4B93B

Complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat domain of varp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
191
Chain Sequence
KDYREVEKLLRAVADGDLEMVRYLLEWTSGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Exocytosis
molecule keywords VESICLE-ASSOCIATED MEMBRANE PROTEIN 7
publication title The Binding of Varp to Vamp7 Traps Vamp7 in a Closed, Fusogenically Inactive Conformation.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 191
sequence length 231
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4b93B00
4DX5D 4ZHBA 3DEPA 3V31A 4DX6D 3TWQA 5AARA 2QYJA 2L6BA 2XZDG 4JB8P 1MYOA 2V4HC 3ZNGA 5CEDB 1SW6A 4U96D 3SO8A 2ETCA 4U8YD 1OT8A 2F37A 3JXIA 5HRYA 5AQAA 1UOHA 5EIDA 3KEAA 3EHQA 3HRAA 4GPMA 3AJIA 5EN5D 1N0RA 4A63B 5KWDA 4CZ2D 2V5QC 5HKPA 3UTMA 3V2OA 5BXOA 3UI2A 3JUEA 4HB5A 3TWUA 3LJNA 2DWZA 4N5QA 5FIOA 1DCQA 4DX7D 3TWTA 3V30A 2KBXA 1N11A 2QC9A 5ITZF 3TWVA 3UXGA 5AQ7A 1MX6A 2NYJA 5JMND 1N0QA 3AAAC 5EIBE 5JA4D 4YDWA 4RLYA 3EU9A 5ENOD 4UUCA 4HI8A 4HNAD 4HRMB 4QFVA 2XEEA 3T8KA 4Z68A 4G8LA 2FO1E 1A5EA 4K5CA 2ETAA 5EILA 3ZU7B 2DZNA 4K5BA 3T9KA 4C48B 3EHRA 4F6RD 2HE0A 4J8YA 3DEOA 3J5QB 2B0OE 2BKKB 2VGEA 1WDYA 4GMRA 3NOGD 4HRNA 5KNGA 3W9GA 2ZGDA 4TUMA 5EYPF 1MJ0A 1SVXA 4BETA 3D9HA 1BLXB 3Q9UC 4YDYA 4LSZE 1DC2A 2KXPC 2AJAA 4O1OA 1S70B 3IXEA 3F6QA 2BKGA 1WG0A 4BESA 2ZGGA 3ZKJA 4DUIA 1BI7B 2PNNA 5AQ9A 1BI8B 5ENQD 1AP7A 2P2CP 2F8XK 5CBNA 3C5RA 4ZFHA 4J7WA 2XEHA 1G3NB 4DX2A 1K1AA 4G8KA 3V2XA 4U95D 4ATZD 2DZOA 5HS0A 3TWRA 1OY3D 3Q9NC 4O60A 2MYOA 4HRLA 3J5PA 4HLLA 5AQBA 1D9SA 5ENTD 1AWCB 2DVWA 5BXUA 1TR4A 2F8YA 2RFAA 5CERB 4HQDA 1YCSB 1BD8A 1QYMA 2Y1LE 1YMPA 1IKND 4HBDA 5CECB 2A5EA 4QQIA 3HG0D 2RFMA 3TWWA 4U8VD 3JXJA 1NFIE 4O1PA 3ZUVB 3NOCD 5ENSD 1YYHA 2ETBA 5CEAA 1IXVA 4BERA 3TWXA 4BEPA 4DRXE 3V79K 3B7BA 4NIKA 4DX1A 4LNUD 1BU9A 2Y0BG 3W9FA 1IHBA 3TWSA 2XZTG 5ENPD 4F1PA 4CYMD 2XENA 4OAUC 1K1BA 1MX2A 4K5AB 4LG6A 5ENRD 4HI9A 4OAVB 2JABA 3B95A 5D66A 4BSZB 3NBNB 2J8SD 1K3ZD 5AAOA 5CBOA 5KBAA 4B93B 5KNHD 5AN8A 5EYLA 1MX4A 5FINA
chains in the Genus database with same CATH superfamily
4AV7A 2E2EA 3FTVA 3TJPA 3QKYA 2B6CA 1N0RA 5G05J 1FVHA 3UTMA 3IHVA 4HOSA 4B8CB 2P9IG 1NA0A 2GRQB 1MX6A 3AS8A 2R59A 3AAAC 4RLYA 1N9AA 2X38A 2LSVA 2FEZA 4KXKB 4FJZA 3QWVA 3RRNB 1DC2A 1IHGA 2BKGA 2C2LA 5G04C 1BI7B 2J9QA 5D0OD 3R7QA 5LP0A 3L13A 3AG1E 3Q79A 2ILRA 2PQRA 4JC8A 1EYHA 3D9KA 3S2AA 2YHCA 1N94A 4TXRA 5KJNA 3CK8A 3CK7A 3CR3A 3UQ3A 2UWJG 2VGYA 1IQRA 4Y6WA 2Y0BG 5ENPD 4KZCA 4TXPA 3D9OA 4BWRA 2H6FA 3ABKE 3D9PA 2GRMA 3FU6A 4O6FA 2EIKE 1H6OA 2KCKA 3FHEA 3ML9A 4B94A 3ZHEA 2WXQA 4CDRA 4U8YD 4ANWA 2P9SG 1TEZA 1MHQA 2J4BA 4GAAA 5LX8A 3AJIA 3MGBA 5BXOA 4GB9A 4ILGA 1E8WA 3CVQA 3PZ4A 3HXBA 4A1SA 4AM9A 4I17A 2H6IA 1N11A 2FBNA 5ENOD 3GZ1A 4LUNU 1Z3XA 4G24A 3PZ1A 4JPSA 3PUKA 1N4SA 2EIJE 2LAIA 4XZ4A 4GMRA 4I43A 3Q49B 2LUHA 4J8EA 4JA9A 4O1OA 1HF8A 3L17A 5A6CA 4AJWA 4CDMA 4A1GA 3PZDA 4U0SA 4WNDA 1EPUA 1TNYA 2F8XK 1MZCA 2XEHA 4KBQA 4ATZD 3ZYLA 3TWRA 3Q7FA 2VTBB 3Q15A 4ILHB 2X3MA 4HQDA 4XEIG 4EZLA 1YMPA 3ZN3A 2WXOA 4HLEA 3UT8A 3PNTB 2V5FA 3CQCB 2X6HA 3DEPA 2QYUA 4APFA 4BSXA 1OWLA 1UW4B 2OV8A 5FQ7A 2XQ0A 3KEAA 2NSZA 5AJDA 5FZSA 3DPYA 2WMOA 2JLBA 3B7UX 2OCCE 4XIFA 4FU3A 3TXMA 2KBXA 2Y69E 5CCMA 3UM0A 4UUCA 4LRZA 3ZYMA 4Z68A 5EKQD 3SZ7A 2VSOE 4F6RD 3E30A 5KNGA 2KZTA 4HRNA 3G2UA 4RG6A 3FH8A 4BFRA 4YDYA 3Q78A 3SFYA 2CFUA 4G2VA 5B3SE 5HQ8A 2JEKA 4WWNA 3D9LA 3AU5A 3APCA 2XS8A 1LD7A 4GA1A 1HG2A 4PH4B 4FULA 1BD8A 5CECB 2PM7A 5T8IA 2GW1A 2BTDA 2ETBA 2BUGA 2C0MA 2CHZA 4BT9A 3PE4A 2KC7A 5EYLA 5ARGA 1S64A 5BUZA 2WXMA 3C3OA 1NZNA 1OT8A 3ULQA 1SZAA 3HVEB 3ZVVA 4FJYA 3IKOB 3UI2A 3JUEA 3TWUA 2PZIA 3KEZA 3TG5A 2R17C 4F7AA 4J6IA 5KJMA 2XPIA 2IO2C 3MKQB 3UIPC 4KMOA 3IV0A 2WXNA 3JQ1A 1SA5A 1FVFA 3LY9A 3OXFA 2DZNA 4I1AA 1KZPA 3HYMB 1SVXA 4GU5A 3D9HA 1WAO1 3R7RA 4G11A 5KJKA 3CVPA 3PDNA 5AQ9A 4AEZC 4H7YA 5BNWA 3E33A 3CSFA 4J7WA 3D9MA 3SFXA 2GGFA 4DLQA 5HS0A 1V55E 3APFA 5BV1A 4GYYA 3T5VA 1TR4A 2M63A 3FY4A 3LYAA 1ZB1A 3RRMB 1QNFA 1KT1A 3SBSA 4ANVA 1PY1A 3QDNA 4P29A 4OAVB 3U4TA 4EHMA 4X8QA 5FINA 5CCLA 2QYJA 2XZDG 4JB8P 3HIZA 5CEDB 3LJ3A 4JEHA 4U96D 2WB2A 4A3VA 2J09A 3IHYA 2F37A 2DYRE 4OYSA 2WXGA 1Z6TA 4A63B 3PRZA 1U2VG 3CVLA 4DK5A 3VTYA 4N5QA 4U7EB 5FIOA 2XGMA 2WMNA 2WXLA 2AXUA 3RU0A 1N0QA 3QC1A 3KS2A 4M3OA 4EBAA 2Q7FA 4DPRA 3QWWA 2NC9A 4Q94A 3TGOA 3W9GA 3QAQA 1TNZA 3L16A 1TN6A 3FH5A 4Q96A 2DCPA 2IF4A 3UKRG 3UT7A 2UY1B 3MKRA 3UM1A 3CIAA 3Q9NC 2DIWA 2WVIA 2KCLA 2A5UA 2I2OA 4UWHA 3N71A 4UWKA 4JHJA 4GTQA 4UI9K 1H19A 1H6PA 5CEAA 3ML8A 3B7BA 4WWOA 2GRNB 3NZUA 3JUIA 4WUYA 3L6AA 5KBAA 1JWFA 1MX4A 4N2SA 2HO1A 3BU8A 1JCQA 2XCBA 3VLDA 5EIDA 2WXRA 2V5QC 3NZSA 4D10C 2DWZA 5AJLA 2PQNA 2AWIA 1FPPA 2J07A 4F53A 2Y3AA 5JA4D 1N52A 3LVQE 4LNGA 2EIME 1JCRA 5FTPA 1N4QA 4K03A 2XEVA 4K5CA 2IU1A 1E8YA 5AENA 3TWTA 5KJLA 2P9NG 3U66A 2WXPA 3SGHA 4FLHA 3FTXA 3L54A 3IEGA 1TN8A 4DUIA 4GTVA 4MRUA 2VGXB 2XPYA 2PL2A 2BEDA 4YNDA 2J08A 2Y4TA 3L9TA 4OVVA 5EX3A 4GTMA 5E75A 4M7CA 5CERB 3CHMA 3RSEG 1LTXA 3E34A 4C0EA 5FJYA 1JCSA 5G05C 3FU5A 3SFZA 3V79K 3NAWA 4YVOA 4W9RA 4CYMD 1K1BA 3S7BA 3L82A 2KATA 3QOUA 5D66A 4LEUA 4FP7A 5AAOA 5CBOA 2R5SA 3B7RL 3CKBA 2P9UG 1WM5A 5ENNA 2CG3A 3FTSA 5BW8C 3EHQA 4HS2A 3EIQC 3ZW3A 4WNGA 5FQ4A 3MV2B 3PUJA 3VLFA 4ANXA 4CRWA 4DX7D 3SF4A 2VJ8A 4ATGA 1ELRA 1JWGA 2X6IA 5JHBA 4I1MA 4JW1A 1FCHA 3UM2A 3UMVA 4PUCA 5B1AE 4G8LA 2P9LG 3DBSA 3FUIA 3EIJA 4YDOA 3FUDA 1EDUA 4B8AA 4NURA 2LO6A 3ASHA 3P2BA 2PNNA 4L7TA 1N4RA 1N4PA 1D8DA 1OXJA 3FU0A 2MYOA 3Q47B 1OCCE 4KZ0A 1SZ9A 4F3VA 2CFZA 3HXCA 2I1KA 4GYWA 2A5EA 5FT9A 4I9CA 2EQXA 2VSYA 1OCRE 3DSXA 4K0RA 1X5BA 3TWSA 2XZTG 1HE8A 3RAUA 4TXQA 1HZ4A 3B95A 1N95A 4B93B 3DSUA 4HRLA 4GCNA 1D8EA 2V4LA 4N39A 1E7UA 3CSTA 1KPSB 3ZXSA 1E7VA 4I6JA 4GPMA 2VSXE 2VTBA 2ZIRA 3URZA 3R9MA 3SD5A 2FULA 1B89A 3LY8A 4RG9A 4U0ZA 2KM4A 3S7DA 4GCOA 5ITZF 2NYJA 3T5XA 1OWPA 3QJZA 4I6EA 3U3WA 3T8KA 3ESKA 3QARA 4HOUA 3MEKA 5EDSA 5KCMA 1E90A 3QWPA 3UIOC 4U04A 2A4ZA 4XI9A 1TJCA 4LSZE 2FI7A 3LS8A 4XKCA 1U3CA 2ZGGA 3ZKJA 1UG3A 4I9EA 3CHQA 5FWQA 1HG5A 4JL0A 3ABLE 3CVXA 3AG4E 3C98A 1OY3D 3SNXA 3ZRHA 2VQ2A 1TNUA 1HX8A 3J5PA 4IYPA 2EILE 1KT0A 3MJWA 2XCCA 3QB2A 3MYVA 2P58C 3ONKA 3B7SA 3ULYA 1INZA 1KLXA 2WXHA 3ONLA 5HI7A 5ENSD 1Y8MA 4APOA 1BU9A 3CHPA 3KSLA 3ABME 3W9FA 4WWPA 1MQSA 4GZDA 3PH0C 3WXXA 4HI9A 4GZ3A 4CEMA 3V30A 4BX9A 3FUJA 5CRUA 2EINE 1EF1C 2AW6A 3HRAA 3BUAA 3CGHA 4U0UA 4HB5A 4U8HA 3C72A 3ZGQA 5IY5E 3LVRE 4XX5A 3DSWA 3LKUA 3FEYA 4KVOA 3EU9A 2AXZA 2PM6A 3PZ2A 3RKVA 1GW6A 3T9KA 4GA0A 2BKKB 3C3RA 4A55A 5J08A 1MJ0A 3CQGB 4HORA 2HYZA 4BTBA 3WG7E 3ESLA 2IJGX 2DBAA 4DJAA 4V3IA 4I1OB 3LEWA 4IULA 3EHNA 3FTZA 2H6GA 1HU3A 3HVEA 3JYSA 4U95D 4J8DA 1RZ4A 5ENTD 1Z5SC 5BXUA 2F8YA 2XHEA 3MKQA 4CGVA 3VTXA 3UX4A 4NACA 4O1PA 3ZIMA 1YYHA 5G55A 4PS7A 1PAQA 4OAUC 5CRVA 1HXIA 3PZ3A 1Q2ZA 2XS1A 3D9JA 5CMYA 2QFCA 2V0PA 4E6HA 5A23A 3V31A 1HO8A 4GA2A 2V4HC 3HHMA 2X6KA 4TUUA 5KWDA 1YA0A 3DRAA 4ANUA 3B13A 2L0IA 5LCWJ 1ZBPA 3CV0A 1E96B 4HOQA 1N54A 1K8KG 4YDEA 3EU5A 4HI8A 2XEEA 4UWLA 1A5EA 4K5BA 2RG8A 1NI1A 1Z3YA 3NOGD 5FZQA 1U3DA 4GZ6A 4TUMA 4DI3A 2LSUA 4L9PA 4GPKA 3ZYQA 1OWNA 3F6QA 4JHRA 4ZFHA 3BEEA 3CVNA 1KZOA 1TJFA 5LCWC 3CKCA 5FZRA 3ZYKA 2IEJA 1E8XA 2DYSE 1AWCB 2WXKA 4GTOA 3EUVA 4L1BA 1YCSB 2Y1LE 2GRLA 1QZ2A 3L22A 1FT1A 3JQ0A 4PS3A 3NOCD 4LNUD 5C1DA 4K5AB 5AYWD 4FLBA 3OTNA 3BQOA 3U64A 4BT8A 3TWQA 3FTUA 3T8MA 4B89A 1UJJA 4FA6A 4IN3B 4HFGA 3PREA 3NQPA 4CZ2D 5FQ8A 2FF4A 5HKPA 2NXPA 3LJNA 2QY7A 4GMJA 3FULA 4KT6B 3BG1B 3TWVA 1QBQA 2F0YA 4GTRA 1HH8A 1WY6A 2L6JA 3SHFA 2IY0C 3EHRA 4AP2A 2ZGDA 1SQMA 3EDTB 3Q9UC 3IXEA 4GTSA 4AOFA 3Q73A 2J4DA 3G2VA 1W3BA 5ENQD 1AP7A 2AVPA 4HOTA 3CVWA 3C5RA 1K1AA 4EZJA 4N3BA 5D2MC 5DIZA 2XRZA 2DVWA 3PVLA 3TAXA 2VYIA 3FWVA 4AY5A 3RIBA 2RFMA 5JJTA 4JEUA 3SQVA 5G04J 1DNPA 2IONA 2IOSA 3G2WA 4BERA 4CT0A 3JCKC 4DX1A 1H2VC 3ZXPA 2V8SE 3PEVB 3ASFA 4LG6A 2YINA 1ZU2A 4MKTA 4N3CA 3UINC 4BSZB 2YQ8A 2RD0A 3U9WA 2OEVA 2LNIA 4ACLA 2ZXWE 3DPDA 2OOEA 2VGXA 3DWLG 2MOWA 5M72A 3JXIA 4UQZA 1LF8A 1UOHA 4GMLA 3NB2A 3ENEA 2X6JA 4N2QA 4UWFA 3G2TA 3MX3A 5LFAA 3HDXA 1NL4A 1IQUA 4AVXA 3LPZA 1IYGA 2J49A 4BY6A 5ANRA 2ETAA 2P9PG 4URKA 1OWMA 3CVVA 4F1PA 3DXMG 3X2QE 1L5JA 5JJ7A 2GROB 1BLXB 2ZU6B 4NQ0A 4LNBA 1S70B 3PE3A 4MBGA 1UJKA 3ZHEB 4Y6CA 3FUHA 3GYZA 3GZ2A 4GTPA 5CBNA 1O5MA 4OVUA 3V2XA 2YNQA 3LXUX 3D9NA 3Q75A 4I6GA 2GRPB 1D9SA 3PEUB 4GZCA 2BF0X 3Q5MA 1IKND 4GTTA 4AIFA 2WQ6A 3TWWA 4WAFA 3ZFWA 2WQHA 3TWXA 4BEPA 3LDZA 4G23A 4NIKA 4L2YA 4EBAG 2XENA 2R2LA 1FT2A 3S7JA 4FHKA 4I2WA 1K3ZD 2GRRB 5ARFA 4DX5D 4RSYA 3UPVA 5LOZA 5T3RA 1LD8A 2ETCA 2OVFA 5AQAA 5EN5D 3MZLB 1XGWA 4EECA 3O48A 5JHAA 1H2UA 4CT4A 3ASNE 4L23A 4UWGA 3IBEA 3UXGA 5JMND 2ZISA 4DLOA 1TNOA 4HNAD 4UI9J 4HRMB 3MCXA 4G26A 4TV3A 1UN9A 4PDXA 1TN7A 4FHJA 1NA3A 3DEOA 2VGEA 3APDA 3Q4AB 5T4YA 2LXLA 3RO3A 3CK9A 4BETA 3D3MA 2IQCA 5FQ6A 3PNLB 5CHEE 4WNEA 3RK6A 5G2NA 3L08A 3KAEA 5CMWA 2P2CP 2MRIA 4KYOB 4BX8A 3K9IA 2IOLA 2HM8A 3AS4A 3GZSA 4O60A 2I6HA 2YHEA 3FFLA 2CHWA 3DSVA 4HVBA 2XRYA 1OCZE 1JUQA 4YVQC 4UI9C 5H7PA 3RRUA 3OXGA 1H0AA 3UT4A 3FH7A 4N5CA 4UQXA 2R05A 2Y4UA 3AU4A 2H6HA 2FO7A 4BTAA 2MHKA 4MLPA 1MX2A 2KZTB 4EPZA 1O1TA 5ENRD 3OXLA 3GW4A 3O4ZA 3NBNB 2HR2A 3PS6A 5KNHD 3RO2A 4E85A 2QZAA 3FP3A 5AARA 1MYOA 3SO8A 4XE0A 2E0IA 2OVBA 3FUEA 1TNBA 3I5PA 2ONDA 2WXJA 3AG3E 4RVBA 3ULEG 3MV3B 2QC9A 3CLJA 5EIBE 3LCAA 5BT1A 1XNFA 3DSSA 2FO1E 2XGOA 5EILA 2HE0A 4J8YA 3I4GA 1WDYA 2XGSA 3HXDA 4HXIA 3C3QA 3E37A 1S0PA 4KVMA 4XI0A 3HXEA 5C2YA 4EZKA 2WQ7A 3ASOE 4U63A 1BI8B 3I3NA 4I2ZA 5JJ6A 4JXTA 3TXNA 1G3NB 3OAWA 4JD2G 3SBTB 3S7FA 4HLLA 3EHMA 4UQYA 2WXIA 2CG2A 2IO3C 4FC8A 4G25A 4H7XA 3HG0D 4FADA 3HXFA 4U8VD 2WM9A 5A7DB 3ZUVB 3QK0A 1TYQG 3ASDA 1E8ZA 1OCOE 1P5QA 4CGWA 1X81A 3QNKA 3DXKG 4JHKA 3SI5A 3D9IA 4DX6D 3UKUG 3FUFA 4IRUA 1SW6A 4ME2A 3EJNA 3P1UA 5HRYA 1NP7A 1Y6IA 3V2OA 3UUXA 3FTYA 1DCQA 4WNFA 2L9BA 4GYOA 3ZPJA 5AQ7A 2LXMA 3CVYA 4YDWA 4N3AA 2LAHA 4QFVA 4JA7A 1DVPA 4L2LA 1DCEA 3ZU7B 4C48B 4G1TA 1BPOA 3SY2A 4RQIA 2AJAA 1H6KA 3CEQA 4B0ZA 3ISMC 1WG0A 3CHOA 3BG0B 1A17A 1S63A 4AY6A 5B1BE 3UM3A 3CVUA 2OEWA 4DX2A 2P9KG 4G8KA 2AXVA 3RJVA 5D0QD 5BPPA 1PC2A 4J8FA 5ANLA 4PS8A 4JZYA 1H2TC 3FTWA 2RKKA 4A3TA 4NRHB 4DI4A 1OUVA 3FDHA 4DRXE 1HS6A 3ASGA 4J0UA 1IHBA 3MA5A 5BV0A 2WPVA 2I1JA 4C0MA 2I9CA 1HFAA 5DBKA 2JABA 3CHSA 4EQFA 2WXFA 4ZHBA 3FUKA 4GZ5A 2L6BA 3ZNGA 4LCTA 1SA4A 1O1SA 1OWOA 2VSNA 4XKBA 2IFUA 3ZEFA 2CHXA 2KCVA 4J8SA 3G2SA 2X6FA 3AG2E 1ELKA 1QQEA 3E32A 4R7LA 5AIJA 2UY1A 1V54E 1ELWA 3I4RB 3LY7A 4F1SA 3DSTA 3J5QB 2B0OE 3TL5A 2R02A 3FU3A 3CHRA 1O1RA 4ILIA 5EYPF 4ABNA 3TG4A 2KXPC 3NF1A 4BESA 4C9BB 5EX0A 4Q69A 3Q7AA 4LERA 3KSQA 3VLEA 1JPLA 3FUNA 5J90A 3B7TA 2DZOA 2XPZA 5E76A 5AQBA 3FUMA 2C0LA 3AS5A 2L0TB 4ACKA 2RFAA 3KD7A 1QYMA 4JVSA 4HBDA 3FEXA 4QQIA 1UN8A 4CCAA 1VDYA 3JXJA 1NFIE 4MS6A 1IXVA 3R9AB 4U07A 4AXHA 1RW2A 2R03A 4CDNA 4TRQA 2J8SD 5AN8A 3E4BA
chains in the Genus database with same CATH topology
4DX5D 4ZHBA 3DEPA 3V31A 4DX6D 3TWQA 5AARA 2QYJA 2L6BA 2XZDG 4JB8P 1MYOA 2V4HC 3ZNGA 5CEDB 1SW6A 4U96D 3SO8A 2ETCA 4U8YD 1OT8A 2F37A 3JXIA 5HRYA 5AQAA 1UOHA 5EIDA 3KEAA 3EHQA 3HRAA 4GPMA 3AJIA 5EN5D 1N0RA 4A63B 5KWDA 4CZ2D 2V5QC 5HKPA 3UTMA 3V2OA 5BXOA 3UI2A 3JUEA 4HB5A 3TWUA 3LJNA 2DWZA 4N5QA 5FIOA 1DCQA 4DX7D 3TWTA 3V30A 2KBXA 1N11A 2QC9A 5ITZF 3TWVA 3UXGA 5AQ7A 1MX6A 2NYJA 5JMND 1N0QA 3AAAC 5EIBE 5JA4D 4YDWA 4RLYA 3EU9A 5ENOD 4UUCA 4HI8A 4HNAD 4HRMB 4QFVA 2XEEA 3T8KA 4Z68A 4G8LA 2FO1E 1A5EA 4K5CA 2ETAA 5EILA 3ZU7B 2DZNA 4K5BA 3T9KA 4C48B 3EHRA 4F6RD 2HE0A 4J8YA 3DEOA 3J5QB 2B0OE 2BKKB 2VGEA 1WDYA 4GMRA 3NOGD 4HRNA 5KNGA 3W9GA 2ZGDA 4TUMA 5EYPF 1MJ0A 1SVXA 4BETA 3D9HA 1BLXB 3Q9UC 4YDYA 4LSZE 1DC2A 2KXPC 2AJAA 4O1OA 1S70B 3IXEA 3F6QA 2BKGA 1WG0A 4BESA 2ZGGA 3ZKJA 4DUIA 1BI7B 2PNNA 5AQ9A 1BI8B 5ENQD 1AP7A 2P2CP 2F8XK 5CBNA 3C5RA 4ZFHA 4J7WA 2XEHA 1G3NB 4DX2A 1K1AA 4G8KA 3V2XA 4U95D 4ATZD 2DZOA 5HS0A 3TWRA 1OY3D 3Q9NC 4O60A 2MYOA 4HRLA 3J5PA 4HLLA 5AQBA 1D9SA 5ENTD 1AWCB 2DVWA 5BXUA 1TR4A 2F8YA 2RFAA 5CERB 4HQDA 1YCSB 1BD8A 1QYMA 2Y1LE 1YMPA 1IKND 4HBDA 5CECB 2A5EA 4QQIA 3HG0D 2RFMA 3TWWA 4U8VD 3JXJA 1NFIE 4O1PA 3ZUVB 3NOCD 5ENSD 1YYHA 2ETBA 5CEAA 1IXVA 4BERA 3TWXA 4BEPA 4DRXE 3V79K 3B7BA 4NIKA 4DX1A 4LNUD 1BU9A 2Y0BG 3W9FA 1IHBA 3TWSA 2XZTG 5ENPD 4F1PA 4CYMD 2XENA 4OAUC 1K1BA 1MX2A 4K5AB 4LG6A 5ENRD 4HI9A 4OAVB 2JABA 3B95A 5D66A 4BSZB 3NBNB 2J8SD 1K3ZD 5AAOA 5CBOA 5KBAA 4B93B 5KNHD 5AN8A 5EYLA 1MX4A 5FINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DX5 D;  4ZHB A;  3DEP A;  3V31 A;  4DX6 D;  3TWQ A;  5AAR A;  2QYJ A;  2L6B A;  2XZD G;  4JB8 P;  1MYO A;  2V4H C;  3ZNG A;  5CED B;  1SW6 A;  4U96 D;  3SO8 A;  2ETC A;  4U8Y D;  1OT8 A;  2F37 A;  3JXI A;  5HRY A;  5AQA A;  1UOH A;  5EID A;  3KEA A;  3EHQ A;  3HRA A;  4GPM A;  3AJI A;  5EN5 D;  1N0R A;  4A63 B;  5KWD A;  4CZ2 D;  2V5Q C;  5HKP A;  3UTM A;  3V2O A;  5BXO A;  3UI2 A;  3JUE A;  4HB5 A;  3TWU A;  3LJN A;  2DWZ A;  4N5Q A;  5FIO A;  1DCQ A;  4DX7 D;  3TWT A;  3V30 A;  2KBX A;  1N11 A;  2QC9 A;  5ITZ F;  3TWV A;  3UXG A;  5AQ7 A;  1MX6 A;  2NYJ A;  5JMN D;  1N0Q A;  3AAA C;  5EIB E;  5JA4 D;  4YDW A;  4RLY A;  3EU9 A;  5ENO D;  4UUC A;  4HI8 A;  4HNA D;  4HRM B;  4QFV A;  2XEE A;  3T8K A;  4Z68 A;  4G8L A;  2FO1 E;  1A5E A;  4K5C A;  2ETA A;  5EIL A;  3ZU7 B;  2DZN A;  4K5B A;  3T9K A;  4C48 B;  3EHR A;  4F6R D;  2HE0 A;  4J8Y A;  3DEO A;  3J5Q B;  2B0O E;  2BKK B;  2VGE A;  1WDY A;  4GMR A;  3NOG D;  4HRN A;  5KNG A;  3W9G A;  2ZGD A;  4TUM A;  5EYP F;  1MJ0 A;  1SVX A;  4BET A;  3D9H A;  1BLX B;  3Q9U C;  4YDY A;  4LSZ E;  1DC2 A;  2KXP C;  2AJA A;  4O1O A;  1S70 B;  3IXE A;  3F6Q A;  2BKG A;  1WG0 A;  4BES A;  2ZGG A;  3ZKJ A;  4DUI A;  1BI7 B;  2PNN A;  5AQ9 A;  1BI8 B;  5ENQ D;  1AP7 A;  2P2C P;  2F8X K;  5CBN A;  3C5R A;  4ZFH A;  4J7W A;  2XEH A;  1G3N B;  4DX2 A;  1K1A A;  4G8K A;  3V2X A;  4U95 D;  4ATZ D;  2DZO A;  5HS0 A;  3TWR A;  1OY3 D;  3Q9N C;  4O60 A;  2MYO A;  4HRL A;  3J5P A;  4HLL A;  5AQB A;  1D9S A;  5ENT D;  1AWC B;  2DVW A;  5BXU A;  1TR4 A;  2F8Y A;  2RFA A;  5CER B;  4HQD A;  1YCS B;  1BD8 A;  1QYM A;  2Y1L E;  1YMP A;  1IKN D;  4HBD A;  5CEC B;  2A5E A;  4QQI A;  3HG0 D;  2RFM A;  3TWW A;  4U8V D;  3JXJ A;  1NFI E;  4O1P A;  3ZUV B;  3NOC D;  5ENS D;  1YYH A;  2ETB A;  5CEA A;  1IXV A;  4BER A;  3TWX A;  4BEP A;  4DRX E;  3V79 K;  3B7B A;  4NIK A;  4DX1 A;  4LNU D;  1BU9 A;  2Y0B G;  3W9F A;  1IHB A;  3TWS A;  2XZT G;  5ENP D;  4F1P A;  4CYM D;  2XEN A;  4OAU C;  1K1B A;  1MX2 A;  4K5A B;  4LG6 A;  5ENR D;  4HI9 A;  4OAV B;  2JAB A;  3B95 A;  5D66 A;  4BSZ B;  3NBN B;  2J8S D;  1K3Z D;  5AAO A;  5CBO A;  5KBA A;  4B93 B;  5KNH D;  5AN8 A;  5EYL A;  1MX4 A;  5FIN A; 
#chains in the Genus database with same CATH topology
 4AV7 A;  2E2E A;  3FTV A;  3TJP A;  3QKY A;  2B6C A;  1N0R A;  5G05 J;  1FVH A;  3UTM A;  3IHV A;  4HOS A;  4B8C B;  2P9I G;  1NA0 A;  2GRQ B;  1MX6 A;  3AS8 A;  2R59 A;  3AAA C;  4RLY A;  1N9A A;  2X38 A;  2LSV A;  2FEZ A;  4KXK B;  4FJZ A;  3QWV A;  3RRN B;  1DC2 A;  1IHG A;  2BKG A;  2C2L A;  5G04 C;  1BI7 B;  2J9Q A;  5D0O D;  3R7Q A;  5LP0 A;  3L13 A;  3AG1 E;  3Q79 A;  2ILR A;  2PQR A;  4JC8 A;  1EYH A;  3D9K A;  3S2A A;  2YHC A;  1N94 A;  4TXR A;  5KJN A;  3CK8 A;  3CK7 A;  3CR3 A;  3UQ3 A;  2UWJ G;  2VGY A;  1IQR A;  4Y6W A;  2Y0B G;  5ENP D;  4KZC A;  4TXP A;  3D9O A;  4BWR A;  2H6F A;  3ABK E;  3D9P A;  2GRM A;  3FU6 A;  4O6F A;  2EIK E;  1H6O A;  2KCK A;  3FHE A;  3ML9 A;  4B94 A;  3ZHE A;  2WXQ A;  4CDR A;  4U8Y D;  4ANW A;  2P9S G;  1TEZ A;  1MHQ A;  2J4B A;  4GAA A;  5LX8 A;  3AJI A;  3MGB A;  5BXO A;  4GB9 A;  4ILG A;  1E8W A;  3CVQ A;  3PZ4 A;  3HXB A;  4A1S A;  4AM9 A;  4I17 A;  2H6I A;  1N11 A;  2FBN A;  5ENO D;  3GZ1 A;  4LUN U;  1Z3X A;  4G24 A;  3PZ1 A;  4JPS A;  3PUK A;  1N4S A;  2EIJ E;  2LAI A;  4XZ4 A;  4GMR A;  4I43 A;  3Q49 B;  2LUH A;  4J8E A;  4JA9 A;  4O1O A;  1HF8 A;  3L17 A;  5A6C A;  4AJW A;  4CDM A;  4A1G A;  3PZD A;  4U0S A;  4WND A;  1EPU A;  1TNY A;  2F8X K;  1MZC A;  2XEH A;  4KBQ A;  4ATZ D;  3ZYL A;  3TWR A;  3Q7F A;  2VTB B;  3Q15 A;  4ILH B;  2X3M A;  4HQD A;  4XEI G;  4EZL A;  1YMP A;  3ZN3 A;  2WXO A;  4HLE A;  3UT8 A;  3PNT B;  2V5F A;  3CQC B;  2X6H A;  3DEP A;  2QYU A;  4APF A;  4BSX A;  1OWL A;  1UW4 B;  2OV8 A;  5FQ7 A;  2XQ0 A;  3KEA A;  2NSZ A;  5AJD A;  5FZS A;  3DPY A;  2WMO A;  2JLB A;  3B7U X;  2OCC E;  4XIF A;  4FU3 A;  3TXM A;  2KBX A;  2Y69 E;  5CCM A;  3UM0 A;  4UUC A;  4LRZ A;  3ZYM A;  4Z68 A;  5EKQ D;  3SZ7 A;  2VSO E;  4F6R D;  3E30 A;  5KNG A;  2KZT A;  4HRN A;  3G2U A;  4RG6 A;  3FH8 A;  4BFR A;  4YDY A;  3Q78 A;  3SFY A;  2CFU A;  4G2V A;  5B3S E;  5HQ8 A;  2JEK A;  4WWN A;  3D9L A;  3AU5 A;  3APC A;  2XS8 A;  1LD7 A;  4GA1 A;  1HG2 A;  4PH4 B;  4FUL A;  1BD8 A;  5CEC B;  2PM7 A;  5T8I A;  2GW1 A;  2BTD A;  2ETB A;  2BUG A;  2C0M A;  2CHZ A;  4BT9 A;  3PE4 A;  2KC7 A;  5EYL A;  5ARG A;  1S64 A;  5BUZ A;  2WXM A;  3C3O A;  1NZN A;  1OT8 A;  3ULQ A;  1SZA A;  3HVE B;  3ZVV A;  4FJY A;  3IKO B;  3UI2 A;  3JUE A;  3TWU A;  2PZI A;  3KEZ A;  3TG5 A;  2R17 C;  4F7A A;  4J6I A;  5KJM A;  2XPI A;  2IO2 C;  3MKQ B;  3UIP C;  4KMO A;  3IV0 A;  2WXN A;  3JQ1 A;  1SA5 A;  1FVF A;  3LY9 A;  3OXF A;  2DZN A;  4I1A A;  1KZP A;  3HYM B;  1SVX A;  4GU5 A;  3D9H A;  1WAO 1;  3R7R A;  4G11 A;  5KJK A;  3CVP A;  3PDN A;  5AQ9 A;  4AEZ C;  4H7Y A;  5BNW A;  3E33 A;  3CSF A;  4J7W A;  3D9M A;  3SFX A;  2GGF A;  4DLQ A;  5HS0 A;  1V55 E;  3APF A;  5BV1 A;  4GYY A;  3T5V A;  1TR4 A;  2M63 A;  3FY4 A;  3LYA A;  1ZB1 A;  3RRM B;  1QNF A;  1KT1 A;  3SBS A;  4ANV A;  1PY1 A;  3QDN A;  4P29 A;  4OAV B;  3U4T A;  4EHM A;  4X8Q A;  5FIN A;  5CCL A;  2QYJ A;  2XZD G;  4JB8 P;  3HIZ A;  5CED B;  3LJ3 A;  4JEH A;  4U96 D;  2WB2 A;  4A3V A;  2J09 A;  3IHY A;  2F37 A;  2DYR E;  4OYS A;  2WXG A;  1Z6T A;  4A63 B;  3PRZ A;  1U2V G;  3CVL A;  4DK5 A;  3VTY A;  4N5Q A;  4U7E B;  5FIO A;  2XGM A;  2WMN A;  2WXL A;  2AXU A;  3RU0 A;  1N0Q A;  3QC1 A;  3KS2 A;  4M3O A;  4EBA A;  2Q7F A;  4DPR A;  3QWW A;  2NC9 A;  4Q94 A;  3TGO A;  3W9G A;  3QAQ A;  1TNZ A;  3L16 A;  1TN6 A;  3FH5 A;  4Q96 A;  2DCP A;  2IF4 A;  3UKR G;  3UT7 A;  2UY1 B;  3MKR A;  3UM1 A;  3CIA A;  3Q9N C;  2DIW A;  2WVI A;  2KCL A;  2A5U A;  2I2O A;  4UWH A;  3N71 A;  4UWK A;  4JHJ A;  4GTQ A;  4UI9 K;  1H19 A;  1H6P A;  5CEA A;  3ML8 A;  3B7B A;  4WWO A;  2GRN B;  3NZU A;  3JUI A;  4WUY A;  3L6A A;  5KBA A;  1JWF A;  1MX4 A;  4N2S A;  2HO1 A;  3BU8 A;  1JCQ A;  2XCB A;  3VLD A;  5EID A;  2WXR A;  2V5Q C;  3NZS A;  4D10 C;  2DWZ A;  5AJL A;  2PQN A;  2AWI A;  1FPP A;  2J07 A;  4F53 A;  2Y3A A;  5JA4 D;  1N52 A;  3LVQ E;  4LNG A;  2EIM E;  1JCR A;  5FTP A;  1N4Q A;  4K03 A;  2XEV A;  4K5C A;  2IU1 A;  1E8Y A;  5AEN A;  3TWT A;  5KJL A;  2P9N G;  3U66 A;  2WXP A;  3SGH A;  4FLH A;  3FTX A;  3L54 A;  3IEG A;  1TN8 A;  4DUI A;  4GTV A;  4MRU A;  2VGX B;  2XPY A;  2PL2 A;  2BED A;  4YND A;  2J08 A;  2Y4T A;  3L9T A;  4OVV A;  5EX3 A;  4GTM A;  5E75 A;  4M7C A;  5CER B;  3CHM A;  3RSE G;  1LTX A;  3E34 A;  4C0E A;  5FJY A;  1JCS A;  5G05 C;  3FU5 A;  3SFZ A;  3V79 K;  3NAW A;  4YVO A;  4W9R A;  4CYM D;  1K1B A;  3S7B A;  3L82 A;  2KAT A;  3QOU A;  5D66 A;  4LEU A;  4FP7 A;  5AAO A;  5CBO A;  2R5S A;  3B7R L;  3CKB A;  2P9U G;  1WM5 A;  5ENN A;  2CG3 A;  3FTS A;  5BW8 C;  3EHQ A;  4HS2 A;  3EIQ C;  3ZW3 A;  4WNG A;  5FQ4 A;  3MV2 B;  3PUJ A;  3VLF A;  4ANX A;  4CRW A;  4DX7 D;  3SF4 A;  2VJ8 A;  4ATG A;  1ELR A;  1JWG A;  2X6I A;  5JHB A;  4I1M A;  4JW1 A;  1FCH A;  3UM2 A;  3UMV A;  4PUC A;  5B1A E;  4G8L A;  2P9L G;  3DBS A;  3FUI A;  3EIJ A;  4YDO A;  3FUD A;  1EDU A;  4B8A A;  4NUR A;  2LO6 A;  3ASH A;  3P2B A;  2PNN A;  4L7T A;  1N4R A;  1N4P A;  1D8D A;  1OXJ A;  3FU0 A;  2MYO A;  3Q47 B;  1OCC E;  4KZ0 A;  1SZ9 A;  4F3V A;  2CFZ A;  3HXC A;  2I1K A;  4GYW A;  2A5E A;  5FT9 A;  4I9C A;  2EQX A;  2VSY A;  1OCR E;  3DSX A;  4K0R A;  1X5B A;  3TWS A;  2XZT G;  1HE8 A;  3RAU A;  4TXQ A;  1HZ4 A;  3B95 A;  1N95 A;  4B93 B;  3DSU A;  4HRL A;  4GCN A;  1D8E A;  2V4L A;  4N39 A;  1E7U A;  3CST A;  1KPS B;  3ZXS A;  1E7V A;  4I6J A;  4GPM A;  2VSX E;  2VTB A;  2ZIR A;  3URZ A;  3R9M A;  3SD5 A;  2FUL A;  1B89 A;  3LY8 A;  4RG9 A;  4U0Z A;  2KM4 A;  3S7D A;  4GCO A;  5ITZ F;  2NYJ A;  3T5X A;  1OWP A;  3QJZ A;  4I6E A;  3U3W A;  3T8K A;  3ESK A;  3QAR A;  4HOU A;  3MEK A;  5EDS A;  5KCM A;  1E90 A;  3QWP A;  3UIO C;  4U04 A;  2A4Z A;  4XI9 A;  1TJC A;  4LSZ E;  2FI7 A;  3LS8 A;  4XKC A;  1U3C A;  2ZGG A;  3ZKJ A;  1UG3 A;  4I9E A;  3CHQ A;  5FWQ A;  1HG5 A;  4JL0 A;  3ABL E;  3CVX A;  3AG4 E;  3C98 A;  1OY3 D;  3SNX A;  3ZRH A;  2VQ2 A;  1TNU A;  1HX8 A;  3J5P A;  4IYP A;  2EIL E;  1KT0 A;  3MJW A;  2XCC A;  3QB2 A;  3MYV A;  2P58 C;  3ONK A;  3B7S A;  3ULY A;  1INZ A;  1KLX A;  2WXH A;  3ONL A;  5HI7 A;  5ENS D;  1Y8M A;  4APO A;  1BU9 A;  3CHP A;  3KSL A;  3ABM E;  3W9F A;  4WWP A;  1MQS A;  4GZD A;  3PH0 C;  3WXX A;  4HI9 A;  4GZ3 A;  4CEM A;  3V30 A;  4BX9 A;  3FUJ A;  5CRU A;  2EIN E;  1EF1 C;  2AW6 A;  3HRA A;  3BUA A;  3CGH A;  4U0U A;  4HB5 A;  4U8H A;  3C72 A;  3ZGQ A;  5IY5 E;  3LVR E;  4XX5 A;  3DSW A;  3LKU A;  3FEY A;  4KVO A;  3EU9 A;  2AXZ A;  2PM6 A;  3PZ2 A;  3RKV A;  1GW6 A;  3T9K A;  4GA0 A;  2BKK B;  3C3R A;  4A55 A;  5J08 A;  1MJ0 A;  3CQG B;  4HOR A;  2HYZ A;  4BTB A;  3WG7 E;  3ESL A;  2IJG X;  2DBA A;  4DJA A;  4V3I A;  4I1O B;  3LEW A;  4IUL A;  3EHN A;  3FTZ A;  2H6G A;  1HU3 A;  3HVE A;  3JYS A;  4U95 D;  4J8D A;  1RZ4 A;  5ENT D;  1Z5S C;  5BXU A;  2F8Y A;  2XHE A;  3MKQ A;  4CGV A;  3VTX A;  3UX4 A;  4NAC A;  4O1P A;  3ZIM A;  1YYH A;  5G55 A;  4PS7 A;  1PAQ A;  4OAU C;  5CRV A;  1HXI A;  3PZ3 A;  1Q2Z A;  2XS1 A;  3D9J A;  5CMY A;  2QFC A;  2V0P A;  4E6H A;  5A23 A;  3V31 A;  1HO8 A;  4GA2 A;  2V4H C;  3HHM A;  2X6K A;  4TUU A;  5KWD A;  1YA0 A;  3DRA A;  4ANU A;  3B13 A;  2L0I A;  5LCW J;  1ZBP A;  3CV0 A;  1E96 B;  4HOQ A;  1N54 A;  1K8K G;  4YDE A;  3EU5 A;  4HI8 A;  2XEE A;  4UWL A;  1A5E A;  4K5B A;  2RG8 A;  1NI1 A;  1Z3Y A;  3NOG D;  5FZQ A;  1U3D A;  4GZ6 A;  4TUM A;  4DI3 A;  2LSU A;  4L9P A;  4GPK A;  3ZYQ A;  1OWN A;  3F6Q A;  4JHR A;  4ZFH A;  3BEE A;  3CVN A;  1KZO A;  1TJF A;  5LCW C;  3CKC A;  5FZR A;  3ZYK A;  2IEJ A;  1E8X A;  2DYS E;  1AWC B;  2WXK A;  4GTO A;  3EUV A;  4L1B A;  1YCS B;  2Y1L E;  2GRL A;  1QZ2 A;  3L22 A;  1FT1 A;  3JQ0 A;  4PS3 A;  3NOC D;  4LNU D;  5C1D A;  4K5A B;  5AYW D;  4FLB A;  3OTN A;  3BQO A;  3U64 A;  4BT8 A;  3TWQ A;  3FTU A;  3T8M A;  4B89 A;  1UJJ A;  4FA6 A;  4IN3 B;  4HFG A;  3PRE A;  3NQP A;  4CZ2 D;  5FQ8 A;  2FF4 A;  5HKP A;  2NXP A;  3LJN A;  2QY7 A;  4GMJ A;  3FUL A;  4KT6 B;  3BG1 B;  3TWV A;  1QBQ A;  2F0Y A;  4GTR A;  1HH8 A;  1WY6 A;  2L6J A;  3SHF A;  2IY0 C;  3EHR A;  4AP2 A;  2ZGD A;  1SQM A;  3EDT B;  3Q9U C;  3IXE A;  4GTS A;  4AOF A;  3Q73 A;  2J4D A;  3G2V A;  1W3B A;  5ENQ D;  1AP7 A;  2AVP A;  4HOT A;  3CVW A;  3C5R A;  1K1A A;  4EZJ A;  4N3B A;  5D2M C;  5DIZ A;  2XRZ A;  2DVW A;  3PVL A;  3TAX A;  2VYI A;  3FWV A;  4AY5 A;  3RIB A;  2RFM A;  5JJT A;  4JEU A;  3SQV A;  5G04 J;  1DNP A;  2ION A;  2IOS A;  3G2W A;  4BER A;  4CT0 A;  3JCK C;  4DX1 A;  1H2V C;  3ZXP A;  2V8S E;  3PEV B;  3ASF A;  4LG6 A;  2YIN A;  1ZU2 A;  4MKT A;  4N3C A;  3UIN C;  4BSZ B;  2YQ8 A;  2RD0 A;  3U9W A;  2OEV A;  2LNI A;  4ACL A;  2ZXW E;  3DPD A;  2OOE A;  2VGX A;  3DWL G;  2MOW A;  5M72 A;  3JXI A;  4UQZ A;  1LF8 A;  1UOH A;  4GML A;  3NB2 A;  3ENE A;  2X6J A;  4N2Q A;  4UWF A;  3G2T A;  3MX3 A;  5LFA A;  3HDX A;  1NL4 A;  1IQU A;  4AVX A;  3LPZ A;  1IYG A;  2J49 A;  4BY6 A;  5ANR A;  2ETA A;  2P9P G;  4URK A;  1OWM A;  3CVV A;  4F1P A;  3DXM G;  3X2Q E;  1L5J A;  5JJ7 A;  2GRO B;  1BLX B;  2ZU6 B;  4NQ0 A;  4LNB A;  1S70 B;  3PE3 A;  4MBG A;  1UJK A;  3ZHE B;  4Y6C A;  3FUH A;  3GYZ A;  3GZ2 A;  4GTP A;  5CBN A;  1O5M A;  4OVU A;  3V2X A;  2YNQ A;  3LXU X;  3D9N A;  3Q75 A;  4I6G A;  2GRP B;  1D9S A;  3PEU B;  4GZC A;  2BF0 X;  3Q5M A;  1IKN D;  4GTT A;  4AIF A;  2WQ6 A;  3TWW A;  4WAF A;  3ZFW A;  2WQH A;  3TWX A;  4BEP A;  3LDZ A;  4G23 A;  4NIK A;  4L2Y A;  4EBA G;  2XEN A;  2R2L A;  1FT2 A;  3S7J A;  4FHK A;  4I2W A;  1K3Z D;  2GRR B;  5ARF A;  4DX5 D;  4RSY A;  3UPV A;  5LOZ A;  5T3R A;  1LD8 A;  2ETC A;  2OVF A;  5AQA A;  5EN5 D;  3MZL B;  1XGW A;  4EEC A;  3O48 A;  5JHA A;  1H2U A;  4CT4 A;  3ASN E;  4L23 A;  4UWG A;  3IBE A;  3UXG A;  5JMN D;  2ZIS A;  4DLO A;  1TNO A;  4HNA D;  4UI9 J;  4HRM B;  3MCX A;  4G26 A;  4TV3 A;  1UN9 A;  4PDX A;  1TN7 A;  4FHJ A;  1NA3 A;  3DEO A;  2VGE A;  3APD A;  3Q4A B;  5T4Y A;  2LXL A;  3RO3 A;  3CK9 A;  4BET A;  3D3M A;  2IQC A;  5FQ6 A;  3PNL B;  5CHE E;  4WNE A;  3RK6 A;  5G2N A;  3L08 A;  3KAE A;  5CMW A;  2P2C P;  2MRI A;  4KYO B;  4BX8 A;  3K9I A;  2IOL A;  2HM8 A;  3AS4 A;  3GZS A;  4O60 A;  2I6H A;  2YHE A;  3FFL A;  2CHW A;  3DSV A;  4HVB A;  2XRY A;  1OCZ E;  1JUQ A;  4YVQ C;  4UI9 C;  5H7P A;  3RRU A;  3OXG A;  1H0A A;  3UT4 A;  3FH7 A;  4N5C A;  4UQX A;  2R05 A;  2Y4U A;  3AU4 A;  2H6H A;  2FO7 A;  4BTA A;  2MHK A;  4MLP A;  1MX2 A;  2KZT B;  4EPZ A;  1O1T A;  5ENR D;  3OXL A;  3GW4 A;  3O4Z A;  3NBN B;  2HR2 A;  3PS6 A;  5KNH D;  3RO2 A;  4E85 A;  2QZA A;  3FP3 A;  5AAR A;  1MYO A;  3SO8 A;  4XE0 A;  2E0I A;  2OVB A;  3FUE A;  1TNB A;  3I5P A;  2OND A;  2WXJ A;  3AG3 E;  4RVB A;  3ULE G;  3MV3 B;  2QC9 A;  3CLJ A;  5EIB E;  3LCA A;  5BT1 A;  1XNF A;  3DSS A;  2FO1 E;  2XGO A;  5EIL A;  2HE0 A;  4J8Y A;  3I4G A;  1WDY A;  2XGS A;  3HXD A;  4HXI A;  3C3Q A;  3E37 A;  1S0P A;  4KVM A;  4XI0 A;  3HXE A;  5C2Y A;  4EZK A;  2WQ7 A;  3ASO E;  4U63 A;  1BI8 B;  3I3N A;  4I2Z A;  5JJ6 A;  4JXT A;  3TXN A;  1G3N B;  3OAW A;  4JD2 G;  3SBT B;  3S7F A;  4HLL A;  3EHM A;  4UQY A;  2WXI A;  2CG2 A;  2IO3 C;  4FC8 A;  4G25 A;  4H7X A;  3HG0 D;  4FAD A;  3HXF A;  4U8V D;  2WM9 A;  5A7D B;  3ZUV B;  3QK0 A;  1TYQ G;  3ASD A;  1E8Z A;  1OCO E;  1P5Q A;  4CGW A;  1X81 A;  3QNK A;  3DXK G;  4JHK A;  3SI5 A;  3D9I A;  4DX6 D;  3UKU G;  3FUF A;  4IRU A;  1SW6 A;  4ME2 A;  3EJN A;  3P1U A;  5HRY A;  1NP7 A;  1Y6I A;  3V2O A;  3UUX A;  3FTY A;  1DCQ A;  4WNF A;  2L9B A;  4GYO A;  3ZPJ A;  5AQ7 A;  2LXM A;  3CVY A;  4YDW A;  4N3A A;  2LAH A;  4QFV A;  4JA7 A;  1DVP A;  4L2L A;  1DCE A;  3ZU7 B;  4C48 B;  4G1T A;  1BPO A;  3SY2 A;  4RQI A;  2AJA A;  1H6K A;  3CEQ A;  4B0Z A;  3ISM C;  1WG0 A;  3CHO A;  3BG0 B;  1A17 A;  1S63 A;  4AY6 A;  5B1B E;  3UM3 A;  3CVU A;  2OEW A;  4DX2 A;  2P9K G;  4G8K A;  2AXV A;  3RJV A;  5D0Q D;  5BPP A;  1PC2 A;  4J8F A;  5ANL A;  4PS8 A;  4JZY A;  1H2T C;  3FTW A;  2RKK A;  4A3T A;  4NRH B;  4DI4 A;  1OUV A;  3FDH A;  4DRX E;  1HS6 A;  3ASG A;  4J0U A;  1IHB A;  3MA5 A;  5BV0 A;  2WPV A;  2I1J A;  4C0M A;  2I9C A;  1HFA A;  5DBK A;  2JAB A;  3CHS A;  4EQF A;  2WXF A;  4ZHB A;  3FUK A;  4GZ5 A;  2L6B A;  3ZNG A;  4LCT A;  1SA4 A;  1O1S A;  1OWO A;  2VSN A;  4XKB A;  2IFU A;  3ZEF A;  2CHX A;  2KCV A;  4J8S A;  3G2S A;  2X6F A;  3AG2 E;  1ELK A;  1QQE A;  3E32 A;  4R7L A;  5AIJ A;  2UY1 A;  1V54 E;  1ELW A;  3I4R B;  3LY7 A;  4F1S A;  3DST A;  3J5Q B;  2B0O E;  3TL5 A;  2R02 A;  3FU3 A;  3CHR A;  1O1R A;  4ILI A;  5EYP F;  4ABN A;  3TG4 A;  2KXP C;  3NF1 A;  4BES A;  4C9B B;  5EX0 A;  4Q69 A;  3Q7A A;  4LER A;  3KSQ A;  3VLE A;  1JPL A;  3FUN A;  5J90 A;  3B7T A;  2DZO A;  2XPZ A;  5E76 A;  5AQB A;  3FUM A;  2C0L A;  3AS5 A;  2L0T B;  4ACK A;  2RFA A;  3KD7 A;  1QYM A;  4JVS A;  4HBD A;  3FEX A;  4QQI A;  1UN8 A;  4CCA A;  1VDY A;  3JXJ A;  1NFI E;  4MS6 A;  1IXV A;  3R9A B;  4U07 A;  4AXH A;  1RW2 A;  2R03 A;  4CDN A;  4TRQ A;  2J8S D;  5AN8 A;  3E4B A; 
#chains in the Genus database with same CATH homology
 4DX5 D;  4ZHB A;  3DEP A;  3V31 A;  4DX6 D;  3TWQ A;  5AAR A;  2QYJ A;  2L6B A;  2XZD G;  4JB8 P;  1MYO A;  2V4H C;  3ZNG A;  5CED B;  1SW6 A;  4U96 D;  3SO8 A;  2ETC A;  4U8Y D;  1OT8 A;  2F37 A;  3JXI A;  5HRY A;  5AQA A;  1UOH A;  5EID A;  3KEA A;  3EHQ A;  3HRA A;  4GPM A;  3AJI A;  5EN5 D;  1N0R A;  4A63 B;  5KWD A;  4CZ2 D;  2V5Q C;  5HKP A;  3UTM A;  3V2O A;  5BXO A;  3UI2 A;  3JUE A;  4HB5 A;  3TWU A;  3LJN A;  2DWZ A;  4N5Q A;  5FIO A;  1DCQ A;  4DX7 D;  3TWT A;  3V30 A;  2KBX A;  1N11 A;  2QC9 A;  5ITZ F;  3TWV A;  3UXG A;  5AQ7 A;  1MX6 A;  2NYJ A;  5JMN D;  1N0Q A;  3AAA C;  5EIB E;  5JA4 D;  4YDW A;  4RLY A;  3EU9 A;  5ENO D;  4UUC A;  4HI8 A;  4HNA D;  4HRM B;  4QFV A;  2XEE A;  3T8K A;  4Z68 A;  4G8L A;  2FO1 E;  1A5E A;  4K5C A;  2ETA A;  5EIL A;  3ZU7 B;  2DZN A;  4K5B A;  3T9K A;  4C48 B;  3EHR A;  4F6R D;  2HE0 A;  4J8Y A;  3DEO A;  3J5Q B;  2B0O E;  2BKK B;  2VGE A;  1WDY A;  4GMR A;  3NOG D;  4HRN A;  5KNG A;  3W9G A;  2ZGD A;  4TUM A;  5EYP F;  1MJ0 A;  1SVX A;  4BET A;  3D9H A;  1BLX B;  3Q9U C;  4YDY A;  4LSZ E;  1DC2 A;  2KXP C;  2AJA A;  4O1O A;  1S70 B;  3IXE A;  3F6Q A;  2BKG A;  1WG0 A;  4BES A;  2ZGG A;  3ZKJ A;  4DUI A;  1BI7 B;  2PNN A;  5AQ9 A;  1BI8 B;  5ENQ D;  1AP7 A;  2P2C P;  2F8X K;  5CBN A;  3C5R A;  4ZFH A;  4J7W A;  2XEH A;  1G3N B;  4DX2 A;  1K1A A;  4G8K A;  3V2X A;  4U95 D;  4ATZ D;  2DZO A;  5HS0 A;  3TWR A;  1OY3 D;  3Q9N C;  4O60 A;  2MYO A;  4HRL A;  3J5P A;  4HLL A;  5AQB A;  1D9S A;  5ENT D;  1AWC B;  2DVW A;  5BXU A;  1TR4 A;  2F8Y A;  2RFA A;  5CER B;  4HQD A;  1YCS B;  1BD8 A;  1QYM A;  2Y1L E;  1YMP A;  1IKN D;  4HBD A;  5CEC B;  2A5E A;  4QQI A;  3HG0 D;  2RFM A;  3TWW A;  4U8V D;  3JXJ A;  1NFI E;  4O1P A;  3ZUV B;  3NOC D;  5ENS D;  1YYH A;  2ETB A;  5CEA A;  1IXV A;  4BER A;  3TWX A;  4BEP A;  4DRX E;  3V79 K;  3B7B A;  4NIK A;  4DX1 A;  4LNU D;  1BU9 A;  2Y0B G;  3W9F A;  1IHB A;  3TWS A;  2XZT G;  5ENP D;  4F1P A;  4CYM D;  2XEN A;  4OAU C;  1K1B A;  1MX2 A;  4K5A B;  4LG6 A;  5ENR D;  4HI9 A;  4OAV B;  2JAB A;  3B95 A;  5D66 A;  4BSZ B;  3NBN B;  2J8S D;  1K3Z D;  5AAO A;  5CBO A;  5KBA A;  4B93 B;  5KNH D;  5AN8 A;  5EYL A;  1MX4 A;  5FIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...