4B93B

Complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat domain of varp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
191
Chain Sequence
KDYREVEKLLRAVADGDLEMVRYLLEWTSGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VESICLE-ASSOCIATED MEMBRANE PROTEIN 7
publication title The Binding of Varp to Vamp7 Traps Vamp7 in a Closed, Fusogenically Inactive Conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Exocytosis
total genus 67
structure length 191
sequence length 231
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4b93B00
4BEPA 2P2CP 2KXPC 4NIKA 5ITZF 4QQIA 3ZU7B 3T9KA 4DX1A 4YDYA 3DEPA 5EYPF 5AN8A 3V31A 2J8SD 5EYLA 4N5QA 5ENSD 3ZNGA 2KBXA 3JXJA 1OT8A 5ENRD 1K1AA 2ETAA 2XEHA 3JXIA 3ZKJA 4A63B 5ENOD 1AP7A 1BD8A 3TWXA 4HRLA 2XZDG 4DX7D 1D9SA 2F8YA 4HQDA 3TWVA 1QYMA 4CZ2D 2HE0A 4DX6D 2F37A 4U8VD 3T8KA 2DZNA 1DCQA 3NOGD 4DX2A 4O1PA 1BLXB 1MX4A 3AJIA 3SO8A 2XENA 2DVWA 4TUMA 4DX5D 2FO1E 4ATZD 4YDWA 4GMRA 3F6QA 3TWRA 2BKKB 3UI2A 1TR4A 3V2OA 5D66A 5KBAA 4G8LA 3Q9UC 5AAOA 5CBNA 4U96D 4DUIA 4HBDA 3B7BA 4BERA 1SVXA 4HRNA 5CBOA 5CEAA 2PNNA 4GPMA 4J8YA 1G3NB 4OAUC 2ZGDA 4F1PA 2L6BA 4ZFHA 4HRMB 4BESA 5CEDB 3TWSA 4B93B 2ETBA 5EIBE 5EILA 2XEEA 4HB5A 3V30A 5BXOA 3IXEA 1MYOA 4J7WA 5EN5D 4U8YD 3TWQA 5AQ9A 4OAVB 1IKND 5AARA 5HS0A 4DRXE 1DC2A 1N0RA 5BXUA 4HNAD 2BKGA 3NOCD 2DZOA 1N0QA 2RFMA 4G8KA 5HRYA 4F6RD 5CECB 2Y1LE 3TWTA 1YCSB 4BETA 2V5QC 1A5EA 3EU9A 2AJAA 3EHRA 2ETCA 4Z68A 1BU9A 1K1BA 3HG0D 2MYOA 5JA4D 4K5CA 5FIOA 2JABA 3D9HA 4HI8A 1MX6A 1BI7B 2ZGGA 5ENPD 1UOHA 3KEAA 5AQAA 1K3ZD 3NBNB 4RLYA 1S70B 3C5RA 1N11A 4U95D 3ZUVB 3LJNA 4QFVA 2Y0BG 1MJ0A 5AQ7A 1IHBA 4CYMD 2NYJA 3UXGA 1WDYA 5KWDA 4LNUD 4JB8P 5ENQD 3J5PA 5EIDA 1MX2A 4LSZE 5HKPA 3J5QB 3TWUA 4ZHBA 2RFAA 3HRAA 5KNGA 4C48B 4LG6A 4UUCA 2B0OE 2XZTG 1SW6A 4O60A 3W9GA 2QC9A 4BSZB 2V4HC 3V2XA 1AWCB 1OY3D 1NFIE 3EHQA 2F8XK 2DWZA 3B95A 4K5AB 3JUEA 3UTMA 2A5EA 2QYJA 3AAAC 3TWWA 2VGEA 5AQBA 5ENTD 4K5BA 5KNHD 3Q9NC 4O1OA 3W9FA 1WG0A 5JMND 3DEOA 1BI8B 5FINA 1IXVA 3V79K 1YYHA 5CERB 4HLLA 1YMPA 4HI9A
chains in the Genus database with same CATH superfamily
4NIKA 4APFA 2I9CA 2WQHA 3CV0A 1N94A 1PC2A 3CK8A 1Y6IA 3TWVA 3U64A 1LD8A 2F37A 2BEDA 2XCCA 4O1PA 2YHEA 4BFRA 4EZLA 4TUMA 4NACA 4M3OA 2J49A 3CLJA 1YA0A 3EU5A 5C2YA 3FTZA 1X81A 3CHOA 3RKVA 2DCPA 5G05C 4RSYA 1KZPA 4NURA 3RU0A 3N71A 2ZGDA 1QNFA 2P9IG 4HRMB 2WXIA 2YINA 1UN8A 4Y6WA 4XI9A 5KJNA 3LCAA 2KATA 1Z5SC 2CHXA 2RFMA 4JVSA 2AJAA 4YVOA 2Y3AA 5AQAA 2L6JA 2NYJA 4CDRA 3J5PA 5HKPA 3ABME 3CHQA 4C48B 3DXKG 2V4HC 1OY3D 4M7CA 1NFIE 1W3BA 4ATGA 4KBQA 3RRMB 3UTMA 3PVLA 3U4TA 2Q7FA 3DWLG 5KJKA 3NB2A 4GA1A 4JA9A 3T9KA 3ULEG 3QARA 4G25A 4N5QA 1OT8A 4CT0A 2ETAA 2LAIA 3FTXA 3I5PA 4GTRA 1TJCA 3MEKA 4U04A 3T8KA 2Y69E 1UJJA 3L22A 3GZ2A 3DRAA 3ABLE 3F6QA 3UI2A 2VSNA 5LOZA 3NF1A 2LNIA 2VSXE 3FUJA 3E37A 4HRNA 3B7SA 4J8YA 1DNPA 3BEEA 4UWLA 2FO7A 2WM9A 3CHMA 4IRUA 2LSVA 3QJZA 4DLQA 2L9BA 5HS0A 2DYSE 1E8ZA 5CCMA 4HFGA 3OXLA 3TWTA 2V5QC 2JABA 2GW1A 3ZUVB 3E33A 4TXRA 1ZB1A 2QZAA 3I4GA 3SQVA 5KWDA 4JB8P 2RFAA 4LG6A 3ZFWA 3CVYA 1HE8A 1OWPA 1H2VC 4UQZA 1SZ9A 1E7UA 2CFZA 2VSOE 3LEWA 4PS8A 3QWVA 4I1AA 4EPZA 2CG2A 3Q9NC 4ME2A 3RIBA 4G26A 3PZDA 2PM7A 3LYAA 2P2CP 3UT7A 1ZU2A 3UM2A 3L08A 3EJNA 3BQOA 4FHJA 4LEUA 4GYOA 4ILGA 3VLFA 1U2VG 3PE3A 2KBXA 3CHRA 5ENRD 3RO3A 3JXIA 2M63A 4DX7D 3PEUB 2V0PA 2GRRB 3HIZA 4JEHA 1MX4A 2FEZA 2ZU6B 5HI7A 2IEJA 2BKKB 3Q9UC 4GU5A 5J90A 2V5FA 4BTBA 3L17A 1G3NB 1Y8MA 2R5SA 4BESA 5FZRA 3FH8A 2KCKA 5EILA 3V30A 4NRHB 4J7WA 4J6IA 1JUQA 3ASDA 3CQCB 1H0AA 5B1AE 3EHRA 3Q7AA 3CVUA 1HXIA 4KT6B 3UX4A 5AJLA 2Y0BG 3Q5MA 3ZVVA 3T5XA 4FJYA 2WXPA 1E7VA 5KNGA 2LO6A 5E75A 2B0OE 2XZTG 3DSSA 3C3OA 3EHMA 3MX3A 4CT4A 4NQ0A 4ANXA 1L5JA 3PRZA 3T5VA 1WG0A 4I43A 3TL5A 1HG5A 4URKA 3PH0C 3LPZA 4QQIA 2OCCE 1XGWA 3E34A 3Q49B 5EYLA 3JXJA 4MKTA 2FF4A 4F1SA 4G23A 4FLHA 4C9BB 2XPIA 2GRQB 3ZW3A 1DCQA 3CVXA 4YDEA 5KJLA 4GZ3A 1OWOA 2ZIRA 3FH5A 3FTSA 5T8IA 3GYZA 4DUIA 2A5UA 5BUZA 4BWRA 5CBOA 3MGBA 4FADA 4L1BA 3BUAA 4L9PA 4HB5A 4JC8A 2E0IA 4KVOA 1MYOA 2DYRE 2AXZA 2Y4UA 2WXFA 3IBEA 3Q4AB 2HR2A 1N95A 5A7DB 2C0MA 2MYOA 4FJZA 4I6JA 4E6HA 2AVPA 4OVUA 4APOA 1IHBA 3ASNE 5EX3A 4N39A 1KPSB 3L13A 4ANWA 3LDZA 4ABNA 3EDTB 4GTPA 2WXQA 2QC9A 3SZ7A 2DWZA 1QBQA 1UN9A 3CEQA 2VGYA 3Q79A 3OTNA 4GYYA 5BW8C 4H7XA 3FEXA 3UQ3A 3G2UA 4I9EA 3CVVA 2VQ2A 4GTMA 1SQMA 1IQUA 1H6PA 3JQ1A 5EYPF 1FVHA 3FU5A 5D0QD 3DSTA 4GZ5A 3SNXA 1TEZA 1NZNA 2IO3C 3O48A 2IOSA 5CMYA 3Q7FA 4ANUA 2GGFA 2CHWA 4PS3A 3IV0A 1JWFA 3FH7A 2AXUA 3FTYA 4GB9A 3CVNA 3PDNA 4W9RA 3EUVA 2IFUA 2P9UG 1N9AA 4WAFA 3FTWA 2Y4TA 2PZIA 4L7TA 4JL0A 3HVEA 5FQ6A 4DRXE 2KCVA 4U0ZA 1N0RA 5HRYA 3ESLA 4LERA 3LY9A 3D9HA 5JJTA 1S70B 1N11A 1MJ0A 3FUDA 1E8YA 2QY7A 3AS4A 3FTUA 1TYQG 3ZIMA 4RQIA 3W9GA 4B0ZA 2VJ8A 2AWIA 4DPRA 1JWGA 4P29A 5AQBA 3MV3B 4O1OA 2WVIA 5IY5E 3R7RA 3V79K 3FWVA 4GTQA 3ONKA 5JHBA 1OWLA 2OVBA 4LCTA 1EF1C 2GRPB 1WAO1 4YDYA 1HFAA 4RG9A 2KCLA 2J8SD 4B8AA 3NQPA 1LD7A 3TWXA 1D9SA 4KZCA 4XZ4A 3UM0A 2GRLA 3DPDA 3MKQA 1QQEA 3NOGD 4EZJA 2AXVA 3SO8A 3HXFA 2C0LA 3HHMA 3HXCA 4JD2G 2WQ7A 3RJVA 3S7JA 3LY8A 1OCZE 2I1JA 5M72A 5FQ4A 4XEIG 1H6KA 4KVMA 4XE0A 4B8CB 3PREA 5G55A 3D9LA 3PZ2A 2P58C 4Z68A 2ETCA 2MRIA 1OWNA 1FT2A 3TXMA 4Q94A 3QWWA 5JHAA 3FULA 1OWMA 3QWPA 4Q69A 3RRUA 3LY7A 4KZ0A 3KAEA 3JUEA 4I2ZA 4N2QA 2UY1B 3RAUA 4A3VA 3X2QE 3SFXA 3ZU7B 4HXIA 3V31A 5ENNA 2RKKA 2R03A 4AY6A 3ULYA 3ULQA 1HO8A 4HRLA 4FA6A 2XRYA 4HQDA 4HLEA 3AG2E 1MHQA 4DX6D 4DX2A 3CIAA 1KT1A 4CEMA 3FTVA 1HX8A 3ML9A 5D66A 1H19A 5KBAA 3OAWA 4IULA 4G8LA 5B1BE 4GYWA 5CEAA 2PNNA 4U8HA 4ZFHA 4AJWA 4F53A 4GA0A 4TUUA 2XEEA 3S7DA 3R9MA 4LNBA 2UWJG 4OAVB 3URZA 4CCAA 4G1TA 1DC2A 3SI5A 3GZ1A 1V55E 4EQFA 3MA5A 3UINC 1O1TA 5A23A 3D9JA 5JA4D 5ENPD 1MX6A 1BI7B 2ZGGA 4FHKA 2LAHA 3JYSA 2J4DA 3CKCA 3AS5A 2X6IA 5LCWJ 5ENQD 3SFZA 2OEWA 2BF0X 1UJKA 2GRNB 3PE4A 5LCWC 4HS2A 1ELKA 3UIPC 4WWPA 4G2VA 1N4RA 3R9AB 1E8WA 2VGEA 3IHVA 4K5BA 4UWFA 3JQ0A 2J08A 5JMND 5BPPA 5BNWA 4AIFA 1Z3XA 4DI3A 2KXPC 2WMNA 5ITZF 2WXMA 1WM5A 4BX8A 2J07A 2YHCA 2HO1A 3MJWA 5HQ8A 1NA3A 3ZYKA 2V4LA 1E90A 3AG4E 3ZXSA 4WNGA 3AJIA 3ZRHA 4KYOB 2FO1E 4N3BA 4PH4B 4U07A 3LVRE 3U3WA 1HH8A 3CK7A 4L2LA 1N4QA 2VYIA 2XEVA 1KZOA 2HYZA 4A55A 2R02A 2BUGA 1FT1A 2VGXB 3TWSA 2F0YA 4GTTA 4ANVA 4LNGA 3ONLA 1IKND 4F6RD 4B89A 4ACLA 2OEVA 3U66A 2E2EA 3FY4A 1WDYA 3D9IA 3QK0A 4XIFA 5EIDA 3TWUA 1JCQA 3HRAA 3GW4A 4AP2A 3UM3A 4HOTA 3ASHA 3TG5A 2IONA 5CCLA 1TNOA 2PM6A 3FU0A 4WNEA 3B13A 4HVBA 1AWCB 3LXUX 4J8DA 5E76A 3FDHA 2F8XK 3ZEFA 1KLXA 1BI8B 5C1DA 1YYHA 2ONDA 2YQ8A 3SY2A 3FFLA 2AW6A 3OXGA 2R17C 4U0SA 4RG6A 3UPVA 2OOEA 3QAQA 4GCNA 5AN8A 2OV8A 2VTBB 5FQ8A 5ENOD 2WXLA 1BD8A 4FC8A 2XZDG 3L16A 3LJ3A 4O6FA 5ARFA 4U8VD 2DZNA 4N5CA 2I6HA 5AENA 1HU3A 2DVWA 1S64A 3V2OA 3ESKA 2R59A 3LS8A 2CFUA 1IQRA 4HBDA 1DVPA 4AV7A 4TXPA 3OXFA 3ZHEB 4R7LA 3DSXA 3FUNA 3IXEA 2X6HA 3TWQA 5AQ9A 2H6HA 2NC9A 4RVBA 5AARA 4C0EA 4UI9K 4FLBA 4JW1A 1N0QA 3KSLA 4J0UA 4ACKA 1EYHA 5EX0A 1LTXA 1K1BA 5FIOA 1D8DA 4RLYA 3ZN3A 3C5RA 4QFVA 2CG3A 3S2AA 3SD5A 2XPYA 2RG8A 5JJ7A 3C3QA 3GZSA 4AY5A 3TWWA 2J4BA 4YDOA 3DEOA 3MV2B 2HM8A 2J9QA 4WWNA 4HOSA 3D9PA 4E85A 3KEZA 4X8QA 3PZ4A 5ENSD 1EPUA 4G11A 3HXEA 4EBAG 4A63B 1QZ2A 3FU3A 4ILIA 4OVVA 2C2LA 1U3DA 3DBSA 2XENA 2KZTB 4YDWA 3K9IA 2IY0C 2XS8A 3RO2A 5CBNA 5AAOA 3ENEA 5D0OD 3B7BA 4MBGA 3ABKE 4B93B 3O4ZA 3ASFA 3CSTA 5BXOA 4HOUA 2DZOA 4N2SA 3HG0D 2QYUA 4K5CA 4LUNU 3CHPA 2R2LA 4I1MA 4CRWA 4PS7A 1JPLA 3NBNB 5ANLA 4MRUA 4CYMD 4LNUD 2FI7A 4GMJA 4U63A 4AEZC 2WXGA 4FU3A 2P9SG 3VTXA 3D9KA 2LXLA 4AVXA 2A4ZA 4BX9A 2QYJA 5AYWD 4BT9A 5KNHD 3W9FA 3DSVA 5FINA 4PDXA 1TN8A 5T4YA 4WUYA 2XRZA 3CKBA 4GA2A 3CSFA 3DSUA 1SZAA 3APFA 4AM9A 2LSUA 3MKRA 3PZ3A 4C0MA 3ZXPA 5FQ7A 3L6AA 2BTDA 3L82A 2F8YA 3KD7A 3QDNA 4XKCA 2HE0A 3G2TA 1NL4A 3VLDA 4DX5D 3Q73A 5LP0A 3P2BA 4KXKB 5T3RA 1K8KG 4OAUC 1UW4B 3IEGA 2KM4A 1N52A 2ETBA 4JEUA 4F7AA 3PZ1A 5BV0A 2WXOA 1GW6A 3G2WA 2FULA 4JA7A 1N4PA 3Q47B 5J08A 3FUEA 4OYSA 4LRZA 3RK6A 1WY6A 2MHKA 5KJMA 3BG1B 1ELRA 4A1SA 3SFYA 4U0UA 1HG2A 1O1SA 5DBKA 4WNFA 3HYMB 4DJAA 3QB2A 2YNQA 3LKUA 2H6FA 3R7QA 3UM1A 1IHGA 4V3IA 3APDA 2GROB 5CERB 3JUIA 1OCCE 2I2OA 1YMPA 2WXKA 3VTYA 1O5MA 1S63A 5G05J 1OCOE 2EIME 4IN3B 3LVQE 4J8FA 1TNZA 4JHRA 4I6EA 3ZYMA 4EZKA 1U3CA 3U9WA 5LX8A 1DCEA 3B7UX 1BLXB 3WXXA 3CGHA 2XS1A 2IU1A 4ATZD 4Q96A 4JPSA 1RW2A 2UY1A 3TAXA 4XI0A 1S0PA 2QFCA 5G04J 1ZBPA 3NZUA 4DK5A 3S7BA 3FUIA 5G04C 2RD0A 2PQNA 3S7FA 2WB2A 1Z3YA 5CEDB 3PS6A 2XCBA 1PY1A 5EN5D 3EIJA 2DIWA 3G2VA 3PNTB 4PUCA 5BV1A 3RSEG 3UMVA 1OUVA 1N4SA 2Y1LE 4GAAA 4BETA 1A5EA 2P9PG 3VLEA 5DIZA 4BT8A 4CDNA 2XGOA 1P5QA 1N54A 3NZSA 3UXGA 5G2NA 4AOFA 2WXHA 4UUCA 5CHEE 1SW6A 3WG7E 5LFAA 2X38A 3SF4A 2L0IA 3AU4A 3Q15A 3B95A 4K5AB 1UG3A 4TV3A 4CDMA 5ENTD 1B89A 4JXTA 1HS6A 4HLLA 4UQXA 4GZDA 3QNKA 3Q78A 3EHNA 1A17A 4DX1A 1BPOA 4U7EB 4TXQA 3ZNGA 3JCKC 1K1AA 2XEHA 1PAQA 3ZKJA 2EINE 4GZ6A 4I17A 1QYMA 3FU6A 3CVLA 1IYGA 4MS6A 3B7TA 3QKYA 1TJFA 3T8MA 3B7RL 3DXMG 4GPKA 4Y6CA 3UT4A 3KSQA 5KCMA 4HORA 1NI1A 2XGSA 1E8XA 2NXPA 3HXBA 5FJYA 2IQCA 4GTOA 2J09A 3E32A 3FUMA 3UKRG 4EHMA 3BU8A 2EQXA 2WXRA 1O1RA 4A3TA 2I1KA 5AJDA 3EU9A 4DI4A 3G2SA 1INZA 5CRVA 2WXNA 1X5BA 1K3ZD 1H2TC 4L2YA 3PUJA 3C98A 4U95D 3LJNA 5AQ7A 4BTAA 3SBTB 1VDYA 1MX2A 4FP7A 1Q2ZA 2VGXA 4ZHBA 3QOUA 5FT9A 5B3SE 3TJPA 4O60A 3TG4A 2IJGX 2WXJA 3V2XA 3AG1E 3ZPJA 3UKUG 4F3VA 5CMWA 3BG0B 3MCXA 5FTPA 5ANRA 1LF8A 4HI9A 4I2WA 3ASOE 3MZLB 3ASGA 4GTSA 3ML8A 2H6GA 4J8SA 3KS2A 3P1UA 1MZCA 4D10C 3SBSA 1E96B 2JEKA 4CZ2D 4UI9J 2X6JA 4UI9C 2R05A 4YVQC 2XHEA 4GMRA 1TR4A 3E4BA 5JJ6A 4EBAA 1SVXA 3E30A 3HXDA 4GPMA 3FUKA 3TXNA 2VTBA 3FP3A 4U8YD 4H7YA 5BXUA 2BKGA 3NOCD 1TNBA 5CECB 1YCSB 1FVFA 1BU9A 1TN6A 3TGOA 1H2UA 3IKOB 2WQ6A 3I3NA 4I9CA 2IOLA 3FUFA 4ILHB 3D3MA 3AU5A 2L0TB 2MOWA 3ZHEA 3CQGB 3D9MA 2DBAA 4BSZB 3CR3A 4JZYA 2X6KA 4MLPA 1OXJA 2WPVA 1SA5A 4HOQA 3ZGQA 1NA0A 3AAAC 2EIJE 3CK9A 2VSYA 3UT8A 1ELWA 1NP7A 2OVFA 2NSZA 5ARGA 2P9KG 2PL2A 3C72A 3MYVA 4XKBA 3QC1A 4G24A 3Q75A 2EILE 3CHSA 3I4RB 1EDUA 3L54A 3CVWA 4UWGA 3D9NA 3AS8A 3TWRA 1KT0A 3CVPA 2P9LG 4GMLA 1MQSA 2WMOA 3HDXA 4XX5A 2L6BA 3IHYA 1FPPA 5CRUA 5EIBE 4N3AA 2IF4A 3RRNB 2CHZA 2H6IA 3FHEA 2P9NG 2ZXWE 4J8EA 5FWQA 1RZ4A 5FZQA 2XPZA 2KZTA 3ISMC 2LUHA 4HI8A 5EDSA 1D8EA 2PQRA 2X6FA 1SA4A 1H6OA 3SGHA 4LSZE 1JCSA 2XGMA 4B94A 4A1GA 4GZCA 3CVQA 3FEYA 1TN7A 5H7PA 2A5EA 4N3CA 3FUHA 4I6GA 4BY6A 1IXVA 3PUKA 5AIJA 3PEVB 4BEPA 1OCRE 3D9OA 5D2MC 4KMOA 4BSXA 3DEPA 2JLBA 1TNUA 3C3RA 3AG3E 2KC7A 3HVEB 1AP7A 4WWOA 2XQ0A 5BT1A 3SHFA 2X3MA 1JCRA 2V8SE 4I1OB 3PNLB 2B6CA 2EIKE 4JHJA 4EECA 4CGVA 3EIQC 4GTVA 4U96D 1Z6TA 3APCA 4K0RA 4BERA 1FCHA 2FBNA 5A6CA 4F1PA 5EKQD 4DLOA 4CGWA 4UQYA 1HF8A 1TNYA 3UIOC 4HNAD 4G8KA 4GCOA 3NAWA 4WNDA 3UUXA 1UOHA 3KEAA 5FZSA 4UWKA 4TRQA 3ZYLA 4UWHA 4JHKA 4AXHA 1XNFA 2ZISA 3J5QB 2ILRA 2GRMA 2IO2C 2LXMA 3ZYQA 3MKQB 3L9TA 4IYPA 3EHQA 4YNDA 1V54E 4L23A 4FULA 4K03A 1HZ4A 3DSWA 3DPYA
chains in the Genus database with same CATH topology
4BEPA 2P2CP 2KXPC 4NIKA 5ITZF 4QQIA 3ZU7B 3T9KA 4DX1A 4YDYA 3DEPA 5EYPF 5AN8A 3V31A 2J8SD 5EYLA 4N5QA 5ENSD 3ZNGA 2KBXA 3JXJA 1OT8A 5ENRD 1K1AA 2ETAA 2XEHA 3JXIA 3ZKJA 4A63B 5ENOD 1AP7A 1BD8A 3TWXA 4HRLA 2XZDG 4DX7D 1D9SA 2F8YA 4HQDA 3TWVA 1QYMA 4CZ2D 2HE0A 4DX6D 2F37A 4U8VD 3T8KA 2DZNA 1DCQA 3NOGD 4DX2A 4O1PA 1BLXB 1MX4A 3AJIA 3SO8A 2XENA 2DVWA 4TUMA 4DX5D 2FO1E 4ATZD 4YDWA 4GMRA 3F6QA 3TWRA 2BKKB 3UI2A 1TR4A 3V2OA 5D66A 5KBAA 4G8LA 3Q9UC 5AAOA 5CBNA 4U96D 4DUIA 4HBDA 3B7BA 4BERA 1SVXA 4HRNA 5CBOA 5CEAA 2PNNA 4GPMA 4J8YA 1G3NB 4OAUC 2ZGDA 4F1PA 2L6BA 4ZFHA 4HRMB 4BESA 5CEDB 3TWSA 4B93B 2ETBA 5EIBE 5EILA 2XEEA 4HB5A 3V30A 5BXOA 3IXEA 1MYOA 4J7WA 5EN5D 4U8YD 3TWQA 5AQ9A 4OAVB 1IKND 5AARA 5HS0A 4DRXE 1DC2A 1N0RA 5BXUA 4HNAD 2BKGA 3NOCD 2DZOA 1N0QA 2RFMA 4G8KA 5HRYA 4F6RD 5CECB 2Y1LE 3TWTA 1YCSB 4BETA 2V5QC 1A5EA 3EU9A 2AJAA 3EHRA 2ETCA 4Z68A 1BU9A 1K1BA 3HG0D 2MYOA 5JA4D 4K5CA 5FIOA 2JABA 3D9HA 4HI8A 1MX6A 1BI7B 2ZGGA 5ENPD 1UOHA 3KEAA 5AQAA 1K3ZD 3NBNB 4RLYA 1S70B 3C5RA 1N11A 4U95D 3ZUVB 3LJNA 4QFVA 2Y0BG 1MJ0A 5AQ7A 1IHBA 4CYMD 2NYJA 3UXGA 1WDYA 5KWDA 4LNUD 4JB8P 5ENQD 3J5PA 5EIDA 1MX2A 4LSZE 5HKPA 3J5QB 3TWUA 4ZHBA 2RFAA 3HRAA 5KNGA 4C48B 4LG6A 4UUCA 2B0OE 2XZTG 1SW6A 4O60A 3W9GA 2QC9A 4BSZB 2V4HC 3V2XA 1AWCB 1OY3D 1NFIE 3EHQA 2F8XK 2DWZA 3B95A 4K5AB 3JUEA 3UTMA 2A5EA 2QYJA 3AAAC 3TWWA 2VGEA 5AQBA 5ENTD 4K5BA 5KNHD 3Q9NC 4O1OA 3W9FA 1WG0A 5JMND 3DEOA 1BI8B 5FINA 1IXVA 3V79K 1YYHA 5CERB 4HLLA 1YMPA 4HI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEP A;  2P2C P;  2KXP C;  4NIK A;  5ITZ F;  4QQI A;  3ZU7 B;  3T9K A;  4DX1 A;  4YDY A;  3DEP A;  5EYP F;  5AN8 A;  3V31 A;  2J8S D;  5EYL A;  4N5Q A;  5ENS D;  3ZNG A;  2KBX A;  3JXJ A;  1OT8 A;  5ENR D;  1K1A A;  2ETA A;  2XEH A;  3JXI A;  3ZKJ A;  4A63 B;  5ENO D;  1AP7 A;  1BD8 A;  3TWX A;  4HRL A;  2XZD G;  4DX7 D;  1D9S A;  2F8Y A;  4HQD A;  3TWV A;  1QYM A;  4CZ2 D;  2HE0 A;  4DX6 D;  2F37 A;  4U8V D;  3T8K A;  2DZN A;  1DCQ A;  3NOG D;  4DX2 A;  4O1P A;  1BLX B;  1MX4 A;  3AJI A;  3SO8 A;  2XEN A;  2DVW A;  4TUM A;  4DX5 D;  2FO1 E;  4ATZ D;  4YDW A;  4GMR A;  3F6Q A;  3TWR A;  2BKK B;  3UI2 A;  1TR4 A;  3V2O A;  5D66 A;  5KBA A;  4G8L A;  3Q9U C;  5AAO A;  5CBN A;  4U96 D;  4DUI A;  4HBD A;  3B7B A;  4BER A;  1SVX A;  4HRN A;  5CBO A;  5CEA A;  2PNN A;  4GPM A;  4J8Y A;  1G3N B;  4OAU C;  2ZGD A;  4F1P A;  2L6B A;  4ZFH A;  4HRM B;  4BES A;  5CED B;  3TWS A;  4B93 B;  2ETB A;  5EIB E;  5EIL A;  2XEE A;  4HB5 A;  3V30 A;  5BXO A;  3IXE A;  1MYO A;  4J7W A;  5EN5 D;  4U8Y D;  3TWQ A;  5AQ9 A;  4OAV B;  1IKN D;  5AAR A;  5HS0 A;  4DRX E;  1DC2 A;  1N0R A;  5BXU A;  4HNA D;  2BKG A;  3NOC D;  2DZO A;  1N0Q A;  2RFM A;  4G8K A;  5HRY A;  4F6R D;  5CEC B;  2Y1L E;  3TWT A;  1YCS B;  4BET A;  2V5Q C;  1A5E A;  3EU9 A;  2AJA A;  3EHR A;  2ETC A;  4Z68 A;  1BU9 A;  1K1B A;  3HG0 D;  2MYO A;  5JA4 D;  4K5C A;  5FIO A;  2JAB A;  3D9H A;  4HI8 A;  1MX6 A;  1BI7 B;  2ZGG A;  5ENP D;  1UOH A;  3KEA A;  5AQA A;  1K3Z D;  3NBN B;  4RLY A;  1S70 B;  3C5R A;  1N11 A;  4U95 D;  3ZUV B;  3LJN A;  4QFV A;  2Y0B G;  1MJ0 A;  5AQ7 A;  1IHB A;  4CYM D;  2NYJ A;  3UXG A;  1WDY A;  5KWD A;  4LNU D;  4JB8 P;  5ENQ D;  3J5P A;  5EID A;  1MX2 A;  4LSZ E;  5HKP A;  3J5Q B;  3TWU A;  4ZHB A;  2RFA A;  3HRA A;  5KNG A;  4C48 B;  4LG6 A;  4UUC A;  2B0O E;  2XZT G;  1SW6 A;  4O60 A;  3W9G A;  2QC9 A;  4BSZ B;  2V4H C;  3V2X A;  1AWC B;  1OY3 D;  1NFI E;  3EHQ A;  2F8X K;  2DWZ A;  3B95 A;  4K5A B;  3JUE A;  3UTM A;  2A5E A;  2QYJ A;  3AAA C;  3TWW A;  2VGE A;  5AQB A;  5ENT D;  4K5B A;  5KNH D;  3Q9N C;  4O1O A;  3W9F A;  1WG0 A;  5JMN D;  3DEO A;  1BI8 B;  5FIN A;  1IXV A;  3V79 K;  1YYH A;  5CER B;  4HLL A;  1YMP A;  4HI9 A; 
#chains in the Genus database with same CATH topology
 4NIK A;  4APF A;  2I9C A;  2WQH A;  3CV0 A;  1N94 A;  1PC2 A;  3CK8 A;  1Y6I A;  3TWV A;  3U64 A;  1LD8 A;  2F37 A;  2BED A;  2XCC A;  4O1P A;  2YHE A;  4BFR A;  4EZL A;  4TUM A;  4NAC A;  4M3O A;  2J49 A;  3CLJ A;  1YA0 A;  3EU5 A;  5C2Y A;  3FTZ A;  1X81 A;  3CHO A;  3RKV A;  2DCP A;  5G05 C;  4RSY A;  1KZP A;  4NUR A;  3RU0 A;  3N71 A;  2ZGD A;  1QNF A;  2P9I G;  4HRM B;  2WXI A;  2YIN A;  1UN8 A;  4Y6W A;  4XI9 A;  5KJN A;  3LCA A;  2KAT A;  1Z5S C;  2CHX A;  2RFM A;  4JVS A;  2AJA A;  4YVO A;  2Y3A A;  5AQA A;  2L6J A;  2NYJ A;  4CDR A;  3J5P A;  5HKP A;  3ABM E;  3CHQ A;  4C48 B;  3DXK G;  2V4H C;  1OY3 D;  4M7C A;  1NFI E;  1W3B A;  4ATG A;  4KBQ A;  3RRM B;  3UTM A;  3PVL A;  3U4T A;  2Q7F A;  3DWL G;  5KJK A;  3NB2 A;  4GA1 A;  4JA9 A;  3T9K A;  3ULE G;  3QAR A;  4G25 A;  4N5Q A;  1OT8 A;  4CT0 A;  2ETA A;  2LAI A;  3FTX A;  3I5P A;  4GTR A;  1TJC A;  3MEK A;  4U04 A;  3T8K A;  2Y69 E;  1UJJ A;  3L22 A;  3GZ2 A;  3DRA A;  3ABL E;  3F6Q A;  3UI2 A;  2VSN A;  5LOZ A;  3NF1 A;  2LNI A;  2VSX E;  3FUJ A;  3E37 A;  4HRN A;  3B7S A;  4J8Y A;  1DNP A;  3BEE A;  4UWL A;  2FO7 A;  2WM9 A;  3CHM A;  4IRU A;  2LSV A;  3QJZ A;  4DLQ A;  2L9B A;  5HS0 A;  2DYS E;  1E8Z A;  5CCM A;  4HFG A;  3OXL A;  3TWT A;  2V5Q C;  2JAB A;  2GW1 A;  3ZUV B;  3E33 A;  4TXR A;  1ZB1 A;  2QZA A;  3I4G A;  3SQV A;  5KWD A;  4JB8 P;  2RFA A;  4LG6 A;  3ZFW A;  3CVY A;  1HE8 A;  1OWP A;  1H2V C;  4UQZ A;  1SZ9 A;  1E7U A;  2CFZ A;  2VSO E;  3LEW A;  4PS8 A;  3QWV A;  4I1A A;  4EPZ A;  2CG2 A;  3Q9N C;  4ME2 A;  3RIB A;  4G26 A;  3PZD A;  2PM7 A;  3LYA A;  2P2C P;  3UT7 A;  1ZU2 A;  3UM2 A;  3L08 A;  3EJN A;  3BQO A;  4FHJ A;  4LEU A;  4GYO A;  4ILG A;  3VLF A;  1U2V G;  3PE3 A;  2KBX A;  3CHR A;  5ENR D;  3RO3 A;  3JXI A;  2M63 A;  4DX7 D;  3PEU B;  2V0P A;  2GRR B;  3HIZ A;  4JEH A;  1MX4 A;  2FEZ A;  2ZU6 B;  5HI7 A;  2IEJ A;  2BKK B;  3Q9U C;  4GU5 A;  5J90 A;  2V5F A;  4BTB A;  3L17 A;  1G3N B;  1Y8M A;  2R5S A;  4BES A;  5FZR A;  3FH8 A;  2KCK A;  5EIL A;  3V30 A;  4NRH B;  4J7W A;  4J6I A;  1JUQ A;  3ASD A;  3CQC B;  1H0A A;  5B1A E;  3EHR A;  3Q7A A;  3CVU A;  1HXI A;  4KT6 B;  3UX4 A;  5AJL A;  2Y0B G;  3Q5M A;  3ZVV A;  3T5X A;  4FJY A;  2WXP A;  1E7V A;  5KNG A;  2LO6 A;  5E75 A;  2B0O E;  2XZT G;  3DSS A;  3C3O A;  3EHM A;  3MX3 A;  4CT4 A;  4NQ0 A;  4ANX A;  1L5J A;  3PRZ A;  3T5V A;  1WG0 A;  4I43 A;  3TL5 A;  1HG5 A;  4URK A;  3PH0 C;  3LPZ A;  4QQI A;  2OCC E;  1XGW A;  3E34 A;  3Q49 B;  5EYL A;  3JXJ A;  4MKT A;  2FF4 A;  4F1S A;  4G23 A;  4FLH A;  4C9B B;  2XPI A;  2GRQ B;  3ZW3 A;  1DCQ A;  3CVX A;  4YDE A;  5KJL A;  4GZ3 A;  1OWO A;  2ZIR A;  3FH5 A;  3FTS A;  5T8I A;  3GYZ A;  4DUI A;  2A5U A;  5BUZ A;  4BWR A;  5CBO A;  3MGB A;  4FAD A;  4L1B A;  3BUA A;  4L9P A;  4HB5 A;  4JC8 A;  2E0I A;  4KVO A;  1MYO A;  2DYR E;  2AXZ A;  2Y4U A;  2WXF A;  3IBE A;  3Q4A B;  2HR2 A;  1N95 A;  5A7D B;  2C0M A;  2MYO A;  4FJZ A;  4I6J A;  4E6H A;  2AVP A;  4OVU A;  4APO A;  1IHB A;  3ASN E;  5EX3 A;  4N39 A;  1KPS B;  3L13 A;  4ANW A;  3LDZ A;  4ABN A;  3EDT B;  4GTP A;  2WXQ A;  2QC9 A;  3SZ7 A;  2DWZ A;  1QBQ A;  1UN9 A;  3CEQ A;  2VGY A;  3Q79 A;  3OTN A;  4GYY A;  5BW8 C;  4H7X A;  3FEX A;  3UQ3 A;  3G2U A;  4I9E A;  3CVV A;  2VQ2 A;  4GTM A;  1SQM A;  1IQU A;  1H6P A;  3JQ1 A;  5EYP F;  1FVH A;  3FU5 A;  5D0Q D;  3DST A;  4GZ5 A;  3SNX A;  1TEZ A;  1NZN A;  2IO3 C;  3O48 A;  2IOS A;  5CMY A;  3Q7F A;  4ANU A;  2GGF A;  2CHW A;  4PS3 A;  3IV0 A;  1JWF A;  3FH7 A;  2AXU A;  3FTY A;  4GB9 A;  3CVN A;  3PDN A;  4W9R A;  3EUV A;  2IFU A;  2P9U G;  1N9A A;  4WAF A;  3FTW A;  2Y4T A;  2PZI A;  4L7T A;  4JL0 A;  3HVE A;  5FQ6 A;  4DRX E;  2KCV A;  4U0Z A;  1N0R A;  5HRY A;  3ESL A;  4LER A;  3LY9 A;  3D9H A;  5JJT A;  1S70 B;  1N11 A;  1MJ0 A;  3FUD A;  1E8Y A;  2QY7 A;  3AS4 A;  3FTU A;  1TYQ G;  3ZIM A;  4RQI A;  3W9G A;  4B0Z A;  2VJ8 A;  2AWI A;  4DPR A;  1JWG A;  4P29 A;  5AQB A;  3MV3 B;  4O1O A;  2WVI A;  5IY5 E;  3R7R A;  3V79 K;  3FWV A;  4GTQ A;  3ONK A;  5JHB A;  1OWL A;  2OVB A;  4LCT A;  1EF1 C;  2GRP B;  1WAO 1;  4YDY A;  1HFA A;  4RG9 A;  2KCL A;  2J8S D;  4B8A A;  3NQP A;  1LD7 A;  3TWX A;  1D9S A;  4KZC A;  4XZ4 A;  3UM0 A;  2GRL A;  3DPD A;  3MKQ A;  1QQE A;  3NOG D;  4EZJ A;  2AXV A;  3SO8 A;  3HXF A;  2C0L A;  3HHM A;  3HXC A;  4JD2 G;  2WQ7 A;  3RJV A;  3S7J A;  3LY8 A;  1OCZ E;  2I1J A;  5M72 A;  5FQ4 A;  4XEI G;  1H6K A;  4KVM A;  4XE0 A;  4B8C B;  3PRE A;  5G55 A;  3D9L A;  3PZ2 A;  2P58 C;  4Z68 A;  2ETC A;  2MRI A;  1OWN A;  1FT2 A;  3TXM A;  4Q94 A;  3QWW A;  5JHA A;  3FUL A;  1OWM A;  3QWP A;  4Q69 A;  3RRU A;  3LY7 A;  4KZ0 A;  3KAE A;  3JUE A;  4I2Z A;  4N2Q A;  2UY1 B;  3RAU A;  4A3V A;  3X2Q E;  3SFX A;  3ZU7 B;  4HXI A;  3V31 A;  5ENN A;  2RKK A;  2R03 A;  4AY6 A;  3ULY A;  3ULQ A;  1HO8 A;  4HRL A;  4FA6 A;  2XRY A;  4HQD A;  4HLE A;  3AG2 E;  1MHQ A;  4DX6 D;  4DX2 A;  3CIA A;  1KT1 A;  4CEM A;  3FTV A;  1HX8 A;  3ML9 A;  5D66 A;  1H19 A;  5KBA A;  3OAW A;  4IUL A;  4G8L A;  5B1B E;  4GYW A;  5CEA A;  2PNN A;  4U8H A;  4ZFH A;  4AJW A;  4F53 A;  4GA0 A;  4TUU A;  2XEE A;  3S7D A;  3R9M A;  4LNB A;  2UWJ G;  4OAV B;  3URZ A;  4CCA A;  4G1T A;  1DC2 A;  3SI5 A;  3GZ1 A;  1V55 E;  4EQF A;  3MA5 A;  3UIN C;  1O1T A;  5A23 A;  3D9J A;  5JA4 D;  5ENP D;  1MX6 A;  1BI7 B;  2ZGG A;  4FHK A;  2LAH A;  3JYS A;  2J4D A;  3CKC A;  3AS5 A;  2X6I A;  5LCW J;  5ENQ D;  3SFZ A;  2OEW A;  2BF0 X;  1UJK A;  2GRN B;  3PE4 A;  5LCW C;  4HS2 A;  1ELK A;  3UIP C;  4WWP A;  4G2V A;  1N4R A;  3R9A B;  1E8W A;  2VGE A;  3IHV A;  4K5B A;  4UWF A;  3JQ0 A;  2J08 A;  5JMN D;  5BPP A;  5BNW A;  4AIF A;  1Z3X A;  4DI3 A;  2KXP C;  2WMN A;  5ITZ F;  2WXM A;  1WM5 A;  4BX8 A;  2J07 A;  2YHC A;  2HO1 A;  3MJW A;  5HQ8 A;  1NA3 A;  3ZYK A;  2V4L A;  1E90 A;  3AG4 E;  3ZXS A;  4WNG A;  3AJI A;  3ZRH A;  4KYO B;  2FO1 E;  4N3B A;  4PH4 B;  4U07 A;  3LVR E;  3U3W A;  1HH8 A;  3CK7 A;  4L2L A;  1N4Q A;  2VYI A;  2XEV A;  1KZO A;  2HYZ A;  4A55 A;  2R02 A;  2BUG A;  1FT1 A;  2VGX B;  3TWS A;  2F0Y A;  4GTT A;  4ANV A;  4LNG A;  3ONL A;  1IKN D;  4F6R D;  4B89 A;  4ACL A;  2OEV A;  3U66 A;  2E2E A;  3FY4 A;  1WDY A;  3D9I A;  3QK0 A;  4XIF A;  5EID A;  3TWU A;  1JCQ A;  3HRA A;  3GW4 A;  4AP2 A;  3UM3 A;  4HOT A;  3ASH A;  3TG5 A;  2ION A;  5CCL A;  1TNO A;  2PM6 A;  3FU0 A;  4WNE A;  3B13 A;  4HVB A;  1AWC B;  3LXU X;  4J8D A;  5E76 A;  3FDH A;  2F8X K;  3ZEF A;  1KLX A;  1BI8 B;  5C1D A;  1YYH A;  2OND A;  2YQ8 A;  3SY2 A;  3FFL A;  2AW6 A;  3OXG A;  2R17 C;  4U0S A;  4RG6 A;  3UPV A;  2OOE A;  3QAQ A;  4GCN A;  5AN8 A;  2OV8 A;  2VTB B;  5FQ8 A;  5ENO D;  2WXL A;  1BD8 A;  4FC8 A;  2XZD G;  3L16 A;  3LJ3 A;  4O6F A;  5ARF A;  4U8V D;  2DZN A;  4N5C A;  2I6H A;  5AEN A;  1HU3 A;  2DVW A;  1S64 A;  3V2O A;  3ESK A;  2R59 A;  3LS8 A;  2CFU A;  1IQR A;  4HBD A;  1DVP A;  4AV7 A;  4TXP A;  3OXF A;  3ZHE B;  4R7L A;  3DSX A;  3FUN A;  3IXE A;  2X6H A;  3TWQ A;  5AQ9 A;  2H6H A;  2NC9 A;  4RVB A;  5AAR A;  4C0E A;  4UI9 K;  4FLB A;  4JW1 A;  1N0Q A;  3KSL A;  4J0U A;  4ACK A;  1EYH A;  5EX0 A;  1LTX A;  1K1B A;  5FIO A;  1D8D A;  4RLY A;  3ZN3 A;  3C5R A;  4QFV A;  2CG3 A;  3S2A A;  3SD5 A;  2XPY A;  2RG8 A;  5JJ7 A;  3C3Q A;  3GZS A;  4AY5 A;  3TWW A;  2J4B A;  4YDO A;  3DEO A;  3MV2 B;  2HM8 A;  2J9Q A;  4WWN A;  4HOS A;  3D9P A;  4E85 A;  3KEZ A;  4X8Q A;  3PZ4 A;  5ENS D;  1EPU A;  4G11 A;  3HXE A;  4EBA G;  4A63 B;  1QZ2 A;  3FU3 A;  4ILI A;  4OVV A;  2C2L A;  1U3D A;  3DBS A;  2XEN A;  2KZT B;  4YDW A;  3K9I A;  2IY0 C;  2XS8 A;  3RO2 A;  5CBN A;  5AAO A;  3ENE A;  5D0O D;  3B7B A;  4MBG A;  3ABK E;  4B93 B;  3O4Z A;  3ASF A;  3CST A;  5BXO A;  4HOU A;  2DZO A;  4N2S A;  3HG0 D;  2QYU A;  4K5C A;  4LUN U;  3CHP A;  2R2L A;  4I1M A;  4CRW A;  4PS7 A;  1JPL A;  3NBN B;  5ANL A;  4MRU A;  4CYM D;  4LNU D;  2FI7 A;  4GMJ A;  4U63 A;  4AEZ C;  2WXG A;  4FU3 A;  2P9S G;  3VTX A;  3D9K A;  2LXL A;  4AVX A;  2A4Z A;  4BX9 A;  2QYJ A;  5AYW D;  4BT9 A;  5KNH D;  3W9F A;  3DSV A;  5FIN A;  4PDX A;  1TN8 A;  5T4Y A;  4WUY A;  2XRZ A;  3CKB A;  4GA2 A;  3CSF A;  3DSU A;  1SZA A;  3APF A;  4AM9 A;  2LSU A;  3MKR A;  3PZ3 A;  4C0M A;  3ZXP A;  5FQ7 A;  3L6A A;  2BTD A;  3L82 A;  2F8Y A;  3KD7 A;  3QDN A;  4XKC A;  2HE0 A;  3G2T A;  1NL4 A;  3VLD A;  4DX5 D;  3Q73 A;  5LP0 A;  3P2B A;  4KXK B;  5T3R A;  1K8K G;  4OAU C;  1UW4 B;  3IEG A;  2KM4 A;  1N52 A;  2ETB A;  4JEU A;  4F7A A;  3PZ1 A;  5BV0 A;  2WXO A;  1GW6 A;  3G2W A;  2FUL A;  4JA7 A;  1N4P A;  3Q47 B;  5J08 A;  3FUE A;  4OYS A;  4LRZ A;  3RK6 A;  1WY6 A;  2MHK A;  5KJM A;  3BG1 B;  1ELR A;  4A1S A;  3SFY A;  4U0U A;  1HG2 A;  1O1S A;  5DBK A;  4WNF A;  3HYM B;  4DJA A;  3QB2 A;  2YNQ A;  3LKU A;  2H6F A;  3R7Q A;  3UM1 A;  1IHG A;  4V3I A;  3APD A;  2GRO B;  5CER B;  3JUI A;  1OCC E;  2I2O A;  1YMP A;  2WXK A;  3VTY A;  1O5M A;  1S63 A;  5G05 J;  1OCO E;  2EIM E;  4IN3 B;  3LVQ E;  4J8F A;  1TNZ A;  4JHR A;  4I6E A;  3ZYM A;  4EZK A;  1U3C A;  3U9W A;  5LX8 A;  1DCE A;  3B7U X;  1BLX B;  3WXX A;  3CGH A;  2XS1 A;  2IU1 A;  4ATZ D;  4Q96 A;  4JPS A;  1RW2 A;  2UY1 A;  3TAX A;  4XI0 A;  1S0P A;  2QFC A;  5G04 J;  1ZBP A;  3NZU A;  4DK5 A;  3S7B A;  3FUI A;  5G04 C;  2RD0 A;  2PQN A;  3S7F A;  2WB2 A;  1Z3Y A;  5CED B;  3PS6 A;  2XCB A;  1PY1 A;  5EN5 D;  3EIJ A;  2DIW A;  3G2V A;  3PNT B;  4PUC A;  5BV1 A;  3RSE G;  3UMV A;  1OUV A;  1N4S A;  2Y1L E;  4GAA A;  4BET A;  1A5E A;  2P9P G;  3VLE A;  5DIZ A;  4BT8 A;  4CDN A;  2XGO A;  1P5Q A;  1N54 A;  3NZS A;  3UXG A;  5G2N A;  4AOF A;  2WXH A;  4UUC A;  5CHE E;  1SW6 A;  3WG7 E;  5LFA A;  2X38 A;  3SF4 A;  2L0I A;  3AU4 A;  3Q15 A;  3B95 A;  4K5A B;  1UG3 A;  4TV3 A;  4CDM A;  5ENT D;  1B89 A;  4JXT A;  1HS6 A;  4HLL A;  4UQX A;  4GZD A;  3QNK A;  3Q78 A;  3EHN A;  1A17 A;  4DX1 A;  1BPO A;  4U7E B;  4TXQ A;  3ZNG A;  3JCK C;  1K1A A;  2XEH A;  1PAQ A;  3ZKJ A;  2EIN E;  4GZ6 A;  4I17 A;  1QYM A;  3FU6 A;  3CVL A;  1IYG A;  4MS6 A;  3B7T A;  3QKY A;  1TJF A;  3T8M A;  3B7R L;  3DXM G;  4GPK A;  4Y6C A;  3UT4 A;  3KSQ A;  5KCM A;  4HOR A;  1NI1 A;  2XGS A;  1E8X A;  2NXP A;  3HXB A;  5FJY A;  2IQC A;  4GTO A;  2J09 A;  3E32 A;  3FUM A;  3UKR G;  4EHM A;  3BU8 A;  2EQX A;  2WXR A;  1O1R A;  4A3T A;  2I1K A;  5AJD A;  3EU9 A;  4DI4 A;  3G2S A;  1INZ A;  5CRV A;  2WXN A;  1X5B A;  1K3Z D;  1H2T C;  4L2Y A;  3PUJ A;  3C98 A;  4U95 D;  3LJN A;  5AQ7 A;  4BTA A;  3SBT B;  1VDY A;  1MX2 A;  4FP7 A;  1Q2Z A;  2VGX A;  4ZHB A;  3QOU A;  5FT9 A;  5B3S E;  3TJP A;  4O60 A;  3TG4 A;  2IJG X;  2WXJ A;  3V2X A;  3AG1 E;  3ZPJ A;  3UKU G;  4F3V A;  5CMW A;  3BG0 B;  3MCX A;  5FTP A;  5ANR A;  1LF8 A;  4HI9 A;  4I2W A;  3ASO E;  3MZL B;  3ASG A;  4GTS A;  3ML8 A;  2H6G A;  4J8S A;  3KS2 A;  3P1U A;  1MZC A;  4D10 C;  3SBS A;  1E96 B;  2JEK A;  4CZ2 D;  4UI9 J;  2X6J A;  4UI9 C;  2R05 A;  4YVQ C;  2XHE A;  4GMR A;  1TR4 A;  3E4B A;  5JJ6 A;  4EBA A;  1SVX A;  3E30 A;  3HXD A;  4GPM A;  3FUK A;  3TXN A;  2VTB A;  3FP3 A;  4U8Y D;  4H7Y A;  5BXU A;  2BKG A;  3NOC D;  1TNB A;  5CEC B;  1YCS B;  1FVF A;  1BU9 A;  1TN6 A;  3TGO A;  1H2U A;  3IKO B;  2WQ6 A;  3I3N A;  4I9C A;  2IOL A;  3FUF A;  4ILH B;  3D3M A;  3AU5 A;  2L0T B;  2MOW A;  3ZHE A;  3CQG B;  3D9M A;  2DBA A;  4BSZ B;  3CR3 A;  4JZY A;  2X6K A;  4MLP A;  1OXJ A;  2WPV A;  1SA5 A;  4HOQ A;  3ZGQ A;  1NA0 A;  3AAA C;  2EIJ E;  3CK9 A;  2VSY A;  3UT8 A;  1ELW A;  1NP7 A;  2OVF A;  2NSZ A;  5ARG A;  2P9K G;  2PL2 A;  3C72 A;  3MYV A;  4XKB A;  3QC1 A;  4G24 A;  3Q75 A;  2EIL E;  3CHS A;  3I4R B;  1EDU A;  3L54 A;  3CVW A;  4UWG A;  3D9N A;  3AS8 A;  3TWR A;  1KT0 A;  3CVP A;  2P9L G;  4GML A;  1MQS A;  2WMO A;  3HDX A;  4XX5 A;  2L6B A;  3IHY A;  1FPP A;  5CRU A;  5EIB E;  4N3A A;  2IF4 A;  3RRN B;  2CHZ A;  2H6I A;  3FHE A;  2P9N G;  2ZXW E;  4J8E A;  5FWQ A;  1RZ4 A;  5FZQ A;  2XPZ A;  2KZT A;  3ISM C;  2LUH A;  4HI8 A;  5EDS A;  1D8E A;  2PQR A;  2X6F A;  1SA4 A;  1H6O A;  3SGH A;  4LSZ E;  1JCS A;  2XGM A;  4B94 A;  4A1G A;  4GZC A;  3CVQ A;  3FEY A;  1TN7 A;  5H7P A;  2A5E A;  4N3C A;  3FUH A;  4I6G A;  4BY6 A;  1IXV A;  3PUK A;  5AIJ A;  3PEV B;  4BEP A;  1OCR E;  3D9O A;  5D2M C;  4KMO A;  4BSX A;  3DEP A;  2JLB A;  1TNU A;  3C3R A;  3AG3 E;  2KC7 A;  3HVE B;  1AP7 A;  4WWO A;  2XQ0 A;  5BT1 A;  3SHF A;  2X3M A;  1JCR A;  2V8S E;  4I1O B;  3PNL B;  2B6C A;  2EIK E;  4JHJ A;  4EEC A;  4CGV A;  3EIQ C;  4GTV A;  4U96 D;  1Z6T A;  3APC A;  4K0R A;  4BER A;  1FCH A;  2FBN A;  5A6C A;  4F1P A;  5EKQ D;  4DLO A;  4CGW A;  4UQY A;  1HF8 A;  1TNY A;  3UIO C;  4HNA D;  4G8K A;  4GCO A;  3NAW A;  4WND A;  3UUX A;  1UOH A;  3KEA A;  5FZS A;  4UWK A;  4TRQ A;  3ZYL A;  4UWH A;  4JHK A;  4AXH A;  1XNF A;  2ZIS A;  3J5Q B;  2ILR A;  2GRM A;  2IO2 C;  2LXM A;  3ZYQ A;  3MKQ B;  3L9T A;  4IYP A;  3EHQ A;  4YND A;  1V54 E;  4L23 A;  4FUL A;  4K03 A;  1HZ4 A;  3DSW A;  3DPY A; 
#chains in the Genus database with same CATH homology
 4BEP A;  2P2C P;  2KXP C;  4NIK A;  5ITZ F;  4QQI A;  3ZU7 B;  3T9K A;  4DX1 A;  4YDY A;  3DEP A;  5EYP F;  5AN8 A;  3V31 A;  2J8S D;  5EYL A;  4N5Q A;  5ENS D;  3ZNG A;  2KBX A;  3JXJ A;  1OT8 A;  5ENR D;  1K1A A;  2ETA A;  2XEH A;  3JXI A;  3ZKJ A;  4A63 B;  5ENO D;  1AP7 A;  1BD8 A;  3TWX A;  4HRL A;  2XZD G;  4DX7 D;  1D9S A;  2F8Y A;  4HQD A;  3TWV A;  1QYM A;  4CZ2 D;  2HE0 A;  4DX6 D;  2F37 A;  4U8V D;  3T8K A;  2DZN A;  1DCQ A;  3NOG D;  4DX2 A;  4O1P A;  1BLX B;  1MX4 A;  3AJI A;  3SO8 A;  2XEN A;  2DVW A;  4TUM A;  4DX5 D;  2FO1 E;  4ATZ D;  4YDW A;  4GMR A;  3F6Q A;  3TWR A;  2BKK B;  3UI2 A;  1TR4 A;  3V2O A;  5D66 A;  5KBA A;  4G8L A;  3Q9U C;  5AAO A;  5CBN A;  4U96 D;  4DUI A;  4HBD A;  3B7B A;  4BER A;  1SVX A;  4HRN A;  5CBO A;  5CEA A;  2PNN A;  4GPM A;  4J8Y A;  1G3N B;  4OAU C;  2ZGD A;  4F1P A;  2L6B A;  4ZFH A;  4HRM B;  4BES A;  5CED B;  3TWS A;  4B93 B;  2ETB A;  5EIB E;  5EIL A;  2XEE A;  4HB5 A;  3V30 A;  5BXO A;  3IXE A;  1MYO A;  4J7W A;  5EN5 D;  4U8Y D;  3TWQ A;  5AQ9 A;  4OAV B;  1IKN D;  5AAR A;  5HS0 A;  4DRX E;  1DC2 A;  1N0R A;  5BXU A;  4HNA D;  2BKG A;  3NOC D;  2DZO A;  1N0Q A;  2RFM A;  4G8K A;  5HRY A;  4F6R D;  5CEC B;  2Y1L E;  3TWT A;  1YCS B;  4BET A;  2V5Q C;  1A5E A;  3EU9 A;  2AJA A;  3EHR A;  2ETC A;  4Z68 A;  1BU9 A;  1K1B A;  3HG0 D;  2MYO A;  5JA4 D;  4K5C A;  5FIO A;  2JAB A;  3D9H A;  4HI8 A;  1MX6 A;  1BI7 B;  2ZGG A;  5ENP D;  1UOH A;  3KEA A;  5AQA A;  1K3Z D;  3NBN B;  4RLY A;  1S70 B;  3C5R A;  1N11 A;  4U95 D;  3ZUV B;  3LJN A;  4QFV A;  2Y0B G;  1MJ0 A;  5AQ7 A;  1IHB A;  4CYM D;  2NYJ A;  3UXG A;  1WDY A;  5KWD A;  4LNU D;  4JB8 P;  5ENQ D;  3J5P A;  5EID A;  1MX2 A;  4LSZ E;  5HKP A;  3J5Q B;  3TWU A;  4ZHB A;  2RFA A;  3HRA A;  5KNG A;  4C48 B;  4LG6 A;  4UUC A;  2B0O E;  2XZT G;  1SW6 A;  4O60 A;  3W9G A;  2QC9 A;  4BSZ B;  2V4H C;  3V2X A;  1AWC B;  1OY3 D;  1NFI E;  3EHQ A;  2F8X K;  2DWZ A;  3B95 A;  4K5A B;  3JUE A;  3UTM A;  2A5E A;  2QYJ A;  3AAA C;  3TWW A;  2VGE A;  5AQB A;  5ENT D;  4K5B A;  5KNH D;  3Q9N C;  4O1O A;  3W9F A;  1WG0 A;  5JMN D;  3DEO A;  1BI8 B;  5FIN A;  1IXV A;  3V79 K;  1YYH A;  5CER B;  4HLL A;  1YMP A;  4HI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...