4UQY A;  2JEK A;  2XPY A;  5KNG A;  3FTS A;  1H6K A;  4A3T A;  5EYL A;  3UQ3 A;  4FC8 A;  3GW4 A;  1JCS A;  3OTN A;  2P9P G;  3PZ4 A;  4GML A;  4BES A;  1Z5S C;  2PM6 A;  3AS8 A;  1H6P A;  3EU5 A;  3OXG A;  3FWV A;  4LG6 A;  3BG1 B;  4KBQ A;  3HHM A;  1N9A A;  3UKU G;  2DZN A;  5BV1 A;  3T5V A;  1NA0 A;  5E75 A;  1INZ A;  3FTV A;  3DRA A;  2VQ2 A;  1FVF A;  1NP7 A;  3CVP A;  2IO3 C;  5ARG A;  4F1S A;  5ENQ D;  4BX8 A;  4ANW A;  1Z3Y A;  2R03 A;  3FU0 A;  4U0Z A;  4AY5 A;  4F6R D;  4Q69 A;  3PH0 C;  3TWX A;  2DYR E;  3JQ0 A;  2AXU A;  1AWC B;  2ZIR A;  5T3R A;  3D9L A;  2LO6 A;  2GW1 A;  2ETA A;  4TV3 A;  3SQV A;  3CQC B;  3ZHE A;  3FUK A;  5ENR D;  2XHE A;  4G25 A;  1NA3 A;  3W9F A;  1XNF A;  3CHP A;  3GYZ A;  5AIJ A;  2WXJ A;  3R7Q A;  1HG5 A;  1IHB A;  5FZQ A;  3HYM B;  1IQR A;  1O1R A;  1MX2 A;  3FUM A;  4O1P A;  4AJW A;  4UI9 C;  3SFX A;  4RLY A;  2IOL A;  3MCX A;  5ANL A;  2P9L G;  4J8D A;  4C9B B;  2XQ0 A;  2ZIS A;  4N39 A;  2F37 A;  3I3N A;  4F3V A;  2CHZ A;  2QFC A;  3B95 A;  3I4G A;  5ENP D;  5B3S E;  3UUX A;  4JB8 P;  3LY8 A;  3FU3 A;  2YNQ A;  3HDX A;  4Z68 A;  3AJI A;  3IKO B;  1DC2 A;  5CMY A;  2KZT A;  2IY0 C;  4EZK A;  2EIK E;  2CG2 A;  5FWQ A;  2WM9 A;  3U3W A;  4Q96 A;  3ZEF A;  1S0P A;  5LCW J;  2V4H C;  4CDR A;  3ULQ A;  3FTX A;  3FUL A;  3KSQ A;  3ZPJ A;  1U3D A;  3WG7 E;  5EX0 A;  4NIK A;  4FJY A;  2J4D A;  4HRN A;  1BI7 B;  3LY7 A;  3L17 A;  4I9E A;  1BLX B;  1GW6 A;  1K8K G;  1IHG A;  3QWP A;  5KJL A;  3HG0 D;  1S70 B;  1WDY A;  3CV0 A;  4QFV A;  3ZRH A;  4GCN A;  5AQA A;  1MYO A;  3RAU A;  3FY4 A;  3D9N A;  2OEV A;  2VGY A;  4JZY A;  5AJD A;  5AEN A;  3FH5 A;  5EKQ D;  4ATG A;  4FUL A;  4X8Q A;  5B1A E;  4C0M A;  4C0E A;  4XZ4 A;  5J08 A;  4DX2 A;  4WNF A;  2I1J A;  4RG6 A;  3E33 A;  1JWF A;  1E7V A;  4ANV A;  5CRV A;  3L16 A;  4XIF A;  3ASD A;  5D66 A;  4I1M A;  2AVP A;  2L6J A;  4K5A B;  2NSZ A;  3CVU A;  3ZYM A;  4GB9 A;  2OV8 A;  2P9K G;  5HI7 A;  2UWJ G;  4LCT A;  2BUG A;  1IYG A;  4G24 A;  4AV7 A;  2WMO A;  4EQF A;  4AEZ C;  1SW6 A;  4UWG A;  5AYW D;  4BSZ B;  3SZ7 A;  1E7U A;  4PS7 A;  3U4T A;  2LSV A;  5FZR A;  3ZHE B;  4GTP A;  1ELR A;  4A3V A;  2OCC E;  3CR3 A;  4YDY A;  3LVQ E;  5G05 J;  2PZI A;  1UW4 B;  4CZ2 D;  4PS8 A;  3ASH A;  3ESK A;  3UMV A;  4KVM A;  2MHK A;  3Q75 A;  2XRZ A;  5KJN A;  4GA2 A;  1TEZ A;  3C5R A;  1OCO E;  2WXF A;  2B6C A;  2FBN A;  2A5U A;  3EIJ A;  4GTM A;  4CCA A;  3U64 A;  4I2Z A;  1FT2 A;  3AS5 A;  3SFZ A;  5DIZ A;  3ABM E;  5G04 C;  1PY1 A;  4B93 B;  3MV3 B;  4UI9 J;  4J8S A;  2DIW A;  3RRU A;  4OVV A;  2VSO E;  3QDN A;  4U0U A;  3ZYQ A;  2NYJ A;  2Y4U A;  4F1P A;  2MRI A;  1D8D A;  3ONL A;  3CHQ A;  2H6F A;  2KZT B;  2EIJ E;  5C2Y A;  3LJN A;  4BX9 A;  4HBD A;  1Z3X A;  4N5C A;  1WG0 A;  3ASN E;  4YVO A;  3QAR A;  3DSX A;  1SZ9 A;  3X2Q E;  3LS8 A;  3ABK E;  4G8L A;  3UT4 A;  4GTT A;  3Q7F A;  1NL4 A;  1JCQ A;  5J90 A;  2I2O A;  3VLE A;  2AW6 A;  1OWO A;  4YDE A;  4HOR A;  3CVQ A;  4KYO B;  4G11 A;  4U04 A;  5AQB A;  4N5Q A;  4LUN U;  2XPI A;  1D8E A;  5EDS A;  2RFA A;  3QJZ A;  3BUA A;  1TNY A;  4Y6C A;  2XGO A;  1K3Z D;  1TJF A;  1EPU A;  3CK9 A;  2BKG A;  4IN3 B;  2BED A;  1L5J A;  2IF4 A;  4AM9 A;  5FJY A;  2JAB A;  3PVL A;  3RIB A;  1FPP A;  2PM7 A;  4ILG A;  5CBO A;  4MS6 A;  2LXM A;  2HM8 A;  3UIO C;  3EU9 A;  1JPL A;  2HR2 A;  3D9K A;  3J5P A;  1SQM A;  5G55 A;  1K1B A;  3QB2 A;  1TYQ G;  2AWI A;  5D0Q D;  3EHN A;  3MJW A;  1DVP A;  4U8V D;  1Y8M A;  3O4Z A;  1H6O A;  4FA6 A;  4GPM A;  2P9U G;  3L54 A;  3Q73 A;  3I5P A;  1E90 A;  2YQ8 A;  2WXH A;  1QZ2 A;  3QAQ A;  3K9I A;  5CEC B;  2A5E A;  2ZGG A;  4GZ6 A;  3L13 A;  3UIN C;  4M7C A;  4DI3 A;  5BXO A;  2PQR A;  5ENS D;  1N0Q A;  2DCP A;  2WXO A;  1UJJ A;  2YIN A;  3LY9 A;  2FF4 A;  4LNG A;  2VSX E;  5CER B;  5LCW C;  4IRU A;  5ENO D;  4KZC A;  4AP2 A;  2GRR B;  1IKN D;  1FVH A;  4XEI G;  1OUV A;  3SY2 A;  3PZ1 A;  3SD5 A;  2P9I G;  3JUE A;  1VDY A;  1OT8 A;  4BEP A;  2XS8 A;  2H6G A;  1N94 A;  1DCE A;  3HXB A;  4A1G A;  4XE0 A;  2QC9 A;  3FDH A;  3QWV A;  2Y1L E;  4TUU A;  2V5F A;  1NZN A;  4CDN A;  3I4R B;  3ASF A;  5G04 J;  3AS4 A;  1SVX A;  3PEV B;  2ZGD A;  5KJM A;  1TNO A;  2QYJ A;  2RD0 A;  3CLJ A;  4ANX A;  4H7Y A;  5D2M C;  3KD7 A;  2KCL A;  4DPR A;  2B0O E;  4DX6 D;  2KC7 A;  1RZ4 A;  5BV0 A;  4K5B A;  5CED B;  1YCS B;  4GTS A;  2X3M A;  4APO A;  2CG3 A;  2GRP B;  3CHS A;  4ACL A;  4HOU A;  2ILR A;  3CEQ A;  3EHQ A;  4JD2 G;  3Q4A B;  4JEU A;  3D9J A;  4U96 D;  4N2Q A;  4GCO A;  4CGW A;  1D9S A;  1KT0 A;  3ZUV B;  4J7W A;  4NQ0 A;  1A5E A;  2YHE A;  3NOG D;  3TWQ A;  1ELW A;  4EZL A;  1UN9 A;  3IXE A;  4FHJ A;  4L1B A;  4FLH A;  3OXF A;  5T4Y A;  3FU5 A;  2LUH A;  3AG3 E;  4GU5 A;  2R05 A;  4GMR A;  4LER A;  1XGW A;  4EBA G;  4CYM D;  4DJA A;  3DST A;  3OAW A;  5G05 C;  5LX8 A;  5E76 A;  3EJN A;  4JHJ A;  4JHK A;  3PDN A;  3G2U A;  3B13 A;  2EIM E;  4HXI A;  5FT9 A;  2WQ7 A;  2VSY A;  4PDX A;  2WXM A;  2CHX A;  4BWR A;  2IJG X;  2XZD G;  1E8W A;  2Y4T A;  3CHR A;  2WXL A;  3FTU A;  4J8Y A;  3ISM C;  5AN8 A;  3V30 A;  3FFL A;  3AAA C;  2RG8 A;  2VSN A;  2XS1 A;  4WWP A;  4QQI A;  3QNK A;  2L9B A;  3TXM A;  2RKK A;  4CT0 A;  4MKT A;  3G2W A;  1X5B A;  1DNP A;  4M3O A;  2V4L A;  1OY3 D;  4B89 A;  3KAE A;  4HFG A;  5A23 A;  1N52 A;  3E37 A;  3EHR A;  2FO1 E;  1MX4 A;  3DXM G;  3MV2 B;  4ZHB A;  2C0L A;  4WND A;  2OEW A;  3DEO A;  4HNA D;  3APD A;  4GMJ A;  4I17 A;  3UM3 A;  1N4R A;  1MJ0 A;  1TN7 A;  2V8S E;  4E6H A;  3FUH A;  5EID A;  3R9A B;  3PZ3 A;  2ZXW E;  4YND A;  3UTM A;  3PRZ A;  4F7A A;  2DVW A;  4K5C A;  3SFY A;  4L2L A;  3UIP C;  3UT8 A;  1B89 A;  3OXL A;  3G2V A;  4IUL A;  4XKB A;  3SBT B;  4NUR A;  1JWG A;  2VYI A;  3CVL A;  5HS0 A;  1FT1 A;  3LVR E;  1PAQ A;  4LSZ E;  4DX5 D;  1YMP A;  3L08 A;  4G2V A;  5ENN A;  2QZA A;  3QWW A;  4RSY A;  2C0M A;  3ZYL A;  4HLE A;  2MYO A;  1KLX A;  3FH7 A;  2JLB A;  5FQ6 A;  4FP7 A;  3J5Q B;  2QYU A;  3SF4 A;  3NBN B;  4TRQ A;  3FU6 A;  3P2B A;  3L82 A;  3P1U A;  3ZGQ A;  4AXH A;  4O6F A;  3G2T A;  4KVO A;  3MX3 A;  2GRL A;  4U0S A;  4URK A;  5FQ8 A;  3RKV A;  3ULY A;  3PS6 A;  5FZS A;  5IY5 E;  2J09 A;  3QK0 A;  2OVB A;  3C72 A;  3UM2 A;  3LEW A;  2KBX A;  3MKR A;  4U8Y D;  1NFI E;  4G23 A;  3QOU A;  1N11 A;  2ETC A;  2BKK B;  2XCC A;  3E30 A;  4HS2 A;  2X6H A;  3EHM A;  4OAV B;  3ABL E;  4JA9 A;  5CRU A;  1UG3 A;  3LKU A;  3PZD A;  3Q9U C;  3ULE G;  2UY1 A;  3JXI A;  4HOQ A;  4DLQ A;  2L0I A;  1N4P A;  2YHC A;  3UXG A;  3DPY A;  5EX3 A;  4FU3 A;  3GZS A;  1OCC E;  5D0O D;  1AP7 A;  3MKQ A;  3DPD A;  4A63 B;  4HI9 A;  4HB5 A;  3UM1 A;  4JEH A;  5EN5 D;  3TAX A;  3QKY A;  3NZU A;  1S63 A;  4JL0 A;  1SA5 A;  4N3C A;  5JHA A;  1IQU A;  1KZO A;  3U66 A;  2WVI A;  3ZN3 A;  3RRM B;  2J8S D;  3SHF A;  4J6I A;  4U63 A;  4KXK B;  4WUY A;  2R02 A;  4DRX E;  3QC1 A;  4HRL A;  4G1T A;  2CFZ A;  2KCV A;  2P9S G;  2VTB A;  4PH4 B;  5FQ7 A;  3ENE A;  4XX5 A;  2XCB A;  2P9N G;  3AU4 A;  3GZ2 A;  3PE3 A;  5JJ7 A;  4UWH A;  4Y6W A;  1DCQ A;  4ILI A;  3C3R A;  4H7X A;  4DX1 A;  2IFU A;  5CCM A;  2NC9 A;  5G2N A;  3DSW A;  4WAF A;  1HE8 A;  3TL5 A;  2IU1 A;  5JJ6 A;  3SGH A;  4BET A;  3HXC A;  1N4S A;  1UJK A;  4UWL A;  3ZNG A;  1IXV A;  3HXF A;  3AG4 E;  5FTP A;  3UKR G;  2WXN A;  3EDT B;  2XZT G;  5KWD A;  5LFA A;  2GRO B;  1Z6T A;  2F8X K;  3VLD A;  1SA4 A;  3D9H A;  1ZBP A;  4U95 D;  1NI1 A;  3ONK A;  3C3O A;  3HIZ A;  4GA1 A;  4FLB A;  1N0R A;  5BUZ A;  3FUJ A;  3FP3 A;  3V79 K;  2V5Q C;  3RO3 A;  4CT4 A;  4FAD A;  2DBA A;  2I9C A;  4N3B A;  5CEA A;  4UQZ A;  4BFR A;  4APF A;  1UOH A;  4CGV A;  4IYP A;  4MLP A;  5JMN D;  4UUC A;  3AG1 E;  4ACK A;  3HVE A;  4B8A A;  3S7J A;  3RU0 A;  4JVS A;  4I6E A;  4O60 A;  2Y0B G;  3ZU7 B;  2CHW A;  4GZ5 A;  3JUI A;  4I6G A;  1HXI A;  3ML8 A;  2KAT A;  1HO8 A;  3AU5 A;  3TWR A;  3UX4 A;  4BSX A;  3D3M A;  2X6J A;  3R7R A;  3ZVV A;  2WQ6 A;  5AQ9 A;  1OXJ A;  2X6I A;  3IHY A;  4NRH B;  5BW8 C;  2UY1 B;  4DUI A;  5BPP A;  3BEE A;  1LF8 A;  3BU8 A;  1H0A A;  3FUN A;  2XRY A;  2WPV A;  3R9M A;  2WXQ A;  3TG5 A;  4I1A A;  2GRN B;  4UQX A;  1MQS A;  1O1T A;  3B7S A;  1Y6I A;  3MGB A;  4OAU C;  1BI8 B;  2BF0 X;  3MKQ B;  4LEU A;  2LSU A;  3ML9 A;  2R5S A;  2AXZ A;  2GGF A;  3IHV A;  1BPO A;  4JXT A;  2A4Z A;  4RVB A;  5C1D A;  3Q49 B;  1EF1 C;  3ASO E;  4K03 A;  3RSE G;  5ARF A;  4JW1 A;  4XI0 A;  3CSF A;  1WY6 A;  3T8M A;  4AY6 A;  4UI9 K;  2EIN E;  4BT9 A;  3E4B A;  5BXU A;  3T8K A;  1BU9 A;  4YDO A;  1HFA A;  1H2V C;  3NB2 A;  5CMW A;  4XI9 A;  4RG9 A;  1LD7 A;  3PNT B;  5JHB A;  3CVW A;  2VTB B;  3DEP A;  2XEE A;  2V0P A;  1PC2 A;  3URZ A;  1N4Q A;  4GTV A;  2QY7 A;  1QNF A;  1YA0 A;  3PNL B;  4U7E B;  2IO2 C;  4L9P A;  2WXG A;  2X6K A;  4L2Y A;  1K1A A;  2R59 A;  1O5M A;  2BTD A;  3EIQ C;  1V55 E;  3S7F A;  2I6H A;  3DWL G;  3Q15 A;  1QBQ A;  2DWZ A;  3SBS A;  4TUM A;  3TXN A;  4TXQ A;  3B7B A;  3CST A;  5AJL A;  4EBA A;  1OWP A;  4GTO A;  1W3B A;  2XPZ A;  4PS3 A;  2WXR A;  1ELK A;  4I6J A;  4AOF A;  4BTA A;  1E8X A;  3B7R L;  3Q79 A;  2XEV A;  1TNB A;  3L22 A;  3CIA A;  4I9C A;  1SZA A;  3TJP A;  4HLL A;  3FHE A;  3FUF A;  4FJZ A;  3LDZ A;  3CQG B;  4GZC A;  2VGX A;  2OVF A;  4JA7 A;  4A1S A;  2EQX A;  3S2A A;  2EIL E;  2GRM A;  2OOE A;  3WXX A;  4N3A A;  4WNE A;  2WB2 A;  2LAH A;  3HVE B;  3DXK G;  2F8Y A;  5HRY A;  5ITZ F;  4CEM A;  1X81 A;  3NAW A;  4OYS A;  3D9I A;  2F0Y A;  4GYO A;  3TG4 A;  1S64 A;  1TR4 A;  2WQH A;  1EYH A;  3TWW A;  3O48 A;  3ASG A;  1N95 A;  4HVB A;  3ZXS A;  3UM0 A;  4LNB A;  4KMO A;  3FTW A;  2ION A;  4U07 A;  3JCK C;  2DZO A;  2I1K A;  3CK8 A;  4GZ3 A;  3MYV A;  3C98 A;  4KT6 B;  4GTR A;  4GA0 A;  4UWF A;  4BT8 A;  2IQC A;  5AAR A;  3GZ1 A;  4J0U A;  1EDU A;  4ME2 A;  2FUL A;  4R7L A;  4DLO A;  2XGS A;  1JCR A;  3F6Q A;  3AG2 E;  1ZU2 A;  3ZFW A;  4EHM A;  5EIL A;  2WXI A;  1OWM A;  2ZU6 B; 
#chains in the Genus database with same CATH homology
 3D9K A;  2P58 C;  1HX8 A;  1SQM A;  3OTN A;  1UN8 A;  3CK7 A;  4GML A;  2UY1 A;  5G55 A;  3QB2 A;  3ZW3 A;  2PM6 A;  3AS8 A;  3CHO A;  3SNX A;  4HOQ A;  2AWI A;  5D0Q D;  4DLQ A;  3EHN A;  3MJW A;  2L0I A;  1DVP A;  3FWV A;  3OXG A;  1Y8M A;  3BG1 B;  3O4Z A;  2YHC A;  4FA6 A;  4KBQ A;  3HHM A;  4KZ0 A;  2LAI A;  5BV1 A;  3T5V A;  1NA0 A;  5EX3 A;  3S7B A;  3L54 A;  3FEY A;  4FU3 A;  5E75 A;  1INZ A;  3GZS A;  2HYZ A;  3FTV A;  5D0O D;  2VQ2 A;  1FVF A;  3MKQ A;  3CVX A;  3I5P A;  3DPD A;  1E90 A;  1NP7 A;  3CVP A;  2YQ8 A;  2WXH A;  5ARG A;  1QZ2 A;  3QAQ A;  3K9I A;  4F1S A;  4JEH A;  3TAX A;  4BX8 A;  4ANW A;  3QKY A;  1Z3Y A;  5ANR A;  3NZU A;  3FU0 A;  4GZ6 A;  3L13 A;  4U0Z A;  4JC8 A;  4AY5 A;  3N71 A;  2E0I A;  1U3C A;  4JL0 A;  4DI3 A;  1MHQ A;  3KS2 A;  4Q69 A;  3RJV A;  4DI4 A;  3PH0 C;  2AXV A;  4N3C A;  2PQR A;  5JHA A;  3JQ0 A;  2AXU A;  1HF8 A;  1IQU A;  2DCP A;  3FUD A;  5T3R A;  3U66 A;  2WXO A;  3D9L A;  2WVI A;  3NZS A;  1UJJ A;  3PE4 A;  3ZN3 A;  3RRM B;  2LO6 A;  3SHF A;  3VTY A;  2GW1 A;  2X6F A;  2YIN A;  3LY9 A;  4J6I A;  5KJK A;  2FF4 A;  4TV3 A;  4U63 A;  2C2L A;  4KXK B;  4WUY A;  2VSX E;  3CQC B;  3ZHE A;  3T5X A;  3FUK A;  3QC1 A;  4G1T A;  5LCW C;  1JUQ A;  2CFZ A;  2XHE A;  4G25 A;  4AVX A;  2KCV A;  4JPS A;  4IRU A;  2VTB A;  4PH4 B;  2PQN A;  1NA3 A;  5FQ7 A;  3ENE A;  4XX5 A;  1XNF A;  2XCB A;  4GAA A;  3AU4 A;  3GZ2 A;  3CHP A;  3PE3 A;  5JJ7 A;  3GYZ A;  5DBK A;  4UWH A;  4KZC A;  4Y6W A;  5AIJ A;  4AP2 A;  2WXJ A;  4GPK A;  4L23 A;  1FCH A;  1FVH A;  4ILI A;  4A55 A;  3R7Q A;  1OUV A;  1HG5 A;  3FUE A;  3CHM A;  1OWN A;  4H7X A;  2J4B A;  2IFU A;  5FZQ A;  3SD5 A;  5CCM A;  2WMN A;  1VDY A;  4UWK A;  2NC9 A;  5G2N A;  4WAF A;  3HYM B;  1IQR A;  1HE8 A;  3TL5 A;  2IU1 A;  4A1G A;  2WXP A;  3FUM A;  4XE0 A;  5JJ6 A;  3FDH A;  3QWV A;  4AJW A;  3SGH A;  3TGO A;  3B7U X;  4UI9 C;  4TUU A;  2V5F A;  1P5Q A;  3PEU B;  1NZN A;  4CDN A;  3I4R B;  5HQ8 A;  2IOL A;  1UJK A;  2VGX B;  3ASF A;  4UWL A;  3MCX A;  5M72 A;  5G04 J;  5ANL A;  4B8C B;  3AS4 A;  4J8D A;  4C9B B;  2XQ0 A;  3B7T A;  3PEV B;  4ANU A;  2LNI A;  3Q5M A;  4N39 A;  3CLJ A;  2RD0 A;  4ANX A;  5KJM A;  3I3N A;  4H7Y A;  3KEZ A;  3JYS A;  5FTP A;  2WXN A;  4F3V A;  2OND A;  3EDT B;  2CHZ A;  3KD7 A;  5LFA A;  2QFC A;  2KCL A;  1Z6T A;  4DPR A;  3I4G A;  2KC7 A;  3VLD A;  5BV0 A;  1ZBP A;  3UUX A;  3LYA A;  1H19 A;  3ONK A;  2X3M A;  4APO A;  3LY8 A;  2CG3 A;  3FU3 A;  4BY6 A;  2YNQ A;  3HDX A;  3HIZ A;  4GA1 A;  4FLB A;  2MOW A;  3CHS A;  3FUJ A;  3FP3 A;  2E2E A;  3MZL B;  4ACL A;  5BUZ A;  5A6C A;  3IKO B;  4HOU A;  2ILR A;  3CEQ A;  5CMY A;  3RO3 A;  4CT4 A;  4FAD A;  2DBA A;  2KZT A;  3Q4A B;  2I9C A;  4EZK A;  4N3B A;  3CKB A;  4UQZ A;  4JEU A;  4BFR A;  2CG2 A;  5FWQ A;  5CCL A;  3D9J A;  4APF A;  2WM9 A;  3G2S A;  4I1O B;  4N2Q A;  3U3W A;  4GCO A;  4CGW A;  4Q96 A;  3ZEF A;  1KT0 A;  1S0P A;  5LCW J;  4NQ0 A;  4CDR A;  4CGV A;  3ULQ A;  4IYP A;  3FTX A;  2YHE A;  3FUL A;  3ZPJ A;  4EZL A;  1ELW A;  1UN9 A;  1U3D A;  4MLP A;  5EX0 A;  4HOT A;  4FJY A;  3RO2 A;  4FHJ A;  4BTB A;  4ACK A;  4L1B A;  2J4D A;  3HVE A;  4FLH A;  4B8A A;  2VJ8 A;  3S7J A;  3OXF A;  3LY7 A;  2WXK A;  5LOZ A;  3RU0 A;  5T4Y A;  3FU5 A;  3L17 A;  4CDM A;  4JVS A;  4B94 A;  4I6E A;  4GU5 A;  5A7D B;  4I9E A;  2FI7 A;  4LER A;  2CHW A;  1XGW A;  4GZ5 A;  3JUI A;  4I6G A;  2HO1 A;  1GW6 A;  2KM4 A;  1HXI A;  3ML8 A;  4EBA G;  4ILH B;  2KAT A;  1HO8 A;  2XGM A;  3AU5 A;  4DJA A;  3UX4 A;  1IHG A;  3QWP A;  4BSX A;  5KJL A;  3OAW A;  5G05 C;  3D3M A;  2X6J A;  3R7R A;  3ZVV A;  2X38 A;  5LX8 A;  5E76 A;  3CV0 A;  3EJN A;  4JHJ A;  4QFV A;  2WQ6 A;  4GYY A;  4OVU A;  2NXP A;  4JHK A;  3ZRH A;  2FEZ A;  1A17 A;  3PDN A;  4GCN A;  2X6I A;  4J8E A;  3IHY A;  3G2U A;  3D9M A;  3B13 A;  3FY4 A;  3IEG A;  4NRH B;  5BW8 C;  3D9N A;  2VGY A;  4HXI A;  2UY1 B;  4WWO A;  5FT9 A;  2WQ7 A;  4XKC A;  5BPP A;  3BEE A;  1LF8 A;  4JZY A;  3JQ1 A;  5AJD A;  2VSY A;  4PDX A;  5AEN A;  2J9Q A;  3FH5 A;  5EKQ D;  5BNW A;  4ATG A;  1E8Y A;  1H0A A;  4WNG A;  3FUN A;  4G26 A;  4FUL A;  2XRY A;  4C0M A;  2WPV A;  3ZYK A;  4XZ4 A;  2WXM A;  4C0E A;  5J08 A;  4WNF A;  2I1J A;  2WXQ A;  4RG6 A;  3TG5 A;  4I1A A;  1JWF A;  1E7V A;  4ANV A;  4UQX A;  1MQS A;  4DK5 A;  3B7S A;  4P29 A;  1Y6I A;  3L16 A;  2CHX A;  3MGB A;  4BWR A;  2IJG X;  2BF0 X;  3MKQ B;  4LEU A;  4XIF A;  1E8W A;  2LSU A;  3ASD A;  3ML9 A;  4WWN A;  2Y4T A;  4I1M A;  1N54 A;  2AVP A;  2R5S A;  2AXZ A;  3CHR A;  4JHR A;  2WXL A;  4F53 A;  2GGF A;  3FTU A;  3IHV A;  1WM5 A;  1BPO A;  4JXT A;  2A4Z A;  2L6J A;  4RVB A;  5C1D A;  2NSZ A;  3Q49 B;  3CVU A;  3ZYM A;  4GB9 A;  1EF1 C;  2OV8 A;  4K03 A;  5HI7 A;  2UWJ G;  1QQE A;  4LCT A;  2J49 A;  2BUG A;  3FFL A;  1IYG A;  1HU3 A;  2RG8 A;  5ARF A;  4JW1 A;  2VSN A;  4G24 A;  4XI0 A;  3DBS A;  4WWP A;  3CSF A;  3QNK A;  1WY6 A;  4AV7 A;  2L9B A;  1HS6 A;  3MEK A;  2WMO A;  4UI9 K;  5KCM A;  3T8M A;  3TXM A;  4BT9 A;  4AY6 A;  4EQF A;  4AEZ C;  3E4B A;  4CT0 A;  4UWG A;  4MKT A;  5AYW D;  3G2W A;  3FUI A;  1X5B A;  1KT1 A;  3SZ7 A;  2J07 A;  1DNP A;  1E7U A;  4M3O A;  2V4L A;  4PS7 A;  3U4T A;  2LSV A;  5FZR A;  4B89 A;  3ZHE B;  3KAE A;  1HFA A;  1H2V C;  4LRZ A;  4HFG A;  4ABN A;  1ELR A;  4A3V A;  1N52 A;  5A23 A;  3CR3 A;  5CMW A;  4XI9 A;  4J8F A;  4RG9 A;  5JHB A;  3PNT B;  3CVW A;  2VTB B;  3LVQ E;  5G05 J;  2PZI A;  1UW4 B;  4B0Z A;  3MV2 B;  4I43 A;  4PS8 A;  4AIF A;  3ASH A;  3RK6 A;  2V0P A;  1PC2 A;  3URZ A;  2C0L A;  3ESK A;  4WND A;  2QY7 A;  3UMV A;  1QNF A;  1YA0 A;  3PNL B;  3CVV A;  3CVN A;  4KVM A;  3APD A;  1H2T C;  4GMJ A;  3SI5 A;  2MHK A;  2WXG A;  2X6K A;  3NQP A;  4I17 A;  4L2Y A;  2V8S E;  4E6H A;  2XRZ A;  2R59 A;  3FUH A;  2BTD A;  3EIQ C;  3ESL A;  5KJN A;  3S7F A;  3R9A B;  2I6H A;  4YND A;  4GA2 A;  3Q15 A;  1TEZ A;  3Q47 B;  5JJT A;  3CGH A;  3PRZ A;  4F7A A;  3SBS A;  3TXN A;  3PRE A;  3BG0 B;  2WXF A;  3VTX A;  3CST A;  4L2L A;  5AJL A;  5FQ4 A;  1HH8 A;  4EBA A;  2FBN A;  1OWP A;  3UT8 A;  2A5U A;  4CRW A;  1B89 A;  4N2S A;  3EIJ A;  3OXL A;  3G2V A;  1W3B A;  4IUL A;  3U64 A;  2XPZ A;  4CCA A;  4I2Z A;  4XKB A;  4EZJ A;  3IBE A;  4Q94 A;  4PS3 A;  3SBT B;  2KCK A;  2WXR A;  4NUR A;  1ELK A;  3AS5 A;  3D9P A;  1JWG A;  2VYI A;  3CVL A;  4I6J A;  4AOF A;  3SFZ A;  4EEC A;  4BTA A;  4MRU A;  1E8X A;  3LVR E;  4I2W A;  3B7R L;  3LXU X;  5DIZ A;  2XEV A;  5G04 C;  1PAQ A;  1PY1 A;  3MV3 B;  4UI9 J;  1TJC A;  4J8S A;  3L22 A;  2DIW A;  3RRU A;  3FH8 A;  4OVV A;  3APC A;  2VSO E;  3CIA A;  3QDN A;  4U0U A;  4L7T A;  1H2U A;  3ZYQ A;  4I9C A;  1SZA A;  3L08 A;  4G2V A;  4U8H A;  2Y4U A;  2MRI A;  3TJP A;  3ONL A;  3FHE A;  5ENN A;  5T8I A;  3CHQ A;  3QWW A;  4RSY A;  2C0M A;  3ZYL A;  2KZT B;  3FUF A;  4FJZ A;  3LDZ A;  3CQG B;  5C2Y A;  4GZC A;  1KLX A;  2VGX A;  3FH7 A;  4HLE A;  4BX9 A;  1OWL A;  2OVF A;  4JA7 A;  4A1S A;  3RRN B;  4NAC A;  1Z3X A;  2EQX A;  2JLB A;  2GRM A;  2M63 A;  2OOE A;  3S2A A;  3WXX A;  5FQ6 A;  3S7D A;  4FP7 A;  3D9O A;  4GYW A;  4N3A A;  3IV0 A;  4N5C A;  4WNE A;  2WB2 A;  3SF4 A;  2Y3A A;  4TRQ A;  3UT7 A;  4HOS A;  3L6A A;  3FU6 A;  3P2B A;  1HG2 A;  4YVO A;  2LAH A;  3HVE B;  4E85 A;  1E96 B;  4W9R A;  3QAR A;  1SZ9 A;  4EPZ A;  3LS8 A;  4CEM A;  3LCA A;  4OYS A;  2IOS A;  3D9I A;  3UT4 A;  3MA5 A;  3P1U A;  4GYO A;  3TG4 A;  3ZGQ A;  2WQH A;  4AXH A;  2Q7F A;  5J90 A;  4O6F A;  2I2O A;  3G2T A;  4KVO A;  1EYH A;  3VLE A;  3O48 A;  3ASG A;  3FEX A;  3MX3 A;  2GRL A;  4U0S A;  2AW6 A;  1OWO A;  4HOR A;  4URK A;  4PUC A;  3ZXS A;  4HVB A;  5FQ8 A;  3RKV A;  3CVQ A;  2PL2 A;  4KMO A;  2J08 A;  3FTW A;  2ION A;  4U07 A;  3JCK C;  3FTZ A;  4GZD A;  3PS6 A;  4KYO B;  2I1K A;  4V3I A;  4G11 A;  1E8Z A;  4U04 A;  1HZ4 A;  5FZS A;  3CK8 A;  3FTY A;  4GZ3 A;  3UPV A;  3MYV A;  4LUN U;  3C98 A;  2XPI A;  2J09 A;  3QK0 A;  3LJ3 A;  4KT6 B;  2R17 C;  4GA0 A;  4K0R A;  3LPZ A;  2CFU A;  2OVB A;  5EDS A;  3U9W A;  2L0T B;  4UWF A;  3QJZ A;  5CHE E;  4BT8 A;  3LEW A;  3MKR A;  3VLF A;  2IQC A;  4Y6C A;  2XGO A;  5BT1 A;  3PUK A;  3CKC A;  3GZ1 A;  4J0U A;  1TJF A;  1EDU A;  4ME2 A;  1EPU A;  2FO7 A;  3CK9 A;  2FUL A;  3APF A;  4IN3 B;  4R7L A;  4FHK A;  4G23 A;  4YVQ C;  1WAO 1;  4DLO A;  3QOU A;  1L5J A;  2XGS A;  2IF4 A;  4AM9 A;  2XCC A;  4D10 C;  3ZIM A;  5FJY A;  3NF1 A;  4HS2 A;  3PVL A;  3PUJ A;  2X6H A;  3RIB A;  5LP0 A;  1ZU2 A;  2PM7 A;  3EHM A;  4ILG A;  3ZFW A;  3CVY A;  4UQY A;  2JEK A;  2XPY A;  4JA9 A;  3FTS A;  2WXI A;  1OWM A;  4MS6 A;  1H6K A;  1UG3 A;  3LKU A;  3PZD A;  4A3T A;  2HM8 A;  3UQ3 A;  2ZU6 B;  1JPL A;  2HR2 A;  4FC8 A;  3GW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...