4B93B

Complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat domain of varp
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
191
Chain Sequence
KDYREVEKLLRAVADGDLEMVRYLLEWTSGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VESICLE-ASSOCIATED MEMBRANE PROTEIN 7
publication title The Binding of Varp to Vamp7 Traps Vamp7 in a Closed, Fusogenically Inactive Conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Exocytosis
total genus 67
structure length 191
sequence length 231
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4b93B00
5CERB 4U8YD 1UOHA 5EN5D 4YDWA 2JABA 2RFAA 1OY3D 2ZGDA 3DEPA 4TUMA 1N0QA 3EHQA 4DX7D 1BU9A 5AQ7A 4DUIA 1BD8A 3LJNA 4U96D 5CBNA 2XZTG 1K1AA 3Q9UC 4CYMD 2NYJA 1S70B 4HLLA 1DCQA 1K1BA 1WDYA 4G8LA 5ENOD 5AQAA 4F6RD 3T8KA 4C48B 1OT8A 2J8SD 4HBDA 4F1PA 4DRXE 3NOCD 3TWUA 3EU9A 4ATZD 1SW6A 4U8VD 2XZDG 2DWZA 5EIBE 4DX6D 3EHRA 5CBOA 5EYLA 3HRAA 4O1OA 5ENRD 2XEEA 3UTMA 4B93B 1MX2A 3TWWA 3V2OA 3V79K 1BI7B 1YMPA 1IHBA 5ENQD 3V30A 3J5PA 1MYOA 4ZFHA 2DZNA 2ZGGA 4K5BA 2XENA 4LG6A 4O60A 2V4HC 5D66A 5EILA 4Z68A 3D9HA 3NOGD 4ZHBA 2DVWA 4O1PA 4QQIA 4RLYA 2F8XK 3T9KA 5KWDA 1N11A 4BEPA 1YYHA 5ENPD 2F8YA 4GMRA 2ETBA 2BKGA 4OAVB 1SVXA 4QFVA 3TWTA 1G3NB 3ZNGA 3AAAC 1TR4A 3W9FA 1BLXB 2ETCA 3AJIA 5FINA 3JXIA 3SO8A 3DEOA 5KNGA 4U95D 4A63B 4NIKA 4LSZE 2XEHA 4CZ2D 5AQBA 4J7WA 4DX1A 1AWCB 3B95A 1MX6A 2KXPC 5KNHD 4BESA 4BETA 4K5CA 2Y0BG 2HE0A 3HG0D 4UUCA 2ETAA 4N5QA 4OAUC 1IXVA 1BI8B 5JA4D 2RFMA 1MJ0A 4HI9A 4HRMB 5CEDB 5EYPF 5FIOA 2Y1LE 5AAOA 4HRNA 3ZUVB 4DX2A 4J8YA 4HQDA 5AARA 5BXUA 1DC2A 5HKPA 5HS0A 3J5QB 3IXEA 4GPMA 3UXGA 2QYJA 1IKND 1MX4A 2B0OE 2DZOA 2A5EA 2V5QC 4JB8P 3NBNB 3TWRA 3KEAA 2P2CP 1QYMA 3V31A 3JUEA 3W9GA 3ZKJA 2FO1E 3TWVA 4BERA 3C5RA 2BKKB 2PNNA 3B7BA 5ENSD 2L6BA 2VGEA 3V2XA 3F6QA 3ZU7B 1D9SA 4HB5A 2MYOA 4DX5D 1A5EA 5HRYA 2QC9A 3TWXA 3TWSA 4G8KA 5EIDA 5CECB 1N0RA 3JXJA 2KBXA 4BSZB 3UI2A 5ITZF 5JMND 5ENTD 4HRLA 1WG0A 4LNUD 4HI8A 1YCSB 2AJAA 4K5AB 4HNAD 4YDYA 1K3ZD 1AP7A 3Q9NC 2F37A 5AN8A 1NFIE 3TWQA 5CEAA 5BXOA 5AQ9A 5KBAA
chains in the Genus database with same CATH superfamily
4N2QA 4GZCA 5ANLA 1OY3D 2KCVA 5ANRA 4DX7D 4XI0A 4AXHA 2R02A 2J07A 2LXLA 4ME2A 3FUDA 2J8SD 4GPKA 1V55E 4DX6D 3L54A 2IF4A 1IHBA 3DSTA 3EHNA 4ILGA 3ABKE 2YHEA 3T8MA 2XENA 3SHFA 4FA6A 3QOUA 2YNQA 3FTVA 3UM1A 1N4RA 4B94A 3FHEA 3ZEFA 3LS8A 3I4RB 1HZ4A 1YYHA 4N3BA 3HHMA 1UJJA 1SVXA 4QFVA 1G3NB 3AAAC 3CVNA 2WQ6A 2WXKA 4AY5A 4PS3A 3PZ1A 1VDYA 3B95A 4WWNA 3DSUA 3C3OA 4N5QA 4I1OB 3ASHA 1V54E 5AAOA 1Z6TA 2VTBB 1DC2A 5HKPA 1H2UA 1Y8MA 4GPMA 2GRNB 3FWVA 3VLFA 3HVEB 3GZSA 2EILE 4BWRA 5LCWC 2DCPA 5DIZA 3U9WA 4E85A 1KT0A 1S64A 4UQXA 1N94A 3ZHEB 2FBNA 2AJAA 2KZTB 2WMOA 3MKRA 5BXOA 3PEUB 4BT9A 4URKA 2Y3AA 3KSQA 2Y4UA 3AG3E 3PE4A 2XZTG 4CYMD 3I3NA 2NYJA 3E34A 4J6IA 3FUMA 3LYAA 4KZ0A 4EPZA 4GYOA 2IOLA 3EHMA 2P58C 1WM5A 3UTMA 1N9AA 3LDZA 4UWKA 2PM6A 4DLOA 3QJZA 2WQ7A 4J8EA 4ZHBA 5D2MC 3LJ3A 3RO2A 5J08A 2IU1A 1N11A 2OEWA 3SFXA 2X6JA 1EPUA 3CV0A 3OXLA 4A63B 2CHWA 5LP0A 4J7WA 4D10C 1AWCB 2VSYA 4AJWA 3CIAA 4HRMB 5EYPF 5A7DB 1N52A 4HVBA 2M63A 5CMYA 4HOQA 4U0UA 3KEAA 1TN6A 3LEWA 3FFLA 5CRVA 2P9UG 3D9LA 2WXQA 2MYOA 1IYGA 2QZAA 1E8WA 3CR3A 2YHCA 5ENTD 4HRLA 1WG0A 4LNUD 4WNDA 3QDNA 4UI9C 3Q9NC 3D9JA 3MJWA 4U8YD 3I4GA 2RFAA 1ELRA 2KM4A 4YDEA 1IQUA 2AXUA 1K1BA 2WXGA 3UMVA 5LOZA 1PC2A 4GTSA 3CVUA 1HG2A 3B13A 4ATZD 3ZPJA 2I1KA 3HRAA 4GCOA 4B93B 3QB2A 3GZ2A 3CK9A 3PNLB 3KAEA 2DVWA 3ULEG 5BNWA 2LXMA 2OEVA 4XE0A 1E7VA 2R05A 3HXEA 2LSVA 1O5MA 4DLQA 4GZ6A 3HXDA 3JXIA 1LF8A 5KJLA 4GTTA 4NURA 2XGMA 5T4YA 2PQNA 3E30A 4HI9A 2DBAA 4H7XA 5BUZA 2CHZA 4JB8P 2V5QC 3I5PA 4GTPA 4OVUA 4U8HA 4C0EA 3ZKJA 2BF0X 5JHBA 2L6BA 1O1SA 4GTMA 2XHEA 4UWGA 1D8EA 2LAIA 3IEGA 4FJYA 3UIPC 2XPYA 2LSUA 3Q79A 3B7SA 4F1SA 2LNIA 4K5AB 5G55A 3PZDA 3P1UA 1H0AA 5CERB 2IOSA 1OCZE 3PDNA 3DEPA 1FT2A 3R7RA 3LPZA 3CVLA 3UUXA 1BU9A 2J08A 3AG4E 1TEZA 1OWPA 1K8KG 1EF1C 4I9CA 5EDSA 3JQ1A 4Y6CA 3OXGA 3KSLA 1Z5SC 3ONKA 4F3VA 2EIME 1KPSB 3OAWA 3G2UA 5D0QD 3GW4A 3RSEG 2C0LA 2EINE 1N54A 4FLHA 4LNGA 3S2AA 5KWDA 4Q94A 3ZYLA 4ANUA 2ETBA 2L6JA 3LVRE 3IBEA 4I17A 3ZNGA 2DYSE 4N3CA 3MV2B 3ZYMA 3FUEA 5FINA 5KNGA 2IEJA 2P9LG 4XKCA 4CDMA 4GYWA 2KXPC 3BUAA 2ETAA 4DK5A 4XKBA 4U07A 5FIOA 2QY7A 4DX2A 3CVXA 2IO2C 5CRUA 2FO1E 2FEZA 5G04J 4BSXA 2WXFA 4GZ3A 3L13A 1E8ZA 4IN3B 1ELWA 4I9EA 4G8KA 5CECB 4G1TA 4JEUA 5ITZF 4J8DA 4RQIA 1HFAA 2JABA 4K0RA 3APCA 3SFYA 2RD0A 4BFRA 4I6JA 3FU5A 2WXLA 3CVWA 3P2BA 2GRRB 3ZGQA 2IY0C 3AG2E 5CHEE 2XRZA 3TWUA 5KJKA 1UJKA 3S7DA 2V5FA 3L17A 3V79K 4LRZA 4XX5A 5ENQD 3V30A 1MYOA 4DPRA 5BV1A 3PRZA 4B8AA 4O60A 5D66A 3NOGD 4AOFA 3UPVA 3FUNA 3UIOC 2VTBA 4UI9J 3U3WA 3KD7A 3CSFA 1MZCA 4JVSA 4UQYA 2WQHA 3W9FA 1N4QA 5ARGA 3KEZA 3PS6A 3DXKG 2IJGX 4NIKA 3PZ2A 3U64A 5LX8A 4AP2A 3SD5A 2KZTA 4PS7A 3MEKA 5JA4D 5CEDB 5G05C 3L08A 3SY2A 1TN7A 3HXCA 4EZJA 3APFA 3JYSA 3FUKA 4RSYA 4U04A 4X8QA 3JCKC 2OVBA 1D9SA 5HQ8A 4L7TA 3BQOA 3FH8A 3D3MA 1JCSA 4BSZB 3D9KA 4I1AA 3ASGA 4TV3A 4PUCA 4YDYA 2I1JA 4U7EB 4WNGA 5EN5D 4YDWA 1X5BA 4FLBA 2DIWA 2IFUA 4C9BB 3SNXA 2XCCA 1BD8A 1P5QA 1DCQA 3KS2A 3IHVA 1S0PA 5ENOD 4JA9A 2EIKE 2J09A 5ARFA 1OT8A 2XQ0A 2WXPA 1E8XA 1N4SA 2VQ2A 3FUFA 3UM0A 5ENNA 1YMPA 4OYSA 3B7RL 3SI5A 3CKCA 1PAQA 2OVFA 3AS4A 3MA5A 3RIBA 2OV8A 3ONLA 4JD2G 2WXJA 2KC7A 5AQBA 4DX1A 5C2YA 4BESA 4BTAA 2I6HA 2HE0A 1Z3XA 4BT8A 1JWGA 3FTYA 4G24A 4L9PA 5HS0A 3J5QB 2VSNA 4AIFA 3K9IA 1BPOA 4WWOA 3FTWA 3L9TA 2FULA 4BERA 3C5RA 2UWJG 3ZU7B 3VLEA 3ZW3A 4W9RA 3MKQB 3G2SA 5A6CA 5C1DA 3QWPA 4EHMA 3QAQA 3QWVA 2ZU6B 4TXQA 5E75A 5D0OD 4XI9A 3RRUA 3FH5A 4I2WA 3Q9UC 3SF4A 1WY6A 4JHJA 4M7CA 4B89A 2NSZA 4PDXA 3Q7AA 3IHYA 4U8VD 4JA7A 3PE3A 5ENRD 2MHKA 2LUHA 1MX2A 1BI7B 3J5PA 3RJVA 2A4ZA 2Y4TA 3RAUA 3EU5A 1E7UA 3ZRHA 3U4TA 1SZ9A 3QC1A 4BX8A 4APFA 2WVIA 4GMRA 1U3DA 2AW6A 4AEZC 1TN8A 1JCRA 3HYMB 3AJIA 3ESKA 3MX3A 3SBTB 2HR2A 3G2WA 4LSZE 2XEHA 5BW8C 3Q5MA 4UWHA 4EBAA 3L82A 2BTDA 1BI8B 1E8YA 4HXIA 1WAO1 4J8FA 4GZ5A 4GTOA 3EIQC 2KATA 3JUEA 5CMWA 4L23A 2Q7FA 4FJZA 5HRYA 2KBXA 2JEKA 1YCSB 4YVOA 2LO6A 1RZ4A 1KZOA 5B3SE 4ACLA 5FQ6A 2CHXA 2JLBA 4CGVA 2Y69E 4RG6A 2E0IA 3VLDA 1N0QA 3O4ZA 4U96D 1NI1A 4FADA 2WM9A 4EECA 5FZQA 4KBQA 5G05J 3BG1B 3FEYA 1PY1A 4LCTA 5FQ8A 4WNEA 4GCNA 3TXNA 4DRXE 3VTXA 3CHQA 4I43A 3HXBA 3CHOA 1JCQA 2LAHA 3V2OA 4AM9A 3LKUA 3CLJA 3UT4A 1HXIA 2AXVA 4RLYA 2F8XK 1LD7A 2UY1B 3BU8A 4V3IA 3QKYA 2XCBA 3CQGB 1MX6A 1KZPA 4FP7A 2Y0BG 3PVLA 4OAUC 2RFMA 2C0MA 4UI9K 4HQDA 1EYHA 4KVMA 5FTPA 1TNBA 2XPIA 3MGBA 4LERA 2GRMA 3NQPA 1HS6A 3FP3A 1TNYA 4Y6WA 2QFCA 3JXJA 2ONDA 5JMND 3ZIMA 1E90A 1H19A 3Q4AB 3ASFA 2GROB 4WWPA 3E32A 4FC8A 5KBAA 2L0IA 2CG2A 2P9IG 3NAWA 3HIZA 4N3AA 1LTXA 2P9NG 2VGXA 5AJDA 3FEXA 5T8IA 3B7TA 4IULA 3URZA 2WXMA 3EUVA 2ZIRA 1HG5A 3EHRA 4BTBA 3Q15A 2DZNA 3RKVA 4GAAA 5CCLA 5FZSA 3DPYA 3DWLG 4BEPA 3ASDA 3L22A 2F8YA 1FPPA 4OAVB 3Q73A 2ETCA 3FY4A 3DPDA 2GRPB 3SQVA 2AWIA 3EJNA 5LCWJ 4CZ2D 2B6CA 4GTRA 3TL5A 4K5CA 2WPVA 3HG0D 4GB9A 2X38A 1TJCA 4Q69A 1FCHA 4HRNA 1GW6A 1H2VC 2QYJA 3CVQA 2BKKB 3X2QE 3MZLB 4AY6A 1A5EA 2I9CA 2WXNA 3LCAA 1S63A 2R5SA 4CDRA 1LD8A 2WXRA 1INZA 5LFAA 2XGSA 3ULQA 1O1RA 4TXPA 3SBSA 5FWQA 1OWNA 3UX4A 4G25A 3ZXPA 3WG7E 4MKTA 3CEQA 3CHMA 3DXMG 2IQCA 1K1AA 2H6GA 3Q78A 4FU3A 2ILRA 4HLLA 1JUQA 1WDYA 4G8LA 4HBDA 4P29A 5A23A 3AS8A 1SW6A 4GZDA 4G11A 3HXFA 1X81A 5EYLA 3ULYA 4JEHA 3FH7A 3T9KA 3ML9A 3WXXA 4YDOA 3QK0A 4C0MA 4TRQA 4CCAA 5JHAA 4PS8A 3UQ3A 4GU5A 2XGOA 3CHPA 3CHRA 3UT8A 4WUYA 1DNPA 4A3VA 1IXVA 3EDTB 4CGWA 2J49A 1TNUA 3O48A 3RK6A 3B7UX 1N95A 3HVEA 3ISMC 2YINA 3SGHA 5FZRA 2P2CP 3FULA 3C72A 3W9GA 3TWVA 1W3BA 2P9PG 4GMLA 3B7BA 2ZXWE 5ENSD 3ZHEA 1NA3A 3UI2A 3CVYA 3S7JA 3AU4A 1IHGA 2XRYA 4NQ0A 3E4BA 2MOWA 1DCEA 3RU0A 3UINC 3QNKA 3FTSA 1SA4A 3FUJA 4TUMA 4DI3A 3LJNA 3UKRG 2XPZA 3LXUX 1MHQA 3JUIA 4HFGA 2CFUA 1XGWA 3TJPA 2L9BA 3FUHA 1QQEA 4ZFHA 1UN9A 5FT9A 3TGOA 4J8SA 2H6HA 3PREA 4I6GA 4QQIA 2KCKA 4HOTA 3D9PA 1L5JA 1ZBPA 2F0YA 4GTQA 1QNFA 1HO8A 2ZISA 3TWTA 3IV0A 2J9QA 1OWMA 3SO8A 5FJYA 2HM8A 3PH0C 1YA0A 4UUCA 4TUUA 3RRNB 4ANXA 1MJ0A 4JXTA 2WXHA 3LY7A 3ZUVB 4J8YA 1Y6IA 4CRWA 1HX8A 3V2XA 4G2VA 3FU3A 2QC9A 3NZSA 2RKKA 1Z3YA 2X6KA 3BEEA 3RO3A 3D9NA 4APOA 4HORA 4HOUA 1XNFA 1UN8A 5AIJA 3SFZA 1OCCE 1UG3A 3EHQA 1JPLA 2YQ8A 4UWLA 4LUNU 4MLPA 3OTNA 2UY1A 5JJ6A 4E6HA 1NA0A 3EU9A 1TYQG 1FT1A 2VYIA 5EIBE 3ASOE 1OWLA 4O1OA 4L2LA 4GTVA 2J4DA 4GA2A 5KCMA 3LVQE 3D9HA 4O1PA 1HH8A 2PM7A 5DBKA 4RVBA 5ENPD 4M3OA 4GA1A 3CVVA 3DEOA 4U95D 2GRLA 2V8SE 5KJMA 3UKUG 4JPSA 4BETA 3CKBA 2AVPA 2GRQB 4EZLA 4WAFA 4HOSA 2WMNA 2A5EA 5T3RA 4IYPA 3TWRA 2PNNA 2X6FA 2X6HA 2VGEA 2WXOA 4KMOA 4GA0A 2E2EA 4YVQC 3G2VA 2GW1A 3E37A 4MBGA 2R59A 2F37A 3DSWA 3TWQA 3CQCB 2R17C 2CG3A 4UWFA 1UOHA 3AG1E 2P9SG 1HU3A 4ANWA 2GGFA 5FQ7A 4U0ZA 5G04C 3T5VA 2DYRE 4DUIA 1S70B 3ML8A 3ZVVA 4F6RD 5AJLA 4IRUA 3FTXA 5EX0A 1OXJA 5J90A 3D9IA 3TWWA 5HI7A 4FULA 5EKQD 3DSSA 2MRIA 2HYZA 3D9OA 2VGYA 4ILHB 2PL2A 3S7FA 3UM2A 5EILA 5KJNA 4CT4A 4K03A 1Q2ZA 5B1AE 4JW1A 2PQRA 1TR4A 1ELKA 3EIJA 1QZ2A 3MV3B 3CHSA 1H6PA 1OCRE 3DRAA 5JJ7A 3ZYKA 1TNZA 4KT6B 4CT0A 2QYUA 5BXUA 4RG9A 1B89A 3IXEA 2B0OE 5M72A 2J4BA 1HF8A 3TAXA 3CK7A 4I1MA 1H6OA 4BY6A 4KYOB 4KVOA 4HB5A 3FU6A 4DI4A 3AU5A 2RG8A 2FF4A 4LEUA 4N2SA 4ACKA 3R7QA 4HNAD 2IONA 1FVHA 3FTZA 4JL0A 2XS8A 3QARA 3PUKA 1OUVA 4ILIA 2NC9A 4FHKA 3ZYQA 3ZN3A 2CFZA 4BX9A 1H6KA 2R03A 1ZB1A 1RW2A 1TJFA 4A55A 1IQRA 2XZDG 2DWZA 4N39A 5CBOA 3FDHA 3C98A 4L1BA 2ZGGA 4K5BA 5BV0A 4GMJA 1JWFA 1NL4A 3QWWA 1E96B 3BG0B 3NZUA 4G26A 5B1BE 1BLXB 1KLXA 2OOEA 3N71A 3S7BA 4U63A 3TG4A 5KNHD 4XIFA 4Q96A 1U2VG 3MYVA 5H7PA 2R2LA 1ZU2A 3UXGA 3NBNB 2DZOA 3IKOB 5G2NA 2EIJE 2X3MA 3AS5A 1SA5A 4PH4B 3PEVB 4UQZA 3L6AA 1NZNA 3ASNE 1NP7A 2NXPA 4B0ZA 5EIDA 3DBSA 4I6EA 3LY9A 4HI8A 4TXRA 3ABLE 1NFIE 5AQ9A 2L0TB 2IO3C 3Q75A 1FVFA 3UT7A 1D8DA 3FTUA 2BEDA 3PNTB 5AQ7A 3CK8A 4KXKB 3CGHA 1SZAA 4NACA 3NB2A 5AQAA 2FO7A 3Q7FA 4B8CB 4C48B 3Q49B 3D9MA 2AXZA 3NOCD 4H7YA 5BPPA 2P9KG 2BUGA 2XEEA 4N5CA 2XS1A 5E76A 4OVVA 3T5XA 4Z68A 2OCCE 2WXIA 5FQ4A 3NF1A 2V0PA 3FU0A 3UM3A 4J0UA 3L16A 1DVPA 3PUJA 3DSXA 3Q47B 1QBQA 2VJ8A 1KT1A 2X6IA 1EDUA 2A5UA 4KZCA 4F7AA 5JJTA 3ABME 4A1GA 4MS6A 4O6FA 3ZXSA 2Y1LE 3TG5A 3ZFWA 1O1TA 1TNOA 1QYMA 4JHRA 4DJAA 4JC8A 4CEMA 3DSVA 3MKQA 5AENA 3ESLA 2C2LA 3ENEA 3TWXA 3TWSA 4I2ZA 3LY8A 3FUIA 4ATGA 3GZ1A 2V4LA 1H2TC 4FHJA 1K3ZD 3R9AB 4JHKA 5AN8A 4MRUA 4EBAG 4ABNA 3R9MA 2KCLA 5BT1A 1SQMA 4EZKA 4A1SA 2ZGDA 3OXFA 1A17A 5CBNA 4CDNA 2PZIA 4U0SA 3VTYA 3E33A 2FI7A 2H6FA 2HO1A 3APDA 2VGXB 2I2OA 3T8KA 3TXMA 4F1PA 2VSXE 4F53A 2WB2A 3G2TA 4G23A 4EQFA 4ANVA 4AV7A 4L2YA 4XZ4A 4LG6A 4HLEA 2V4HC 4GYYA 3C3RA 2XEVA 4HS2A 3MCXA 4WNFA 1U3CA 3HDXA 2BKGA 3CSTA 2EQXA 4YNDA 5AYWD 4AVXA 3JQ0A 3RRMB 1OWOA 3C3QA 1UW4B 5IY5E 3PZ4A 5CCMA 4JZYA 5AARA 1IKND 1MX4A 3V31A 2VSOE 1HE8A 5EX3A 2H6IA 3PZ3A 3F6QA 3SZ7A 4DX5D 4R7LA 3CVPA 1MQSA 3GYZA 1N0RA 1N4PA 4XEIG 4A3TA 1OCOE 4LNBA 4NRHB 1AP7A 5CEAA 3U66A
chains in the Genus database with same CATH topology
5CERB 4U8YD 1UOHA 5EN5D 4YDWA 2JABA 2RFAA 1OY3D 2ZGDA 3DEPA 4TUMA 1N0QA 3EHQA 4DX7D 1BU9A 5AQ7A 4DUIA 1BD8A 3LJNA 4U96D 5CBNA 2XZTG 1K1AA 3Q9UC 4CYMD 2NYJA 1S70B 4HLLA 1DCQA 1K1BA 1WDYA 4G8LA 5ENOD 5AQAA 4F6RD 3T8KA 4C48B 1OT8A 2J8SD 4HBDA 4F1PA 4DRXE 3NOCD 3TWUA 3EU9A 4ATZD 1SW6A 4U8VD 2XZDG 2DWZA 5EIBE 4DX6D 3EHRA 5CBOA 5EYLA 3HRAA 4O1OA 5ENRD 2XEEA 3UTMA 4B93B 1MX2A 3TWWA 3V2OA 3V79K 1BI7B 1YMPA 1IHBA 5ENQD 3V30A 3J5PA 1MYOA 4ZFHA 2DZNA 2ZGGA 4K5BA 2XENA 4LG6A 4O60A 2V4HC 5D66A 5EILA 4Z68A 3D9HA 3NOGD 4ZHBA 2DVWA 4O1PA 4QQIA 4RLYA 2F8XK 3T9KA 5KWDA 1N11A 4BEPA 1YYHA 5ENPD 2F8YA 4GMRA 2ETBA 2BKGA 4OAVB 1SVXA 4QFVA 3TWTA 1G3NB 3ZNGA 3AAAC 1TR4A 3W9FA 1BLXB 2ETCA 3AJIA 5FINA 3JXIA 3SO8A 3DEOA 5KNGA 4U95D 4A63B 4NIKA 4LSZE 2XEHA 4CZ2D 5AQBA 4J7WA 4DX1A 1AWCB 3B95A 1MX6A 2KXPC 5KNHD 4BESA 4BETA 4K5CA 2Y0BG 2HE0A 3HG0D 4UUCA 2ETAA 4N5QA 4OAUC 1IXVA 1BI8B 5JA4D 2RFMA 1MJ0A 4HI9A 4HRMB 5CEDB 5EYPF 5FIOA 2Y1LE 5AAOA 4HRNA 3ZUVB 4DX2A 4J8YA 4HQDA 5AARA 5BXUA 1DC2A 5HKPA 5HS0A 3J5QB 3IXEA 4GPMA 3UXGA 2QYJA 1IKND 1MX4A 2B0OE 2DZOA 2A5EA 2V5QC 4JB8P 3NBNB 3TWRA 3KEAA 2P2CP 1QYMA 3V31A 3JUEA 3W9GA 3ZKJA 2FO1E 3TWVA 4BERA 3C5RA 2BKKB 2PNNA 3B7BA 5ENSD 2L6BA 2VGEA 3V2XA 3F6QA 3ZU7B 1D9SA 4HB5A 2MYOA 4DX5D 1A5EA 5HRYA 2QC9A 3TWXA 3TWSA 4G8KA 5EIDA 5CECB 1N0RA 3JXJA 2KBXA 4BSZB 3UI2A 5ITZF 5JMND 5ENTD 4HRLA 1WG0A 4LNUD 4HI8A 1YCSB 2AJAA 4K5AB 4HNAD 4YDYA 1K3ZD 1AP7A 3Q9NC 2F37A 5AN8A 1NFIE 3TWQA 5CEAA 5BXOA 5AQ9A 5KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CER B;  4U8Y D;  1UOH A;  5EN5 D;  4YDW A;  2JAB A;  2RFA A;  1OY3 D;  2ZGD A;  3DEP A;  4TUM A;  1N0Q A;  3EHQ A;  4DX7 D;  1BU9 A;  5AQ7 A;  4DUI A;  1BD8 A;  3LJN A;  4U96 D;  5CBN A;  2XZT G;  1K1A A;  3Q9U C;  4CYM D;  2NYJ A;  1S70 B;  4HLL A;  1DCQ A;  1K1B A;  1WDY A;  4G8L A;  5ENO D;  5AQA A;  4F6R D;  3T8K A;  4C48 B;  1OT8 A;  2J8S D;  4HBD A;  4F1P A;  4DRX E;  3NOC D;  3TWU A;  3EU9 A;  4ATZ D;  1SW6 A;  4U8V D;  2XZD G;  2DWZ A;  5EIB E;  4DX6 D;  3EHR A;  5CBO A;  5EYL A;  3HRA A;  4O1O A;  5ENR D;  2XEE A;  3UTM A;  4B93 B;  1MX2 A;  3TWW A;  3V2O A;  3V79 K;  1BI7 B;  1YMP A;  1IHB A;  5ENQ D;  3V30 A;  3J5P A;  1MYO A;  4ZFH A;  2DZN A;  2ZGG A;  4K5B A;  2XEN A;  4LG6 A;  4O60 A;  2V4H C;  5D66 A;  5EIL A;  4Z68 A;  3D9H A;  3NOG D;  4ZHB A;  2DVW A;  4O1P A;  4QQI A;  4RLY A;  2F8X K;  3T9K A;  5KWD A;  1N11 A;  4BEP A;  1YYH A;  5ENP D;  2F8Y A;  4GMR A;  2ETB A;  2BKG A;  4OAV B;  1SVX A;  4QFV A;  3TWT A;  1G3N B;  3ZNG A;  3AAA C;  1TR4 A;  3W9F A;  1BLX B;  2ETC A;  3AJI A;  5FIN A;  3JXI A;  3SO8 A;  3DEO A;  5KNG A;  4U95 D;  4A63 B;  4NIK A;  4LSZ E;  2XEH A;  4CZ2 D;  5AQB A;  4J7W A;  4DX1 A;  1AWC B;  3B95 A;  1MX6 A;  2KXP C;  5KNH D;  4BES A;  4BET A;  4K5C A;  2Y0B G;  2HE0 A;  3HG0 D;  4UUC A;  2ETA A;  4N5Q A;  4OAU C;  1IXV A;  1BI8 B;  5JA4 D;  2RFM A;  1MJ0 A;  4HI9 A;  4HRM B;  5CED B;  5EYP F;  5FIO A;  2Y1L E;  5AAO A;  4HRN A;  3ZUV B;  4DX2 A;  4J8Y A;  4HQD A;  5AAR A;  5BXU A;  1DC2 A;  5HKP A;  5HS0 A;  3J5Q B;  3IXE A;  4GPM A;  3UXG A;  2QYJ A;  1IKN D;  1MX4 A;  2B0O E;  2DZO A;  2A5E A;  2V5Q C;  4JB8 P;  3NBN B;  3TWR A;  3KEA A;  2P2C P;  1QYM A;  3V31 A;  3JUE A;  3W9G A;  3ZKJ A;  2FO1 E;  3TWV A;  4BER A;  3C5R A;  2BKK B;  2PNN A;  3B7B A;  5ENS D;  2L6B A;  2VGE A;  3V2X A;  3F6Q A;  3ZU7 B;  1D9S A;  4HB5 A;  2MYO A;  4DX5 D;  1A5E A;  5HRY A;  2QC9 A;  3TWX A;  3TWS A;  4G8K A;  5EID A;  5CEC B;  1N0R A;  3JXJ A;  2KBX A;  4BSZ B;  3UI2 A;  5ITZ F;  5JMN D;  5ENT D;  4HRL A;  1WG0 A;  4LNU D;  4HI8 A;  1YCS B;  2AJA A;  4K5A B;  4HNA D;  4YDY A;  1K3Z D;  1AP7 A;  3Q9N C;  2F37 A;  5AN8 A;  1NFI E;  3TWQ A;  5CEA A;  5BXO A;  5AQ9 A;  5KBA A; 
#chains in the Genus database with same CATH topology
 4N2Q A;  4GZC A;  5ANL A;  1OY3 D;  2KCV A;  5ANR A;  4DX7 D;  4XI0 A;  4AXH A;  2R02 A;  2J07 A;  2LXL A;  4ME2 A;  3FUD A;  2J8S D;  4GPK A;  1V55 E;  4DX6 D;  3L54 A;  2IF4 A;  1IHB A;  3DST A;  3EHN A;  4ILG A;  3ABK E;  2YHE A;  3T8M A;  2XEN A;  3SHF A;  4FA6 A;  3QOU A;  2YNQ A;  3FTV A;  3UM1 A;  1N4R A;  4B94 A;  3FHE A;  3ZEF A;  3LS8 A;  3I4R B;  1HZ4 A;  1YYH A;  4N3B A;  3HHM A;  1UJJ A;  1SVX A;  4QFV A;  1G3N B;  3AAA C;  3CVN A;  2WQ6 A;  2WXK A;  4AY5 A;  4PS3 A;  3PZ1 A;  1VDY A;  3B95 A;  4WWN A;  3DSU A;  3C3O A;  4N5Q A;  4I1O B;  3ASH A;  1V54 E;  5AAO A;  1Z6T A;  2VTB B;  1DC2 A;  5HKP A;  1H2U A;  1Y8M A;  4GPM A;  2GRN B;  3FWV A;  3VLF A;  3HVE B;  3GZS A;  2EIL E;  4BWR A;  5LCW C;  2DCP A;  5DIZ A;  3U9W A;  4E85 A;  1KT0 A;  1S64 A;  4UQX A;  1N94 A;  3ZHE B;  2FBN A;  2AJA A;  2KZT B;  2WMO A;  3MKR A;  5BXO A;  3PEU B;  4BT9 A;  4URK A;  2Y3A A;  3KSQ A;  2Y4U A;  3AG3 E;  3PE4 A;  2XZT G;  4CYM D;  3I3N A;  2NYJ A;  3E34 A;  4J6I A;  3FUM A;  3LYA A;  4KZ0 A;  4EPZ A;  4GYO A;  2IOL A;  3EHM A;  2P58 C;  1WM5 A;  3UTM A;  1N9A A;  3LDZ A;  4UWK A;  2PM6 A;  4DLO A;  3QJZ A;  2WQ7 A;  4J8E A;  4ZHB A;  5D2M C;  3LJ3 A;  3RO2 A;  5J08 A;  2IU1 A;  1N11 A;  2OEW A;  3SFX A;  2X6J A;  1EPU A;  3CV0 A;  3OXL A;  4A63 B;  2CHW A;  5LP0 A;  4J7W A;  4D10 C;  1AWC B;  2VSY A;  4AJW A;  3CIA A;  4HRM B;  5EYP F;  5A7D B;  1N52 A;  4HVB A;  2M63 A;  5CMY A;  4HOQ A;  4U0U A;  3KEA A;  1TN6 A;  3LEW A;  3FFL A;  5CRV A;  2P9U G;  3D9L A;  2WXQ A;  2MYO A;  1IYG A;  2QZA A;  1E8W A;  3CR3 A;  2YHC A;  5ENT D;  4HRL A;  1WG0 A;  4LNU D;  4WND A;  3QDN A;  4UI9 C;  3Q9N C;  3D9J A;  3MJW A;  4U8Y D;  3I4G A;  2RFA A;  1ELR A;  2KM4 A;  4YDE A;  1IQU A;  2AXU A;  1K1B A;  2WXG A;  3UMV A;  5LOZ A;  1PC2 A;  4GTS A;  3CVU A;  1HG2 A;  3B13 A;  4ATZ D;  3ZPJ A;  2I1K A;  3HRA A;  4GCO A;  4B93 B;  3QB2 A;  3GZ2 A;  3CK9 A;  3PNL B;  3KAE A;  2DVW A;  3ULE G;  5BNW A;  2LXM A;  2OEV A;  4XE0 A;  1E7V A;  2R05 A;  3HXE A;  2LSV A;  1O5M A;  4DLQ A;  4GZ6 A;  3HXD A;  3JXI A;  1LF8 A;  5KJL A;  4GTT A;  4NUR A;  2XGM A;  5T4Y A;  2PQN A;  3E30 A;  4HI9 A;  2DBA A;  4H7X A;  5BUZ A;  2CHZ A;  4JB8 P;  2V5Q C;  3I5P A;  4GTP A;  4OVU A;  4U8H A;  4C0E A;  3ZKJ A;  2BF0 X;  5JHB A;  2L6B A;  1O1S A;  4GTM A;  2XHE A;  4UWG A;  1D8E A;  2LAI A;  3IEG A;  4FJY A;  3UIP C;  2XPY A;  2LSU A;  3Q79 A;  3B7S A;  4F1S A;  2LNI A;  4K5A B;  5G55 A;  3PZD A;  3P1U A;  1H0A A;  5CER B;  2IOS A;  1OCZ E;  3PDN A;  3DEP A;  1FT2 A;  3R7R A;  3LPZ A;  3CVL A;  3UUX A;  1BU9 A;  2J08 A;  3AG4 E;  1TEZ A;  1OWP A;  1K8K G;  1EF1 C;  4I9C A;  5EDS A;  3JQ1 A;  4Y6C A;  3OXG A;  3KSL A;  1Z5S C;  3ONK A;  4F3V A;  2EIM E;  1KPS B;  3OAW A;  3G2U A;  5D0Q D;  3GW4 A;  3RSE G;  2C0L A;  2EIN E;  1N54 A;  4FLH A;  4LNG A;  3S2A A;  5KWD A;  4Q94 A;  3ZYL A;  4ANU A;  2ETB A;  2L6J A;  3LVR E;  3IBE A;  4I17 A;  3ZNG A;  2DYS E;  4N3C A;  3MV2 B;  3ZYM A;  3FUE A;  5FIN A;  5KNG A;  2IEJ A;  2P9L G;  4XKC A;  4CDM A;  4GYW A;  2KXP C;  3BUA A;  2ETA A;  4DK5 A;  4XKB A;  4U07 A;  5FIO A;  2QY7 A;  4DX2 A;  3CVX A;  2IO2 C;  5CRU A;  2FO1 E;  2FEZ A;  5G04 J;  4BSX A;  2WXF A;  4GZ3 A;  3L13 A;  1E8Z A;  4IN3 B;  1ELW A;  4I9E A;  4G8K A;  5CEC B;  4G1T A;  4JEU A;  5ITZ F;  4J8D A;  4RQI A;  1HFA A;  2JAB A;  4K0R A;  3APC A;  3SFY A;  2RD0 A;  4BFR A;  4I6J A;  3FU5 A;  2WXL A;  3CVW A;  3P2B A;  2GRR B;  3ZGQ A;  2IY0 C;  3AG2 E;  5CHE E;  2XRZ A;  3TWU A;  5KJK A;  1UJK A;  3S7D A;  2V5F A;  3L17 A;  3V79 K;  4LRZ A;  4XX5 A;  5ENQ D;  3V30 A;  1MYO A;  4DPR A;  5BV1 A;  3PRZ A;  4B8A A;  4O60 A;  5D66 A;  3NOG D;  4AOF A;  3UPV A;  3FUN A;  3UIO C;  2VTB A;  4UI9 J;  3U3W A;  3KD7 A;  3CSF A;  1MZC A;  4JVS A;  4UQY A;  2WQH A;  3W9F A;  1N4Q A;  5ARG A;  3KEZ A;  3PS6 A;  3DXK G;  2IJG X;  4NIK A;  3PZ2 A;  3U64 A;  5LX8 A;  4AP2 A;  3SD5 A;  2KZT A;  4PS7 A;  3MEK A;  5JA4 D;  5CED B;  5G05 C;  3L08 A;  3SY2 A;  1TN7 A;  3HXC A;  4EZJ A;  3APF A;  3JYS A;  3FUK A;  4RSY A;  4U04 A;  4X8Q A;  3JCK C;  2OVB A;  1D9S A;  5HQ8 A;  4L7T A;  3BQO A;  3FH8 A;  3D3M A;  1JCS A;  4BSZ B;  3D9K A;  4I1A A;  3ASG A;  4TV3 A;  4PUC A;  4YDY A;  2I1J A;  4U7E B;  4WNG A;  5EN5 D;  4YDW A;  1X5B A;  4FLB A;  2DIW A;  2IFU A;  4C9B B;  3SNX A;  2XCC A;  1BD8 A;  1P5Q A;  1DCQ A;  3KS2 A;  3IHV A;  1S0P A;  5ENO D;  4JA9 A;  2EIK E;  2J09 A;  5ARF A;  1OT8 A;  2XQ0 A;  2WXP A;  1E8X A;  1N4S A;  2VQ2 A;  3FUF A;  3UM0 A;  5ENN A;  1YMP A;  4OYS A;  3B7R L;  3SI5 A;  3CKC A;  1PAQ A;  2OVF A;  3AS4 A;  3MA5 A;  3RIB A;  2OV8 A;  3ONL A;  4JD2 G;  2WXJ A;  2KC7 A;  5AQB A;  4DX1 A;  5C2Y A;  4BES A;  4BTA A;  2I6H A;  2HE0 A;  1Z3X A;  4BT8 A;  1JWG A;  3FTY A;  4G24 A;  4L9P A;  5HS0 A;  3J5Q B;  2VSN A;  4AIF A;  3K9I A;  1BPO A;  4WWO A;  3FTW A;  3L9T A;  2FUL A;  4BER A;  3C5R A;  2UWJ G;  3ZU7 B;  3VLE A;  3ZW3 A;  4W9R A;  3MKQ B;  3G2S A;  5A6C A;  5C1D A;  3QWP A;  4EHM A;  3QAQ A;  3QWV A;  2ZU6 B;  4TXQ A;  5E75 A;  5D0O D;  4XI9 A;  3RRU A;  3FH5 A;  4I2W A;  3Q9U C;  3SF4 A;  1WY6 A;  4JHJ A;  4M7C A;  4B89 A;  2NSZ A;  4PDX A;  3Q7A A;  3IHY A;  4U8V D;  4JA7 A;  3PE3 A;  5ENR D;  2MHK A;  2LUH A;  1MX2 A;  1BI7 B;  3J5P A;  3RJV A;  2A4Z A;  2Y4T A;  3RAU A;  3EU5 A;  1E7U A;  3ZRH A;  3U4T A;  1SZ9 A;  3QC1 A;  4BX8 A;  4APF A;  2WVI A;  4GMR A;  1U3D A;  2AW6 A;  4AEZ C;  1TN8 A;  1JCR A;  3HYM B;  3AJI A;  3ESK A;  3MX3 A;  3SBT B;  2HR2 A;  3G2W A;  4LSZ E;  2XEH A;  5BW8 C;  3Q5M A;  4UWH A;  4EBA A;  3L82 A;  2BTD A;  1BI8 B;  1E8Y A;  4HXI A;  1WAO 1;  4J8F A;  4GZ5 A;  4GTO A;  3EIQ C;  2KAT A;  3JUE A;  5CMW A;  4L23 A;  2Q7F A;  4FJZ A;  5HRY A;  2KBX A;  2JEK A;  1YCS B;  4YVO A;  2LO6 A;  1RZ4 A;  1KZO A;  5B3S E;  4ACL A;  5FQ6 A;  2CHX A;  2JLB A;  4CGV A;  2Y69 E;  4RG6 A;  2E0I A;  3VLD A;  1N0Q A;  3O4Z A;  4U96 D;  1NI1 A;  4FAD A;  2WM9 A;  4EEC A;  5FZQ A;  4KBQ A;  5G05 J;  3BG1 B;  3FEY A;  1PY1 A;  4LCT A;  5FQ8 A;  4WNE A;  4GCN A;  3TXN A;  4DRX E;  3VTX A;  3CHQ A;  4I43 A;  3HXB A;  3CHO A;  1JCQ A;  2LAH A;  3V2O A;  4AM9 A;  3LKU A;  3CLJ A;  3UT4 A;  1HXI A;  2AXV A;  4RLY A;  2F8X K;  1LD7 A;  2UY1 B;  3BU8 A;  4V3I A;  3QKY A;  2XCB A;  3CQG B;  1MX6 A;  1KZP A;  4FP7 A;  2Y0B G;  3PVL A;  4OAU C;  2RFM A;  2C0M A;  4UI9 K;  4HQD A;  1EYH A;  4KVM A;  5FTP A;  1TNB A;  2XPI A;  3MGB A;  4LER A;  2GRM A;  3NQP A;  1HS6 A;  3FP3 A;  1TNY A;  4Y6W A;  2QFC A;  3JXJ A;  2OND A;  5JMN D;  3ZIM A;  1E90 A;  1H19 A;  3Q4A B;  3ASF A;  2GRO B;  4WWP A;  3E32 A;  4FC8 A;  5KBA A;  2L0I A;  2CG2 A;  2P9I G;  3NAW A;  3HIZ A;  4N3A A;  1LTX A;  2P9N G;  2VGX A;  5AJD A;  3FEX A;  5T8I A;  3B7T A;  4IUL A;  3URZ A;  2WXM A;  3EUV A;  2ZIR A;  1HG5 A;  3EHR A;  4BTB A;  3Q15 A;  2DZN A;  3RKV A;  4GAA A;  5CCL A;  5FZS A;  3DPY A;  3DWL G;  4BEP A;  3ASD A;  3L22 A;  2F8Y A;  1FPP A;  4OAV B;  3Q73 A;  2ETC A;  3FY4 A;  3DPD A;  2GRP B;  3SQV A;  2AWI A;  3EJN A;  5LCW J;  4CZ2 D;  2B6C A;  4GTR A;  3TL5 A;  4K5C A;  2WPV A;  3HG0 D;  4GB9 A;  2X38 A;  1TJC A;  4Q69 A;  1FCH A;  4HRN A;  1GW6 A;  1H2V C;  2QYJ A;  3CVQ A;  2BKK B;  3X2Q E;  3MZL B;  4AY6 A;  1A5E A;  2I9C A;  2WXN A;  3LCA A;  1S63 A;  2R5S A;  4CDR A;  1LD8 A;  2WXR A;  1INZ A;  5LFA A;  2XGS A;  3ULQ A;  1O1R A;  4TXP A;  3SBS A;  5FWQ A;  1OWN A;  3UX4 A;  4G25 A;  3ZXP A;  3WG7 E;  4MKT A;  3CEQ A;  3CHM A;  3DXM G;  2IQC A;  1K1A A;  2H6G A;  3Q78 A;  4FU3 A;  2ILR A;  4HLL A;  1JUQ A;  1WDY A;  4G8L A;  4HBD A;  4P29 A;  5A23 A;  3AS8 A;  1SW6 A;  4GZD A;  4G11 A;  3HXF A;  1X81 A;  5EYL A;  3ULY A;  4JEH A;  3FH7 A;  3T9K A;  3ML9 A;  3WXX A;  4YDO A;  3QK0 A;  4C0M A;  4TRQ A;  4CCA A;  5JHA A;  4PS8 A;  3UQ3 A;  4GU5 A;  2XGO A;  3CHP A;  3CHR A;  3UT8 A;  4WUY A;  1DNP A;  4A3V A;  1IXV A;  3EDT B;  4CGW A;  2J49 A;  1TNU A;  3O48 A;  3RK6 A;  3B7U X;  1N95 A;  3HVE A;  3ISM C;  2YIN A;  3SGH A;  5FZR A;  2P2C P;  3FUL A;  3C72 A;  3W9G A;  3TWV A;  1W3B A;  2P9P G;  4GML A;  3B7B A;  2ZXW E;  5ENS D;  3ZHE A;  1NA3 A;  3UI2 A;  3CVY A;  3S7J A;  3AU4 A;  1IHG A;  2XRY A;  4NQ0 A;  3E4B A;  2MOW A;  1DCE A;  3RU0 A;  3UIN C;  3QNK A;  3FTS A;  1SA4 A;  3FUJ A;  4TUM A;  4DI3 A;  3LJN A;  3UKR G;  2XPZ A;  3LXU X;  1MHQ A;  3JUI A;  4HFG A;  2CFU A;  1XGW A;  3TJP A;  2L9B A;  3FUH A;  1QQE A;  4ZFH A;  1UN9 A;  5FT9 A;  3TGO A;  4J8S A;  2H6H A;  3PRE A;  4I6G A;  4QQI A;  2KCK A;  4HOT A;  3D9P A;  1L5J A;  1ZBP A;  2F0Y A;  4GTQ A;  1QNF A;  1HO8 A;  2ZIS A;  3TWT A;  3IV0 A;  2J9Q A;  1OWM A;  3SO8 A;  5FJY A;  2HM8 A;  3PH0 C;  1YA0 A;  4UUC A;  4TUU A;  3RRN B;  4ANX A;  1MJ0 A;  4JXT A;  2WXH A;  3LY7 A;  3ZUV B;  4J8Y A;  1Y6I A;  4CRW A;  1HX8 A;  3V2X A;  4G2V A;  3FU3 A;  2QC9 A;  3NZS A;  2RKK A;  1Z3Y A;  2X6K A;  3BEE A;  3RO3 A;  3D9N A;  4APO A;  4HOR A;  4HOU A;  1XNF A;  1UN8 A;  5AIJ A;  3SFZ A;  1OCC E;  1UG3 A;  3EHQ A;  1JPL A;  2YQ8 A;  4UWL A;  4LUN U;  4MLP A;  3OTN A;  2UY1 A;  5JJ6 A;  4E6H A;  1NA0 A;  3EU9 A;  1TYQ G;  1FT1 A;  2VYI A;  5EIB E;  3ASO E;  1OWL A;  4O1O A;  4L2L A;  4GTV A;  2J4D A;  4GA2 A;  5KCM A;  3LVQ E;  3D9H A;  4O1P A;  1HH8 A;  2PM7 A;  5DBK A;  4RVB A;  5ENP D;  4M3O A;  4GA1 A;  3CVV A;  3DEO A;  4U95 D;  2GRL A;  2V8S E;  5KJM A;  3UKU G;  4JPS A;  4BET A;  3CKB A;  2AVP A;  2GRQ B;  4EZL A;  4WAF A;  4HOS A;  2WMN A;  2A5E A;  5T3R A;  4IYP A;  3TWR A;  2PNN A;  2X6F A;  2X6H A;  2VGE A;  2WXO A;  4KMO A;  4GA0 A;  2E2E A;  4YVQ C;  3G2V A;  2GW1 A;  3E37 A;  4MBG A;  2R59 A;  2F37 A;  3DSW A;  3TWQ A;  3CQC B;  2R17 C;  2CG3 A;  4UWF A;  1UOH A;  3AG1 E;  2P9S G;  1HU3 A;  4ANW A;  2GGF A;  5FQ7 A;  4U0Z A;  5G04 C;  3T5V A;  2DYR E;  4DUI A;  1S70 B;  3ML8 A;  3ZVV A;  4F6R D;  5AJL A;  4IRU A;  3FTX A;  5EX0 A;  1OXJ A;  5J90 A;  3D9I A;  3TWW A;  5HI7 A;  4FUL A;  5EKQ D;  3DSS A;  2MRI A;  2HYZ A;  3D9O A;  2VGY A;  4ILH B;  2PL2 A;  3S7F A;  3UM2 A;  5EIL A;  5KJN A;  4CT4 A;  4K03 A;  1Q2Z A;  5B1A E;  4JW1 A;  2PQR A;  1TR4 A;  1ELK A;  3EIJ A;  1QZ2 A;  3MV3 B;  3CHS A;  1H6P A;  1OCR E;  3DRA A;  5JJ7 A;  3ZYK A;  1TNZ A;  4KT6 B;  4CT0 A;  2QYU A;  5BXU A;  4RG9 A;  1B89 A;  3IXE A;  2B0O E;  5M72 A;  2J4B A;  1HF8 A;  3TAX A;  3CK7 A;  4I1M A;  1H6O A;  4BY6 A;  4KYO B;  4KVO A;  4HB5 A;  3FU6 A;  4DI4 A;  3AU5 A;  2RG8 A;  2FF4 A;  4LEU A;  4N2S A;  4ACK A;  3R7Q A;  4HNA D;  2ION A;  1FVH A;  3FTZ A;  4JL0 A;  2XS8 A;  3QAR A;  3PUK A;  1OUV A;  4ILI A;  2NC9 A;  4FHK A;  3ZYQ A;  3ZN3 A;  2CFZ A;  4BX9 A;  1H6K A;  2R03 A;  1ZB1 A;  1RW2 A;  1TJF A;  4A55 A;  1IQR A;  2XZD G;  2DWZ A;  4N39 A;  5CBO A;  3FDH A;  3C98 A;  4L1B A;  2ZGG A;  4K5B A;  5BV0 A;  4GMJ A;  1JWF A;  1NL4 A;  3QWW A;  1E96 B;  3BG0 B;  3NZU A;  4G26 A;  5B1B E;  1BLX B;  1KLX A;  2OOE A;  3N71 A;  3S7B A;  4U63 A;  3TG4 A;  5KNH D;  4XIF A;  4Q96 A;  1U2V G;  3MYV A;  5H7P A;  2R2L A;  1ZU2 A;  3UXG A;  3NBN B;  2DZO A;  3IKO B;  5G2N A;  2EIJ E;  2X3M A;  3AS5 A;  1SA5 A;  4PH4 B;  3PEV B;  4UQZ A;  3L6A A;  1NZN A;  3ASN E;  1NP7 A;  2NXP A;  4B0Z A;  5EID A;  3DBS A;  4I6E A;  3LY9 A;  4HI8 A;  4TXR A;  3ABL E;  1NFI E;  5AQ9 A;  2L0T B;  2IO3 C;  3Q75 A;  1FVF A;  3UT7 A;  1D8D A;  3FTU A;  2BED A;  3PNT B;  5AQ7 A;  3CK8 A;  4KXK B;  3CGH A;  1SZA A;  4NAC A;  3NB2 A;  5AQA A;  2FO7 A;  3Q7F A;  4B8C B;  4C48 B;  3Q49 B;  3D9M A;  2AXZ A;  3NOC D;  4H7Y A;  5BPP A;  2P9K G;  2BUG A;  2XEE A;  4N5C A;  2XS1 A;  5E76 A;  4OVV A;  3T5X A;  4Z68 A;  2OCC E;  2WXI A;  5FQ4 A;  3NF1 A;  2V0P A;  3FU0 A;  3UM3 A;  4J0U A;  3L16 A;  1DVP A;  3PUJ A;  3DSX A;  3Q47 B;  1QBQ A;  2VJ8 A;  1KT1 A;  2X6I A;  1EDU A;  2A5U A;  4KZC A;  4F7A A;  5JJT A;  3ABM E;  4A1G A;  4MS6 A;  4O6F A;  3ZXS A;  2Y1L E;  3TG5 A;  3ZFW A;  1O1T A;  1TNO A;  1QYM A;  4JHR A;  4DJA A;  4JC8 A;  4CEM A;  3DSV A;  3MKQ A;  5AEN A;  3ESL A;  2C2L A;  3ENE A;  3TWX A;  3TWS A;  4I2Z A;  3LY8 A;  3FUI A;  4ATG A;  3GZ1 A;  2V4L A;  1H2T C;  4FHJ A;  1K3Z D;  3R9A B;  4JHK A;  5AN8 A;  4MRU A;  4EBA G;  4ABN A;  3R9M A;  2KCL A;  5BT1 A;  1SQM A;  4EZK A;  4A1S A;  2ZGD A;  3OXF A;  1A17 A;  5CBN A;  4CDN A;  2PZI A;  4U0S A;  3VTY A;  3E33 A;  2FI7 A;  2H6F A;  2HO1 A;  3APD A;  2VGX B;  2I2O A;  3T8K A;  3TXM A;  4F1P A;  2VSX E;  4F53 A;  2WB2 A;  3G2T A;  4G23 A;  4EQF A;  4ANV A;  4AV7 A;  4L2Y A;  4XZ4 A;  4LG6 A;  4HLE A;  2V4H C;  4GYY A;  3C3R A;  2XEV A;  4HS2 A;  3MCX A;  4WNF A;  1U3C A;  3HDX A;  2BKG A;  3CST A;  2EQX A;  4YND A;  5AYW D;  4AVX A;  3JQ0 A;  3RRM B;  1OWO A;  3C3Q A;  1UW4 B;  5IY5 E;  3PZ4 A;  5CCM A;  4JZY A;  5AAR A;  1IKN D;  1MX4 A;  3V31 A;  2VSO E;  1HE8 A;  5EX3 A;  2H6I A;  3PZ3 A;  3F6Q A;  3SZ7 A;  4DX5 D;  4R7L A;  3CVP A;  1MQS A;  3GYZ A;  1N0R A;  1N4P A;  4XEI G;  4A3T A;  1OCO E;  4LNB A;  4NRH B;  1AP7 A;  5CEA A;  3U66 A; 
#chains in the Genus database with same CATH homology
 5CER B;  4U8Y D;  1UOH A;  5EN5 D;  4YDW A;  2JAB A;  2RFA A;  1OY3 D;  2ZGD A;  3DEP A;  4TUM A;  1N0Q A;  3EHQ A;  4DX7 D;  1BU9 A;  5AQ7 A;  4DUI A;  1BD8 A;  3LJN A;  4U96 D;  5CBN A;  2XZT G;  1K1A A;  3Q9U C;  4CYM D;  2NYJ A;  1S70 B;  4HLL A;  1DCQ A;  1K1B A;  1WDY A;  4G8L A;  5ENO D;  5AQA A;  4F6R D;  3T8K A;  4C48 B;  1OT8 A;  2J8S D;  4HBD A;  4F1P A;  4DRX E;  3NOC D;  3TWU A;  3EU9 A;  4ATZ D;  1SW6 A;  4U8V D;  2XZD G;  2DWZ A;  5EIB E;  4DX6 D;  3EHR A;  5CBO A;  5EYL A;  3HRA A;  4O1O A;  5ENR D;  2XEE A;  3UTM A;  4B93 B;  1MX2 A;  3TWW A;  3V2O A;  3V79 K;  1BI7 B;  1YMP A;  1IHB A;  5ENQ D;  3V30 A;  3J5P A;  1MYO A;  4ZFH A;  2DZN A;  2ZGG A;  4K5B A;  2XEN A;  4LG6 A;  4O60 A;  2V4H C;  5D66 A;  5EIL A;  4Z68 A;  3D9H A;  3NOG D;  4ZHB A;  2DVW A;  4O1P A;  4QQI A;  4RLY A;  2F8X K;  3T9K A;  5KWD A;  1N11 A;  4BEP A;  1YYH A;  5ENP D;  2F8Y A;  4GMR A;  2ETB A;  2BKG A;  4OAV B;  1SVX A;  4QFV A;  3TWT A;  1G3N B;  3ZNG A;  3AAA C;  1TR4 A;  3W9F A;  1BLX B;  2ETC A;  3AJI A;  5FIN A;  3JXI A;  3SO8 A;  3DEO A;  5KNG A;  4U95 D;  4A63 B;  4NIK A;  4LSZ E;  2XEH A;  4CZ2 D;  5AQB A;  4J7W A;  4DX1 A;  1AWC B;  3B95 A;  1MX6 A;  2KXP C;  5KNH D;  4BES A;  4BET A;  4K5C A;  2Y0B G;  2HE0 A;  3HG0 D;  4UUC A;  2ETA A;  4N5Q A;  4OAU C;  1IXV A;  1BI8 B;  5JA4 D;  2RFM A;  1MJ0 A;  4HI9 A;  4HRM B;  5CED B;  5EYP F;  5FIO A;  2Y1L E;  5AAO A;  4HRN A;  3ZUV B;  4DX2 A;  4J8Y A;  4HQD A;  5AAR A;  5BXU A;  1DC2 A;  5HKP A;  5HS0 A;  3J5Q B;  3IXE A;  4GPM A;  3UXG A;  2QYJ A;  1IKN D;  1MX4 A;  2B0O E;  2DZO A;  2A5E A;  2V5Q C;  4JB8 P;  3NBN B;  3TWR A;  3KEA A;  2P2C P;  1QYM A;  3V31 A;  3JUE A;  3W9G A;  3ZKJ A;  2FO1 E;  3TWV A;  4BER A;  3C5R A;  2BKK B;  2PNN A;  3B7B A;  5ENS D;  2L6B A;  2VGE A;  3V2X A;  3F6Q A;  3ZU7 B;  1D9S A;  4HB5 A;  2MYO A;  4DX5 D;  1A5E A;  5HRY A;  2QC9 A;  3TWX A;  3TWS A;  4G8K A;  5EID A;  5CEC B;  1N0R A;  3JXJ A;  2KBX A;  4BSZ B;  3UI2 A;  5ITZ F;  5JMN D;  5ENT D;  4HRL A;  1WG0 A;  4LNU D;  4HI8 A;  1YCS B;  2AJA A;  4K5A B;  4HNA D;  4YDY A;  1K3Z D;  1AP7 A;  3Q9N C;  2F37 A;  5AN8 A;  1NFI E;  3TWQ A;  5CEA A;  5BXO A;  5AQ9 A;  5KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...